3O6CA

Pyridoxal phosphate biosynthetic protein pdxj from campylobacter jejuni
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
259
structure length
259
Chain Sequence
NAMLLGVNIDHIAVLRQARMVNDPDLLEAAFIVARHGDQITLHVREDRRHAQDFDLENIIKFCKSPVNLECALNDEILNLALKLKPHRVTLVPEKREELTTEGGLCLNHAKLKQSIEKLQNANIEVSLFINPSLEDIEKSKILKAQFIELHTGHYANLHNALFSNISHTAFALKELDQDKKTLQAQFEKELQNLELCAKKGLELGLKVAAGHGLNYKNVKPVVKIKEICELNIGQSIVARSVFTGLQNAILEMKELIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pyridoxine 5'-phosphate synthase
publication title Pyridoxal phosphate biosynthetic protein PdxJ from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 100
structure length 259
sequence length 259
ec nomenclature ec 2.6.99.2: Pyridoxine 5'-phosphate synthase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o6cA00
1GZGA 3B0VC 4NXSA 4CQAA 2Z1BA 3QF0A 2W0UA 2J27A 3M43A 4OGZA 3USBA 3UQNA 4O16A 1VYSX 2PRLA 3M47A 4XBKA 3WFAA 3LCIA 2CFFA 1F05A 3LERA 3QQ0A 3TW6A 1F6PA 2E6AA 3W7DA 3A23A 4ZQNA 2C16A 3DFNA 3C0JA 5HNRA 3THQA 3S9YA 4CQ8A 4Y8FA 2OCZA 3UYCA 3W7JA 1GQNA 1Z48A 4UFMA 4EIVA 7TIMA 3GYEA 4O13A 2A7NA 4TMCA 1Q6OA 2C19A 3S1VA 4FNSA 1GYNA 1F2JA 3N2MA 3E9AA 4MPQA 1Z42A 1JRCA 2A1YA 4PCFA 1VQTA 1VRDA 1MZHA 2YZRA 4LNYA 5TQLA 1AL8A 1HUVA 2NLIA 1TPFA 2A6LA 5AN7A 1TPEA 3P5ZA 2NWRA 3KRUA 3FYOA 1GOXA 3NZ1A 4TMBA 5HMSA 3TK7A 3EXSA 3L65A 4JTIA 3OHIA 4GXMA 3MHGA 2NUYA 4FF7A 5CPOA 2EKCA 1ZENA 3A24A 3NQ8A 2RDTA 6TIMA 1G67A 1H50A 3WJYA 1QPNA 3STCA 3R8RA 4RZ6A 4O52A 3MO7A 1W31A 4QNWA 3KXQA 2EPHA 1ZFJA 3ZS4A 1OFEA 3TQKA 2Y85A 1TREA 1FUYA 1YXDA 4O15A 4YWIA 1I2PA 1K7XA 2ZA3A 3TXVA 3BLIA 1TTJA 5EYWA 1Q6QA 5I3JA 2TSYA 1U83A 2VFIA 5HUPA 3F4WA 1EWDA 4NJGA 1JCXA 2UV8G 3W7PA 3LCLA 3C4UA 1Q6RA 5EKYA 4GC4A 5AOUA 4DBEA 1FXPA 1TV8A 1Q45A 3HG2A 3HPSA 4UFJA 3W74A 2NX9A 2YYTA 5AB3A 4WXYA 1KFLA 5D2VA 2ZZ4A 3CC1A 1C8VA 1KFEA 3LLDA 4Z0JA 3G22A 1XBXA 2A5HA 2ZTJA 3CPRA 4HIBA 3CM4A 1QMLA 1Z44A 1KFKA 5CZJA 3W7MA 1DORA 5DN1A 3PULA 1K7FA 4XBSA 3DU0A 3R5EA 4BF9A 4ZQOA 1JCJA 2G96A 4WUIA 5LSMA 3ABRA 3IVSA 4RZ4A 1YPIA 3PVFA 3L0NA 3M6YA 3TSMA 3NM1A 2CLKA 3TIMA 1WYIA 3LV6A 2WSRA 3GLCA 4K8HA 1PCKA 3C6CA 1HO4A 1GG1A 1QO5A 3BO9A 4LS1A 3TAOA 3MW7A 4NNCA 4ICNA 3SECA 1J4EA 2GJNA 1LLWA 4N02A 2Q3OA 2H3DA 3LX9A 2FQIA 5D38A 3E0IA 4Z1DA 3W85A 1H62A 3WK0A 3N3MA 2TRSA 3K30A 1OABA 3M5VA 3EX4A 5AHFA 1KM0A 3DFQA 4UMCA 1I8JA 4UMAA 4OHQA 1ADOA 3STEA 1BWLA 2A2IA 1T96A 1LBLA 3LM7A 4IMFA 1N8FA 4MY1A 1E51A 5IBXA 2VFHA 3LLFA 1OG0A 3IIPA 4DBDA 1FXQA 1D9EA 1YYAA 1FDZA 1G4TA 3NL5A 3B03A 3WJZA 5AHEA 2CLFA 3PWAA 3PUOA 2CZDA 3LHZA 3NG3A 4I9AA 4AHQA 3ZWTA 3P62A 5G2IA 3YPIA 2C18A 1W56A 3FOKA 2J6XA 2ISWA 1AW1A 3W2KA 2QCGA 2DZWA 1DBTA 3VFLA 5C55A 1KFCA 1B57A 3QJAA 1VGAA 1I2OA 1O60A 4BWLC 2J9ZA 3OEXA 1VYPX 3DKJA 4CQ9A 2Y61A 1JQVA 5CPNA 3BG3A 4O0ZA 3NYZA 4JX6A 1JCMP 4QNEA 3W76A 1OHLA 1WDWA 5D30A 3Q2DA 3EEGA 4AWTA 2E77A 1W8SA 3BW4A 4JXCA 4UTWA 1MSSA 3QFEA 1I4NA 1NFBA 2QCHA 3DENA 1CI1A 1TCDA 2GVLA 3SFKA 1SZFA 2YGYA 4NJKA 1NSJA 5U4NA 2CWNA 1ME8A 1KW1A 4BK9A 5D04C 2G95A 2ZRVA 5DLCA 3M1ZA 5CZSA 1FX6A 4IMGA 4QQ3A 3W1QA 2PRHA 2QJGA 5HUOA 3GDKA 1FDJA 4DO4A 2NUWA 2PRMA 1OFPA 1GVFA 4PH6A 1X1OA 1TSIA 5G1TA 1XDLA 2H3BA 4A2RA 1XXXA 1YDOA 5EL1A 1IIGA 4GRSA 1H51A 3G0XA 3QW3A 4IXXA 2Y7FA 5A5WA 3UWYA 3L66A 3SJ3A 4UTTA 1UB3A 3C2FA 3W07A 1JVNA 2VOMA 1W0MA 5D03A 3FYPA 2NXGA 3UZJA 3QMRA 3MI2A 3P7YA 1ZAHA 2RDWA 4Y96A 1OX5A 3JRKA 4BI7A 3CEUA 3P8JA 5AC7A 3G8RA 4GJ1A 3L2IA 3GKFA 4YCPA 1G69A 3PSVA 2DJLA 1VCGA 2EGZA 3P60A 4AHPA 1AL7A 1O95A 4RX0A 1XBYA 2V8ZA 3HBLA 1KM3A 2FPVA 4CNOA 1TB3A 3UWQA 2CLIA 1S5TA 4Z0SA 5LHEA 5ABTA 4S2BA 5FEXA 1K8XA 2F7FA 4UUIA 4O12A 1W5QA 1BWKA 3KVKA 5D2YA 4HNUA 3KFTA 3MP4A 5F1VA 3O8AA 4UCGA 3H54A 1TPC1 5AHNA 1UUOA 4ZL1A 1EB3A 3IIXA 4FNRA 5CZTA 4NU7A 1WOBA 3E49A 2JKAA 2ZYFA 1ALDA 3U2OA 2ATSA 2JBMA 4O28A 1FY6A 2X2GA 3LTPA 4N9DA 3W7GA 4JN6A 1DV7A 4K7VA 3BV4A 4WXZA 1FCQA 3GKAA 1YXYA 3MP5A 4AB4A 4EF9A 3LCGA 1MXSA 4MZ1A 5FI8A 1EEPA 4OV9A 3JR2A 1JUBA 4E0CA 3W1NA 1H7XA 3G1DA 3LRMA 3RK8A 2YW3A 4TIMA 3M5YA 3KHJA 2C6QA 3HIJA 5BRBA 1TTPA 2E6YA 5C5YA 5K9XA 4LVFA 1A5CA 1JUEA 4NQ1A 2BSLA 3GNDA 3R2GA 5G2HA 1QOPA 4M7SA 4NX5A 1F6KA 1IF2A 4MUZA 3G8EA 1QPQA 4KFPA 3TMLA 1T8XA 2QCEA 3SR7A 5KZEA 5L9FA 1W5NA 3DFOA 2FPYA 1M6JA 5DCBA 3LXBA 1OF8A 4RXFA 2E68A 2QJIA 4LV9A 3UNDA 1F76A 3W7QA 1IXQA 1R30A 3MJYA 2WKJA 4IMCA 1XDMA 1OYBA 3QH2A 3G1AA 3HMJG 1BKSA 1M7PA 3ABSA 4JYFA 1YDVA 4MOZA 3P81A 1TRDA 1RZMA 2VELA 3NPUA 2YFOA 3EWXA 3DHDA 1VPXA 1W3IA 4O17A 3C3NA 1AG1O 1GG0A 4N9BA 3W7NA 3TC6A 4HT3A 1EX5A 3MHUA 1P5BA 4FXRA 3KVLA 3ZWSA 3QPYA 3D0CA 2A0NA 4XZ9A 2RHGA 3L9CA 2LLEA 3DFTA 1HTIA 3PBYA 1DKWA 2H6RA 4Y9AA 4FNQA 2OJPA 2A85A 1R2SA 5F2IA 3C52A 1MEWA 1A50A 3I6RA 3RMJA 5BOOA 2P10A 1LDCA 2ATMA 3AJXA 3DXIA 2VFFA 4UTHA 5LNUA 3RLVA 5LHFA 3NQMA 4QM1A 3DH7A 5HR6A 1SFJA 4HKPA 5K3VA 3LCWA 3R13A 2PCQA 5HULA 4N2YA 2E1DA 1Z41A 4IX0A 2BX7A 4JNMA 5LKYA 3S1WA 3FS2A 4R34A 1SR9A 3NDOA 4O18A 4K7YA 1ML1A 3TXZA 2Q8LA 3B06A 4K8EA 3BVJA 5EPDA 4I7UA 1D3GA 3P61A 5FF3A 2VENA 2HTMA 3L5LA 4D2JA 1BEUA 1LYXA 2O7SA 3FJLA 2EAWA 3VNDA 3CTLA 