3O6CA

Pyridoxal phosphate biosynthetic protein pdxj from campylobacter jejuni
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
NAMLLGVNIDHIAVLRQARMVNDPDLLEAAFIVARHGDQITLHVREDRRHAQDFDLENIIKFCKSPVNLECALNDEILNLALKLKPHRVTLVPEKREELTTEGGLCLNHAKLKQSIEKLQNANIEVSLFINPSLEDIEKSKILKAQFIELHTGHYANLHNALFSNISHTAFALKELDQDKKTLQAQFEKELQNLELCAKKGLELGLKVAAGHGLNYKNVKPVVKIKEICELNIGQSIVARSVFTGLQNAILEMKELIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxine 5'-phosphate synthase
publication title Pyridoxal phosphate biosynthetic protein PdxJ from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 100
structure length 259
sequence length 259
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o6cA00
3EX4A 4JD4A 3TR2A 3GDLA 3HGRA 4GBUA 2J9ZA 4NUWA 3QFEA 3BW3A 1SSGA 1RVGA 2NZLA 3PG9A 1L9WA 3BW2A 4CLMA 4ZQOA 4DXVA 5AC7A 4JN6A 4JGDA 4LY8A 1CI1A 4JX4A 3G1VA 3LM7A 1N7KA 1C8VA 1JCMP 3DXIA 4FNQA 3PBUA 3DH7A 1LORA 6ALDA 4LVBA 1TPEA 5TQLA 3MP5A 3GX9A 1K3UA 3NQGA 2ZZ2A 1TREA 1GTEA 1DKWA 1SZEA 2V5LA 4M19A 3TW6A 2EF9A 3MHUA 4Q33A 3TFXA 3TA6A 4ZL1A 1VCVA 5F2IA 3ZFHA 3GYEA 2JKAA 3NZRA 3S42A 4N4PA 3TSMA 3NM3A 4O54A 1K8XA 3R2GA 3W2NA 4AWTA 3IVSA 1R30A 1IXQA 5IBXC 3W9ZA 2FQIA 4ALDA 3OA3A 2HSAA 3LHUA 1DQXA 2V5BA 4IPJA 1JR1A 1RZMA 2W0UA 5CPMA 3NL3A 5D04C 2PC4A 4MY9A 3BLFA 3WK0A 1HUVA 1TYGA 4UTKA 1VYRA 3W1XA 2Z6IA 3W22A 2HMCA 5HWJA 1H7XA 5G5IA 3W7CA 4ZZ9A 1RR2A 3IVTA 4JX5A 3S1XA 5SWUA 3GDMA 1PCKA 3DFPA 1SW3A 3Q94A 5AHMA 1JRBA 1G4EA 3GR7A 3C8FA 3W7MA 4JIPA 5D2XA 2J24A 5D38A 4FF7A 3EX1A 5HINA 2I1OA 3W73A 1I2PA 5AC8A 1KBIA 1HO4A 5AYYA 1LCOA 4IUOA 1YYAA 1FWTA 1Q3NA 2CLIA 1OX4B 2O7QA 2CW6A 1KTNA 4JTTA 1QCWA 1KA9F 4HIBA 5I3HA 3NNTA 3FIGA 3W1AA 3UZJA 2CZFA 4N02A 5E0KA 1NVMA 1F6KA 4N9CA 4Y96A 1FY6A 2NWSA 2RKXA 5K3VA 1THFD 2YDAA 1JJKA 4NJJA 4U28A 3O05A 3S5OA 3QW4B 1OF8A 1ME7A 1DVJA 2FFCA 3LRKA 3HG3A 3ABRA 4LT9A 2CLLA 4JR5A 3A23A 3HBLA 3S0CA 5CZTA 3H55A 1MSSA 5DBTA 3S5ZA 3W70A 3PF3A 4ZVJA 4LUJA 2BWGA 1U83A 4MPQA 4E2BA 3TAOA 3LXBA 4M7TA 1EWEA 3WJZA 2ZTKA 2V81A 1VYSX 3EXTA 5K2ZA 4RX0A 2A1YA 1R47A 3G1DA 2P1FA 4OV9A 4D2JA 3BG5A 3LTYA 3MWAA 5KZDA 3C2VA 5LNUA 1C29A 1SZNA 3W75A 2DZXA 3DENA 4R33A 1AW1A 1HTIA 4CNNA 1YXYA 1QOQA 2QCFA 1OABA 2XN0A 1S5WA 1SO5A 1FXQA 3ATYA 2OT1A 5F1VA 3SGZA 3S1WA 2ZRUA 3HF3A 2WOQA 4YCPA 4O17A 1TV8A 2H6RA 3U6WA 2QUUA 2Z6JA 3EKLA 1MEIA 2R94A 3A21A 1ONRA 5DCDA 5F2LA 2Z1BA 3DAQA 3LCGA 1LRNA 1TRIA 1OFRA 3LV5A 4O8RA 1W5PA 2EHHA 5HR6A 1KFBA 1KFEA 2NXIA 3GK0A 4N2YA 3FEMA 2QDHA 1W5OA 3SSJA 5F1UA 1G7VA 2TRSA 1Q6LA 2E77A 3EXSA 1KFCA 1SO6A 5H91A 2Q8ZA 3PB0A 2ZFAA 2D73A 3UWVA 2ZTJA 3NQVA 4CCCA 3NQFA 4UMBA 5FEWA 2YFNA 3MHGA 3UZ5A 3G22A 4RK8A 4O57A 2G95A 4Z1CA 4A22A 5C2XA 1TB3A 3PR2A 4BWLA 4KWWA 4UTMA 2DZPA 5D02A 2FB3A 5HULA 2F84A 2V2CA 3OVRA 2OMAA 2NLIA 1GJPA 3STEA 4FNTA 4ZQPA 1W5MA 5AYZA 2BX7A 3LDVA 1QPQA 1WOAA 5CG7A 2NXGA 2VC6A 2QDGA 2B7PA 1U5JA 5HQEA 4AHOA 4DBDA 2ZRYA 4U4MA 4HSNA 4K37A 1W8SA 3GB6A 2ATSA 1TSIA 3KAOA 1L6SA 5FI8A 3UWQA 3G1FA 3ABOA 2WPBA 3M16A 1GT8A 2QUTA 3P81A 3A22A 4A29A 3IVUA 4YLWA 2UV8G 2V2HA 3N3MA 1ZALA 4MLJA 1AW2A 4CQ8A 4XUGA 5TIMA 3W1MA 1H1YA 3TQKA 4OE7A 2GQ8A 4Z08A 3WFAA 4DQWA 3NQ6A 2YPIA 3LCHA 3USBA 1FWRA 1PIIA 4WXYA 4MUZA 3BK0A 1K7FA 2CZ5A 1UCWA 3W7KA 1RD5A 1W3NA 3PAJA 3QSRA 3THAA 3P62A 3LI1A 4UTWC 2ISSA 4HPJA 2QCHA 5L9FA 5CZSA 4MY1A 4OGZA 4JTUA 3PY2A 7TIMA 1LRTA 3O1NA 3DFTA 3M0ZA 4FX8A 4NX0A 2Y70A 3T7VA 2BZNA 3IGXA 4FXRA 2G97A 4O14A 3UPBA 2GVLA 2WSRA 2ZZ1A 5K9CA 4FXSA 3TIMA 1W37A 4M6VA 3IIZA 4JIQA 4FIRA 5AHLA 1NF7A 1FUYA 1UB3A 1I2OA 1KM5A 4L4MA 4ZQMA 5AOUA 4ADUA 1LP6A 2Y6ZA 3SR7A 1SPQA 4UFKA 5CPOA 3W7PA 1ZFJA 1G4TA 3KXQA 4OV4A 3F1QA 4QQ3A 4XQ6A 5D09A 4LS1A 1B4EA 4X3ZA 5D2TA 4BI5A 4FNSA 2VEMA 5FF2A 3P84A 3NAVA 2ZA3A 3NL2A 4K36A 1H1ZA 5FF0A 4XZ9A 5FEZA 1GVQA 2F7FA 4LVGA 1X1ZA 3C4UA 2Y61A 2ZZ3A 2X1RA 4R53A 1W31A 4NNBA 1RQBA 2QUVA 2E1DA 2CWNA 4GUHA 3FS2A 4DEFA 1X1OA 3S1UA 2VFIA 3HPZA 3LBMA 1CW2A 4JTJA 4LC6A 1SW0A 5K9DA 3MUXA 3O16A 4UMCA 4AHQA 1JVNA 3RFAA 1I2RA 2LLEA 3I65A 3TSDA 3LXCA 3IGSA 2YFOA 4QNWA 4UFHA 1KV5A 3P5ZA 3ZS4A 4A3UA 4O52A 3PM6A 2C19A 1S5TA 2ZRZA 2QCEA 4YL2A 2NXHA 4DO4A 1JCLA 2B7QA 5LNSA 3NPXA 1K02A 3PSWA 2O7SA 5HUOA 3E12A 3IIVA 1B57A 1L2UA 2ABBA 4JTFA 3TROA 2TYSA 2Y88A 4AEOA 1BWKA 3P61A 3QQ0A 2ZZ7A 4MZ1A 1M5WA 3OBKA 4UNKA 2NUYA 2DORA 2DJXA 1TV7A 2FDSA 3B04A 1W3TA 3STFA 3W23A 1SZGA 1BTMA 4MJMA 1Q6OA 2QCDB 2YSWA 3SY5A 4RLIA 2J88A 3QQ1A 1OFAA 4Y9AA 4O0ZA 4C1LA 1DOSA 2EPHA 3CTLA 4KFOA 2PCQA 3UY7A 3OVQA 3TNOA 1DJNA 1KLZA 1GPWA 3A5VA 4A2RA 3W2JA 1F6PA 4NU7A 1UASA 1TPVA 3HB9A 3CIWA 4JNMA 4N9BA 2C16A 1PL9A 4LVAA 2R91A 3W2KA 2JKEA 5AHNA 3W87A 1KV8A 5D2VA 4Q4KA 2ALDA 4RXGA 3FFSA 4LS2A 5K9XA 4LC8A 5MHBA 4FX6M 3G3MA 1XUZA 4JX6A 3CEUA 2VENA 2VFFA 5AFDA 1VPXA 2GJLA 3Q37A 1SUXA 3QRHA 4O16A 4JYEA 4AWUA 5KMYA 1E51A 3W7EA 5DY3A 2FPYA 3A9IA 1VHNA 5T26A 3N19B 1PE1A 3OVPA 2DP3A 2AGKA 2VFEA 3QEZA 5BMWA 1P0KA 2A0NA 4NXKA 3NOEA 2VXNA 2Q8LA 1F7BA 3T78A 1C9DA 5G1YA 1DL3A 3INPA 3MYOA 4UTTA 1VR6A 3RLUA 1HG3A 5DCEA 3G24A 3MO7A 2R14A 2Y7DA 5F4SA 1T8XA 1QO5A 5EBUA 3W85A 2FIQA 