3O6CA

Pyridoxal phosphate biosynthetic protein pdxj from campylobacter jejuni
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
b'NAMLLGVNIDHIAVLRQARMVNDPDLLEAAFIVARHGDQITLHVREDRRHAQDFDLENIIKFCKSPVNLECALNDEILNLALKLKPHRVTLVPEKREELTTEGGLCLNHAKLKQSIEKLQNANIEVSLFINPSLEDIEKSKILKAQFIELHTGHYANLHNALFSNISHTAFALKELDQDKKTLQAQFEKELQNLELCAKKGLELGLKVAAGHGLNYKNVKPVVKIKEICELNIGQSIVARSVFTGLQNAILEMKELIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxine 5'-phosphate synthase
molecule tags Transferase
source organism Campylobacter jejuni subsp. jejuni
publication title Pyridoxal phosphate biosynthetic protein PdxJ from Campylobacter jejuni.
rcsb
total genus 100
structure length 259
sequence length 259
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o6cA00
3W7HA 4HSNA 2YCEA 1F05A 1OYAA 3EB2A 2VEPA 3TSDA 1VLIA 3P84A 3TX9A 4TMCA 4HNTA 4O17A 3F1QA 4AB4A 3VNDA 4E2DA 1FQ0A 1SO4A 5D2VA 3I68A 3DFPA 3U6WA 3IGSA 1B9BA 4OU1A 3NXFA 4M5PA 1FWSA 3C6CA 1RVGA 3STFA 4LUJA 5T26A 3R8RA 1BWKA 3OEXA 1W0MA 3W83A 3EXTA 3DI1A 4L4LA 3BO9A 4IX0A 1KM0A 3HPSA 2VFEA 1GVOA 3E0IA 4MPQA 1RQBA 5BRBA 2ZA1A 4NZFA 4PODA 4H6KA 3PBWA 3PB2A 2B7NA 2PCQA 1DQXA 3W7EA 1OK6A 8TIMA 1LRNA 3W22A 3ZS4A 3NQCA 3KX6A 4O10A 7TIMA 3TQ0A 4ORIA 3L5MA 5EY5A 2BX7A 3LRLA 3NDOA 4RZ6A 4S2CA 3M41A 4O50A 5J5DA 2F7FA 4UFJA 4LVAA 2FFCA 2ZZ7A 1XBYA 3PUOA 1YYAA 1GVSA 1VCFA 4LS1A 5HWNA 5K9DA 4JXCA 4K39A 1S5VA 1TTJA 2QJGA 1PHWA 1EX5A 2OJPA 1WOAA 1B57A 5I3FA 5H2ZA 3HG5A 3W87A 3VFLA 3R13A 2B7OA 3GDKA 3NZRA 3PC0A 2ATMA 3ABOA 2OX1A 4NT0A 2RDUA 3M9YA 2OCZA 1G6CA 2QCFA 4UXDA 1GTEA 4X2RA 2G95A 5DCDA 2Y61A 1RD5A 3DGRA 3W71A 3FFSA 4MUZA 5HWMA 5FEXA 2OT1A 4UTMA 3BV4A 3O6YX 3V1PA 1TJPA 1XKYA 3P67A 4ZZ9A 3GZ3A 3NM1A 2FPYA 3QW4B 3Q2DA 1H63A 3S42A 3TJXA 4AWSA 4BI7A 2A85A 2WPBA 1H60A 2E6AA 4O53A 4BI5A 4O15A 4LS0A 3S0CA 1KFLA 4UFKA 3C2VA 4FB7A 3UZJA 3QQ0A 3M1ZA 1SPQA 3A24A 4MZ1A 3TXZA 3WFAA 4EVZA 3EWWA 4FIQA 3DI0A 5BMXA 4JTTA 1X6UA 1QCWA 1PCWA 2NLIA 2ZTKA 4R33A 3CIXA 3HIJA 3KAOA 4IOTA 4UTKA 1FBAA 2C3ZA 3MJYA 3G8RA 1K8YA 3SJ3A 5E0KA 2X30A 2BSLA 3W85A 2NZLA 4P2VA 4UFLA 5DY2A 1DV7A 3LOTA 1PHQA 3N9RA 1QR7A 3S1XA 4JYEA 4OGZA 3C0JA 3L5AA 3PULA 3M0ZA 4MFEA 5CPMA 2R91A 4O19A 1NF0A 4EIVA 3P80A 1OG0A 1ALDA 1OYBA 4GE8A 3MWAA 2DJXA 1KV8A 1LORA 3LERA 3W1RA 3CB8A 3FJ6A 5CPNA 1WBJA 4YMZA 1OHLA 1JQVA 4IJBA 5DBTA 4E2BA 4CNPA 2QCMA 4NU7A 1OF6A 3GR7A 1VHNA 2YDAA 3G3DA 3O63A 1GG0A 3EX1A 2VFGA 4JTJA 4N6EA 3EX3A 2Z0IA 4PH6A 3SI9A 3HGJA 2ZA2A 3R2GA 1P0KA 3HGOA 2B7QA 3TU9A 1I45A 2BZNA 1H5YA 2CFFA 5D03A 4O1CA 4UMAA 2OMAA 3LCFA 4UMBA 1B4EA 2V5LA 1FY6A 2A6LA 2ZZ4A 3GNDA 5AYXA 3SY5A 3W74A 5F1VA 3NA8A 3O16A 2H6RA 2J88A 1EP2A 2ZYFA 3SR7A 2X16A 3TDFA 3LTYA 4UTWC 2FPTA 2BTMA 4ADSA 3K30A 3F4WA 3GIYA 2QUUA 5AC6A 4DQWA 4UMCA 1VQTA 1TO3A 1GTHA 4N6FA 3SZ8A 2AGKA 4DO6A 4GJ1A 3D0CA 1QO5A 1R46A 1W5PA 2NV2A 1PS9A 3G1SA 4ICNA 4K38A 3M7WA 5K2ZA 1VC4A 1ZFJA 2GPTA 3W73A 5FF7A 2VELA 1MSSA 1FXQA 2Q8LA 2VOMA 3S1UA 3NG3A 3EKZA 3L67A 4HPXA 1K8ZA 2JKEA 1YXDA 4HIBA 4HNUA 4OWGA 4K6AA 4P61A 2OT0A 3N19B 4DBEA 3BW4A 2V9DA 4WUIA 1R2RA 3QPYA 3M5ZA 3W7RA 1LYXA 3P62A 2OZ0A 4ONVA 5IM51 4LOCA 3JR2A 2QDHA 2VC6A 3VE9A 2V2DA 1PV8A 3BLEA 1B4KA 2E5CA 3QFEA 2DZWA 2VENA 2CLMA 4N02A 1ICSA 4YCPA 4AH7A 3GK0A 1RV8A 2XFWA 3T78A 1K3UA 3LCWA 3JS3A 3N2XA 1YXYA 2TRSA 4IXHA 1OABA 3BGJA 4AAJA 4WOZA 2O7QA 1FX6A 4TR9A 1OFDA 1VJIA 4K8EA 3WK2A 1UASA 1DVJA 1Z48A 4OQVA 1WX0A 2DZVA 3EXRA 1FCBA 4BWLC 1J2WA 3QYQA 4MVAA 1QNVA 3ZR4A 1SQ7A 1U5JA 2QCDB 1OFOA 3DAQA 5SWUA 2ZRWA 2H8ZA 2A4AA 2GOUA 4O0KA 3PG9A 3EWBX 3TIMA 2FJKA 3UWYA 1W5QA 4RK8A 3W9ZA 4GC4A 3PB0A 4ADUA 3O8AA 4GRSA 4JS3A 4Y90A 2C18A 1JR1A 3C61A 3DENA 5D2WA 4KFNA 2ZRUA 4K7YA 2I1OA 2GVGA 4MJMA 3G1VA 3MMTA 2ZQ0A 3FS2A 3ABRA 2WNZA 5LNRA 3LXBA 5HR7A 3OVQA 3Q37A 5AHMA 3CLMA 1TSIA 1A53A 2CLIA 4NJJA 2CZEA 1QMLA 4NXSA 4D2JA 3NQFA 3VKJA 3W2NA 1SFLA 2DZUA 1P4CA 1ZJIA 4JTUA 3S9YA 5DY3A 1FCQA 3BW3A 3W7CA 4A22A 4M7SA 1T8XA 2NXHA 3L5LA 2A21A 2QCEA 3QZEA 5IBXA 1Z41A 1O4UA 4H4IA 4JEQA 5KITA 2ISVA 4MLRA 1TV8A 3OG3A 4LVFA 3GKAA 4JD4A 1YADA 2C15A 2A6NA 3T44A 1JUBA 3LXCA 5G4WA 1XXXA 3EEGA 1UUOA 4CQ9A 1JJKA 1FDZA 2D73A 4O14A 3UWVA 1SO3A 4JR5A 4UNLA 2VFIA 1G67A 3L66A 3EXSA 1A5SA 1IXQA 1HG3A 1TYGA 3PSVA 1XL9A 1QPRA 2QUTA 3RU6A 4JICA 1LCOA 2ZRXA 1MO0A 2J9YA 4GBUA 2J6XA 3DFQA 3QJAA 2DZXA 4NNCA 4FNTA 4WQ6A 3W1MA 3HQ1A 1J5TA 3L0GA 1F7BA 1AG1O 3GXTA 5J5RA 2ZA3A 1ZAIA 4Z1CA 2CZDA 2JK2A 5FF3A 2PURA 3N14A 3P74A 4UTIA 1WOBA 5CG7A 3HGRA 4UUIA 4O12A 1QDSA 3HMJG 2X1RA 1EIXA 3W7GA 1YTDA 3M5YA 3A5VA 3CWNA 2YZRA 5KZDA 5D2TA 3DFSA 2P1FA 3BK0A 1LOSA 3RLVA 2ATSA 1I2RA 2WKJA 3P81A 1KV5A 3TW7A 5DLCA 2JKPA 3ABSA 5K3VA 3LM7A 4RLIA 2E09A 1F74A 4ML9A 2VKZG 1ZAJA 3F4NA 4UNKA 4ZMGA 3PY2A 3QSRA 1TCDA 3DFTA 2GQAA 3STCA 1D3GA 4BR1A 4M6VA 3O15A 5G2IA 2TPSA 3BGGA 1W3TA 5ABTA 4PFMA 1YPFA 1OK4A 4IPIA 1ZCOA 3BLIA 3PG8A 4JYFA 4XBKA 2YPIA 4AMAA 3DZ1A 5HUPA 3NL3A 4XZ9A 4IGHA 4S2BA 1KFJA 1Q6LA 5LNUA 4KWWA 3NL5A 3BLFA 1TRDA 3HG4A 2YW3A 1MEIA 5FF0A 2DZSA 3C2EA 3O05A 3OIXA 4IX2A 5F2IA 4Y9AA 4LVGA 1GQNA 2NUYA 4KWVA 4WD0A 1L6YA 5KTLA 4UC5A 