3H4GA

Structure of aldehyde reductase holoenzyme in complex with potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
324
structure length
320
Chain Sequence
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTRVPRDAGHPLYPFNDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase [NADP+]
publication title Structure of aldehyde reductase holoenzyme in complex with the potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 101
structure length 320
sequence length 324
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3h4gA00
2PDLA 2HV5A 5HNUA 1QRQA 3BURA 1X96A 3LUTA 2FZDA 2FGBA 2IQDA 1SM9A 5LIWX 4JTAA 3LN3A 2ISFA 4G5DA 2PDXA 4IGSA 5HA7A 3BCJA 4JQ4A 2PDBA 4IJCA 2FZ8A 4L1XA 2IPJA 3FX4A 4LB4A 1PWMA 1PZ1A 1EF3A 1C9WA 4DBUA 4JTCA 2PD9A 2BP1A 2PDNA 1S1RA 3N6QA 2PDGA 4JQAA 2IPGA 5LIKX 3S3GA 3EB4A 2IKGA 2WZTA 3FJNA 1YNQA 1HQTA 3GHUA 2BGQA 2PDFA 3UG8A 2HVNA 2PDUA 2PFHA 3T42A 3UFYA 3WBYA 3ERPA 4YVVA 1AFSA 3R94A 3WCZA 4WRHA 3G5EA 3M0IA 4XK2A 1PWLA 4WDTA 2J8TA 1ADSA 1LWIA 4FALA 4XAPA 1XF0A 3O3RA 1S1PA 2PDMA 3LBOA 3LZ5A 1IEIA 1MRQA 1S2CA 3GUGA 1VP5A 3UZYA 1AZ2A 3MB9A 1ZUAX 2PDYA 2I16A 1GVEA 4XVDA 5JH1A 4WDXA 4YS1A 2IS7A 2PDIA 3QKZA 3H7UA 3R8HA 3WBXA 4ASTA 3LEPA 2IPFA 1QWKA 4L1WA 4FZIA 2PD5A 2PDQA 3N2TA 4Q7BA 4LBSA 1RY0A 3RX3A 2IQ0A 2NVCA 1ZSXA 3D3FA 2ACRA 1X98A 4XZLX 3R7MA 3V0TA 5LIUX 3CAVA 3R8GA 3COTA 4LAZA 1PYFA 1S2AA 1Z8AA 3CV6A 4PUUA 3R58A 4R9OA 4JIIX 3V35A 5C7HA 4H8NA 4PMJA 4PUWA 5KETA 3NTYA 1AH3A 4LB3A 2ACUA 3V36A 1T40A 3LD5A 2PEVA 2PDHA 2PDKA 2FZBA 5LIXX 4XZHA 4GA8A 2P5NA 4DBSA 2ACQA 4WEVX 2F38A 2ACSA 3CV7A 1VBJA 2IKHA 3ONCA 1YNPA 4XO6A 4IJRA 3B3DA 1X97A 1Q5MA 4OTKA 1MI3A 2I17A 3EAUA 4LAUA 3DOPA 5AZ1A 4LBRA 4PR4A 4XVEA 2FVLA 5M2FX 1T41A 2HVOA 4JQ1A 3LQGA 4EXAA 3GHRA 4JQ3A 1US0A 4QBXA 2R24A 3Q67A 1Z3NA 3WG6A 2IKJA 1JEZA 4JTDA 4XZMX 1YE4A 5DANA 2HE5A 3CAQA 4GACA 1ZQ5A 2PDWA 3UWEA 1UR3M 1MZRA 3LENA 4QR6A 2PDCA 3DN5A 4JIHA 3BUVA 3R43A 3UZZA 4EXBA 4HBKA 1EL3A 4ICCX 3M64A 1K8CA 2HDJA 2QXWA 4PRRA 2INEA 4GQ0A 3R6IA 2DUZA 4F40A 4YVXA 3LZ3A 1AH4A 4YVPA 2BGSA 4GCAA 1A80A 4GABA 5LIYX 2HE8A 1Z9AA 4QX4A 3H7RA 4JTQA 2PDJA 1HW6A 2R9RA 3ONBA 3CASA 3GHSA 2IPWA 3BV7A 3G1RA 3C3UA 4JIRA 1YE6A 2CLPA 4FA3A 3EB3A 2DUXA 3LQLA 4DBWA 2C91A 2ALRA 1XJBA 4ZFCA 1R38A 5HNTA 2A79A 4GIEA 2PDPA 4PRTA 3VXGA 3LNMA 2F2KA 3V0UA 2FZ9A 3GHTA 3RX2A 1RY8A 1OG6A 1EXBA 3Q65A 3UP8A 1RALA 1LQAA 3WBWA 3MC5A 4MHBA 1IHIA 2PF8A 1Z89A 3U2CA 4XO7A 3RX4A 3UGRA 4Q3MA 5JH2A 3P2VA 1EKOA 4QXIA 2DV0A 1Q13A 2IKIA 3KRBA 1ZGDA 4JQ2A 4RPQA 1XGDA 2PZNA 1PZ0A 4FAMA 1J96A 4I5XA 3CMFA 4XZIA 4YU1A 4NKCA 2NVDA 3H4GA 4WDUA 1AH0A 4WGHA 4GQGA 4XZNX 3UZWA 2HEJA 3O0KA 4H7CA 3V0SA 2AGTA 2VDGA 3M4HA 2INZA 4AUBA 1M9HA 1FRBA 4JTRA 2WZMA 1AZ1A 4HMNA 3UYIA 4WDWA 5AZ0A 3F7JA 3UZXA 4DZ5A
chains in the Genus database with same CATH superfamily
4JYDA 4DN1A 1XCXA 5CC3A 1A5LC 3GAKA 5FF7A 3BURA 5AKQA 2CNCA 2XFWA 3ZIZA 1Y5WA 1TIWA 1DE5A 1HTIA 3IEBA 3LN3A 1HP5A 3VIIA 5JBEA 4M6VA 1J9YA 1L2QA 2J77A 4L9XA 4JQ4A 3F4VA 1LBFA 1DL3A 4WK9A 4JN6A 4K3ZA 1MUCA 1KFCA 3ARTA 2I5QA 1ICPA 2HZGA 2D2GA 2Z7GA 2DPEA 2DJLA 3OODA 2GSEA 1O94A 3GDBA 2DSUA 2OELA 3BW4A 4GYPC 3SURA 5GNXA 4HNNA 3SQSA 1HQTA 4XD4A 3D5HA 2QJIA 2AQVA 3LM7A 3L5MA 1PZ2A 2ZA2A 3EXTA 2X16A 2QJNA 1E56A 3H4XA 3VIJA 4AMAA 3QV7A 1HKVA 3G6LA 3LMYA 3CIWA 1UA7A 1W3IA 3SQMA 2FHCA 3KVLA 1Z7AA 2WVSA 1ADSA 3NQCA 5AHFA 2PUZA 1V77A 2AL1A 2C18A 1N2VA 3BVJA 1HJSA 1K1DA 3JS3A 3BCDA 3GE7A 2H3DA 1H7OA 2B81A 4ORMA 4ZENA 1O68A 2KZHA 3URNA 4IMCA 5IBXC 2VUNA 3SJ3A 5JH1A 1DWHM 3HFTA 2I7GA 3JZEA 1RPXA 4NRSA 5DX7A 4DWSC 4AZHA 1ME9A 3IANA 1IV8A 3VOHA 4C6CA 3TMLA 3VAVA 4BQ2A 3POCA 2Y5JA 3N2MA 1R2SA 3FVDA 4LF1A 3W1QA 5I77A 4MWAA 4CNSA 1S5NA 3W73A 2DT2A 5KZ6A 3BG5A 5CPMA 1WPCA 5HXMA 2A85A 3BZGA 1OX5A 2OX4A 4C6LA 1K9EA 5LIUX 5GJNA 2GSHA 3SEPA 4HVXA 1O12A 4I9MA 4K36A 4Z0JA 3T6CA 1AW5A 2VL4A 3GNRA 3CL6A 3UVAA 5LGXA 3WO8A 1O4UA 1W32A 1XKJA 2YA2A 1V3IA 2BX7A 2Q8LA 1TPDA 4GFIA 3A4AA 3HIJA 3BLOA 1C3FA 1H1ZA 3M0KA 3LD5A 2PDHA 3UPMA 4G7EB 2WHMA 1VYPX 4F0RA 4WEVX 1IZKA 3LI0A 3WLJA 4AAJA 1VPQA 4R85A 4FLOA 4O4VA 4GJ1A 4MLJA 3URBA 1X97A 3W1NA 7REQB 5T91A 2E25A 2ZRWA 2GUBA 4R33A 4RDYA 4IM4A 2X1RA 2BHUA 1X1NA 2BNJA 4LAUA 1IEQA 1H61A 4K6AA 1XCWA 1JUEA 2ZZ3A 3AMCA 2HK1A 4O54A 1T41A 4JQ1A 3QMSA 5LXEA 3LCGA 4H6KA 5FL0A 3ORWA 3WD2A 2G95A 3WH6A 3OVPA 1NH6A 5H8PA 3TQKA 3ZWTA 5I00A 1F8IA 3WG6A 4OV9A 1XLIA 2YDRA 2PURA 3LPGA 1JL8A 3QY8A 3QSRA 1MDRA 4GUFA 2ZE0A 3GH7A 5CC5A 2HWGA 5F4WA 4RZBA 4AIOA 3UWEA 2OG9A 3Q4DA 4IICA 2B0MA 1Q6EA 5LHEA 1V6TA 4ML9A 1GYNA 3F03K 4S23A 1NDVA 1A3XA 2X2GA 1KQYA 3GNNA 1GKRA 2DU2A 5I09A 3B8TA 1K4GA 4QISA 2BY2A 1WV2A 4HMEA 3NL5A 2XPKA 1ME8A 1XR2A 4Q32A 5BNKA 3EXSA 4MPKA 1YDVA 3QHNA 1J0IA 3ZYZA 1NWTA 5CG7A 1O95A 3ARVA 2EG7A 1V6VA 3MS8A 5H8UA 2PC4A 4M8UA 3WEZA 4UB9A 2VEPA 2ZC8A 3KE0A 5CSYA 2DGAA 1T99A 4F2BA 1EF2A 1WOBA 1JYNA 3Q58A 5FESA 2ATMA 3W83A 1F3TA 4OIFA 2QYGA 3GTNA 3IVTA 5EFFA 4ZB0A 4DNHA 3S0CA 3H2CA 3WD1A 4H01A 4ZFCA 1XLAA 3VE7A 4HNOA 2HXUA 4WZHA 2BXVA 1H5VA 4EWND 4C6KA 3ABOA 3FEMA 4XTDA 