2QAPA 1F05A 2ISWA 1PHQA 4MYXA 2X2GA 1JCJA 4O1AA 3GKFA 3P7YA 3W2LA 1L6YA 1LRQA 2X16A 4PA8A 2QJHA 5AYXA 4X9SA 4O12A 5F4XA 2ISVA 3CU2A 4UUIA 1ZENA 3C6CA 3EEGA 4XTDA 4FX7A 3F4WA 3M41A 3C61A 3M1ZA 4UTUA 3KRZA 1XBZA 3E49A 2E6DA 1P5BA 2H90A 2YXGA 3TCEA 1NAL1 4YMZA 2HS6A 4WX2A 3CPRA 1HFBA 2E5BA 1I2QA 5BMXA 3HGSA 4GUFA 4ZQCA 2DJLA 1FDZA 4JXCA 3M7WA 4GFSA 4LRTA 1K8YA 1EEPA 3NQCA 4BI7A 3GDTA 3N14A 3NQAA 3CLMA 3BLEA 1G69A 3U8GA 3LTSA 4IOTA 4B5NA 1OYCA 4P2VA 3RK8A 1YXCA 2YGYA 4E38A 2VKZG 4K39A 5LSMA 3DKLA 3GNDA 3VNDA 3TX9A 1IXOA 3FYOA 4JEQA 4MYAA 3LV6A 3I7SA 4IXXA 4UFMA 2X1SA 3S8HA 1QPRA 2CLOA 4BWLC 3NQEA 1KLYA 5CSRA 3L5LA 1TPDA 3KOFA 3SZ8A 2QCCA 3NQ2A 1K03A 4UFLA 4HNNA 5A5WA 5K7JA 2OJPA 8TIMA 1VLWA 3M44A 3LI0A 4AXKA 1OFDA 3CWNA 4KFNA 3W72A 2A6NA 1LROA 3STGA 1XFBA 4UMAA 2W6RA 4YXGA 1KBJA 4OHQA 2E6YA 1S5VA 1ICSA 4KKXA 4UCGA 1H7PA 2DZUA 1X6UA 3LCXA 4UNLA 1G4PA 5EKYA 3TE9A 5FF3A 1LOSA 4IX2A 3HG2A 1W54A 1TCDA 3SGUA 1G67A 2AAMA 4CQ9A 4AWSA 3EX2A 2RH9A 3LRMA 2Z2UA 3QMTA 4HN4A 5U4NA 2GUUA 3LCIA 3OIXA 2RFGA 3H54A 2ZQ0A 1KM4A 4PC8A 2NV2A 4WY0B 4PEKA 3PVFA 3I7RA 2RHGA 1ICPA 1W3IA 1G6CA 4MFDA 3QZEA 5DCBA 4Z1BA 1TPUA 3PUOA 5G1TA 2HTMA 3TV8A 2JGQA 3TJXA 1O4UA 3YPIA 1ZAHA 5CPNA 5AB3A 3WJSA 3R5EA 1LLWA 1DHPA 2WNNA 1DORA 4M5PA 1K8ZA 3EX6A 4O15A 5HWNA 2NWRA 3EX3A 1YTEA 2FPTA 1J5TA 3G1AA 4LUIA 4HNVA 3EWWA 3SJ3A 3QMRA 1YDNA 3BG3A 4TR9A 5K4XA 5EPDA 3VFLA 3U2OA 4XKYA 1TMHA 4RZ5A 1FQ0A 1XCFA 5AHEA 3DFOA 3P5YA 1CX9A 1VCFA 3W7HA 4IJBA 4EWND 3GNNA 1UBSA 4NZFA 3WJWA 1YADA 2RDTA 3UY8A 3V75A 5BOOA 4YWIA 3W76A 1K7XA 4QSHA 3MW7A 3FJLA 4PODA 3TMQA 1EP3A 2C1HA 1QFEA 4CQAA 3E96A 4FNPA 4IX0A 5HR7A 4S2BA 5KSWA 4I9AA 5FESA 1P1XA 2DU2A 2P0OA 1ALDA 1HO1A 3TUUA 3GXPA 4JTLA 4MVAA 4UTIA 3R8RA 1QNVA 3QM3A 1VHCA 4O10A 4ZQNA 5HNRA 3MJYA 3HGJA 2QAFA 3KVKA 1JRCA 3NQ7A 5C54A 4RZ4A 3M47A 2EAWA 1OVDA 2CU0A 4MKNA 3BGJA 3O07A 3PSVA 3KVJA 3LLFA 1VYPX 4DF1A 1VGAA 1TTJA 2JBMA 5BRBA 1FCQA 5LGXA 1Q45A 1YXDA 2C14A 1KM6A 3W86A 3T4CA 4PCFA 3LHYA 2B0MA 3DU0A 3RMJA 1WBJA 1FWNA 3B03A 1RQHA 4FNRA 3STCA 3N2XA 4MFEA 1F5ZA 4IQLA 3HOJA 1FX6A 5LKYA 3KVMA 1V5XA 3N73A 3L9CA 3W1QA 4JTHA 3ABQA 5D05A 2QF7A 1SO4A 3SIZA 4UTHA 4I7UA 1XDMA 4HPXA 1I4NA 4AF0B 5IM51 4CCEA 3BV4A 1SR9A 4MZYA 4WY0F 1F76A 3PBWA 3G0SA 1R46A 3SECA 4NJHA 1D9EA 1JUKA 1KM2A 1OF6A 3M5YA 5AHIA 3T55A 4QITA 1P0NA 1FBAA 2FB2A 5CPLA 1M7PA 3NEVA 2Q3OA 4PTNA 5CGQA 2Y89A 3NGJA 5IBXA 1V7YA 3MBDA 1SFLA 3W74A 3EWZA 4WQ6A 3G1XA 4QM1A 3KRUA 3CC1A 3MMTA 5E1QA 3EWBX 3P67A 4JY9A 1VLIA 4HKPA 3G1SA 4ZQRA 2C18A 3GVGA 2A85A 4A21A 2PURA 3W84A 1WDWA 3BG9A 5G2WA 4M6QA 1SSDA 4GUGA 4NNAA 3NG3A 1VS1A 3IIOA 1F73A 4UIOA 4Y8FA 1Q6RA 5G4EA 4R7JA 3UQNA 3SI9A 1H61A 1H62A 2H3BA 1GVRA 1N8FA 1TRDA 3B4UA 3DFSA 4JTIA 4IMGA 3S5YA 1VQTA 3UNDA 4BK9A 2YCEA 3FYPA 3VI2A 5FF7A 1WOBA 2Z0IA 3O6YX 3TW7A 1ZNNA 2WSQA 5FEPA 3QH2A 3UD6A 1EA0A 3G8RA 2J9XA 1EWDA 1DQWA 4TMCA 1LYXA 2C0AA 5F4WA 1OX4A 3M6YA 4MIMA 3R13A 1BWLA 4JYDA 3LHWA 1T0OA 3LCWA 3LRLA 4NJIA 1TPFA 3LX9A 3ANYA 1Z44A 2J9YA 3N2MA 1QPOA 2Q3RA 5G4WA 4O4VA 3NDOA 4XTIA 1OK4A 3LB0A 1MO0A 2YR1A 1M6JA 1QWGA 3RU6A 3TXZA 1FWSA 3N9RA 1QAPA 1ZJIA 3EB2A 3E9AA 4P61A 3CEPA 3GXNA 4IMDA 2PRLA 1RPXA 4EIVA 1J4EA 2WNZA 3W1UA 2OCZA 3ZWTA 4E2DA 4JY8A 4DO5A 5L6UA 5BNKA 1GYNA 1JCNA 1YDOA 4I7VA 4UTLA 3MBFA 4X2RA 3NQ8A 1QO2A 2FTPA 3MI3A 2I9EA 4IPIA 3DKJA 4WJEA 4ORMA 3DFNA 5D2YA 3PUEA 3PBYA 2Y62A 4HSOA 3C2FA 4BR1A 2PRHA 2A2IA 3NXFA 1NF0A 5DXYA 2QCLA 4ZMGA 1AW5A 1IIGA 5AN7A 2E6AA 3JRKA 4O0KA 4O11A 3B0VC 1KM3A 3EWXA 1NEYA 4OBTA 4ORIA 1A5AA 3KHJA 1F2JA 2FJKA 3DBPA 1KFKA 2CZDA 4OQVA 3NZ1A 5A8GA 2A7NA 4GC4A 1FWWA 1HL2A 2DZVA 1KW1A 1SZFA 4AVFA 2ZZ4A 2ATMA 4DPQA 3W7IA 3M9YA 2GQAA 2YYUA 3W88A 4UC5A 5D33A 4OU1A 3WK2A 3L68A 1YLVA 2VEKA 3UWUA 3IGUA 4GE8A 3FOKA 2NUXA 1XDLA 1A5BA 2TMDA 1R2RA 1TPC1 5DY2A 3MHFA 1X7FA 5D30A 5CZ0A 1WAUA 3T44A 5LNWA 1G4SA 2PE4A 3NVTA 2NX3A 3FKKA 2W79A 4GNJA 2CLHA 5AC6A 1OFEA 1ZHAA 3TC6A 3NQDA 3PS7A 1EP1A 4IXHA 2NUWA 4IGHA 2YW3A 3L5MA 3C2EA 4QNEA 1BEUA 1YTKA 1O94A 1EIXA 1GQNA 4DELA 4Y6GA 1GWJA 3TFCA 4LS0A 4I7WA 2VFDA 4NQ1A 3TXVA 1JCXA 3D0CA 1EUNA 5DBUA 4WXZA 4JDBA 1XUUA 2CLKA 1EUAA 4IMCA 1JQXA 2CLMA 3LTPA 4CNOA 3WJYA 1GZGA 4Q32A 4X22A 1W1ZA 2H8ZA 1DBTA 3W3OA 5LZLA 1VCGA 3C2OA 2ZYFA 2ZDRA 5HUPA 5LHEA 4GUJA 3W7GA 3K30A 3KX6A 2E5CA 3HMJG 3W1TA 2BSLA 1MEWA 1LTDA 3GDKA 2V0TA 3KRSA 1IIHA 4A2SA 4LU0A 1QMLA 3Q2DA 1ZCOA 4AAJA 1GG1A 1PVNA 4WOZA 1GTHA 1GOXA 1SQ7A 3NL5A 1LM1A 1W5QA 1O60A 4JTEA 4JS3A 4N4QA 5KTLA 2V8ZA 2WSYA 3HPSA 1PHWA 3W7OA 3WK3A 1VZWA 2NX1A 4L4LA 1H50A 3L67A 3L66A 3ATZA 1OJXA 1R2SA 1OFPA 1GYLA 3OG3A 1EP2A 3PB2A 3HQ1A 4UXDA 3BVJA 4XBSA 4NX5A 4EOUA 3I7QA 4JTGA 2JK2A 3TC7A 1A5CA 3E0IA 4N9EA 1EB3A 3MP3A 5G2IA 3DHFA 4RZ6A 2ZRXA 3LHTA 3S6DA 4PFMA 5LNRA 1XKYA 2ZA1A 3O15A 3UWYA 1LBMA 1RV8A 4LW7A 1JUEA 5KITA 3M43A 1ME9A 1Z48A 3TJLA 1SFJA 1DJQA 2E09A 1K7EA 5EYWA 1FCUA 4PL2A 3CHVA 1ICQA 1Z41A 2DZTA 5CZJA 1EX5A 3W7JA 5C5YA 4Z1DA 1AL7A 3TMLA 2GJNA 4NXSA 3FKRA 3ELFA 3ABSA 2ZZ6A 4LWWA 2ZRVA 1QPNA 5EL1A 3GZ3A 4MJZA 4IWWA 4JYFA 3W71A 4O1DA 1J2WA 2C13A 4K6AA 2YZRA 3L0KA 3TKFA 5DXXA 