3O6CA

Pyridoxal phosphate biosynthetic protein pdxj from campylobacter jejuni
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
b'NAMLLGVNIDHIAVLRQARMVNDPDLLEAAFIVARHGDQITLHVREDRRHAQDFDLENIIKFCKSPVNLECALNDEILNLALKLKPHRVTLVPEKREELTTEGGLCLNHAKLKQSIEKLQNANIEVSLFINPSLEDIEKSKILKAQFIELHTGHYANLHNALFSNISHTAFALKELDQDKKTLQAQFEKELQNLELCAKKGLELGLKVAAGHGLNYKNVKPVVKIKEICELNIGQSIVARSVFTGLQNAILEMKELIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxine 5'-phosphate synthase
publication title Pyridoxal phosphate biosynthetic protein PdxJ from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Transferase
total genus 100
structure length 259
sequence length 259
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o6cA00
1L6WA 4IOTA 4EIVA 2OX1A 3UZ5A 3RFAA 1HUVA 3DFNA 5EMUA 2EAWA 3TV8A 5BW6A 4POCA 1KLZA 3CEPA 3A21A 2PE4A 4ZQCA 4N6FA 3DI1A 4FNTA 1FXQA 1LYXA 1WAUA 2CFFA 3LV5A 1KM0A 3T44A 2QCDB 1Q6OA 4O1AA 1ML1A 1TPH1 3SGUA 2J9YA 3F4NA 3KFTA 2A21A 3DAQA 5HJLA 3VE7A 4N4QA 3C4UA 3WK0A 1KFLA 3CHVA 3W1TA 3LHVA 1XBVA 4JD4A 3LX9A 4Y8FA 1QPRA 3HB9A 3TK7A 3BGJA 3A23A 2C19A 1LP6A 3BG3A 2V9DA 4UTMA 3PB0A 2DZUA 2YZRA 2DORA 4OQVA 3NDOA 4O52A 3PSVA 3IIZA 3THQA 1FX6A 3W1QA 2NWSA 3NPWA 1W8SA 2YGYA 3E12A 3MO7A 3QEZA 5IM51 4NVTA 3GNNA 5IBXC 1ONRA 5AYZA 4YCOA 2BX7A 2R8WA 1W37A 3NO5A 3W88A 3QMRA 2FDSA 4S2BA 3W7HA 4ZQRA 4JICA 1JJKA 3NAVA 3M5VA 4MZ8A 2WQPA 2Z2UA 3QFEA 1OF8A 4PFMA 2X1RA 3FFSA 5DBUA 3MP5A 1EEPA 2ZBTA 1LROA 2CLHA 5DBTA 3U6WA 1WDWA 2QEZA 3M16A 5E0KA 3NNTA 3BLEA 5DELA 1KTNA 4QNEA 3DFPA 4JXCA 4GJ1A 2BTMA 4UFKA 4BWLC 4JTSA 3N73A 2DZPA 3LHYA 1KV8A 1PCWA 4JIQA 4NZJA 4Z0JA 1WX0A 2QKFA 4TX9A 3UNDA 4DELA 1ME7A 3NOEA 1BKSA 3QW3A 3TQVA 3NVTA 5I3FA 4NNBA 2DZWA 1WQ5A 4DF1A 3C3NA 4UTJA 2WNZA 2QAFA 3W1UA 4MFDA 3LRKA 2VFGA 5E1QA 3S5YA 3HF3A 3UZJA 3WJZA 3PVFA 4JYEA 4A3UA 4FNUA 2VXNA 5EL1A 4AH7A 3LERA 4O12A 3NEVA 5F4SA 1W5OA 1K7XA 4Q32A 3LXCA 4LUJA 3LCHA 1VHCA 3EX2A 1PS9A 2ZZ4A 5T26A 2NLIA 3W7JA 3TH6A 1C8VA 3LV6A 2J9ZA 3NQMA 3IRDA 4A22A 1WXJA 5D02A 3CTLA 4UFIA 1TYGA 4B5NA 4UR7A 3LXAA 4A2SA 3FKKA 2GQ8A 3PAJA 4YL2A 5FEWA 3Q58A 2DJLA 3LCGA 1T0OA 3N19B 4NJKA 3W7LA 5DCEA 1M5WA 4HKPA 3TFXA 1H7XA 3EKLA 2H3DA 1F2JA 1DOSA 7TIMA 1KBIA 2E09A 2YX0A 5C6MA 1GG0A 4NJGA 4BI6A 4LVBA 2GVGA 5HQEA 3DH7A 5DN1A 4QNWA 2E77A 2ZRUA 4MJMA 2ZZ1A 1JCJA 4OBTA 1X1ZA 4NJJA 4DBDA 3EB2A 3QH2A 3CPRA 3LTYA 1UCWA 4LTSA 4JN6A 4E2DA 5G2WA 2ZZ3A 1TPWA 4UFLA 2F84A 3NL2A 2YPIA 4AWTA 3LOTA 1TSIA 3BW2A 3PY2A 4LVGA 4CCEA 2VKZG 3EKZA 2NUWA 1F76A 1R2RA 4O0ZA 1SFJA 2GQAA 3GAKA 1RQEA 4A21A 4R33A 3TDFA 2A6LA 3IVTA 1O5XA 2VEMA 3TXVA 3FIGA 3W7DA 3G1YA 1AW5A 4RK8A 1TMHA 1Q6QA 3G8RA 1JCLA 2A4AA 3P5YA 2X2GA 1U83A 4K6AA 3BGGA 2GVLA 1SFLA 4BI5A 1EX5A 1H50A 1UBSA 3BO9A 4JTKA 5H2ZA 2ZA2A 5TIMA 1K8ZA 1G4SA 3GXTA 2X30A 4AB4A 3W2UA 1LLWA 3QPYA 4MYXA 2KZHA 1TIMA 4UTIA 3MYOA 5CKSA 3PSWA 3T4CA 4IQLA 4RV8A 4YWIA 3T55A 3NQ6A 4QISA 5GVJA 5CPNA 3W7OA 4MOZA 4UUIA 3W85A 2OT1A 3EWZA 5I3JA 1SW0A 4FEZA 2E6DA 3S5OA 3H53A 5KSWA 3TCEA 2CLEA 3E02A 4MY1A 5FI8A 3NQFA 1FWRA 3IGXA 4RCXA 5AOUA 2YSWA 4O54A 2B7QA 1VZWA 1OFEA 1ICSA 3G1SA 1F6KA 1QPNA 1VGAA 1SW7A 1PL9A 4W9TA 4OHQA 3O6CA 3GK0A 3PB2A 1TTQA 4GUGA 1EUAA 1TJPA 2FLIA 1VH7A 1AMKA 4UC5A 1K8XA 1LBLA 3NL6A 2A7PA 5K4ZA 3G24A 1M7OA 1P5BA 3EXSA 5LNWA 3PULA 3KRZA 2NX9A 3DKLA 1NF7A 2VC6A 2ZRWA 3Q94A 3T78A 2ZTJA 5FF4A 1B4KA 3S5ZA 1EP2A 3KVKA 3LI1A 5CG7A 3I65A 1OX4B 3WJSA 3G22A 3W2JA 4N6EA 2UV8G 3TUUA 4WQ6A 1I2QA 5CPLA 4CCCA 4J9JA 3UPWA 3PUOA 4ZQNA 4I7UA 5CZJA 3MHGA 4UFMA 3GDLA 1TV7A 1YXYA 3PUDA 1HO1A 4Y90A 2C1HA 5D2YA 1SSDA 3S6DA 2ZRXA 2EGZA 1XKYA 3ABOA 2B0MA 3CIWA 5FESA 5HULA 4R53A 1GT8A 4EF9A 1WOBA 3NG3A 4O4VA 4WY0F 3N34A 2Y61A 5LHEA 2YYUA 5G1YA 1IF2A 1HL2A 5FF7A 2WNQA 1XXXA 1W54A 1SO3A 3GLCA 3LB0A 3WK1A 3GDRA 1OJXA 2B4GA 3DENA 1DHPA 3FYOA 1LORA 4UTTC 3O6YX 1K7EA 3L5MA 3HG5A 5D2VA 5LGXA 2CZDA 1SR9A 2FPVA 1LBFA 4KFPA 2Q3OA 4ZL1A 1QCWA 1XDLA 3A5FA 3CLMA 5AHEA 4HN4A 2GUUA 3G1HA 2XFWA 4JTLA 4ZQPA 3ABSA 5HWNA 3S5NA 2NXIA 1YTEA 1D3HA 3SSJA 3W3OA 5K7JA 5KZMA 3DFSA 4K7VA 2NWRA 2I9EA 1FCVA 1AG1O 2ISSA 1JUBA 5BNKA 1GTHA 4JEQA 3R89A 3I7SA 1IXPA 3S9YA 1KM6A 2CZEA 5BRBA 2RDTA 1HO4A 5EA9A 1F7BA 3WK2A 3ZFHA 3W7IA 1SPQA 1A53A 2DZTA 3BW4A 4JTHA 1TPFA 3W72A 1TTJA 2E5DA 3W7GA 3MUXA 5AHMA 5AHLA 4O57A 4BFAA 1LTDA 5KZEA 4ADSA 1S5VA 3SY5A 3SFKA 4XZ9A 1EP1A 3LDVA 3NA8A 1QMLA 4MPQA 4O19A 2FPTA 4NUWA 4LUIA 4RX0A 1SO5A 3P8JA 3M9YA 3QJAA 4IX0A 3P84A 4CNOA 4MLJA 4DEFA 1VCFA 3WJWA 4WXYA 1V7YA 3MWAA 3S42A 3G1XA 4DO6A 3MJYA 1YDNA 4MY9A 1Q6RA 3C52A 5CSRA 1KFCA 3HG4A 3LCLA 4Q4KA 4UMCA 2Y70A 2Y7EA 3NQDA 3TSBA 2DU2A 1WYIA 1LLZA 8TIMA 1TPC1 2TMDA 2ISVA 4HSOA 5FF3A 4P2VA 2X16A 4GUHA 4IMGA 2IQTA 5AHIA 2PC4A 5F2MA 3UXDA 3UWWA 3G3MA 3MI3A 2Y62A 1VJIA 1JRBA 3U2OA 2Y89A 3OVPA 2ABBA 4G1KA 3QQ1A 4RZ4A 4YCPA 4ZMGA 1ME9A 3I7QA 4QJ1A 3TC6A 3KX6A 4GE8A 5J5RA 1JCNA 2J9XA 4WJEA 2CWNA 2BXVA 4JR5A 1UUOA 4QM1A 4FIRA 3I6RA 1LRQA 4XWUA 1TV5A 5DLCA 4O11A 1FCBA 3L68A 3W86A 1TTIA 2VFIA 2ZZ5A 4N9EA 3ZWSA 3UY8A 4LW7A 1X7FA 4IPJA 1TPEA 2OCZA 3IEBA 3F1QA 1YTDA 5D32A 5TQLA 5AC8A 3W9ZA 