1F7BA 1LRNA 3TW7A 5KSWA 1YADA 3I68A 3ABQA 1H61A 2QCLA 4GFSA 2V30A 3LHUA 1TJRA 5LGZA 3BK0A 2RKXA 3IVTA 3W3OA 3ZR4A 1MEIA 2QCDB 4O8RA 2CZFA 4N4QA 1K02A 1VCFA 4QAIA 4PL2A 1DVJA 4W9TA 4FNTA 4N4PA 1BTMA 3NOEA 1WBJA 4RJEA 2WV8A 2AAMA 1B3OA 5CPMA 3CB8A 3W84A 3S1XA 2ZZ7A 3TJLA 4X3ZA 4CCEA 2CLMA 5F2GA 3TU9A 1PCWA 4O11A 1KLZA 4IPIA 3EB2A 3UD6A 1FWWA 2ZZ1A 3LTYA 2NUXA 4AEOA 4J9JA 3L5MA 3OVPA 1RQEA 3DFSA 4LY8A 3UY7A 4TR9A 1H7WA 5KTLA 2NZLA 1VS1A 4CNPA 3MUXA 1OJXA 1EUNA 4A22A 3QC3A 4Z1AA 3QPZA 1C29A 3DHFA 5LNSA 2DU2A 1QPRA 1JR1A 2GUUA 2CZ5A 2VEKA 2X1RA 4O4WA 2VXNA 3PBUA 1UJPA 4GBUA 4MY8A 2DZXA 4LC8A 1QPOA 5MHBA 3OA3A 1O94A 1OK6A 1LM1A 1B4KA 1ZCOA 1XBZA 2P1FA 1WOAA 4JIPA 1NAL1 4DQWA 1GVOA 1VCVA 4WX2A 4E2DA 4X9SA 2C1HA 3N9SA 3W2JA 4AHOA 4JY8A 4IOTA 2QUTA 2QAFA 4AF0B 4JY9A 4GWEA 1VHCA 2GJLA 4P2VA 5F2LA 1OX4B 5KMYA 2ISSA 1LTDA 3EX1A 1XFBA 2C15A 1A5SA 1SW3A 1K8ZA 4JTGA 3TDFA 3H53A 2ZZ2A 4Z08A 3LDVA 2E6FA 1OK4A 1FWTA 1DJNA 1ICPA 3N2XA 1RQHA 3C8FA 1KM2A 2R91A 3NQGA 1V5XA 5F4WA 1OFAA 1KTBA 2Z2UA 2ZRXA 3KAOA 3C2RA 1EUAA 3OVRA 3O6YX 1L2UA 2EHHA 2QEZA 2X30A 2PE4A 4HHPA 2QCDA 3NNTA 3KRSA 3E12A 3TSBA 2YXGA 1KFJA 3TSDA 4C1KA 1KM6A 2ZFAA 1P1XA 3Q94A 4JYEA 4FXSA 2QUVA 3W7EA 1DQWA 3PF3A 2XFWA 5KINA 1OFOA 1J2WA 1CW2A 4I7VA 5G5IA 4UNKA 3S6DA 1SO5A 2NXIA 4O1CA 3DBPA 3ELFA 3HB9A 4JTKA 3U6WA 1FWNA 2P0OA 3TQ0A 4MLRA 5D33A 2A7PA 4ML9A 2G5WA 5EY5A 3NQFA 4S1FA 3FA5A 2WNQA 1H63A 5TIMA 3S42A 2XN0A 1AW2A 4JTEA 4M6PA 2W79A 1HFBA 2FB3A 4FIQA 3GXNA 5EBUA 4NUWA 4IGHA 3W2UA 2Y70A 3S5NA 3GK0A 4QITA 2A7RA 1YDNA 1G6CA 1G4EA 4CLMA 1PVNA 3TFCA 3TC7A 1K03A 3VKJA 3A21A 5BMXA 1UCWA 5CSSA 3ZFHA 1TYGA 3G3DA 4WY0F 4B5NA 5FESA 4LS0A 2DORA 5D2WA 3UWWA 4EWND 1GTHA 4IPJA 4UFKA 3KOFA 1TIMA 2DP3A 1JULA 1X1ZA 4WZHA 2VC6A 3BPWA 2WNNA 2GPTA 3DAQA 4YCOA 5AFDA 1FCBA 4M19A 1VH7A 2V82A 2FJKA 4HSNA 3PUEA 4AF0A 4FB7A 4UTLA 3W22A 4XQ6A 4KWVA 4BWLA 4M6VA 5BW6A 3NQ7A 4ZQPA 1OX4A 2QCMA 3O6CA 1G4SA 2WQPA 3MI3A 4QISA 5AHIA 1KFBA 1XI3A 5J5RA 4Q33A 3BLEA 3VCRA 3BGGA 4LS2A 3LOTA 4WOQA 1PV8A 3MWAA 3GDTA 4PODA 4LRTA 3CEPA 3NA8A 3PS7A 1EIXA 2WPBA 3LV5A 3W88A 2OT0A 1DL3A 4MYXA 1SO4A 4XUGA 1IGSA 3FLUA 1EP3A 1MEHA 4M6QA 4N6FA 1ZHAA 3DGRA 2ISVA 3HGSA 2VFDA 1L6SA 4U4MA 4IUOA 3B8DA 4NT0A 1A5BA 4CNNA 5HWJA 3W7CA 1AK5A 3FIGA 2DJXA 2R14A 3EWZA 3G1SA 2H8ZA 3EKZA 3T78A 3HQ1A 4EF8A 4X2RA 4O19A 2QCCA 3LGEA 2E5BA 3GB6A 2X1TA 1OVDA 4JTFA 3IIVA 1VR6A 1SO6A 2DZTA 3LHWA 4FNPA 3IIZA 5D02A 2VFGA 3BGJA 1XUUA 2CU0A 3N9RA 4JTUA 1LRQA 3EWBX 5FEPA 3LHVA 1Q6LA 5G4EA 5CZ0A 4EVZA 1PHQA 1H7NA 2Y7EA 1O5KA 4DPPA 4G1KA 3H55A 3EWWA 4IXHA 2IQTA 3F03K 1S3HA 5FF4A 2DZPA 2E5CA 4PC8A 2Y62A 1B4EA 1LZOA 3P5YA 4PA8A 1WQ5A 5K7JA 4O0KA 3LXAA 3TH6A 5I3KA 2OZ0A 3TA6A 5K9DA 3EX6A 1KV5A 3ANYA 1Q3NA 1ME7A 1I2NA 3MMTA 1LRTA 2Y6ZA 3W7RA 2ZDRA 4ADTA 3PG8A 4ZMGA 1TPB1 5D09A 3GXPA 3PSWA 5D2TA 1H5YA 3ABOA 3UXDA 4NJJA 4LOCA 1NEYA 3W7HA 3HO8A 4X22A 1UUMA 3G18A 1SW7A 1V7YA 4H3DA 3G1XA 1S5WA 1TPUA 2W6RA 1H1YA 3MYOA 2BZNA 3CIXA 3GZ3A 3L0KA 2QAPA 3NPVA 3TROA 1M7OA 1I2RA 4LW7A 3HPXA 1DJQA 3G1FA 3L21A 4OV4A 5EMUA 4O10A 1ZALA 2ZTKA 3C56A 3W71A 5I3GA 3MBFA 1GEQA 3FKKA 3F4NA 3LB0A 5TBOA 3V75A 4NZJA 3CHVA 3W70A 3NXFA 3L0GA 3W1XA 4OBTA 1VHNA 2E6DA 5HWNA 3M5ZA 2Z0IA 4XKYB 1YPFA 4DF0A 3NEVA 2V81A 1QOQA 4NJHA 1XL9A 3GAKA 5CSRA 2NWSA 5F2MA 4MYAA 4K37A 2QJHA 2Y89A 4BFAA 3HF3A 1K3UA 4O54A 2YCEA 4M7TA 4K6AA 5BMWA 3W1PA 1RVGA 5CGQA 4JICA 1G4PA 1XUZA 1KTCA 2F84A 2V0TA 2BLEA 4JX5A 3T4CA 3GX9A 4HPJA 1TPWA 2I14A 2B7PA 2GQ9A 2PURA 2V9DA 3UPWA 3LI0A 3M5XA 2HS6A 3DI1A 5K9CA 5L6UA 2GVJA 2ZRYA 5HINA 2ZZ3A 4LV4A 1LROA 1C9DA 3QQ1A 1RPXA 1FBAA 2WSYA 3DI0A 3B05A 1QDSA 2OX1A 3T44A 5LGXA 5AYYA 2X16A 4H6KA 3W1MA 3HGOA 5DXXA 4UXDA 3IGXA 2EF9A 1LP6A 1TV5A 4RZ5A 5K4ZA 2CW6A 2C14A 4XTIA 2YDAA 4QSHA 2YW4A 4TX9A 2ZRZA 1VJIA 3ATYA 3NL6A 4O1BA 4ADSA 1WX0A 3W1TA 2NV1A 1O5XA 2I9EA 4L4LA 3BLFA 3UXAA 1SFLA 4LVGA 2HS8A 1MO0A 4E38A 3IGUA 4DO5A 4MFEA 4WD0A 2RH9A 3C2EA 2WSQA 3THAA 3UY8A 3OG3A 3LHTA 2WNZA 5T26A 5G1YA 3OBKA 2Z6IA 4MVAA 1JJKA 1VZWA 3C2VA 3WK2A 3OIXA 5DELA 3O15A 1EP1A 3EX3A 4LC6A 4JEQA 3SY5A 3LRKA 2RDUA 2GQAA 3R89A 1QR7A 2D73A 3MHFA 3C61A 4FO4A 3STGA 2I1OA 3W1UA 2QKFA 4KWWA 1JCYA 1AMKA 3QMTA 3S0CA 5KZMA 4Z1BA 1L9WA 4S2CA 3SZ8A 2C13A 2V2DA 2OT1A 2A4AA 4FHAA 4WY0B 5BNKA 2XN1A 4AWUA 1I45A 2YX0A 4RR4A 1YTDA 3NQEA 3RFAA 2DZSA 3A5VA 3NZRA 3LI1A 1L6WA 2FIQA 3QW4B 5DCDA 4N9EA 4O53A 5DCEA 1TO3A 4YMZA 1PIIA 3JS3A 1EA0A 3PBVA 4A21A 1HL2A 1OFRA 1RQBA 4MIMA 3S5OA 5I3IA 1W37A 3WJXA 3N34A 3TV8A 3NPXA 3IRDA 3WK1A 5FEZA 3GNNA 1IXNA 4GUIA 5A8GA 3KVJA 3DKLA 5C6MA 3B0UX 2FDSA 1WV2A 4JTLA 4RXGA 2R8WA 1TTQA 3HG5A 3TFXA 2RFGA 2AGKA 2Q3RA 4AXKA 3CT7A 1B9BA 2HSAA 2QUUA 2BWGA 3T7VA 1ZY9A 2JKEA 1IXOA 5HJLA 4LVBA 5DBTA 3B0PA 4PEKA 3W2MA 4O1AA 1PHWA 4OQVA 1ICSA 1OYAA 3M0ZA 2CZEA 2NX3A 3QRHA 1W5OA 1KBJA 3VE7A 3GVGA 4E2BA 1FQ0A 3W6YA 2FFCA 3BW2A 3VI2A 3HGRA 3RF9A 3UWUA 4KKXA 4P61A 1ZAIA 1GWJA 1W54A 4UFLA 2ALDA 1GT8A 4AWSA 4UR7A 3W1RA 2NV2A 3W7KA 4UFHA 5D2XA 4L4MA 3S5YA 1I2QA 4RK8A 2C0AA 3BG9A 4KFOA 4JTTA 2ZA2A 2VEMA 1FWRA 4C1LA 3NL2A 4LVDA 1JRBA 1TPH1 3M44A 3Q37A 4MZYA 