5AHFA 4ADTA 3W07A 1XC4A 2QR6A 4WOQA 3MI2A 4K7YA 3ZR4A 2E68A 1DV7A 1H5YA 1IXNA 2E5DA 3O6CA 3LOTA 1PS9A 1PV8A 4UR8A 3UYCA 2QCGA 1AK5A 3G0XA 1OK6A 1A50A 5G2HA 5I3FA 4LV9A 1S3HA 1YTDA 1ZAIA 2Y7FA 1SO3A 2A6LA 4FHAA 4FO4A 3NM1A 4JTKA 1BKSA 3GAKA 4IMFA 2DZSA 3O63A 3L5AA 3QPYA 3A5FA 1IXPA 3TDFA 3VE7A 3EWYA 3S9YA 3V1PA 1KFLA 3GDRA 1N55A 5F2GA 3HG5A 4AB4A 3PG8A 4DF2A 2TSYA 4R34A 1TTPA 4BF9A 3RLVA 5LHFA 3UPWA 4NT0A 5D03A 3F4NA 4N6EA 2C6QA 1IGSA 4QISA 2WO5A 2QCDA 2FPVA 3G8EA 2QCMA 4KWVA 4G1KA 2Y63A 5EY5A 1ZAJA 3N34A 3LLDA 4YCOA 4NZJA 3G0UA 3O06A 2QEZA 1LOQA 2CZEA 1TJRA 3S1VA 3KVLA 6TIMA 3NPWA 3SW6A 1XI3A 3CIXA 3PUDA 2RDUA 4AHPA 4TIMA 2HS8A 4ONVA 4HT3A 3EKZA 1AG1O 2XN1A 3GLCA 1P4CA 3UWWA 2VEIA 1W56A 3W7DA 1QOPA 4DPPA 3Q58A 3QSTA 1JULA 2VFGA 4TMBA 4K7VA 3G3DA 5U7SA 1OHLA 1F74A 4MOZA 5KINA 2I14A 5TBOA 4LVDA 3G1YA 3E02A 3QYQA 2E6FA 3NYZA 2ZZ5A 1B4KA 4M7SA 3GXTA 3W1NA 4Z0SA 2CLEA 4WUIA 2EGZA 2A7RA 2WQPA 3TAKA 4O13A 5CSSA 5I3JA 3DI0A 3CQ0A 2GPTA 2G5WA 3VE9A 4EF9A 2V82A 3P60A 4UR7A 3GIYA 2EKCA 3NPVA 2XN2A 4RXFA 2DZWA 1QR7A 4K8HA 3GAYA 1WXJA 4Y90A 4CNPA 3P74A 4H6KA 2B7NA 2FLIA 4MY8A 1NFBA 1TTIA 3PWAA 4LVFA 4W9TA 3UXDA 3VKJA 3W2UA 4POCA 1OFBA 3L65A 3I68A 5D37A 1T99A 2VOMA 3F03K 1D3GA 3QF0A 2RDWA 4O19A 4WD0A 3W1RA 3S5NA 1OG0A 4RR4A 5ABTA 4TU1A 4OT7A 4EF8A 4RJEA 3TH6A 3H53A 4XWUA 4Z1AA 3I6RA 3QJAA 4UFJA 4N6FA 2V9DA 4S1FA 4OWGA 4LNYA 4LOCA 1ZY9A 1H7OA 3B05A 3B0PA 4QIUA 5DLCA 2A4AA 4KFPA 1ADOA 4LV4A 3GR8A 4EVZA 3QC3A 3JR2A 2WV8A 2G96A 4BFAA 3DZ1A 3BW4A 3LCFA 4O4WA 5HMSA 3B0UX 1NSJA 4RCXA 1A53A 1YPIA 1TV5A 5D32A 2ZBTA 5C55A 2OX1A 1LZOA 3W7NA 1TTQA 3LERA 3L0NA 3W6YA 4K38A 5HWMA 5LNVA 3FLUA 1KTBA 2R8WA 4ML9A 3QPZA 4GXMA 3WJXA 1PCWA 3NA8A 1I8JA 1G7UA 5HJLA 5KZEA 1GVSA 1LBFA 4E0CA 3W83A 2X1TA 5DN1A 1MZHA 3PULA 3IIXA 4TX9A 4O28A 1XXXA 4UTTC 5I3IA 4K8EA 2H8XA 1TJPA 4QAIA 3BO9A 3HG4A 4LTSA 2NV1A 2BLEA 3NPUA 3BPWA 1O5KA 2JGYA 3FJ6A 2V30A 3W1PA 2WJZA 4Z0JA 1TPH1 2A21A 1I45A 3FA5A 4UFIA 1T96A 2GVGA 3T40A 1L6WA 1VC4A 3W2MA 4WY0A 1ME8A 2H3DA 2P10A 4O18A 3GKAA 1TO3A 3KFTA 1FCVA 3UWZA 2QJIA 5LGZA 1UJPA 2ZRWA 3L0GA 1JQVA 1M7OA 5CKSA 3HIJA 3M5XA 3C56A 1LLZA 4GUIA 4RV8A 2Y7EA 1XL9A 4M6PA 4AH7A 1JUBA 2B7OA 2OZ0A 3P82A 4BI6A 3B8DA 1I2NA 1VJIA 5KZMA 3IV3A 1YDVA 1D3HA 1XBYA 3HO8A 1AL8A 4UTJA 4JTSA 3C52A 3CWOX 5BW6A 3N9SA 3A24A 1OX6A 4TO8A 2WKJA 3EWUA 4JICA 1VH7A 2QJGA 1GVOA 3TK7A 2X1UA 1W0MA 1KTCA 1OFOA 1LOLA 4NJKA 4C1KA 3G18A 1TPB1 2QKFA 1Q6QA 1XBXA 3W1LA 3R89A 1KM0A 3LXAA 1UUOA 1H7WA 3SFKA 2GVJA 4DF0A 1QDSA 4H4IA 2CLFA 1H60A 5E93A 4O50A 2OT0A 4O53A 1TQJA 4FNUA 4FEZA 5FF4A 4RKAA 1MEHA 4MZ8A 3DGRA 2ZA2A 4H3DA 3C2RA 2B4GA 3MYPA 3NR0A 3LHVA 4QJ1A 1Y0EA 1H7RA 1LDCA 3EXRA 3G1HA 5H2ZA 4DO6A 4N9DA 3TQ0A 4LRSA 3IEBA 4CCDA 1FCBA 2VEPA 3IRDA 4O1CA 3MP4A 3WK1A 3THQA 1OYBA 1B9BA 5GVJA 1XM3A 2J6XA 3NL6A 4GRSA 1O95A 3L21A 2VFHA 1KM1A 5I3KA 3W7QA 1R2TA 4XBKA 4NVTA 2ZCGA 3RNDA 2JKPA 3TQVA 1WQ5A 1SW7A 4HHPA 5DELA 1X8FA 1Z42A 3P8IA 3LHZA 4MLRA 2Y85A 4FB7A 3OHIA 4IMEA 2X30A 3C3NA 3L2IA 2GQ9A 1W5NA 3W7RA 3TSBA 1RQEA 2YX0A 1WX0A 3CM4A 4JDYA 2A7PA 1XBVA 3OEXA 2C3ZA 4XKYB 1WV2A 4S2CA 2XFWA 1AMKA 2BTMA 3HPXA 4AMAA 2CFFA 3C0JA 5C6MA 3BGGA 2WNQA 2V2DA 4AF0A 2Y7GA 4HNUA 1H63A 1O5XA 2GOUA 2PRMA 1JCYA 1VRDA 5F2MA 3P80A 1TQXA 5J5RA 1H51A 5I3GA 2TPSA 2YW4A 4ADSA 3LCLA 3MI6A 3PBVA 5J5DA 3RF9A 3DFQA 5FEXA 3TU9A 1WYIA 1WA3A 3BARA 3DI1A 3CB8A 4PL1A 1FDJA 1TPWA 3LGEA 4NNCA 2BXVA 4GJ1A 3AO0A 1FXPA 1ML1A 1OYAA 1A5SA 1B3OA 4HNTA 2KZHA 3JS3A 4PH6A 4ICNA 1MXSA 4GWEA 4O1BA 3PC0A 1GVFA 4NJGA 3NO5A 5EMUA 2VELA 3O8AA 2QCNA 3M5ZA 2J27A 2A5HA 2NX9A 3B06A 4UTWA 1GG0A 1OX5A 2ABAA 1UUMA 1H7NA 3HGOA 3QMSA 1LBLA 4J9JA 3HJZA 1KFJA 3P8JA 3W7LA 3CT7A 3M5VA 3O6DA 3BLIA 1SU5A 4DBEA 3AJXA 3VCRA 4FIQA 1GEQA 3LBCA 2IQTA 3QW3A 1FDYA 2YYTA 3IIPA 5EA9A 5D2WA 2C15A 2AQWA 3R12A 1TIMA 1IF2A 1WBHA 3DHDA 1YPFA 5K4ZA 4WZHA 1OFQA 1EPXA 3NQMA 3ZWSA 3UXAA
chains in the Genus database with same CATH superfamily
1V6VA 3EX4A 2EJAA 3PPGA 4QHRA 3TR2A 4ENLA 4Q4SA 2DSZA 3UVAA 3WFLA 3WNKA 3BW3A 1RVGA 4WSHA 3PG9A 4J7RA 4H83A 3N6JA 3BQ5A 5T9BG 3VOHA 1SYTA 2PA6A 4MWAA 2PDMA 2ZUWA 2IKIA 1JCMP 4LUTA 4CNUA 4LVBA 1TPEA 3QV6A 5TQLA 5MF5A 4JIHA 1QW8A 3TYCA 2OZ3A 1BSLA 3SCUA 1E70M 1TREA 3IUDA 1GTEA 2V5LA 3DEQA 3UBPC 3TW6A 4Q33A 1FFRA 1VCVA 3VCNA 1EGVA 3NZRA 1O12A 2G8ZA 1E4MM 4Z2JA 2XVKA 4BF5A 1PX4A 3L4UA 3R2GA 1EJTC 4AWTA 3IVSA 1IXQA 5IBXC 3W9ZA 2FQIA 4L65A 1MRQA 3OA3A 2HSAA 3MS8A 2XIIA 1RBLA 3ONBA 3VX0A 2V5BA 3UR7A 1X7IA 1F9CA 5D04C 1HJVA 4G7FA 5A6LA 1E6RA 3WH8A 4C60A 1OD0A 5IOBA 1GPFA 1QVBA 4AIEA 4HCDA 3WX7A 1VYRA 1H2JA 3R0DA 1PX3A 4Q8PA 3W7CA 3CH0A 1RR2A 3S1XA 4JX5A 5CC3A 3GDMA 1PEZA 3BICA 4AZ5A 1TR1A 3C8FA 4XSLA 3W7MA 1JDAA 4KQNA 4JAWA 2J24A 4HPHA 5JUVA 3D5HA 3ALGA 2I1OA 4S23A 4KCUA 5LXEA 1KBIA 1LCOA 1E5NA 3IJQA 3W1AA 3UZJA 1JEZA 2CZFA 4N02A 1F6KA 1WZMA 4GQBA 1IR2A 2R82A 3MC5A 3WD2A 2RKXA 1THFD 5I2UA 2IXVA 2Y8VA 2CLLA 1XLCA 4FLOA 1OT2A 2NVAA 1Q2SA 1VFLA 3HBLA 3V5FA 4MKVA 5CZTA 3H55A 4LFYA 3S5ZA 3W70A 3PF3A 4ES4A 3GXIA 1ZU8A 4HMDA 2D3LA 4HZ8A 3WJZA 2ZTKA 3NCOA 1CXHA 4ASTA 2W62A 