4ZL1A 4GXMA 2GQ9A 4WXYA 1XUUA 4UCGA 1FWNA 4Q33A 3LX9A 5E93A 5L6UA 3R89A 1B3OA 2Y7FA 4IMGA 3SW6A 4FXSA 4RCXA 3B0VC 4DPQA 2C14A 4JDBA 3NQ6A 3IGUA 5DN1A 1C8VA 1QPQA 2QAFA 1WDWA 2RDWA 4YLWA 3W75A 4Z08A 3ZWTA 2EHHA 4NX0A 5AC8A 3UWWA 4N9CA 2YGYA 1TPWA 2NWRA 4AVFA 3O06A 3MP3A 2BWGA 2YR1A 3EKLA 1LTDA 2ZZ6A 4PA8A 5CKSA 3L21A 1R2TA 3KXQA 1WAUA 1A5BA 4UTUA 1KFCA 3T4CA 3GAYA 3TMQA 2DZPA 4IWWA 1LDCA 1OFAA 1N55A 3TSBA 3LB0A 4QQ3A 1VPXA 3W2JA 4WZHA 2A0NA 4JY9A 1YDVA 2RFGA 3NQEA 4XQ6A 3LXAA 4O28A 3G0SA 5AHIA 4M6QA 2ZCGA 2CW6A 3IEBA 1G7VA 3N2MA 3THQA 3NQAA 1DQWA 1H51A 4RZ4A 3NPWA 3UPBA 3W1PA 4UTWA 4ZQOA 1TTIA 1WV2A 4UFIA 4TX9A 4CNNA 1W1ZA 1XM3A 2GVJA 4N9EA 3PM6A 3HO8A 3B8DA 5EPDA 5HQEA 3L0NA 2RDTA 3PBUA 2GJNA 5L9FA 1AW2A 3B4UA 1HO1A 4ORMA 1GVQA 3STGA 2FTPA 2HS6A 5I3GA 1GYLA 2WO5A 2QEZA 3DBPA 5LGZA 2PRLA 1YDOA 1ZY9A 4K37A 3RMJA 3RF9A 1TPFA 3TAOA 3NOEA 5HULA 1VCVA 4ALDA 2WNQA 4WX2A 4XTIA 4MYAA 1VR6A 1F76A 3LHUA 3NPXA 3M6YA 4PL1A 3NQGA 4HSOA 1RR2A 5EMUA 3QF0A 2X1SA 1C29A 4MJZA 3JRKA 3TQKA 3TW6A 4R53A 3PVFA 3LBCA 1GJPA 5D37A 3FYPA 3NL2A 3B05A 4IMCA 3L65A 1IIHA 1KA9F 3I65A 3I7QA 3R5EA 2WOQA 2QCNA 4ZQRA 4KFPA 3G8EA 4O4VA 4RXFA 3DKJA 4JGDA 3MP4A 1I2OA 2YW4A 3PBYA 5FF4A 3A9IA 4LUIA 1OX4B 4FHAA 4JTLA 3BG3A 1T99A 3QC3A 3FKRA 3TMLA 1ICPA 5AB3A 4J9JA 1XI3A 1JCMP 1G4TA 5DELA 3VCRA 4XTDA 4XWUA 3M43A 4CCEA 4YWIA 2Z2UA 3W84A 4FIRA 1E51A 1Y0EA 2YSWA 1V7YA 5D02A 1X8FA 3A22A 4O8RA 1NFBA 3IIXA 2XN0A 3W3OA 5CZSA 4JDYA 3MHFA 4AF0A 4EWND 1OX5A 1EB3A 1KTBA 5G5IA 3EX2A 1M6JA 1W5OA 1QAPA 5C54A 3M16A 3LV6A 1GVRA 1RZMA 1NVMA 2UV8G 2Y70A 1O5KA 1FDJA 2E1DA 3P60A 3TFCA 3GYEA 3DHDA 1L9WA 4NVTA 2H3DA 1YXCA 3G0UA 2QR6A 5D05A 5FEZA 4KFOA 3HPXA 6TIMA 1IXNA 1GZGA 2NXIA 1C9DA 1QPOA 1XDMA 4PCFA 3G24A 1S5TA 4NQ1A 3P8IA 4BI6A 3S5ZA 1ZNNA 1KFEA 4UTTA 1BWLA 3W7LA 1FUYA 5BMWA 3H55A 1H1YA 3HG2A 2ZZ2A 2VFHA 5K7JA 1OX6A 3KFTA 3T40A 4DO5A 3FKKA 3BG5A 3C3NA 4LS2A 1SR9A 1K03A 1R47A 2PE4A 2X1UA 4Z1BA 2Y63A 3TSMA 4BK9A 3E49A 1I4NA 1YDNA 3QQ1A 4NJGA 3S5NA 4FXRA 4WY0A 1N7KA 1F73A 1F5ZA 3CM4A 1OFRA 4MZYA 3BG9A 4QNEA 5C6MA 1DJNA 1ZHAA 2WNNA 3QPZA 1QWGA 2EKCA 4A2RA 1SU5A 1IF2A 2ZZ3A 3UPWA 3LHTA 3W7QA 2EGZA 2HSAA 3KVLA 3G22A 3UNDA 2CZ5A 3LDVA 1FWTA 1TB3A 3LCXA 4S1FA 4EF9A 2H3BA 4X9SA 1ME7A 1W37A 1QO2A 4MY1A 2CLKA 4LC6A 3G1DA 3EWUA 4FNSA 2E68A 4LU0A 3W7NA 5A5WA 4FNPA 2VEKA 2ZDRA 3NQ2A 1FCVA 3O07A 3C56A 4WY0B 3WJSA 1W54A 3THAA 2NUWA 1A5AA 1YLVA 2E6YA 3LHVA 3UWQA 2QCGA 3W07A 5D38A 3NPUA 1X1ZA 1BTMA 2DZTA 1W3IA 3INPA 3UXAA 4MLJA 5MHBA 4ZQMA 2B4GA 4N2YA 4GUIA 3LRKA 4LC8A 3TC7A 3MI6A 3S5YA 3NR0A 2WV8A 3KRSA 3TNOA 5FEWA 1HO4A 1RPXA 4KKXA 1TPH1 4RV8A 3E12A 3GXNA 1H61A 5FI8A 4QIUA 4CQAA 1AW1A 5AHNA 4K7VA 4K36A 4MY9A 2GQ8A 3LCGA 1LLWA 2G97A 2JBMA 3UWZA 4JIQA 1TRIA 1KM1A 3W2MA 5D04C 4FO4A 4CCCA 5G4EA 1DORA 1OYCA 1EWDA 1VGAA 5HINA 3W6YA 1F6KA 2A7PA 4TIMA 1GOXA 1FWWA 1SW7A 3CTLA 3GDRA 5CSSA 5F2MA 2JGYA 4FX6M 5EL1A 3DH7A 1K7FA 1H7OA 3UY8A 3SIZA 1CI1A 2V0TA 3GAKA 3LCLA 3W7MA 1IIGA 6ALDA 4UR7A 3UWUA 1Q6RA 3ANYA 3W7PA 4L4MA 3GLCA 3HB9A 3S6DA 3MYOA 3NM3A 3G0XA 4O52A 4R7JA 1M7OA 4X3ZA 1JCNA 4G1KA 1NEYA 3DU0A 4UFMA 3WJXA 2A7RA 3HG3A 3LGEA 5CPOA 3QMSA 5LNVA 3ATZA 1ME8A 1XCFA 3ZWSA 3ATYA 3GDMA 4FNUA 1VYRA 3TK7A 4OHQA 4DXVA 4O18A 2E5BA 3NQMA 5K4XA 4IMEA 4QM1A 1L2UA 3L2IA 4NNBA 4WOQA 4FEZA 4A21A 1KFKA 2TSYA 3NO5A 4WXZA 4LT9A 4CQ8A 4UIOA 4M7TA 2FIQA 2ZZ1A 4M19A 1P1XA 3FJLA 2QDGA 3PF3A 3IVSA 1VS1A 1P5BA 4JX6A 2O7SA 5D2YA 3W1NA 4LRSA 4MFDA 3VI2A 3HBLA 4GFSA 5FESA 1UCWA 3P5YA 1TV5A 1WA3A 3GDLA 4LVBA 3H54A 2TYSA 4MYXA 3T7VA 3SSJA 1VHCA 3S1WA 1GYNA 1OFEA 3GKFA 1PIIA 4GUFA 2CU0A 3KRUA 4C1KA 1TPB1 4MOZA 4HKPA 2Y62A 3B06A 2RH9A 5KMYA 1RQEA 2NX3A 3G1XA 5EA9A 3M44A 3EX6A 1D3HA 2DJLA 3W2UA 3NQDA 1TTPA 3I7RA 1M5WA 4IQLA 2C16A 3A21A 2QCLA 5BNKA 2C13A 5F4WA 4UTTC 4XKYB 3TC6A 1KTNA 4H3DA 5EYWA 3TROA 3B0UX 2QAPA 1LM1A 2R8WA 4QITA 4U4MA 4YL2A 5GVJA 3IIZA 1XC4A 1ICQA 4GUJA 3TFXA 4I7VA 3NPVA 3QSTA 1LBLA 4W9TA 4IMFA 2V2CA 3Q94A 5F2LA 1H7NA 1Q45A 3W7JA 4EF8A 3U8GA 1SO6A 3SECA 3N34A 2CLLA 2YYTA 3N9SA 5AHEA 3NVTA 1G4SA 3TQVA 3W76A 3UXDA 4DF1A 1SSDA 4B5NA 3C2FA 4QISA 1VZWA 1UUMA 2WJZA 4ZQCA 4JNMA 5FF2A 4JTIA 2QJIA 2C19A 5TBOA 5G2WA 3HJZA 5BW6A 1W8SA 4IXXA 4LTSA 1TIMA 4AWTA 3TJLA 4AWUA 3LLFA 3TV8A 4HHPA 1Q6QA 4Y96A 3G3MA 2CLHA 3W1UA 3GX9A 1LBMA 2NV1A 1VCGA 3LBMA 4I7WA 5EKYA 3CWOX 2Y85A 3V75A 3CHVA 3QMRA 3FLUA 2TMDA 3OHIA 4O13A 1JCXA 3WK1A 1UJPA 3W23A 2PC4A 1H7XA 4LNYA 4EOUA 3OVRA 2H8XA 4JTSA 1K02A 2V30A 3S1VA 3PUEA 1OFQA 2Y7DA 3CIWA 4LY8A 5I3JA 3MBFA 2NXGA 3W70A 1JVNA 2PRHA 4Z1DA 4AEOA 3YPIA 1IGSA 2BLEA 1K8XA 2HS8A 3N73A 1MZHA 2CZFA 3ABQA 5CZ0A 2XN2A 5G2HA 3UYCA 1O94A 2V2HA 4N4QA 3HGSA 3G1HA 2YFOA 3U2OA 3MI2A 4ZVJA 2YXGA 5C5YA 3IV3A 1EWEA 1Q6OA 3PWAA 4GNJA 3IGXA 1I8JA 1THFD 5AYYA 1YTEA 5LZLA 4NNAA 1Q3NA 4CLMA 2FDSA 3GB6A 1QOPA 4YXGA 4OBTA 2VFFA 2IQTA 3KOFA 1EEPA 2GJLA 2FQIA 5G1YA 4AXKA 3FOKA 4MIMA 3MHUA 4IMDA 1L6SA 3DKLA 4FX7A 1SZGA 4HNVA 1HFBA 1FXPA 4K8HA 4BWLA 5D09A 1TQXA 2AQWA 4JX5A 1YTKA 2YYUA 1I2QA 3M47A 3O6CA 1DBTA 3WK3A 5AN7A 3NAVA 1N8FA 2P0OA 4RR4A 4ZQPA 4POCA 3B04A 4FNRA 