2B4GA 2ZCGA 3A22A 4ZQRA 1SZGA 2QDHA 3PUDA 4FX7A 1RR2A 5LNRA 2FLIA 1YXCA 1QO2A 4MJMA 4U28A 1F5ZA 4FX6M 1QAPA 1OFDA 2J9YA 3IV3A 2YFNA 4NNAA 5IM51 3QZEA 4WY0A 4MJZA 1H60A 3NAVA 1LOSA 4K36A 4YL2A 3HG3A 2FB2A 1DQXA 2YR1A 4ZQMA 3W87A 3MI6A 3S8HA 2CLOA 1JCLA 4DPQA 5AHLA 5AHMA 3C2OA 4NNBA 1PL9A 2TPSA 4UR8A 1KA9F 1ZAJA 3BARA 3GDMA 1TJPA 3LHYA 4JIQA 3W23A 4Y90A 3T55A 5H2ZA 3STFA 3UWVA 1SZEA 4JTSA 3UZ5A 3P82A 1SSGA 3Q58A 1LOQA 4RCXA 2BXVA 4K39A 1T99A 2VEPA 2HMCA 4GUHA 3VE9A 2J9XA 3DFPA 3G24A 2ZBTA 2KZHA 1UBSA 1SQ7A 1KTNA 4JR5A 4O4VA 3IIOA 3W9ZA 2Z6JA 1YTKA 5EA9A 3TX9A 3UPBA 3O6DA 2X1SA 2B7OA 1VLWA 3RNDA 3TQVA 4EOUA 4HNNA 1EP2A 3KVMA 4HSOA 2TMDA 5HWMA 3WJSA 2YYUA 3ATZA 3M7WA 1A53A 4MY9A 2ZA1A 3LBCA 4M5PA 4H4IA 5CPLA 1SW0A 2WOQA 3SSJA 3KX6A 1W3NA 5G2WA 3V1PA 3N73A 1KM4A 3I7RA 4OE7A 1FWSA 4UIOA 4ALDA 4GUJA 4GE8A 3MYPA 3W75A 4BI5A 1W5PA 5LNVA 3W7LA 4HNTA 5FEWA 4FEZA 3MBDA 2B7NA 3TE9A 5J5DA 3NR0A 1OF6A 3NQDA 2R94A 4RKAA 5HR7A 4O1DA 1XKYA 3CWOX 4QJ1A 3L5AA 3P80A 3TR2A 5AYZA 2E09A 3TJXA 2YPIA 3INPA 2QF7A 3M16A 3N19B 4DF2A 4YXGA 1H7OA 4MFDA 3P8IA 1TRIA 3QEZA 4OWGA 1OFBA 4LUIA 4NVTA 4UC5A 4LRSA 1TQJA 2V2HA 3G1VA 3BG5A 4NZFA 4ZVJA 4O14A 5IBXC 1W1ZA 3NQAA 1X7FA 3GR7A 1WA3A 4N6EA 3OVQA 3PY2A 4DXVA 1GTEA 3SI9A 3PBWA 4RV8A 4ORIA 4GUGA 5FF7A 3G0SA 3PC0A 4A3UA 2FTPA 4HN4A 1X6UA 2NXHA 1QNVA 1QFEA 3HG4A 2GQ8A 2ZZ6A 5LNWA 4POCA 3EKLA 3FEMA 5DY3A 1U5JA 1X8FA 4JDYA 1IIHA 2DZUA 1LBMA 1R46A 3TAKA 1VLIA 2JK2A 3M41A 1ONRA 2ZRWA 4DF1A 1F74A 5CKSA 1TPVA 3SGUA 4ZZ9A 2ZQ0A 5K4XA 3GDRA 1S5VA 2WO5A 1TQXA 1G7UA 2QR6A 3CLMA 3F1QA 1FDYA 3P74A 5AC8A 3LXCA 3TNOA 4GNJA 4JYDA 5K2ZA 4PTNA 3LBMA 3I7SA 3MP3A 3EXRA 4LU0A 5DY2A 5F4SA 5F4XA 1WXJA 4JDBA 2B0MA 4UTWC 1OFQA 2X1UA 2NX1A 3L67A 1PE1A 2JGYA 3HPZA 4UTJA 4R7JA 3EWYA 2G97A 1P0KA 1W3TA 3AO0A 3IVUA 2JGQA 3G0UA 5FF2A 1SO3A 4IJBA 1KV8A 1ICQA 4CCCA 3NQ6A 4CCDA 1XCFA 5FF0A 4TU1A 1K8YA 3LCXA 1R2RA 2O7QA 4PFMA 3W2LA 3O06A 1XM3A 5D32A 4JTHA 3TUUA 3SIZA 3NQ2A 2GVGA 1KBIA 3M9YA 1VC4A 3PR2A 2JKPA 2H90A 3E96A 1HO1A 3TMQA 4O57A 3UWZA 3NGJA 2GOUA 3LCHA 3T40A 2ZRUA 1Y0EA 1H1ZA 3PG9A 3A9IA 1F73A 3NVTA 4IMEA 2A6NA 3S5ZA 5SWUA 5F1UA 3W1LA 1AW5A 1CX9A 4UTTC 4FIRA 4UMBA 2CLHA 2OMAA 3NM3A 1LLZA 1IXPA 1SPQA 3W7OA 3GAYA 2YSWA 5C54A 1N7KA 4NXKA 2WJZA 4K38A 1LBFA 2Q8ZA 2A21A 2XN2A 4A2SA 3PB2A 1KLYA 1NF7A 1H7RA 2Y7GA 1KM1A 4NJIA 4OU1A 1GPWA 4WOZA 4I7WA 2C3ZA 4JX4A 4WQ6A 4Q32A 1P0NA 3FJ6A 5GVJA 3RLUA 1G7VA 1YLVA 1T0OA 5HQEA 5CG7A 5DXYA 3TKFA 4QIUA 4GUFA 2J88A 2VFEA 3SGZA 1EPXA 4XTDA 1HG3A 1K7EA 3IGSA 4OT7A 4YLWA 3LRLA 3O05A 1GJPA 2QDGA 3SW6A 1EWEA 3FFSA 1FCUA 3TCEA 1DHPA 1RD5A 3O1NA 2ABBA 2BTMA 2TYSA 4AH7A 1NVMA 1WAUA 3QMSA 3R12A 2VKZG 1JCNA 2FPTA 2Y88A 1XBVA 1XC4A 3DZ1A 4BR1A 4ONVA 4KFNA 1OX6A 4JS3A 4MLJA 4IMDA 3CQ0A 4JGDA 1TPDA 3E02A 3S1UA 3I65A 1WBHA 3RU6A 4HPXA 5H91A 1JUKA 4LWWA 5E93A 4R33A 1TMHA 3EX2A 3L68A 4PL1A 4UNLA 3GXTA 1YTEA 1DOSA 3B4UA 3W86A 4DO6A 4UTKA 1D3HA 5I3FA 1GVSA 2J24A 5D05A 1ZNNA 4AVFA 3G1HA 4UTIA 3PB0A 3IEBA 1THFD 1LOLA 1R2TA 4LT9A 1SZNA 3NO5A 3NL3A 3G1YA 1W5MA 3KRZA 1N55A 3O16A 3P67A 4RLIA 4MZ8A 4N9CA 4WJEA 4IX2A 5C2XA 3WJWA 1L6YA 1P4CA 5AC6A 5LZLA 4Q4KA 2V5LA 4HNVA 3CIWA 4O50A 3LCFA 4FX8A 2PC4A 1RV8A 2Y63A 4Z1CA 1A5AA 4IQLA 1LORA 3BW3A 2V2CA 3EWUA 1GYLA 3W73A 1OYCA 3QSTA 1ZJIA 3QM3A 3GR8A 1KM5A 2E5DA 1LCOA 1VYRA 3I7QA 4MKNA 4JTJA 3O63A 3O07A 4XWUA 4UTUA 2ABAA 2VEIA 1PS9A 1NF0A 3PAJA 5KITA 3CU2A 8TIMA 3EXTA 3GIYA 3QSRA 3PM6A 5DBUA 1SSDA 2B7QA 3G3MA 4LTSA 3W2NA 4UFIA 1TV7A 4XKYA 1GVRA 5I3HA 3N14A 4JD4A 4FNUA 4UTMA 5D37A 3WK3A 3A5FA 5G4WA 4LUJA 1QWGA 1H7PA 2QCNA 4IWWA 3U8GA 3HJZA 2ZZ5A 2CLLA 2DZVA 3P84A 4LVAA 3W83A 1TTIA 2H8XA 4ZQCA 1J5TA 5U7SA 1GVQA 1JQXA 4BI6A 1M5WA 1ME9A 3CWNA 1QCWA 3LTSA 4DEFA 5KZDA 3HOJA 3NQVA 5E1QA 3HGJA 4A29A 1SU5A 3W1AA 2V5BA 4AAJA 4ADUA 2Y7DA 4TO8A 4Y6GA 2CLEA 1SUXA 3GDLA 4R53A 5E0KA 2AQWA 5AYXA 3B04A 4NX0A 3W7IA 6ALDA 2QCFA 1O4UA 4DELA 1R47A 4AMAA 4ORMA 3NPWA 3NQCA 3FKRA 1FCVA 1UASA 3W72A 3QYQA
chains in the Genus database with same CATH superfamily
1GZGA 2UZ9A 4NXSA 5REQB 4CQAA 3QF0A 2J27A 3USBA 3DHUA 4M51A 4O16A 1TWDA 3M47A 2EJ1A 2XH0A 4M81A 4MG4A 2OGYA 3LERA 1F6PA 1M7JA 5AVNA 4CQ8A 4Y8FA 2WHMA 1Q2SA 1VIWA 3ZLFA 3EOSA 2XVLA 3GYEA 3S1VA 1JNDA 1F2JA 2Z1VA 2DZBA 3E9AA 2VVNA 1CDGA 2A1YA 3E2SA 1VRDA 3HFTA 2ZUUA 2YZRA 4LNYA 5TQLA 1AL8A 1FWCC 1LWHA 1WZMA 3U0HA 3HQPA 3NTYA 5AN7A 3TNBA 3FYOA 1UG6A 3EXSA 4QDPA 4RDVA 4IH3A 4MAVA 2A3AA 3MHGA 3TWAA 4NIRA 1DXFA 3VFCA 1YHTA 4H8VA 4ZGYA 1UA7A 4IG2A 5XIMA 2ACSA 4RZ6A 8XIAA 3MO7A 3VC6A 4QNWA 1ZFJA 3C8NA 1A80A 3TQKA 2Y85A 1XH0A 5CJ5A 4HZMA 1YXDA 1I2PA 3RUBL 4NKCA 2ZA3A 3TXVA 3BLIA 4U5IA 4GVFA 2VFIA 4GPNA 2XGBA 2P3ZA 4A6GA 4CN4A 1EWDA 3L4VA 2UV8G 3LCLA 3C4UA 5EKYA 4GC4A 1FXPA 4UFJA 2NX9A 2GJXA 1KQYA 2YYTA 4D9PA 3VZZA 1KFLA 2AQVA 3CC1A 4GIRA 3WF4A 4XD5A 9XIMA 3LLDA 4Z0JA 3M0JA 2QGYA 2WQDA 1D3CA 3CJPA 2W91A 2WMIA 4HIBA 3AAMA 2WCAA 3BLDA 2FZBA 1Z44A 2BOFX 2HCVA 3T08A 4RPPA 1UC4A 4IICA 5HQMA 3R5EA 4BF9A 4ZQOA 1JCJA 3BH4A 2OKTA 3ABRA 1PDZA 1EPVA 3EMZA 3M6YA 3TSMA 3NM1A 3LV6A 1VFLA 2YDQA 3C6CA 1S5NA 3WD4A 3ZSSA 