3H4GA

Structure of aldehyde reductase holoenzyme in complex with potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
324
structure length
320
Chain Sequence
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTRVPRDAGHPLYPFNDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase [NADP+]
publication title Structure of aldehyde reductase holoenzyme in complex with the potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity
pubmed doi rcsb
total genus 101
structure length 320
sequence length 324
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3h4gA00
3R43A 3R8HA 3S3GA 1EF3A 4YVPA 3UP8A 3DN5A 3NTYA 2NVCA 2IPWA 2ACQA 4LAUA 2PD5A 1Z9AA 1EKOA 2PDGA 4GACA 5DANA 2DUXA 3RX3A 1FRBA 3ONBA 2PDNA 3KRBA 1QRQA 1X98A 2PDYA 2IPJA 4IJCA 1T40A 3UWEA 4LBSA 4PUUA 1PZ0A 1S2AA 3V36A 3ONCA 2PD9A 3G5EA 2IS7A 1AH3A 4DZ5A 3RX2A 1VBJA 2I17A 4JIHA 1QWKA 2FZ8A 1T41A 1EXBA 2PZNA 2ACUA 1X96A 4L1XA 1YNQA 2IQDA 5LIUX 3LENA 4JTDA 1LQAA 1MZRA 4L1WA 2FZBA 3R94A 2F2KA 2I16A 4H8NA 2PDXA 3QKZA 2BP1A 4XZNX 3FJNA 2AGTA 4Q3MA 2QXWA 3LQGA 4JTAA 1X97A 3LUTA 3V35A 4GA8A 2WZMA 3G1RA 3O0KA 3WBXA 1S1RA 2ACRA 4XAPA 3GHTA 4PUWA 3UYIA 3F7JA 4GQGA 1PWLA 3R7MA 2HEJA 3LBOA 2IKHA 4XVDA 2HVNA 4OTKA 1MI3A 3LZ5A 4XZLX 4IJRA 2PDKA 4QR6A 5M2FX 2PDBA 1PYFA 1GVEA 4I5XA 1Q5MA 2HE5A 4GQ0A 1RY8A 2CLPA 4XZIA 3O3RA 1RALA 2DV0A 3D3FA 4LBRA 4RPQA 3BUVA 1HQTA 1XGDA 5AZ1A 2J8TA 1XF0A 1PZ1A 3EAUA 2PF8A 3EB4A 4DBUA 1Z3NA 4FAMA 1J96A 1RY0A 4XZMX 2BGSA 3H4GA 4QBXA 4JIRA 5LIXX 2IPGA 4JQ4A 1AZ2A 2R9RA 3LEPA 5LIYX 3MC5A 3CASA 1IHIA 1HW6A 3UZWA 2FZ9A 4JQAA 3CAVA 3COTA 1XJBA 1YNPA 4NKCA 3M64A 5LIKX 4HMNA 3LNMA 2R24A 2HE8A 1OG6A 1UR3M 1JEZA 4WEVX 4YU1A 3N6QA 3M0IA 4ASTA 1C9WA 4F40A 4XO7A 1LWIA 2IPFA 4JQ3A 3C3UA 1AH0A 1Q13A 2FVLA 2HVOA 4PRRA 4Q7BA 3WBYA 2ISFA 2IKGA 4ICCX 3GHSA 3CAQA 4WDXA 2PFHA 3LQLA 1VP5A 4PR4A 4EXAA 3GUGA 3BV7A 2C91A 4QX4A 3UZXA 5JH2A 4FA3A 5HNUA 2HDJA 3GHUA 3V0SA 3H7UA 4XO6A 2WZTA 1R38A 3M4HA 3DOPA 3MB9A 1US0A 4EXBA 4GIEA 4YS1A 2PDFA 1AZ1A 4DBSA 3T42A 1ZGDA 4XVEA 3LD5A 3V0UA 2PDHA 2PDIA 2PEVA 3R6IA 4MHBA 4XZHA 4XK2A 2NVDA 3BURA 1ZSXA 3CV6A 2PDWA 3LN3A 4JTQA 4WGHA 5AZ0A 5HNTA 4WDUA 1YE6A 3FX4A 3UGRA 1YE4A 3WG6A 3LZ3A 3R8GA 4LB4A 1IEIA 2PDCA 4WDTA 3V0TA 3RX4A 3GHRA 3UZZA 4JIIX 1S1PA 3B3DA 2FGBA 2INZA 5JH1A 3WBWA 1S2CA 1Z89A 1A80A 4GCAA 4JQ2A 3CMFA 4AUBA 2F38A 3P2VA 1ZUAX 5LIWX 3R58A 4G5DA 5C7HA 1PWMA 1ZQ5A 1AH4A 4HBKA 2BGQA 4DBWA 3VXGA 3ERPA 4JTRA 1K8CA 3BCJA 3UG8A 2IKIA 4LB3A 3Q67A 3U2CA 4JTCA 2DUZA 1AFSA 4WRHA 2ACSA 4QXIA 1EL3A 2A79A 4ZFCA 4PMJA 1ADSA 2VDGA 4YVXA 4FALA 4R9OA 2HV5A 3UFYA 4H7CA 2PDQA 3Q65A 2IKJA 2PDLA 3H7RA 4LAZA 5KETA 3EB3A 4GABA 2PDUA 1SM9A 3N2TA 4WDWA 4IGSA 2PDPA 2IQ0A 2FZDA 1MRQA 2PDMA 4PRTA 4JQ1A 5HA7A 1M9HA 2ALRA 4YVVA 3WCZA 2INEA 3UZYA 2PDJA 2P5NA 4FZIA 3CV7A 1Z8AA
chains in the Genus database with same CATH superfamily
2E77A 3CHVA 2BVWA 3A9IA 5C9WA 4L9YA 3W2KA 5K2ZA 1BF2A 4YVPA 3B0UX 5I3HA 3DN5A 4V33A 3VO0A 2ACQA 4NVTA 3GC5A 3PWGA 2PWVA 1EHNA 4PULA 4AH7A 5EY5A 5CC5A 2X09A 2QAPA 3AMGA 2VX4A 5KZMA 1JZ4A 4DWDA 3CU2A 3LGGA 4DJDA 2PBOA 4GNKB 2WC4A 3QQWA 3EDEA 4F79A 3RMJA 1T8XA 2XH4A 1UIPA 1ZJBA 2FDSA 1PXGA 1JUBA 1PX3A 2GGIA 3RJYA 3ARYA 2CHRA 2DFAA 3MI2A 4H83A 2QJGA 1JNEA 2ACUA 4PMXA 4IQLA 4L1XA 1SW3A 5I09A 3LDVA 1GCYA 1JAKA 2FH8A 3K30A 1VLWA 3MWCA 1B30A 4UTMA 1DP0A 4FS9A 4MKSA 4UOJA 2XIBA 1D2KA 3YPIA 1EWDA 2X2YA 3NVTA 3WBXA 2GJPA 3LGEA 4JEQA 3I65A 2D2GA 4IT1A 4WKAA 1HGYA 4RCXA 1ZLPA 3T8QA 4A8LA 5IM51 4PMNA 1ODZA 1RUSA 4O15A 1C8VA 4W5UA 1EWEA 4MJZA 3LZ5A 4LSBA 4OHQA 1U5VA 1OD8A 1RJRA 3UVAA 1B31A 1GYMA 3M0YA 3DEQA 5D9NA 3TIMA 1CGUA 1MW1A 4H9MA 1JGIA 3QMRA 8TIMA 1H49A 2E6YA 3VCRA 2Z6IA 1LL4A 3PK7A 1XDJA 1TJ0A 1A5CA 3S46A 3OA5A 1CW2A 3B04A 4NUWA 3VZYA 2GUBA 2E4TA 4RDZA 5K7JA 4BWLA 6A3HA 4XZMX 1EIXA 1NWRA 1N7KA 4AG0A 1WZAA 2VEGA 3UR8A 3RLVA 2X7VA 1GPFA 1TJ1A 1JZ3A 1QNOA 4D2JA 2W5FA 2QAFA 3BSHA 1QWGA 3CLWA 4LWWA 3P60A 3KUMA 3C0LA 2BNJA 3RUBL 4DNMA 2HE8A 2ZZ1A 2GSJA 3VIHA 3LGDA 3S1WA 1F6YA 1FTXA 1KWKA 3CL7A 3KWSA 4DX3A 1W1ZA 1A3HA 3GU2A 1J0JA 1GZ1A 1CGYA 4QCFA 3G3MA 2IPFA 1AMKA 4FNSA 2OWXA 3MUAA 2OQHA 1UWAA 2V82A 4YMZA 4PFHA 2FTYA 1UWQA 3QR0A 3O6DA 2ZRXA 