2VFHA 1G7UA 3N9SA 3AO0A 3G1FA 2E6YA 1PCKA 3H55A 3FJ6A 4PC8A 3W6YA 1XFBA 4K38A 3TROA 1QNVA 2A6NA 2WSQA 2BSLA 4MLRA 4HPJA 4MFEA 1EIXA 4CQAA 4EWND 3CWNA 3OIXA 1SSGA 3OVRA 4WXZA 4O15A 4GFSA 3PM6A 3SECA 3W7EA 1OX5A 4CNNA 3UWQA 5BMWA 3TJLA 4BF9A 1G4TA 1TPB1 5HUOA 3DXIA 3E0IA 5DXXA 2AQWA 1DJNA 3STGA 3B03A 5D33A 3P5ZA 3QRHA 1K8YA 1G4PA 1GQNA 2AGKA 4P61A 3TAOA 3LCFA 1L2UA 3GDKA 3EX6A 1TO3A 2NXHA 4O14A 5C5YA 1U5JA 4H6KA 1XL9A 3T40A 1P0KA 1BTMA 1K7FA 4N02A 1FWNA 5EY5A 3FEMA 3KXQA 5I3HA 1W3IA 2QUVA 5HR7A 1ALDA 3P80A 1LOLA 4ADUA 4AVFA 1FWSA 4FIQA 4BWLA 3IIOA 3O6DA 4QITA 4UTLA 1VR6A 3Q37A 4NXSA 3UYCA 1UB3A 1G67A 2YDAA 1M7PA 3GKAA 3RU6A 2GQ9A 4RZ6A 4I9AA 4XBKA 3EWYA 3QSTA 2HS6A 3W7RA 1RVGA 3GDMA 1KM3A 2A7RA 2DZVA 2G96A 5LGZA 1Q45A 2QCGA 4HHPA 1NVMA 1SZEA 4LC6A 3TJXA 3O05A 2W6RA 1IIHA 5E93A 2ZTKA 4UNKA 3G3DA 1Q6LA 5DCDA 3IVSA 1VYSX 3HG3A 2R14A 3PF3A 1H5YA 4RKAA 3NXFA 1JQVA 1QAPA 1GVQA 1QOPA 2BWGA 5I3IA 3ZWTA 5F4WA 1SU5A 1LM1A 1W1ZA 5FF2A 4MJZA 5L9FA 3EXRA 1YYAA 4MY8A 4YLWA 1UASA 4K8HA 1XM3A 4BR1A 1OK4A 1T99A 1F73A 3HBLA 3RK8A 4QSHA 3A5VA 2FQIA 3B04A 3C2VA 3T7VA 1QWGA 4OE7A 2O7QA 2CLMA 4RLIA 4N2YA 5G1TA 4AXKA 4UXDA 5F1UA 3DFQA 3B0PA 3THAA 1O4UA 4UTWC 3H54A 3L0NA 4IMDA 3GR8A 1MEWA 3MYPA 3AJXA 5FEPA 1ZY9A 3MW7A 5F2IA 2DJXA 2VFDA 4UCGA 3C0JA 3C8FA 3W1LA 4UMBA 1KM5A 3R2GA 4NXKA 3W76A 4FX6M 2WNNA 4EOUA 3O8AA 5HINA 4UTKA 2WKJA 4JGDA 3W74A 4Z1DA 2PRLA 3LXBA 1HTIA 1H1ZA 4PEKA 1CX9A 3DGRA 4MKNA 4OWGA 1IGSA 4AHQA 3R8RA 1TPUA 5I3GA 5HMSA 1VLWA 2NZLA 3OVQA 4CCDA 4DF2A 1KM2A 4EVZA 4EF8A 3BPWA 1WBJA 1JULA 1OFQA 2QJHA 4H4IA 3M47A 5D03A 2QF7A 3HJZA 4O13A 5C54A 3SIZA 1H60A 1D3GA 4JS3A 4K36A 3I68A 2YW4A 1FBAA 3PUEA 1LDCA 3G1AA 2H8ZA 5LSMA 4JTJA 5A8GA 1GOXA 1YDVA 1P1XA 3VKJA 3VCRA 3LBMA 4U28A 1I2NA 2CW6A 3QMSA 1TRDA 1OF6A 3F4WA 1KFEA 1FDJA 4O16A 4O50A 3W23A 4O0KA 4O18A 4HSNA 3DKJA 2ATSA 1I2RA 4MUZA 2F7FA 3B0UX 4Z1BA 5KMYA 1M6JA 4JNMA 3DHDA 1WV2A 1TPVA 2A85A 4HNVA 1AL7A 3L5AA 3BLFA 3UPBA 2V2CA 1AK5A 4LRTA 4R7JA 2I14A 1A5AA 2QUUA 4FX8A 3G0UA 3QF0A 4N9CA 4TO8A 1FWWA 2ZDRA 3GVGA 3A9IA 2EKCA 2WOQA 3HGOA 3OA3A 2OT0A 1OX4A 4IXXA 2AAMA 3W1PA 4N9BA 2Y7GA 3GXPA 4U4MA 1VLIA 4IJBA 2NX1A 4ZQOA 1RZMA 1JQXA 1RR2A 1OYBA 4TU1A 3STEA 2E6AA 4AF0B 3L5LA 1NAL1 4CNPA 4K8EA 4JYFA 4PTNA 1OX6A 3OHIA 4ORMA 5G5IA 5CGQA 1BWLA 2TSYA 3WJXA 1KW1A 4MZYA 2CU0A 4MYAA 1TREA 3IV3A 2ZA1A 2Q8ZA 3TKFA 4KFNA 3V75A 2CLOA 4DF0A 3G1VA 1D9EA 1H7WA 1S3HA 2RDUA 1H7PA 4FF7A 4JTIA 3N9RA 3IVUA 2GJLA 5TBOA 2CLFA 2C3ZA 3P61A 4TMBA 5KINA 1F05A 3KHJA 4GUJA 5LNUA 3IGSA 3M5ZA 3M0ZA 4GBUA 1ZNNA 3N3MA 1R47A 1TV8A 3P7YA 1ICPA 2V2HA 3NZRA 4TIMA 3MI2A 3ZS4A 1SZGA 2WPBA 3GB6A 4X2RA 4HPXA 4WZHA 1GG1A 5J5DA 1JCXA 3D0CA 5EPDA 5MHBA 1W5MA 1KBJA 4OT7A 3F03K 1MO0A 5HUPA 4KWWA 1W3NA 1O5KA 3P82A 1EWEA 4ZQMA 3BG5A 4RJEA 2TYSA 1JCYA 2ZQ0A 3TW7A 5KITA 2WSYA 3NR0A 3W7QA 2Z0IA 2FFCA 1VQTA 3KOFA 3C56A 3NQVA 3LTSA 5K9XA 2B7NA 3INPA 4UTTA 1TRIA 4BI7A 1WA3A 4LNYA 1EPXA 1ZCOA 1JR1A 1ZHAA 4NU7A 3HMJG 3NL5A 5AC7A 1WOAA 3NZ1A 3E9AA 3DZ1A 2CLLA 5CPOA 4HT3A 3P74A 4BK9A 3HGJA 4LS0A 4LC8A 5LNSA 2NXGA 1G4EA 3W87A 2VELA 3HGSA 4NNAA 2DZXA 4LU0A 3OG3A 4LWWA 3R13A 3STFA 4O1DA 2QCCA 3NQ2A 3S1WA 3KRSA 2YFNA 4ICNA 1X1OA 4R34A 1DJQA 3TNOA 3MBDA 5FEXA 4TMCA 2R94A 4LT9A 1OG0A 2ZZ2A 1MZHA 3W75A 3M41A 1MXSA 3LBCA 1B3OA 5FEZA 4AHOA 2ZCGA 1EA0A 3G18A 4KKXA 2VEKA 2JK2A 5LZLA 3NM1A 3CB8A 1F74A 1K03A 3MP3A 3OBKA 5L6UA 1LRNA 4JTTA 1PVNA 5DCBA 1OFAA 1KM4A 3P67A 2ZA3A 2OZ0A 4JY8A 4XQ6A 4LOCA 1I2PA 2Q8LA 1VYRA 3TMQA 1AL8A 1ZENA 2CLIA 3NQ8A 4E2BA 3EXTA 3TU9A 2XN2A 3FYPA 4NJHA 2E1DA 3JRKA 3USBA 2Y85A 4JTGA 3W83A 1B57A 1RD5A 2B7OA 3M6YA 6TIMA 2CLKA 4HNTA 1XUZA 1XI3A 1R2SA 4GUIA 2ZYFA 3N2MA 1EB3A 4E0CA 2DZSA 4JX6A 1OVDA 5D38A 1PV8A 2H8XA 3NQCA 3HOJA 3IGUA 1DL3A 1N7KA 4UNLA 4TR9A 2YR1A 3W70A 1Z41A 4IMFA 1KFBA 1X8FA 1GVSA 1SO4A 4M6VA 5CZTA 4PL2A 1K3UA 1LOSA 2CZFA 1XBXA 3LCWA 4OV9A 2A7NA 2GOUA 3FA5A 3HIJA 5I3KA 3TX9A 2QJGA 5U4NA 2VOMA 4M19A 5AHNA 3RMJA 1FCQA 5EYWA 3O15A 1LCOA 3SGZA 1HG3A 3CQ0A 1FCUA 2JGQA 3LHUA 3EWBX 2JBMA 3CM4A 3BVJA 3E49A 3W2LA 3W7PA 1QO2A 1KA9F 1MEHA 1BWKA 1DV7A 4K7YA 1IXOA 3SJ3A 2PURA 3EX1A 3RNDA 1J2WA 4MVAA 1SQ7A 1OABA 2YCEA 3GX9A 4HNNA 4NQ1A 5KZDA 5D2XA 3LLFA 4UR8A 3CU2A 2NX3A 1KTCA 1SUXA 1OFDA 3PG8A 3TFCA 3DI0A 2NV1A 1R2TA 2WO5A 1R46A 2ZFAA 2RH9A 3G1DA 5K3VA 2A1YA 4GC4A 3C2EA 3M5YA 1YXDA 3CIXA 2V82A 1TPDA 2FB3A 3NYZA 3NGJA 4I7VA 4WOZA 3MHUA 3W7NA 3LRMA 4LV4A 4JTUA 3O16A 5K2ZA 3Q2DA 3QYQA 4O4WA 3QSRA 4AWSA 4O17A 3QMTA 3LTPA 1GVFA 3W7KA 2ZZ6A 1SZNA 3A24A 2Q3RA 3VNDA 4GXMA 3UQNA 4DO4A 1OFPA 4LVAA 1T8XA 3NQAA 3SZ8A 2YXGA 3W84A 5IBXA 1I4NA 3VE9A 4UTHA 1DQXA 3EWUA 3IIXA 4WUIA 3KVMA 2A0NA 3TA6A 2D73A 5SWUA 3LHZA 5K9DA 3QQ0A 3L21A 3PS7A 4LS1A 4AAJA 1XUUA 2ZRVA 1G6CA 1TJRA 5LNRA 1W5PA 1FXPA 1DQWA 4NX0A 5LKYA 3UWUA 1GYLA 5LHFA 5DY2A 1LOQA 3E96A 3QM3A 3LCIA 4A2RA 4DQWA 4IUOA 4JY9A 3LCXA 2PRHA 4FNPA 4UMAA 2EPHA 2FPYA 1Z42A 3PBUA 4JDYA 2TRSA 1T96A 2Y88A 1NFBA 1GZGA 4FO4A 5D2TA 3PBYA 1S5WA 3W71A 2H90A 1FQ0A 2J6XA 3LHTA 1JUEA 3ZR4A 3W1XA 3W2NA 4QIUA 3R5EA 4QQ3A 3NQ7A 1L6SA 2JKPA 4FHAA 3QC3A 