3WK0A 3CT7A 4LV4A 1NSJA 1OVDA 1GEQA 2YFNA 3CQ0A 4TMBA 1PVNA 1X7FA 1KBIA 4TO8A 5LHEA 2R14A 1ZALA 1EPXA 4I9AA 4Z0JA 2Q3OA 2FLIA 2X2GA 1G4PA 1VYPX 3W7DA 2Y88A 1W5NA 1J4EA 4R34A 2EAWA 5CGQA 3QMTA 1KM6A 5D2XA 3W7IA 3NQVA 1P0NA 3GR8A 4YCOA 3NL6A 1S5WA 5CZJA 1GT8A 1LBFA 3LV5A 1GPWA 5I3KA 3LHZA 3AO0A 5G1TA 5KZEA 4OV4A 2Y6ZA 1HTIA 4FNQA 5U4NA 2KZHA 3QW3A 4MKNA 1AMKA 5TQLA 5HNRA 5AOUA 4N9BA 3RFAA 5LKYA 3TXVA 1T0OA 3EWZA 4PC8A 3QM3A 2ZRZA 3CPRA 1VLWA 1MXSA 2JKAA 2C0AA 5EBUA 4U28A 4RX0A 1CW2A 5IBXC 4O1BA 1W5MA 3I6RA 2C1HA 3UY7A 1WXJA 1AK5A 3IVUA 5DCEA 1LOLA 3GXPA 3L9CA 1PE1A 3FEMA 5AHFA 3LLDA 5E1QA 1SZFA 1TJRA 3O6DA 4CCDA 4AHQA 5DBUA 3QEZA 1LRQA 4HN4A 3W88A 2V82A 3IIOA 2I14A 3KVMA 5D33A 2E6DA 4QJ1A 4JTFA 3NGJA 2QCHA 1HL2A 3BVJA 4UTHA 3G1FA 4JYDA 1JCYA 1ML1A 2ABAA 4NJHA 1SUXA 3W86A 4NJIA 3LTSA 4IUOA 3MYPA 2QCDA 2ABBA 3LRMA 5F4XA 1O95A 5K9XA 3FA5A 4NXKA 1LZOA 1SZNA 3CC1A 2A5HA 3EWYA 1IXPA 3FYOA 3R12A 5LNWA 1XUZA 1ADOA 5CPLA 1V5XA 4TU1A 2ZZ5A 2QJHA 1TPDA 4JIPA 4AHOA 5C2XA 3GDTA 1VH7A 4UFHA 3HOJA 2V81A 4QAIA 4NX5A 3L68A 3LCIA 4JTGA 1EP1A 1AL7A 4CNOA 4OV9A 2WQPA 4AHPA 1WBHA 4O57A 2ZFAA 3C2RA 4O4WA 3QRHA 5KZMA 2EPHA 3SFKA 3WJWA 1TQJA 3S5OA 3ELFA 4JN6A 1LRTA 4Z0SA 4RZ5A 4DO4A 4O11A 2V8ZA 4DF2A 2J27A 3P82A 5LGXA 4DBDA 1TMHA 4A2SA 4HNNA 5DCBA 1VYSX 1KM3A 2CLOA 2J9XA 2H90A 1NF7A 2J9ZA 1KM5A 4LW7A 1R30A 2RHGA 2XN1A 2E6FA 2NX9A 1KFBA 4DF0A 2Z1BA 3W2KA 1JCLA 4WY0F 3MI3A 3MHGA 4FX8A 4X22A 3S8HA 3E9AA 1AW5A 1PL9A 3E96A 2DP3A 4LV9A 1ZAHA 1TREA 2VXNA 4UR8A 3B0PA 1WQ5A 3GNNA 1SZEA 1G4EA 2X1TA 3LTPA 2W0UA 3TR2A 3W1TA 4XKYA 3O1NA 2Z6IA 1TPVA 3H53A 3DFOA 1OX4A 2RKXA 2B0MA 2VEMA 2QKFA 3MP5A 1BKSA 3CEPA 2ISSA 4A29A 3A23A 2W6RA 3W7OA 2BXVA 1JQXA 4OE7A 3TUUA 1DL3A 5K9CA 4O0ZA 1A5CA 4LVDA 1KTCA 1MEWA 1SW0A 2CLEA 4HPJA 2JGQA 5LSMA 1MEHA 3C8FA 3Q58A 2FPVA 3WJZA 3VE7A 3PBVA 1H50A 2QUVA 2NX1A 1S3HA 5HWJA 1KLZA 3W1LA 2AAMA 1SW3A 2GUUA 4MZ8A 5HR6A 1F2JA 1DOSA 3EWXA 2GVLA 1A50A 3OA3A 1SO5A 2VEIA 1DJQA 1LROA 4I7UA 5HUOA 4E38A 5D32A 5AFDA 2B7PA 3PSWA 3ZFHA 4N9DA 3MW7A 1SSGA 4O1DA 3WJYA 4N4PA 3FIGA 3HPZA 3B03A 2Y89A 1SFJA 1UBSA 2Y7EA 1TTQA 3PUDA 1T96A 4NZJA 2A7NA 2ZTJA 2Z6JA 3PR2A 3P61A 2EF9A 4JTEA 3SGUA 4JY8A 3P5ZA 3IIVA 1KBJA 3BARA 3MBDA 2CLFA 5TIMA 1KM2A 3UZ5A 4Y6GA 4LRTA 3G1AA 3RNDA 4HT3A 2J24A 1TPC1 5LNSA 4BFAA 1O5XA 1OFPA 2VFDA 4Y8FA 2C6QA 4PTNA 3M5XA 1Z44A 1W31A 3DFNA 4DELA 2HTMA 1W56A 1O60A 5F4SA 5CZTA 2NUXA 1TPEA 1ZENA 3LCHA 3NZ1A 2PRMA 3OVPA 1FDYA 2A2IA 3BPWA 4O16A 5F1UA 3IIPA 4MY8A 5FEPA 3OBKA 1DHPA 5DXYA 3N3MA 3LHYA 2G5WA 1KW1A 4A3UA 5AHLA 1QOQA 2Q8ZA 5HMSA 2Y7GA 1KM4A 1D9EA 3W1AA 1JCJA 5DXXA 5HJLA 1XDLA 2DORA 1F6PA 1RQHA 3KVJA 3F03K 2FB2A 3G18A 1X1OA 4GUHA 4UTJA 1LP6A 1XBVA 3RK8A 3GVGA 1I2PA 4JTHA 3DXIA 5CSRA 1JRBA 2P10A 3SGZA 4QNWA 3LI0A 3C52A 3CEUA 4ADTA 1FWRA 4BF9A 1I2NA 3W1XA 1HUVA 4Q4KA 4QSHA 3TKFA 3W72A 1FCUA 4GUGA 4UTLA 1OJXA 2G96A 1QFEA 2E5DA 2F84A 4O54A 4RXGA 4RJEA 1H7WA 3QH2A 1KLYA 2ZRVA 4IPJA 3W2LA 4WJEA 3MUXA 3TE9A 1TV7A 2ISWA 1WYIA 1OFBA 1YPIA 1ONRA 4XUGA 4C1LA 5K4ZA 3TH6A 1JUKA 4NUWA 2WSYA 4O1AA 1H62A 3P8JA 5I3HA 2YX0A 2I9EA 1NAL1 1BEUA 5U7SA 1XBZA 2R94A 1AL8A 3NQ8A 3E02A 3KVKA 1JRCA 2ZRYA 2LLEA 1H1ZA 1LOQA 5C55A 1JULA 4RKAA 1EUNA 3TCEA 1R2SA 5A8GA 3STEA 3NQ7A 2ALDA 2ZBTA 5BOOA 4Z1AA 2W79A 3C2OA 1EA0A 1Z42A 5KINA 3UD6A 2A1YA 1XBXA 3A5FA 2HMCA 4DPPA 5LHFA 3DHFA 2E77A 4GWEA 4NJKA 1GG1A 2WSQA 3AJXA 2CWNA 5KSWA 2NWSA 3L0KA 3IRDA 4JX4A 1IXOA 1LLZA 4PEKA 4LWWA 4DEFA 3PS7A 3KHJA 3NYZA 3USBA 4JTKA 3NEVA 3P7YA 1ME9A 5F2GA 1H7RA 3RLUA 1G7UA 1PCKA 1XFBA 3UQNA 3LHWA 1OF8A 3W1QA 4OT7A 4ZQNA 4M6PA 3PAJA 1CX9A 3LI1A 5AC7A 3M5VA 2FB3A 1DKWA 1G69A 3EX4A 3MO7A 3HF3A 1TPUA 2Q3RA 1K7EA 1GVFA 1M7PA 2QCCA 2V5BA 1UB3A 5D30A 3NNTA 2WSRA 3G1YA 4XBSA 4PL2A 5I3IA 4AF0B 4Q32A 4FF7A 1EP3A 3C4UA 1K7XA 3CU2A 4E0CA 1QPNA 2DU2A 3W7KA 1VRDA 3BW2A 1JUEA 2QF7A 3TAKA 3I7SA 5AYZA 1GWJA 3IVTA 1EUAA 5H91A 3TA6A 1W3NA 1U83A 3KRZA 3T55A 1H7PA 1L6WA
chains in the Genus database with same CATH superfamily
3W7HA 5HOSA 4UZUA 3RX4A 2VEPA 4KEZA 3F1QA 2VUNA 1FQ0A 3H2FA 2WHLA 1PTAA 3IGSA 1KO0A 1B9BA 1A3WA 4IICA 3R0DA 1YBQB 4DYJA 1ONEA 3W83A 3E6EA 2WSPA 3HPSA 5C2GA 2VFEA 4AD2A 1ZBCA 1RY8A 5BRBA 1VPQA 2PCQA 1GOOA 1DQXA 1KQYA 1OK6A 5IHRA 3ZS4A 1MWOA 5CSUA 3UU0A 2QZRA 1RH9A 4ORIA 3L5MA 4PMXA 2BX7A 5EMKA 3UR8A 4O50A 3V36A 4QQUA 1A5MC 1H3GA 5TAOA 3VNMA 1XBYA 1UKSA 2BVYA 3WDPP 2XSBA 3OW1A 1Z7AA 4LS1A 1UD3A 5K9DA 2B81A 3S4TA 2G3FA 4K39A 2YDQA 5C9ZA 2Y5SA 4MJ2A 3SFWA 1TTJA 4UNIA 2QJGA 1EX5A 2PGWA 4HPNA 3VUPA 1QNPA 2ZE0A 3B9DA 1JCTA 3CL7A 2RDUA 1GQJA 1G6CA 1GTEA 3GW0A 3WBXA 4X2RA 2VRKA 3CL8A 2Y61A 4B3KA 3DGRA 3W71A 4O8AA 4QHRA 3EOUA 2ZWZA 2OTDA 1V6WA 2OT1A 1YE6A 3O6YX 3MKVA 1XKYA 1M1BA 1K8CA 5JVLA 4ZZ9A 1HNYA 2FPYA 4B3ZA 3ANUA 4BI7A 2A85A 3CQKA 1XYCA 4KRUA 1E0WA 4LS0A 1PIFA 1JAKA 3WZ0E 4V2XA 1GOIA 4GYJA 4S3EA 2CHRA 1UP3A 3A24A 2C91A 3TXZA 1E5NA 5I02A 1X6UA 1BYBA 2ZTKA 3T09A 4KGJA 3CIXA 3H2OA 2FTYA 1PEZA 3G2GA 3MJYA 1K8YA 4M24A 4PCPA 3GXIA 5E0KA 3IAPA 3W85A 1PPIA 5DY2A 4Z2GA 1PHQA 2GSJA 1XYLA 4JYEA 3C0JA 1XLAA 4MFEA 2NVCA 2A3EA 4UZSA 