3ONCA 4JCMA 5K2ZA 2BXYA 4JFVA 2A1YA 3G1DA 4D2JA 1TWIA 3BG5A 3LTYA 3BCDA 2DIEA 2YLAA 3GHRA 3TLQA 1C29A 4BKNA 3BMXA 2JIEA 5CJNA 3IJ7A 2DZXA 4PCTA 1S2TA 4RE0A 2OYLA 4GQGA 1AW1A 4QE5A 1YXYA 4W8BA 2TODA 1NM9A 2QCFA 1OABA 1CXKA 1S5WA 3E2VA 3WF0A 1FXQA 5F1VA 3IAQA 4F2TA 1UR2A 2DV0A 1KGXA 1GCYA 3MZ2A 4YCPA 4O17A 3UNTA 1K4GA 3GYCA 3U6WA 3EKLA 2R94A 3W26A 1A3HA 2E8YA 1IQ8A 3CPUA 1JXJA 2Z1BA 3DAQA 1FP9A 1U5HA 3M0VA 3VDAA 4NASA 4H8UA 4S3GA 1QUMA 2NXIA 1NWUA 3GK0A 4DUXA 3FEMA 2QDHA 1W5OA 1GQIA 2TRSA 1XGZA 3H22A 1HJUA 1Q6LA 2E77A 4LYRA 4DX3A 1SJBA 3S2MA 5A6MA 5E9XA 3UWVA 1PO9A 2J8FA 5FEWA 3PPFA 1PYFA 4RK8A 4GVFA 1HJSA 5C2XA 1TB3A 3KCOA 1KXTA 4KEZA 2OOGA 3AYRA 3O7UA 3RPTA 4H6EA 4Q8VA 4GY0A 2F84A 1V03A 2OMAA 2NLIA 4JHZA 4XVEA 2X0HA 2VOTA 3AYVA 3W25A 4C6FA 3AXHA 3PJTA 3LMZA 5D9PA 2VC6A 2QDGA 3VD9A 4MNLA 2ZRYA 1E0VA 4HCHA 4K37A 1W8SA 2QV5A 5C0QA 5FI8A 4ICMA 2ON3A 1G1YA 1GT8A 1R9ZA 1JD9A 3GNPA 3QR0A 3BC9A 1YBQB 2WNWA 4CQ8A 5TIMA 1H1YA 4Z08A 1VF8A 3L4WA 2YPIA 1PIIA 4INFA 4WXYA 1XX1A 4AMCA 4QQUA 1CGUA 4PMNA 4AD5A 1H11A 5MKGB 1NWTA 4Z2KA 4OGZA 3WQEA 3PY2A 4NYYA 3VUSA 3O1NA 4L4OA 3B9DA 4P7RA 3DFTA 2ZUUA 5B7ZA 2G97A 3P6LA 2WSRA 3G2GA 4WKAA 2ZZ1A 3UA4A 1CEOA 5AHLA 4RL3A 1UB3A 1DWFM 2W92A 1KM5A 4L4MA 5AOUA 1AMYA 1LP6A 3SR7A 1FP8A 1MQQA 3W7PA 1EX1A 1DJZA 3F1QA 4OIFA 4NG3A 4QQ3A 2AKMA 2IPJA 3WG6A 1IZKA 1C8QA 2BOGX 1NFGA 3RO6A 4BI5A 4GLEA 2GSHA 2VEMA 3CUIA 1QNPA 1A5MC 3NL2A 1ZSXA 4MKSA 4LH8A 4F48A 1NWRA 3TYBA 3PZMA 3PZNA 1CB2A 4BCEA 1JYXA 1IEQA 4A05A 2I57A 4GUHA 1XQLA 4PFHA 4Y9PA 1UP3A 4KH2A 1CW2A 5ENLA 4OBSA 1UMYA 3PWGA 4LC6A 3UJ2A 1NY1A 2DEPA 4UMCA 5HA7A 1JVNA 4GY1A 1I2RA 2LLEA 3T8QA 3I65A 3MSGA 1PWLA 4QNWA 4O52A 4YTQA 2CPUA 1QK0A 2QCEA 4DO4A 3DFYA 4GX8A 1OC7A 4ZE5A 4DYEA 4AFYA 2ABBA 3DX5A 4JTFA 1XLBA 1X6NA 3PAOA 4FOUA 3VKBA 3VGBA 1WNOA 1M5WA 3OBKA 1VJZA 2DORA 3MUZ1 3ZMRA 3EPOA 2DJXA 3ARVA 1E72M 2FDSA 4MAZA 3STFA 4YJ5A 3IARA 4MJMA 5IFTA 4Y9NA 3UR8A 2IKHA 3SY5A 2J88A 3L4VA 2YIHA 4O0ZA 2EPHA 3CTLA 1NOFA 3VZXA 4HMEA 5CBIA 2GGIA 3KTXA 2BDQA 1TWSA 4A2RA 1ZBWA 1FRBA 3HJEA 4ZSUA 1TPVA 4P5UA 1UC4A 1M1BA 1PL9A 3KWXA 4LVAA 1V8EA 3TA9A 4Q4KA 2ALDA 3KOYA 4HPGA 4D6EA 3FFSA 1AD4A 1UWQA 5KEZA 1JI2A 4LC8A 1JDEA 4FX6M 2VENA 5AZ1A 1KKOA 5FIPA 3PNZA 4MWAD 2VZUA 2CLPA 3EPNA 5EMKA 4A3QA 3FNDA 4C6LA 3A9IA 1J12A 2A3CA 2VUYA 2VFEA 3QEZA 3AHYA 1F7BA 2BVDA 2OLHA 4JQAA 1Q2RA 1US3A 1UUQA 1KCXA 4V1YA 2CBVA 1V7AA 3T09A 2ZICA 3BZGA 4QE1A 1RJPA 2FIQA 2YL5A 1DTUA 3K1DA 1F05A 4F4RA 4MYXA 1LQAA 3P7YA 4D72A 2PP3A 4E8CA 3T0AA 4X9SA 3CU2A 3EEGA 2G3FA 4XTDA 3F4WA 3KRZA 1XBZA 5EMLA 2E6DA 2AOSA 1P5BA 2H90A 1EJUC 4WX2A 4C6PA 1QNOA 2XH7A 1EHNA 5EB8A 2VGGA 4XBJA 2DJLA 1FDZA 1E6ZA 3M7WA 3IJ6A 2PMQA 4CD8A 4LSBA 3N14A 4V27A 5T91A 3O6AA 4AD3A 1OD8A 3M0XA 1J96A 2X2YA 1YXCA 4E38A 2VKZG 3MTWA 3VNDA 1KNWA 4JEQA 4URIA 1HF6A 1GEHA 4IXXA 3VDBA 4PMQA 3ARTA 4PCPA 5CJMA 4IM4A 1DE5A 2FKPA 2CC0A 4GY7A 4C6JA 2VTFA 3RCMA 4FPSA 3LA4A 2YL6A 1Z3NA 4AXKA 1OFDA 3CWNA 3EKGA 3W72A 4F2UA 4GYPC 1ZS2A 3BLPX 2NT0A 4UMAA 1RXOB 4YXGA 2J7DA 1X6UA 3EOEA 2BY0A 3TE9A 4MPKA 5FF3A 4TOQA 3GWQA 1S46A 1W54A 3WMCA 2PFHA 4CQ9A 3EX2A 4IF2A 4MDOA 3LRMA 2Z2UA 1MNZA 4GCXA 3OIXA 3LSBA 2JIWA 3LPOA 3UG8A 3GO2A 1JZ4A 4H41A 2NV2A 2VWSA 3A9BA 1VBRA 4WY0B 3VOGA 3PVFA 3TLLA 3MKKA 4B2DA 2NV9A 1WKDA 5A1AA 5FSEC 4IP4A 3QGAC 3SRHA 4Z1BA 3PUOA 5G1TA 3UG4A 1ECQA 2EPLX 1WZLA 1RK6A 2DW7A 2JGQA 4J40A 5AB3A 4IH3A 1UPMB 4MJ4A 1K77A 3WJSA 4KIRA 1GHRA 2BBFA 3EX6A 4FLSA 1LQ2A 3EX3A 1WKEA 3ARYA 4NZ5A 3ARWA 7A3HA 4HGXA 2VR5A 2OPJA 4YN5A 2XHYA 4JIIX 4TR9A 5K4XA 3VXGA 1FQ0A 3WNLA 1V0MA 2V3EA 1CX9A 3EB3A 3KBWA 4EWND 3BGAA 3GNNA 1UBSA 3R6IA 8RUCA 3MKVA 2F9RA 2P0IA 4CVUA 3W4RA 2PDGA 4U10A 1AA1B 1BYCA 1K7XA 4QSHA 3UG5A 3GXFA 4ZOAA 5M3WA 4UZSA 1REQB 1XR2A 5JBFA 1U22A 3T08A 3TMQA 1WO2A 1EP3A 1C7SA 4F66A 4HJFA 2HCVA 4L9XA 3LSCA 4I6KA 3GHUA 3K46A 3GXPA 1R87A 1EF2A 3QOKA 4UTIA 3GVWA 1QNVA 3QM3A 1M03A 1W1VA 4CEXC 5HNRA 1CENA 4R9XA 1JRCA 3NQ7A 2EAWA 4F0HA 4GXWA 4IT1A 3SY1A 3DYMA 3BGJA 2ZUVA 2FGLA 4RDZA 1H0IA 2ONEA 2ZXAA 1FCQA 3PJWA 3DYOA 1Q45A 3N29A 2YA0A 2B0MA 3DU0A 3B03A 2WC7A 3QN3A 4FNRA 1XPGA 3N2XA 1P6WA 3TVAA 3R11A 1FX6A 5LKYA 4AC7C 4JTHA 1I0BA 3SIZA 4UTHA 1YQ2A 4HPXA 4Q8MA 4LQ1A 4TVCA 1B1YA 3FGCA 3APTA 1XF0A 4WY0F 2VR2A 1F76A 1R46A 3TN4A 1Q7ZA 3M07A 1JUKA 3TCSA 5BZAA 5AHIA 4QITA 5LA0A 5CGQA 1I6NA 2O9OA 1BAGA 1V7YA 3VNIA 4EWJA 3A4WA 3Q65A 3EWZA 1RD6A 3PANA 3KRUA 1IE7C 1PZ0A 1JFHA 4PMOA 3MMTA 3P67A 3K1GA 2YBUA 1CIUA 4Q8UA 4EPBC 4IJRA 3G1SA 4LCQA 3VKKA 4A21A 2PURA 3BXWA 5ABFA 3P0XA 3TJIA 4TVUA 5HQMA 4GUGA 4HP5A 3IIOA 4KERA 4R88A 3UQNA 4F0MA 2WBKA 5D9MA 3ZT7A 4X0NA 1VQTA 2ZC8A 3UNDA 2GDVA 5FF7A 1ODZA 2Z0IA 3O6YX 2G50A 5FEPA 3QH2A 3IJDA 3UD6A 5CC6A 2PZNA 2J9XA 1QHOA 2VZVA 4S3KA 1LT7A 4AY8A 1XINA 1FWJC 3LHWA 3EDJA 1TZ7A 4NJIA 3VTRA 4HB7A 3ANYA 3GUWA 2SFPA 4YU1A 1LT8A 4XTIA 3LB0A 1MO0A 3LNPA 3TXZA 1ZZMA 3JZUA 4IPNB 3USZA 2QVNA 1U1JA 4IP5A 4P61A 3ZVHB 4EIVA 4AWEA 5BWFA 4E2DA 5L6UA 4NYUA 5FJIA 1YDOA 1OB0A 3MBFA 4NILA 3SCRA 4ORMA 3QFWA 4WSJA 5JVLA 1PKNA 4S3EA 3HQNA 1AW5A 1IIGA 3BSMA 4O11A 1DIKA 1OSEA 2PDYA 