1BQGA 3UJSA 3EPMA 5I3IA 4PR4A 2WMGA 4PUEA 3S9ZA 4N9EA 1DXEA 4TMBA 3O07A 1K9EA 5K9DA 1E73M 3AIBA 1X6NA 2O9RA 4AZBA 5MKGB 2Y5SA 3G0XA 3BAJA 2G95A 4D1JA 4E4PA 1B3OA 2W27A 4UTLA 1UWTA 3WD4A 3ZLFA 1LT8A 3LV5A 2UY4A 4OKDA 1AZ1A 3AHVA 2YCIX 3QFEA 1A5MC 2VEFA 3PTDA 3CZKA 1EJSC 4PTVA 1XICA 3V75A 2Q3OA 4EKJA 1I2PA 2C0HA 3KVJA 1XM3A 3S1VA 2EPMX 1FWEC 1ZSXA 5HQEA 4BA0A 2W63A 4O4VA 3OU8A 3W25A 1TG7A 3BH4A 3WD0A 4DIAA 3HB9A 1PTGA 3DG3A 2HVMA 4XIMA 4AHPA 3S5YA 2I1OA 4MZ8A 4YHGA 1ME8A 3KTXA 4LVDA 1AW1A 4XSMA 3BLDA 7PTDA 3CQJA 2GVGA 4C6QA 4MADA 5LHFA 2WZHA 1B2YA 1DQXA 3O6YX 3VC5A 5HQMA 1EH9A 3OHIA 1TPB1 3VUSA 2YFOA 3CUXA 2XGBA 3GIYA 3KBWA 1OT2A 3R25A 3CHCA 1UWIA 4IWWA 4LB3A 1TELA 2PCEA 3WQEA 3GH7A 4ZTXA 1JNDA 2OMAA 5E6YA 3AYVA 4Q7NA 4QLLA 3W7KA 1KKOA 5I3DA 3EX4A 4JDYA 5DEZA 2H3DA 2CHOA 1HJQA 2Q8LA 1V0LA 3GW0A 1XLIA 4LVBA 2ZCGA 4JGDA 1T99A 2NLYA 4CGTA 4QLJA 1OFQA 1O66A 3LXBA 1L6GA 3EA2A 1NWTA 3WLSA 1OC5A 1O68A 3I4EA 3WF2A 3P6LA 4IZGA 4UQEA 4BHYA 4Z17A 4KGJA 4GY1A 3N2TA 3IIOA 4FNPA 4IPLA 3PZ9A 2FZDA 4JIPA 1JIBA 2A5HA 3L66A 1PCWA 3EWWA 4PODA 3OVRA 3UW6A 4BI6A 2R1MA 4IPIA 4Q8MA 2QW5A 4RLIA 2DORA 3CO4A 2P5NA 1PE1A 3QYQA 1JQVA 5HNNA 1HNYA 3KZSA 4O1CA 1E6PA 1A5UA 2JGQA 4QQ3A 2P88A 1CPUA 3IS4A 3W76A 1VPYA 4PH6A 1DTNA 2DUXA 4Y90A 3GNDA 3VAVA 1IV8A 2PDNA 2FJUB 1JYNA 1GZGA 4YWSA 2IXVA 3GXIA 4XBKA 4ZO8A 4ZB5A 2G96A 3ZOAA 2BXYA 1FWTA 4I9AA 3LHZA 3MSYA 3FNDA 4U5IA 4Z2JA 1E6NA 3WF1A 1AH3A 5FD0A 1OFEA 3LM3A 4UWMA 1W9UA 4WJEA 5DCEA 5D9MA 1ADDA 3KM8A 1T41A 4UFMA 1EXBA 4LPCA 1M7JA 1H7RA 1ODUA 1A5LC 1VFUA 3D3AA 1BSIA 1GEHA 3ITLA 1FH8A 4HOXA 4L6HA 3WY1A 3R8RA 4MPKA 4AWSA 5FJUA 2V67A 3BGJA 1KFKA 2QCLA 5F1UA 1K70A 1VENA 1UKQA 5DMLA 2GJXA 5GQBA 3MPGA 3FV9A 1DWIM 2Z7GA 3TP4A 2HXTA 2CERA 4HYWA 3NFUA 2UZ9A 4L5ZA 1WBJA 2HEJA 3N9KA 4A3RA 2JKEA 1K8XA 1CGVA 2QJJA 3QJAA 3PB2A 2UY5A 3GFXA 4AY1A 4D6HA 2AQVA 2SFPA 3RITA 5A6MA 2H8ZA 3ELFA 3SRDA 1A5KC 1UA3A 4PMRA 2DW6A 2OT1A 3S1GA 1Q5MA 4XZIA 5HUOA 1KD0A 5EU9A 5HPOA 4DEFA 1RQEA 2YA0A 3IGXA 2TYSA 2E40A 1SO4A 3QQ1A 1I0BA 4Q8QA 4O11A 5SWUA 3TJXA 1M7XA 1JI1A 1ONXA 1YEYA 1QBAA 4NIRA 3QOMA 2VC6A 2J66A 4DYKA 4A8RA 1L8NA 5JU6A 2EPLX 3QSRA 3L4ZA 1GVIA 3DI1A 1R46A 2ZOXA 2GQ3A 1TYGA 9XIAA 3GDRA 3GXDA 3DC8A 3SRKA 3MA8A 3GDTA 1MEIA 1JI2A 2QEZA 1S5WA 3ANUA 4H8HA 1C9WA 4F40A 2E8ZA 3MCOA 4BI7A 1HIZA 2W9MA 4GQQA 1IXPA 4IUOA 3CUJA 1U30A 4LBUA 4CQ9A 4HHHA 5A2CA 1GQIA 5BXSA 4H7ZA 4WOQA 4HSHA 2YXOA 3GHSA 5BMWA 3P74A 5BZAA 5L9FA 2OT0A 3P0XA 2PRHA 4OWGA 3ABXA 3A4XA 2J25A 4QX4A 2ZXDA 4RXFA 1BGGA 2X40A 1PUDA 5JH2A 2YPIA 2FB2A 5IBXA 1J6PA 1O5KA 1E5NA 3O16A 3TZNA 4IP4A 2QLYA 4WVXA 3VKDA 2OQYA 4S1FA 3WDJA 1F5ZA 1QMLA 3S9IA 4CVUA 3T6CA 3KL0A 2PDFA 2G41A 1ZP3A 3N29A 5H2ZA 1GQNA 1UYQA 1FWAC 4DPPA 4R85A 3WMLA 4PUKA 5HULA 3HU7A 5TF0A 3UETA 1PIIA 2D0HA 1MRAA 4ENLA 2NVDA 3FW6A 1E3XA 3DKLA 1PEZA 4NI8A 2FHBA 5F4WA 2DZWA 4TVDA 1TPC1 3OIXA 4JTQA 4GUJA 1RJPA 3ZT6A 2E9MA 2NQJA 3ARXA 5G2HA 1EJ7L 1W9XA 2RDTA 3S83A 3WG6A 1AL7A 1IQ8A 4G56A 2TAAA 5FACA 1GOQA 1OCJA 2OG9A 5I3FA 1G4PA 4WDTA 5DT5A 1RQBA 1TZZA 3UWZA 1OZMA 3OQEA 3FYOA 3GXFA 3HPZA 2E3ZA 3FY1A 2G0WA 5F1VA 3VILA 3FYPA 4ACYA 3B3DA 4Q8NA 2INZA 2ZC8A 1R86A 1L8PA 3FVDA 2UY2A 4DJFA 3W1TA 1GJWA 2PWFA 1S2CA 2X2GA 1KM1A 3QLDA 3EDJA 2WM0A 3QZEA 3TR9A 1YDNA 4Z2KA 3IACA 1PWMA 4N9CA 5GVJA 3RFAA 1MYRA 4HBKA 4TQTA 4C6KA 1Q7MA 1TWIA 3ERPA 4JTRA 2OSWA 3NDOA 3TW6A 3FKKA 4W89A 4EAMA 2QV4A 1Y5WA 1NDVA 3M0ZA 4P5UA 1TQJA 1XV8A 1JPHA 2Y70A 1J8VA 2OCZA 2PRMA 4IX0A 3LK6A 5FEWA 1JF5A 2H3BA 4PMJA 4U2YA 5U4NA 3LHYA 5AC4A 1UWUA 3H22A 2HV5A 2XISA 2FMNA 4O19A 1LM1A 3TU9A 2H9AA 4L7ZA 3DYOA 1VBHA 1DIKA 1IZJA 3ZMRA 3QHNA 1VPQA 4A2RA 2QMJA 2V2DA 2Y4SA 2HNEA 4YPJA 3OGSA 3APTA 3M0LA 5HA7A 4PC8A 2CLFA 2J78A 2REQB 3FXGA 2JKPA 1K9FA 3O7UA 1PCKA 2NX9A 3HGSA 2FJKA 2VXNA 3R43A 2EEXA 1TR9A 3UPBA 2TPSA 4IOTA 2VDIA 4H9VA 3UYCA 1KFBA 2VFGA 3KRZA 1KC7A 2YIHA 1OK4A 1WP6A 3T05A 3EKZA 3GTNA 3MUXA 3QV7A 3TX9A 4L9ZA 1KFLA 5HUPA 3H24A 1TPFA 2PDYA 7XIMA 1T40A 3OZPA 3F5KA 3LRLA 3GB6A 1VPXA 3WNMA 3UXIA 3PZUA 2PD9A 1W8GA 2ZX7A 3TMLA 4HHLA 2VZOA 3TOYA 2VCAA 4Y7EA 4ZCWA 3WMCA 1LRTA 1UP2A 1R2RA 2WM1A 3M41A 3DHDA 2YDAA 3KBSA 3FKRA 1ZFJA 2ZVRA 1RA0A 3WQ8A 3KOFA 5C6MA 2JALA 