1KRAC 3RR4A 4JBRA 3WUFA 4JNZA 4L1GA 5HA7A 3WIJA 4R27A 2HQAA 4JOMA 1KV8A 1LORA 2VI0A 3FJ6A 5CPNA 1WBJA 1FH8A 3NDZA 1OHLA 1JQVA 4IJBA 1PUDA 1Q2RA 5DFAA 4DI8A 3WNLA 4J3ZA 1OF6A 3GR7A 2AQVA 1OGSA 1GG0A 3AOFA 2VFGA 4N6EA 4F2TA 2PZ0A 2Z0IA 1TX0A 4R9OA 3LPFA 1P0KA 3OA5A 4LUTA 1H5YA 1K4HA 2Z29A 2XVKA 4AVOA 1FHDA 4C6NA 4A3HA 5A69A 4EPBC 1X1NA 2A6LA 4Q7IA 1QW8A 3GNDA 3SY5A 4M56A 1EP2A 2TODA 3TDFA 3LTYA 4E2VA 4ZGYA 4RL3A 4MWAB 4H9UA 1C8XA 4DWSA 1TO3A 1J6OA 1GTHA 3B0YA 3E3HA 3NZPA 3SZ8A 3AISA 4DO6A 1W5PA 1TZ9A 2NV2A 4KWOA 3UR5A 3HV8A 3M7WA 5CJ5A 4MF4A 4KH2A 3GNRA 1DJZA 3Q67A 5FF7A 4NRRA 3RITA 3ITOA 3A4WA 4RW3A 3VDBA 1RPKA 3L67A 4HIBA 4HNUA 4OWGA 4Q4MA 4K6AA 3WCZA 4E4FA 3JUGA 5F7UA 4V1YA 2V9DA 4WUIA 3QPYA 4FLSA 4L1XA 4NILA 3JR2A 1B1YA 2QDHA 3FNDA 2WMFA 2V2DA 1PV8A 3BLEA 3QFEA 3JW7A 5DQPA 2YCLA 2CBJA 4C6CA 1RV8A 1S2VA 2XFWA 1Q6DA 4Q8PA 3T78A 1K3UA 4YVXA 2XIIA 1WDQA 3ARZA 3U2EA 2OGJA 5FSDC 3KOWA 3LM3A 3BGJA 4AAJA 2QGHA 4WOZA 3VZXA 4GJJA 4EAYA 2D22A 1W6TA 1J2WA 4JQ1A 3CZLA 3QYQA 4MVAA 1XSJA 5HQLA 3DAQA 2ZRWA 3PTMA 1TA3A 3UETA 4EE9A 1BQCA 2GOUA 4HHLA 2VZSA 4AZ5A 3TIMA 3FN9A 3W9ZA 4QCFA 4GC4A 1E9IA 2PDHA 3O8AA 2ADAA 1XG4A 4Y90A 3DENA 2QJNA 4KF1A 4R7OA 3WKZA 4MJMA 5GNYA 3G1VA 2ZQ0A 3E0WA 4ERAA 1BXCA 5BWAA 3CLMA 3RILA 1RBAA 4NJJA 3FA3A 1QMLA 2B31A 4JQ3A 1CXFA 1TR1A 2Z27A 5CLWA 2PDFA 1W2PA 2V6AA 4C6OA 2XDFA 2DZUA 1ZJIA 4YHGA 2EKGA 1B2YA 1FCQA 3W7CA 2NXHA 2A21A 2QCEA 3VVGA 3QZEA 1PZ3A 3ZT7A 3URBA 5KITA 4QBXA 4W8BA 3ENLA 1TG7A 3FVMA 3A6OA 2V3FA 4KCUA 2VTFA 3B40A 3S83A 2VRJA 4JD4A 1YADA 2A6NA 4U2ZA 4L6HA 3LXCA 3PFMA 4HOWA 2D73A 3UWVA 3VKKA 4J7RA 4ZFCA 4JFVA 4UNLA 1G67A 1IXQA 1HG3A 3PJUA 3RU6A 3EPMA 4JICA 5CBBA 1V3MA 1XLBA 2ZRXA 2A3HA 1DJGA 2GSHA 5LXEA 3KOZA 1QHZA 4GBUA 3N2CA 3ALGA 3A12A 4NNCA 2ZX9A 1J5TA 3K2GA 1F7BA 3A4AA 1ZAIA 4C6PA 1NIUA 2J74A 5AZ0A 1Y5VA 3TN3A 3HMJG 3W7GA 1RCXB 3OZPA 3CWNA 3IANA 3A47A 1TIWA 4Y9MA 5KZDA 2ZUMA 3BAIA 3BK0A 2V5CA 4H1ZA 1I2RA 3QTGA 1J8VA 3UVAA 1KV5A 3AXKA 5FSEC 3ABSA 5K3VA 5E70A 3CWHA 2E09A 1F74A 1EHNA 1W9VA 4CKQA 3PY2A 1ZPTA 1O5QA 4XAYA 2GQAA 3B8TA 4INFA 4XAFA 1SM9A 3BGGA 1XLCA 1EEXA 1WKYA 2ACQA 1E4MM 4TQTA 3BE7A 1KD0A 2CIPA 1I0DA 5JXQA 1V6VA 5A8OA 1EC8A 2D2OA 1E43A 3N4AA 5HUPA 3W82A 3NL3A 4W7WA 2QXWA 1Q6LA 4WDUA 2YCIX 3BLFA 2X0YA 2J47A 3KBMA 1QJWA 2YW3A 4DJFC 1MEIA 5FF0A 1KRBC 1RD6A 2DZSA 2CEQA 3O05A 4C6BA 4LVGA 1VEPA 2YA1A 4AC1X 4H6EA 4KWVA 3W29A 4C1NA 1J0KA 5KTLA 2GQ9A 2E9MA 4HA4A 4WXYA 1XUUA 3KBNA 3SCWA 5JQ9A 4MPKA 1FWNA 2EG6A 4E4UA 4B5TA 1B3OA 4IMGA 3VIGA 2WQDA 3OLDA 7ODCA 4AIBA 1BRLB 1LJYA 2PS2A 2XH2A 2RGLA 1WDWA 4YLWA 3KBVA 3VTRA 3W75A 4NX0A 4XAZA 1FWFC 1XIDA 2YGYA 1TPWA 2DZAA 4UOQA 2NWRA 4GZ7A 1E1EA 2W5FA 3CYVA 3N2OA 5CKSA 4HU4A 4A3YA 1CYGA 1WAUA 1ZS2A 3GAYA 3N2TA 3TMQA 2YCJA 4IWWA 4LNCA 3FSUA 1IEIA 1QI5A 1VPXA 2ZVRA 4AISA 1YDVA 4XQ6A 9XIAA 3BMXA 4O28A 2XFYA 1IT8A 2CW6A 3IEBA 2I56A 5HXMA 3N2MA 5GJMA 4JPGA 3NQAA 3THQA 4A05A 4FAMA 1DQWA 5LXXA 1BKHA 1R7AA 1XGDA 4M1BA 4D8AA 1UD8A 1UWUA 4WK9A 1D8WA 3MZNA 4B3LA 1BPLB 4ICMA 4UFIA 4DWSB 4CNTA 4CNNA 1W1ZA 3S6TA 2GVJA 3M0KA 4DBWA 4LUYA 2RDTA 1HO1A 4JTCA 3MCMA 3I4KA 1GYLA 2WO5A 3DG3A 2Z1KA 1LWIA 3DBPA 5LGZA 2BFGA 3UA3A 4Y7EA 2YKKA 3APYA 3MMWA 1JNEA 5HULA 3WX7A 1QNQA 1J11A 1I6NA 1VR6A 1BLIA 3NPXA 5REQA 1E4LA 3NQGA 1CXLA 6XIMA 3AZSA 4NAEA 2GGHA 3QF0A 3TW6A 2DSZA 4R53A 1MUWA 1CZ1A 3LBCA 4ZE4A 4EKJA 4LYPA 2DY3A 3GU1A 5D37A 3NL2A 3ARTA 3K5XA 1GHRA 5I09A 4AIEA 2QCNA 3QTPA 3QLLA 5I5RA 3VMNA 4CU6A 1PZ2A 3LENA 4O4VA 1NDVA 4DWDA 4KWUA 3DKJA 3UJEA 3VDAA 1IEXA 3NGFA 3N6QA 4LUIA 1OX4B 4FHAA 4OIFA 3BG3A 1EDGA 2HDJA 4AY7A 3FKRA 5AB3A 1EGMA 5AYBA 1UR4A 1JCMP 1G4TA 5JIPA 3VCRA 4XTDA 4AD1A 4ZXOA 4CCEA 4YWIA 3W84A 2WWCA 3O0FA 2WXDM 3RJXA 3F4DA 1NFBA 3HU7A 2PWFA 5C9WA 1Q4NX 2XN0A 2GJXB 5CZSA 5FAJA 4C6FA 4ZO9A 4AF0A 4DJDC 4WSJA 1U1JA 2VCBA 3EX2A 3LQLA 1XR2A 1GVRA 3KZSA 3S2MA 1NDZA 4IFOA 3TOYA 2Y70A 3DYPA 1FDJA 1F3WA 3GYEA 2IPFA 1XH2A 3DHDA 2VX4A 5FEZA 1YXCA 3FDKA 4QDWA 3CNYA 5I06A 4JTDA 4GVHA 3IAQA 6TIMA 1GZGA 4IISA 4PCFA 1ZSXA 1S5TA 2YXXA 4NQ1A 4B9YA 3S5ZA 2ZUSA 1KFEA 4PTMA 1W3LA 1A3XA 3MWCA 1E6PA 4L64A 4WEVX 4RNHA 2VNCA 3PTQA 1R47A 1WAWA 1X8CA 2Y63A 2XSXA 3R58A 1V0LA 5JIWA 3QQ1A 3DG7A 4IFRA 1PWMA 3GZAA 4FXRA 1B90A 1F5ZA 3CM4A 4E5TA 1F3XA 4MZYA 2BB0A 1CLKA 1DJNA 3OODA 2EEXA 1SU5A 2ZZ3A 3H2EA 4IUGA 3VGDA 3W7QA 1VFTA 1Z32X 2HSAA 1F8MA 3KVLA 3UNDA 5I00A 3T08A 1K6WA 4MY1A 2CLKA 5B80A 4QLLA 4FNSA 4LAOA 3UVIA 2ZDRA 4IT1A 3NQ2A 3O07A 2QIWA 4U3AA 3A13A 3THAA 4P7LA 3W07A 1DPMA 5C9XA 1A5KC 3U48A 3B0XA 3MMDA 3RLGA 4I3GA 5MHBA 4XVDA 3SUUA 2PDBA 2AKZA 3GFZA 4QLKA 1U5VA 4GUIA 3LRKA 2R82A 2WV8A 1GEHA 5HATA 1HO4A 1RPXA 3LY0A 4YS1A 3GXNA 3GSMA 3A4XA 3F5JA 1YMYA 4ZODA 1A47A 2DSKA 4MY9A 4D6CA 2BVWA 3LCGA 1LLWA 4PE8A 1E0UA 3W2MA 4HTYA 1US3A 4GLEA 4GISA 5G4EA 3QHNA 4PUKA 1EWDA 1VGAA 1RA5A 1N2VA 2IPGA 4AZ6A 4RE4A 1AZ1A 1FWWA 3GDRA 4FX6M 5A1AA 3EOSA 2G4FA 3DH7A 4XZBA 3OYXA 1Z69A 3SIZA 3S2LA 5E09A 3LCLA 1IZKA 1V93A 1KCKA 4LXFA 1OD0A 3UWUA 2OYMA 5E6ZA 4YTTA 5XINA 4R7JA 1VAHA 5HJXA 3VNKA 1HJWA 3A9BA 3H21A 4G1KA 3L12A 2WHMA 2A7RA 3HG3A 4GIYA 3GRIA 