3IJDA 1GOMA 2W63A 3VNIA 3MW7A 4C6EA 2J74A 4BHYA 5DT5A 3DOPA 2H3DA 3ECQA 2FQIA 3W85A 2YCJA 1H09A 4LUSB 3WK0A 1KC7A 4IIFA 1R87A 8A3HA 3NYDA 3AS1A 1SMDA 3AU2A 3DFQA 2DT0A 3GO2A 3FAWA 3STEA 5BRPA 3AHZA 1QW8A 1AH4A 2VP8A 2DY3A 3BAKA 2ZUVA 1ZGDA 2VZUA 1JZ2A 3H2CA 3WBYA 3VA8A 3V0UA 4DBDA 4XKMA 1FXQA 4HYRA 5FJUA 4PMYA 3BURA 3GH4A 4MB3A 2PFHA 4I9AA 3NG3A 3RPDA 1EYWA 5A6KA 5G2IA 3YPIA 4AIUA 4I5RA 3WUFA 1UD2A 1V51A 1QHPA 4B5UA 6A3HA 2ISWA 1UPMB 1NDWA 3N4AA 1JG9A 1V93A 4J3UA 2NQJA 1DBTA 3CPUA 1UOZA 3G5EA 2DSUA 5C55A 1KFCA 3H2NA 1QW9A 3G2GA 1MW0A 3DKJA 1J18A 4LFYA 4JX6A 1JCMP 4F3HA 1PPIA 4L9ZA 3IACA 3WFZA 2E77A 1W8SA 3L4WA 2Q6ZA 4UTWA 1E1CB 1LQ0A 1TCDA 1SZRA 1GOOA 1ZU8A 3CZEA 4IIBA 2YGYA 2O56A 2YL9A 1NSJA 4GIEA 5D04C 3ITOA 1AQ0A 1H2JA 2XM2A 4IMGA 3AXKA 4DNHA 3DN5A 1KB3A 2VZOA 3GDKA 3WLOA 2PRMA 2WVVA 1OFPA 4PH6A 1YRRA 3MZ2A 2PD9A 4QLLA 3LZ3A 1R3WA 1SFSA 2P0IA 1H51A 3BGAA 3V5OA 4QBXA 3GU2A 3QW3A 3UZWA 1XINA 3W27A 1E6PA 3HV8A 2O92A 3L66A 3C2FA 1JVNA 3W38A 4PB4A 5D03A 2NXGA 3MI2A 1WKDA 1OX5A 1EZWA 2BP1A 3F7JA 4DN1A 2GGIA 4YYFA 2DGAA 1XLHA 1A5NC 1VEOA 3P8JA 4JIIX 3VZYA 4GJ1A 3L2IA 4URIA 3IJ6A 1QNQA 5I07A 1AL7A 1P0BA 4AD2A 1XBYA 1KM3A 2F8QA 1JF5A 3SO7A 1TCMA 1TB3A 1TMQA 1XCWA 1P7TA 4XZWA 2FHCA 1F8IA 3E3HA 4RNJA 3OO2A 3GM8A 3KOWA 4RE3A 1S5TA 1XX1A 2YCLA 5GPRA 1Z6KA 2F7FA 5D2YA 3V36A 2BVYA 1P43A 3KFTA 3R10A 1BGGA 4QHRA 4UCGA 3UZXA 2QNEA 4TVCA 2HEJA 4ZL1A 5EBAA 1AJZA 3OW1A 1EB3A 4Z2GA 1R8LA 4NU7A 4Q8TA 3K4DA 1W1PA 2HPIA 4RE2A 2IPWA 3U2OA 1EO5A 2X2GA 3MP5A 3D5HA 4FLQA 2P3EA 5FI8A 2ADAA 4OV9A 4C65A 4QDMA 1UP3A 3WG6A 2YW3A 2DVXA 3M5YA 1PDYA 3HIJA 5BRBA 2VJXA 2WMJA 3HQNA 4XAGA 2V5JA 5CGTA 1JUEA 5I00A 4RZBA 3R8GA 2OWCA 4FOJA 3C0SA 2Y5JA 3GD6A 2BGSA 3AIQA 4M7SA 3SB0A 4KBXA 1F6KA 3MWCA 5XINA 4MUZA 3HQOA 4KFPA 3WQCA 2IKJA 1XLEA 1VB9A 2UBPC 3APYA 1W5NA 3RDKA 4DB7A 3GIPA 1M6JA 4WKAA 5CC6A 2AOSA 1OF8A 4AVNA 3R43A 4GVGA 1F76A 3W7QA 2VTFA 3MJYA 1OYBA 3QH2A 2Z4GA 3G1AA 1XV8A 3HMJG 1BKSA 3GG8A 4GZJA 4HHMA 1TZ9A 4IP4A 1YDVA 1UZHA 3RU8X 2WHKA 4MPKA 3C3NA 1ZBKA 1UH4A 4TX8A 3AMCA 4D6JA 2HE8A 1IZJA 3KM8A 1P5BA 4FXRA 3JVAA 3D0CA 1OT2A 4PEEA 4K8GA 5LIKX 1TX2A 2LLEA 3CBWA 3ITGA 1DKWA 1I0BA 2OJPA 1UD8A 1J5SA 3C52A 1CT5A 1MEWA 1TUFA 2ZKMX 5DMNA 1DJXA 3RMJA 3VKBA 4L61A 4K1GA 2ATMA 3DXIA 4G7EA 3BSGA 4P8XA 2WB5A 4KWUA 4QM1A 5K3VA 3LCWA 1Q6DA 3SUUA 2EG7A 3F2CA 4IX0A 3VGDA 2BX7A 4H1ZA 3WQVA 2G3JA 3S1WA 4R34A 4K7YA 3GTHA 1ML1A 3TXZA 1CXHA 2XDFA 3VIFA 4K8EA 5KEZA 1S2AA 5FF3A 4CEUC 2VENA 2VX5A 4Z2LA 1ZPTA 1HKJA 2O7SA 1RY0A 3FJLA 4LX4A 1R7AA 5F7UA 3N3TA 2HPMA 3VNDA 3TW7A 1OEPA 1NY1A 4FOKA 5HPOA 3PNZA 1H61A 2EBNA 3KBWA 1XPYA 4GY0A 3STPA 3WLLA 1TJRA 2RKXA 4GJJA 1MEIA 4O8RA 1DVJA 4FNTA 2FVLA 1ZRQA 1B9ZA 1Z89A 2AAMA 5CPMA 1SVDA 4XV0A 3EB3A 2CLMA 3PTQA 1QW7A 4IPIA 1FWWA 4WGHA 4TV6A 3FEQA 4J9JA 1ZP4A 4EACA 2W67A 1GOQA 5KTLA 4OOZA 1VS1A 2VM8A 4CNPA 2QPSA 2WZIA 1MXDA 3EMCA 3WMCA 2V5KA 3TTEA 3PJXA 2DU2A 2PDPA 4PUWA 1KXHA 4GBUA 4H9YA 2D69A 2DZXA 4HNCA 4DVOA 4U2YA 4CD5A 4F66A 2XH2A 1P48A 2QPXA 5MHBA 3OA3A 5FD0A 1ZCOA 3B0XA 1FKXA 2QS8A 4KQNA 4ENLA 2FYMA 4M6UA 2F9RA 1WDDA 1TZZA 5ECUA 3LMYA 1NDVA 4JY8A 3CL6A 4ZA0A 2QUTA 2QAFA 4AF0B 1VFMA 4GWEA 4WR3A 2DQXA 3GG7A 5KMYA 2ACRA 2ZE3A 3VKCA 1LTDA 2A3BA 3EX1A 3WDHA 4C60A 1SW3A 3TDFA 3K13A 3LDVA 1OK4A 1LG2A 1RQHA 1KM2A 2R91A 4WDXA 4PTDA 3LBOA 4QJ3B 5G4HC 4UQBA 3C2RA 5E0CA 2DVUA 5A2CA 2VCCA 2WMHA 2X30A 4JCLA 4KGLA 2Z7KA 1KFJA 3UU0A 1AD4A 2ZFAA 4UQAA 4PB5A 3RX2A 4JYEA 3L4UA 1GNXA 3W7EA 3PF3A 2VRJA 3AI0A 4ZCWA 4GYPC 1VBRA 2NQZA 5IHRA 3DBPA 3ELFA 3EB4A 2A7PA 2ZOXA 4JQ1A 4LBUA 3TLLA 2G5WA 5EY5A 4NAEA 2WK2A 2W79A 3T42A 3WQGA 2FB3A 2J79A 4FIQA 5EBUA 4AIBA 3S1GA 2J8TA 1R86A 3W2UA 3UR7A 3MV01 1OT1A 4CD6A 2IKIA 2EPLX 5BMXA 3HMCA 1UCWA 3G3DA 3GVWA 5I03A 4LS0A 2DORA 4L5ZA 3S4TA 1GW1A 2WLZA 3UWWA 2HRWA 2E9LA 4DWSC 4EWND 1B54A 2PBOA 2PDKA 3PZGA 4J3TA 3VNZA 1YMYA 2E8YA 4GQGA 1HKWA 4QEEA 4YCOA 1GQJA 2UY4A 3LQGA 2OLAA 3A4AA 4YTTA 5CC5A 1R85A 3DESA 4Q8NA 1P0DA 2FJKA 4HSNA 3U4AA 4BWLA 3VIHA 5BW6A 4ZQPA 4K68A 1Q65A 4B3LA 2QCMA 3CAWA 1G4SA 2WQPA 3SN1A 3MI3A 3H2EA 5J5RA 3BLEA 3EOOA 3OIHA 1ISYA 5HMDA 2VNCA 2J7FA 2O9TA 1EIXA 3LV5A 4MYXA 3FLUA 1KXTA 1MW2A 4N6FA 5BXSA 4KEZA 4WK9A 1CLKA 3KBSA 1Q6GA 3RM4A 3UP8A 3B8DA 3J7HA 1UROA 1MQPA 4JBRA 3E5PA 3NUKA 2NVCA 4F0SA 4O19A 4NG3A 2X1TA 1OVDA 5E09A 4ATWA 2DZTA 2WVSA 1ODUA 5FOOA 2VFGA 1F3TA 2BV9A 1XUUA 1W3HA 3UGRA 4GOAA 2VGFA 3EWBX 4G6CA 5FEPA 6XIAA 3WD0A 4S3FA 4C6JA 3CUFA 2W66A 4DPPA 5LIWX 3F03K 5KETA 4IQEA 1K8CA 2E5CA 4PC8A 3APGA 2Y62A 1TA3B 4PA8A 2FGBA 5K7JA 3SCNA 3N6JA 1JL8A 1BTCA 1Q3NA 1OINA 2ISDA 1FVPA 2Y6ZA 4HU8A 1BYCA 3W7RA 1TELA 1HKMA 1M41A 2ZDRA 3VNYA 4ZEPA 4ADTA 1QATA 2FZ9A 3GXPA 3ZOAA 2WW5A 5D2TA 1PTDA 4IFOA 4V15A 2PD5A 1E5JA 1U1JA 3UXDA 2D0FA 2ODOA 1IZCA 3B9OA 1XIBA 4KPLA 4LOCA 3GH7A 1OGSA 1RA5A 1UUMA 1DEDA 3LPPA 4IL2A 5TF0A 1S5WA 2W6RA 3OVGA 3MYOA 1H1YA 1V77A 2BZNA 3CIXA 3GZ3A 1BG4A 1I2RA 4LW7A 2OWWA 1DJQA 1V02E 3N29A 3SY1A 1ZALA 2J7DA 2ZTKA 1A3HA 5I3GA 2X42A 3MTWA 3MBFA 4MNKA 5TBOA 3U57A 1V6UA 4HK5A 5I3DA 3CT2A 4OBTA 2ZUSA 2E6DA 2HJPA 2W61A 4DF0A 2RJGA 2PDQA 