1TREA 3TFCA 2D73A 5FAJA 4GNJA 1A0DA 4AY1A 1EHAA 1EXBA 3DFSA 2V8ZA 1V6UA 2YCIX 2E8ZA 3E12A 3STFA 4J3SA 2YL8A 3D46A 4MFDA 4DWSD 5FCZA 3IJ8A 3WEOA 2G0WA 4JTLA 2X42A 3UR2A 3DHPA 4FIQA 4QP0A 2JQXA 4I6KA 3I6EA 3VCCA 7ODCA 1XSJA 4V27A 3I3BA 1Q8JA 3M6DA 3SQLA 2PZNA 1WE5A 3CMFA 3BG3A 3P0XA 2QPXA 1FDZA 4EAMA 2ZUUA 3SM0A 2QGYA 3UWZA 2WSYA 1QT1A 4JTEA 3RM4A 4F66A 4D1IA 4Q33A 3GWQA 2REQA 1RCOB 1E51A 4MDPA 4DXXA 1TPWA 1U2YA 4LXFA 3P5YA 5A6SA 1SO6A 3R5EA 3RLVA 3B0UX 2CZFA 4HJFA 3ZXWA 2VFHA 3OA3A 2O9TA 3W7JA 1QRQA 3T1GA 5EL1A 3LUTA 1JDEA 2GL5A 5C6MA 3TA6A 2J7CA 3PBUA 1AMKA 4J3VA 4M29A 3UXDA 2BODX 3QZAA 6CGTA 1R3WA 5HA7A 5D02A 4RZ4A 5H1WA 2PZ0A 4IFOA 4C6DA 5A2BA 4J3ZA 3O6DA 1XIHA 1DJHA 2W66A 2VCAA 1DIEA 1XGZA 3OZOA 4NL1A 4TX9A 4O16A 2J6XA 3ZSSA 4DBUA 2QR6A 4JTCA 2PA6A 3IV3A 2CLMA 1IXOA 2ZX8A 3CZJA 1XLBA 3DYOA 4U3AA 1H11A 4PUEA 3TAOA 2WZHA 4GY7A 3FJNA 2VTFA 2CIPA 2PDUA 4IP4A 4KETA 4TX8A 1LUCB 1QATA 3GFYA 1PUDA 3C2VA 5FJPA 4NZ3A 2YJQA 1C92A 1DE6A 3FXYA 3JU2A 2OGJA 3UETA 3IIVA 5HQMA 1VCGA 3P93A 4YCPA 1AQFA 1IZCA 4GY0A 1AODA 2CCRA 1AK5A 3E1F1 3W85A 5A8OA 3WJZA 2NZLA 1UWAA 4IMEA 3VABA 1S1PA 2AMXA 3W29A 3OPSA 3GR4A 1P7TA 1QUMA 3CPGA 3FAWA 1LLOA 2V67A 4Q4QA 3O06A 1VEPA 2JKEA 5BOFA 4X3ZA 2IUZA 2HBVA 4I9JA 3MI3A 4AD4A 4YS1A 2IS7A 1AJ0A 4I6VA 2YIHA 3QKZA 4RX0A 2YCJA 4YJ5A 1TMHA 2ATSA 2BLEA 3EWZA 1DJXA 4TV6A 4O1FA 5BW6A 3B8SA 1S3HA 3H12A 2ZXQA 2WXDM 2ZADA 3PZTA 1YPXA 4FI4A 2HQAA 4WIWA 3DG6A 4ZQOA 3BMXA 5A95A 3FOKA 2ZIDA 4XD3A 5HJXA 4JR5A 5J8LA 3S5ZA 1XUZA 1XIBA 1R7AA 3W75A 3B9NA 3GXPA 1T40A 3MO4A 3RLUA 1NF0A 4PCNA 3C2YA 2Z27A 3K13A 2V5KA 1JXJA 4F48A 2Z1VA 3TXZA 2E28A 1YEYA 3AIRA 3P60A 1H3GA 3VINA 3OZYA 3WNOA 2QVHA 4C7FA 4IJRA 2W62A 2WPGA 1US3A 2VCCA 1W2VA 1O6IA 2CEQA 2OOFA 4A3QA 4HN8A 3IAPA 2VQTA 1E9LA 3CT7A 4OHQA 1UD4A 4LJ3A 2QMJA 3I65A 3FA3A 3H21A 2DP3A 5AC6A 1K7FA 1WUEA 1H7PA 2DT1A 3HV8A 2YYUA 3P14A 3HA1A 3PJUA 3TROA 4XD6A 3Q67A 3WMBA 1E4NA 1XICA 1AD4A 1KBLA 3CAWA 3BJTA 4PUDA 1YE4A 2FFCA 1BRLB 3EOOA 3VCNA 1XYAA 2TRSA 1XQKA 1JCMP 4DWSB 3CU2A 1RBOB 4IFKA 3RXZA 3M16A 5IFTA 4EPBC 4ATDA 1K3UA 1XPYA 3GTHA 3GXFA 3M0XA 3P74A 5D04C 2X7WA 2VC6A 3CHFA 3QV6A 5LGZA 1KRMA 3CUIA 1EC9A 3CUZA 1SZNA 3HBLA 2ESCA 3M64A 4Q8UA 5HAOA 1V0MA 2HDJA 1U33A 2V3FA 1C90A 3O7UA 4KRTA 5M1TA 3IV8A 1TA3B 2VDIA 3A6OA 1OCJA 1J2WA 2X7VA 3Q45A 4O13A 1T8XA 2J25A 1XYCA 2WMIA 1IEVA 1W2PA 1ITCA 3SUVA 4DLMA 1QCWA 1B3WA 3GHSA 4UMCA 2OQHA 1XDMA 1P6BA 4DM1A 4IIFA 3VK5A 5JQ9A 4UMBA 2NUYA 1KBJA 4R7WA 3W3OA 2C91A 3GR7A 1E3ZA 4LQ1A 2A79A 4LVDA 2EEXA 2J27A 4S38A 2PS2A 3K46A 4UUIA 4Z2LA 1TFVA 1JJKA 4QLJA 3G0SA 3HU7A 1E55A 2TSYA 5LNSA 1VBHA 2PSNA 3VD7A 3TCEA 3EX6A 3N11A 3TR9A 4RE3A 1QBBA 1FH9A 3N1AA 3HG4A 4E3VA 3PZMA 3VKJA 1EBGA 2P8CA 4JCLA 4XZBA 5BOEA 2J79A 4NNAA 1TB3A 2VGIA 5D9PA 1POJA 1QW8A 3V5OA 2Y61A 4JY8A 1F07A 2E6FA 3U7VA 4AUBA 1TELA 5CKSA 4YN5A 1N82A 4KIRA 4JTRA 4NASA 2HMCA 4LC6A 3B06A 1P48A 4REQA 3ABZA 1VBUA 2VWTA 5BMWA 1JR1A 4L65A 1VEMA 3NQMA 4GE8A 3E3HA 5DBUA 4ERIA 1EOKA 1KCKA 3LRKA 3EOEA 2GPTA 1CPUA 1L8PA 1RH9A 2PE4A 2ZX9A 3ID7A 5TNVA 5HANA 3G1DA 1W1IE 5G4HC 1WYIA 2BXYA 1OC5A 1WAUA 3W70A 5LNWA 1K7EA 4PUKA 1ZU8A 4AHQA 2IPJA 2GVYA 4QE4A 1OFRA 1W54A 3BC9A 5CEWA 2XIOA 3A21A 4HT3A 1FCBA 4X22A 3NURA 1E1CB 3U2ZA 4U28A 1YKWA 4PSRA 4MB5A 3EB4A 2AQWA 2CBUA 3UD6A 4JY9A 5AFDA 2YKKA 3TW7A 4H9YA 2O55A 4Z1CA 3S2JA 3LGEA 3V7PA 1I0BA 3MMDA 3R0UA 4OU1A 4ZXLA 2P0IA 4IQJA 2I56A 2QPUA 4FXSA 2VC5A 3LHWA 3M0IA 4O1DA 2WAGA 4G8TA 5CBBA 4GJIA 1K03A 4XAPA 3DC0A 3GDTA 4LT9A 4GQQA 4WOQA 5DY2A 1NFGA 3DGRA 3U2EA 4ZOAA 2C6QA 2BWGA 3LZ5A 3ES8A 4KBXA 5KSWA 1UC4A 3WMSA 3IVSA 1G1YA 1D7KA 4GXMA 3KWSA 3CUFA 1PBGA 5JXQA 2ZDSA 1ZL1A 1MYRA 5ABGA 1GQNA 2EKGA 4LYQA 3HG2A 3R8HA 4BWLA 4ASTA 4HK5A 1Q4WA 2PDQA 4Y9MA 4TTUA 2P3ZA 1P0NA 3N17A 4C1NA 1E4MM 4IGMA 1U30A 1RVKA 4I5UA 3EBVA 5G2IA 3KS6A 5K4ZA 1KXTA 3T8LA 3USZA 1ADOA 1WBHA 3BJFA 3DI1A 1F8MA 3URAA 1HX0A 1V3HA 3V35A 3GYCA 2X8RA 4AWSA 3NXFA 3FIGA 5KITA 4LAKA 3WNPA 2X2YA 5MKGA 3WQGA 2X0YA 3WDQA 1Q6FA 2QUMA 4QS6A 2QCDA 1WOAA 3TE9A 5I3DA 1LL6A 3R10A 3UCQA 2BGNE 1LG2A 3MDUA 3CV7A 3QMRA 1OT1A 1AQ0A 4TMCA 1YNPA 3ABSA 2C79A 1QPOA 1Q8AA 3T55A 4IIGA 3V3WA 1GVRA 4C1KA 4X9SA 3M43A 3VKAA 1JVNA 3CC1A 2Q01A 4Q8TA 4XSLA 4IG2B 3KVJA 5CZ0A 1OCBA 4K39A 3A12A 2PLKA 3TTQA 4EXAA 4IQEA 3CLWA 1OX4B 3ZT6A 3WD0A 4P8XA 4Y8FA 5I3KA 4PMRA 5EYWA 2NQLA 4MZ1A 4US5D 3H2AA 5LNVA 3SCOA 3VIFA 4PB3A 5A2AA 2RGLA 2J7FA 1YDYA 4AIEA 3KM8A 1BEUA 1ICQA 1GJWA 2IKJA 4ZE4A 3TYBA 4DM2A 2GJRA 2WKLA 5ECUA 2ODOA 3QN3A 3QGAC 4D6CA 4IFRA 1UCWA 3EKGA 3QRHA 3OQEA 3W2NA 3WLNA 3WELA 3QGKC 3LENA 4QR6A 1H5YA 4GNKB 2GSJA 1GKQA 3DN5A 5FI8A 4Z2KA 4QJ3B 1C7SA 1FWIC 4PGLA 3W2LA 5AHLA 3FHQA 1V08A 2J66A 2ZX6A 1EL3A 4O11A 4UR8A 5CLWA 4XAGA 5BWFA 1U5JA 4ROPA 4H4IA 2BOGX 2OT1A 4UOQA 2INEA 3ECQA 3GG0A 1OD0A 3AHTA 1GNXA 5AN7A 1CW2A 1OT2A 6A3HA 3KHDA 3RUBL 5BRPA 1Z9AA 5CJ5A 2POZA 4PTXA 4CQAA 4P2VA 4O19A 1EZ2A 3WQCA 2OKTA 5KZDA 1QPNA 2TYSA 3TQVA 4JIEA 3TYEA 2XVNA 1GVYA 3WK2A 1G6CA 5EY5A 4NAFA 4HMCA 1XH0A 3C3UA 1H49A 4JIRA 1CGUA 2VQUA 1FVPA 3FGCB 4H04A 4KEMA 