4PTNA 1QAPA 4HNVA 1HJWA 1ICQA 2EGZA 5EFDA 2Y8KA 1GG0A 3CIVA 3KXQA 3FJNA 1SJDA 3KP1A 1FWWA 2XSBA 2Y85A 2AL2A 4W7UA 3NQ6A 3DZ1A 1UZ4A 1JXJA 4M7SA 1HUVA 3O05A 2UV8G 4AX6A 1C9DA 3PUGA 3FA5A 1XP3A 2QCEA 1EJRC 8XIMA 1CNVA 2Y61A 3LCIA 1PYMA 1RPXA 3UJRA 3ZVHA 1XX1A 3WLMA 6ENLA 5BYWA 3DENA 3BMVA 1XS2A 4IHCA 4IQDA 4P7QA 2XYLA 1A5SA 4KCTA 2YW4A 4OVXA 4GIRA 4H2CA 2TRSA 3M16A 4AF0A 4HZ7A 2PDBA 1JFHA 1QOPA 5HDRA 4I5XA 5CZJA 2CLPA 2DV0A 1F7BA 3CTTA 4XAGA 4PCPA 3PR2A 2OZTA 5I07A 5T9CE 2X1RA 1V3IA 3I7RA 4TVUA 1XF0A 3EB4A 2F6XA 2GVJA 2HPIA 3IJDA 4RR4A 3VIKA 2AQOA 2F2HA 1RLCL 2EPHA 3ZYZA 4QAWA 2BG5A 1KGXA 3VIGA 1OCQA 2BTMA 3POCA 2VEPA 1UASA 3D5HA 3GIPA 2WC7A 4NZFA 3OZYA 1XLLA 4KRZA 2VEMA 3SUSA 4QLKA 2NVAA 3ZQ9A 2CXEA 1JRBA 2ADAA 1TE1A 4JTKA 3DFHA 3QPEA 1BAGA 1RCQA 4E3VA 4YU1A 4R7OA 4XO7A 3I3DA 4RNIA 3TWBA 3JRKA 1P43A 3IJIA 4J3WA 2Q6ZA 4P7NA 4C6LA 1Q13A 1LJYA 1DV7A 2YOCA 4JL1A 3SB0A 3VE7A 2O55A 1TUFA 5CPQA 2XM1A 5CSSA 3PWIA 2WHMA 3IIVA 3R2GA 2OWCA 1AW2A 4Q7IA 3GR7A 3NEVA 4PUNA 2QUVA 2E5CA 1V3KA 1B54A 4ATWA 4DJEC 4FA3A 2A0NA 4ATDA 3F03K 2JE8A 5EMKA 2ATMA 3M9YA 1TO3A 4M24A 4UR9A 1J6OA 3WEOA 3FDGA 4DWSB 3V18A 1K77A 3DOPA 5F4XA 4C6DA 4Q8PA 1US0A 1ZB5A 4EXBA 4MMWA 1GT8A 1UD6A 4CD5A 5A6AA 3V0UA 3GM8A 4WSHA 3RO8A 4HA3A 4L4OA 4Q4KA 4BR1A 5K4XA 2XINA 4MHBA 1G7VA 1BF6A 2CKSA 4PTMA 1PVNA 4JN7A 3LXAA 2CWXA 4GO9A 4NZ3A 4UTHA 4OUIA 2J9YA 2PDWA 4UNLA 2CLHA 3G0UA 4TR9A 3WEMA 3T07A 5GNXA 4XWUA 1P1XA 1R0MA 1H5VA 5D03A 7REQA 3U2EA 2DP3A 4GYJA 4KBXA 4PYSA 4GBUA 3GDBA 4AVFA 4QGCA 4TV6A 3INPA 3R8GA 4P61A 2FH6A 4M1BA 4C6BA 1OSEA 1TKKA 5FKYA 1EC7A 1CXKA 3ARZA 4WD0A 1BRLB 5FF3A 1P1MA 3BLPX 4M80A 4LRTA 2XSAA 2XZ7A 3BICA 2NUYA 4WUIA 2OTDA 2QIWA 4RXGA 1EOMA 1WB0A 2OX1A 2DJXA 2DGAA 4L80A 4HOZA 4UQAA 1S38A 3IUDA 2CBVA 4AZCA 3BQ5A 2Y89A 1G5AA 4MUZA 2E25A 4PCNA 4V28A 2ONEA 1PHWA 2GQAA 3Q67A 1W3HA 3CC1A 1H50A 2DSWA 2E0PA 5CBJA 3N2MA 3S6TA 1YPIA 3JZEA 4Y8FA 4C1NA 1E4NA 1TWSA 1OADA 4F0HA 3HIJA 2A3EA 1HF6A 1W9BM 1VGAA 4FNQA 3MBDA 1JD9A 5EA9A 3VM7A 4XB3A 4L6DA 3H7RA 2X0SA 4JS3A 4KT2A 4GABA 2A3HA 2ZDSA 3ZWTA 3TXVA 4D6FA 4HZ8A 2FLIA 3NQ7A 3DIPA 3NQGA 1QASA 3AIRA 4LY8A 3W85A 2QYGA 3I6RA 4ZQCA 4CN1A 3M0JA 2OFJA 4UZSA 1QPNA 2Q8ZA 3RCNA 1VFTA 1ZJHA 2JKAA 1WA3A 3TMQA 1UC4A 1TPDA 2F84A 2O56A 2PBGA 5D4YA 3OLGA 1HGWA 4HVXA 3UP8A 2NVCA 2WLZA 2VVNA 4PTDA 4LTSA 2EBNA 1O5RA 1MQRA 5LSMA 4X61A 4H9XA 1VD6A 1M1BA 3PB0A 3RG6A 1AK5A 4IJCA 1OFDA 4AFYA 3FJ6A 2QNEA 1C8YA 3ATYA 4AQLA 1J10A 3T0DA 3URAA 4TV5A 4PMZA 2J6VA 3TA9A 2WBKA 3PHAA 1XW8A 1UW9A 2QPXA 1OM0A 4NZ4A 1KXHA 2VTFA 1ISZA 3IWPA 4TX8A 2OJPA 1KRAC 4JXCA 3RRAA 3NSMA 2VZUA 3UWVA 4GE8A 4M29A 3U5UA 2R91A 3S6DA 4HK7A 1GTHA 4ADUA 5CPNA 4F66A 5D04C 1C91A 4IFKA 3UJ2A 1KFEA 4PB3A 4IIDA 1Q63A 4H19A 1Q6FA 2DVXA 4V15A 3LI0A 1TPWA 1DJZA 3C52A 2XFYA 3EKGA 2IKHA 2XZ9A 4UTIA 5A6BD 1UMLA 4B90A 4Q8TA 2YFNA 2ZA1A 1AG1O 1QVBA 1XIEA 4EANA 1AQMA 3TYBA 4GVFA 2BXVA 1QW7A 4PMYA 3W81A 2WQPA 1PYFA 3PZOA 3W7EA 1TV5A 1RALA 4D8LA 4IL2A 2Q01A 1E1CA 4RPQA 3PAOA 1WO2A 4ZVJA 5IHSA 1GQLA 1XQLA 3CYJA 4FAMA 1TPEA 4J3UA 3ZO9A 1MXDA 5CPTA 3CLMA 3W28A 2GDVA 1D8WA 3V1HA 3L23A 1SMAA 3G0SA 1KM0A 4C5YA 5LIYX 2XN1A 3FYYA 4FLQA 4GCXA 1GGOA 4WKFA 4HPXA 4GUFA 3PUOA 3HQNA 1JJKA 3IVUA 3T2OA 2P0IA 4WIWA 5A6SA 1SGJA 4NKCA 4D72A 1S5VA 2NWSA 2G50A 4M19A 4HA4A 3BANA 2R24A 4C65A 2D0FA 1SJBA 2QHAA 3R5EA 4LV9A 1F73A 3UXDA 3ZSTA 2NUXA 2V63A 1V6YA 2B7PA 4XIAA 5CG0A 3GTXA 4LAOA 4DY1A 3TYCA 3ARRA 4EX4A 1C29A 4UTKA 3RDKA 2HVOA 2IKGA 3THQA 3AIEA 1ZBVA 4D6GA 3VIPA 2PFHA 1H7PA 5HR7A 1TFVA 3LCLA 4HU0A 3S5ZA 3AC0A 3WJZA 1KRMA 4UFHA 3SN4A 2J7FA 2CZVA 3E0IA 3E0FA 3HGOA 3A4AA 1VRDA 3UERA 4ZA0A 1H60A 3QW4B 1UPMB 4W88A 1E1FA 1KLYA 3QC0A 4NJHA 4ACZA 3LNPA 4LUSA 4Y9AA 4QQUA 3RJXA 2AKMA 1NM9A 3T09A 1QR7A 1O95A 3L12A 3WK0A 3GU1A 4OQVA 4QJ4B 1P6CA 2PEVA 1AQ0A 3ANYA 4JTJA 1OCNA 3GC2A 4HHPA 3PZQA 1YPXA 3LHWA 3S8HA 4X22A 2D1ZA 2DSVA 3GXPA 5TD4A 4IPPA 1FBAA 1M65A 3CYVA 3KAOA 4MAVA 3GO2A 4RDWA 2C1IA 3RR4A 2WMJA 3N1AA 3OA3A 4ZOEA 4BQ5A 2PCQA 3TTEA 3OO2A 1EJWC 3CEUA 3W22A 4ZZ9A 4AMCA 2VFFA 1VCGA 1XLAA 1E72M 1Q65A 4E4UA 4QSFA 3NOYA 4QCEA 3RCMA 1I2NA 1G7UA 3RR1A 4JIIX 1IIGA 4UFKA 1PS9A 3N13A 4RNFA 3ABSA 5DBTA 3NDYA 4MIMA 4F2TA 