2V81A 5I5RA 1XYZA 2IPJA 4O1FA 3B9NA 4WSKA 5F2MA 4K37A 4RDZA 3H6OA 3HA1A 3GE7A 1UR0A 3L4YA 3SJNA 5RUBA 3WH9A 4OUIA 1RVGA 4FI4A 1D2KA 2W5FA 4US5A 4KRZA 4JTDA 2F84A 3RCNA 1ECEA 1YBQB 4JX5A 3LU2A 4BQ2A 2V9DA 5A1AA 3UPWA 3LI0A 2HS6A 3DI1A 4L1GA 4W85A 4CNSA 1OY0A 4PGLA 3MKKA 4XO7A 3QQ1A 1KFWA 2CLPA 3B05A 1QDSA 3T44A 4XZNX 4H6KA 3HGOA 3SUVA 1PIGA 2XVNA 2PDIA 4MAZA 5K4ZA 3GIQA 4WDUA 3S9IA 2CW6A 4H8HA 4AIEA 2VWTA 4TX9A 1JYWA 1V0MA 3BL3A 3OZOA 3WLSA 1UUQA 4O1BA 4DZAA 1EBGA 1SFLA 1WB0A 1Q2RA 2HS8A 2VD9A 1MO0A 3ARZA 3WQWA 1EBHA 3SRKA 2RH9A 3THAA 1XYCA 2WNZA 3KCJA 3OBKA 3A64A 4YIWA 2Z6IA 3AWNA 3RG6A 5CG0A 1FHDA 1VZWA 3WK2A 3OIXA 5C2GA 1R5YA 3WBAA 4LC6A 3C5QA 3ARXA 3QQWA 1WP6A 3PZMA 2GQAA 4ZOCA 4QGCA 2J7BA 2QDDA 1YNPA 3MHFA 4CGTA 4FO4A 3BUVA 3W1UA 3WNNA 1JCYA 3VDHA 1L9WA 6CGTA 4S2CA 4C6QA 1KGWA 2A4AA 2C71A 2Z2BA 5BNKA 4H2CA 3VPLA 2XN1A 2YX0A 3V18A 1UKQA 1YTDA 3NQEA 4B15A 1MUWA 3IJ9A 4CQCA 5HQLA 5DCDA 1LJYA 5A8NA 4P8UA 5I77A 1TO3A 4KGJA 2E9BA 2XWDA 4B92A 1O12A 3S5OA 3H7UA 3IRDA 3QR0A 1FFQA 3GNNA 3MUZ1 4GUIA 5C6MA 3W26A 2Z25A 2J4GA 2FDSA 4HPHA 1GVYA 3GHUA 4TX6A 1TTQA 2FGZA 1HQTA 4L56A 1OD0A 2FZMA 4KCWA 1B9BA 2HSAA 1O1ZA 1UWTA 3VDGA 4NHVA 5KZ6A 3IAQA 2VGGA 2BWGA 3UCCA 4TUFA 5HJLA 2W62A 3AS0A 3CV6A 3M0ZA 4FF5A 1MQQA 2A3HA 2CZEA 2NX3A 1W5OA 1JZ5A 3VE7A 3GVGA 4D6GA 1VEPA 3AROA 2G3MA 4N0RA 3GVRA 2P5NA 3Q65A 3HGRA 3DYPA 1ZAIA 3QV6A 4UFLA 1CWYA 1QNSA 2WMKA 3W1RA 1QK2A 4ERIA 3W7KA 3QTPA 4UFHA 3RMEA 4PR4A 4IFRA 3O9NA 5JH2A 4QR6A 4GKTA 1WDSA 2VEMA 4C1LA 3CUGA 4HHHA 4LVDA 1JRBA 3Q37A 3T0AA 3TTOA 5A8PA 1FTXA 1RR2A 2IXUA 3CH9A 2ZX8A 3IK2A 1S38A 4U28A 3I10A 4FX6M 2A3EA 1OFDA 1V3KA 3TQPA 4OBRA 7A3HA 2YFNA 4NNAA 5IM51 4IUGA 2BS9A 4WY0A 4MJZA 2IUZA 1LOSA 4EWJA 3HG3A 2FB2A 1V03A 1UZ1A 4QG6A 3T8QA 4UWMA 2CLOA 1JCLA 5AHLA 5AHMA 2BNJA 3C2OA 4NNBA 2QIWA 1KA9F 5FAGA 2WMFA 3BARA 1R38A 1TJPA 3QV7A 1VENA 5FACA 1IQ8A 3T55A 1TE1A 2YDSA 1W17A 3QVQA 3JU2A 4RCXA 4HMNA 2BXVA 2PWEA 4FZIA 4K39A 1T99A 2YJQA 4GUHA 2J9XA 3DFPA 2PGWA 3VIIA 2ZBTA 3CUIA 1FH7A 4Q4QA 1UBSA 3VKAA 3W9ZA 1UA3A 3SQLA 3O6DA 3PZVA 5FAJA 5LIXX 1EP2A 3KVMA 4F2BA 5HWMA 1Z9AA 3A12A 4B3KA 4Q4RA 3WJSA 3UJ2A 1A53A 3RITA 2ZA1A 2VEGA 1DP0A 4M5PA 3W6MA 3QZ6A 3KX6A 3O7UA 1RD6A 4U10A 5G2WA 3V1PA 1A0CA 4FALA 3I7RA 3OHMB 1BLIA 2VYOA 4V28A 2X0SA 3W75A 3RYSA 1W5PA 2OFJA 3EA1A 5LNVA 5FEWA 2YL8A 3MBDA 1UHVA 4GYKA 2XVPA 3AXHA 4H7CA 3ISIX 3NJ3A 5H6HA 3TR2A 3V5CA 4CVUA 5A6JA 2YPIA 2VO5A 1H7OA 2CXGA 5ECVA 2PI6A 4OWGA 3S6OA 4EXBA 1OFBA 4LAKA 4NVTA 3VUPA 3OB8A 1TQJA 1XRTA 4PSRA 3T0TA 4ZVJA 4P7LA 4F9DA 2QLYA 5IBXC 3WX7A 3GR7A 4XVDA 4V1XA 4DXVA 3EWCA 4RV8A 1FWFC 1EJRC 4ORIA 4ROPA 1N8IA 3G0SA 5B7YA 1QFEA 2GQ8A 4POCA 1WDPA 5T9CE 3FEMA 1TJ0A 1X8FA 2XZ7A 3CAVA 2WKLA 2DZUA 1R46A 3TAKA 4ERAA 1FFRA 2HBVA 1TFVA 4QS5A 1L6FA 1TR1A 1TQXA 1G7UA 4E3TA 2CZVA 3CLMA 3F1QA 4JL2A 5DO8A 1EJXC 3I7SA 5FJTA 3EXRA 4LU0A 2XIBA 1WXJA 4IF2A 1WXYA 3ZT6A 1ZL1A 2X1UA 3L67A 2KX9A 1PE1A 5HA7A 2YBUA 1U1HA 2V6AA 4J2PA 2G37A 2G97A 2NQHA 5C9ZA 3IVUA 5FF2A 2OEKA 4LF1A 4TOQA 4AZBA 5JQ9A 2GFTA 4CCDA 1XCFA 4UQCA 1R2RA 1V6VA 4H9ZA 4Z42C 4PFMA 3W2LA 1C91A 3O06A 1O5QA 1XM3A 3MKCA 3TUUA 4X60A 5HMFA 1V3IA 2BDQA 2DVTA 1VC4A 3S5SA 2JKPA 2GSEA 3TMQA 4W84A 3EOEA 5CCZA 3UWZA 4AX7A 1EC9A 4TXEA 3B8WA 3PG9A 3A9IA 3NVTA 2A6NA 3S2NA 3S5ZA 4DUVA 3UA4A 1AW5A 4UTTC 3E2VA 4FIRA 1TV4A 4JFWA 3WO8A 2OMAA 4FR1A 1DXIA 3W7OA 5C54A 2YKKA 4NXKA 3M0MA 4A8IA 1PYMA 1F4HA 2A21A 4A2SA 3KBVA 4KWSA 4MKSA 2WANA 3WEMA 1YNQA 4QLJA 4RNFA 4JFSA 7PTDA 2XINA 2Y0FA 4WQ6A 4Q32A 4JQ3A 5GVJA 3RLUA 1T0OA 4GA8A 5DXYA 3TKFA 3KBJA 3WDQA 4ZSUA 2J88A 4CU8A 4P8WA 3MJMA 4OBSA 4X0NA 4DJEC 1HG3A 1M01A 3H22A 1Q5MA 3IGSA 3UZZA 3O05A 2QDGA 2DUAA 3SW6A 1EWEA 4YJ5A 4CKQA 4ACZB 4J3SA 2GGHA 2F38A 2TYSA 4AH7A 2V3GA 1VPQA 2Y88A 1XC4A 1MWOA 3CMJA 5JBFA 1OX6A 4PMNA 4MLJA 3W37A 4AFYA 4DWDA 3CQ0A 4JGDA 1TPDA 3LS9A 4P7RA 1JUKA 3BJTA 2INFA 3EX2A 4CD8A 3VTRA 4LB3A 3DFHA 4DO6A 1D3HA 1R9XA 3ZJ6A 3TVAA 1X6LA 2O0TA 4UTIA 5EMMA 4IIEA 1PSCA 1O7AA 1LOLA 1XLBA 5LIYX 2IKGA 1W5MA 3WMSA 3P67A 5AC6A 3UEQA 3RRXA 2W9MA 4WDTA 4AY8A 3RAOA 2ACQA 4O50A 4FXFA 2V5CA 1NDYA 3FX4A 1RV8A 2Y63A 4Z1CA 1A5AA 3T8LA 1WE5A 5DRCA 3E1F1 2CKSA 1ZJIA 3WNKA 3OODA 3OZPA 3GR8A 1KM5A 3PN8A 3PHAA 4YVPA 3DFYA 2JE8A 3AJ7A 4UTUA 2G0WA 1B2YA 3OJGA 1J9YA 1CCWB 5KITA 4QP0A 3CU2A 4MF4A 4IG2B 3AYVA 3BC9A 3PM6A 4ZO8A 5DBUA 3F2DA 4Q6JA 5FJOA 4XKYA 4GZEA 5MF5A 2D1ZA 5D37A 3A5FA 7CGTA 2G3IA 1QWGA 4IWWA 4C6FA 3LK6A 1OQFA 2DZVA 4KERA 3W83A 3GTNA 1J5TA 1GVQA 3WF0A 4B5SA 5KZDA 4A29A 3HGJA 3W1AA 2V5BA 4AAJA 4AZGA 4F2UA 1V6WA 5AYXA 4NX0A 1UMLA 2AAAA 3ZT5A 3CGTA 1E5NA 1IT8A 4GCAA 1XIMA 3GU1A 2WMIB 4AZIA 2CBUA 2WJDA 1JPKA 4WKHA 4HJFA 2I57A 1XIJA 5C7VA 1VYSX 2BHUA 3S2CA 3LCIA 2CFFA 4GQRA 1F05A 4AZHA 3QQ0A 3L7RA 1XICA 5B7ZA 3A23A 2ZX9A 4PMUA 3THQA 4A3QA 1IGWA 1QHOA 3UYCA 3AS2A 1GQNA 4GMEA 3AHTA 8CGTA 1DIOA 1AZ2A 4EIVA 7TIMA 3MT1A 4O13A 1Q6OA 1NOUA 1J0HA 1J6OA 4Q8QA 1GYNA 3RIKA 5PTDA 4IIDA 4ZTYA 1CLXA 1VQTA 1JZ8A 4F40A 5C9XA 3P5ZA 1HP4A 4E3VA 4I6VA 4TMBA 3NZ1A 5HMSA 3TK7A 3L65A 2PWHA 4HTYA 2V5DA 4JTIA 1GOWA 3SCRA 2EKCA 1ZENA 3NQ8A 2RDTA 