3EWXA 1QU4A 3KHJA 2XVPA 2FJKA 3DBPA 4OQVA 1ZBKA 1YIXA 5D4YA 2WXDM 4W8AA 3AUOA 3N4EA 1WZAA 3ZLFA 3SCQA 2JFEX 3V1HA 3CZLA 3N25A 4DPQA 3W7IA 1GOQA 4YYCA 1E15A 4GGBA 4XZNX 3W88A 4OU1A 3WK2A 4RV3A 2HBXA 3PWIA 1OCJA 2VDIA 3IGUA 3IACA 1X39A 4G1NA 5HJYA 3FOKA 2PLMA 5KETA 5DY2A 4DUVA 4US6A 3MHFA 5D30A 3TZFA 3EOSA 5LNWA 2PE4A 3FKKA 2FZ8A 3B8IA 1CGVA 3MV01 3OLDA 2YCLA 1ZHAA 3IGHX 4G8TA 4IXHA 2YW3A 3A4AA 4IG2A 3C2EA 5EMJA 1TIWA 1O94A 4Y6GA 4LS0A 3WDRA 4C6BA 3O0FA 2EEXA 4IIEA 3TXVA 4K1GA 1U30A 5C9ZA 2HQAA 2J75A 5DBUA 1Z69A 4U3AA 4CD4A 2XZ7A 4AZBA 5JQ9A 3QGVA 2CLMA 1UWSA 1TZZA 4OKDA 5I78A 3ARQA 1W1ZA 2H8ZA 4JKKA 3GVQA 1HL8A 4GYJA 4D6JA 2ZYFA 2ZDRA 1J93A 3K30A 1J0KA 1TMLA 2E9BA 4XZIA 3SCSA 1WCGA 3RILA 5FCZA 3W1TA 2D0HA 3CASA 1D8WA 1P6BA 1M7JA 1K8CA 2EO7A 3U2CA 4D8AA 1FKXA 3THDA 3V4BA 3WNNA 1EQCA 1A0DA 3UETA 4A4AA 1QWKA 3Q2DA 1V6TA 1ZCOA 2DIKA 1GG1A 3H12A 3BAXA 1O5RA 1UIPA 3AZRA 4F9DA 1TWWA 1GOXA 1QOXA 4YVXA 2V8ZA 3S2JA 2OG9A 3SCVA 3WK3A 4JTAA 1DP0A 4YWSA 4L4LA 3ATZA 1N2VA 3WLHA 3NSNA 1GYLA 1R7AA 1X1NA 4L5ZA 4JZ5A 3PB2A 4HK6A 4UXDA 4Y8EA 3BVJA 2J79A 4PEEA 4JTGA 2JK2A 1A5CA 2VWTA 1NTHA 3ISIX 3OO2A 1CXEA 1XYFA 3MMWA 1RV8A 4A8NA 4B2DD 1JUEA 5KITA 3PN8A 3LZ5A 1ME9A 3OLGA 3A64A 1W1IE 1K7EA 5HAOA 1Z41A 2WC3A 3E0LA 3W7JA 3OQ8A 3BCFA 5A6BA 5ABGA 3TMLA 5CQ1A 2Y0FA 3ABSA 1W9XA 2JEPA 1POKA 3R79A 5EL1A 4QDWA 4DM2A 1KXVA 3JUGA 3BJFA 3CIVA 4ZO6A 4JYFA 3DOPA 3RDKA 3GVRA 3MDWA 4IQEA 1XV8A 5FL0A 4YVVA 3MI2A 1V3JA 3ZR4A 3FSTA 3GSMA 1IXNA 3SUTA 4GZ7A 3LOTA 3UYCA 1A50A 2R1MA 1MWOA 3OYZA 5I3FA 1XWYA 1S3HA 1YTDA 1RJQA 1S2WA 1VP5A 5HDRA 4FHAA 1SO3A 2PWEA 3N12A 1BKSA 4JNYA 1P0BA 1M65A 4HCLA 1IXPA 4PTWA 3PTKA 3W53A 2GFTA 3H21A 3DHUA 4YVPA 1MW0A 5F2GA 2TSYA 1TTPA 1EGMA 4NT0A 3FYYA 3F4NA 4N6EA 2CERA 3C0LA 4AC1X 2OWCA 3G8EA 2C1IA 5EY5A 2IUZA 3FAXA 1IT7A 1D7KA 3H8AA 3LLDA 4UQCA 1XQKA 4ZBCA 4OUEA 4ATDA 3G0UA 3KUMA 1E40A 1OY0A 1V02A 4L9ZA 2XU2A 3K4WA 1UWUA 4CU7A 2HS8A 1HGWA 4ONVA 4HT3A 1SZRA 4R9OA 3OYXA 3UWWA 5M03A 4FK9A 2ZKMX 3ITVA 3QSTA 2WJDA 3QKEA 4H2HA 4K7VA 3RIKA 1B3ZA 5DRCA 1UR3M 5U7SA 4J3XA 2PDBA 4A8LA 3MWCA 3DN5A 3BOFA 2I14A 2GDUA 3LPFA 3PBGA 3W1NA 3GXTA 4WLCA 3AHTA 2CLEA 2X0SA 4WUIA 1U1HA 3JU2A 5CSSA 4DWSB 3ZJ6A 5I3JA 2G5WA 3GIYA 3VZZA 2XN2A 4GFIA 2ZUSA 1A5OC 4Y90A 3B4YA 2B7NA 4Q7IA 1FWFC 2VRQA 2FLIA 4MY8A 2HVOA 2GWNA 3T8LA 1XIHA 4W9TA 3UXDA 3WZ0E 1OFBA 1E6QM 4DXXA 3I68A 3NO1A 2WKGA 3PTMA 4JTDA 4QG6A 2I7GA 3FJ4A 3S6OA 6TAAA 2QLYA 2RDWA 4O19A 2QF8A 2P8BA 4TU1A 3FHQA 1I60A 2GJPA 1AQFA 3EBVA 1R38A 4EF8A 5HPOA 1UWTA 3TH6A 4P8WA 4AU0A 1ISWA 3ZYZA 3V0UA 1XLHA 4LNYA 5A6AA 1O68A 2XUCA 1ODUA 1H7OA 3KTCA 3B0PA 4QR6A 3GZAA 4GNVA 1EJRC 2GGJA 2NQ5A 3DZ1A 3BW4A 4JIEA 4O4WA 3B0UX 3ZQ9A 1TV5A 2VD9A 5D32A 4QLLA 5C55A 1ZUAX 3ZLGA 4HU8A 3CZEA 2OX1A 3W7NA 1V0LA 3NDZA 3LERA 4XD5A 1O7AA 3WJXA 3NFUA 3NA8A 4MWAE 2VX4A 5KZEA 2Z7KA 4S39A 3GNXA 3CUFA 5JH1A 4ZGYA 2X1TA 5A2AA 3WD4A 3PULA 2PD9A 4EXAA 4RE3A 1JZ2A 6CGTA 3HG4A 1MVYA 2C1GA 1F61A 3KP0A 4PUNA 2V30A 4OOUA 2WJZA 3AMLA 1I45A 4XSMA 5LIWX 3CO8A 4LUYA 3OZOA 1HJWA 2BY2A 3T40A 3VCCA 4M56A 1B0IA 3W2MA 4PB3A 4CEUC 4J3TA 2C0HA 3CK5A 3C5QA 2PDQA 4X60A 1TO3A 3UWZA 1IZJA 3SBFA 5LGZA 4Q8TA 3LS9A 4GUIA 1IWAA 1YX1A 3KLKA 4ZODA 2F6XA 3WQFA 3SJNA 3VIHA 1AL8A 4UTJA 1RCOB 1MDLA 1OX6A 3A24A 3CQJA 4JICA 3KL0A 1TKKA 1VH7A 4HTYA 1HVXA 5LA1A 1B3WA 3M0YA 1SJAA 3K8LA 3KBVA 4NJKA 1D2KA 2QKFA 4ZCWA 1DWHM 4H2CA 3R89A 3W1LA 1KM0A 4AIUA 1EBGA 1UUOA 5FJRA 1H7WA 3GE7A 2GVJA 3E2QA 3IS4A 2CLFA 3M0HA 1UA7A 4GI8A 5LYRA 1TQJA 2ZX8A 2PSNA 1JPDX 3GM8A 1MEHA 4RKAA 3DGRA 1UIOA 4H3DA 2ZC1A 2B4GA 3MYPA 1T7LA 2C7FA 3U4FA 1Y0EA 3G1HA 4BJHA 1EJ7L 4DO6A 3VU2A 4CCDA 1FCBA 2VEPA 3IRDA 2D20A 4O1CA 1NJJA 1B9BA 3GFXA 3U5UA 4U5KA 4ZOBA 8A3HA 2X1IA 2J6XA 3NL6A 1GOMA 3GFZA 4LYPA 5DT7A 5I3KA 3W7QA 2OFJA 3B9EA 5ABEA 3RNDA 1SJDA 3MZNA 5C9UA 1GUVA 3AYTA 2VT0A 3GBEA 4DUOA 1P0DA 4IMAA 1ISXA 1JF5A 1XISA 4FB7A 4Q8NA 3OHIA 3WLIA 2W4XA 3BAIA 3PNUA 3T07A 3H6OA 1RQEA 4C6OA 2OQHA 1W3KA 3QY6A 2A7PA 3SIMA 4S2CA 2XFWA 1J0ZA 2BTMA 1GVIA 4REQA 2CFFA 2PWHA 3OA5A 3OB8A 3UXKA 7TAAA 4AF0A 1UYQA 3TYUA 4J1OA 1H63A 2QULA 2GOUA 3WLKX 4BY3A 3UCDA 3VNYA 4B5TA 1V3LA 3AROA 1TQXA 3APGA 4HA3A 4TTUA 3OJGA 1OT1A 4JHOA 5I3GA 3N6HA 4ADSA 3WQ8A 3MI6A 5E5CA 3ICJA 3RF9A 5FEXA 4RZBA 1WYIA 3DI1A 1IGWA 3H70A 1FDJA 2BXVA 3FHAA 5BOEA 4KBXA 4ECLA 4GVIA 1A5SA 4XK2A 3HFYA 4ICNA 1MXSA 1S5MA 2DH2A 2DT3A 5A6BD 4H9UA 5H6HA 2QCNA 2J27A 2A5HA 2PWFA 2VL4A 4LUSA 1RA5A 2PBGA 1N8IA 2DY3A 2VO5A 1XYCA 6ENLA 1KFJA 3CT7A 3S9ZA 3M5VA 3NUKA 1BF2A 4OVXA 1SU5A 4GKLA 1ADDA 1XIMA 3VD7A 1PBGA 4BZYA 2C15A 3ARRA 2XGIA 3VIOA 2XJ7A 4WZHA 1AH4A 5IHRA 4JD4A 2ACSA 1WPCA 1PTGA 2PDIA 3DC0A 4PMZA 4ZE4A 1WDRA 2NZLA 1L9WA 1G01A 3CPGA 2BASA 4CLMA 3GC2A 5AC7A 4JGDA 1RHCA 3NURA 3AI0A 3DH7A 3MP5A 3GX9A 4PRTA 4RNHA 3QZAA 5DQPA 5IDIA 1VFFA 1R3YA 3T1GA 1AVAA 3MHUA 5F2IA 5I06A 3NSXA 3URBA 2PPGA 5BYWA 2NQ9A 1K8XA 4KS0A 1R30A 2WZTA 3T42A 1MFUA 3OQEA 4JTQA 2OSXA 5REQB 5A6KA 2HBVA 3NL3A 2PC4A 4PBFA 3MPGA 4UQBA 3BLFA 1TX2A 1BPLB 2YDSA 1HUVA 1TYGA 1CBGA 1V08A 2Z6IA 3DESA 5FJJA 1H7XA 4ZZ9A 2CWXA 4PSPA 