4IMCA 4LVDA 3P62A 2G95A 3P81A 3BV4A 3L66A 4FXSA 5K4XA 1TQJA 1XDMA 5K9CA 5AFDA 4OV4A 1C29A 3EWWA 2E5CA 4XKYA 5G2IA 2G5WA 1Z44A 3GKFA 4PODA 2BLEA 1GPWA 1MEIA 3ABRA 3UY7A 1ZJIA 1OYCA 2FIQA 1B9BA 3RLUA 4CQ9A 3PR2A 1S5TA 3GNDA 3MHFA 4WD0A 2J88A 3FS2A 3W7CA 3VFLA 4UTWA 1H7RA 1QOQA 3DFTA 3C61A 4S1FA 2W0UA 4JTFA 5F4XA 3N2XA 3HG2A 4O28A 4K39A 4NT0A 3UD6A 1XC4A 1CW2A 3C2RA 2OJPA 3QZEA 1RPXA 2GVJA 2VENA 4O1BA 2Z1BA 5AC6A 1KTBA 1TTPA 2R91A 2Y63A 5CZ0A 2ATMA 2VFFA 1VS1A 5DY3A 4PH6A 4ZVJA 3OEXA 5CSSA 3BG9A 1PHWA 3KVJA 4LV9A 3STCA 2V5BA 2VEIA 1H7OA 4YMZA 5CZSA 3M5XA 4PA8A 1PE1A 2Z6JA 1NF0A 1L9WA 5D04C 4HNUA 3W1MA 1RQBA 1RV8A 4IMEA 3ABQA 2QCNA 3FKRA 3FJLA 1ZAIA 1TQXA 1MSSA 3PBWA 2J24A 3R12A 4XKYB 2JKEA 2QUTA 1FUYA 3TIMA 3N14A 4RXGA 2E5BA 4LY8A 3HPSA 1W56A 1OYAA 1LZOA 3B8DA 3L65A 1FDZA 1Q3NA 4AEOA 5EKYA 4AF0A 2BZNA 2NUYA 4FXRA 2V2DA 3C6CA 5D30A 2E68A 3PWAA 4Q33A 3G0XA 3B0VC 1RQHA 4S2CA 4JYDA 5KTLA 3W1AA 3TR2A 3TMLA 1C9DA 3M43A 2XN0A 5F2GA 1VHNA 1XBZA 3TQ0A 2B7PA 3MMTA 3M44A 2Y6ZA 1JRCA 2QCEA 3DFOA 3ANYA 3S1UA 1I8JA 1VYPX 1OFRA 1QPOA 2H6RA 5CPMA 2XN1A 2HTMA 3MI6A 2CZ5A 4PCFA 5G2HA 2Z6IA 2ZZ7A 2NV2A 1GVOA 4FNQA 3LHWA 2WV8A 1TCDA 4N4PA 3NPXA 4RZ5A 5HWMA 1B4EA 4M6QA 1JUKA 5H91A 5D37A 3P8IA 3YPIA 2LLEA 5AYXA 3JS3A 3TAKA 4IWWA 3ELFA 4AWUA 1K02A 1ZAJA 4L4MA 4XTDA 3NL3A 6ALDA 2H3BA 1QDSA 5F1VA 2YFOA 3G0SA 2X1UA 1YLVA 2C16A 1NSJA 2QJIA 2TPSA 3W7MA 1ZALA 4X3ZA 3WFAA 3S1VA 3S0CA 1Z48A 1DVJA 1N55A 4MIMA 1DKWA 1YTKA 1WBHA 5F2LA 2Y7FA 3W73A 1XBYA 3FOKA 3PBVA 3W2MA 1UUMA 3MBFA 4Z08A 2P10A 1H63A 2I1OA 3KVLA 2V30A 3O07A 1YPFA 2C18A 4ML9A 4LS2A 2C15A 5LNVA 1ME8A 3S8HA 4Z1CA 1W31A 4C1LA 3DBPA 3CT7A 4DO5A 2PCQA 4UTUA 2DP3A 1R30A 1TB3A 3BARA 3NQEA 4O10A 1V5XA 4JDBA 3EEGA 4XBSA 4X22A 1DBTA 3W1RA 2HSAA 3CEUA 2WSRA 4D2JA 3I7RA 1IIGA 4OU1A 1O60A 4NZFA 2E6FA 3LGEA 3NPVA 4X9SA 5D2WA 5C55A 1LRTA 2C14A 5HNRA 2G97A 2QCMA 4QAIA 2FTPA 1THFD 4NJIA 3M7WA 1YADA 2RDWA 1H51A 4JIPA 3GZ3A 1QO5A 2ABAA 4K37A 3NPUA 3UXAA 1AW2A 2VEPA 3LM7A 5G4EA 4UFHA 1O94A 4FNSA 2QCFA 2C6QA 4UIOA 3C2FA 2V8ZA 3ATYA 2JGYA 2J27A 4FX7A 4WOQA 1YXCA 3O06A 3IIVA 4LRSA 2QCHA 4L4LA 3NQGA 1H1YA 3L9CA 4DXVA 3WK3A 3GIYA 3KRUA 1GJPA 2C0AA 1X6UA 1OK6A 2Y7DA 3L2IA 4PL1A 3TE9A 2ZRYA 1OFOA 1GWJA 2W79A 3W1NA 3IIPA 1VCVA 3KAOA 5D09A 3UWVA 1KM1A 3S1XA 3U8GA 1N8FA 3LLDA 2QR6A 4M5PA 3O63A 2OMAA 5U7SA 1NEYA 1YDOA 3GYEA 3HQ1A 4RXFA 3TQKA 3PC0A 1EUNA 3O1NA 3TW6A 1ZAHA 1YPIA 1G7VA 2A2IA 3HPXA 1XCFA 1H7NA 1A5CA 3NM3A 1O95A 4RR4A 5HWJA 3TC7A 1I2OA 2EHHA 3L0KA 1QFEA 1W5QA 4FNRA 4M6PA 3RLVA 4DPQA 1SZFA 4IX2A 3MP4A 5A5WA 2ZRZA 4H3DA 2ISWA 4AMAA 5ABTA 3BLIA 2HMCA 3SR7A 3G8EA 1PIIA 3GR7A 2WJZA 1HFBA 2ALDA 2C13A 4GUFA 1IXQA 5C2XA 1G69A 1P4CA 3JR2A 4JTEA 3W07A 5HR6A 1FY6A 4I7WA 4IXHA 1CI1A 1J5TA 1I45A 2X1TA 3DHFA 1SO6A 3DU0A 2V0TA 4E38A 4DPPA 3SI9A 1KFJA 1ZFJA 2RFGA 4Y96A 1KV5A 3BK0A 4ADTA 1UJPA 1E51A 2X1SA 1VRDA 4O8RA 2P0OA 5AN7A 2VFEA 5EBUA 2PRMA 5FF0A 3VI2A 1H62A 3HGRA 1L6YA 1A5SA 1AW1A 1A5BA 2P1FA 2NUXA 4CQ8A 3QW4B 1FWTA 4YXGA 1VCGA 4MZ1A 4M7SA 2V81A 4JX5A 1Y0EA 1OFBA 1OHLA 1PHQA 1JCMP 4WX2A 3HO8A 1A50A 4A29A 4WY0A 2V5LA 4Z0SA 1BEUA 2RKXA 3GAYA 3B05A 1QR7A 2YW3A 1GVRA 4CLMA 5AB3A 4IPIA 1FDYA 4ORIA 2YYTA 5AYYA 2FJKA 4JX4A 1SW3A 2RHGA 3ATZA 4ZZ9A 4N9DA 3GDTA 4GNJA 3SW6A 4C1KA 3LI0A 2GPTA 3PG9A 3UWZA 1GEQA 3RF9A 3W22A 3L67A 3K30A 5BMXA 3B06A 3QPZA 4ALDA 2EF9A 4GRSA 4KFOA 2GJNA 3C2OA 3CWOX 3A22A 4ONVA 4Y6GA 1IXNA 4GWEA 3W2KA 1P0NA 5AHFA 4DBEA 2QCLA 3BW3A 1QPQA 4XUGA 1GYNA 2QDHA 4Z1AA 1GTEA 4NNCA 3WJYA 3V1PA 4NX5A 4KWVA 1J4EA 2QCDA 3CC1A 1JVNA 3UWYA 5BOOA 1H61A 4UFJA 3TXZA 1W3TA 2QDGA 2A5HA 2JKAA 1KFKA 3EX4A 4O1CA 4OGZA 3TSDA 3HPZA 4LVFA 3L0GA 3FLUA 3M1ZA 3EWXA 4Y9AA 1LBMA 2O7SA 3TSMA 4M7TA 3P60A 5DXYA 5G4WA 1F6PA 1W0MA 1VC4A 4WY0B 4O53A 4XTIA 3B4UA 1VPXA 1EWDA 4AHPA 5D05A 3EX3A 1KLYA 2QAPA 4FB7A 1F5ZA 2FB2A 1DORA 4IGHA 3GXNA 3LRLA 4HIBA 1EP3A 2HS8A 1ADOA 1ICQA 1W5NA
chains in the Genus database with same CATH superfamily
4HOWA 4IOTA 4ES4A 2OX1A 1G01A 3CZEA 5C9UA 2EAWA 1O5QA 5BW6A 1E43A 4L6OA 3T08A 2WHKA 1KLZA 3CEPA 2WHMA 1NWSA 3A21A 4ZQCA 2Z2AA 4N6FA 3DI1A 4DJED 1GYMA 4QS6A 3GYCA 1E6RA 1VEOA 3E0LA 5DMLA 1B3ZA 2WZMA 3T44A 1NY1A 4XKMA 4E8GA 1KQZA 2J9YA 1V02A 2A21A 3DAQA 5HJLA 4FSAA 1DWHM 3W1TA 3N4FA 3BLPX 2D0HA 1Z69A 3IWPA 1QPRA 3B4YA 3BGJA 3A23A 3TTSA 3NO3A 3BG3A 3PB0A 4HYWA 2ASHA 2NWSA 4L6DA 1FKWA 3QEZA 5IM51 1FH8A 1FHVA 3GNNA 1ONRA 5AYZA 1WE5A 4YCOA 3MCOA 3SUVA 1E9YB 4ZQRA 3RCYA 5HK4A 4YN5A 3FK4A 3KWSA 3M5VA 4BHYA 1XLMA 1OF8A 4PULA 2X1RA 3FFSA 5DBUA 1ISWA 3ZXWA 1DJHA 5E0KA 4XD6A 1CECA 4MPKA 2XJ7A 3FAXA 1KTNA 4QNEA 4M0XA 3HM7A 2WC7A 2DZPA 1KRBC 4JIQA 4L64A 3LHYA 3E2RA 1NM9A 1QNQA 1WQ5A 3H4XA 1BPLB 1TX0A 8XIAA 3W1UA 3LRKA 1MRQA 3BICA 1QW9A 3WJZA 3VFCA 4A3UA 5EL1A 4AH7A 3NEVA 5F4SA 4DUVA 3EMCA 5HNUA 3EDEA 1E0XA 2X8RA 4A8LA 4KCWA 3LCHA 1VHCA 2ZZ4A 4GQRA 2NLIA 1C8VA 1DHKA 4YIWA 3IRDA 3CUZA 3CH0A 3CTLA 4GI4A 1TYGA 3F4DA 1OGBA 3N1AA 1TIWA 4ZO8A 2BVTA 3UZZA 1A5OC 4G5DA 2QV4A 3TFXA 1F2JA 3N11A 7TIMA 1L6FA 3U48A 4PUJA 4N42A 1RSCA 4WSHA 4NJGA 3IRSA 4I9TA 3TN6A 2ZRUA 4CQBA 