5CPOA 3ATZA 1XCFA 3TK7A 3QY6A 3NQMA 1CLXA 1KFKA 1V3JA 1KGWA 3B3DA 4LT9A 5A6LA 3O6AA 3R25A 4M7TA 4QCEA 2PLMA 2FIQA 4P7NA 3FJLA 3CHEA 1XISA 3IVSA 4Z1YA 3MSYA 1P5BA 2O7SA 4PMOA 3GFYA 3OGVA 2BGQA 3HBLA 5FESA 2DVUA 3O2LA 5CPSA 5A6JA 2WKGA 2J78A 2WZMA 1TV5A 3GDLA 1KFWA 1KXQA 3PTDA 4YVVA 3TTQA 3T7VA 1IV8A 1PIIA 4QROA 3KRUA 3HFTA 3T2PA 2WC3A 4HKPA 2ZADA 3KS6A 3B06A 5KMYA 1RQEA 2NQHA 3G1XA 4AZ7A 7XIMA 4ZO6A 4EXQA 3EX6A 4Q8QA 4H9TA 3W2UA 3VOHA 3A21A 6TAAA 2Z1XA 5F4WA 4PMQA 2PDCA 5EYWA 2QAPA 1LM1A 2XVGA 3UG3A 4U4MA 4YL2A 3VPLA 3AXHA 5GVJA 2W63A 1XC4A 3KW3A 4GUJA 3TFXA 3NPVA 3VNYA 4I6KA 1LBLA 4QLJA 1E70M 4QJ4B 3Q94A 4ZOCA 1V3LA 1G0CA 4GZJA 1Q45A 3W7JA 3WFZA 3SECA 3N34A 2NQZA 2YYTA 3CUJA 3WYZA 3NVTA 1S1RA 1SSDA 4UQEA 4ZQCA 2WJZA 2X42A 3VA8A 4ENLA 2C19A 5TBOA 2PTDA 3TOPA 3VU2A 1XCWA 2OO0A 4IL0A 5CC6A 1K1DA 1RLCL 1CNVA 3TV8A 1Q6QA 2WZTA 1OC5A 4Y96A 1J2BA 3GX9A 4GABA 1VCGA 4GG9A 4W5UA 3V75A 3SCNA 4O13A 1JCXA 3S46A 1JPKA 4LNYA 1BF2A 1H7XA 4EOUA 4GCAA 3QLDA 4DNMA 1OFQA 3RPTA 1YW1A 4JFSA 4R9XA 2NXGA 5BXRA 1OG6A 1HP4A 2PRHA 3ZT5A 1OQFA 1CWYA 4L80A 3TNBA 2QLYA 4WKHA 3WFLA 3YPIA 1IGSA 1LWJA 1PSCA 2X1IA 5CZ0A 3T07A 2XN2A 1HKVA 1O94A 3OBEA 1U1UA 1W8GA 1VFHA 4GY1A 3OB8A 3TYDA 4JTRA 3BICA 2HVMA 3IV3A 4I9TA 4L6OA 4GNJA 2CC0A 4F4RA 1I8JA 5LZLA 1PX4A 4WRHA 3TCSA 3EA2A 1JYWA 3GB6A 4D8ZA 1REQA 3QR3A 2VFFA 2IQTA 3KOFA 3QY7A 3MHUA 5HMEA 4IMDA 1L6SA 3DKLA 1VP5A 1SZGA 1EA9C 3EOOA 4K8HA 4JX5A 3O6CA 4GI4A 1EJSC 4DB7A 3ITLA 3NAVA 5KZ6A 4V27A 4ZQPA 4POCA 4WSHA 3VKBA 2WNWA 4AD4A 1XSKA 1NSJA 2P5NA 3K46A 4S3JA 4F3HA 3GTFA 2ALRA 2Y88A 1E5JA 4ZXLA 4G7FA 2Q09A 3C3UA 1MW3A 2EAWA 4GI9A 5CGQA 4HB7A 3MDUA 4BQ3A 5BU6A 5D2XA 1A5NC 4YCOA 1CXKA 1LBFA 1UMLA 2RDXA 5I3KA 3KDNA 3H70A 5EMLA 5G1TA 5TNVA 1F4HA 4AXNA 4OV4A 4FNQA 3PJTA 1QOXA 3M64A 3AS3A 5AOUA 3RFAA 4PC8A 2EJ1A 3AWNA 1NWUA 3CPRA 2O9OA 3N4FA 2VMFA 1RCOB 3BDKA 4QG9A 4MAVA 2OB3A 2OOGA 5IBXC 3HMCA 2VDIA 3I6RA 2C1HA 3UY7A 1F9CA 2WBKA 1WXJA 5GNXA 3GIQA 5JBFA 3GG0A 1XH0A 1TELA 3SADA 1TJRA 4AZHA 2X40A 2E0PA 3W88A 2XYLA 3TVAA 3KS5A 4QJ1A 3ZQ9A 4Z42C 1HL2A 3BVJA 3PUGA 2VT0A 4UTHA 3GR4A 1JCYA 3EMCA 2Y24A 2ABBA 3LRMA 5K9XA 4CVWA 2O9PA 3R12A 4CU7A 5LNWA 1O7AA 4AZCA 2XIMA 1YDYA 4GKLA 1ADOA 5CPLA 3VIJA 4TU1A 2ZZ5A 4U33A 3ZM8A 4JIPA 2FGBA 1JAEA 4YU1A 3HOJA 3KRBA 1TE1A 5I78A 1RUSA 1EP1A 4AHPA 2XGBA 4O4WA 3QRHA 1R8LA 5KZMA 3H8AA 2W91A 3S5OA 4JN6A 1X7IA 4QAWA 4G56A 4IQJA 4Z0SA 4RZ5A 3KL5A 2HK0A 5LGXA 4DBDA 4A2SA 3RR1A 3BOXA 4HK7A 2CLOA 3D5HA 4U10A 2FH6A 5LIXX 5M5DA 1R30A 2P53A 3B9EA 3FXGA 1UWTA 3T9PA 4PBGA 4AX7A 5ENLA 4JCMA 4Q8TA 1PL9A 1LT7A 4OOZA 2ODOA 1BG4A 3WN6A 1TREA 3B0PA 3GNNA 1SZEA 1MUMA 1W1A1 1RK5A 3VOIA 3B9OA 3W1TA 3IJIA 4J40A 4EPEC 1ESWA 3POCA 5C7HA 2PLCA 1TPVA 2W4XA 2RKXA 3AIUA 1L6FA 3CEPA 3FAWA 2J7CA 1XPYA 2INFA 3W7OA 2BXVA 2WC4A 3WQ6A 4OE7A 1V6UA 3QHOA 4WIWA 1MEWA 1KNWA 2AL2B 4HPJA 5EFDA 1KCLA 2YJQA 1TZZA 1H50A 1ECQA 2QUVA 4K1WA 2YCLB 1TVNA 1S3HA 4RW5A 2WHKA 3T05A 8XIAA 4FLOA 4MZ8A 1SW3A 3PNZA 2G3IA 3EWXA 2DH2A 1WKEA 3Q65A 1SO5A 1XLIA 4GYPC 1DJQA 3S9IA 4IPPA 1POJA 5HUOA 4E38A 3NXLA 5AFDA 4EWJA 1E73M 1ZBKA 4PBFA 1SSGA 4BZYA 3GH5A 1XIHA 3FIGA 2PDPA 3M4HA 2FH8A 1SFJA 2Y7EA 1TR9A 1JZ5A 4ROQA 1T96A 3GU2A 3U4FA 4ZO8A 2PAJA 3L4WA 3LUTA 3WH9A 3Q45A 2RAGA 2XWEA 4IG2A 3UERA 1C90A 3N9KA 3GDBA 3LSBA 1HKKA 3EA1A 3CS2A 3SGUA 4S39A 1FVPA 3WQ5A 1UG6A 3U5UA 4GIAA 2QS8A 4LCRA 1KBJA 1WDSA 3IIVA 5A6SA 2CLFA 3ARQA 1XIBA 2DT0A 2WK2A 4GO9A 1KM2A 5C9RA 3UZ5A 5FJIA 1P43A 5ECUA 3EPNA 1EJUC 3AYTA 3G1AA 1SYTA 3KHDA 3MSRA 1XFCA 3ZR6A 4BFAA 1OFPA 3TWAA 2VFDA 4DELA 1E1CB 2HTMA 1L2QA 1W56A 5DEZA 3FK4A 5BROA 3LCHA 3DGBA 1J01A 2PRMA 3CHCA 4MY8A 5DXYA 5IOBA 4IGSA 1D9EA 3W1AA 2HV5A 4KRTA 3TZNA 3L23A 1XDLA 1XLKA 2DORA 1BRLA 2ZX5A 1FWJC 4YTSA 3G18A 1X1OA 1A49A 4GK8A 3RK8A 2E25A 2VO5A 4OFCA 4PMVA 4JTHA 3UW6A 2W62A 4R7WA 3JU2A 2PODA 1HXJA 3LI0A 3C52A 5DT5A 4BF9A 4N0RA 1E9YB 1GW9A 3BMWA 4IJCA 3BLOA 4Q4KA 1WNOA 1DJYA 3GQYA 2OEMA 3PPHA 4QTGA 2EPMX 1QFEA 2C1IA 3LQGA 4O54A 2R9RA 3NO1A 1RBOB 3QH2A 1UWSA 2GGEA 3W28A 4YNGA 3T2QA 3UGVA 3W2LA 5H1WA 4WJEA 3MUXA 3KP0A 1KB3A 2VCCA 3XIMA 2F61A 4YJ5A 1WYIA 2UY3A 3GHSA 1EIBA 1HGWA 3W26A 1H11A 2D20A 2OXNA 3APTA 4L65A 4C1NB 1UA7A 3VOFA 3OQEA 4KQNA 2VJXA 2RUSA 3P8JA 1E6SM 5IHSA 3IJQA 4G6CA 5EFFA 3GW3A 4A3RA 1TWSA 3MC5A 5IXEA 5U7SA 3QXBA 4ES4A 2R94A 1B3YA 1AL8A 4CQDA 3NQ8A 3KVKA 1JRCA 1GVEA 1H1ZA 1XCXA 1NH6A 1EUNA 3CASA 7A3HA 4XD4A 3GFXA 2W79A 4PTXA 4P5UA 2VYOA 3A5FA 3W02A 2BDQA 3DHFA 1TKKA 2WYSA 4GWEA 2L5HA 4XISA 3PP7A 5LIUX 5KSWA 1VF8A 4D1JA 4HA1A 1LLZA 2MNRA 3I4EA 2VGFA 1LQ0A 4MWAA 1ZLPA 3P7YA 2A3BA 1FFQA 1TV4A 4G2DA 5HANA 2YB4A 5A2CA 1V0MA 4K2SA 1PCKA 1XFBA 5HMDA 1OF8A 3VC6A 4OT7A 3PAJA 4I90A 4Q7BA 4YVPA 3M5VA 1DYSA 1G69A 2EPNA 3EX4A 4HU0A 2FZNA 1K7EA 2VM8A 5FIPA 3BJTA 2OLAA 1M7PA 4CD6A 1UB3A 5D30A 1OADA 4OVXA 3G1YA 4GQ0A 1ZZMA 4MM1A 4PL2A 2OWWA 1BGGA 4W8LA 2Z28A 1S3TC 5E5CA 2GVYA 3CU2A 4TTUA 3N25A 5BYWA 1O68A 4AD0A 3BW2A 1T5AA 1FA2A 3BZJA 3I7SA 5FJUA 3U2CA 1U83A 1BG9A 3ARWA 3KRZA 3T55A 1HT6A 1H7PA 1F05A 3EB2A 3TSDA 3P84A 4HNTA 3P0XA 3H6OA 3M0IA 4O17A 3IV8A 4AB4A 