4I5RA 3U7BA 4H1ZA 4DJEC 1PCKA 3Q94A 5SWUA 3DCPA 1G4EA 2PB1A 3GR7A 1JDCA 2BS9A 3KP1A 4JIPA 4FF7A 4MSSA 3I6TA 3RR1A 1EYEA 3S3GA 4IUOA 4GC3A 1Q3NA 5B7YA 1GNXA 1OX4B 4C6KA 2VRKA 1Z8AA 1QCWA 2QPUA 3UJEA 3NNTA 1SJCA 1CGWA 5EMMA 5D8ZA 5E0KA 4Y96A 4GA8A 5FA5A 3B8SA 1FY6A 2NWSA 3CJPA 5IXEA 2IS7A 1HP4A 1Q6FA 2FFCA 1XH1A 3BAWA 4JR5A 1IEIA 3A23A 4QFUA 2RDXA 3TEVA 4GH1A 5DBTA 4LUJA 2BWGA 1U83A 4MPQA 2VDHA 2ZE0A 3LXBA 1EWEA 3CB3A 1M01A 5I3DA 5D9NA 3UWEA 3N1AA 4RX0A 1QTWA 4P7OA 1R47A 4UQ9A 4OV9A 3MWAA 2OZ8A 2PGEA 3C2VA 3F5LA 5LNUA 5DO8A 1D3CA 1KWKA 4R33A 2OKTA 3CZGA 1C92A 1PJ9A 1XD1A 1MXDA 2ZX9A 1R86A 3ATYA 1G9HA 1JI1A 3MO4A 4X2PA 3HF3A 5IRPA 1TA3B 2O4QA 1XIGA 5HJXA 3CUHA 4E8GA 1W17A 2V3DA 2YL9A 2WHKA 2TAAA 4M1RA 1OBAA 1MEIA 3UZYA 2V3FA 4HNCA 2FJUB 1XFCA 4K3ZA 3QBUA 3H4XA 1W1A1 1E0TA 4PMRA 3LCGA 4O8RA 1LJYA 5HR6A 3TN6A 2ZWZA 1H1NA 1PB0A 1G7VA 1ADSA 1JZ6A 3GS6A 1KFCA 1SO6A 5H91A 2Q8ZA 2G3JA 3V5CA 3PB0A 1HNYA 3EPMA 2ZFAA 4XD6A 4M82A 4HVXA 2VX7A 3NQFA 4JQ3A 3MHGA 3UZ5A 5I24A 4N7QA 3G6MA 4Z1CA 4TTGA 4A22A 3SO7A 1A0CA 4FS9A 2FB3A 1WDQA 2V2CA 1GJPA 4FNTA 4M0XA 3LDVA 3R10A 5HANA 3C0QA 4LF2A 2B7PA 1U5JA 4GYPA 4AHOA 3VM5A 4U4MA 5A6TC 1Y7VA 4GI9A 3WDJA 2QJJA 4UBPC 1L6SA 4EX4A 3UWQA 1UG6A 3ABOA 2WPBA 3M16A 4HJWA 4A29A 3HZ3A 3IVUA 4YLWA 2UV8G 5CBJA 3BURA 5H8UA 1OIFA 1TWDA 3GG1A 2E8ZA 3M0KA 3TQKA 4OE7A 3VNMA 1SMDA 2CESA 4C5YA 3NQ6A 4JFSA 4MUPA 3USBA 2REQB 3CYJA 1GHSA 3BK0A 1K7FA 3FAWA 4MUZA 3WF3A 4D71A 1RD5A 3PAJA 5ECUA 3P62A 3FY1A 4TQTA 3EOLA 1BYBA 4NAFA 3P3BA 4UTWC 2VCCA 3VMPA 2WMGA 4G2DA 4GINA 3MMUA 5CZSA 2IPFA 3N11A 4MY1A 5XIAA 2AAAA 4WGXA 1HKMA 2DUZA 3FK4A 4AX6A 4A8RA 3FXGA 1RCQA 2ALRA 4Q8WA 2FZDA 2E0PA 2V5KA 1HL9A 3WBEA 4KPLA 1AD1A 3EMCA 4DWSD 1DXEA 2CBJA 4WKHA 3FCPA 4ZQMA 1XDJA 3HA1A 3U2ZA 1IZCA 4KF1A 4H9XA 1XSJA 5CPOA 3FJNA 4H9ZA 2Z1SA 3R1ZA 3TN3A 4XQ6A 4LS1A 3ZSSA 1QASA 4AG0A 1B4EA 5E70A 5D2TA 2PWVA 4W86A 2PGFA 5FF2A 3P84A 1XYLA 1S5NA 2ZA3A 3WUEA 2XH2A 1TCMA 2F7FA 5A2CA 3C4UA 3ABZA 5FAGA 3VIJA 2X1RA 4R53A 1DJWA 1RQBA 4NNBA 2QUVA 2E1DA 4QJ5B 3CXOA 4GZJA 3R25A 1Z7AA 2YXXA 3S1UA 2D0FA 3UR5A 3CWHA 3AS0A 2VFIA 3LBMA 2HEJA 4JTJA 1SW0A 2OR2A 3VFCA 3O16A 5FAJA 1E6PA 3RFAA 3HV9A 2HISA 1VFSA 2HJPA 1KV5A 3IK4A 4AYGA 4A3UA 3PM6A 3CS2A 3C86A 1S5TA 3DUGA 3KRBA 4TX8A 2ZRZA 3NPXA 1K02A 3VIGA 4YYFA 4DJDC 4IFOA 3E12A 2QMKA 1L2UA 1XYZA 2TYSA 3KW3A 2Y88A 4XAYA 1BWKA 2PTWA 3QQ0A 3L12A 4D6CA 4UNKA 1BD0A 3UYIA 4PZVA 3WLOA 4NKCA 1W3TA 3FX4A 3W23A 1BTMA 1H41A 4UNIA 2QCDB 2YSWA 4RLIA 2Z2BA 3QQ1A 4XG1A 4C1LA 1DOSA 4KFOA 5I79A 2VNCA 3A4JA 2PCQA 3UY7A 3VIPA 3TNOA 1F6PA 1ISVA 4NU7A 4JBRA 3PZOA 3RUBL 2C16A 4E5TA 3RMEA 2R91A 3W2KA 2FHBA 4DWDA 3E2RA 3UW6A 1C3FA 4GK8A 3HTWA 4GIEA 3WH5A 3TTQA 1JL8A 3T6CA 1AZ2A 3D47A 3BQ6A 1ENUA 2ZVIA 5AFDA 2E1WA 1VPXA 3RCYA 1SUXA 4AWUA 4JYEA 1E51A 4H9MA 5BU9A 2NQHA 2R1LA 5DY3A 1YHTA 4G7EB 1JZ5A 4H00A 1H4PA 4AD1A 1PE1A 3WLPA 4NXKA 4IGMA 3T78A 1Q6DA 3OU8A 1UR0A 3INPA 3OGVA 3LN3A 3RLUA 5DCEA 4K8GA 1E9ZB 1E3XA 2IXUA 1ELSA 1CLXA 3DG6A 3WQGA 3RGTA 2QAPA 2ISWA 3VZYA 1AFSA 3I3BA 4TV5A 2G3MA 4D6FA 1VPQA 1L6YA 2EXOA 3SRFA 2X16A 5AYXA 2Z00A 2WANA 5HK4A 1AJZA 1JNEA 1ZENA 3C6CA 1HJXA 4UTUA 3UU0A 4AY7A 3WH6A 4A6GA 3TCEA 2HS6A 2HK1A 3FDKA 5BMXA 2D3NA 3HGSA 4GUFA 3C0SA 1XYBA 3E6EA 4ZQCA 2V5CA 1T41A 3TZNA 2G37A 4G56A 1K8YA 1EEPA 3NQCA 4S3BA 3GDTA 5BOFA 3QPEA 4PB4A 4V1XA 3U8GA 3UJSA 1IYXA 8XIMA 2DSKA 3QQWA 3W82A 2YGYA 5LSMA 3GNDA 4G6CA 3TX9A 3TOPA 1VRXA 1OQFA 2O56A 2X41A 1DJGA 2QIWA 3LV6A 3I7SA 3VDGA 4UFMA 2X1SA 3ZT6A 4NZ4A 3VGDA 4NAEA 3QLLA 4BWLC 3T0BA 1TPDA 3SZ8A 1LL4A 3NQBA 1RUSA 1UP0A 3NQ2A 4DB7A 3FVMA 4UFLA 5K7JA 2XIJA 2C71A 3LI0A 3NIYA 4Z1YA 4AISA 3CUXA 1XFBA 3AWOA 3T0CA 3GH7A 4XZBA 2E6YA 4UCGA 1ICSA 1H7PA 1V6UA 2DZUA 5G4HC 2WCSA 2PF8A 1G4PA 4JL2A 1J6PA 5EKYA 2HV5A 3QHNA 3IJ9A 3BUVA 3AIRA 1TCDA 1G67A 4PMJA 2RH9A 4Z2LA 3B0XA 4I6VA 1F3EA 4W7UA 5I00A 1MZRA 4F0LA 3L23A 4B5WA 3QV7A 1EH9A 3AZTA 1TPUA 4LB4A 4HZMA 3R94A 2D2OA 1VFHA 4JKMA 3TJXA 3F5JA 1FHDA 1WUFA 4XB3A 4I9MA 5JIPA 3BE7A 3RJYA 3EYPA 1TUXA 2FPTA 4KETA 3I3EA 3SADA 4LUIA 4WR3A 4HNVA 2J66A 4UQDA 3QMRA 2PDCA 3BG3A 1UKOA 3VFLA 4HU4A 3U2OA 4XKYA 1TMHA 1ZBCA 4RZ5A 5GJNA 5JBEA 3DFOA 3XINA 1AODA 2PD5A 1IT8A 1JAKA 2GK1A 2J7CA 2F61A 1YADA 2RDTA 1W9UA 3BOXA 3V75A 3NZQA 1GZ1A 2AL1A 2VX6A 3MW7A 3VMNA 3GDBA 5E9AA 3SGGA 3FJLA 1AQ0A 2R6OA 1T40A 1P7TA 4DN1A 4PODA 5BXPA 3AMKA 4J35A 2CHRA 1XLFA 3N13A 2Y24A 4CQAA 1KBKA 5HR7A 5KSWA 2PZ0A 3L4TA 4I9AA 5FESA 2DU2A 4ZR8A 1HN1A 1ALDA 1R3SA 3WDIA 3WQDA 4MVAA 4AX7A 3WDQA 2HXUA 4J28A 3ALFA 1XSKA 3UXLA 1G5AA 3HGJA 2VZOA 2WVTA 5C54A 5C7HA 2WVVB 4FF5A 2XH0A 1L6GA 3QV8A 2P50A 4IIHA 4KCTA 2NQJA 3KVJA 4DF1A 1VGAA 2VGFA 1TTJA 2OEMA 2PDWA 2EPKX 5LGXA 2J7GA 1GW1A 1YXDA 1C9WA 1P1MA 2C14A 3T4CA 4XISA 4PCFA 1OCNA 3QY7A 2E7FA 3RMJA 1ZQ5A 3STCA 7PTDA 3ERPA 1Q8AA 5LIYX 2PDFA 1V5XA 1XLMA 3L9CA 3W1QA 3GNOA 1V0NA 4HA1A 3G1RA 2WMIB 3E2SA 5A6JA 1XDMA 4S3AA 3BV4A 4FSAA 3G0SA 4NJHA 1YE4A 2XVNA 1KM2A 4DZIA 3T55A 1CTNA 1UD6A 2PTZA 2BVWA 1M7PA 3NEVA 5CPLA 2Q3OA 3ARZA 5EFFA 2ZX6A 2XIMA 1DXIA 3MBDA 1SFLA 1CGYA 3PFRA 1GQJA 2YKKA 3G1XA 