4MJMA 2DY3A 3EB4A 1D7FA 3TW9A 4DBDA 3EB2A 4MKVA 5BCAA 1J0IA 3CPRA 1UMYA 3LTYA 2UY3A 3P3BA 4KW2A 2ZZ3A 4UFLA 4NAEA 5T8GA 3UCQA 3BW2A 3PY2A 1E1CA 4OKDA 2Z29A 2NUWA 3QLLA 3BZJA 1V3JA 2GQAA 3TDFA 4B5VA 2VEMA 3ARSA 3FIGA 3TXVA 1QU4A 2YB4A 3GTHA 3CK5A 3G8RA 3LS9A 2X2GA 4NF7A 3RXZA 3MCMA 2GVLA 1SFLA 4D71A 1K8ZA 1QTWA 3GXTA 2BOFX 3T0TA 2RUSA 3KBWA 3ITOA 3QBUA 5AVNA 4MYXA 4PMQA 1XSKA 4B3LA 4UB9A 4WIWA 5CKSA 3T4CA 2C8NA 1U2YA 4RV8A 5C8BB 3SCRA 3GNOA 3KOYA 2E9LA 1OM0A 5CPNA 4M56A 1RBAA 4GIEA 3EWZA 4NAEB 4FEZA 3H53A 4JIRA 1EJTC 2CLEA 4DHGA 3AOFA 3M46A 1J11A 2DFAA 3E02A 1E1CB 3NQFA 3AIRA 2BXYA 3N2TA 3VIHA 3OB8A 1R3RA 3CTTA 3UETA 1VZWA 1GZJA 4AQLA 2WMHA 3WD1A 3GK0A 5A6MA 3PB2A 3WUEA 1ZTVA 4GUGA 1TV2A 1PDZA 3OU8A 4J7RA 3CZ8A 2FLIA 4K1WA 1VH7A 1Q8JA 1FWIC 4PB3A 2NQ9A 3CAQA 5EBAA 4H8UA 1LWIA 1P5BA 2PTZA 3PULA 3WLSA 2NX9A 1NF7A 3KP0A 3NGFA 4AFYA 4H2HA 3T78A 5H6HA 5FF4A 3D3AA 3I65A 3WJSA 3G22A 3W2JA 2FHCA 1I2QA 2R24A 5CPLA 2J4GA 3PUOA 3VIGA 3PZIA 1HX0A 4C6NA 1YXYA 3UGVA 5JBFA 2X41A 3S2CA 2ZRXA 5FL1A 4GKLA 5HPCA 1E0VA 3VILA 1U1HA 4P7RA 2FZMA 3N34A 2XHYA 5G1YA 4J3TA 4XG1A 4HHLA 5FF7A 1SR0A 3B3DA 3LB0A 1EJ7L 1OJXA 2FMNA 2B4GA 1EJUC 4DM2A 4XVEA 1EHNA 1RCQA 3NSXA 3MSDA 4CU6A 1POJA 3O6YX 3R0KA 3KE0A 1J0YA 5D2VA 5LGXA 1U33A 1G5AA 3CV1A 1BFNA 2D0GA 4KFPA 4ZL1A 3VOCA 3Q65A 1X6NA 1XDLA 1MW2A 2UWFA 5AHEA 2GUUA 1ISXA 3ZJKA 1VFHA 2XFWA 5HWNA 3IK2A 3D47A 1GKPA 5MKGA 4PCPA 2A3CA 3VNIA 1BF2A 3AIWA 1UW9A 1K9FA 3TWAA 3VNJA 1EYEA 2E4TA 1GTHA 3AMLA 5GNZA 1ESWA 1ODZA 3HPFA 2W4XA 2CZEA 2RDTA 3WFZA 2X1IA 1EC7A 1XLKA 3WUFA 5CGTA 1JYXA 3WLIA 3L4YA 3S47A 4MJ4A 4JTHA 3W24A 5A69A 1RXOB 1B90A 3MUCA 3MUXA 3U7BA 5AHLA 2DZAA 3SFKA 1NARA 4BEUA 1EIBA 2PDXA 3EDJA 3LDVA 4QE4A 3H70A 4MPQA 3SRHA 1SO5A 4DX3A 4DEFA 3TYDA 3W01A 3GRIA 3MWAA 2R9RA 4CQCA 1H1NA 1DYSA 4DO6A 1YDNA 4JOMA 3C52A 4D6FA 1KFCA 4Q4KA 4A3YA 3NQDA 3GWQA 1LLZA 4FOUA 3UJ2A 8TIMA 1QASA 2DV0A 3A4XA 1TPC1 4DYKA 5MKGB 4A8IA 5I77A 1F8IA 2X16A 2R1NA 4IMGA 3MCNA 1QBAA 4GJIA 1MW3A 2IQTA 3KBNA 3WQWA 1KRAC 4G7FA 3ITYA 4RV3A 1VJIA 2I56A 4RZ4A 4IT1A 3VGEA 1E3XA 1UKPA 1XX1A 1JZ6A 3TC6A 3KX6A 3IAPA 1JYVA 3QHMA 5J5RA 2XH2A 2V69A 3WQ5A 2D1ZA 2BGSA 5I2UA 1UUOA 4FIRA 2O9RA 3S2NA 2DGAA 1FCBA 3L68A 4E3TA 3KCOA 3ZWSA 2ZZ5A 3GUGA 2GGIA 3L2LA 4EPBC 4ZODA 2OCZA 2CZVA 3CJPA 3VGGA 1YTDA 3VPLA 2BS9A 2WM1A 1CIUA 1KKOA 1LL7A 1G7UA 3N9SA 1PCKA 1JF6A 3KL5A 2PMQA 1L0PA 3A4WA 3BOFA 4M81A 4L4PA 3QY7A 4V27A 3EYPA 4GIAA 1QNVA 4J3VA 5CC6A 2YA2A 2WSQA 1S2UA 4PTMA 1GKRA 4A35A 2BY2A 5T9CE 1G1YA 3WLJA 4EWJA 4WXZA 3SECA 3W7EA 3UWQA 3TJLA 4BF9A 4Y7EA 3WQFA 3ARTA 3DXIA 1IZJA 1M7XA 1R5YA 5DXXA 1CXKA 3UFYA 5E9XA 1D3CA 1GQNA 1E6PA 1NH6A 1MQPA 3OODA 2AGKA 4AZ7A 3TAOA 2HEJA 2RDXA 4XD4A 3K4WA 1TO3A 3CZKA 3MVIA 4JKMA 3P6LA 1XL9A 4NZ1A 3T40A 4Q8OA 3FHQA 4HNOA 2L5HA 1K7FA 3SBFA 3K1DA 3FEMA 2PDYA 3CB3A 3P80A 4ADUA 4FIQA 3M0KA 3EAUA 3IIOA 1YNQA 4HMEA 3WQ8A 1G67A 3QYSA 2E3ZA 2GQ9A 1QNPA 2PI6A 4I5UA 3SJNA 1RVGA 2Q8XA 1VPQA 1PO9A 3EOSA 2OSXA 2DZVA 2INFA 1DJGA 2G96A 4AZ5A 1Q45A 1ZJHA 5CJMA 1NVMA 1XYZA 3AJ7A 1A49A 1IIHA 1DQUA 3G3DA 3VIOA 3IVSA 4AZIA 3FA4A 2AMXA 4GX8A 1QAPA 1QOPA 3LNPA 5I3IA 3UZXA 2VGBA 5FF2A 3AQUA 5L9FA 5CC3A 3EXRA 3TEVA 1JNEA 4H8NA 4K8HA 4FF5A 4BR1A 4FAMA 4AW7A 4HA4A 4Q8MA 3URAA 1RCXB 3RK8A 4PMVA 3K8LA 2FQIA 3PN8A 2F38A 1E15A 3TJIA 1LT7A 2CLMA 4RLIA 2OO0A 3WBWA 5G1TA 3M0JA 1S2CA 1J6OA 4C6LA 3BCDA 1A3WA 4ZCWA 3OIHA 3L0NA 4IMDA 5FEPA 3I4EA 1ZY9A 3MW7A 2Y8UA 2P3ZA 2DJXA 4JZ5A 1QK0A 5BU9A 4UMBA 4DAFA 3R2GA 3W76A 2WNNA 3WH7A 3NEHA 2CIPA 4JTRA 4PEKA 4MKNA 2UBPC 2VR2A 3KHDA 4JL1A 1Q7MA 4RDWA 2NZLA 3OVQA 1JI1A 5HDRA 4DF2A 1RLCL 1PZ3A 1OIMA 8CGTA 2GFTA 1EL3A 4JCMA 2QF7A 1XH2A 3TYCA 3AXMA 4YVXA 3SIZA 1H60A 4JS3A 5BYWA 3CO8A 2HQAA 4MWAC 2H8ZA 4JTJA 1GOXA 1KQYA 2J7HA 3VKJA 3VCRA 4U28A 4B9YA 2J7FA 3QMSA 3GIPA 3HMCA 4PMYA 4O16A 4ZB5A 3I6TA 2YZ5A 1XYFA 3WLLA 3J7HA 2E7FA 3M07A 3DOPA 1PBGA 5KMYA 1M6JA 3LYEA 4QSFA 3IGHX 4HNVA 1AL7A 3L5AA 3SCVA 3UPBA 1AK5A 1Y65A 5AVHA 3MKVA 3SY8A 2QUUA 4FX8A 3RIKA 4N9CA 2WWDA 1MFUA 4HZ8A 1SJBA 3GVGA 1RALA 4EACA 1P1MA 4GCXA 1US0A 5JUVA 4HSHA 1OY0A 2AAMA 3TVAA 1RJPA 2Y7GA 3GXPA 3VNLA 1T8QA 2XGBA 4GZIA 1VLIA 9CGTA 3MZNA 4ZQOA 3STEA 1NAL1 3UR7A 2X09A 3ZT5A 4PTNA 1OX6A 4ORMA 4IG2A 3VCCA 1BWLA 3SN1A 3GW0A 1QI2A 3VDAA 1LG1A 2ZA1A 4PCTA 4YVPA 4CNTA 1V6YA 3G1VA 4IIBA 3ONCA 4F9DA 1QI3A 1ODUA 1FH9A 5TBOA 1OSEA 4HZ7A 2C3ZA 4MNLA 3P61A 5KINA 4PUKA 2FZ8A 4DZAA 4H6RA 4GUJA 3M5ZA 4GBUA 1R47A 3LK6A 2O55A 1WDSA 1XV8A 3GSMA 2WPBA 3LSCA 2BB0A 4GK8A 2QUNA 3QV7A 1GG1A 4L9ZA 1R7OA 4OT7A 4Z17A 4KGLA 3F03K 4KWWA 1O5KA 4KS0A 2CKSA 2XIOA 2ZQ0A 2A79A 5KITA 3NQVA 3C56A 4ICMA 1QW7A 5K9XA 3INPA 4R27A 1B5TA 4IG2B 2I5QA 1EA9C 5AYBA 2FZ9A 5FSDC 3WL1A 4NU7A 3HMJG 4NIRA 4MHBA 1GJUA 1WDPA 4PMNA 1EBHA 1LQ2A 3VIIA 4W88A 4NYUA 3ID7A 4BK9A 1CXIA 4LS0A 3B40A 2O4QA 3W87A 2VELA 1K77A 3O2LA 3VIMA 4RDVA 2HE8A 3BMVA 1E4NA 1BVNP 4O1DA 2QCCA 1F4AA 3S1WA 4PBGA 1QRQA 1ZPTA 4GYKA 4DLMA 4GYJA 1U22A 1ZGDA 3QR3A 2GGGA 5D9MA 2R94A 4LT9A 1OG0A 4IHCA 3N29A 2VDIA 1BXNA 4BQ4A 1MXSA 3CWHA 3G18A 1TZ9A 2VEKA 2JK2A 5LZLA 1GQKA 1XRSA 