1I6NA 1AUSL 4QM1A 4ROQA 1VB9A 2BY3A 3AIWA 1ZUAX 1ME9A 2CBIA 1KA9F 3W1LA 7TAAA 3TA6A 1AVAA 3TOPA 3WLJA 2EKGA 1E9IA 2IKIA 3L0NA 4EE9A 2YDSA 4PUJA 1B5TA 1VJSA 1ZJIA 3MDWA 1TJRA 2OLAA 5HBFA 1JCJA 1AFSA 2BASA 3WBEA 5D9OA 5ENLA 5FOOA 2ZTKA 1TMLA 3PY2A 1FH7A 1R3RA 2D22A 1S5MA 4WZHA 3OPSA 1GKRA 4XAFA 2H90A 3WDQA 4GVGA 9CGTA 3SRFA 1J9YA 1HKKA 1BHGA 2Y88A 4UQBA 4HMCA 4HA0A 2F8QA 1KR0A 1RP9A 2EG7A 2PDPA 3ITTA 3FIGA 5E0CA 4NG3A 1X7IA 3MW7A 1NDZA 3TSDA 3PUDA 1ZAIA 3QOKA 4ICMA 3APYA 3IJ8A 3TE9A 3WYZA 2W61A 1UOZA 2XHYA 4WF7A 1EP3A 1QNSA 4YN5A 3ITOA 3R8HA 4OOUA 3SFWA 1W56A 2J7DA 3N2BA 2VKZG 4FF5A 3KVKA 3SY8A 1Z9AA 3IJ9A 1FP9A 3SCUA 1GTEA 4WJXA 4H6QA 2R14A 3VZZA 3TC3A 4GOAA 1CLKA 1Q6QA 3M7WA 1XSJA 3E0LA 1OGBA 3HJEA 3T1GA 4IIFA 3ITGA 4DZAA 5HMEA 5D32A 3WD2A 1KXQA 1XG3A 1OFOA 3PANA 2WPGA 3P62A 4DZ5A 4LF2A 4BF7A 3TN3A 2GJRA 2HBVA 2I17A 1DQWA 3R1ZA 3AAMA 4GK8A 1R7AA 3G1SA 4GUHA 3K8LA 2C15A 5J04A 2O9TA 1T7LA 4J9JA 5D37A 3SR7A 2G97A 3LENA 5AHFA 1QOQA 3HO8A 4CN6A 1BWLA 1XUZA 2FZBA 3IAPA 2YKKA 3W38A 4B4FA 1H7WA 1X38A 2A6NA 1PIGA 3WLLA 1Z6KA 4DXVA 5AECA 2DT2A 3CGTA 3V35A 4NJKA 2PP3A 3ZLHA 3TWAA 3CWOX 1CX9A 1UHVA 1J0YA 2VFDA 3EYPA 1NH6A 3M47A 2J4GA 3O15A 5AYBA 5LA2A 3L21A 1UG6A 1Q85A 2BODX 3VINA 1OABA 2J62A 2EJ1A 1F9CA 4NJGA 3AISA 1BFNA 3AO0A 4HNNA 1FWFC 1WXYA 1FCVA 3QR3A 1FKWA 1QHPA 1HL2A 4EPKA 4I6VA 3NXFA 4LS0A 2RAGA 4HIBA 1WDWA 2Z26A 4AY7A 3CNYA 3AS1A 3HFTA 4J5NA 2VNCA 2ZWYA 4B9YA 4PBEA 2DIEA 3EX2A 3HZ3A 4PCTA 3G2GA 3TFCA 2FIQA 3ISIX 2X1TA 4IMEA 4QBXA 2ZZ3A 3UCDA 4N42A 1SZGA 2AL2B 2OEMA 4DAFA 4HNTA 3NSXA 4S38A 3BK0A 3CUGA 4YCOA 5XINA 1RQHA 2W0UA 3MC5A 1QTWA 3S5OA 3PN8A 1DORA 4V27A 2ZX8A 4ZO6A 2FZ9A 1C92A 3F5LA 2XWEA 3F4CA 3ZVHB 4GXWA 4IUGA 1OINA 5H91A 5DMNA 1XR2A 5CJNA 3LNMA 1JRCA 3VIOA 3DH7A 1NU5A 4PBFA 3T2PA 1I2RA 4IXXA 3V4BA 2WXDM 1Y8BA 1ALDA 5A8PA 4KEVA 1UD2A 3DHUA 4A22A 1N55A 4PUDA 1BXCA 4K6AA 4UTTC 4NNCA 4AZIA 1VHCA 3WUBA 3W75A 4H9TA 3WNLA 1S2VA 2E09A 2ISFA 1UCWA 4R7WA 5DO8A 4EVZA 4LUTA 3IJQA 3NG3A 4RZBA 2WCAA 1T0OA 1PO9A 4AVOA 3SJNA 3HOJA 1ZRQA 4DJEA 2VX5A 4UQ9A 4QRNA 3KCOA 4QG9A 2BGNE 2ZX5A 3UWWA 4XAZA 3IIPA 4YLWA 2HNHA 1P0DA 3P93A 1UBSA 3ZJ7A 1JXKA 3MB9A 4UTWC 3A13A 3MDUA 1ICSA 4UCGA 2XVNA 4JTTA 3AMCA 1KFCA 4MY8A 5A94A 3MMWA 1ZGDA 3VDCA 2WMIA 4M7TA 3OLEA 1GWJA 1TVPA 1AJ2A 2PDIA 3R6IA 4XZHA 1K7XA 2CXGA 4FP1A 3SGZA 4OZOA 2DQXA 4EF9A 4F0SA 4QG8A 3E96A 3GKFA 2JGYA 1DJWA 1W3JA 4GXPA 2VOTA 5F2LA 3FDKA 3PULA 1J0ZA 3NPVA 1J12A 1O4UA 2XPKA 1Y65A 3TLQA 4WOZA 3L5MA 1KM3A 3S2MA 1ML1A 1V0MA 4A2SA 4DI9A 2P8CA 4YTSA 1FY6A 1OFRA 1KFWA 2FPVA 3N4EA 2Z2UA 1SFTA 4AWUA 3RRXA 4Z1AA 3QY6A 2DZSA 5FEZA 5DBUA 1X6LA 3LV6A 4AUBA 3OJGA 6XIMA 4F3HA 4XX6A 4DO5A 1W3NA 5I3JA 1LZOA 1DWJM 3VXGA 1R3WA 2PGWA 3VD7A 2QJIA 3N14A 2ZVIA 4BEUA 1V93A 2J88A 5KZ6A 4JIQA 4MF4A 4KMQA 2OO0A 3ABRA 3BG3A 4W8AA 3A24A 2WLYA 4RUBA 4ZB0A 7REQB 2PF0A 4B5WA 1WOBA 1E0UA 1QK0A 2J7CA 3MMTA 4BK9A 4CQ8A 4Q4OA 1AMYA 3AMLA 4LAZA 4WLCA 1TTQA 3WBAA 2V8ZA 1QUMA 1PKYA 4JCLA 1YDVA 1KGUA 2AKZA 1BVNP 3CPRA 3MHFA 5EYWA 3SIZA 4AEFA 4IQEA 4XZ9A 3H54A 4HQVA 1QOXA 1FFRA 4GZEA 1MFVA 2YZRA 3DI0A 4QFUA 5A95A 3N25A 2VL4A 3VGGA 2INEA 4JNMA 4NQ1A 4FSAA 4Q6JA 4AZCB 1PZ3A 3HF3A 4ZE5A 3LCXA 3NQ8A 1ITXA 1G4SA 2PTXA 3APGA 4TTGA 4GZ7A 1T8QA 1R7OA 5HWNA 4J2MA 4UFLA 3LMZA 3NYDA 1K4HA 1NFGA 4ZQOA 4C1NB 2RDWA 3GY1A 2A3CA 4DZIA 1R9YA 4AIUA 2XFWA 3KRBA 3KL3A 5IHRA 1XPGA 2F61A 1DVJA 1V6VA 2UY3A 3WD1A 1S2AA 3GDLA 2WKLA 3W7HA 4C6MA 3TN4A 1M03A 3KZPA 3V5OA 4PGLA 3GFZA 3RX2A 3IGHX 3ZS4A 4H1ZA 4P7OA 1X1ZA 4KWOA 3T0BA 3GKAA 3W7LA 2QUTA 3CHDA 2A1YA 1VLIA 5LIUX 1W31A 3CWHA 2OEKA 2W66A 3UY7A 2Z2BA 4PA8A 3QW3A 3L5LA 1JAEA 1OBAA 1VJZA 4RE3A 4Q4PA 5RUBA 3G1AA 1R8LA 1JCLA 4F9JA 1FWJC 6XIAA 1YKWA 1WOAA 4U28A 4QROA 5A1AA 1EX1A 2R6OA 2RUSA 4IIHA 3L4XA 5M1TA 2Z1XA 4XVDA 1A0EA 4GJ1A 3KDNA 3UWQA 1GORA 3MUY1 1WUFA 4CCEA 1M01A 3EEZA 2IQTA 1MNZA 1ESWA 4W7WA 4KRTA 3HPXA 4DLMA 3C2VA 2GLKA 4QR6A 1ZPTA 2X8RA 1RP8A 3DC0A 1XRTA 3NL6A 4GQ0A 4ECLA 1H11A 1R6WA 4ROPA 2Z28A 1FWIC 2QGHA 4YTRA 5FAJA 5CPLA 4MB1A 1P6WA 3DFOA 5I23A 4NAEA 2QUUA 2RDUA 3MV01 4TXEA 2E9BA 3AMDA 3CJPA 3IJ6A 4DBUA 4QS5A 1KNWA 1GYNA 4GZIA 1XRVA 2VX7A 3TNOA 2PWUA 4GNJA 1DQUA 4IFKB 1BG4A 