4QM1A 3OODA 4W7VA 3N04A 3CC1A 2KX9A 4JY9A 3LYEA 1BVWA 5CC5A 4ZQRA 4ZB5A 4E2OA 2QT3A 2OGJA 2A85A 2CITA 4IICA 5CLTA 2NT1A 1WDWA 2INEA 2V5DA 3PJXA 4IL0A 1SSDA 2IQ0A 3CL8A 3QV9A 1Q4NX 4FP1A 1VS1A 2EPMX 2WQDA 2BY1A 1EF3A 4ZXLA 1UH2A 4OFCA 2CKSA 2BODX 2H3BA 1GVRA 1N8FA 3B4UA 3DFSA 2OODA 4J27A 2YCEA 2QHAA 4DNHA 3LENA 1I75A 1BKHA 5DRIA 1U1UA 1S2AA 3G8RA 3H2FA 4TMCA 1LYXA 2C0AA 3KOWA 4QLKA 3S46A 1HKWA 3R13A 4JYDA 3FDGA 3MSYA 8XIAA 1TPFA 2W27A 3ZOAA 1Z44A 4J3UA 4MWAB 4IIGA 3N2MA 2Q3RA 3AS2A 4LUTB 1OK4A 3BJTA 2YR1A 3TR9A 1FWSA 2NQZA 3KBMA 3N4AA 2OTDA 3N9RA 1QAPA 4LCSA 4WRHA 4AEEA 4ACYA 3BLDA 3U4AA 3CEPA 4QGCA 4R3UA 1RPXA 3VGHA 3W1UA 3S2LA 4DO5A 1B2YA 1Y5XA 1JCNA 4RE4A 4Q22A 4Q8OA 4I7VA 4UTLA 3NQ8A 4F3HA 4NF7A 1Z32X 4WJEA 3NO3A 4GVGA 2NW0A 5D2YA 4DM1A 3PUEA 3PBYA 1UZHA 2PRHA 2WC4A 5DXYA 3BSGA 3SN0A 1SFTA 4ORIA 1A5AA 1F2JA 1KFKA 4WKFA 3V35A 1J79A 4PTDA 4GC4A 1VB9A 1FWWA 2ICSA 1B90A 4GZIA 1KW1A 2OO0A 3EWDA 4Y9MA 3URNA 2ZZ4A 3MDUA 5I03A 1XRFA 2YYUA 4UC5A 3KS5A 4XAZA 5TNVA 4NSBA 3RPDA 3IV8A 2TMDA 3KEHA 3U57A 4DY1A 1X7FA 2XFRA 3T44A 4WJXA 1V51A 2JEQA 2QXWA 3NVTA 1MFVA 4GHRA 3ZSTA 2CLHA 2NUWA 3LLXA 4IGHA 4QNEA 3DECA 1YTKA 1EIXA 2VURA 1GQNA 2Q6ZA 1US2A 2VFDA 3H7UA 3UA3A 4GPNA 4NQ1A 3SRKA 2DSVA 1JCXA 1CCWB 1OCBA 1R85A 3FA4A 3ITYA 3E5PA 4KRTA 2EG7A 1XUUA 4D9PA 3EZ4A 3E5BA 1JQXA 2VGBA 3SCPA 3DERA 4DBSA 3C2OA 5HUPA 2NSXA 3W7GA 3ZJKA 3E38A 3KX6A 1YPXA 2E5CA 1FOBA 3WUBA 2P3ZA 4P8VA 1OEPA 3REQA 3ZVIA 3KOXA 3GDKA 4FOKA 4NRRA 2V0TA 3KRSA 4I8DA 3W02A 4PN2A 2Y5JA 3VAVA 2INFA 5A95A 3LG3A 4C6CA 2J77A 3UPMA 4JHMA 1UKTA 2R1KA 3LQGA 4AZCA 4S3FA 2VYOA 3CNYA 3GH4A 2QUNA 4AZHA 3JZEA 3NL5A 1O60A 5BROA 5KTLA 3ARPA 3AIWA 1GQKA 3V5OA 3K8MA 1R2SA 1OFPA 4ZO8A 4NZCA 3B3DA 4WK9A 3HQ1A 4XBSA 4NX5A 4EOUA 1V6XA 2UY3A 1ECEA 1E1CA 4N9EA 3KCLA 3RM4A 1WUEA 2V67A 3S6DA 1XKYA 3O15A 1KGUA 4OECA 3UWYA 2G4JA 4ML4A 2EBNA 2QGYA 3M43A 3AIBA 1A5UA 3WL1A 5H8PA 3WY1A 2HNEA 4ROPA 4D8ZA 3EWCA 1ICQA 1PDYA 3AMDA 5CZJA 3N4FA 4CQBA 4U2YA 3CLWA 2P5NA 3R58A 5C5YA 2PTDA 4FXJA 5AZ0A 4NXSA 1OC5A 1LG2A 3FKRA 2ZZ6A 3RX2A 3IUIA 2WWCA 2ZRVA 1RP8A 3D46A 3GZ3A 2VEGA 2V38A 4GIYA 1X6LA 1UD4A 3RYSA 3VINA 2XISA 3W71A 3PZIA 4O1DA 5C8BB 2J8TA 2C13A 2YZRA 1NQKA 5AHFA 2XIBA 1TV3A 3W07A 1MW3A 2NLYA 4NHVA 2QR6A 4K7YA 1F6YA 1F8IA 2E68A 5E6ZA 1XIIA 2WVUA 3PHAA 2PODA 2E5DA 1PS9A 1PV8A 3EDKA 3GTXA 1P48A 3G0XA 1OK6A 1EIBA 1SR0A 4LV9A 1WKYA 1HKKA 4Q4OA 3GAKA 3EDEA 1TE6A 3TJ4A 5EGRA 3O63A 1KWGA 1UOKA 3L5AA 1MRAA 3QPYA 3TDFA 3VE7A 1QBAA 4HHMA 3V1PA 3OLIA 3HG5A 1ONEA 4DF2A 3ZLHA 1LWIA 4TUFA 4W84A 2C6QA 4QISA 3V16A 3U9IA 4B9ZA 2XYLA 1JPKA 2FZNA 4B3LA 3AIVA 4PUJA 4D6HA 2WWDA 2W67A 3O06A 4XIMA 1NOUA 4RNFA 1LOQA 1XYMA 1E0WA 1D8CA 4JOMA 1US0A 3S1VA 9XIAA 3PUDA 2RDUA 4PRRA 3SUSA 4AHPA 2WAGA 4TIMA 4DYJA 3RHGA 2GL5A 3OG2A 1AG1O 2NVCA 4Q4RA 1XC6A 1W56A 2WB5A 1X8CA 3COTA 3FVDA 4AZ7A 1JD7A 5E0CA 3N9KA 4XAFA 3VD5A 1W3LA 2VFGA 1L8NA 4UTFA 4UWMA 3MMDA 1M7XA 1XGDA 5KINA 2I56A 3ENLA 2Z1XA 3G1YA 1EC7A 3QYQA 2E6FA 3WLRA 3UGRA 2OB3A 3R0KA 4Z0SA 4X0VA 2A7RA 3TAKA 1K1DA 4O13A 1GVEA 3MUY1 2GPTA 3QGKC 3F4DA 4IPLA 3NPVA 3B9OA 4ICCX 4J3VA 2DZWA 4K8HA 3GAYA 5FJTA 1DIDA 4H6KA 1Y5VA 4N0RA 3WEZA 4LVFA 4E4FA 4DJFD 1MXGA 4QEEA 2BMBA 1QI3A 1JDDA 3P93A 1TVLA 4QG9A 5HQLA 1HKVA 2PS2A 1TV2A 1ISYA 1SGJA 4Q3MA 1R3RA 1UBPC 2GOKA 4OT7A 3KLLA 3GUGA 1Y5WA 2VJXA 3I6RA 3QJAA 4N6FA 4BHYA 2YA1A 4OWGA 4I9TA 3ZIZA 1JIBA 1W2VA 3ZT5A 2VI0A 4PMXA 3B05A 1ZPTA 4UQEA 4QIUA 2XH4A 2A4AA 2D2HA 3BLKA 2OQLA 7REQB 1EC8A 4BFAA 3FW6A 3LCFA 5HMSA 1E6NA 3WNPA 3F5KA 2IKJA 1A53A 3PP7A 2ACQA 2YB1A 1DJYA 2ZBTA 1XIBA 2W5FA 2I5GA 1LZOA 3GIPA 1TTQA 1L0PA 3PPCA 4K38A 5HWMA 2ZADA 3QPZA 5CPTA 1PCWA 1I8JA 4YPJA 1LWHA 1G7UA 1I0DA 1OZQA 4E0CA 1TVNA 3W83A 1PTDA 5BCAA 3ZXWA 5DN1A 1MZHA 1B3YA 4O28A 1XXXA 1JGMA 5I3IA 4V2XA 1TJPA 4D6GA 3A3WA 4LTSA 4LYKA 4ILSA 4E4PA 1BYAA 2BLEA 4D6IA 4DRSA 3BPWA 3FJ6A 1JZ7A 1BFNA 3KDOA 2WMKA 4HU0A 4FXFA 3S4TA 1R7OA 3NVDA 1T96A 3H26A 2D2GA 1B54A 1LF1A 1J10A 1NWSA 3WLSA 3V0TA 5CC7A 2Z24A 3OHMB 4K1WA 3OVGA 2VUNA 1TG7A 1V3KA 3I3DA 5J04A 1WB0A 1FCVA 3AXKA 2ZRWA 3L0GA 5AVHA 5CKSA 3M5XA 1LLZA 3ZR6A 3VO0A 1NP0A 1E6XM 1AQHA 1JUBA 3F4VA 1I2NA 2XSBA 4O8AA 3VKDA 4GIAA 1D3HA 1FKWA 4HYVA 3R4IA 1GONA 4JTSA 2WMJA 4DZ5A 2YLLA 4TO8A 3EWUA 3EB4A 3TK7A 4IHCA 4F0SA 1W0MA 1YKWA 1KTCA 2PDLA 3CV2A 1XKJA 2BV9A 4H9VA 1LOLA 3K5XA 2DGAA 3G18A 3OIHA 4H8HA 4KT2A 4DF0A 3SFKA 2XWEA 4DI9A 1QDSA 4H4IA 1H60A 2VZTA 4JL1A 1IT0A 3LNMA 3N15A 4MZ8A 1EBHA 1GJUA 1UROA 1UR4A 4NZ1A 3C2RA 3A6OA 3LHVA 4QJ1A 1H7RA 4HU3A 2C79A 5BU6A 4B3ZA 3IEBA 3CV7A 1YMYA 3MP4A 4V28A 1OYBA 3WKZA 1QPKA 2BB0A 1XM3A 3Q45A 1O95A 2DPEA 5CGTA 2VFHA 1KM1A 1EDGA 4Z42C 3GXDA 2ZCGA 4GO9A 5AY7A 2OQYA 2X8RA 4HHPA 2Z7GA 3ANVA 1X8FA 1MUMA 2PI6A 2ISDA 7XIMA 1JXKA 1A47A 3P8IA 4MLRA 4F0RA 4LBSA 4DVOA 4CN4A 3MCMA 2PWUA 4EXBA 5T9CE 4AD2A 4IMEA 3C3NA 2GJXA 2GQ9A 4PUKA 3M0MA 4A3YA 4R7WA 5HMDA 2HPIA 3PZ9A 4QJ3B 4GACA 3VC6A 5FSDC 3AU6A 3J7HA 5FD0A 3CV6A 3C0JA 2WNQA 1MW1A 3MCNA 1W1YA 3CAKA 2X7WA 1O5XA 2PRMA 1JCYA 1R0MA 3W0KA 2IMRA 2X0YA 5J5RA 1EJSC 1CNVA 5J5DA 2D24A 3DFQA 1PKMA 