4E2DA 3WLKX 5D2VA 4CU8A 1HVXA 1SZRA 3AU2A 1RJPA 3NXFA 1ITCA 4M5PA 3STFA 1RVGA 2PBOA 4HHMA 5T26A 3QV8A 4LF2A 1BWKA 4C7FA 1OCJA 4DLMA 4H6KA 3W7EA 2PP0A 4HZ7A 4C7GA 2C8NA 3P6LA 4IG2B 3WNPA 3CIVA 4LVAA 2FFCA 3PUOA 2XWDA 1GVSA 4AYSA 3WQDA 1BAGA 1H4PA 4HMCA 3K8MA 4RDYA 4JXCA 1PX3A 2XVNA 4HYVA 1PHWA 2OJPA 2CETA 1QBAA 2JF7A 3NZRA 3THDA 1DJHA 2ATMA 1O6IA 2INEA 4QS6A 2OCZA 1GHSA 2NT1A 5A6BD 2G95A 2G0WA 1RD5A 2XU2A 2HE5A 4MUZA 2X0SA 1X6LA 5FEXA 4DXKA 3BV4A 3V1PA 3UWEA 1UJQA 2C79A 3WH6A 3MO4A 3REQA 3NM1A 3BAWA 3QW4B 3C0SA 4KIRA 4F2BA 5D9OA 1T40A 3VGGA 4AWSA 3TJXA 1X39A 3R8HA 1FRBA 1HP5A 3IARA 3S2NA 1E0XA 3MJMA 4I5RA 4O15A 1TUFA 1KFLA 1U1HA 4I8DA 3VGBA 1V51A 3S5SA 3UZJA 1GJUA 3M1ZA 2D1ZA 4G1NA 5DF0A 3WFAA 2WZIA 1OC6A 5BMXA 4JTTA 2FTWA 2NLIA 3WMSA 4IOTA 2QT3A 3VM5A 1FBAA 2C3ZA 4L7ZA 4GINA 5HJYA 1W1YA 5EMMA 3SJ3A 2ISFA 4V33A 2X30A 2BSLA 4GH3A 3CZGA 1FKXA 2F2KA 1Q66A 2DUZA 4UFLA 5LA2A 5FCZA 3LOTA 3LEPA 2OX4A 3S1XA 4WSKA 3R4IA 4ZEPA 3KP1A 2R91A 3CPUA 1CBGA 3GG7A 3U57A 2HVOA 3GVWA 4RPPA 3P80A 1JXJA 1OG0A 5G1MA 1OYBA 4GE8A 1Z8AA 2X0HA 3MWAA 3W1RA 2OPJA 3AMDA 3LERA 3UJ2A 1G01A 3UG8A 4YMZA 2ZXQA 3NOYA 1JGMA 4IGMA 4E2BA 3TA9A 4CNPA 4TTGA 4QDMA 1Q13A 1VHNA 2YDAA 3G3DA 3O63A 4L1WA 3EX3A 1NFGA 4PCNA 3SI9A 2J8TA 4UTFA 5JH1A 1XIGA 2B7QA 4AD5A 3CAVA 3MPGA 5D03A 3CLWA 1UKPA 4O1CA 2OMAA 2V5LA 4QE4A 2BY0A 4AY1A 8XIMA 4S3KA 3FHAA 1QVBA 4O0QA 4WGHA 3WUBA 3NJ3A 2FPTA 4J3WA 4H6QA 2QUUA 2FHBA 2PWHA 1P1MA 1S2AA 1TVLA 2AGKA 4GJ1A 4LUTB 3W25A 2PP1A 4J2MA 1PS9A 1X98A 1M01A 5FL0A 4YWSA 5AC4A 3GWQA 1VC4A 1L8NA 1B3ZA 4J3TA 1MSSA 1EXBA 3TN5A 2Q8LA 4AEEA 2QV4A 1GQIA 2Z1VA 4HPXA 1VBUA 3TC3A 1J0ZA 2V5DA 3TQPA 2OT0A 3ZIZA 3ZJ8A 4US5A 3N19B 3AYSA 5CPQA 3BW4A 1R2RA 4EPKA 2ZX7A 3M5ZA 3P62A 1EFZA 4ONVA 5IM51 4LOCA 2MUCA 3L7RA 3BQ6A 1V4YA 1B4KA 2E5CA 1QK2A 1B3WA 2CLMA 1ICSA 3GK0A 4KETA 4AZIA 3AROA 4JFWA 3JS3A 1MUCA 1YXYA 4IXHA 1F07A 3CH9A 3GBEA 4TR9A 1OFDA 4K8EA 3WK2A 1UASA 3DESA 1Z48A 4OQVA 2DZVA 4PTWA 5PTDA 4MJ4A 3WSUA 1IR2A 4NASA 3CYJA 1U5JA 2QCDB 1LWHA 3T0TA 2XPKA 2VURA 2F6KA 1IZCA 1WUFA 1WDDA 2A4AA 4IP5A 3EWBX 4IJRA 1DHKA 3CK5A 3UWYA 1W5QA 5T9BG 3R8GA 2VCAA 2V3DA 4ADUA 2FVMA 3C61A 1H0IA 2ZRUA 4K7YA 4X0NA 3ZLGA 1QI2A 2OYLA 5JBEA 1E4IA 1KBBA 4IPNB 4NHVA 3FS2A 4L9XA 4JHZA 2WANA 3Q37A 1TSIA 3GH4A 1DWIM 1CIUA 3M0JA 4NXSA 3BSMA 4S38A 5MKGA 4MKVA 1V3KA 3VKJA 3WELA 1P4CA 1YNQA 2QYGA 1KGUA 3BW3A 4A22A 4AIUA 1HKJA 4Y2WA 3FDGA 4ATDA 1ITXA 2J13A 4DYKA 3E5PA 3FJNA 1OB0A 2BG5A 2WVSA 4HQVA 2GYIA 3UG5A 3THUA 1FHVA 2GJRA 2UY4A 4LVFA 4MTVA 3GKAA 1XIIA 5G4WA 3EEGA 4CQ9A 1EJTC 1FDZA 3UYIA 4O14A 3PTKA 5MKGB 3TONA 1B5TA 3VFCA 1A0EA 1EKOA 3MSGA 2I5GA 1LQAA 3PSVA 1TYGA 2AMGA 1XL9A 2EPLX 2IW0A 2VGIA 3CUIA 2J6XA 4S3DA 2I5IA 3I3EA 3QJAA 1XINA 1BYCA 4WR3A 3P0WA 3W1MA 3HQ1A 5DMLA 1UWAA 4PMDA 2ZA3A 4Z1CA 2CZDA 1WZAA 1E40A 3ZVHB 1EIXA 4D1IA 4FXJA 5CEWA 1DE5A 1HZYA 5D2TA 3UBPC 3NSNA 3RLVA 2ATSA 1UKTA 2P8BA 1R3YA 1CPUA 1UQZA 3TW7A 3MUIA 4ZTXA 4BEQA 3WQOA 3D47A 4AD3A 4MGGA 1ZAJA 3F4NA 4ZMGA 3QSRA 4MB5A 4EP8C 1TCDA 4YPJA 3STCA 3CZJA 2GSEA 3BGAA 3GTHA 4NF7A 5G2IA 2TPSA 1SR0A 5ABTA 3WDHA 5D9PA 3GBDA 1GZJA 4JYFA 4XBKA 1AZ2A 3TYEA 3ZSTA 2VR2A 2DT1A 1QRQA 4AMAA 1OSEA 1X97A 4B92A 1SJBA 4IGHA 5LNUA 1UPMB 4KWWA 2Y4SA 3NL5A 3SO7A 4ACZA 4GZEA 1P7TB 3I10A 3C2EA 1K9DA 2ZX8A 1GQNA 1OC7A 2NUYA 1YKWA 3OLGA 4F0RA 4UC5A 2EBNA 3UEQA 4XD6A 1R9ZA 4H9YA 4Q33A 4LB3A 3VYLA 3KCOA 5L6UA 3PZGA 3R89A 4B4HA 3RPMA 4DPQA 3MMUA 4GXPA 3NQ6A 4D6EA 1NWRA 3IGUA 5A8MA 4HVXA 3C8NA 2QAFA 2RDWA 4Z08A 1HW6A 3K1GA 1JI2A 3O06A 2YR1A 1LTDA 4PA8A 4OJYA 3L21A 3PWIA 5FAGA 1R2TA 1IT0A 4UTUA 4S3BA 1KFCA 2NQJA 2ASHA 1N55A 3W2JA 4WZHA 3KDOA 1NOWA 1ZGDA 2A0NA 4JY9A 2RFGA 4Z17A 3LXAA 5AHIA 4A35A 4WHBA 5FKYA 1MNSA 3WQGA 2JEQA 3VIHA 2W61A 3NPWA 4QS5A 1R3RA 2YOCA 5ECVA 1EDQA 1WV2A 2Y2WA 3AMGA 2UY5A 3R94A 1XYBA 3B8DA 3NUKA 5HQEA 3QOKA 5L9FA 1AW2A 3STGA 5I3GA 3NSMA 3UNTA 2AL2A 2I57A 2PRLA 1ZY9A 2POZA 3VOGA 4GQQA 1R85A 1FWEC 3GC5A 1DWHM 1OT2A 4Q7NA 4J1OA 4WX2A 1XH1A 5IDZA 1F76A 1Q7MA 3M0HA 3SM0A 4PL1A 2XISA 1P6WA 4HSOA 1RR2A 4Z2JA 4IQEA 4PTDA 5D9NA 3QYSA 3TQKA 1UHVA 3ZSSA 3PVFA 1GJPA 4FF5A 3B05A 2X2YA 3HFYA 2O0TA 1KA9F 3THCA 4H00A 2J4GA 3I7QA 4IIFA 4XSMA 3R5EA 4DUVA 4C60A 2XIJA 4RXFA 2J77A 4DZIA 5EMJA 2QF8A 4JGDA 3RX2A 1I2OA 3SRDA 5FF4A 3VX1A 4J9JA 4H2HA 1XLDA 5DELA 1VBJA 1AJ0A 3M43A 1C8YA 2Z2UA 4F40A 1V7YA 1X8FA 3A22A 4Q8MA 4NRSA 4MB3A 3T8LA 1YX1A 4BJHA 3K4WA 1IR1A 3MHFA 1OX5A 1M6JA 4UB9A 5CXPA 2YCKX 1QAPA 3M16A 3LV6A 3GVQA 1NVMA 4RPQA 3U9IA 3RGTA 4V1XA 3DBNA 2E7FA 4B2DD 5D05A 1WUEA 3BZGA 1XIMA 2WPGA 2CCRA 1PZ1A 3GVRA 4J35A 3N11A 3VKAA 3G24A 4BI6A 4Y9NA 3VDHA 1FUYA 3VIIA 3H55A 1H1YA 2I17A 2ZZ2A 2VFHA 1JDEA 1OX6A 4DO5A 3FKKA 1HF6A 3BG5A 4LS2A 2X1UA 4V15A 2D3LA 5AVNA 4Z1BA 4C6IA 1MXDA 4HD5A 4HHHA 3P93A 5DRIA 3TSMA 4BK9A 5CBIA 1I4NA 3W6LA 2CBVA 3S5NA 1GZ1A 4WY0A 2BY1A 1F73A 3W24A 3KBJA 1EH9A 4PN2A 5C6MA 2EKCA 1W3JA 4A2RA 1JFHA 1CGTA 4GJIA 7REQB 2D2JA 1J0IA 4Q8NA 2Q71A 3LHTA 1Q7QA 1EJRC 2PWEA 3KLKA 5EB8A 4S1FA 4JKLA 2H3BA 4EF9A 1ME7A 3LD5A 1PO9A 1KXHA 3QHMA 1CCWB 3EWUA 3ARPA 5A5WA 2VEKA 3TYCA 4Y8EA 