4DUOA 4JQ4A 4HKPA 2ZICA 1CGWA 3EB2A 4ZE4A 3KFTA 4I7UA 2VDHA 4O12A 4NZ5A 2PI6A 1G0CA 4FF7A 3VFLA 2EF9A 3HV9A 1XJBA 4HCLA 3SCQA 2QZRA 1Q3NA 1YNPA 2VT0A 2GUUA 5LIKX 5G1TA 2WZIA 1NSJA 3IJ7A 3NJ3A 3IRSA 1OG6A 4AYGA 1YXDA 4R3UA 1JEZA 1IE7C 2PA6A 5G1YA 1OFPA 1XFCA 2EG8A 1XLCA 4E2DA 4JQ3A 1UR8A 5LA0A 1AH0A 1E1CB 2J7HA 3H55A 2YL6A 3BOFA 4IMFA 5I78A 4WY0B 2RGLA 2QPSA 1JZ6A 2G3FA 1E9YB 3CAQA 3KHDA 3LG3A 3B4YA 3GUGA 5CGMA 2OX4A 3CWNA 2DH2A 2NLIA 3D6NA 3LXCA 4ZODA 1KBKA 2ZWZA 3MSRA 3OZMA 4OIFA 3MUZ1 4QNWA 3N2OA 5CZSA 2VEIA 2IXUA 3H70A 4I90A 4GISA 6PTDA 3NR0A 1TZ9A 4A3QA 4I6KA 6ALDA 1JCXA 2WOQA 3K1DA 4C5ZA 5CH9A 4LYPA 4DZHA 5J5DA 1HL9A 3PJWA 2AMXA 4NNBA 2QJHA 1WE5A 4PSRA 1QATA 5CSRA 2C71A 3G6MA 1MFUA 1E4MM 2EPNA 4QJ1A 3TK7A 2KX9A 3ATZA 1EX5A 1NFBA 2LLEA 1E4LA 1RJQA 4MNKA 3G1FA 3RHGA 1BVZA 3W7NA 1UP3A 5FI8A 2HRWA 1BTMA 3HURA 1NEYA 3W7RA 4A3YA 2D2OA 3CHEA 4POCA 3W0KA 1NDWA 2UBPC 5EKYA 3W1PA 4MY1A 2X41A 5D8ZA 1BYDA 2Y6ZA 4AYSA 4H2HA 4ACZB 4QHRA 3E5PA 4IFOA 1LBLA 3LTSA 4LUSB 2BOEX 2Z24A 3MP5A 1FWRA 1S5TA 2G3NA 5D30A 3P2VA 2GGEA 4LAKA 4WY0F 4AIOA 1OIFA 1K8CA 3BCJA 3IUHA 3QH2A 3LTYA 1LYXA 2HISA 3AXKA 3L2LA 3CT7A 4X60A 4CNOA 4U33A 2KAUC 4J3VA 3BARA 2ACSA 2CZ5A 4M3PA 4OGZA 4X2RA 2VR5A 3VDBA 3URNA 2B7NA 3ZM8A 1QI5A 1G69A 3ABZA 5A8OA 1TE6A 2NQ5A 4H7CA 3LRMA 3G8RA 3R12A 5G4EA 3UT0A 3L4UA 3LS9A 3WQ5A 5KETA 2Q02A 4N7QA 4CD6A 2PDUA 3CUFA 4MOZA 4D8ZA 1Y5VA 2BX7A 4Q4SA 4D6IA 1LCOA 5C9XA 2IUZA 2YCJA 3T44A 3AHYA 4I9TA 1PAMA 3QF0A 3MSDA 2CFFA 1XLFA 1P4CA 1WKYA 4YVVA 3MSGA 3M6DA 2PDJA 1VFSA 3VNMA 1TB3A 5E5CA 3G1DA 1BD0A 2GJLA 1X8CA 1QI4A 5G2WA 4J3ZA 3H23A 4XUYA 3WMBA 1D3CA 4WHBA 2PWHA 4IQJA 3FVMA 1YIXA 4K2SA 3OBKA 3W6MA 1YPFA 3NQDA 1D9EA 2ABBA 4Q22A 1X98A 3TZFA 3P3BA 3PC0A 1V7AA 4PUUA 3CQIA 2J74A 3N17A 4WSKA 4NSBA 1POKA 3WQOA 2DIJA 4ALDA 1FQ0A 4JIHA 1NOUA 1OX4A 2FZ8A 2YYTA 3SGUA 4XD4A 1G94A 1ZNNA 1B3YA 2GWNA 1RK6A 4CD4A 4XZWA 3K46A 1KBJA 1XYAA 2ZUUA 2BWGA 3M46A 3R94A 4UZUA 2P0OA 5I03A 3AS2A 4EACA 3LSBA 5JBFA 4DUXA 5H8PA 2C6QA 3AXXA 1XD1A 1SZEA 2F9RA 2JQXA 5LXEA 3LUTA 3E12A 5A6JA 2WZMA 2YJQA 1GQJA 1S1RA 5AFDA 2ZC1A 2W79A 3WNNA 3P7YA 4XISA 4GQGA 1V6TA 1S3TC 2Y24A 1F05A 1JCYA 3HJZA 3PTMA 2ISVA 4A3HA 1TV8A 1GK8A 3VKBA 4LGXA 3GVVA 1O60A 1W3IA 4E8DA 1W6TA 3B9NA 3A3HA 3IV3A 3B8WA 3MHUA 2DPEA 4MNLA 2Z1SA 2NSOA 1DHKA 2OZ0A 2EKCA 1GOMA 3EX3A 4YJ5A 3ZVIA 2ANUA 5DXXA 5FL1A 2G37A 4KFNA 2E7FA 3AYTA 5CC3A 1B3VA 1BWKA 2WNQA 3V3WA 5KTLA 1ITUA 2JK2A 4MTVA 4GIAA 4IIGA 3UXLA 1UWSA 1WYIA 1VFFA 5LKYA 2J9ZA 3VIJA 1E6RA 4GO8A 1JVNA 5BXPA 1IR1A 1SR0A 1UWRA 3AQUA 1DEDA 4MY9A 3B40A 2PLKA 2YDRA 3W6YA 1IHIA 3THAA 3HG5A 3V16A 1XLHA 1F07A 1V0NA 5CLTA 3RPMA 3GG7A 3KRUA 1OF8A 1OX6A 1UB3A 3C86A 4TX9A 3GX9A 1R2TA 1XDMA 4RNHA 2XVPA 4DXXA 2Z1BA 4PTWA 3IK2A 4UC5A 1MDRA 4WEVX 1UUMA 1QNRA 4UTTA 1OB0A 3EA3A 4F0KA 1LWIA 3LCWA 2QJNA 1MMFA 3E02A 1FP8A 2V0TA 5I3GA 1Q8AA 1OYCA 3DFNA 3MCNA 4A21A 5G5IA 3WBYA 2PSNA 4JTLA 4AD4A 1E15A 3CB3A 4EXAA 3GXMA 4ILSA 4TOQA 3EWXA 3DFYA 4DN1A 1H7XA 2XIJA 2PE4A 1RBOB 3STPA 5FCZA 5A6KA 3PM6A 4ZO9A 1K8ZA 1LOSA 3ITYA 4LJ3A 4UTWA 4ZO7A 4DYEA 4H8UA 2E5BA 3VU2A 3W71A 4V1YA 4C90A 2MNRA 4DBSA 1QI0A 3RGTA 5A5WA 3O0FA 4GFSA 3NO5A 1DWGM 1UKTA 2VD9A 3WQPA 3WH7A 4GKLA 2PGEA 2HS8A 5HNTA 3DKJA 4Y9NA 4H01A 3ZT7A 1F8IA 1PPIA 2ZXBA 3U2ZA 1B3ZA 4Y96A 4YTTA 1I45A 3D0CA 4NF7A 4GBDA 4IMDA 1J5SA 4CD8A 2CYGA 3PBYA 4TO8A 1LP6A 1IEXA 3DUGA 1GOIA 2PDCA 1DIEA 4L65A 3ZJKA 1KQZA 3KBVA 4H4IA 3SECA 5J8LA 2BFGA 3NOEA 1KCZA 1RCXB 4H41A 4GJIA 3FAXA 2E8YA 5CBIA 4UTUA 1DYSA 2F38A 1ZL1A 3A21A 3WF4A 2WMIB 3NZQA 4B2DA 4ADSA 4KEZA 1JG9A 2NQZA 2Z2AA 1Z41A 4S3EA 3U2CA 2A7PA 3N73A 4DF0A 1UROA 1Z7AA 2NXIA 5LZLA 2QUMA 2YDQA 3SY5A 2JEPA 4WRHA 3UU0A 4EWJA 4ZFCA 5ABGA 3AUOA 2PP1A 2YGYA 4BQ2A 1EPXA 3WH9A 1GOXA 1L6SA 1L2QA 4R9OA 2YA1A 1Q45A 2XVLA 2BZNA 2P3ZA 2VC7A 3W73A 3Q65A 3TYZA 4HMEA 1OVDA 4RE4A 2QR6A 2VHLA 3W88A 3P67A 3GLCA 1E9ZB 4JKMA 3R10A 1AJ0A 3BJFA 1MW0A 4MZ1A 2CW6A 3EOSA 3SY1A 1CGTA 1M9HA 1Q7ZA 4XTIA 3WK3A 3WL1A 4PMDA 4CUCA 4XTDA 2QKFA 3CV7A 4S39A 1SSDA 2BLEA 3FN9A 4RX0A 4P7LA 4K8EA 4J2PA 5D33A 5GNYA 3CPGA 2P10A 5TNVA 1CECA 4DM2A 1JPKA 5DANA 2AQWA 3QXBA 1P0BA 3LY0A 3B8UA 1HT6A 3UWEA 2QCGA 2VRKA 8A3HA 3U0HA 