4UTHA 5DXXA 4JFTA 2PI6A 3PZIA 2ZRYA 2E4TA 1E5NA 4ADUA 3BTNA 3E6EA 4GUJA 4QFUA 4FNUA 1XJBA 1H7WA 4WKAA 3WY1A 3QOMA 4PRTA 1Z69A 3VILA 5IDZA 3GH5A 4TO8A 1R3QA 4DAIA 4JPGA 1M7XA 3WQPA 3P84A 2VX5A 3HZ3A 1U1HA 1JD7A 1XYBA 4OV4A 2VI0A 3QW3A 4C6NA 3NSMA 1MW2A 4HOXA 4AWEA 4GX9A 2WMFA 2ZZ5A 1XRTA 1RHCA 2BOFX 2DORA 4H9ZA 5JH2A 3UGVA 2GQ3A 5DQPA 2WJZA 2VRKA 4W4QA 3CB3A 4KIEA 1X7IA 3NPXA 3MQTA 3POHA 4PTVA 1P0EA 3UESA 3MSYA 4LUTB 3EX3A 1KV5A 2OODA 1XYZA 1PXGA 4NZCA 3O0KA 1B0IA 1D2KA 4PUJA 3M4HA 3EX1A 3HJEA 3R12A 2JBMA 2EGZA 4MAZA 2JIWA 5EBUA 2VURA 2FMNA 5FF4A 3GAYA 3PWIA 1GYLA 1ZFJA 2QV4A 3C61A 3KXQA 1SJCA 4RV8A 3I10A 3W2KA 1BGAA 2VHLA 5T8GA 1WKYA 1JZ7A 1KRAC 5HNUA 3DBPA 2J13A 4QJ1A 1THFD 2XHYA 3ZWSA 1UR9A 4XISA 3SN1A 3FKKA 3VOIA 2A3CA 4NILA 1RJRA 1I0DA 3WFAA 3GXDA 3S5OA 3AUJA 4FLQA 3W26A 1UWRA 4OKDA 4JTUA 5JVLA 2W6RA 4AIBA 2GWGA 1Q6CA 1CGYA 4JFVA 1BQGA 2A4AA 1WQ5A 3NDOA 5T26A 1G9HA 3U57A 2ICSA 1EF3A 4DZHA 5C7VA 1X8FA 4QSHA 3PJTA 3L4VA 5HJLA 2VFEA 4RNIA 2X1SA 2O0TA 3INPA 2IKGA 4A8NA 3VZYA 1WDDA 3W38A 2VGFA 3C3NA 4W7WA 3WLLA 1XD0A 3B0XA 5I78A 2X09A 1B3XA 4H41A 3VZXA 5EMJA 4YVVA 1BXBA 4FNRA 1AFSA 1PB0A 3BO9A 4CNTA 4LUSB 1SPQA 2A1YA 3OGVA 2GYIA 4XK2A 3A23A 2Z1WA 4IL2A 3H22A 1T6MA 4LYRA 4L4LA 1S5MA 5K9XA 3GG1A 1BKHA 3O3RA 3UA4A 2B7NA 4EXQA 3TK7A 3SCWA 3NYDA 1VQTA 1W9PA 1KXVA 4DVOA 3MJYA 1IT8A 2WHLA 3OIXA 3ANYA 3KOFA 2DZWA 2E1DA 4JTKA 2DSWA 4XBSA 3LMZA 4D2JA 3UZYA 2GGGA 3LYEA 1OK4A 4AW7A 4UZSA 1GVEA 4NAEA 1TPB1 1NP2A 3C4UA 4NT0A 1G4SA 1LOLA 1SW0A 1VIWA 4WVXA 5LSMA 3QSTA 4Q7BA 1O66A 3N14A 1GJPA 1J0JA 3AIVA 1GVQA 2FGLA 1BVZA 1TX2A 1ODUA 4GISA 1H2JA 4S3EA 4JN8A 3ARQA 5I03A 4NUWA 3D3AA 2I57A 2A3EA 3R8GA 4LAZA 1GG0A 3BGGA 1S2AA 1LCOA 3OHMB 1HJUA 2CBJA 2YDAA 5C9RA 3VX1A 4BF7A 2BVWA 3UXLA 1OIMA 2J7GA 2Y2WA 1ODZA 2C15A 2V38A 1CT5A 3LCHA 4WSKA 1QK2A 2XN0A 3AYRA 1ZTVA 3T2PA 3W00A 1BFNA 4OBTA 3WNNA 2CU0A 4UCGA 3SW6A 2Y5EA 5EMMA 1IXQA 4DBSA 2GGHA 1XH1A 3NZ1A 3FKRA 3CWOX 4A4AA 4FOKA 4Y90A 3SCPA 1R5YA 3PWGA 3C0JA 4QDMA 3ZOAA 3VIOA 5BWAA 4ZO7A 5H91A 4GYKA 2NUXA 3VI2A 4PTNA 1UKQA 2R82A 3L0KA 3F4DA 2VRJA 3TN4A 1BAGA 1A50A 4MY8A 3WIJA 4N9BA 3V1PA 2QUUA 3FVMA 4CNUA 2NLYA 2C16A 5HMSA 2DZUA 3TQ0A 3MU7A 5K9CA 1WKFA 1PDYA 1PEZA 2FTWA 2G3JA 1JPIA 3BG9A 2PWHA 3KLLA 2G97A 3AZTA 1BG9A 3JW7A 2DH2A 3MT1A 1E72M 4O14A 2Q8XA 3W82A 2O4QA 3SY8A 4Z0SA 2EAWA 5JBFA 2X40A 6REQB 2PLJA 4JKMA 1ZQ5A 3G8RA 1BG4A 2WMKA 2C13A 4YTUA 4RKAA 3H6OA 3GW0A 1HO1A 1DIOA 3R79A 5EMYA 4UTUA 3VGBA 4MY9A 8A3HA 3GO2A 4D72A 1DJWA 3DFOA 5E9XA 2OSYA 4C60A 2GZXA 5KZMA 3WF4A 4JIPA 2CERA 4M80A 3W37A 3LZ3A 4GRSA 3HGRA 5LA1A 4OQVA 1JYXA 3WNKA 2XG9A 2PP1A 3NL3A 1B4EA 1H60A 1HW6A 4Z2IA 2R9RA 3B4YA 4M3PA 3PUOA 4S3AA 5DFAA 1KKOA 5D2XA 1WDWA 4WF7A 2ZRXA 1DWGM 2R8WA 1UROA 1TPFA 2BHYA 1V0KA 3MUCA 1ZRQA 2E6AA 1CWYA 3W01A 4DI9A 2W5FA 4P7OA 3CUGA 3LQLA 4Y8EA 3Q94A 4HK7A 2YBTA 4GVIA 4J4KA 3F4CA 2V3EA 2QJHA 1H51A 2CBVA 2D24A 3R0KA 1K70A 3O8AA 5A6BA 1WDSA 2BASA 4ZZ9A 1Q63A 3W2UA 2WC7A 1UP3A 4UZUA 1GPWA 4NZ4A 1OC6A 4MHBA 3VFLA 1B54A 3APYA 3GXNA 3KCJA 1JCJA 3ANVA 1MXSA 1ISXA 1BD0A 2OEMA 3RX4A 1QNSA 3AISA 1OZQA 2OLHA 3M47A 1JRBA 3QF0A 1EKOA 1OY0A 2P53A 4FMVA 4I5XA 3LSCA 3A3WA 5IXEA 4NKCA 1PO9A 1VFMA 1W31A 1A49A 4IL0A 1JPHA 3UJ2A 1KCLA 3NQ2A 1XYLA 3NL6A 2D0FA 3E2SA 1V51A 2A5HA 1XRVA 5C2CA 4Q8NA 1WDQA 5E9AA 1QJWA 2O92A 2DZPA 3MCOA 1EGZA 1AZ1A 3K5XA 2EPNA 3A64A 3TTYA 3REQB 3F7JA 3UZXA 4GXWA 4M19A 1HKJA 4XKYB 5CAKA 4NIRA 2PGWA 3HMCA 3W7NA 5IRPA 2FGBA 3UXKA 3ITTA 4ZB5A 2WW5A 4GH1A 4NJHA 4CUCA 5LIWX 1NVMA 1VJSA 2WWCA 3W1RA 1I60A 2WOQA 2FVMA 1SYTA 3B97A 3UVIA 1IT0A 2EHHA 4JD4A 3BMVA 1TPH1 3D6NA 3I68A 3EX2A 4UIOA 3PP7A 3UY8A 1PWMA 2PODA 4NX5A 1KM5A 4JTIA 5REQA 4OJYA 4NNCA 3N2OA 3UJRA 3W84A 4RNJA 2ISWA 2E9LA 3U7BA 2YLAA 2BGQA 2PDFA 2Z00A 3CIVA 4DPQA 2DEPA 2XVGA 3TTOA 2F84A 3TYAA 4CD7A 3W1UA 4BZYA 1VF8A 3GKAA 1S38A 2X05A 5A1AA 4KWVA 4MMWA 2NWSA 5HATA 1EWEA 3SUWA 2GJLA 3PBYA 1XYMA 3SY5A 2WNQA 3LCLA 1SSDA 4CD5A 1G94A 4G1KA 2JF6A 3TC7A 3LBOA 4I9TA 4UNIA 3RO6A 2NW0A 3R1ZA 2RKXA 3GSMA 3W1PA 1QO5A 2YYTA 1PX8A 1ISYA 4AX7A 2QF7A 1SR0A 1VENA 3LNPA 3ZVHA 1SQ7A 1V6WA 4JEJA 4ZR8A 5C2GA 3W02A 2CYGA 2YCLB 4A3YA 3NQVA 4WXYA 1GOKA 4NJIA 6XIMA 3M5YA 2QJMA 3KBSA 4NRRA 3G0UA 4L1WA 2LLEA 4E3TA 4JNZA 4F0MA 3C6CA 4HYWA 1MSSA 2Q71A 5LA2A 4PBGA 2BV9A 1M3UA 2DY3A 1V0NA 1E73M 2YXXA 1AL8A 1VEOA 2V82A 2YGYA 4NJKA 1QPRA 1R47A 4RLIA 3LBCA 1RLCL 3ITGA 3VE9A 5KETA 3S9ZA 1G4EA 1ZAIA 2Y1HA 4AU0A 4E0CA 1NM9A 3PB2A 5B7YA 4CN4A 5G4WA 3CHCA 5FF0A 2Z2AA 1CB2A 4MSSA 5FACA 4XZHA 3PPGA 1XIMA 3S2LA 3A4WA 3CUJA 3DENA 3GNPA 1PL9A 1TZZA 1CXIA 5D4YA 1KR1A 3TLQA 1VFSA 1VJIA 2JF7A 5GJMA 1MI3A 1L6WA 3UA3A 4GYFA 4AVFA 4XWUA 3NEHA 1OYAA 2XJ7A 1GW1A 1S5WA 4F8XA 3WX7A 3AUOA 3F1QA 3VCRA 1QWGA 3ITVA 4GBDA 7ENLA 2ZUWA 4AD0A 4JQ3A 3EGJA 3OYXA 4QBXA 1XM3A 1BVNP 3IVUA 4S1FA 2XIBA 1FWHC 1C7TA 4QITA 4IMGA 1TZ7A 2P76A 4LUIA 3TJXA 1EYEA 3V5FA 4XSMA 3AJ7A 2HJPA 4YWIA 1UC5A 2VR2A 5LHFA 1OFAA 3DFTA 2BDQA 1WAWA 3SFKA 3AHXA 1OB0A 1BTMA 4N9DA 4QLLA 1TV8A 3MWAA 4KFPA 4E4UA 4N42A 3BV4A 3SUUA 3SIMA 2Y6ZA 2ISVA 