1FWIC 1REQB 3BSHA 2NUWA 4A8LA 1A5AA 2E6YA 2QCGA 2JF6A 1X1ZA 3PZQA 4GX8A 5C9UA 3INPA 3DOPA 2P3ZA 3BSGA 4ZQMA 2B4GA 4KWSA 4LC8A 3TC7A 3NR0A 4MWAC 3TNOA 5FEWA 2OLSA 1W1PA 1WO2A 4M82A 3WEZA 2O4MA 4GNKB 3L4ZA 2GQ8A 4DVOA 3SCRA 2G97A 2JBMA 3UWZA 1TRIA 3TYBA 4CCCA 4L9YA 4A8IA 1DORA 1S39A 2GVEA 2ZC1A 3H7UA 5HINA 3OIHA 4IM4A 2GFTA 1O5RA 3H24A 4TIMA 1SW7A 5F2MA 4P7QA 4PR4A 2JGYA 1JIBA 2PDWA 1JG9A 1K7FA 4X9YA 1H7OA 2V0TA 4TX8A 1SGJA 1IIGA 9CGTA 4GHRA 2XJ7A 5I79A 4ERIA 2R24A 3W38A 3NM3A 3WUEA 4O52A 1UZ4A 3A4JA 4X3ZA 3NWRA 4IIEA 3WJXA 4Q3MA 1ME8A 3FGCA 5DT7A 4RZBA 3BC9A 1VYRA 3V0TA 1EC7A 4OHQA 2VVNA 4GXWA 6CGTA 4IMEA 4QM1A 1CGXA 3WG6A 4FEZA 2YL9A 3NO5A 4CQ8A 1WPCA 1E3ZA 1A0CA 4JX6A 1A3HA 1M04A 3WD1A 4FOKA 4LRSA 2FHFA 4C6EA 4GFSA 3SSZA 1GW1A 1KXVA 1JGIA 3P5YA 1T7LA 1E6NA 4E4PA 1QU4A 4LVBA 1XD0A 2TYSA 4MYXA 3SSJA 3S1WA 1GYNA 1OFEA 3CB3A 3GKFA 2CU0A 1LQ2A 5M03A 2ISDA 1KQZA 1XS2A 4W85A 1IYXA 4PUWA 1JFXA 3M44A 5C7VA 3R43A 1VFFA 1VFMA 1TTPA 3VIFA 2PA6A 4NKCA 1M5WA 3C5QA 4IQLA 2C16A 2QCLA 4MNLA 5BNKA 1HJSA 3TC6A 4QJ3B 3TROA 1K9EA 2GQ3A 4QITA 1S5MA 4I7VA 2PTZA 3QSTA 4W9TA 2GWNA 4JKMA 1H7NA 3AMKA 2IQDA 3U8GA 1FHUA 2CLLA 4L56A 2PDIA 1CGWA 1G4SA 3W76A 1AMYA 4XZHA 4DF1A 1UC5A 4B5NA 4JTIA 5G2WA 2HEJA 3WBAA 5BW6A 3GS6A 4LAZA 1TIMA 3T8QA 1A5UA 4KIEA 4AWTA 3UJSA 4QR6A 4AWUA 3MVIA 3LLFA 1C92A 2CBIA 3G3MA 3RCMA 3W1UA 4G9PA 4J3UA 3A3HA 4MUPA 3V5CA 3CWOX 4ERGA 4RNIA 4JQ2A 4AZBA 2WJDA 3F4CA 4F0LA 2TMDA 4U31A 2BMBA 1UJPA 2QVNA 3W23A 2PC4A 1XGZA 2H8XA 5HPCA 1K02A 2V30A 4A6GA 3T0BA 3ERPA 5FJOA 4K1GA 4LY8A 5I3JA 3W70A 1JVNA 2GOKA 4AEOA 1LL4A 6REQA 2QDDA 1K8XA 2HS8A 3N73A 1MZHA 1SMAA 1T8QA 2CZFA 3ABQA 3OTRA 2PLKA 3AHTA 3AICA 3LBOA 2V69A 5G2HA 1S2CA 3H26A 3UYCA 5CQ1A 3WF3A 5T8GA 2FZMA 3H12A 1DXIA 2YFOA 1U33A 1CB7B 1R7OA 3N13A 3BJSA 4FSAA 4ZVJA 4KERA 3V35A 2PEVA 3PWAA 4IHCA 3UCDA 3URQA 4GX9A 4JN7A 1THFD 1AH4A 4CLMA 2GGIA 1QOPA 4OBTA 4XZMX 2GJLA 1S2UA 4AXKA 1CTNA 1V6TA 4DBSA 2ZUWA 4MIMA 1RK6A 4AUBA 1HFBA 4HNVA 1DXEA 1FXPA 3WD3A 1YTKA 1YPXA 1I2QA 4XIAA 3WLHA 2CKRA 3WK3A 3IJDA 4PBEA 1ADSA 2XUCA 1NELA 3B04A 3CT7A 4LV4A 1K9TA 1OVDA 1QT1A 2PWUA 1PVNA 4TO8A 4HNCA 1UMYA 3UP8A 1EPXA 4Z0JA 5ABEA 2Q3OA 3AIVA 1X96A 1JF6A 1G4PA 4NL1A 4R34A 1UH2A 1US0A 1VENA 1KM6A 2D24A 3ARVA 5GNZA 1P0NA 3GHRA 4DYEA 3CQHA 1MVYA 1GPWA 3LHZA 2YDRA 4KRZA 1GGOA 2SFPA 1VBGA 3I6EA 2G41A 3QY8A 1DIOA 4W7UA 5HNRA 1ELSA 5LKYA 1UA3A 1T0OA 3EWZA 2CLPA 2ZRZA 4PYSA 2CESA 4E6MA 2C0AA 3BANA 3FY1A 4AMCA 4U28A 4RX0A 1JNDA 2QMJA 3WQCA 4DHGA 4R3UA 2QQ6A 3AIQA 1W5MA 4KCWA 2HROA 1U2YA 3AI0A 3IVUA 5DCEA 2HBXA 3E5BA 4FOUA 1R3QA 3GXPA 4YTRA 4PUEA 3M0VA 1NQ6A 3WQPA 4G7EB 4MG4A 1VKFA 2WCGA 3LLDA 1SZFA 1OIMA 3O6DA 1DTNA 2WW5A 4D6JA 1LRQA 5D4YA 4NAFB 2V82A 4HA3A 3KVMA 2NV9A 5D33A 2E6DA 4JTFA 4TOQA 3G1FA 4P8XA 3VILA 1ML1A 1JDCA 2ABAA 3MZ2A 1CLVA 4NJHA 1DXFA 1AD1A 3LTSA 5B7YA 4IUOA 2WMKA 2QCDA 3PBGA 3AHZA 2PDXA 3FA5A 1JZ2A 3M0YA 4QX4A 1XUZA 1T6MA 4AW7A 1EBGA 2J6VA 1V5XA 4MNMA 2QJHA 4QFUA 1TPDA 3PNUA 5J8LA 2BBFA 3JZUA 5C2XA 4D6HA 3VD9A 4W5ZA 3GDTA 3WUGA 1VPYA 1NWTA 3VD7A 3EPOA 4OECA 1YQ2A 3AYRA 4CNOA 2ZFAA 2PB1A 3ZXWA 2QUMA 2AQOA 3ELFA 4WDWA 5CCZA 1G5AA 1YNYA 2QULA 4XSLA 3CMFA 3WNMA 3I3DA 2J27A 1EO7A 3KOXA 4PUNA 5DCBA 1KM3A 3UR7A 1DIEA 2J9XA 1PX8A 1NF7A 1ZJBA 1EDTA 4UOJA 1I60A 2YXOA 1KM5A 5FACA 4W8AA 3EA3A 4IQDA 4D6FA 1QASA 2WKLA 2WM0A 3W2KA 4GMEA 5FA5A 4XB3A 4V28A 3MI3A 4FX8A 4X22A 2BV9A 3S8HA 3E9AA 5M1TA 2WJEA 3CBWA 4QJ5B 5ABHA 4LV9A 1ZRQA 1M7XA 4JCLA 4HYWA 2X1TA 1GOWA 4Q6JA 3TR2A 1A5LC 4XKYA 3O1NA 2XH0A 1E72M 3H53A 8A3HA 4JTQA 4DUOA 3WNOA 2VEMA 1JPHA 2QKFA 3MP5A 3GHTA 4MDOA 4A29A 1PZ0A 1Q8JA 3GG8A 3QV9A 5A2AA 3WF2A 3CUHA 1DL3A 5K9CA 1V7AA 1A5CA 1KTCA 1SW0A 2JGQA 3UGRA 3WJZA 2FPVA 3TEVA 1KLZA 1BQGA 5HR6A 3DIPA 3QZAA 7TAAA 2VX6A 3N4EA 5A6BA 1A50A 4PSRA 2WVTA 2VEIA 1NDYA 2VHLA 4I7UA 3GXDA 1EJXC 2IQ0A 2J79A 3ZFHA 2OOFA 3TJIA 3RXZA 3O3RA 4O1DA 1CT5A 2Y89A 2XSAA 2HBVA 3DCPA 2XFRA 2PC8A 3H2CA 5CG0A 1GUVA 4LH8A 1KBKA 4H01A 2ZTJA 4S3GA 3EMZA 3P61A 1WXZA 4HTBA 4JTEA 4DAIA 5FD0A 3BARA 3FJ4A 3MVTA 5FJRA 4KPLA 2OKTA 3ZJKA 4LRTA 1QUMA 3BCJA 4M81A 4I9MA 4GC3A 1MQPA 2BY2A 3WLLA 1XIJA 5LNSA 3S9ZA 4RUBA 4Y8FA 4XZWA 1RSCA 4PTNA 1PKNA 1M65A 2O56A 3DFNA 5KEZA 2XFFA 2HNEA 2XGZA 4PUDA 5F4SA 1PBGA 4MMWA 3NZ1A 2XG9A 5F1UA 4O16A 3IIPA 1DHPA 1J5SA 3LHYA 3N3MA 1ECEA 5E6YA 1KM4A 3KBWA 1FWDC 1JCJA 5I6SA 5HJLA 4BF7A 3MQTA 3F03K 3VIKA 4H19A 4UTJA 5CC5A 1LP6A 1XBVA 3GVGA 4KEUA 1V3IA 1I2PA 3TTEA 3DXIA 1XV8A 2GWGA 2P10A 4NZ3A 3RCNA 4D72A 3DERA 4ADTA 5T9CE 4DLFA 1I2NA 4Q4PA 3P2VA 3N29A 2DGAA 3TKFA 3GTNA 3QGAC 1FCUA 3VCCA 4UTLA 3S1GA 2G96A 3UESA 2E5DA 1H7WA 5AKQA 2GGJA 3T0DA 3BWWA 2X41A 1Q8AA 3ZJ7A 3AUOA 2QVHA 1ONRA 1UR8A 5BZAA 5E9XA 3TN6A 2FDMA 1B31A 2GDQA 1PAMA 3ZT6A 1W3KA 1NY1A 5I3HA 2O55A 3R1ZA 3RO6A 2D69A 2I9EA 1NAL1 1BEUA 1FWCC 5CBJA 2DW7A 2Z1WA 4BF5A 4NZCA 3BCDA 3EEZA 2J7EA 4BEUA 2BGNE 3VOCA 4UR9A 3TCEA 4DN1A 1R2SA 3VINA 2FZ8A 1E1CA 3EYPA 5C8BB 1AQMA 4DJFD 4HSHA 3IACA 2E4TA 1J93A 2HMCA 3IUDA 2E77A 4H8UA 5A8NA 1XRSA 5GJPA 2PSNA 3AXXA 5D8WA 3L0KA 3HPAA 4LWWA 4DEFA 3PS7A 1Q5MA 3VGEA 3NEVA 