3MSRA 3P67A 4LCQA 5T91A 2ZA3A 4XQ6A 1AL8A 4GGHA 3T4WA 3SUWA 3VTRA 4DNMA 1TMLA 2GUYA 4E2BA 3VX1A 2O4MA 1IWBA 3EXTA 4CNUA 3TU9A 3GXIA 2XN2A 2FGBA 4NJHA 4Q4MA 2Y85A 1E70M 4Q8PA 1XUZA 3LY0A 4YTUA 1R2SA 3W00A 5A6BA 3MSYA 4IZGA 4DJDD 3RLGA 2Y5SA 1GVYA 4IMFA 5FJTA 3SDOA 1SO4A 3QZAA 1M53A 1LOSA 2GVEA 2CZFA 3ARUA 1L8PA 4OV9A 4M29A 3FA5A 4PCNA 1MNSA 3DC8A 2J8FA 5U4NA 3GC5A 1FCQA 4K8GA 5EYWA 2ZE3A 1C9WA 2VMFA 2P8BA 4EAYA 1HG3A 4JIIX 1QJWA 3E49A 2DSKA 3OOQA 1DWFM 1MEHA 5E0FA 1DV7A 1X1NA 2AL1A 2J74A 4TVDA 4K7YA 3SJ3A 4JQ4A 1SQ7A 1OABA 3AU6A 3WLHA 3GX9A 4HNNA 3ITLA 2YA1A 1J93A 2WXDM 3PTKA 2NX3A 3QOKA 1E6QM 3ES7A 4KEUA 5E9AA 4AD3A 2YXOA 3GU1A 2ZFAA 4PTXA 5D9PA 2IKHA 3E2VA 1NDWA 5H8MA 3M0YA 2FH8A 4W8BA 4GZ7A 3WYZA 4GC4A 1WZKA 1YEYA 3QQWA 1XISA 1OQFA 1AD4A 3IV8A 2OGYA 4B5TA 5CGMA 3NGJA 4I7VA 4WOZA 2DIJA 3WDRA 2XSXA 3VX0A 3U4AA 3O16A 3F5LA 1W1A1 1I9CB 2HRWA 3S6TA 2XVLA 3AZRA 2ZZ6A 1SZNA 3AIQA 4GXMA 2XSBA 5M17A 4DB7A 3SZ8A 4H7ZA 4LSBA 1KWGA 2I9UA 3EWUA 2YL6A 3KVMA 2A0NA 2OXNA 2Y5JA 1RK5A 3PS7A 4GY7A 4AAJA 4KF1A 3WLOA 3PNUA 4AIOA 3EDFA 5HXMA 3KTSA 3CZGA 2FZDA 5DY2A 1LOQA 3E96A 3PZUA 3LCIA 4YYCA 2DPEA 2J79A 2BASA 1E72M 3NTYA 4H6EA 4A3RA 2V67A 1O66A 1F6YA 3BAWA 2Y88A 3QTGA 1NFBA 1GZGA 1XIBA 2H90A 1FQ0A 3PPCA 1YX1A 3W2NA 3QGVA 3NQ7A 1GJWA 2P5NA 1L6SA 1BHGA 4QROA 1CLKA 3SCTA 3QC3A 3RGTA 1V3IA 2YLLA 2DW6A 3BV4A 3L66A 2WMIA 4R7WA 4FXSA 5JXQA 3FJ4A 4JQ2A 5AFDA 1YNPA 1A5NC 3EWWA 2E5CA 5HPOA 4XKYA 2G5WA 1Z44A 1AH4A 3H2NA 4GNKB 1NQ6A 3TZFA 1EX1A 3EKGA 1B9BA 4XV0A 2VR5A 2J47A 3VFLA 4CUCA 3B0YA 3C61A 5F4XA 1KGWA 4GACA 5DANA 3K8MA 4NT0A 1XC4A 1CW2A 3VD3A 2PDIA 3LENA 1AD1A 3M0VA 1OT2A 1JPIA 2GVJA 2XDFA 3AIVA 4O1BA 4GYPC 5AC6A 1V3MA 2Y63A 5CZ0A 1VS1A 4WDUA 2Z24A 3T0DA 3KVJA 2J7EA 2PD5A 3M64A 3STCA 4E6MA 2WB5A 3OGRA 1H7OA 4L61A 2PEVA 4GH1A 4YMZA 1PE1A 3SGGA 2EBNA 1NF0A 3WFLA 4NZ4A 4MWAA 4MMWA 4MNJA 5D04C 1RQBA 1RV8A 3ABQA 4F0SA 2G37A 1MSSA 4C6KA 4XKYB 2ON3A 3ARWA 5CXPA 1BD0A 4ZE5A 1PZ0A 3N14A 2E5BA 4HA1A 4PRRA 3TTYA 1B1YA 4PSPA 3EBVA 1JZ2A 1OYAA 4OFCA 3V18A 5BXPA 1Q3NA 4ILSA 4C6FA 4Q33A 3G0XA 2XFYA 3A64A 1H5VA 5FACA 1RQHA 1MQQA 3UR8A 2VCAA 3TR2A 3TMLA 1C9DA 1NTHA 4OOUA 1IR1A 1VHNA 3N4AA 1SMAA 2VQUA 4REQA 3K2GA 4YYFA 4D6HA 3TTEA 2Y6ZA 3FDGA 1JRCA 1UKSA 4HPHA 1VYPX 1OFRA 1WCGA 4HK5A 3QY8A 2HTMA 3HV8A 3CV6A 2CZ5A 1T6MA 2ZZ7A 3BAIA 3HFTA 2BHZA 2W62A 1YHTA 1TCDA 4MWAB 3NPXA 5HWMA 4M6QA 1JUKA 1MW1A 5H91A 5D37A 1M68A 3LQGA 4G6CA 2YKKA 3ELFA 3TCSA 1Z32X 5F7UA 3E5BA 3T05A 2EG6A 4XTDA 4XZIA 2QPSA 2JEPA 2YFOA 5B7YA 1YLVA 2C16A 2TPSA 4V33A 3S0CA 2QXWA 4FP1A 4MIMA 1TZ7A 1XBYA 3NYDA 4NY2A 3W2MA 2POZA 1EO7A 3MBFA 2P10A 1QT1A 4KRZA 4PMUA 2YCLA 1YPFA 1M9HA 2C15A 3S8HA 4Z1CA 1SVDA 3ZZ1A 4C1LA 1HGYA 1E0WA 5AC4A 3CT7A 4REQB 2IPJA 4DO5A 1TB3A 3NQEA 4O10A 4IFKA 3EEGA 1DBTA 4EP8C 4D2JA 1IIGA 4CQDA 1IWPA 4NZFA 1UUQA 3NPVA 4HPNA 1LRTA 1FWEC 2FTPA 4NJIA 1KXVA 1QO5A 2WZIA 1SMDA 3UXAA 2FGLA 2P0IA 1HF6A 3UESA 2Z28A 4FNSA 4HD5A 3GXMA 1EHAA 2ZUSA 1W2PA 4UIOA 2QGHA 3SUSA 2WHJA 2VC7A 1YXCA 1C8XA 3IIVA 2V38A 4W4QA 4L4LA 4Q8VA 3PZMA 1X98A 3DG7A 4DXVA 3KRUA 2C0AA 3FSTA 3VU2A 2Y7DA 1HL8A 4F2TA 4J5NA 1GWJA 2YCLB 2UY2A 2DSUA 4PRTA 1Q2RA 3KAOA 3LU2A 3UWVA 2DSZA 3GNRA 5FJJA 2NSXA 1N8FA 1NEYA 2J7DA 3R58A 4IFKB 4QGCA 4ATWA 3OA5A 3PC0A 3TW6A 4ZFCA 1YPIA 1JDDA 1G7VA 4ROQA 3BURA 2REQA 1XCFA 3HFYA 1P0BA 1UD5A 1O95A 3AS3A 1AUSL 5DRCA 2XM1A 2JE8A 2D0FA 2CESA 2GGEA 5HWJA 1PX8A 4FNRA 1SZFA 3LMZA 3MP4A 5A5WA 4H9ZA 5ABTA 2BBFA 2VRJA 4YTTA 1XLLA 1ZL1A 3ES8A 3CL8A 3GR7A 1T5AA 2INZA 4ZR8A 2C13A 3Q45A 2EJAA 3JR2A 3QHOA 3WQVA 1E71M 1WKDA 2VRKA 3W07A 4IXHA 3T81A 3FV9A 3IS4A 2V0TA 3GH4A 1RA0A 3EOUA 4E38A 3VA8A 4DPPA 1F8MA 5ABEA 5AZ1A 5JVLA 1VRDA 2P0OA 3L7RA 2VFEA 4DN1A 4Z2IA 3B8SA 1Q6DA 5FF0A 1H62A 1AW1A 1N2VA 4LAMA 1EBGA 1VD6A 1Y5WA 4DUOA 4YPJA 1ADDA 1S2WA 2REQB 4F0RA 2V81A 1PHQA 3HO8A 5FJPA 1DE6A 4G8TA 2V5LA 1BEUA 1EOKA 3GAYA 4L1XA 2G4JA 1XH1A 2ACRA 1CT5A 2VZSA 4JX4A 4H83A 1E1FA 3AHZA 4ZZ9A 3MC5A 3IUDA 3KWXA 4C1KA 1EJXC 5BOEA 3CUFA 3R79A 2BHUA 4QDPA 3NUKA 1TWIA 2GSJA 2ZICA 3W22A 4JKKA 1UKQA 1J0HA 2PC8A 1ZUAX 4F79A 3CWOX 4Y6GA 1VEMA 3STPA 3BW3A 1D8CA 2JF6A 2W63A 4XUGA 1VIZA 1GTEA 3VOIA 3WJYA 3V1PA 1IV8A 4KWVA 1J4EA 3ZR5A 3CC1A 2OPJA 1KBKA 3S5SA 3ZYZA 4Q8QA 3TXZA 3GR4A 2A5HA 3EX4A 3LZ5A 4NHVA 1ISZA 1LLOA 3FLUA 7A3HA 2O7SA 2NQHA 3TSMA 4M7TA 1XD0A 3OLIA 5DXYA 3TYZA 1F6PA 3B8UA 3GIQA 1VC4A 4MGGA 4XTIA 4IJCA 1VPXA 1W32A 1EFZA 4V1YA 1W1IE 2VVNA 3WBEA 4AD2A 1CTNA 1DORA 1E4LA 3ANVA 3GXNA 2WVSA 5M5DA 3GM8A 1ICQA 1L6WA 4EIVA 4GX9A 4G7EB 3UT0A 1HL9A 3DFNA 1AFSA 3LEPA 3S2MA 2J8GA 4H41A 1XLIA 4D6EA 1EF2A 3ZT6A 3QLDA 4FNTA 1FXQA 1ZZMA 1Z6KA 1WAUA 1KM0A 1TFVA 3REQA 4UOJA 3FJNA 1ML1A 3SGUA 3F4NA 1R38A 4N4QA 1N82A 3CHVA 1O5RA 1XBVA 1J5SA 2UY4A 2CHRA 4XO7A 4ZEPA 3S6OA 4PUDA 3HB9A 4PB4A 4G2DA 3T2OA 3T8LA 3T2QA 1LP6A 4UTMA 4J3WA 4P8VA 2CBJA 2DZUA 2VDHA 3THQA 3IIZA 4ROPA 1FX6A 3MA8A 2YGYA 2VYOA 2HVMA 3MO7A 2EQDA 2P88A 4XO6A 2VRQA 4HK7A 4C6CA 2BX7A 2V5KA 1V8EA 2WYSA 2RGMA 3QMRA 2BVDA 2Z2UA 4R88A 5EGRA 3CHCA 5BRPA 2WVTA 4GYPA 4HMCA 2ZBTA 1LROA 1WDWA 2QEZA 1VBGA 1J96A 