3AIEA 4W5ZA 1WP6A 3IS4A 4L9YA 4K7VA 1XISA 3IAQA 4AD3A 4AZ7A 1Q7QA 2AL2A 3UW6A 1OFBA 3V1HA 1Q6LA 3CMGA 3R6IA 1W5QA 1D8CA 1IWPA 3PTKA 3VKCA 1FXQA 1DIKA 4Q4MA 2W3ZA 2G41A 3PBVA 2RUSA 1LOSA 4IZGA 2CZ5A 3W6YA 4JGDA 5EMUA 4D8AA 3LDVA 1W1PA 2O9OA 4PTWA 5CPTA 3N4EA 4DNMA 3ZLGA 2VGGA 5C54A 4JHOA 1ZPTA 4O1EA 3EKZA 1U5HA 3AOFA 3O15A 3CV1A 2H9AA 3TA9A 3N3TA 3QC3A 3E2VA 4GO8A 3IRSA 3HG5A 4N6EA 5A6JA 2ZZ7A 4GKLA 4G1NA 1XSKA 4FO4A 3V4BA 4H2CA 3MZNA 2ZWYA 3MHUA 3T08A 1QOQA 1G7UA 4ZTYA 4DF2A 1LQAA 2GVJA 1W17A 4IGHA 3L68A 4LNCA 4ZL1A 1N8FA 2ZKMX 1JRCA 3AIWA 1FH7A 1NIUA 1PX4A 2P10A 1ISZA 5FJRA 2JFEX 3U2CA 2VZTA 2QEZA 2VP8A 3B03A 1TTJA 2X1IA 4Q3MA 1XPGA 2QKFA 1PHQA 4TOQA 1UYQA 2HS8A 1CIUA 3FSUA 3W0KA 3QFWA 3K4DA 2P3EA 5G4EA 3BL3A 2G4FA 3KBVA 3OBAA 5I7GA 1MNZA 4YU1A 3G22A 3QTGA 3OHIA 3H4GA 2Z26A 2ADAA 3PWAA 4IQLA 4X61A 3KVKA 3EWYA 4A05A 3R4IA 6ENLA 1SFJA 5LNUA 1W1VA 1FH8A 4XX6A 1VFLA 1XLGA 2NQHA 3UYIA 2Q8ZA 3WDHA 3QR3A 2WCSA 8XIMA 4GZIA 4DELA 4G9PA 3NQEA 2OEKA 3EDFA 2HV5A 2E77A 3GU1A 4Z1AA 4IOTA 5HMDA 1HL9A 1SM9A 2YLLA 2OTDA 4HOWA 4JX5A 2ISFA 4YHGA 3WZ0E 3BAJA 2XN1A 2V5BA 4MB1A 2IMRA 4UTTC 2YX0A 3ALFA 4HQVA 5D8ZA 3MZ2A 3U2OA 3OEXA 5A5WA 1QOXA 4CU6A 3FK4A 3CT2A 3PNZA 2GQ8A 1V6XA 3MP4A 3N3MA 4F4RA 4L9ZA 3FW6A 1NF7A 2PDNA 2F61A 2OMAA 3WSUA 1JG9A 4F9DA 3MWCA 4QS5A 4GXPA 1E5JA 3RFAA 3LHYA 1EUNA 4QEEA 4M7SA 3T42A 4H8UA 4J3UA 1REQB 2V6AA 1UA3A 1RUSA 1HO4A 4BFAA 1KFLA 1HJXA 2J9YA 3G5EA 4NSBA 1L8NA 3H54A 3OIHA 4JYEA 3H2EA 5DMMA 3RPDA 2PDMA 3AU2A 4YTSA 4R7JA 3ARSA 3KOWA 4UTIA 2OLSA 1MRQA 4DJFA 1CCWB 1W91A 5K3VA 4CQ9A 3EWDA 1RQBA 1M1BA 1GOMA 1D3GA 2I16A 4PBEA 3SCNA 2VOTA 2NT1A 2YFOA 2CXGA 1YYAA 4ACZB 1EP3A 4Q8QA 2VT0A 4WXZA 3ZO9A 2IPFA 4RE0A 3GFZA 4FZIA 4HZMA 4MB4A 1DXFA 5HNRA 1DPMA 2NVCA 3FXGA 1Q6GA 2PWVA 3ZJKA 9CGTA 1UZHA 2DIJA 1RD6A 4R7OA 2QCMA 3GKFA 1UR8A 2ACRA 4DRSA 4H6QA 2V63A 1R3VA 1PDZA 1OSEA 3PJWA 2W9MA 4HPNA 2FDSA 5K9DA 3OVGA 3NXLA 1VBRA 3VGDA 2CHOA 4PMJA 2OR2A 3VGFA 2UY2A 1K9TA 1OC7A 3AMLA 3PG9A 2PCQA 3PNUA 2G37A 2ZWZA 3VNYA 4A3RA 2FB3A 3G1AA 1R3RA 1WO2A 2PDKA 2PTXA 2V3GA 3TSBA 2V2DA 2FZBA 4K2SA 5LIXX 2V5DA 5HOSA 1A0CA 4O52A 3SJNA 2BHZA 2V69A 3BXWA 3AHVA 3B0YA 4ILSA 4KEUA 5HJYA 3SCSA 4D8ZA 2J7HA 1F2JA 3G1FA 4CQ8A 4RUBA 4ZCWA 4D1JA 4PB5A 1OYCA 2F7FA 4I7UA 2GJXA 1GW9A 2VEFA 2CC0A 3RO8A 3U3HA 1CECA 3OGRA 1V93A 4QQ3A 5FKYA 2R91A 1VFTA 4LBRA 4PR4A 4Z2HA 1RAKA 2Z0IA 2BY1A 3UCCA 5KZEA 3J7HA 4JFWA 3T0DA 1A4LA 1C29A 4ADSA 4K8EA 4O28A 3NFUA 1MZHA 1VPXA 1ONWA 3MUY1 4GMEA 4W89A 4CKQA 2ZZ1A 2VVNA 5I3HA 3HTWA 3GX9A 1W9BM 1VFOA 3HURA 2XINA 3KDNA 3WL1A 2OB3A 3UJFA 4S3BA 3PF3A 1JZ6A 1MZRA 4GD0A 1WKEA 3LOTA 3WQOA 1K8ZA 3F2CA 4CNNA 4DAFA 4A21A 4LV9A 2OO6A 1E9YB 3H53A 2VCBA 1XLHA 3L21A 3NCOA 1D7FA 3BANA 4TV5A 4C6MA 3CS2A 4N2YA 3TLLA 4QJ5B 5A6LA 3H70A 4ZMGA 2VXNA 4GK8A 3IRDA 5LA0A 2XGBA 1DJGA 1EEPA 2QDHA 4C65A 3M0JA 3E0LA 4G2DA 2OGYA 3BMWA 3ZMRA 2GVEA 1CXKA 3BLFA 5G1YA 4LVBA 2UY3A 1ONEA 4AZ6A 5D03A 3V16A 3AFBA 2ABAA 3MUIA 4DUVA 3PTQA 3KS5A 4P8VA 1N8IA 1W3KA 4HNTA 3N04A 1J0ZA 3GXTA 4DYJA 2PTYA 4FA3A 4N4QA 3S9YA 3PM6A 4L56A 4FEZA 3WF0A 3DU0A 4GUIA 3T2QA 4J5NA 5F2IA 1HKWA 4JTFA 4D6FA 5AC8A 3A9IA 1KFKA 3PBGA 3N6HA 1PZ3A 1A53A 3FSTA 3CNYA 3AALA 2E0PA 5BXSA 3OLDA 1GOWA 4INFA 2QDEA 1BXNA 2ISDA 1D8WA 1IHIA 4MUPA 2PWUA 3AXKA 1TG7A 3AZSA 2C1HA 3P61A 1KA9F 4E38A 3JRKA 1Z89A 3TAKA 4U4MA 3WL0A 4GJJA 4YHEA 4NZFA 3VNZA 1LYXA 2DV0A 3GVQA 4MF4A 4S3CA 4O57A 4RPQA 3MANA 1KBBA 4CCZA 5HQLA 4B5NA 1J96A 1J6OA 3HGSA 2FTPA 4WY0B 1VKFA 1YBQB 2XTKA 4G7EA 3FHAA 2A21A 1NWRA 4ZEPA 1BF2A 2YOCA 4TMBA 2J9ZA 1N55A 1EQPA 1XS2A 2NX1A 2HEJA 3M9YA 3G0XA 2JIEA 3S8HA 7REQA 2Y8UA 1GQKA 3N2BA 2OPJA 4B16A 1F3WA 5GPRA 3OZPA 3VMNA 3W6MA 1PKLA 2FVKA 1TRDA 1FWRA 5A3HA 4ZOEA 3LPOA 1C8QA 1Y5VA 2G3FA 2DVTA 3CGTA 4QE5A 2CPUA 4S3GA 3SCQA 1QNRA 3B9OA 3A9BA 3L5AA 4RW3A 4B3ZA 3NR0A 3A4XA 1O5QA 5BU9A 1BKSA 2PDXA 2R6OA 3NUKA 4X0VA 2O7SA 2ALDA 3BCJA 2HVMA 2GJPA 4HU0A 2ZXAA 3KL5A 1ZP4A 1UMLA 3FX4A 4GKTA 1UP0A 4I3GA 3RMEA 3WH8A 3VPLA 3B8IA 3GTIA 4LYPA 1U83A 2PLCA 2Z1KA 4JICA 4BHYA 3UG8A 1WZLA 2CITA 1ZJHA 3AXIA 7TIMA 5I79A 3PN8A 2V2CA 4JIQA 2QV5A 1TTIA 3W7MA 1T7LA 9RUBA 3P80A 1R46A 3IJ6A 4FNQA 5FJIA 3RMJA 4DJDC 3DC8A 3BDKA 3TC3A 3L4TA 3WCZA 4UTJA 1RCQA 3F5JA 2GUYA 1PWLA 2WJFA 1DOSA 2GOUA 1GCYA 4NNBA 4FALA 2ZYFA 1MXDA 4EK7A 4RNFA 5AC4A 1PS9A 5A8GA 2E7FA 1IEIA 3OVRA 3JVAA 3UZJA 1XBYA 4TVDA 3W7KA 3WUFA 3N18A 1UW9A 2Y0FA 5ABFB 1ALDA 1SFLA 2OLAA 2VZVA 4V15A 5EA9A 1H7XA 4BK9A 4W88A 5FF3A 3MMWA 4LBSA 4U3CA 1Q6RA 2CZDA 2PP3A 4WKHA 4BI6A 5HWJA 4GZ7A 3OLIA 2XH2A 1KGUA 4KCUA 5I6SA 3S2MA 1ZSXA 3T44A 3GDLA 1X98A 4XZLX 3R7MA 3WQ6A 3DBNA 4C90A 2XH7A 5E0FA 1JDDA 5DELA 3BWWA 3CHVA 1XIDA 2YSWA 3M0HA 4P7LA 4WQ6A 2XN2A 4B9ZA 4MYAA 3HPSA 2GVLA 5EGRA 1VB9A 3EPNA 3GB6A 3NGJA 5K7JA 3M41A 2ZE3A 2A3LA 2BMBA 4CNOA 1Y5XA 3E0IA 2WYSA 4GHRA 4IWWA 4XO6A 1QHPA 2D0HA 4XBKA 3QYSA 3BSMA 3VIHA 2ZQ0A 4PL1A 1A5BA 4AH7A 3AMDA 5A8NA 4K1GA 1W37A 3DOPA 1BSIA 3MYPA 4Q8PA 1QR7A 2R14A 4W8BA 1B9ZA 2DSVA 4DPPA 3W7LA 2O56A 3W1TA 3LQGA 3VDAA 3WENA 1DJIA 1BYAA 3R25A 4V28A 1ZB5A 