4I6VA 1V03A 1TMLA 1H7RA 3RLUA 2BASA 2HE8A 5A8PA 2O4QA 1XLLA 3UQNA 2ZIDA 3HA1A 2RGMA 1ZL1A 2E8ZA 4M6PA 5CJMA 1NP0A 3PZ9A 1CX9A 5AC7A 2FB3A 3U2ZA 3UXKA 3HF3A 1GYMA 1XIEA 1KC7A 1Q6CA 3VK5A 1GVFA 2ZVIA 3NNTA 2PDYA 1K6AA 4AY8A 2DIJA 3H23A 4C6LA 4CD7A 1V08A 1AA1B 2VWSA 3AHYA 3W6MA 3UJRA 2QF7A 3TAKA 4BHYA 4M80A 5H91A 3OBAA 4IIHA 3TA6A 2PWVA 2REQA 1V0KA 3LNPA 4CGTA 4AU0A 4HSNA 2YCEA 3G77A 1VEOA 1VLIA 3TX9A 4TMCA 4IGNA 4ZENA 4MHBA 3DFYA 3VNDA 4B5SA 4FP1A 3DFPA 3U6WA 3WEOA 1JPDX 3QFWA 4GKTA 1ZP3A 4WVXA 1FWSA 5D8ZA 4LUJA 4D8LA 3UR2A 3WDQA 3OEXA 1HKWA 4L4LA 1QTWA 1GPFA 2CXEA 3E0IA 1Q7ZA 1OM0A 1HGYA 4NZFA 2B7NA 1XKJA 8TIMA 1LRNA 2UWFA 1OIFA 3NQCA 3K8LA 3KX6A 4HJWA 4U5IA 5EY5A 4RZ6A 3M41A 5J5DA 2ZZ7A 4PMUA 5T91A 2CHOA 3CAQA 4X2PA 1ONXA 1D7FA 1MW0A 4LAUA 1B57A 5I3FA 4IP4A 5H2ZA 3W87A 3EMQA 3VFLA 3R13A 2B7OA 4EXBA 2G3NA 1AH3A 4NT0A 3UCCA 2QCFA 3RHGA 1EGZA 1UOZA 2J7FA 3GU9A 1FH9A 3MUY1 1NARA 5HWMA 3KUMA 2WJFA 1XD1A 1MW1A 1LG1A 3LSCA 2QJJA 3P67A 4X0VA 3NVDA 5HBFA 4ICCX 1H63A 2CKSA 4GQGA 2OQLA 2WPBA 2E6AA 3AIWA 3WLNA 2BY3A 3PWGA 4FPSA 3S0CA 3H4WA 2OEKA 3ITGA 3C2VA 5H8PA 3UF9A 4I5UA 4FB7A 3QQ0A 1SPQA 4DJFA 4MZ1A 1WDPA 4XO7A 3EWWA 4FIQA 1JPIA 3DI0A 4DJDD 4LEQA 1XLMA 3RJYA 1QCWA 1PCWA 1VIZA 3T1GA 3HIJA 4UTKA 3CV1A 1ZJHA 3CTTA 3G8RA 4LCSA 3T0CA 1WE5A 2NZLA 3V16A 4LEFA 2OYKA 3N9RA 1QR7A 3N15A 3H2MA 3L5AA 2OWXA 3PULA 2G3JA 1H2JA 2V63A 4XZIA 4O19A 2VZVA 2DQXA 5LIWX 4XV0A 1ALDA 2HWGA 2J25A 3UXLA 4HMEA 1BGAA 2J62A 1PDYA 5EU9A 2I7GA 4NU7A 3KZPA 2D2HA 3EDJA 3GO2A 4JTJA 3FEQA 1TCMA 3HGJA 1UD4A 3NDYA 3R2GA 1DP0A 1I45A 1Q85A 3EWCA 2CFFA 4UMAA 3LCFA 4HU8A 3VZZA 3SCTA 4CN4A 1B4EA 4L4OA 1EXPA 2ZZ4A 1V6XA 3B9NA 1V02A 3NA8A 2J7BA 2H6RA 3UJFA 2X16A 3B8UA 3CZ8A 3RPDA 4ADSA 3K30A 3F4WA 4GPNA 3GIYA 1B30A 1H41A 4DQWA 1XYMA 4UMCA 2WCAA 4N6FA 2QDEA 4F0KA 2BGSA 4PUJA 2OELA 3GNPA 3ZMRA 1R46A 1IWBA 3V4BA 4K38A 5A6TC 2GPTA 4K8GA 2VELA 3BV7A 3UFYA 7PTDA 1ODUA 1FXQA 2YBTA 3NG3A 3MTWA 4IP7A 1K8ZA 4OTKA 3S47A 5CSYA 2FGZA 3RO8A 1EO5A 2G37A 4LYQA 3W7RA 1LYXA 1XHGA 3QGKC 4M6UA 3OP2A 2P76A 2VENA 3SRFA 1UR2A 4DBUA 4KEMA 4YCPA 3SURA 5DO8A 3LCWA 2TRSA 3SUWA 4IMAA 2CZVA 4B5XA 1A4LA 3FGCB 3WLQA 1EJWC 1VJIA 1O1ZA 1WX0A 4J4KA 3EXRA 1U30A 1ZUAX 3ZR4A 3WMLA 4A8RA 3ARRA 1OFOA 1I1WA 5A6AA 2H8ZA 4O0KA 4NIRA 2Z2AA 3B8WA 3PG9A 1W2VA 3GIPA 2FJKA 1E6XM 4RK8A 3VGFA 4ZA0A 4JS3A 2C18A 5D2WA 2PU1A 2I1OA 3LPGA 5HR7A 2R1LA 4FLQA 5AHMA 3LK6A 2ZE3A 1XLFA 1C91A 4D2JA 3RAOA 5LA0A 1ISZA 3NQFA 4H9VA 4C65A 4JTUA 3D46A 5DY3A 1RP8A 4M7SA 1BF6A 1T8XA 3ONCA 1S1PA 4U5KA 1E71M 1CECA 4TVDA 4CVUA 1O4UA 4D6IA 3GTXA 2J7GA 2ISVA 4MLRA 5GPRA 1TV8A 3OG3A 4HGXA 3EAUA 1JEZA 3WMBA 1W1B1 1J18A 2C15A 3BL3A 3ITTA 1JUBA 3KTXA 1UKOA 4W4QA 1XXXA 1UUOA 1JJKA 4GO8A 4NZ1A 1SO3A 4JR5A 1QPKA 2VFIA 2XINA 3BLKA 4GVFA 2PUZA 2UY2A 1P6CA 3EXSA 1A5SA 1DWFM 3H7VA 2OGYA 3GNXA 1QPRA 4DI9A 2PI6A 3LMZA 3V7PA 5RUBA 1LCOA 2D3NA 4PUMA 1JZ3A 4EK7A 3DFQA 4MSSA 3PN8A 4FNTA 4WQ6A 1HKIA 1VBHA 3L0GA 1AG1O 2OEJA 2OSWA 5J5RA 2DPEA 3TW9A 1MZRA 4CCZA 3QKZA 3N14A 4XD3A 3HGRA 1IT7A 4UUIA 4O12A 1QDSA 3LZ3A 1YTDA 3M5YA 4FLRA 3CGTA 2R6OA 3N3TA 1XP3A 3ZVIA 2YZRA 2PGFA 3FHQA 3DFSA 3QVQA 1LOSA 2WKJA 5JU6A 3P81A 2F2HA 3SN4A 2ESCA 2KAUC 4ML9A 3EB4A 2VKZG 3MDWA 3RU8X 4UNKA 2F8QA 2WLYA 5CZKA 5I7GA 5FJJA 2W66A 2WMJA 4BR1A 3CZEA 2G3MA 3ICJA 2IXUA 4GZIA 3WDJA 4PFMA 4QGCA 1ZCOA 3BLIA 3G6LA 4GOAA 4E3VA 1JF5A 2OODA 4XZ9A 3N17A 4S2BA 1KFJA 5ABFB 1TRDA 3HG4A 2FZDA 1RALA 2AOSA 4WJXA 3LZ5A 4Y9AA 1DWGM 2PDUA 4NG3A 2ZWYA 2WWDA 4WD0A 1L6YA 3DFHA 4GXMA 4LUSA 1MFVA 2A3AA 1EOMA 1RJQA 4UCGA 3E1F1 3DDMA 4HCDA 3VDCA 1PIGA 3LX9A 1UW9A 4XG1A 1TWWA 1W91A 1DTUA 4FXSA 2AMXA 4JDBA 2D0FA 1FFRA 3W00A 3T81A 1EHAA 3L4TA 5DN1A 2E28A 3ZWTA 1EF3A 3UWWA 4N9CA 1Q63A 4Z2KA 3MP3A 2PD9A 3EKLA 7CGTA 2GUYA 4Q4SA 1A5BA 3SAZA 1C3FA 1TJ1A 3T4CA 1K4GA 4GCXA 3U4AA 3WD0A 3TSBA 3GNOA 3V18A 2JFEX 4L6DA 2NVAA 3ANVA 4W86A 3NQEA 2P0IA 3DHPA 3G0SA 4M6QA 2ZCGA 5ABGA 2Y0FA 2XIQA 1H51A 2Q01A 4RZ4A 3SCPA 1E6RA 4H8NA 1CGUA 3W1PA 1YE4A 2W9MA 4UTWA 4HMNA 1TTIA 3N12A 1HQTA 4TX9A 4GVIA 4N9EA 1TMQA 3PM6A 2YLAA 2OQHA 2PDJA 3MANA 5E0FA 2G8ZA 1NOUA 3L0NA 3PBUA 4ORMA 1UH3A 2GK1B 1ZP4A 1FOBA 5BU9A 1M3UA 5BXPA 1YDOA 1SJDA 2C0HA 3OGSA 3RF9A 1TPFA 3RMJA 2V68A 3TAOA 3W0KA 4ALDA 1NQKA 1UR1A 3CHDA 4MYAA 1VRXA 2GUBA 3CUXA 3LHUA 2PBGA 3M6YA 1LUCA 5EMUA 4URIA 4MJZA 3OJGA 3JRKA 1OZQA 4H6RA 4IL2A 3VAVA 3WENA 3BQ5A 3WBYA 4W89A 1IIHA 3I65A 1WB0A 4ZQRA 1GKPA 2WM1A 4KFPA 3G8EA 1X38A 4B15A 4KBXA 1JDDA 2IUZA 3A9IA 3BH4A 3CAWA 2DT2A 4JTLA 3NURA 1T99A 2C71A 3TMLA 4JTAA 2ZKMX 1XI3A 3GY1A 4B9ZA 4XWUA 4QRNA 1NDWA 1US2A 2VVSA 5TF0A 4MKSA 1E51A 5D02A 4JHMA 4CN1A 2ZUTA 3IIXA 5HAOA 1T41A 2JE8A 4YHEA 4E3TA 3I6TA 4EWND 4HCHA 4CD4A 1EB3A 5G5IA 1W5OA 3CUZA 2HXUA 4LF1A 1RZMA 2PF0A 2UV8G 2CBUA 2E1DA 3TFCA 3P60A 4PB4A 4KGLA 1V0NA 4NVTA 2H3DA 4OZOA 2QR6A 1R0MA 1JL8A 1UP0A 2G50A 3HPXA 4C6JA 2J75A 4PCSA 2NXIA 1C9DA 3LU2A 3ORWA 2ACRA 3P8IA 4UTTA 5BMWA 3TYZA 4CQBA 3HG2A 1Q6EA 3KFTA 5IFPA 3OZOA 2VGGA 1K03A 4PCTA 4AG0A 1PJ9A 1UIOA 3DN5A 3E49A 5CJNA 1YDNA 4NJGA 4DUWA 4HYRA 1N7KA 2Y5EA 4ZOAA 4ZFMA 1OFRA 3EWDA