1G67A 4PMVA 4E4FA 2HNEA 4IFKB 3STCA 3RM8A 4NL1A 1W31A 3KXQA 1E71M 3RILA 2EPHA 4DHGA 1SJCA 3ZS4A 2BGQA 3ZJKA 1R3RA 3K4AA 2VZVA 3VOIA 2J7HA 4XX6A 3DC8A 3ALFA 1K9EA 4MB5A 5I3JA 2XJ7A 1U83A 2EG6A 4QJ4B 5HUPA 1PAMA 1E4LA 1WZAA 3W7PA 3H4GA 3SCWA 3KHDA 4DBEA 1TV8A 1Q45A 2PWUA 4DBSA 1AQHA 4LAZA 2ZZ4A 3CQIA 1C8VA 3GQYA 3KZPA 1V3LA 3V4BA 2OEMA 1ZB5A 4AIOA 4XAFA 5HANA 1KCKA 5CZJA 7TAAA 3URQA 1FWBC 1WZLA 3DU0A 1RCOB 1M3UA 3KE0A 3I3EA 2G96A 4WUIA 4NY2A 3IVSA 4PUMA 1YPIA 3L0NA 3U48A 2CLKA 3ITVA 3GLCA 1PCKA 5M03A 1KGXA 2W3ZA 1HO4A 1QO5A 4HB7A 4ERGA 4NNCA 2OZ3A 3E2RA 1XFCA 4ICNA 3SECA 1XG3A 1IEVA 1J4EA 1JD7A 2WVVB 3LX9A 5CC7A 4XSMA 5D38A 2J13A 3E0IA 4PMQA 2XSBA 4Z1DA 2EJAA 3GNOA 5CZKA 1H62A 1BPLB 2J8FA 5I02A 1D8CA 1OABA 3POCA 3EX4A 5AHFA 1KM0A 3ITXA 1L6GA 4UMCA 3QKEA 4W7WA 1I8JA 5HK4A 4OHQA 5CPQA 3V35A 1BWLA 3LM7A 1LBLA 2JIEA 3LSCA 5FSDC 1E51A 2VFHA 2PS2A 1EDTA 1JF6A 1D9EA 2QT3A 3TYAA 2PWVA 4F79A 1G4TA 3NL5A 3B03A 4AD1A 4E8DA 3WJZA 5AHEA 3ONCA 4AHQA 3PUOA 2CZDA 3LHZA 3QFWA 1XRFA 3HZ3A 3QYSA 3ZWTA 3B8UA 2OG9A 3P62A 1W56A 4FP1A 1P7TB 3LEPA 3IPWA 4MUPA 1XLFA 2OYLA 2QCGA 4W88A 4AD5A 4PMZA 2YCLB 4CD7A 1FHLA 1SJBA 5IOBA 3OG2A 4AD3A 1QPKA 1B0IA 3QLLA 4PRWA 1B57A 1JYVA 1I2OA 1O60A 4DO7A 4OJYA 1EGMA 3EDFA 1JQVA 3BG3A 4O0ZA 3NYZA 3TZFA 3W76A 1FKWA 4W7UA 4OECA 3T2PA 4AWTA 3EEGA 2DH3A 4HU0A 3Q67A 3BW4A 2TAAA 1I4NA 3DENA 3DYOA 4HD5A 3SFKA 1EHNA 4ILSA 4NJKA 3LSBA 4J1OA 4BK9A 2CWNA 1ME8A 4LANA 2DT2A 4Z17A 5DLCA 1D7FA 4QQ3A 3W1QA 2PLMA 4DO4A 4IP5A 3ME3A 3C0LA 4CCZA 3PBMA 1POJA 5HOSA 5CEWA 5G1TA 4A2RA 1XXXA 4Y9PA 5AZ0A 4J35A 1MFUA 1XGDA 1IIGA 4Q3MA 1O5RA 2PLCA 3G0XA 2XIJA 3TZNA 4B9ZA 5A5WA 1N8WA 3W07A 2VOMA 1UD4A 4QE5A 1LT8A 3TTSA 2YA1A 2PODA 4OOUA 1ITUA 3BCJA 3P7YA 2RDWA 2GK1B 2VCAA 1H3GA 1ECQA 4NASA 3EPMA 1Q4NX 3E6EA 2XFRA 5AC7A 1JCTA 4MDOA 1DJYA 1XWYA 3GKFA 1G69A 3PSVA 3CV7A 1SJDA 3GR4A 3K46A 2DJLA 3WQEA 1VCGA 4JNYA 2EGZA 4AHPA 3R4IA 1XQLA 3EDDA 1C93A 5M2FX 3VD9A 2V8ZA 3EYPA 2DT1A 1NARA 2R24A 3UWQA 3GH5A 5DF0A 4J27A 2CLIA 4B5TA 2GDVA 4ATLA 5LHEA 4WDWA 4UUIA 1W5QA 4OFCA 3KVKA 5CBIA 2Y5SA 1HKVA 2XSXA 5F1VA 5ABHA 3O8AA 3TR9A 1TPC1 5AHNA 4G7EB 4QRNA 1HJWA 5H8MA 1L0PA 3E49A 5BU9A 2AMGA 5DQPA 2Y8UA 4HK7A 1DYSA 1ALDA 2JBMA 1FY6A 3RX4A 4JN6A 4K7VA 4Q4PA 3BV4A 2NQ5A 1FCQA 1YXYA 4AB4A 4EF9A 1E9IA 2PDLA 3E5BA 4E0CA 3W1NA 3ARUA 1RJRA 1C7SA 2R82A 4TIMA 4JKMA 3HFYA 4K3ZA 2VQTA 1HL8A 4FLSA 1A5CA 4NQ1A 3ZIZA 3U2EA 4Q4SA 5G2HA 4ICCX 2PDBA 3H2OA 1T8QA 1QPQA 2PZNA 2ZUMA 4R5EA 3SR7A 3LN3A 3VXGA 4IHCA 2E68A 3GRIA 4XZHA 5EMLA 3ZVIA 4QX4A 1R30A 5M3WA 4IMCA 1XDMA 3MA8A 2WM1A 4Y9MA 4OTKA 3WLJA 1TRDA 3E0VA 3BJFA 1MNSA 2NQ9A 2YFOA 1UBPC 3EWXA 4TTGA 1VPXA 3TYDA 1AG1O 3SN4A 2QIIA 4AY1A 2HISA 3MHUA 5A6SA 2GVEA 2YL5A 4MMWA 2RHGA 3UFYA 3L9CA 4KEUA 3UG5A 4R7OA 3DFTA 6REQB 2BY2A 3CXOA 1HX0A 5F2IA 2DZAA 3I6RA 4DLFA 5AY7A 2CPUA 3AJXA 2VFFA 3WLRA 3RLVA 3SIMA 1AH3A 2OXNA 5A8OA 1SFJA 4HKPA 3R13A 4PMRA 4I5XA 4ZOEA 4ZSTA 2E1DA 2XFYA 4PUKA 4KEMA 5LKYA 3R58A 3FS2A 1SR9A 1QASA 1GVEA 3NDOA 1EOKA 1T6MA 1ESWA 4QS6A 2Q8LA 3BVJA 1D3GA 3II1A 1GQIA 4F0KA 3L5LA 2EAWA 3LG3A 2D2GA 2QV4A 1LRNA 5KSWA 3GXDA 1TWZA 1YADA 4LAMA 2CBIA 3SUWA 4LH8A 2WHLA 1J93A 1BRLA 4G7FA 4GI4A 1MXGA 4ZR8A 4GFSA 4Q8OA 2Z1XA 1GJUA 4BEQA 3LHUA 1PWMA 5LGZA 3BK0A 3ZR4A 3GW3A 4YHEA 2CZFA 4N4QA 1K02A 1VCFA 2J7EA 1POKA 4PL2A 5GJMA 3TC3A 4ZB0A 2A3LA 1AZ1A 1WBJA 1T40A 3AXMA 4C6NA 3AMLA 5HBFA 1HJVA 4GABA 4CCEA 3BE7A 3ZT7A 2UY2A 4P7OA 5CPTA 1RY8A 3AYRA 3LLXA 5B80A 3EB2A 4D71A 3WH5A 2ZZ1A 4J3XA 4RDWA 5M1TA 5CJMA 1RQEA 4LY8A 4Z2HA 2NZLA 3JZUA 3MUXA 4S3KA 3QC3A 4JHMA 5D9MA 1TVLA 4ZFCA 3GZAA 4BEUA 4YU1A 1SFTA 1ISWA 2GUUA 1JR1A 4DWSB 2X1RA 3VMNA 2VXNA 3PBUA 1UJPA 2GJPA 4WEVX 4MY8A 3CUHA 3TOYA 1QPOA 3PJWA 3CQJA 1O94A 2P1FA 3VGGA 2I5QA 2VRQA 4GH3A 4AZCB 3AYSA 4C1NA 1XSJA 4O8AA 3EBVA 1VCVA 1NTHA 3N9SA 3W2JA 2DUXA 1MW1A 4IOTA 1RCQA 2P88A 3NFUA 2GJLA 5F2LA 3CB3A 2DH2A 2YBVA 1XFBA 3L23A 2C15A 2WMGA 1K8ZA 4JTGA 1CB2A 3H53A 3FAXA 1IEIA 2OOFA 4NI3A 3VIOA 1NQKA 1CGUA 3C8FA 4LCSA 1V5XA 1OFAA 4PUEA 2ZRXA 3EPOA 1S1PA 3MY9A 5REQA 3O6YX 1L2UA 3E74A 2Y5EA 3NNTA 1FWEC 1MUMA 3KRSA 5I23A 3D47A 2YXGA 1KR0A 2JF7A 4C1KA 3Q94A 3N25A 4XAYA 1DQWA 2VDHA 3W25A 2XFWA 3WLMA 1GKQA 2DV0A 1OFOA 1S2UA 1CW2A 4UNKA 1SO5A 3M46A 3HB9A 4JTKA 1B31A 3U6WA 2P0OA 4U31A 4B5VA 2QMJA 2POZA 3B4YA 1TZ7A 4U33A 4CU6A 3N2OA 3CL8A 1HFBA 3VOHA 4NRSA 3U2CA 4L7ZA 3T4WA 1PJ9A 2J66A 4QITA 3CWHA 1Q6FA 4CLMA 2XGZA 1VPYA 3TTQA 3C3UA 2IQDA 3TC7A 3A21A 3U7VA 5CSSA 3ZFHA 4F48A 3FDGA 3NSNA 3DG3A 4DBWA 3VKKA 1DE5A 1GTHA 1MRQA 2BHZA 3KOFA 1X1ZA 2FH8A 3BLOA 1W3LA 2I5GA 3DAQA 3ITYA 4P8VA 3GTXA 3VGEA 1FCBA 4C6PA 4FB7A 3GHRA 1OX4A 4PTVA 5AZ1A 4A35A 1J0ZA 4ROQA 3BGGA 4LS2A 4HCHA 1PZ0A 1S2WA 2OO6A 2P76A 1NIUA 1UWSA 2R1PA 3OQ8A 4RNIA 1NFGA 1UWQA 2YA2A 3UETA 1DL3A 1SO4A 2PDHA 2PDCA 3BZJA 3DCPA 4M6QA 3MV11 3W53A 3UESA 1RBOB 3DGRA 1EL3A 1L6SA 1P6WA 1O1HA 2GUYA 5HWJA 3W7CA 2ZUWA 1AK5A 2DJXA 3EWZA 4NF7A 4LEQA 3EKZA 3T78A 1BVWA 1RA0A 3LPFA 4P7QA 1IT7A 4X2RA 1KKOA 3WBWA 2QCCA 4G2DA 3RR1A 1B3ZA 3ARRA 2VQUA 1EJUC 3PAOA 4L4OA 4C7FA 3IIVA 1VR6A 3M0YA 3M0VA 1SO6A 