3WLKX 1SSGA 3K2GA 5IXEA 1XIJA 3FEQA 3C5QA 5BOFA 1QWKA 3A4WA 3QTPA 5HPCA 1L9WA 4LUYA 3TCSA 4HYRA 4CU7A 1XH2A 2VRQA 1Q6RA 3TC6A 4MJ2A 1XLGA 3DXIA 5I77A 4JTDA 4EPBC 2F7FA 3BMXA 1CYGA 4A4AA 4LAMA 3RPTA 3EOUA 3SN1A 1XFBA 3SCSA 2BP1A 4RNJA 1E0VA 4GI9A 3W2MA 2WMFA 3K4DA 3B4UA 4KCUA 1BQCA 2O4QA 5DQPA 2Z0IA 2Y0FA 4DQWA 3L4VA 2RDXA 4X2PA 3W53A 3T0TA 1TV7A 4IJBA 4KWUA 2O7SA 2XIMA 1YMYA 1E5JA 2HWGA 2O0TA 4BQ3A 2DSUA 3WJXA 1N8WA 1JCMP 2HMCA 1SFLA 1RVKA 5JIPA 4S3JA 2C18A 2JIWA 2YXXA 1FVPA 3OHMB 1ITCA 2DIKA 3PBVA 1PKNA 4NX5A 3U4AA 3VD4A 1A5BA 5AHEA 1IEQA 2C3ZA 1JPIA 3T0CA 1NIUA 1MZHA 1KM2A 4O0KA 4MB3A 5ABFB 4D8AA 2OOFA 5AYZA 4R34A 3S5NA 2YR1A 1HXJA 1AL8A 3OGVA 4US6A 4PTXA 3ANVA 4JIRA 1KGWA 3ZR6A 3POHA 2A3BA 3VDGA 2WANA 3PS7A 4O8RA 3KCJA 1W1A1 3NO3A 4ZB2A 4J7RA 1IR2A 1KBLA 1A49A 1IZKA 4UQDA 1XUUA 1EGMA 2ZE3A 2BB0A 1BGAA 2C19A 5B80A 2DSZA 6REQA 3HM7A 1G67A 3M43A 2ZZ4A 4GINA 3BGAA 2ISSA 2PU0A 1FCUA 3RPDA 1XBYA 1GKPA 2WC3A 3DHPA 2X30A 5CPSA 3WFLA 1PTDA 3A4JA 4KIEA 3W87A 3TC7A 3SW6A 1FWHC 4ERGA 1J0KA 1LL6A 1Q6OA 1R3VA 3URQA 1XD0A 4NAEB 3KOZA 4Q7BA 4ZGYA 3GG8A 3Q2DA 4ICCX 2X1IA 3VGHA 1M04A 4MB5A 2J47A 2O7QA 2PTDA 1ZP4A 3OVGA 5C2XA 2C91A 4Z1BA 3VOIA 1TWDA 2YL9A 4PN2A 4EIVA 3R0KA 3P14A 1B57A 4PBGA 7A3HA 5HNUA 4KKXA 3K5XA 3H7UA 4AIBA 4AD1A 4XO6A 3QV9A 3GTHA 1EHAA 5JVLA 4E8GA 4UIOA 4YS1A 3AHXA 3LU2A 4DWSD 3VMOA 1MQPA 3ZR5A 3WIJA 1WDPA 4K1WA 4Q6XA 4EOUA 5EB8A 3QRHA 3W23A 1FXQA 4GZJA 3BLLA 1UZDA 2DQWA 4H9UA 4JNYA 3CMJA 3THUA 4HJFA 1OFBA 4Q4MA 3HGRA 4Z0JA 3EX1A 1RSCA 3WQCA 2DY3A 3AHZA 4JYEA 1CXFA 5HMSA 1JZ7A 2WO5A 1VBRA 4CLMA 2DDXA 5D2VA 1OFAA 1OX5A 3M07A 1JL8A 4B16A 4A3UA 1JCNA 5BCAA 3QMSA 4HN8A 3U3HA 1A4LA 2PWEA 4BY3A 1YHTA 4FX7A 3SGGA 2NT1A 1FCQA 4MJ4A 3REQA 1LWJA 3EMZA 3OBEA 3MBFA 2OSYA 4DELA 4DWSC 2OKTA 3NZRA 5D2WA 5FF2A 2I9EA 4M56A 1P0EA 2VZTA 4GIYA 1LG2A 1DXIA 1JPDX 3A64A 3F4VA 4LS1A 4XD3A 3GNRA 3PG8A 3QYSA 1VBGA 3W86A 1F3EA 3NM3A 2YL5A 2CLIA 5A3HA 3PFMA 4MKNA 5AHMA 1V8EA 2QF7A 3DFPA 5AY7A 4FX8A 3W24A 4CQBA 3VGEA 3PUEA 4XD5A 4Y9PA 1L6WA 3RLHA 1AD1A 4DRSA 5C54A 4RL3A 2R1PA 3CZJA 1MEHA 3W1QA 1J4EA 3OVPA 4M5PA 1XBZA 3VTRA 2VC5A 4MSSA 5E9AA 4QG6A 4FR6A 4HCDA 3N2XA 5F2GA 1DJQA 3C56A 4OU1A 4FLSA 3U48A 1XL9A 3UWUA 5DFAA 3W2JA 4ZQNA 3RLUA 4HA1A 2EO7A 3CAKA 1HJUA 3PZMA 4JY9A 4CNPA 4QIUA 1EGZA 3S1UA 4LT9A 5AC7A 1SO6A 3AICA 3NM1A 3THDA 4IG2A 3UPWA 1KB3A 2QCMA 5I2UA 2PDMA 3W7CA 4PRTA 4HU3A 4G8TA 2J79A 5EGRA 3I6TA 4AMAA 4IF2A 3A22A 3NZGA 4FZIA 3T2QA 2Z6JA 3QGAC 3B9OA 3ZJ6A 4JYFA 5C5YA 3KEHA 5EMMA 4ZQRA 3NTYA 1CXIA 4B5NA 1XLEA 4DUVA 5FEXA 4FXJA 2OPJA 2AGKA 3PJUA 3PJXA 4D1IA 3NIYA 1FDZA 2CLMA 1E43A 5D8WA 2PGFA 4I7VA 1I4NA 2XH7A 1CB7B 1QRQA 4GQRA 4E4FA 2DT0A 1GVFA 2VUYA 3STCA 4F0RA 3KS6A 3UEQA 1XG4A 2X0HA 1HJSA 3FSUA 5HANA 2OOGA 3V36A 3W29A 2FGLA 3PVFA 1GJPA 1VAHA 3HG2A 1B1YA 3VNDA 3M5YA 4K7YA 1EA0A 3UA4A 5AOUA 3RMEA 1KTNA 4BF9A 3TQPA 4LNCA 4XBJA 1MEWA 1XISA 2GVLA 2J13A 1XGEA 3O6AA 2L5HA 3P8JA 1XI3A 2ZUSA 3E9AA 1KXTA 2H6RA 3W3OA 4B15A 2FPTA 1KV8A 3TW9A 1MUWA 3WQGA 1ECEA 1HG3A 2OU4A 1GOWA 1EBHA 1KKRA 1VR6A 4KQNA 3D47A 3PSWA 3FA4A 4GWEA 1UD4A 4V1XA 3WLIA 1A0DA 3QSTA 1V4YA 3PJTA 1WPCA 1W91A 1OYAA 1GW9A 1QPRA 5AC6A 3GK0A 3VIFA 1GNXA 3TYAA 2X1UA 2DZTA 1O1ZA 3GTIA 2ASHA 3A23A 3GVQA 3NVDA 4HPGA 5KINA 3STFA 1B4EA 2Y7FA 4XZLX 4Z0SA 5T9BG 2PDKA 3AWNA 3SQMA 1OX4B 4S3BA 2QDHA 3JVAA 2BMBA 2NV2A 3BE7A 1XGDA 2JBMA 3W26A 5AZ1A 1BYBA 1K03A 1OEPA 3NSNA 4YTQA 3CO8A 4IGMA 5FJPA 3TH6A 1ZENA 1QK2A 2QCDA 1QHOA 2HPMA 1KCKA 4O57A 3OLDA 5DLCA 4KH2A 5BRPA 3BC9A 1EYWA 4HJWA 2BXZA 4H8VA 3GRIA 2DZUA 1XYFA 5F7UA 3UZWA 2X05A 3LTPA 3TTOA 3RU6A 1DHPA 3TFXA 2Y63A 2ZZ2A 3DU0A 3OTRA 2I14A 4MLJA 3PWAA 2ZUVA 1HVQA 4YHEA 3HV8A 1TV2A 5M17A 1CCWB 3G1YA 5BRBA 1UH4A 1SZFA 3S2JA 5J5RA 4KF1A 4GMEA 4I9JA 5D9PA 2OB3A 4O18A 3FHQA 1K6WA 4GXMA 3EPNA 2X16A 4FOJA 3GR4A 1W9PA 1ZBKA 3BAYA 2Y2WA 4FLOA 1UQYA 3LQLA 3U9IA 4UCFA 3B0PA 1L0PA 3S1XA 4N2YA 1M3UA 5LNRA 4AZGA 3H2FA 1QFEA 3ZWSA 5D2XA 2V69A 3AJ7A 3O1NA 4S3GA 5EMLA 3P5YA 4B5SA 4ZOBA 3E2VA 3BAXA 4JX5A 4IGHA 4DM1A 1G01A 5JBEA 4GC4A 2DZBA 4NYYA 1FXPA 3SUUA 4GIEA 1A5OC 4BQ4A 3KTSA 2C1HA 3S47A 3BW3A 3AU2A 3BDKA 5HJLA 4YYFA 2AAMA 1JZ5A 1ITQA 1SW0A 1NQ6A 4TTUA 4UMBA 