1PKLA 1WKYA 3C2YA 3REQB 2Z7KA 4JXCA 1VFLA 4GJ1A 1UH3A 4BWLC 4L80A 3BSHA 3ZVIA 1PCWA 3CL7A 4NZJA 2QKFA 4TX9A 4DELA 2BHYA 3QV8A 4U31A 1ZBCA 3AWNA 1XH0A 4IICA 1XQLA 3WBXA 1IT8A 2ZE0A 3BDKA 4JCLA 2ZX8A 3ARQA 4FNUA 2VXNA 4LF2A 4Q32A 4EPEC 1KCLA 3RG6A 3P93A 1JPMA 3RRAA 1YIXA 2OEMA 2OEJA 2J9ZA 3QV6A 3QPEA 4AVOA 1VEPA 1CBGA 4DI8A 5D02A 1G94A 1OB0A 3TC3A 4E5TA 3LXAA 4A2SA 3PAJA 4DJEC 3AXXA 3Q58A 3GBDA 3OW1A 3VOGA 2DJLA 2BP1A 3LCGA 3W7LA 3N19B 1W9UA 1M5WA 5HJXA 1H7XA 4JN7A 2H3DA 1I1WA 3HV9A 1KBIA 4AD0A 2QPUA 3RM4A 4I9JA 4U33A 1QWKA 1JFHA 4KIRA 2ZZ1A 1JCJA 4OBTA 1X1ZA 3XIMA 1VPYA 1O6IA 4ZGYA 3WG6A 1X8CA 4PTVA 1WZMA 4IH3A 4LTSA 4WGXA 1E5NA 4JN6A 4E2DA 2XVPA 5JH1A 3NL2A 2YPIA 3AROA 3ALGA 4LVGA 2WVVA 2NVAA 3IJDA 1R2RA 3GAKA 4R33A 2A6LA 4F0HA 3W7DA 4AYSA 5EMLA 4PGLA 2YCKX 4AD1A 5T9BG 4JTQA 1CENA 3P5YA 3N6JA 1U83A 3DIPA 3TN3A 3RX4A 3URQA 2DUZA 2EO7A 3AI0A 2PWFA 1MNZA 1OG6A 1WNOA 1G4SA 3IJIA 2X30A 3QPYA 5EU9A 3RHGA 1KGUA 2AQVA 3MPGA 3PFMA 2UY5A 4IQLA 1Y5VA 3MV11 2WMFA 4YWIA 4S3KA 1J6PA 2VX6A 3KRBA 4N7QA 4D1IA 3CS2A 2X05A 5FI8A 2WVVB 1QHZA 1UJQA 2YSWA 4JBRA 1OFEA 1ICSA 3RPTA 2A3BA 3NZGA 5JIWA 2W91A 1VGAA 1PL9A 4O1EA 3IUHA 1K6WA 5A6KA 5DMNA 1TTQA 1OINA 2XIQA 3WLKX 4Y9NA 3VD7A 1VFOA 4UC5A 1K8XA 1GOOA 5K4ZA 1M7OA 4R9OA 3KRZA 1VRXA 3DKLA 1E5JA 3VKAA 1O68A 2HBVA 3KEHA 1V0KA 2GYIA 2ZRWA 3Q94A 5CPQA 4DBSA 2DUAA 1EP2A 3AMDA 3VOHA 1XSJA 3KVKA 4FLRA 1OX4B 3EMZA 4N6EA 3TUUA 1XCXA 1X6LA 2XGZA 4GXPA 3UPWA 4ZQNA 4I7UA 2QZRA 2OR2A 1R6WA 3PUDA 2ZIDA 2C1HA 3S6DA 1HJUA 1XKYA 2B0MA 2J7BA 2HCVA 5HULA 1GT8A 4FLQA 1WOBA 3LD5A 3KZPA 4O4VA 2Y61A 4QP0A 4XAPA 1HW6A 2Z1SA 2YYUA 3AAMA 3DHUA 1IF2A 3UYIA 1HL2A 5LIKX 3RJYA 1XXXA 1W54A 3WK1A 1FHUA 1DHPA 1KCKA 4H9VA 5JBDA 4UTTC 2PFHA 5JU6A 3A47A 1K7EA 1R0MA 2GVYA 3UXLA 3A4JA 1R3YA 3F7JA 4CNSA 3RM8A 2FPVA 1LBFA 1PEZA 5KETA 4JTLA 4ZQPA 3ABSA 3WLQA 3ZJ6A 2ACQA 1K4HA 2CXGA 1B3WA 2I5GA 5K7JA 3AMGA 5KZMA 2I9EA 1TJ1A 2DT2A 3GC2A 1VENA 2HVOA 1DIEA 5C9WA 5EA9A 1HO4A 4QE5A 4E4PA 1UYQA 4J2MA 2DZTA 1XYLA 4BEQA 1TPFA 4CU7A 1TTJA 2E5DA 4QG8A 3W7GA 1AMYA 4ADSA 3LPOA 2OLHA 1EDTA 5BOFA 3AHTA 2C1IA 1AQMA 5ABGA 4KWOA 4NUWA 2YDSA 3M9YA 4CNOA 3QGAC 4ATDA 1Q6CA 3VXGA 2ZWYA 1GGOA 3SCSA 4WXYA 1V7YA 2E25A 1TWWA 4LAZA 4HU4A 1CWYA 3G1XA 1I60A 3DDMA 3RX2A 2OWWA 3RO6A 3E0FA 3U2ZA 4UMCA 3GHRA 2Y70A 4H9MA 3TSBA 3II1A 1HGWA 2ACSA 1VJSA 1Z7AA 2NQ5A 3TA9A 4LFYA 3N15A 1XLJA 3FN9A 2W9MA 5AHIA 3U2CA 2PC4A 5F2MA 3UXDA 3G3MA 4Q4RA 3CO4A 3WEOA 2XISA 2ABBA 3GDBA 4G1KA 1CGTA 4YCPA 1OGSA 4GE8A 5FSEC 1PB0A 2CWNA 1UR0A 4JR5A 1XIFA 3F4VA 1A5KC 4LALA 4PFHA 3I6RA 1TV5A 3XISA 3W86A 1TTIA 2VQTA 2VFIA 1UR8A 3KBJA 3UY8A 5BXTA 1O7AA 1X7FA 1KR0A 1TPEA 3C0SA 1FTXA 1DEDA 3G1FA 5KEZA 1V3KA 3FJ6A 4ZOEA 4MJ2A 2CEQA 1XIMA 4B91A 4MLRA 2PDPA 1H0IA 1QNOA 4RNHA 1ITXA 3RPDA 2XIMA 4KRUA 3W82A 1SSGA 3BLOA 4GFSA 5HOSA 5I07A 5BMWA 4QCEA 5HUOA 4HNCA 5C9RA 1H41A 3BL3A 3P5ZA 3FSUA 5GPRA 4P61A 5LIXX 1HIZA 4WR3A 3EX6A 4PMRA 2A3AA 1U5JA 5C7HA 3WDJA 4DJFD 3N4EA 1V02E 1BTMA 3VUPA 1BYBA 1FWNA 2BY0A 4C6MA 3KXQA 4D72A 1BSLA 3CUJA 1W3IA 3OVGA 1SJDA 1HQTA 1MFVA 3E2QA 4TV5A 4UQ9A 3SQMA 4AVFA 4PTDA 4BWLA 4V28A 2GSHA 1Y5XA 4UTLA 1VR6A 2PAJA 3V16A 3RU6A 4RZ6A 4I9AA 3N2BA 3EWYA 4XBKA 3G5EA 2HS6A 3W7RA 1KM3A 5KZ6A 2PDNA 3R25A 3W25A 1OEPA 3BAXA 1ONWA 4HHPA 5GJPA 2OQLA 1DIKA 2NVDA 2PDHA 3LPPA 4UNKA 1H2JA 4RW5A 2FZBA 2PPGA 2ZUUA 2VD8A 3NXFA 3L4WA 3ZSSA 2DW7A 3E2SA 3QOMA 2BWGA 3ZWTA 1ITUA 4IP4A 5F4WA 3IACA 4LF1A 3H2MA 5FAJA 1LM1A 1VBRA 1IQ8A 2BV9A 3F5JA 1YYAA 4MY8A 4WJ8A 5FKYA 1OK4A 4DJEA 1FFQA 4WLCA 3H4GA 3CUHA 4Q4OA 3A5VA 7REQA 4JQ1A 1HKJA 1QWGA 3WNKA 2YBVA 4DRSA 5F1UA 4W84A 4L56A 4H8VA 3V1HA 3B0PA 3THAA 2FTWA 4X0VA 1O4UA 2F6XA 1EJSC 3PP7A 3V5FA 1K70A 3VKBA 1LG2A 4B3ZA 3O7UA 4ERGA 3NXLA 4EPKA 3C8FA 1SZRA 4GI9A 4FX6M 4D6IA 4WKAA 3O8AA 4UCFA 5CEWA 3W74A 3LXBA 4XD5A 1FWCC 1UOKA 1CX9A 2PWVA 4OWGA 4AHQA 1TPUA 1DJIA 1VLWA 3H21A 4B92A 2AKMA 2NT0A 4EF8A 5C71A 3LPFA 1JULA 1EJRC 2QJHA 4H4IA 3EA1A 4B2DD 3UR2A 3HJZA 4O13A 5C54A 1HKMA 1A5LC 1FBAA 3PUEA 3UP8A 3VO0A 3BJFA 1WZLA 1EXBA 4D6CA 5ABFA 3ARPA 4C90A 1Z9AA 7REQB 2CW6A 4W86A 3F4WA 1OF6A 1KFEA 3WNLA 2YCJA 3A3XA 4S3FA 3UZYA 4CVWA 4O18A 3HURA 3Q4DA 3B0UX 4P5UA 1GOKA 1WV2A 2NT1A 4H9TA 1E56A 5I79A 1OZQA 4R7JA 2I14A 1A5AA 3G0UA 4NASA 4NKCA 2ZDRA 2JF7A 3BE7A 2WLZA 2O9OA 2WOQA 1Q63A 2ZWZA 3VKDA 3OA3A 4EE9A 4N9BA 5I5RA 2BXZA 4CN4A 3S46A 3SUTA 4KQNA 1E6SM 1I1XA 4AF0B 1E6XM 1DWIM 4GKTA 4TVUA 4IISA 1S2VA 4K8EA 1PPIA 1W1VA 3OHIA 3WJXA 1T40A 4MZYA 2KAUC 2J7CA 5ABFB 4MYAA 4XIAA 5M03A 3KBSA 2D3LA 3LGDA 4ZOCA 4KCVA 3UJFA 2Q8ZA 3APTA 4L9YA 3V75A 2CLOA 1D9EA 1S3HA 1H7PA 4B90A 4JTIA 3AYRA 3UNTA 3IVUA 3EPOA 1MUCA 4BZYA 2CLFA 4XZLX 2E40A 3KHJA 3OQEA 3M0ZA 4K68A 1TV8A 2V2HA 4TIMA 3MI2A 3ZS4A 1SZGA 3ISIX 1XG3A 1YDYA 4KGJA 4KEMA 3V36A 4AD5A 1S39A 1TWSA 4Y8EA 3TR9A 4YTRA 1AJ0A 1MO0A 5HUPA 2QGYA 5IRPA 1EWEA 2CKRA 3BG5A 3BTNA 2GJPA 3DYMA 3TW7A 2WSYA 3BJTA 1R86A 3NR0A 3W7QA 2C7FA 3EEZA 3KOFA 1MW0A 1TA3A 3AICA 1GCYA 4F66A 4QLJA 4UTTA 1XYBA 1TRIA 4BI7A 4RW3A 1C8QA 4JTAA 3UJRA 4LNYA 4BF7A 1ZCOA 1L8NA 4UQAA 3UCDA 2PUZA 1AQ0A 1LL4A 