1ZJBA 3LHWA 3IIZA 4GYJA 1DJGA 2PP3A 2WKGA 1B3XA 4LUSA 4JTUA 2PBGA 3WENA 3U9IA 3LHVA 5G4EA 4EVZA 1XSIA 1H7NA 1XLJA 5CGMA 3EMQA 1JD9A 1S3HA 4JIHA 2DZPA 2O4MA 4MWAD 4NYYA 1B4EA 1QI5A 2Y4SA 3TOPA 2CESA 3CMGA 1JGIA 1DHKA 1EZ2A 2XFFA 2OZ0A 2ANUA 3EX6A 4PCSA 2O9OA 4YHGA 1I2NA 1ZBCA 3MMTA 1TUXA 1XIEA 2J78A 2TODA 3KRBA 3R11A 1QJWA 1EJTC 1RAKA 2ZC1A 1TPB1 3H23A 1H5VA 2Z24A 5I0DA 1JXKA 1MW3A 3ARYA 2VEFA 3ABOA 2AL1A 4DX3A 1V7AA 3K1GA 3UR5A 3UW6A 2JALA 3W7HA 4HQVA 3CO8A 4MWAA 1SW7A 3UXKA 4WRHA 3AYTA 1M7OA 1E15A 4V1YA 3G1FA 1J0IA 1FOBA 2E28A 3MMUA 1CGWA 4OV4A 4W87A 1GCYA 4BY3A 1E1CA 1EEXA 5AC5A 3QY7A 1F3XA 1XYMA 3ALGA 3W70A 3WLKX 3MVTA 2GDUA 4KW2A 2WC4A 3W1XA 2VCBA 2J6VA 4FSAA 3A9BA 2WWCA 1EJ7L 5HNNA 3NEVA 4NJHA 3WELA 3KW3A 5JBDA 2VWSA 5CQ1A 2VT0A 1K3UA 4O54A 1QTWA 4AX6A 1T5AA 2YCEA 1E0VA 4K6AA 1UR4A 3CASA 5CGQA 4JICA 3V0SA 3V16A 1WCGA 3KBMA 4JEJA 1XUZA 1KTCA 4O1EA 4X2PA 1TVNA 2GQ9A 4LBRA 4GGBA 3NZPA 5K9CA 5A6AA 3GC2A 3N1AA 2ZRYA 5HINA 2ZZ3A 4LV4A 3KCOA 3BSMA 2OZ8A 2D23A 2WSYA 3SAZA 2OX1A 4WKFA 1EJVC 5AYYA 1XYFA 2VX4A 2RAGA 4XB3A 4UXDA 4AD4A 1LP6A 1TV5A 1HJUA 4XTIA 2YW4A 2VURA 2FHBA 1PZ2A 3UG3A 1GVIA 3H7RA 3KBNA 4GKLA 4ADSA 1WX0A 3ICJA 1O5XA 4AVOA 4A8NA 4LVGA 4E38A 4DO5A 4MFEA 3HTWA 1GHSA 2VX7A 2WSQA 3UY8A 3OG3A 5BRQA 2BMBA 1XIGA 4MVAA 3WD3A 2X8RA 1XJBA 4EE9A 2XVKA 4DJDC 7REQB 4J40A 4R9OA 4H41A 3R89A 3SFWA 2D73A 3C61A 1UMYA 1U5HA 3UNTA 2QKFA 4LEFA 4GLEA 1DWAM 1AMKA 4J2MA 3NEHA 2X2YA 2ZE0A 4M0XA 3MMWA 4B4FA 1HT6A 2C13A 3OZYA 4FHAA 4WY0B 1IEQA 4GI6A 1C8XA 4IGNA 2X7WA 2C0HA 1CENA 3QXBA 5LXXA 3RFAA 1I1WA 4GXWA 3A5VA 3NZRA 3LI1A 2FIQA 3QW4B 1U2YA 1XH1A 4N9EA 4O53A 5BROA 4YMZA 3JS3A 4YTSA 1TJ2A 3ONBA 1FHVA 1S1RA 1OFRA 1R7OA 4GNVA 5I3IA 1W37A 3LM3A 3WJXA 3TV8A 3WKZA 3WK1A 3WQ5A 8XIMA 3KVJA 1CXEA 4FLRA 3ZQ9A 2EKGA 1TG7A 5A6LA 2GVYA 4NAFB 2R8WA 4BQ5A 5EU9A 3WLNA 4AXKA 2XIQA 3CT7A 1QHZA 4IP7A 5HATA 1YKWA 4QLKA 4H6QA 3T7VA 2JKEA 5IHSA 4M24A 1LG1A 4M80A 4I8DA 1OYAA 3MUCA 3QRHA 1YX1A 2E7FA 1YPXA 4E2BA 1OGGA 2FFCA 3BW2A 1E0TA 4IMAA 4P61A 2V63A 4EANA 3B3DA 4GVIA 4UR7A 4E8CA 2NV2A 1I2QA 3KP1A 3R1ZA 2C0AA 3BG9A 4D6EA 1V0NA 4KFOA 4HNLA 2ZA2A 3NL2A 3UYIA 3M44A 2F6KA 4MZYA 4RW3A 3VILA 3KTXA 2ZCGA 1XQKA 3P6LA 3URAA 2QDHA 3DG6A 4WVXA 2FZ8A 2PWGA 2FLIA 1YXCA 4NILA 3PZOA 5JIPA 3HU7A 3SCVA 4HPNA 2GL5A 1MNZA 2C1GA 2REQA 2J9YA 1PEZA 1CYGA 3P93A 1O6IA 3QZEA 3WNOA 1FWGC 4P7NA 3B97A 4K36A 4YL2A 1DQXA 3WCZA 3TN6A 5LA1A 1GOKA 4ZQMA 4H00A 2WCGA 2BASA 3W87A 4DPQA 3WEZA 1OB0A 3FGCB 2TPSA 4UR8A 4LPCA 1MRAA 5H2ZA 5CAKA 1EIBA 1LOQA 1HVXA 2VEPA 2D0GA 3URBA 4AY7A 2YB4A 5H1WA 5D8ZA 4HA1A 2KZHA 1YE6A 1KCLA 1SQ7A 4JR5A 4O4VA 3GC4A 3IIOA 1OCNA 4M8UA 2E3ZA 3LZ5A 2B7OA 1VLWA 3QZAA 3TQVA 4HNNA 5A6MA 1E3XA 1M03A 2FFIA 1K6WA 3A6OA 4DBUA 4MY9A 1UC5A 1Q66A 4XZBA 4XAZA 5C9WA 4R7WA 3SSJA 3QOMA 3VNLA 1W3NA 3UF9A 2ZWYA 3GNRA 4ALDA 4GUJA 4DZ5A 3NURA 3MYPA 1AODA 2R1LA 1IR2A 1OCJA 5A2BA 4GIYA 4BI5A 4HTBA 4PMDA 3W7LA 4HNTA 3EOLA 4FEZA 2B7NA 1VBGA 1G94A 5JH1A 5TAOA 1OF6A 4ATDA 5J04A 5HR7A 1IE7C 1SGJA 3P80A 2WZTA 3TJXA 2QF7A 3N19B 4GO8A 4U5KA 3OGRA 3THUA 3VAVA 4LUIA 3VKDA 4LRSA 3G1VA 3BG5A 4NZFA 3VYLA 4PBFA 3NQAA 3N17A 3CZJA 3ARVA 1A0EA 3OVQA 3PY2A 4PMXA 1GTEA 3F2BA 1E0XA 3BOXA 4A05A 4GUGA 3PC0A 2FTPA 4LAOA 2PEVA 1IWAA 1XLLA 1NM9A 1U5JA 1DE6A 4QG9A 1LBMA 3OTRA 2ONEA 3DUGA 2D3LA 3CMFA 1J12A 2JK2A 4WJ8A 3SQMA 5CKSA 1TPVA 3SGUA 2ZQ0A 4W89A 3GDRA 1S5VA 5K4XA 3UJEA 5AC8A 3LXCA 3TNOA 3U5UA 4JYDA 3GWQA 3AALA 4PTNA 4JHZA 3KTCA 3MP3A 2BY1A 5F4SA 4ES4A 2ZX7A 1HN1A 4LBSA 4C5YA 1OFQA 4UTWC 2NX1A 4HMCA 3O0FA 4GY7A 4JQ4A 4IPLA 5CAHA 2HVNA 1P0KA 4FPSA 4KIRA 4L6HA 1SO3A 3OA5A 1ZTVA 2DQWA 1CECA 1ICQA 1ONXA 1EF2A 4G9PA 5FF0A 3LCXA 1HIZA 1OWQA 3OBEA 1KBLA 1GORA 1ENUA 2GVGA 3VMPA 1JAKA 1Q7MA 1V79A 1RLDA 5JMUA 3FK4A 2H90A 1WKFA 5C0QA 2ZUTA 1R3VA 3CNYA 1C8QA 1VFHA 2ZRUA 1H1ZA 4JL1A 1F73A 1CXIA 3TCSA 4IMEA 5BZAA 1XG4A 1J2BA 4GI8A 4UOQA 3W1LA 4IQJA 3HM7A 1CXKA 2CLHA 1LLZA 1IXPA 1N7KA 3IRSA 3IUDA 4PULA 1P0EA 2FMOA 1B5TA 3Q4DA 2XN2A 1F3EA 1XHGA 4DYJA 1KLYA 2Z00A 4DJFD 3K2GA 4A3YA 3M0HA 1GPWA 1NELA 1FWHC 1JXJA 3UJSA 5BWAA 3QGKC 4JX4A 1EF3A 3DGBA 3AHXA 3CK5A 2VZTA 1G7VA 3BTNA 4LY4A 3R94A 1YLVA 4QTGA 4PN2A 4DYEA 3CAQA 4IISA 1AA1B 5ABGA 1XRSA 2VFEA 4EX4A 4ZTXA 4EXQA 3CZKA 1GJPA 3MANA 5FKYA 1H4PA 1UWAA 3FFSA 1C8YA 3UVIA 4GIAA 1FWAC 1RD5A 3BMWA 3O1NA 3SCQA 2W4XA 4PTMA 1A5KC 1ZBWA 4UOZA 2FPTA 4DJFA 2QVNA 4DXKA 1NWUA 4JS3A 4IJRA 1GW9A 3K8LA 3EDEA 1UD5A 2ZDSA 3E0FA 1NP0A 3WQFA 4MM1A 3S1UA 4HPXA 1OZMA 4LWWA 4CQDA 1TWIA 3KWSA 1VBJA 2WJFA 4GNKB 4AW7A 1JZ3A 1E6QM 1YTEA 1PYFA 3B4UA 3W86A 1TA3A 5JU6A 4D6DA 3G1HA 2HQAA 2D22A 4IGSA 1IT0A 4AZ7A 3W28A 3AZSA 1HGYA 1SZNA 2MANA 3NO5A 1E6SM 3KRZA 2ZXAA 2V3EA 3GNXA 4QROA 4N9CA 4WJEA 4IX2A 3VNMA 2OSXA 1L6YA 4XZMX 2B81A 4Y8EA 2YCKX 1OC5A 2OVLA 2EPMX 4S3DA 3LCFA 2PA6A 3H21A 3G6LA 3TN3A 1UD6A 1LORA 3BW3A 2BXZA 3CQHA 3FJ4A 2V2CA 2R6OA 3CL7A 3N04A 3W24A 3W73A 1RK6A 5A6TC 1UQYA 4E4PA 1LCOA 3I7QA 4MKNA 1A49A 2NT1A 1GKPA 4XWUA 1TR9A 5EMJA 3EA2A 1EH9A 8TIMA 2XZ9A 4LGXA 4XZIA 3CPGA 2B7QA 4LTSA 1ZCCA 4UOJA 3W2NA 4UFIA 3WH6A 4FNUA 3N12A 4PRRA 5G4WA 