3AYVA 2E1WA 1T8QA 1ZHAA 2XYLA 4CU7A 2BG5A 1E3XA 3QHOA 2ZVIA 2VC9A 1E0TA 4ICMA 2V3DA 3CZKA 4UQEA 4A2RA 3W1XA 4O0KA 1XC6A 4IQDA 1RK6A 3S1UA 4QLKA 2VMFA 3R8RA 4IP7A 2D3NA 1OADA 3CL7A 2XFFA 1LUCA 2G4JA 2FHFA 4FPSA 3M0ZA 3SBFA 2RJGA 1NSJA 3RLGA 4Z1BA 1W3TA 3CLMA 1B3ZA 3G2GA 4S3DA 4O0QA 1SFSA 2G3NA 1L6YA 5SWUA 5JUVA 5D37A 1R9XA 4EX4A 3WN6A 3O0FA 4XZWA 2QJJA 4H9MA 1B57A 3O2LA 4DJDD 5RUBA 2JKAA 1MNSA 2QDGA 5D9MA 4M56A 2GJNA 3N29A 3UEQA 4ZGYA 5F2MA 4BCEA 2C8NA 1KQZA 3OVQA 2ZVRA 3B8WA 1W1TA 3W1AA 4PTDA 3W22A 5CPQA 2VR4A 1FTXA 1HL2A 3M5VA 3U9IA 3EA1A 4RDZA 2PDPA 2GVGA 4UMAA 3G8EA 1EJWC 3WJYA 2ZXBA 1NDZA 3OO2A 4UXDA 2CWNA 4JEQA 3KVMA 3WF3A 3AS2A 3MC5A 2QIIA 5GNZA 3TEVA 4O1BA 1CLXA 4U33A 1LOQA 4CVWA 2J62A 2W0UA 4D6HA 6TIMA 4LUYA 2TAAA 5H8MA 3E5PA 3CTLA 1H63A 4HB7A 3IUIA 3DFYA 4KWOA 1NELA 4ERGA 4U5KA 3OJGA 4LFYA 2OSWA 4Q22A 4AEOA 4XZIA 1JIBA 2BVDA 1C8VA 2YL6A 4GYPA 4ZOCA 2NVDA 4NP7A 1LWHA 3H4WA 1TCDA 1MQRA 1O5KA 1RP8A 2WV8A 3EX4A 3KLKA 4XZNX 3NQ8A 3UZWA 1W6TA 1DIDA 1XSIA 4ERAA 1H0IA 3EYPA 2XM2A 4QM1A 4LCQA 3VD3A 5JBDA 2WMHA 3VOGA 1R2RA 3DUGA 3TFXA 8RUCA 1PIFA 2QS8A 3VMPA 4PMDA 4MDOA 1BPLB 3NGFA 1OYBA 4QAWA 5BYWA 5FOOA 2QCEA 3EWXA 1IR1A 4HIBA 5C71A 2VEKA 2WKGA 1GQJA 1DWAM 1PAMA 2YW3A 5IBXA 4BF5A 1YRRA 1CLKA 4PE8A 4LAOA 1BRLA 1DJNA 4YL2A 1AUSL 1WA3A 3CMJA 3SCUA 1S1RA 3N6QA 3WKZA 4DWSA 2PDGA 1IWAA 3LHZA 1EP2A 3NZRA 4J3WA 3GHUA 2FYMA 2HVNA 2JGQA 4HPGA 2BTMA 1OABA 3WF1A 3RRXA 1WZMA 2FZMA 1LRQA 5JIWA 1P4CA 4M1RA 4WRHA 1K02A 2GDVA 2Z2UA 4NZ1A 4WGXA 1V4YA 3MYOA 4FIRA 1UOKA 1TA3A 4PEKA 4M7TA 4PEEA 1ZY9A 4IX0A 1SSGA 1YIXA 2J47A 1IWBA 5CLTA 1UD3A 4LVGA 2OFJA 2NVAA 3HQPA 4RPPA 2YCEA 4S39A 1CENA 4FSAA 1UZ4A 3DECA 1FWDC 5BU6A 4RDWA 1H7NA 3EMQA 3UY7A 1PKYA 2E40A 2PRHA 3NIYA 3E02A 2WZIA 3WBXA 2IW0A 1QI2A 1EO5A 4FOJA 4H3DA 1TIMA 1A5UA 3L2IA 3N2TA 2F6KA 1IQ8A 2XIIA 2QCHA 1W0MA 4LEQA 5HQEA 4DQWA 4X2RA 5A69A 4KF1A 3D3FA 3A3XA 4KS0A 3RILA 1CDGA 7A3HA 2WHKA 4PRWA 3H2NA 3DIPA 4YTRA 2QMKA 2FGZA 2DSZA 1UKSA 3FA4A 4Y96A 5D33A 5HK4A 4BR1A 2QQ6A 3NSXA 2PBGA 1NWUA 3PB0A 2GDUA 2VKZG 2PBOA 4NF7A 3QXBA 5BROA 4LB3A 5TQLA 1W8SA 3QY7A 1V3JA 3DYPA 2ZC1A 2UBPC 1W9UA 1S5TA 2ZUMA 2UZ9A 2ZCGA 2XH0A 2ACSA 3NPUA 4ZB2A 2ZTJA 3GXMA 3LCXA 2WSKA 1F9CA 4IMDA 4B4HA 4Y9OA 3NM1A 1TX0A 4LGXA 3VNDA 1YMYA 3EA3A 5CGMA 1HL8A 3LPFA 1UD8A 3KBNA 1NTHA 3EAUA 4N0RA 3UNDA 3VA8A 3ITYA 4H83A 5BCAA 3PBMA 4LRSA 4AYGA 3U5YA 1W1YA 3EPMA 1W1B1 3FYOA 3C5QA 3TR2A 4GZEA 3T2OA 3F2DA 2INFA 2JK2A 4OWGA 1C8YA 4B2DD 3TP4A 1XIJA 2P88A 2GGIA 4XG1A 3VC6A 3QPZA 2HBXA 1OX6A 4TR9A 1LT8A 1TVLA 3M6YA 5DANA 4GOAA 5AC7A 1K4HA 1FWWA 3LU2A 3QLLA 3AZRA 1IYXA 2Z6JA 2VFDA 3AO0A 1TPVA 2E6YA 1GZGA 1E1CA 2AAMA 3B4UA 3AROA 2KAUC 1NQKA 3CL8A 4EXBA 2VD9A 4N9EA 3SGZA 5CZSA 5DY3A 3OTRA 4JYFA 3E2QA 4B5SA 2ZZ4A 4ICCX 3LCIA 2BFGA 4ALDA 1Z32X 5D2TA 2PU0A 2CLFA 2XU2A 4Z08A 3N12A 4PRRA 4GI4A 3WLTA 2RH9A 5AYIA 2JEQA 4YVXA 1AH4A 3BOXA 3BOFA 4E4PA 2J4GA 3KAOA 3EDDA 1OINA 2WBGA 1FXPA 3SN0A 3MSGA 4QX4A 3CZEA 4PMNA 3XINA 4ATLA 3V18A 1S46A 4TIMA 3WUBA 5C8BB 3T07A 2Q09A 1A5OC 4R53A 5J04A 3C56A 1IR2A 5AYYA 1YADA 1XG4A 4CEUC 1QI3A 3G24A 3NOYA 3QVQA 4D9PA 1LLWA 4HZ8A 3L23A 2GUUA 1JPKA 1TPUA 3OW1A 3DH7A 3EB3A 1XGEA 4UTFA 2QCFA 4GI8A 4WX2A 5HNTA 1VHCA 4Z17A 2C1IA 2OCZA 2XGIA 3LNMA 4MYXA 3S42A 1IGSA 2E5BA 3GFXA 3SR7A 3VDHA 1OG6A 5HWMA 1LL4A 2C71A 3UG5A 1FCUA 2QVNA 2PF8A 2PMQA 3FS2A 5GQBA 1BGGA 1FCVA 3BH4A 3F2BA 3CWNA 1JDCA 3N19B 4N7QA 4LWWA 3W7OA 4R5EA 2HK0A 4HP5A 1UPPA 3W71A 1KTNA 1IF2A 3P2VA 1C93A 4NI8A 4BS0A 1YXDA 4RNHA 3RM9A 2E3ZA 6XIAA 5C9WA 4EACA 2RFGA 3PFMA 3W7DA 4ONVA 1PHWA 3TNBA 3EXRA 4WDUA 4WGHA 2VC7A 4GQGA 2VX4A 3B0PA 1DJZA 2IXUA 1O5RA 1HT6A 3EDEA 1TTQA 2AGTA 3TSDA 1BWLA 4TTGA 1UZDA 3R13A 3LTPA 5E0KA 1SMDA 1W3NA 3QH2A 1TJPA 1S2VA 4G6CA 1UIPA 3EOSA 4DLFA 1TJ2A 3BGJA 4WDWA 4M0XA 4O0ZA 5T9CE 3RJXA 5TD4A 3MO7A 2JE8A 4F9JA 5XINA 4IG2A 1HKMA 1MMFA 4LVFA 1JUKA 3KEHA 4ORIA 3UXIA 2QGHA 3TOPA 1EGMA 3IIOA 1OX4A 3SCVA 4LH8A 1W5NA 3RNDA 2BY3A 3G1YA 3N73A 3WLIA 1OHLA 3MCNA 5AYZA 4K37A 3C0LA 4IJCA 4JDYA 2QULA 4V1XA 2VM8A 1F6PA 3CM4A 3TSMA 1CB7B 2OQYA 4N4PA 2B7PA 5DEZA 1J10A 1D3CA 3IARA 2PD9A 2KX9A 2XZ9A 1JQVA 4H19A 1HP4A 2IPGA 1G01A 4LY4A 4RCXA 1QU4A 2PAJA 5JMUA 4L4OA 3AU6A 2YA1A 3KOZA 5I2UA 4Q7IA 3HM7A 1E6SM 3AMKA 6PTDA 1DKWA 1XCFA 3L5LA 1CZ1A 3MUAA 4TUFA 2VEIA 2XFRA 2XSBA 3VOFA 3VDBA 4UWMA 4IJBA 3UPBA 3IGSA 4FR6A 1VRDA 3AIBA 2C0HA 3K2GA 4NI3A 3W07A 1R6WA 3WLSA 3O6YX 1JYWA 5AB3A 2Y8KA 3QW4B 4TQTA 3M46A 4FNTA 1UUOA 1TMLA 1AL7A 5EBAA 2NQJA 3FGCA 4PH6A 3QGVA 3O6AA 4IPPA 4K8HA 3WYZA 1IIGA 3PPFA 4L7ZA 4KW2A 4YLWA 3SFWA 3BZJA 4FK9A 4RE4A 3LHUA 2DT3A 1MQQA 4K38A 3GG7A 3AIUA 1QWKA 3MUXA 4I7VA 1S2UA 1V8EA 4J28A 3SN4A 3KX6A 3DGBA 4H9TA 4A35A 2PRLA 1MEHA 3HGOA 3RRAA 3NG3A 1DHPA 4C1LA 4QEHA 3W7RA 1B3YA 3CAVA 3EA2A 1H62A 4CU8A 2XIJA 1SR9A 2CLKA 5DCDA 3HF3A 3T4WA 4KEVA 3FY1A 3MV01 2CBIA 2Z2BA 4KGLA 2CLIA 3JZUA 5HUOA 4FNPA 4IP5A 1XDJA 1K6WA 4MKSA 4M82A 4UFHA 4IX2A 4HNVA 3FNDA 2ACQA 3S1WA 2PB1A 2ZTKA 4AXKA 4DJEC 1SZEA 3RU6A 4LUTA 4HSHA 2JKPA 5IOBA 1XL9A 3DFQA 1K77A 4E5TA 1I1WA 