3A3XA 3BURA 3AXIA 3CV6A 1SZNA 1DE6A 2R1NA 1NF0A 1TJPA 4AISA 4IICA 4LCSA 5TBOA 5I0DA 3LN3A 1HKVA 5ABHA 2Y7DA 4KEUA 4WDUA 1YE6A 3KVLA 3EWZA 1VBUA 3CL6A 1OC7A 3N6HA 1ZALA 4U5KA 4TUFA 3WQWA 4MYXA 1SYTA 3M44A 1H0GA 3UXAA 4B4HA 4LB4A 4Z1CA 3G1VA 3ALFA 4CQCA 2QT3A 4G1NA 4I8YA 3C2RA 3NL2A 4IH3A 1T5AA 3LCGA 4J28A 1PJ9A 4TMCA 4NNAA 1IWPA 4R9XA 1UR2A 5A8GA 3BTNA 1F6PA 4UQCA 4UB9A 5LNUA 1ME7A 3AFBA 2FHCA 1M7OA 4B5XA 3V5CA 5LIWX 3UXKA 4L1GA 3NUKA 1UUQA 1TA3A 1AH4A 2BGQA 4B9ZA 3NPWA 1WQ5A 2PTYA 3ABQA 5EMJA 4HSOA 1A4MA 3WFAA 1PX8A 5CJMA 1EL3A 3AXMA 5C71A 1ADSA 1W1YA 5FAGA 1V0KA 3DHFA 2WYSA 3CHFA 2H8XA 1WNOA 4MG4A 4FALA 3NQFA 5XIAA 2XIIA 3C0SA 4JL2A 3PBGA 1GOOA 3K4WA 3VI2A 2HROA 1GHRA 4EK7A 5HAOA 1FX6A 3QKEA 3O8AA 3WKZA 4FOUA 4J3TA 4HHMA 3P0WA 4QDMA 4XUGA 1US3A 4Q8OA 2ISDA 4OBSA 3VA8A 4XSLA 2QDEA 5E70A 2RHGA 1XIDA 3PZGA 1KCXA 3TJ4A 2Q8XA 4L9XA 4L56A 4WKHA 3C2EA 1F2JA 1H51A 1ICPA 1THFD 2GDUA 2V5JA 2VJXA 2ZE0A 1E0TA 4N6EA 4G1KA 3G24A 1E40A 4I7WA 1P7TA 2XVGA 5HATA 3NNTA 1W17A 1Z48A 2P76A 3WLOA 3T08A 3VUPA 4O1EA 3TONA 5I3KA 2PTZA 4EF8A 1V02E 3MQTA 2PDGA 4GACA 4J3XA 2XGIA 1QI2A 2Z1WA 4AD5A 5FA5A 1DJXA 1WKEA 4OE7A 3OEXA 1FRBA 4S2BA 3CZEA 1EDTA 2WSRA 3MMDA 3N6JA 4DF1A 4MPQA 1J11A 1KQYA 4FHAA 2D2HA 5H8UA 1IEWA 2RH9A 4QP0A 1UA7A 4EPEC 4IMCA 2WWCA 4GQBA 4HGXA 3M1ZA 1E9LA 5I79A 2HK1A 2VGIA 4J27A 3LM7A 2IS7A 1EEPA 3NWRA 3PSVA 3PPFA 2YBUA 3KHJA 4US5D 2REQA 4WQ6A 1BKSA 3BXWA 2BVYA 4NY2A 4CCZA 9RUBA 1SZRA 5DMMA 8RUCA 3VGBA 1GQKA 3W6LA 3BL3A 1KXVA 1QPQA 4ORMA 3IAQA 2QGYA 4LCRA 2RJHA 2Y7GA 1LQAA 3TAOA 4JTGA 4H8NA 1WDSA 4XQ6A 3S42A 4P8UA 5FL0A 3KS5A 3QKZA 1DE5A 1VFOA 1K1DA 1TWWA 1W9VA 3W7PA 4K36A 3SURA 2PRLA 1H7NA 3GHTA 3VNIA 3UYIA 3E2QA 3SSZA 2DH3A 1PWLA 3LPPA 1MUMA 3LBOA 1E1EA 3F4DA 2PZ0A 5AB3A 1YDOA 3WLQA 2BHZA 5E09A 1XKJA 3OG2A 3B8IA 3A6OA 2PS2A 1PL9A 4PMQA 5M5DA 4HTBA 1CXHA 1U83A 2VURA 4B91A 3RM9A 5CZKA 3O9NA 4IJRA 3H4WA 3XISA 5M2FX 4UFIA 2HE5A 3AZSA 1W8SA 1UZHA 4RW5A 1A5NC 3OIHA 1NVMA 4JAWA 4LW7A 1ZY9A 3MUIA 5HOSA 1P5BA 1NQKA 2PF8A 4KGLA 1Z3NA 4CN4A 3TTYA 4LC8A 2QDGA 4LVGA 3DYPA 2ZKMX 3NAVA 1KFJA 4N9DA 3LHTA 4DI8A 1AZ2A 1QI3A 3LEPA 2V5KA 1X7FA 3V1PA 2WVTA 3QPZA 4N4QA 2WBGA 3VD3A 1GJUA 5BXTA 1O1HA 4G7FA 4W8BA 2VQTA 1K8YA 3T4CA 5AKQA 3UG5A 3KLLA 1H2JA 3VNZA 1HO4A 2FYMA 2PWGA 4PRWA 1EBGA 3N6QA 3M0IA 3BAWA 4YTUA 2UWFA 2VFEA 3FJLA 4JFTA 5CGQA 3EGJA 2GYIA 3OLIA 1EP2A 1IZCA 1TX0A 1ADOA 1GZJA 4CNSA 1VHNA 1FDJA 5IRPA 1EJXC 3EWBX 1WXJA 1ECQA 4LX4A 5T91A 4KPLA 1LTDA 4GI8A 2J7BA 4G2DA 1A3WA 4HPHA 3QQ0A 3SAZA 1VQTA 3GYCA 3WSUA 4B5TA 3SEPA 2OZ3A 3ENLA 1RBLA 2ZQ0A 4KWSA 2CLLA 3V0SA 1ZZMA 4U31A 3W7OA 1H3GA 2WVVA 1DPMA 1DIDA 2DVUA 1JR1A 2R82A 2RFGA 3NQCA 4XG1A 1SR9A 5FJRA 1CI1A 4F48A 1B0IA 4C6CA 4N9BA 6REQB 1WCGA 1QHZA 2JFEX 1LLZA 4FK9A 3FHAA 3EKLA 5CXPA 1ZTVA 5A6LA 5LHEA 3DYMA 1WDDA 3F2DA 1RLDA 3AU6A 2WPBA 4NASA 1LL7A 3H12A 4HU4A 3TYEA 3W37A 3RU8X 3H7VA 3CIWA 5DCBA 4KERA 3WH6A 1JUKA 2D23A 4WGHA 4BI5A 2VEKA 3T55A 4KEMA 3LRKA 4FR1A 2I9UA 2FDMA 3DBNA 4J1OA 3CM4A 2GDQA 4X0NA 1JUEA 2YZ5A 3CB8A 5GPRA 5LNWA 2WMKA 5U7SA 3GE7A 5E6ZA 1CT5A 4KESA 4DWSA 3CS2A 5BMXA 1E0WA 3LBMA 3HG3A 4N0RA 1WKDA 4MFEA 3EDFA 4O1DA 1S1PA 2PMQA 2QMKA 1GVOA 4GI6A 1LLOA 5JH1A 1CGXA 3O2LA 4MWAD 4GCAA 3KLKA 2V3FA 3CMFA 1F3XA 4LOCA 1OHLA 4GH3A 5REQA 3EPOA 1V6UA 2WK2A 2OVLA 1EQCA 3VMNA 1E71M 2PGRA 2I5IA 1UH3A 5DN1A 4JTCA 3S2NA 2VFHA 5CC6A 4HCHA 2HS6A 4XAYA 1MXGA 5BWFA 4DPQA 4L4PA 4K1GA 2R1LA 1JFXA 2YCEA 4K37A 3UG3A 3WDHA 2E1WA 2QVNA 3W74A 1YLVA 2EPKX 4U4MA 3L4YA 3BCDA 4NL1A 4D6JA 4BCEA 1ZAJA 2V2HA 1BRLA 2VFIA 3R13A 3E1F1 4DAIA 2YBVA 2E67A 1R3YA 3REQB 2W6RA 3FAWA 3MZNA 2F6UA 3E3HA 5I24A 4MWAC 5IFPA 1SW7A 4FIQA 3HPSA 4W87A 1ISVA 3DX5A 2NZLA 5A6TC 3N12A 1HKWA 1F61A 2IQ0A 2D3LA 3NPUA 1FWDC 4HNOA 1Q6CA 4LYQA 1SFSA 3NQVA 1ONRA 1XIMA 4HN4A 1EDQA 1Z8AA 3A47A 2ALDA 4JX6A 3TAKA 2BV9A 3I3BA 3L5AA 2E9LA 3LHVA 3WQ6A 3W2LA 1I2OA 4C7GA 2B31A 4QAIA 4LALA 3WFZA 4U3AA 4OBRA 5JBDA 2KZHA 2NUWA 3ZIZA 4ZL1A 3H53A 4S23A 4DHGA 1P0KA 3BG5A 3RM8A 2NV1A 4O28A 2GJXB 3WLRA 3QBUA 1F3WA 1EO7A 4WSJA 1F8MA 1C8QA 3N15A 2VGBA 3EXSA 3W4RA 1S39A 1DOSA 1OZQA 3TNBA 2YSWA 4HOWA 3LHUA 4LUIA 2XDFA 3R0DA 2P3EA 3BLFA 4IG2B 3SDOA 4S3AA 5LXXA 4GI4A 