4LUJA 4GJIA 2QCNA 3LPOA 5EB8A 3T07A 3LNPA 2O9PA 3EZ4A 2ZZ5A 2D2HA 2CLLA 1XIDA 1TTIA 5A6BD 2AGTA 1JQXA 4CN1A 1ME9A 4DEFA 3NQVA 2C1IA 5E1QA 2Y7DA 4TO8A 1QBBA 2CLEA 3GDLA 2AQWA 2PDJA 3W7IA 4GYFA 4L64A 2QCFA 3PNUA 1R47A 4AMAA 3NQCA 1KRCC 1KO0A 3FKRA 1FCVA 1UASA 3ARQA 1ZQ5A 4YN5A 3LYEA 3TTYA 3H12A 3B0VC 4M29A 4CEXC 4NZ4A 4OGZA 1F3WA 3M43A 4LSBA 4XBKA 2PRLA 2PDFA 1CGXA 1Q7ZA 3U4FA 2E40A 2PU1A 5A6BA 5E5CA 3W7DA 1VFTA 2WWDA 3S9YA 3GU9A 4AISA 1Z48A 2BOGX 2O9RA 3K4WA 1LT7A 4UFMA 2VR5A 2A7NA 3I6EA 2C19A 3E0WA 4MPQA 1JRCA 4PCFA 1EHAA 4D1JA 3QGAC 4CNTA 3WUEA 1HUVA 3BCFA 2NLIA 3WQPA 1TPFA 2A6LA 1US2A 4YNGA 1IEXA 2XG9A 4S23A 4GXMA 2NUYA 4FF7A 3A24A 3PZ9A 1J96A 1V08A 1H50A 1QPNA 1KCXA 3R8RA 4KCTA 4O52A 1XLGA 5E9AA 1FWDC 4NZCA 1E6ZA 1TREA 5CC3A 1FUYA 1PZ3A 3QV9A 4O15A 4YWIA 1K7XA 1Z3NA 3K8MA 4AZ6A 4W4QA 1TTJA 3SRDA 4LNCA 2E67A 5EYWA 3VGBA 2VOTA 3RPMA 5IDIA 3H7VA 4GG9A 3P14A 3AFBA 3F4WA 3R79A 1Q6RA 4XAPA 5AOUA 5HJYA 5AB3A 3WSUA 4WXYA 3WLIA 1KFEA 1XBXA 3CPRA 3CM4A 1QMLA 4NP7A 5JBEA 4OVXA 2GGEA 4DNMA 2Z29A 3OYZA 4IIHA 1K7FA 3W0KA 4QFUA 2P53A 1FH9A 5M17A 5LSMA 2XVGA 4RZ4A 1ITCA 3CZLA 2PDMA 3CUJA 4UQDA 3QPEA 4IQDA 1HJQA 2RGMA 2VX6A 2WSRA 4K8HA 4PYSA 4ML4A 1GG1A 4JFVA 3BO9A 4LS1A 1M1BA 2ZC8A 4ZO7A 1E6XM 4JFTA 4Q7IA 3NOYA 1LLWA 4N02A 2Q3OA 4V2XA 4H9UA 4GVHA 2Q71A 4BF5A 3N3MA 3KCLA 3PFRA 4UMAA 1ADOA 2HNHA 2ZXBA 3AS3A 3LA4A 3ZM8A 3CHCA 2A2IA 1T96A 4IMFA 4V27A 3VOFA 1N8FA 3SCOA 3BOFA 3A4JA 3WF2A 3LLFA 1OG0A 3IIPA 1HVQA 1YYAA 4DAFA 1TKKA 5I7GA 1ISVA 1FDZA 2BY0A 2EEXA 4I5UA 4MHBA 2WM0A 1ONEA 4Q4OA 3DEQA 1JEZA 1XSKA 1YW1A 2C18A 1RVKA 2J6XA 4ZOBA 3GW0A 4QXIA 1BVNP 3VDCA 5AKQA 4BWLC 1K70A 1UWRA 3OEXA 4P5UA 1VYPX 1X98A 4ZB5A 4CQ9A 1ZUAX 5CPNA 2CKRA 3O0KA 1WDWA 3GVVA 5A2AA 5BCAA 3GS6A 2XIOA 4JXCA 4YTRA 1K9TA 4AEEA 1NFBA 2QCHA 1CI1A 1L8PA 1PO9A 1GEHA 4M82A 5D9OA 4QJ5B 1SZFA 3BMXA 4M1BA 3LNMA 4YYCA 4O0QA 4GBDA 2G95A 2XGIA 2PDNA 1EKOA 5I24A 1K9DA 3ORWA 3SEPA 2I5IA 1NWSA 2PRHA 3ZZ1A 4REQA 5HUOA 2GDQA 2JF6A 2NUWA 4X63A 1X1OA 1MDRA 1TSIA 2Z1KA 2H3BA 4Y9OA 3AHVA 4GRSA 3OGSA 1KXQA 1OSEA 4IXXA 2PPGA 1S2TA 1BQCA 2BY3A 3SJ3A 1GQLA 1UB3A 2DSVA 2GOKA 4DI8A 1UP0A 3MSDA 3THCA 4MNJA 1L2QA 5C8BB 6ENLA 4HOZA 1I1XA 3DHPA 4DZIA 1DIDA 3QBUA 1ZAHA 4B5WA 5AYBA 3JRKA 1UD3A 4BI7A 3MSGA 4OZOA 3G8RA 4YCPA 2MUCA 4LUYA 4AC7C 4KS0A 4XVEA 4RX0A 3HBLA 2JIWA 3WLHA 2FPVA 3AHYA 3C0QA 2WLYA 4PCPA 2V67A 4S2BA 3AMGA 3TYBA 1RPKA 5HMEA 3U3HA 4F0MA 1WUEA 4UTFA 1V4YA 5I79A 2F6XA 3MP4A 2OODA 4A3RA 3CV1A 2Z1SA 3H54A 1JZ4A 1DTUA 1R3TA 4L6DA 4FNRA 5CZTA 2DSKA 3FHAA 1KNWA 2O4QA 1WOBA 4HP5A 4US5D 2ZYFA 3IJ7A 2FMNA 3QLDA 4O28A 3W7GA 3LTPA 1G1YA 4HCLA 3JUGA 1DV7A 3RCMA 1LUCA 3LCGA 3JR2A 1H7XA 1W6TA 4JNZA 2WVTA 4GH1A 3GSMA 4W8AA 1GONA 3IANA 2E6YA 1XGZA 1M9HA 4UB9A 1VBUA 3IARA 1QOPA 4L1XA 1IF2A 4C7DA 1RALA 3MCOA 1JZ6A 1KGUA 3G8EA 1T8XA 5KZEA 5L9FA 1GUVA 3DFOA 2FPYA 5DCBA 1HZYA 4DRSA 1HJXA 1MI3A 1IV8A 2QJIA 4LV9A 3UNDA 4ZE5A 4N42A 1KBKA 1IXQA 2D3NA 1V3HA 2WKJA 2V38A 1M7PA 3ABSA 4JYFA 3VMOA 2VELA 3NPUA 4RE4A 3SCUA 3DHDA 1XYLA 2IS7A 1GG0A 4N9BA 1V6YA 3W7NA 3TC6A 1XDJA 4GQBA 4HT3A 1EX5A 1TV2A 1XC6A 3CQKA 3KVLA 3ZWSA 2NSOA 2J25A 2RGLA 3A47A 1W8GA 4XZ9A 4L9XA 1HL9A 1HTIA 3PBYA 3RJYA 4FNQA 2A85A 2C91A 3AMKA 2OYKA 1BWVA 1A50A 1RK5A 4UQEA 1LDCA 2PGEA 5LNUA 2PZ0A 5LHFA 2WSKA 1TVPA 3I4EA 3WEOA 3NQMA 5JUVA 2XSAA 3DH7A 2VUYA 2PCQA 4ZBCA 3KS6A 4C1NB 1Z41A 3NO3A 4JFUA 4ACZA 2XH7A 1ZJHA 3ITTA 5CSUA 5GQBA 2YDRA 1VKFA 4YVVA 2G41A 4A3HA 1TIWA 3B06A 3OZMA 3B8TA 4FXJA 1C92A 5D9NA 3FJNA 5EPDA 3M0LA 3ZVHA 3NSXA 4XISA 2HTMA 3ZLHA 5DT7A 4D2JA 1LYXA 4FOUA 1F8MA 3AIEA 3K8KA 5HNUA 3Q45A 3MVIA 3RGTA 5C71A 3ITLA 3I68A 3ABQA 3NSMA 2CWXA 2G4JA 4OKDA 3MU7A 3GXMA 2DUZA 1R9ZA 2P8BA 4MNLA 3MSYA 2DT3A 2OEJA 4QAIA 3SURA 4W9TA 4N4PA 4H83A 1XRVA 3NOEA 2V3DA 1P6CA 4RJEA 1XGEA 2WV8A 1B3OA 1HNYA 3CB8A 3K1DA 3W84A 4LCRA 3S1XA 3TJLA 1JI2A 3VCNA 2F2KA 3AIUA 2X1IA 1GHRA 5F2GA 2Q01A 1PCWA 3PWGA 4HA4A 1T7LA 1ADDA 3UD6A 1BKHA 3UR2A 1W3KA 2ZVIA 4AEOA 3L5MA 3OVPA 1EC8A 3DFSA 2XWEA 5E0FA 1TX0A 4TR9A 1H7WA 4TQTA 1BYDA 1OJXA 1EUNA 4A22A 3O6AA 4KETA 1FHUA 1C29A 3DHFA 1QPRA 4G1NA 4O4WA 5I6SA 2G3FA 5HXMA 1B90A 2HDJA 3AU6A 1IZKA 1OK6A 3VU2A 1LM1A 3MB9A 1EYEA 1XBZA 4C6LA 1NDZA 1E72M 1VJZA 2ESCA 2QV5A 1QK0A 4DQWA 4WX2A 4E2DA 1T41A 2C1HA 2HV5A 3DBNA 4AHOA 1BG9A 1BQGA 2GWGA 2BOEX 2VI0A 3CHFA 3EA3A 1VHCA 4P2VA 1OX4B 3DX5A 2ISSA 1NH6A 1MVYA 3I4KA 3S46A 2E6FA 4XBJA 1Q13A 1DJNA 4D6CA 2GQ3A 4X0VA 4PRTA 1W2VA 3WYZA 3NQGA 5F4WA 1KTBA 1SM9A 2Z2UA 1B3VA 3KAOA 4XD3A 3M64A 2QEZA 2D2JA 2PE4A 4HHPA 2QCDA 3PP7A 3GVQA 3UJRA 3TSDA 1BSLA 3IJQA 1KM6A 4DZHA 1W1A1 1HP5A 4UNIA 4RW5A 1P1XA 2FTYA 3RLHA 4KMQA 2QUVA 4AWEA 4DM2A 3KWXA 4HYVA 3IUIA 2CBJA 3SDOA 2E9MA 1J2WA 3UG4A 4I7VA 4DI9A 3S6DA 2ASHA 4O1CA 1FWNA 4ML9A 3FA5A 1H63A 9CGTA 1K9FA 2XN0A 1AW2A 4JTEA 4M6PA 3VNKA 4KIEA 3GXNA 3SRHA 5FJIA 1LQ2A 4Q8MA 2Y70A 3S5NA 4KRTA 2A7RA 1WUFA 3L4TA 4QCFA 3URNA 5ENLA 3TFCA 1K03A 3VKJA 4WY0F 5FESA 4IFKA 4E5TA 1BSIA 5E70A 4DYKA 3GTIA 4UFKA 2DP3A 1JULA 4WZHA 2P50A 2PU0A 2VC6A 3TJ4A 3ZMRA 3REQB 2WNNA 2GPTA 4HU4A 1RSCA 1HKIA 5GNZA 5HPCA 4LUTA 2V82A