3W53A 4LUYA 3NL5A 5AC7A 4UQBA 1WOAA 2GK1A 1NP2A 2CETA 4ZOAA 3R1ZA 4PBFA 4CD4A 3P74A 4QJ5B 1G4EA 3U57A 3HGSA 1MYRA 4IGNA 4M1RA 1DP0A 1LQAA 1V77A 2OKOA 2VC5A 3L4VA 4AX7A 3KRSA 2YFNA 1ONXA 1Z3NA 1KCZA 3TNOA 2Y2WA 4BKNA 3BQ6A 1MZHA 4AC1X 3R7MA 1UR1A 3V35A 3LBCA 2OSYA 3E3HA 3HJEA 4ZO7A 3ZLHA 1TA3B 1PAMA 1DJYA 3MMWA 1J12A 4Q8WA 4JTTA 3M0XA 5FIPA 3IJQA 1QI5A 1KM4A 2WMGA 3PWGA 1I2PA 5I6SA 2CLIA 2GK1B 3GVVA 4H04A 3USBA 5JH2A 4JTGA 4Q4SA 2CXEA 3ARYA 1B57A 2B7OA 1M1BA 3EZ4A 3TLQA 1ZBKA 4LYKA 2ZYFA 9XIAA 4JX6A 1PV8A 4HA3A 3GG8A 4J3UA 3HOJA 3MWCA 3IGUA 1DL3A 1N7KA 2YR1A 2PDLA 1X8FA 1XFCA 5C9XA 2FZNA 1UPMB 1GVSA 1E0UA 1V3LA 4M6VA 4PL2A 4Z1YA 3QY6A 3LCWA 1SJCA 2R1LA 1UA7A 5I3KA 2OOGA 1UD4A 1ZQ5A 3PHAA 2VOMA 4M19A 1F9CA 1UHVA 3O15A 3CPUA 3SGZA 1ZBWA 3EWBX 2ADAA 3CM4A 2Y1HA 3WNMA 1QO2A 2PLMA 3GVWA 4W5ZA 4MVAA 3ME3A 5ECUA 4JFVA 4ACZA 5D9OA 2PWEA 1XSIA 4HBKA 3LLFA 1IR2A 3CU2A 4XVDA 1OFDA 3MMUA 3DI0A 2E0PA 4B5WA 1BQCA 5D8WA 3FX4A 4C60A 5K3VA 3L4UA 1LT8A 1D2KA 5XIMA 1YXDA 4PN2A 3W29A 3CIXA 2C79A 1YE6A 3OZYA 1XDJA 3LRMA 1OT1A 1XIJA 4LV4A 3QYQA 2O0TA 3QSRA 3A12A 2V3FA 3QMTA 1R8LA 4HZMA 3LM3A 4LCRA 3TN5A 1U1JA 3B9NA 3GFZA 1T8XA 4DBWA 4DIAA 3RRXA 3NDYA 5IBXA 4UTHA 1DQXA 1HKIA 4WUIA 3TA6A 4GOAA 3QQ0A 1XLFA 4LS1A 2Z25A 1XUUA 1US2A 2WAGA 4D6JA 1G6CA 5E5CA 2GWGA 1W5PA 4ACZB 5IFPA 2ZC8A 1GYLA 1EQPA 5LHFA 3H7UA 2WCAA 4DQWA 1TJ0A 4IUOA 2PDCA 2PRHA 3LCXA 4LNCA 8XIMA 3QTPA 4C7FA 1YE4A 2FPYA 3CAKA 2HROA 1HT6A 1RHCA 3H24A 1KFWA 4PBEA 4JFWA 2OLSA 2YBTA 3WQ6A 1GKQA 3P2VA 1Q7QA 1V0NA 5CG0A 5DRIA 3ZR4A 4QIUA 4ZFMA 3R5EA 2XZ9A 4I3GA 2PZ0A 2WBKA 4GH3A 4F3HA 4R9XA 2HXUA 4HU3A 3OZMA 1OBAA 2BY1A 4FHAA 3P62A 3P81A 1P43A 4W8LA 1QUMA 1XLCA 2PCEA 5E6YA 2BG5A 3KS5A 1TQJA 3UZWA 5I02A 1PWLA 4OV4A 1PX4A 4FR1A 4D9PA 2VUYA 3ITGA 1YW1A 4DYJA 1OYCA 4CQ9A 3VUSA 3PR2A 1S5TA 1J18A 1RCOB 3W7CA 4F4RA 2FVMA 4S1FA 2P76A 5AKQA 4BQ2A 4FOKA 3HG2A 4K39A 3BGAA 1JXJA 3QKZA 3LN3A 1Q6EA 4GD0A 3QZEA 1V51A 2CITA 4KMQA 1TELA 3VOFA 2ATMA 2VFFA 1C7SA 5CSSA 3MUZ1 4CD8A 3VGFA 4LV9A 2OQYA 2NVCA 2VEIA 1XIEA 1GNXA 2J8TA 4OOZA 2CHNA 5CAKA 3H26A 1L9WA 1RBOB 4GI8A 3UU0A 4IMEA 4GQQA 3FKRA 1S38A 1ZAIA 4Y9MA 3R12A 1IEQA 2QUTA 1KC7A 3WX7A 3N3TA 4LY8A 1W56A 1XG4A 1HP5A 2VUNA 1LZOA 3B8DA 3KDOA 2INEA 4AEOA 2Z26A 3GHUA 1GQIA 3FGCA 2BZNA 4PUEA 2V2DA 5D30A 2W92A 4UBPC 3WZ0E 3B0VC 3S4TA 1EOMA 1DJXA 4KIEA 3W1AA 1N8IA 2V3GA 1XBZA 4A6GA 1HKKA 2QDEA 2P8CA 4M3PA 2HNEA 2PODA 1F4HA 5LYRA 4QEHA 1PKMA 4HA0A 4KWSA 3ZLFA 2XN1A 4AXNA 4ZOBA 3CASA 3WF2A 4XAFA 4PCFA 5G2HA 4DUWA 2RAGA 3S1GA 4AEFA 2PWHA 3IAQA 4HU0A 3P8IA 2LLEA 4LX4A 4OBRA 3TOPA 4GVFA 4IWWA 4WSKA 4JFSA 2VX7A 4HOZA 1QDSA 4Y2WA 5FJUA 1E9ZB 4H7VA 1B3YA 3EA2A 3W7MA 1ZALA 2D23A 1DTNA 3S1VA 4CD7A 1DVJA 1DKWA 1WBHA 3FGCB 1H11A 3B8IA 4WEVX 4OUEA 1UUMA 1KRCC 4Z08A 1H63A 2I1OA 3THDA 1V0MA 3CGTA 4KESA 4LS2A 1W31A 2ANUA 1NFPA 3ENLA 1R30A 4JDBA 2PU1A 4X22A 3H2CA 2HSAA 3CEUA 1QPKA 2A3EA 4OU1A 3VVGA 3C3UA 4GVGA 4L1GA 2E6FA 5D2WA 2VM8A 5HNRA 2WKLA 4QAIA 1XW8A 1THFD 4X60A 3WLMA 1SJAA 5CLTA 4G9PA 3GZ3A 1E40A 2ABAA 1E4IA 3GVQA 3NPUA 1AW2A 4H9YA 3N6QA 3DHPA 1O94A 2C6QA 3C2FA 3E74A 1TR9A 4LANA 1IWAA 3B0XA 4U3CA 3UPMA 3L2MA 4WOQA 3VZXA 4S3EA 3O06A 2YLAA 2QVHA 2QCHA 1FVPA 2QHAA 3NQGA 4CEUC 3WK3A 1K9TA 1WAWA 5J04A 2WPGA 4ICCX 3GNPA 1OK6A 4CVUA 3L2IA 4PL1A 3LUTA 3WQPA 4A8RA 3TE9A 1MXGA 4B4HA 3T1GA 1OZMA 2FFIA 1JZ7A 3IIPA 3SCUA 4HGXA 4MDPA 2OB3A 5C2GA 3U8GA 3BOXA 4WHBA 2QR6A 3APGA 3R8GA 1QVBA 2Y5EA 1EGMA 4RXFA 3SN4A 3RLHA 5DT7A 1V3HA 1ZAHA 5AZ0A 1NDVA 4XX6A 1UP0A 1A5CA 2JIWA 3MSGA 5IHSA 1FOBA 2OG9A 3G1RA 3TC7A 1UQZA 2EHHA 3L0KA 1R3SA 2IPGA 2R82A 1XIGA 4M6PA 4H3DA 1C92A 3WF3A 3BLIA 3BSMA 3FY1A 1A5MC 4M82A 3EB3A 3G8EA 5G4HC 2WK2A 2AKZA 1ZP4A 2DIEA 1VBHA 2VI0A 1TWZA 3NOYA 5C2XA 1G69A 1FY6A 3S3GA 1FWFC 4J3SA 4HHMA 4YHEA 1J5TA 1HXJA 3S9IA 4M51A 1RJRA 1KBLA 3WENA 1ZFJA 4S3GA 3WLNA 2E8YA 3CV2A 2VZOA 5ECVA 4D6DA 2WJFA 4HVXA 1U1UA 1NU5A 4J3ZA 3VI2A 1L6YA 1A5SA 2EG7A 2P1FA 4W7UA 4CQ8A 1FWTA 4GXWA 3WQDA 4YXGA 3P14A 4MZ1A 2WCSA 2DVXA 4JX5A 5AY7A 4J4KA 1B0IA 1BTCA 3GE7A 1YBQA 4FPSA 2RKXA 1GVRA 4CLMA 4IPIA 4UOZA 2QIIA 5AYYA 1XINA 2GDQA 3SIMA 1UROA 1SW3A 2RHGA 2WLYA 3ATZA 1B30A 4EANA 4JTDA 1W1YA 4N9DA 4GNJA 3SW6A 1W2VA 7XIMA 3RF9A 3DEQA 3FYYA 4CN1A 5BMXA 3B06A 3QPZA 4ALDA 4DM1A 2GJNA 3C2OA 1IXNA 3W2KA 4Q8NA 1BXBA 4MG4A 1D7KA 1GYNA 2XTKA 2QDHA 2V5CA 2OELA 2PWUA 2F9RA 3FDKA 4ENLA 4NNCA 5C70A 1XJBA 2XIBA 1DIDA 3AMCA 1XIHA 1XHGA 2PS2A 2QCDA 3GG7A 1S2AA 4L1WA 3UWYA 2E28A 1WZAA 3GUWA 1W3TA 2QDGA 2FJUB 1MRAA 1X7IA 3HPZA 2X7WA 3TZNA 4DZHA 1I75A 4LEQA 3SCNA 2QMJA 3VIPA 5LXXA 2FTYA 1W0MA 3AZTA 1YBQB 3GS6A 2G3NA 1UC5A 3TYUA 3OLDA 3ZLGA 4AHPA 1KGXA 4WDXA 1PTGA 1F5ZA 1IYXA 2FB2A 1VFMA 4IGHA 4K1GA 3LRLA 1W5NA 2O92A 4NI8A 1QI0A 4DJDA 3RFAA 1R9ZA 2J77A 2GDUA 1ONEA 4OJYA 4POCA 4CU8A 1O1ZA 5A8PA 1J10A 4ZB2A 2CFFA 3WDHA 4Q6XA 2XUCA 2QCDB 4GY0A 4WKHA 4O1AA 1JDFA 3RAOA 3KFTA 3VE7A 3C4UA 2POTA 3EDKA 1MVYA 3LHVA 2B31A 4IFRA 1O12A 3H7VA 4GO9A 4Y8FA 5JQ9A 3OGVA 3DG3A 3TK7A 3DFYA 1WDDA 3ZIZA 2ZUMA 4P7LA 1A5UA 2YZRA 2DORA 2XG9A 1W1TA 4OQVA 1V93A 1GOMA 3PSVA 4DUXA 