1FP9A 1XH2A 4AVNA 4Q4SA 3DKLA 1H41A 4DBDA 5TBOA 4GINA 5MF5A 3QQ0A 4GZJA 4PMZA 2OWXA 1XLFA 4Q6XA 1G4TA 1YTKA 4H1ZA 2FVLA 4AC7C 5U4NA 3CH9A 2HVOA 3GM8A 3CH0A 3W74A 1ISVA 3BAXA 4ZA0A 3F5KA 4E6MA 4QE1A 2GK1B 4MNKA 4FNSA 3GH4A 3G3MA 2H8ZA 3MKVA 4S2BA 1R9YA 2EF9A 2PTDA 3WH9A 4GO9A 1E71M 1LBMA 2D22A 4QGCA 3GNXA 1JDFA 1ECEA 5CPLA 4AWUA 4UTWC 5M03A 1UR3M 4BA0A 5J5DA 1V02E 1XV8A 2E9BA 3S47A 2X0HA 3R43A 3MKKA 5LZLA 1GG1A 1DHKA 4IUOA 4CQBA 1Q7ZA 3N9SA 5BXRA 4HJWA 1K8CA 2D23A 2Y7EA 3JR2A 2RGMA 3DHUA 4LUSA 1SMAA 5C9XA 2ABBA 4UFIA 3EWWA 3L65A 2YR1A 4GABA 2ZRVA 3TN5A 3I6TA 3QPEA 3DKJA 3GBDA 3GR8A 3QZ6A 1EB3A 3LLFA 3BLIA 1FHDA 2FB2A 1TVNA 3G1RA 2OYKA 2XGZA 1DTNA 3GC2A 2DW7A 4US6A 3N9RA 1SZRA 1MRAA 4XAYA 1DXEA 1A47A 4JS3A 1HG3A 2E9MA 4US5A 4RW5A 4DX3A 2FZ9A 5FEWA 4QCFA 5AVHA 1AMYA 4EAYA 3GHTA 3WDPP 3CPRA 1Y0EA 2R1MA 4K8GA 5H6HA 3FDKA 1SJDA 3VX0A 4H9UA 4M51A 3LLDA 3W25A 4GVHA 1XDLA 1I8JA 2G5WA 4E2VA 3LLXA 3S6OA 2D2HA 1X39A 4C6JA 5G1MA 1GUVA 1VHNA 3UGRA 2WZEA 3VD5A 1KXQA 2Z24A 3DDMA 4DO4A 2OZ8A 4JFUA 1VC4A 1EPVA 1IE7C 4LU0A 1FX6A 3UYCA 2WM1A 4JHMA 5I06A 1HZYA 1E43A 1ICSA 1UKTA 3RGTA 1CXFA 3WMLA 4AD1A 4N9CA 3RR1A 1EJVC 4HOZA 4HGXA 3WNMA 3AS0A 4H7CA 5EMKA 1Q6OA 3H23A 1RA0A 3CIXA 5HNNA 1HFBA 2XVLA 3P81A 3S1VA 1TUFA 4UFJA 4QCEA 2WZMA 2PWGA 1F6KA 1VCVA 3B9AA 4KCWA 3WDJA 3THQA 3AXHA 3H26A 1Q7MA 4OFCA 4DJED 4IIHA 2DZVA 5A94A 3S5NA 1SGJA 1WB0A 5KINA 1X96A 1D3HA 4JTSA 2IQDA 1W1A1 1KM2A 1OFOA 4MZ8A 1ME7A 1B1YA 3II1A 2QF8A 2EQDA 3VNJA 3AQUA 1KB3A 4DUOA 3S9IA 4MVAA 3PZNA 3CO8A 3LI1A 1XIFA 1ZBCA 2ZBTA 1GOXA 4XQ6A 5CZTA 3K4WA 5G2WA 1GONA 3R11A 6REQA 4B15A 1NWSA 1RJQA 3GU9A 2PGEA 3C2RA 4QRNA 1B3OA 1OD8A 2ZFAA 1BQCA 4FR1A 1VIZA 3GVRA 4NZJA 2PFHA 1AW1A 1UWSA 1LJYA 4OVXA 2DZSA 3ARPA 3URQA 3OU8A 3C0SA 5EMLA 1BYBA 1H1NA 4JKKA 3WK3A 1BF6A 3NZPA 4MJZA 4C7DA 1H7RA 1QASA 4ZO9A 3UR7A 2A6LA 4L61A 1GPFA 1LZOA 4UOJA 1KWKA 4RZ6A 3TW9A 4NG3A 3VD9A 3L2MA 4MGGA 2WC4A 4GC4A 4NYYA 1FP8A 4WCJA 3RPMA 1PVNA 4IXXA 4W8LA 3TOYA 4E2OA 4PULA 1B4KA 3CAKA 5DO8A 1EA9C 3BAKA 1ZUAX 2RAGA 4LS1A 1F5ZA 3P0WA 4JFSA 1T5AA 3G1VA 1SUXA 4MUZA 1TJRA 4LS2A 1UWQA 4PBFA 1RXOB 3HQOA 2NSOA 1SW3A 4XKMA 5D9NA 2OOGA 4XBJA 3EKLA 1E1EA 1N7KA 4AZCB 4CD4A 3WQDA 1RY0A 4S3JA 1NDYA 2VVSA 3LSBA 5I0DA 1V5XA 2WNZA 3GDRA 5A6TC 1QOPA 1VYSX 3V0TA 5ABHA 4UBPC 2XZ7A 1XBVA 1Z8AA 4P61A 4E8CA 4PUUA 1RV8A 4ZBCA 3BSHA 1KGWA 4J9JA 2E09A 2WVTA 1EJXC 1YTDA 3ZSTA 4GLEA 1P1MA 2ACUA 5HBFA 1XIIA 3A13A 4GBUA 1WX0A 1GTEA 1CGVA 3FJLA 5BXPA 1V3KA 4D6EA 4AX6A 1KM1A 3DG7A 4BF9A 1KM3A 2WCGA 2X1UA 1XQLA 3QV9A 5CSUA 2OZTA 3W72A 1Q5MA 4C91A 3L67A 1VR6A 1I2OA 3WLMA 3REQA 2OWCA 2GQ9A 4XKYA 1OGSA 1X1OA 3B40A 4XVEA 3VU2A 2OX1A 3S6DA 5M2FX 1UR4A 2DQXA 4MWAC 4P5UA 3A47A 1O5XA 1KM4A 1J18A 2OVLA 5CSSA 5FIPA 2JGYA 1ECQA 1POKA 3I4KA 5E5CA 1RBLA 1JQXA 3MBFA 1FHLA 4KH2A 5DT5A 4C5YA 3A5FA 1EJRC 5F1VA 2PDWA 2WSRA 3W81A 3VM7A 4XTIA 3FFSA 5I5RA 1I9CB 1AJZA 4PA8A 3UG4A 3OOQA 3UZ5A 3VDGA 1ZBKA 4ZO8A 1V7YA 3LCFA 2YW4A 1X6NA 4O17A 1FDJA 4D71A 5C0QA 3T7VA 1TE1A 1YTEA 4IPLA 4LF2A 4AB4A 4IH3A 3TYDA 2YB4A 3G77A 3W7CA 5KTLA 2W92A 3QYQA 4AF0B 2WSQA 4XAFA 3MI6A 2VJXA 5D05A 2YDSA 1A80A 2WO5A 1ESWA 3LGDA 3W1LA 3GS6A 1VFHA 4FOUA 3DESA 1X8CA 3RCMA 1AJ2A 3ZR5A 4A22A 2IPWA 2DQWA 1P1XA 3QOKA 3MUZ1 2CWXA 4G7FA 4PFHA 4X60A 4L6DA 3KOYA 1R85A 1LROA 4HHLA 1JF6A 3I7RA 4PCSA 2YCLA 4DXVA 2AKZA 4HA4A 3IIPA 1PIGA 3LV5A 2I1OA 2F9RA 3FYPA 3V0UA 3IJDA 1IT7A 4IF2A 1WUFA 5F4XA 4GGBA 2B7QA 1F4AA 3Q65A 3SGGA 3V5CA 4MLRA 3VVGA 3U4AA 1EX5A 1JZ8A 1V79A 3TQPA 3UWVA 3LXAA 3CEPA 4Y6GA 4BI5A 3QTPA 4OBRA 5AHNA 3LX9A 4U10A 4ZFMA 1RSCA 1ZZMA 1W9VA 1TWSA 3WLHA 3TONA 1VD6A 3DAQA 4IIDA 5E6YA 1A4MA 1E1FA 5IHRA 4MY1A 1MW3A 1WNOA 1TJ1A 1QMLA 3THDA 4FX8A 4M1BA 1Q66A 2NQ9A 1GHRA 1GK8A 5FJOA 1M41A 1J11A 2B31A 2Y62A 3LRLA 1EC7A 3HB9A 1ONRA 4OZOA 2A6NA 3TUUA 5FJUA 4DZ5A 4AC1X 5HWNA 3W76A 1M65A 3CQHA 1JZ5A 3FJ4A 1PKMA 1AQHA 1HJVA 1VLIA 4HHMA 2FZDA 3EEZA 3P67A 4RE2A 4MJMA 1EEXA 1LP6A 4NX0A 2ZZ2A 3ZLHA 1BWVA 1Q85A 1XFBA 3BW2A 4J7RA 1E6XM 2YBVA 2YB1A 3CUXA 1L6SA 3GC4A 2YFNA 2GWNA 3CYJA 4LPCA 4MWAD 2I14A 4Y7EA 1E0XA 5DCBA 7TAAA 1PZ1A 4DB7A 3APTA 4MNMA 4GGHA 3E74A 6TAAA 3ZM8A 1V7AA 1WCGA 1W5MA 4I7WA 2RJHA 3S1GA 5CBJA 1XFCA 4P8UA 2WZTA 1YNQA 4WLCA 4J27A 3SRKA 2JALA 1FA2A 4W87A 5G5IA 1PPIA 3VOCA 4GVGA 3W6LA 1VGAA 3NQDA 2CZEA 3C2FA 2J8FA 4JTGA 3OBKA 3VIMA 4O10A 4NXSA 1YNYA 4FF7A 1KFJA 1OF8A 2WLZA 1FDYA 1DWJM 1OK6A 1DQXA 1W8GA 1I4NA 3E5BA 2BZNA 2YA0A 2J8TA 3SRFA 4RR4A 1CNVA 2EPHA 1XF0A 3P7YA 4J35A 4P7RA 1T0OA 3KHJA 1DV7A 2WVVB 3VD4A 1WZAA 2MANA 3CZLA 3K1DA 3UWQA 3QLDA 1JD9A 4ZODA 3SSZA 1Z48A 1VP5A 4CCCA 1DJYA 1R9ZA 4GCXA 4A6GA 3W7HA 4R3UA 1J6PA 3KOXA 4ZQRA 4GWEA 3CYVA 2HS6A 3HQNA 1H09A 4B3KA 5F2GA 3PY2A 5CBIA 5BOOA 3VNKA 4PTMA 3PZGA 2BOEX 4DEFA 4HNLA 1EWDA 5IM51 3AYTA 2OYMA 4ZVJA 1JNEA 1KFWA 1KCZA 2GDQA 2FH8A 4ZSUA 4W8AA 1OQFA 2QAPA 3CV6A 1U1UA 1NOFA 4R9OA 3CK5A 4QQUA 3W7IA 3VO0A 3DG3A 4AY7A 5LXXA 2ZICA 3W4RA 4CD8A 4O1CA 4MNLA 5U7SA 3O16A 3GIPA 3ZJ8A 2PEVA 2FZNA 2ZRUA 5I3JA 4H7ZA 3WEMA 3T9PA 1NOWA 2HNHA 3WBAA 4GUHA 2IKHA 5IHSA 