3TU9A 1WA3A 3CB8A 3E74A 3LGEA 4LAKA 3RM9A 1HVQA 1LWJA 7REQA 2OKOA 1FXPA 1OYAA 2INZA 2PAJA 5GJPA 4HNTA 1UH3A 3SUUA 2OX4A 1TFVA 2BHYA 2BHZA 2YBTA 2R1PA 3NO5A 5EMUA 2VELA 3M5ZA 5I0DA 3B06A 4UTWA 1GG0A 1OX5A 1W9BM 4KW2A 1UUMA 3HGOA 3QMSA 2POZA 2QPSA 1LBLA 1H09A 3B97A 5A3HA 1XRTA 4BQ4A 3AJXA 1BQGA 1QI0A 3THCA 3VCRA 1E4IA 2VRJA 3S2NA 1GEQA 3WQPA 4B5SA 1BRLA 4XUYA 1KRMA 2QMJA 5EA9A 5D2WA 3UVIA 4FI4A 2AQWA 3FSUA 1IF2A 3DHDA 1K9TA 3T4WA 1CB7B 1VBUA 1E1FA 3GDLA 3HGRA 3GR4A 2J9ZA 4NUWA 3QFEA 3HN3A 1J18A 1K9DA 1AH0A 4W8LA 1BG9A 4KEUA 4LY8A 5JH2A 2Y8KA 3FGCB 4ACZA 3LM7A 2R1NA 5LXXA 5FKYA 1C8VA 1LORA 1RJRA 5I09A 3NQGA 1KFWA 2ZZ2A 1DKWA 3HV8A 1K9EA 1ZJHA 3TFXA 4ZL1A 3S42A 4N4PA 4L80A 3W2NA 2PUZA 4QXIA 1SFSA 1RK5A 3LHUA 1LUCA 2YL8A 3F2CA 3VIMA 1RZMA 1J6OA 1IEWA 4MY9A 5ABFB 9XIMA 1ZRQA 3SDOA 3ARXA 4FR6A 3WK0A 3GW3A 3IRSA 2WYSA 2IKGA 3R43A 1UR9A 1ZCCA 4UZUA 3W22A 3TONA 5HWJA 1XSIA 5G5IA 2OYKA 1SW3A 2O4MA 1JRBA 2A3AA 2Z4GA 5D38A 1HXJA 3AHVA 4QBXA 3H4GA 5GJMA 3D6NA 5HINA 4L61A 3W73A 2I17A 1HO4A 5AYYA 2HROA 4CU8A 2RAGA 3CHEA 2H9AA 1W6TA 1XCXA 2CETA 3RXZA 4F0KA 4I8YA 5I3HA 4UB9A 4DBWA 4M24A 4LEQA 4P7NA 4QCFA 1NVMA 4N9CA 2Y1HA 4AZIA 4AY1A 3UR2A 4NJJA 1KKRA 4U28A 1U33A 1GQLA 2ZDSA 1OF8A 1DVJA 3HG3A 1O1HA 3EOOA 4LT9A 1A4LA 4H9YA 1UH4A 2ACUA 1A3XA 1E9IA 2RUSA 3WLNA 4WDUA 1JZ8A 1VFUA 1MSSA 4KIEA 3U48A 2DT1A 4XX6A 3N6QA 2V81A 3IAPA 4E4UA 1A49A 1PAMA 1W8GA 2HDJA 3WQVA 5KZDA 5HXMA 4GKTA 2DUAA 1SZNA 3LQLA 1Q13A 3AIQA 3QC0A 3EA2A 4AD4A 3W75A 4L1XA 4Z2IA 1M04A 4U2ZA 3DENA 3IPWA 3WBAA 2Q8XA 1HTIA 1R6WA 1WDDA 1LG1A 2ISFA 3B8UA 2XN0A 3ARUA 3U0HA 3H7RA 2J62A 4U33A 4ZSTA 3SGZA 3S1WA 1WE5A 1KRBC 4ZFCA 1OGBA 3H7VA 4KWOA 1MYRA 4EKJA 1TV8A 2QUUA 4QJ4B 2VCBA 4DI8A 2X7VA 4W5ZA 1ONRA 5DCDA 1F4HA 4IL2A 2O55A 3LV5A 1YNYA 1W5PA 3AAMA 2GZXA 4JQ1A 2EHHA 3FV9A 5CXPA 4EPEC 3P2VA 3GU1A 3VILA 3WD3A 5F1UA 3VUPA 2YCLB 1JNDA 1YW1A 3CH9A 5TF0A 1CXFA 3EXSA 1KQZA 4IG2B 5AC5A 1UPPA 1OGSA 2ZTJA 3NQVA 4PSRA 4UMBA 1E6SM 3CAQA 4O57A 2EKGA 4HPNA 3WUFA 1GW9A 1NQ6A 4PUEA 4BWLA 3WF2A 4KWWA 2QNEA 1BSIA 4UTMA 4GH3A 4JN7A 1FWGC 1PSCA 3OVRA 4KEVA 1RCXB 2PWGA 5AYZA 2BX7A 1U5VA 3W37A 1WOAA 3MCOA 2NXGA 5HQEA 5CSYA 2OEJA 2O9TA 4DBDA 4OJYA 1W1B1 2GQ3A 2OZTA 1QRQA 3BANA 2ATSA 3KAOA 3KBJA 3G1FA 3SY8A 2QUTA 3P81A 3KBNA 4MLJA 1TJ2A 2CHNA 3PPHA 1XLAA 5H8MA 2GQ8A 3ZO9A 1POJA 1FWRA 3CT2A 1O6IA 4PYSA 3C8NA 4P8XA 1UCWA 3QTPA 1W3NA 4RDYA 3QSRA 3THAA 1AH3A 1XLLA 3MA8A 4CUCA 1Q7MA 4AVNA 3LI1A 2ISSA 3CUGA 5L9FA 2DVXA 1QNRA 5AYBA 4JTUA 1Q6EA 7TIMA 1TELA 1LRTA 3GTNA 4H7VA 3M0ZA 4NX0A 2BZNA 3IGXA 3PZVA 1OWQA 3UPBA 2GVLA 5K9CA 4EPKA 1BXNA 1XRVA 4GZEA 2VEFA 3OBEA 1NF7A 1FH9A 1FUYA 1DYSA 4ADUA 5PTDA 3E0WA 5A8NA 1SPQA 3I4EA 4UFKA 3P0WA 1ZFJA 1G4TA 3KXQA 2FDMA 2EG8A 5D09A 1PIGA 3I4KA 5CAKA 5DMNA 3I10A 4GQ0A 4QS6A 3LBOA 3SURA 3NAVA 1VD6A 4JTCA 3GD6A 2OLSA 3APYA 5I7GA 5FF0A 4MF4A 5FEZA 4DHGA 4LVGA 3T0DA 2Y61A 3WO8A 1W31A 4AZGA 4KEMA 2Q01A 4H9TA 1X1OA 1EC9A 4Y9OA 3HPZA 5K9DA 5B80A 5GNXA 2WK2A 3CL7A 3TSDA 3LXCA 3VX1A 3IGSA 3CUJA 4UFHA 3P5ZA 5I6SA 3SCWA 2C19A 1YNQA 4YL2A 3WSUA 1BWVA 5LNSA 3HPFA 1AZ1A 2O7SA 4L6OA 4WHBA 1DQUA 4LNCA 5C2CA 4X9YA 1EEXA 2EPNA 4PULA 3TNBA 1R9XA 4PUWA 1ISZA 2ZZ7A 2DSWA 3R8GA 2NUYA 1CLVA 3PJUA 3T05A 1TV7A 3B04A 4RDVA 4ATLA 2Q71A 2VC7A 3NOYA 5M1TA 1LL7A 4B91A 5I07A 1OFAA 4GYFA 4IFKA 3OVQA 1YNPA 3CBWA 1DJNA 1BXCA 1GPWA 3W2JA 2FGBA 1UASA 4N9BA 3AMGA 2DZAA 1RALA 3ZJ7A 2JKEA 1IV8A 5D2VA 4RXGA 2P3EA 5MHBA 3G3MA 5FJOA 3TTEA 2I9UA 4WDTA 2VFFA 3Q37A 3DYPA 1UD3A 5A2BA 1BHGA 2YDRA 3UZZA 2FPYA 1UQZA 5CBBA 3URQA 4TV6A 3ABXA 3N19B 3WD1A 1P0KA 4M81A 4ZB0A 2XIQA 2Q8LA 4ZTYA 5G1YA 5ABHA 4UTTA 1VR6A 4A3RA 5DMLA 4QROA 3G24A 3UG3A 3RAOA 1T8XA 1QO5A 5EBUA 2Y4SA 3W85A 1XLGA 4NY2A 5EMYA 5JIWA 4Q6XA 2A3EA 2X2GA 1JCJA 3W2LA 4J4KA 3M46A 4P7LA 1LRQA 4PA8A 2QJHA 5F4XA 4UUIA 9RUBA 2ZIDA 3M41A 4MMWA 1RA0A 1MQPA 1UQYA 4DAFA 1DHKA 1EXPA 3B8VA 3GG0A 2GYIA 3CPRA 2E5BA 4MB1A 3AXMA 1BLIA 3HQOA 3WIJA 3P14A 3HM7A 3BJSA 1Q4WA 2W91A 1DWGM 4JXCA 2VQUA 1KXHA 1NDWA 3F4CA 1CT5A 4MNKA 2YZ5A 3CLMA 1G69A 2DDXA 3H2NA 4IOTA 4B5NA 1OYCA 3KCJA 4P2VA 2E3ZA 2QGHA 4LJ3A 4K39A 3WL0A 4MYAA 1W9DM 4EE9A 1QPRA 1KB3A 2CXGA 2CLOA 3NQEA 1KLYA 1Y8BA 2J7EA 2QCCA 4XIAA 4N42A 2QDEA 5C71A 2Z28A 2OJPA 8TIMA 3M44A 8CGTA 3H2OA 4KFNA 2BGSA 4R5EA 2A6NA 1LROA 3T0TA 3MQTA 2W6RA 4OHQA 1NELA 4KKXA 3O2LA 4UNLA 4PRWA 4AVOA 1LOSA 4IX2A 3OGRA 3HG2A 1K4HA 1VPYA 2GUBA 3LD5A 1DIEA 4XZMX 3SGUA 2AAMA 4AWSA 1QW7A 3EDFA 2GUUA 3LCIA 2ZQ0A 1KM4A 1PTAA 3WMSA 4PC8A 1RP9A 4PEKA 1KR0A 4L56A 3I7RA 3VDHA 1ICPA 4LCRA 1G6CA 1FTXA 3PK7A 3CMFA 5DCBA 3ME3A 2HTMA 4RDWA 3D3AA 3YPIA 3EMQA 1ZAHA 3AFBA 5CPNA 2I5QA 3R5EA 1U2YA 2WNNA 1DORA 4O15A 1K8ZA 2NWRA 5A8PA 1IR1A 1YTEA 1J5TA 3OZYA 3VGGA 1UHVA 2DSUA 1FA2A 2CIPA 1E0XA 1YDNA 3K2GA 3WQ4A 3VPLA 1JGIA 5AHEA 1XLIA 2PDJA 4IJBA 4B90A 1XIJA 4DZAA 2PDXA 4NZFA 3WJWA 4DNMA 1PUDA 3TC3A 1KBLA 1JDFA 2EJ1A 1WKFA 1E55A 2GUYA 2DQWA 2X40A 3GIQA 3T2QA 1JYVA 1UWIA 3NZGA 1HT6A 2J78A 6REQA 3S47A 3E96A 4FNPA 1P1XA 2P0OA 4QP0A 4JTLA 3H4WA 4M6UA 2PDUA 2OO6A 1CECA 4M3PA 4GISA 1XLJA 2HE5A 1OVDA 2CU0A 2ZOXA