3W1QA 3AWOA 3E12A 4XISA 3I3DA 1J01A 1XYMA 4L5ZA 2OODA 2JQXA 1V6VA 3NO5A 3W88A 4A3HA 2FDSA 3PJTA 1I0DA 1NOFA 4H8HA 3TNBA 1V6WA 4H01A 3RILA 3NAVA 5DF0A 1DXEA 4MZ8A 4F2BA 2I7GA 3SM0A 3OHMB 3QFEA 4PFMA 4C6PA 1EEPA 2CLHA 3GO2A 4AIUA 2GQ3A 3CUXA 3UG8A 4DWDA 4JAWA 3NNTA 1XLHA 3BLEA 1OCBA 4FI4A 5DELA 3U7VA 3DFPA 4HK6A 2BTMA 4D8AA 2J66A 2ZOXA 3N73A 5HANA 4Z0JA 2ZC1A 1AA1B 3UNDA 3WMLA 3CUIA 1ME7A 4MAZA 1BKSA 4DBUA 5I3FA 4QCFA 1HP4A 4NNBA 4G1NA 3UERA 7PTDA 1IZCA 4DF1A 3C3NA 4HCLA 2QAFA 5CSUA 3T8QA 4MFDA 4YJ5A 2Y4SA 2DUXA 2VFGA 5E1QA 3HF3A 3DX5A 3U0HA 3PVFA 4JYEA 4W8AA 4O12A 4Q8UA 4WGHA 2VGFA 3EWCA 1K7XA 3DFHA 1UKTA 3M6DA 4LBSA 2ZUWA 2X42A 3EX2A 1BXCA 2BFGA 2XWDA 3W7JA 4HYRA 3LV6A 1FWBC 1IT7A 3MANA 4X0NA 3NQMA 4A22A 2GWNA 1WXJA 3HN3A 3O0FA 4UR7A 2GQ8A 2QPXA 1MMFA 3P0WA 5I23A 3CZLA 4V2XA 4YL2A 5I3DA 3GNXA 3R0DA 5B7ZA 1QNSA 1HJWA 1T0OA 5IHRA 4W85A 3BAKA 5DCEA 3EKLA 3M0LA 2NSOA 1DOSA 4BY3A 5CAHA 4OECA 3DCPA 4IF2A 2E09A 1AH0A 3AS2A 1GG0A 2QS8A 3JW7A 4LCSA 4PMDA 4RPQA 4LVBA 2GVGA 5HQEA 1PTDA 3DH7A 5DN1A 2XH7A 5ABHA 2E77A 4GHRA 1UR9A 3GHTA 4NJJA 3QH2A 1UCWA 2EEXA 1TCMA 2YJQA 3NVDA 4A3QA 1R85A 1T7LA 2F84A 3IJ6A 3PZTA 2BOEX 1TSIA 1FA2A 3QZ6A 4XZMX 2VKZG 3VZYA 1F76A 1P7TA 4LUSA 4O1FA 4O0ZA 1EKOA 1SFJA 3SCOA 1ITCA 1RQEA 2W5FA 3B9EA 4A21A 1H0GA 1BG9A 2FDMA 2J62A 3G1YA 1AW5A 4RK8A 4S3AA 3ZMRA 1XD1A 1IE7C 3NQBA 3PTMA 2A4AA 4Q4PA 5CLWA 4MB3A 4K6AA 1DXFA 2E9BA 3BGGA 4C1NA 2BGQA 1EX5A 5B80A 1UBSA 3A9BA 4JTKA 4JIEA 2OZTA 5H2ZA 5TIMA 4P8UA 3AZSA 4AB4A 4CKQA 3WL0A 1MDRA 2KZHA 3MY9A 3MYOA 1B3XA 3HA1A 3PSWA 2H9AA 1E1EA 2E9MA 4HHHA 3T55A 1Q4WA 3PZNA 2PTDA 1XCWA 4MOZA 4UUIA 2E8ZA 2E6DA 3HZ3A 5KSWA 4HB7A 2NV9A 4FXJA 3O6AA 5REQA 8RUCA 3IGXA 4TXEA 5AOUA 4O54A 3KW3A 4CEXC 1QK2A 1P7TB 4LUSB 1F6KA 3GTIA 1SW7A 3WO8A 3KBMA 1GW1A 4W9TA 3GQYA 4OHQA 5CPSA 4NSBA 3CT2A 3RX3A 4PUWA 4XZBA 1EUAA 1JI2A 1IZKA 4I5XA 1LBLA 3NL6A 1YMYA 2A7PA 5IXEA 3HTWA 3G24A 4KPLA 5LNWA 4C1NB 3MUY1 3S9ZA 1K1DA 2QW5A 3V0UA 2AQOA 1JYNA 2ZTJA 1S46A 3S5ZA 2D2JA 3LI1A 5CG7A 1JF5A 4CN6A 1W9DM 1TVNA 3COTA 4DVOA 3UVIA 4WQ6A 4CCCA 1GOIA 2H9AB 5CZJA 5HAOA 1U5HA 2GDVA 1TV7A 3CAVA 1HO1A 4Y90A 5D2YA 4KWUA 4QR6A 1NIUA 1P6BA 4FOJA 4P8XA 3KTCA 4S3BA 5REQB 4R53A 5C7VA 3DERA 4YTSA 3NG3A 4I5RA 3WMBA 1XKJA 2ZX5A 1UWAA 5GJNA 3WQOA 1SO3A 3GDRA 3DECA 4GMEA 1ZRQA 1SYTA 1PUDA 1TZZA 3N12A 3VIJA 3HG5A 3EMQA 2CZDA 1SR9A 1A0EA 2Q3OA 2G3JA 1QCWA 3W28A 3A5FA 4HN8A 1B9ZA 2DEPA 5I78A 4HN4A 1BAGA 2CPUA 2VHLA 4J40A 3S5NA 2NXIA 1UD6A 4CCZA 3SSJA 4E3VA 3DFSA 2NWRA 1FCVA 1AG1O 1G9HA 2ISSA 1JUBA 5BNKA 3R89A 2YL5A 3I7SA 4MB4A 2YDQA 5BRBA 1F7BA 3WK2A 4WCJA 3H4WA 1CXHA 3W7IA 1A53A 1F3EA 4MM1A 3W72A 1TV4A 3UF9A 1XLDA 3EOLA 1JGIA 5AHMA 5KZEA 3SY5A 3B9OA 1EP1A 4ZTYA 1KNWA 1QMLA 2VGGA 4MLJA 4AEEA 3NSNA 1VCFA 3TP4A 3NWRA 3W6MA 1U30A 2D69A 3PJWA 4C6BA 4D6GA 1VBUA 4QDMA 3LBOA 3OZPA 2DVTA 3C0QA 4TX6A 1M7JA 1V6TA 3HG4A 3LCLA 4P7OA 4FK9A 2XFRA 2Y7EA 4RDZA 4AY7A 5BWFA 2TMDA 2EPLX 2PTXA 5RUBA 2ISVA 5FF3A 4P2VA 4GUHA 5A6SA 3OGSA 2CLPA 3MUAA 3UGRA 3WD2A 1HVQA 2HBXA 1VFSA 3MI3A 2Y62A 3U2OA 3KCJA 5DMMA 4I6KA 4ZMGA 1ME9A 3I7QA 4QJ1A 1E6NA 2PDMA 2BDQA 5EMKA 2J9XA 4WJEA 2BXVA 4QM1A 2TODA 1LRQA 1B54A 5DLCA 3LQLA 4O11A 4KCUA 4NYYA 4X9YA 4DWSD 4IPJA 2DQXA 3IEBA 4G56A 3F1QA 5D32A 5AC8A 3W9ZA 2PWDA 2VFHA 1AJ2A 2E6YA 3H55A 3A13A 4PC8A 3U5YA 1WPCA 3NIYA 3TROA 2A6NA 4W87A 4BA0A 2CWXA 1Q2SA 5TAOA 3JZEA 1EIXA 3D5HA 3BUVA 3CH9A 1MZRA 3CWNA 3OIXA 3OVRA 3EDDA 3PM6A 1OX5A 4FZIA 4GO8A 1G4TA 5HMEA 2ZKMX 3STGA 3B03A 3U3HA 1E0TA 2G50A 2OO6A 3QRHA 1XPGA 4ML4A 3LCFA 1L2UA 2HISA 2XU2A 4HP5A 2VOTA 4XZWA 4UQDA 2NXHA 4O14A 7ODCA 1D8WA 1OADA 4JL2A 4GQBA 3WLTA 5A8MA 5CJ5A 1KR1A 2YL9A 3S2LA 1BSIA 5EY5A 3USZA 2I5IA 5HR7A 1LOLA 2OKTA 3AUJA 2PGRA 1HJSA 3F5KA 3O6DA 4QITA 4C6OA 3QKEA 1VB9A 3Q37A 5A8OA 4ZO6A 4HTBA 5DEZA 3DG6A 3TOYA 1ECQA 3VZZA 2A7RA 3I3BA 3OP2A 5LGZA 1M01A 5HQMA 2QCGA 2IKJA 1SZEA 3QVQA 3O05A 2VVSA 1Q6LA 2E67A 3CQJA 3OLGA 3TYAA 5FOOA 1VYSX 3HG3A 3MV01 3PF3A 4RKAA 2V5JA 1JEZA 2OFJA 1JQVA 2WW5A 1CXEA 1GVQA 2PZNA 4KEVA 1R7AA 3H23A 3BZGA 3I10A 3KP1A 2YCIX 4R5EA 2WJDA 4MJZA 1JZ5A 2GZXA 3AXHA 2CC0A 2QF8A 4YLWA 1UASA 5A2BA 1FWAC 1XM3A 3BCFA 1F73A 2F2KA 1JDCA 4XK2A 3GFYA 3B04A 1A4LA 3C2VA 3PFRA 3ITXA 4OE7A 2O7QA 2JALA 1IEWA 4UXDA 4YHGA 3DFQA 4WKFA 1C8YA 4CD5A 6PTDA 3S2JA 3H54A 3GR8A 3ZR6A 4Q7IA 1UH2A 3VM5A 1A3HA 4LAOA 4YWSA 3C0JA 3W1LA 1UQYA 1KM5A 4F48A 1OC5A 1SM9A 1NDYA 2WMIB 1TMQA 5HINA 2WKJA 1OC7A 4Z1DA 5HBFA 1HTIA 1TWDA 3XINA 1H1ZA 3DGRA 1CEOA 3R8RA 2ZUTA 4Z2KA 3WLRA 1NELA 1M04A 3NURA 5HNTA 1OFQA 1QNRA 1XLAA 3MB9A 4DJFC 1E55A 1D3GA 4K36A 2D3NA 3BV7A 1QHPA 3WQGA 3G1AA 5LSMA 1YDVA 1P1XA 3IPWA 2PB1A 4QLLA 4W7WA 1FDJA 4O50A 2PGWA 3UR5A 3VCNA 3W23A 4LXFA 5I06A 1JZ4A 1YRRA 3DKJA 1I2RA 3K13A 4FS9A 4MUZA 4Z1BA 4JNMA 3DHDA 1TPVA 2A85A 3LMYA 3PBGA 3M4HA 3BLFA 3OYZA 3ERPA 4Y9OA 3QF0A 1W1PA 3FHAA 1R9YA 4IL0A 1EDGA 2HK0A 3A9IA 3M0HA 1NWRA 3OYXA 3HGOA 2YOCA 5J8LA 1W8GA 2OT0A 4IXXA 4HJWA 3W1PA 4U4MA 4I90A 2CHOA 3OBAA 4IJBA 2NX1A 1RZMA 1OYBA 5GNXA 4TU1A 1AVAA 3U4FA 3L5LA 4JHZA 1DTUA 1CB7B 5E09A 1KW1A 2CU0A 1TREA 1ZP3A