1MUWA 2A3BA 5FAGA 5CZKA 2XDFA 3TX9A 4UFLA 3B3DA 4PCPA 1AG1O 2J7BA 3C8NA 2H3BA 3KL3A 5CPOA 2NLIA 2R94A 5I23A 3ZZ1A 1TR9A 1JULA 2Y24A 4QTGA 3IACA 4MWAE 4FXFA 4MADA 2ZA3A 3DCPA 1GOOA 2WNWA 1QO2A 5CCZA 2WMGA 3ABRA 4PCTA 2XH4A 3W7EA 3DHDA 1G4PA 4J2MA 2WC3A 4QSFA 5CZJA 3IK2A 3SRDA 4R27A 3N2CA 2MUCA 2X41A 3L9CA 2V5JA 1JEZA 1KWGA 3L4WA 5I02A 1V6YA 4XZMX 3VGHA 1EGVA 3E0VA 4JX4A 1P6WA 3U8GA 1P0KA 1MEWA 3ME3A 4UQ9A 5FJJA 1M7OA 4W85A 4FX6M 3WQ8A 3GNDA 5BXTA 3UZZA 1QI5A 1GWJA 1QHZA 1XC4A 2EJ1A 2W79A 4LNYA 4MZYA 1VRXA 2C14A 4I9AA 4LBUA 2VWSA 1QI4A 1REQA 5BRQA 3DERA 4C6EA 1SW7A 1ZLPA 1E6ZA 3LTSA 3SY1A 4O18A 4EWJA 3THAA 2DVXA 3ITCA 2ZRZA 4MJ2A 2A7PA 2EPOA 2BVTA 3PAJA 4CN1A 3C86A 2Z7KA 1GOIA 2EG6A 4YCOA 3SIZA 1UWIA 4ZQPA 5HR7A 3TC6A 3GDKA 3ABQA 1RCXB 2OZ3A 4B5WA 1CYGA 1D9EA 3BV7A 1QK0A 3ITOA 1OEPA 1J93A 4E2DA 4EF8A 2DZAA 3W7QA 3RHGA 2EKCA 5A2CA 2WBKA 4C6PA 4H9VA 2CLPA 2HISA 1QBAA 3OG3A 1PX3A 4ACZA 4AIUA 4ES4A 3L2LA 3GZ3A 4Q4RA 4CLMA 1DBTA 2PU1A 1LM1A 1TWDA 4LV4A 3EWBX 4MWAB 1VZWA 3RCNA 2C1GA 2CXEA 2UY5A 1W5OA 4UQDA 1KV8A 1TRIA 1F74A 2A3HA 4YPJA 1MVYA 2BSLA 4QDWA 4FLRA 3B8VA 3TZFA 5D2YA 4M6UA 4DBEA 2OU4A 3IJ9A 3KRBA 4ZO6A 4AYSA 1TKKA 4YTTA 3K8MA 2G50A 2YCKX 2EPKX 5HUPA 4HZ6A 1M53A 1ML1A 1I45A 4X63A 3L7RA 1TV7A 3TW6A 4DYKA 4UTLA 1F7BA 1Y65A 3ZR4A 5CJMA 2WWDA 4ZE5A 4FS9A 2EPLX 5K4XA 3AC0A 1JZ3A 4LEFA 3HO8A 3V75A 4QNEA 2QW5A 3A3HA 5FSEC 2Y7GA 4W5UA 3IWPA 1EX1A 3NQFA 3T8QA 2W63A 2PWDA 1EDGA 3FV9A 4YNGA 3LTYA 4RZ5A 1W3LA 5A8PA 3U48A 2PDLA 1YXCA 4V2XA 1S2WA 2BXZA 1FFQA 3HQ1A 1EJTC 1TZ9A 4O50A 3MCMA 2YZRA 2DFAA 3QM3A 1TCMA 4PYSA 1TV4A 2POTA 4WOZA 2XVKA 1W9XA 3NO1A 4IPNB 5D30A 1EJSC 4I8DA 3N15A 1EXPA 1RD5A 3U4FA 3XIMA 4L1XA 1YDOA 1WBJA 4JCMA 1MWOA 1JCYA 3M0YA 1UASA 3EOUA 4J1OA 3ES7A 5HULA 3ALGA 1NAL1 3VNMA 1LBLA 4L80A 2MNRA 1I75A 3NOEA 3FJ6A 3XISA 4KCTA 3AI0A 1CGTA 3EPOA 1VBGA 1PKNA 2QJGA 1B9BA 3UFYA 4G56A 4ZQNA 3WBYA 3ERPA 3HOJA 3KRSA 4I8YA 4PMYA 3WJSA 4R34A 2NX3A 2XWEA 1MFVA 5AOUA 1J01A 1LL7A 2O7QA 1OFEA 4AFYA 4L4PA 2P8BA 3GLCA 3KP0A 3VTRA 3WUEA 1DQWA 2C7FA 2OSXA 3LBMA 3SUSA 3PVFA 1PIIA 3L0GA 5F4SA 3NO5A 4UTMA 2XIMA 3ELFA 5LNRA 1VPYA 3MB9A 1CGWA 1FY6A 1VLWA 3HG3A 4KQNA 3W86A 1Q6DA 4XVDA 1OGGA 4WDXA 5I3FA 1KFBA 2PWEA 1FKXA 5F2LA 3GW3A 1CLVA 4HYRA 4LAMA 4C6IA 3EWUA 3L4XA 3RIKA 4IIEA 1ZJIA 1MFUA 2C19A 1FKWA 3S5SA 2Y88A 2OZ0A 3MSRA 5DF0A 5D8WA 2E67A 4DIAA 4GNVA 2OYLA 4Z2GA 1PYMA 1TV5A 5K2ZA 4EPDC 4BI7A 1EFZA 5C7HA 2RHGA 2HSAA 3WDRA 3T05A 5JIPA 1NFPA 3QC0A 1UB3A 3NTYA 4DXKA 1KLYA 1X7FA 1PCWA 4WY0A 1RQEA 3TJLA 1FUYA 1RP9A 1YBQA 2NV9A 1JF5A 5E93A 1CX9A 1MW1A 5FEPA 3HMJG 3SZ8A 4GQBA 1F61A 1H0GA 1XW8A 3WFLA 4PC8A 4C7GA 1E0UA 2Y5SA 3WLKX 1XYFA 2REQB 3H2OA 3EEGA 2E5DA 2CZVA 5JU6A 3T09A 3M7SA 4DHGA 3QY6A 4D6DA 1WXYA 4BWLC 3KDOA 1S39A 1AD1A 4LW7A 4AEFA 1RR2A 2Z1XA 3IIXA 2YXGA 4PCFA 3BK0A 4B5TA 2GLKA 1S3TC 1A5AA 4HN4A 4AZGA 4Z2JA 3H55A 5CJNA 2VGBA 3VIKA 3OYZA 4E8GA 1TV2A 3STGA 2BB0A 1EH9A 4HCDA 3PZUA 1BYDA 1KW1A 1UQYA 3AS1A 4Q4OA 4PMUA 2WCAA 3GVVA 4DUWA 2VFGA 4IIBA 3MTWA 1CXLA 1VFFA 1ZS2A 3MVIA 4Y9NA 5HR6A 3SRHA 5BRBA 3CEUA 2DSKA 1KD0A 2CLOA 2J7DA 3WQ4A 3PTDA 2QCLA 3EMZA 4GVFA 4HTYA 1UOZA 2DZXA 1ZJAA 3GNOA 2XISA 3GIQA 4ACYA 4Q6JA 3FYYA 1KBIA 3I4EA 5G1TA 4XB3A 4CEXC 2QNEA 1JUBA 3MW7A 5DMLA 1HF6A 2V68A 1YDNA 1UBPC 2QXWA 4RXFA 3A22A 1KKRA 1EYWA 3LGGA 3RITA 4GQ0A 1TTPA 5AYBA 2H6RA 5AHIA 3NQAA 4LY8A 1QAPA 1EDTA 4O15A 1E6RA 4CD6A 1R30A 1P7TB 3EOLA 4JZ5A 3RJYA 3ZLFA 3T40A 1ZP3A 5FL1A 3WQEA 1I2PA 4AY8A 1ELSA 4Y2WA 2Z6IA 3BLPX 4YMZA 3AMGA 1A5SA 3Q37A 5ABFA 2DUXA 1J0HA 1J12A 4GIAA 1G0CA 4HKPA 2VEMA 3AXMA 5T9BG 4UCFA 1L2UA 3QBUA 3VKBA 1RZMA 3SDOA 3RM8A 2V9DA 4O8RA 1C8XA 3E2RA 5ECVA 4PMOA 1Y7VA 1S2TA 2NSXA 4UTTA 1GHSA 4HNUA 3ATYA 2XSAA 2QUVA 1RK5A 2V81A 1OGBA 1Q13A 3MDWA 5J5RA 1E4IA 3DXIA 3PHAA 5DN1A 3IGXA 3CQJA 1UZ1A 4WR3A 5L6UA 1RVGA 1TR1A 1KO0A 1U5VA 1FFRA 4JKLA 3APGA 1OWQA 3WLPA 1UR2A 4MNJA 2VDGA 3S5YA 3E9AA 3CQIA 1M68A 2GGJA 4NY2A 4NJGA 4MG4A 4M6QA 1NDWA 4CCEA 1XRFA 4BEQA 2GGEA 3W2MA 1QXLA 3CZGA 1ITQA 2WVUA 4GIYA 3KZPA 2FH6A 2ZUNA 1ADDA 3MSDA 4EF9A 3PTMA 2EBNA 3WLOA 1SZGA 2RDXA 3MP5A 2VYOA 1JZ2A 2ANUA 3N4AA 1JYVA 1R3TA 1GT8A 1OBAA 4DO7A 2PDBA 3TKFA 5AC5A 2H8XA 3NVTA 2FPYA 1GKPA 3GYEA 3O6CA 4HD5A 3HGJA 4B4FA 4LB4A 1SJAA 3ISIX 2CKSA 3QEZA 3QQWA 3VNIA 5HMEA 5DRCA 1ZNNA 3NZGA 1O1ZA 5A8QA 5XIMA 4IFKB 1KTCA 1TMQA 2E8YA 2O4MA 1NJJA 2HXTA 2J6VA 1QFEA 1TE6A 1LF1A 3PBWA 1YXYA 3OGSA 4QG9A 5AHEA 2V5CA 1HKKA 1Q45A 4A3HA 3WQWA 4D6JA 1AA1B 1K6AA 1KRCC 3O63A 4FX7A 7CGTA 3L4UA 4V33A 4C6BA 4WJXA 3LM3A 4UNKA 1XIEA 2P0OA 2Z29A 1L9WA 4PUMA 3QHMA 3SUTA 3FAXA 2GOKA 3SGUA 1QNQA 2YZ5A 1E40A 3BLDA 4X0NA 1V03A 1M5WA 2DZTA 3W7GA 3RN6A 1IEXA 3UJEA 5ABTA 4M81A 1XLMA 4GC3A 1TV3A 3G3DA 4RK8A 2WMIB 4F3HA 4HU8A 3CUHA 1XP3A 3CHDA 3IJLA 9XIAA 3KCOA 4OT7A 4X9YA 3W23A 1K9FA 2NXIA 1VJZA 3K1GA 1MDLA 1UD6A 1XHGA 1YLVA 1OM0A 1TUXA 1UD2A 3TWBA 1X6UA 3I7QA 1UH4A 4OBSA 4CNPA 4UQCA 4WD0A 1LT7A 4LX4A 3M0LA 1Y8BA 5EU9A 1UP2A 1UG6A 3ATZA 4FF5A 2XFYA 3NYZA 3ZT5A 4QJ4B 3W87A 3NO3A 4I90A 3M5XA 4FXJA 1OJXA 4D6GA 2VEGA 4NQ1A 2F6UA 3Q2DA 1UR0A 1J0YA 2SFPA 1F05A 2VENA 2BS9A 4M24A 3PULA 2HRWA 4JIIX 3TN6A 3BE7A 2AOSA 1JPMA 3TYUA 3HJZA 2VFIA 1LRTA 1UUMA 2WNNA 5CXPA 1AH3A 4QHRA 2R1LA 3UWWA 4NHVA 3WJWA 1NOUA 3EDJA 3AWOA 4ECLA 1FWGC 2J74A 3HN3A 3IJIA 5M5DA 5C9UA 3VC5A 3STEA 3L0NA 3OZMA 2F38A 3I3DA 1G69A 3PS7A 1LQ2A 2D1ZA 1GORA 3KFTA 3PSVA 4U2ZA 2H90A 4IMAA 2EJAA 2QLYA 2I17A 4REQB 3UERA 4AZIA 1M7PA 3NQGA 1XKYA 1F6YA 1JAKA 2W91A 3MMUA 4S3FA 2V30A 4FB7A 1TWZA 3PSWA 4AISA 3THUA 1RLDA 4UQAA 1K8YA 5I24A 1HXJA 1EIXA 1UHVA 3G1XA 2OT0A 3LCWA 1BWKA 2VOMA 1I6NA 2CESA 3GC5A 1R3SA 1Z3NA 2RDTA 5IFPA 1KM6A 3BPWA 3QQ1A 4AZ5A 2E68A 1L6GA 1IXNA 4W7VA 4I5RA 5HINA 3TTSA 3LS9A 3M0MA 4JDBA 2BVYA 1DEDA 4OOZA 2HPMA 3HPXA 3DFPA 1IXPA 4KMQA 4B5UA 4OOUA 2VELA 4J3XA 1YQ2A 1GVOA 3N4FA 3W27A 2VRQA 2VZOA 3WLQA 5HPCA 3EWCA 4B3LA 3C2EA 2W67A 1EUAA 4TXEA 3ZS4A 3WF2A 2ZX5A 4F0LA 3MBDA 2VO5A 1GYMA 3I6RA 3IJQA 4WJEA 4UR7A 3AHYA 4YVPA 2J9XA 4GCAA 1R86A 5ABEA 3NWRA 3RF9A 4TX6A 5D09A 3PR2A 5LIYX 5BMXA 1UKPA 3FLUA 3PC0A 3P8IA 2EO7A 4EPKA 3T81A 2PDJA 3AS3A 3GVWA 1DYSA 4O4WA 1JI2A 1SO5A 4KWWA 4LALA 1XG3A 4PN2A 3S46A 2NXHA 1X6LA 1R3YA 4UOZA 5I07A 3C8FA 3WH5A 4L64A 4Q8VA 4O53A 3PZ9A 4EVZA 5I3GA 3IGUA 3MKCA 1CXHA 3AXXA 3T4CA 4HPHA 2WHJA 2CLEA 1H1YA 4H2HA 1R7OA 1EC8A 1ZENA 3O1NA 3CHEA 1YHTA 3MHGA 4KT2A 4JNMA 1JCXA 3O05A 4UNLA 3KWXA 2C0AA 3IUHA 3RDKA 4C1NB 1JCNA 1RY8A 3DEQA 4JXCA 4JHZA 2FPVA 1K8XA 3WBWA 5AHMA 2Q3RA 2W27A 2Z4GA 3GRIA 1BTCA 3THCA 2E6DA 3M7WA 4GI6A 2Y4SA 4DO6A 3ABXA 4L1GA 3KRZA 4AXNA 4W7UA 2L5HA 3UT0A 1QHOA 2PGRA 2VX7A 5CSRA 3MMTA 3QR1A 4CGTA 1KRBC 4H6EA 2VX6A 3QFEA 1XINA 4E8DA 1KC7A 4JX6A 4QXIA 4KWSA 2PRMA 2IKIA 2Z28A 1LTDA 1MW0A 3PPCA 5MKGB 1XGDA 1XLLA 3LHTA 2QCDB 1BVWA 2FFIA 4H9XA 2AMGA 4L4MA 1J0KA 2QAFA 1AH0A 3S4TA 3ZFHA 2CETA 4IPIA 3G18A 2WSPA 3T78A 3IJ7A 4MIMA 4BKNA 2FKPA 1J5TA 4FXRA 1C91A 1PTAA 2ZUVA 4DJDA 2WK2A 3NDZA 1XUUA 2WLYA 2JEPA 3P8JA 1UBSA 2Y70A 3BLEA 3C0QA 4KFNA 3NA8A 2G96A 4YWSA 4OECA 4UR9A 2UWFA 4S3KA 4K1WA 2CHNA 2UV8G 2VZSA 3CZ8A 3E0WA 5FA5A 1SJBA 4L6OA 4G5DA 1ITUA 4AQLA 1UH3A 1EZWA 2J75A 4IGSA 5DLCA 4MKVA 1W5PA 1HUVA 4J40A 1KFEA 5CG0A 2G3MA 4UQBA 1EO7A 2O9PA 3MY9A 1MXGA 4DUXA 1FWJC 1ENUA 1C9WA 1L6FA 4WUIA 3U0HA 2BP1A 1JI1A 3S3GA 2TPSA 4IPJA 2J78A 3N13A 1O1HA 1XLJA 4NJJA 1VYRA 2FTYA 1XBXA 1KM0A 3BCFA 3H7VA 3G1SA 1HGYA 1PCKA 2ZX7A 4JTJA 1GVSA 1TPC1 1LG1A 1UQZA 3R94A 1Q2RA 5KMYA 4A2SA 1RPKA 1UKOA 1VCFA 2RDWA 3TWAA 3L4YA 2FJUB 3MVTA 4NYUA 1BSLA 1LWIA 1QPKA 2DUAA 4YTQA 3HPZA 5DMNA 1U1JA 3KZSA 2Z25A 1CBGA 4IXHA 5D2WA 1R8LA 1E70M 1QTWA 4O12A 2PLMA 4NAFB 3ITXA 2CKRA 4W9TA 5EKYA 1GZJA 5TIMA 4J3TA 3MJMA 4FLSA 2PGFA 4HNCA 2QCNA 1A3WA 3KP1A 2PDIA 1LWJA 1TWIA 1CI1A 2AKMA 2HCVA 3LXBA 3NDYA 3NM3A 1E4LA 1L0PA 3NQ7A 3UPWA 3E38A 3TNOA 2B4GA 4LS0A 4PUNA 4CVUA 1JAEA 3DFHA 1DXIA 1ZAHA 1IEWA 3B8DA 4GX8A 2D2JA 5G2HA 3D0CA 2AQOA 2A2IA 1SVDA 4A8RA 1F76A 5CH9A 2VR5A 3ZVIA 4QG8A 2OKOA 3KTCA 2J88A 3CWHA 2D3LA 3COTA 2Q6ZA 4F2TA 4XZ9A 3LERA 1KCXA 3NVDA 3SECA 3R58A 4MB3A 3VDCA 3HPFA 3KBJA 3PPHA 1C9DA 1JGIA 1OCQA 4H8NA 3VMOA 3LV6A 1AW2A 2BY0A 2Y63A 3UG3A 3A4JA 2Q02A 3BW3A 4TU1A 1XI3A 1MQPA 1K9DA 3S1XA 1SU5A 2Q3OA 2ZA1A 1FBAA 3DX5A 2P5NA 3WD4A 3VNLA 2YPIA 1PJ9A 3DFNA 4Z1YA 1W9DM 3QV8A 1TSIA 1FCQA 3C2OA 3TJ4A 4U5IA 4CCDA 1HJWA 1E6PA 2FIQA 2G3IA 4P8WA 3WQFA 3C52A 2X0SA 5AVNA 1VH7A 1GTHA 2XSXA 3TN3A 4P7NA 2TMDA 1O7AA 3ARZA 3TH6A 4GIRA 4IUGA 3CTTA 5DT7A 4UFKA 4YYFA 1HGWA 1QNPA 1OFDA 2R24A 4PFMA 1QPQA 2PP0A 3CO4A 4JL2A 1LDCA 1CTNA 3MHFA 1GOQA 3ICJA 1XRSA 5A6BD 4F79A 3MA8A 1EPXA 2WPBA 2A0NA 2HE5A 5GJPA 4XV0A 4GACA 3E49A 4LSBA 3QJAA 1XXXA 3VYLA 3PUEA 3SSJA 1OFQA 1P5BA 3W7PA 2XIQA 1OVDA 3S83A 4WY0F 1LLZA 3AIQA 1XLCA 3HV9A 3NJ3A 1M03A 3VIPA 3SCTA 3GTFA 2PCEA 1B90A 1NARA 3RR4A 3TCSA 3N9KA 5C9ZA 4XD5A 3SCRA 4B91A 1F3XA 3IPWA 1JZ4A 1JPDX 3PG8A 3S2NA 3W9ZA 2IXVA 3AJXA 6ALDA 2VFFA 4H8VA 2WM0A 3TYCA 3K8KA 4UTKA 3QMTA 4A8LA 1M01A 4GUGA 4E2BA 1E6NA 4K7YA 2R1PA 2CLHA 3LRMA 4JTQA 1J2BA 3NNTA 1G7VA 2F6XA 1WXZA 5HDRA 3BICA 4E4FA 4Y9PA 4DY1A 3WH7A 3CASA 4KRUA 3GBEA 1XX1A 1V3LA 4GFSA 1DWIM 4N02A 2EG8A 3JUGA 4HMDA 3PZOA 1YE6A 3B9EA 3UBPC 3ZJ7A 4NAEB 5C70A 1Q2SA 1ZALA 5CPNA 4YXGA 3ARYA 3K8LA 4B2DA 4GY1A 1DORA 3TMQA 2ON3A 5A6MA 4AD5A 1P43A 3WMCA 3CJPA 3S6TA 3W88A 3TIMA 1GVFA 1NY1A 5DRIA 5PTDA 1EP1A 4ROQA 2NV1A 1T96A 2EPMX 4AG0A 2ZDRA 5AYXA 3VGGA 4KKXA 2BBFA 2QDDA 3EB2A 4XO7A 3E96A 5FEXA 3KRUA 1H50A 4OE7A 3M1ZA 3GQYA 3K30A 1OF6A 1Q3NA 4EIVA 3P3BA 3WFZA 1A3HA 4JQ2A 4X2PA 2EXOA 2DJXA 4C5ZA 3UNTA 3R0DA 1A5NC 2TODA 2DVUA 4S2CA 4Q4PA 1DTUA 4B9YA 3FDGA 2A7NA 3LHVA 3RPTA 2QIWA 5XIAA 4GYJA 3B05A 1UUQA 3D47A 1KNWA 2YL5A 3DI0A 2ZUTA 4DI8A 1FRBA 1A5CA 1B5TA 3PJXA 2WQPA 4JTTA 5C55A 3HFYA 1R0MA 3FA5A 3UU0A 1KTBA 3KTXA 5FEZA 3RYSA 2J24A 2NWRA 1AVAA 4ENLA 3RG6A 3H2MA 4OGZA 4HCHA 4ZSTA 4MAVA 2GK1A 1EOMA 1ZAJA 1HJQA 4B5XA 4BQ3A 1HNYA 1KXHA 1RBAA 4AWTA 3P5ZA 3MI2A 4O1AA 4LOCA 3G1HA 3GVGA 3TDFA 4ICNA 2FZ8A 2YBUA 2OQLA 4URIA 3U5UA 5DXYA 3IK4A 2R1NA 3BLKA 3RK8A 1YX1A 3DHFA 2CW6A 2OO0A 1XD1A 4HA0A 3F4NA 4JQAA 5LIKX 4MOZA 1HVXA 3NPVA 4PB4A 3IIZA 3OG2A 1UPMB