1GVQA 3F5JA 5PTDA 1W5OA 1DBTA 3WX7A 3ID7A 1I1XA 2CIPA 2E6AA 3WMSA 5C70A 1AW5A 1MZRA 4NZ1A 2YX0A 4HPJA 4PFMA 5M3WA 2VC9A 3B06A 3RN6A 3RK8A 2V3DA 4XZNX 2VGFA 4AZ5A 3LQGA 1XLDA 1E6XM 4GA8A 2ACRA 3HQPA 3W07A 4PMVA 2QPUA 4FLRA 1DJNA 1LF1A 4AD0A 5CAHA 1DIOA 1HJVA 4MYAA 1IF2A 4UNIA 1MWOA 4L6OA 1R30A 1CEOA 1FH9A 1K02A 5AHIA 1EPVA 3MT1A 3KDOA 3MJYA 3WJSA 4O53A 3BG9A 1IXQA 5DY2A 1BPLB 1U2YA 3B8VA 4WXZA 1OD0A 4DO4A 3DCPA 1MO0A 4KCVA 3TN5A 3FGCA 1DTUA 2R8WA 3D3FA 5L6UA 2WJZA 5K9CA 3QZAA 2WJEA 3WEZA 1TV4A 4E3TA 4GUGA 1BTCA 2VYOA 2GVYA 3MHGA 3QN3A 1H63A 4Q33A 1KRBC 3EWYA 1VCFA 3CT2A 4UXDA 3WZ0E 1HP5A 1RXOB 4LEQA 1UQZA 3PNUA 3CASA 3EOLA 4HD5A 1E6QM 4FO4A 1HW6A 5DF0A 2DVTA 3F2BA 4JCMA 2ESCA 2D2JA 5BRQA 3GG1A 2W92A 1OYBA 3M64A 4H04A 4E2OA 3VOJA 1NOWA 2EG6A 3CXOA 3N4AA 2X7WA 3PZNA 3U7VA 3TXZA 4R27A 3SN0A 5G4HC 3TQKA 4HSNA 4AEOA 3QGVA 3QLLA 2YCKX 1S2TA 2GJNA 1QW9A 4M0XA 4W86A 1O94A 3F4NA 2J77A 1TR1A 4O16A 4JN8A 4IP5A 1X1OA 4O17A 3SCOA 4G6CA 4HTYA 4H9YA 3KTCA 4HK5A 1WDQA 1XLMA 2QCDB 3MV11 4QE5A 3WK2A 3PTQA 4JTUA 3W1UA 3AI0A 4KRUA 2WMHA 2AAAA 4CCDA 1DJIA 2ICSA 1S46A 3N4FA 1Z69A 1ZBWA 2VVSA 3CAWA 3L9CA 4N02A 2DZPA 4UMCA 2Z1VA 3NGJA 3SJ3A 1L2UA 4X9YA 5KITA 3BOXA 2WKJA 1OCBA 4RV3A 2XVKA 3Q58A 1YQ2A 3GSMA 2OO6A 3ARTA 5CAKA 1XIBA 6TAAA 1XYMA 3W02A 4WXYA 4MGGA 1QNVA 3MCMA 4XVEA 1FHDA 1UR1A 3FSTA 2JEQA 2ZA3A 1BG9A 1UBPC 4M51A 4S3DA 3H26A 3F1QA 3M0HA 4MFDA 2XN2A 2OLSA 1PZ2A 4JYDA 1J5TA 4NZCA 3NQMA 3U7BA 3EXTA 4KCWA 1PDYA 3ITVA 5LNSA 2GGJA 1NP0A 1YXYA 2ZZ5A 5HMFA 3TUUA 1XLKA 1D7KA 3NCOA 4C1LA 3M5VA 3BOLA 4GFIA 2O9PA 2HSAA 3KBJA 3N34A 1LRNA 1YE4A 4UTJA 3SM0A 4HMDA 3GNXA 4C6FA 3K13A 3E0WA 3HN3A 4A29A 1UPPA 4M1RA 1HP4A 3NYZA 4DLFA 3OG3A 3XINA 4QJ3B 3BGGA 3SIMA 7CGTA 4WGXA 3HQ1A 4J40A 1KTBA 1CB2A 5JUVA 2YL8A 4XD6A 4CCCA 4NP7A 4Z1YA 4AXNA 3KWXA 1ELSA 4ZMGA 4HB7A 2H9AB 1W1VA 1HKMA 1TRIA 3R4IA 4Q8VA 5D2YA 4JNZA 4O8AA 3RAOA 2OR2A 3M0XA 5IOBA 1DJGA 4FEZA 4I3GA 3KOYA 1R3SA 3NGFA 3AS0A 1MVYA 4JFUA 3KW3A 3R11A 4X63A 4JKLA 1YTEA 2ZADA 3PPGA 1QBBA 1F74A 1O6IA 1VS1A 1RZMA 2BVDA 4K3ZA 1D8CA 1A0CA 3AIQA 2FGZA 1GOKA 4AZ6A 1XIIA 2GUYA 3FLUA 2YBTA 3NZ1A 3QFWA 3QMTA 4Y2WA 2YXGA 3ZLGA 3B8SA 3K1GA 5EBAA 4OFCA 3VX1A 3TYUA 3SCRA 3EXRA 3CV1A 4ML9A 4BEQA 3W2NA 1CTNA 3GC4A 3U6WA 5DT7A 1HKIA 3AROA 3CL8A 2J27A 2Z29A 3MZ2A 3L7RA 5C2CA 3LB0A 4IPNB 4G7EA 1TIWA 1EUNA 4NXKA 5TQLA 4KS0A 4H6RA 1KW1A 3GW3A 3UZYA 1TIMA 4RJEA 4D71A 2OODA 1YYAA 1TA3B 2DSKA 2W62A 3LLFA 4FMVA 1I1WA 3W27A 1JDCA 3S3GA 3BQ6A 4Z08A 2D3NA 5ABTA 2IPWA 2VELA 3URBA 4NILA 4NZJA 1LQ2A 1Q2RA 1YRRA 4QISA 1J93A 1EQPA 1HO1A 2GSEA 5I5RA 3NQ2A 3WUEA 1K6AA 2CWNA 1N82A 4TX6A 1F6KA 5F2IA 3GTFA 3ZJ8A 3QZ6A 1I60A 1TSIA 2EXOA 3MY9A 1EOKA 3T78A 3T40A 2YB1A 2VWTA 1Q6DA 1IT7A 5C55A 2CZFA 4F8XA 2GL5A 4Q4RA 4L61A 2Y8VA 3H2AA 3ECQA 4R33A 3GH4A 3SADA 2G8ZA 3DAQA 4GX9A 1FHLA 1FHUA 1FWCC 4BF5A 5DX7A 3S0CA 2NQ9A 4XKYA 2PZNA 4WX2A 4FXFA 4AF0B 2ZXAA 4JTHA 1Q2SA 1XRSA 1E70M 4B3KA 1P7TB 3H2MA 1OGSA 3GIQA 5LYRA 1HVXA 3EMQA 5AVHA 4W5ZA 5CGTA 2A2IA 2CNCA 3P61A 4EPDC 1KO0A 2AGTA 3Q4DA 3KCLA 4UNKA 3O0KA 4D9PA 4JEJA 5CCZA 1VJIA 4Y6GA 2O92A 4JX4A 2WWDA 4AC1X 1WZMA 2E5DA 3SCVA 1RV8A 3NA8A 3STGA 4US5A 1M7PA 4ML4A 1VF8A 3GFYA 4E2VA 1F3TA 3A5VA 4ZXLA 2NQLA 3IK4A 4C60A 1SJCA 1I0DA 3MMUA 3I7SA 1JDFA 1J2WA 3QY7A 4CNTA 4LFYA 1Q6GA 3LCHA 3CQHA 4PEEA 1E51A 4F4RA 4MNJA 3NQBA 2BY1A 4IX2A 4C6IA 1RBAA 3LLDA 1KCLA 1A47A 1M41A 5F4SA 4H00A 4REQA 3BUVA 3T8LA 4ADTA 3M0KA 1E56A 3WENA 5IFTA 3H2NA 3AIUA 4BKNA 1Q7QA 1V3JA 4JFVA 4KFOA 4M81A 3H2CA 4AEEA 3FK4A 4W9TA 1FFQA 1QCWA 2WSQA 3VKKA 4GD0A 2A85A 4L4LA 1MXSA 3PBWA 2FVMA 2E6FA 3G22A 1ZAHA 2BDQA 1EP1A 1S2UA 1TZ7A 3J7HA 4DF2A 1UD5A 1PX4A 2DZVA 3WNKA 2XSXA 3COTA 2GGGA 4FI4A 1TUXA 2ATSA 4HMNA 1NARA 1E6SM 1EJUC 4NXSA 5BROA 2EJAA 1XBXA 5D2TA 3MUCA 4BS0A 4RE0A 3IJLA 3GH5A 2J9XA 4UFJA 3UF9A 3TLLA 1CLXA 4HZMA 2NSXA 3GG0A 4TU1A 3OW1A 2V2CA 2GQ9A 1IGSA 3UZJA 3C3UA 2V3GA 2HQAA 3TJLA 3TEVA 4FNUA 3CK5A 2BY2A 2FPYA 3RLGA 1ONWA 4JFSA 3OB8A 4PE8A 1TPVA 2OYMA 3G8EA 3CMGA 4TIMA 1NAL1 1NWUA 2R94A 1VP5A 1JYVA 4BJHA 1LWHA 2FMOA 4N6FA 1MQQA 4J3SA 1EC9A 3Q45A 3SQSA 3LCFA 5AVNA 3LBCA 1XRFA 1NDYA 3DFSA 3S2LA 3OODA 3HMCA 3RF9A 2ZX9A 3GXTA 2Y62A 1S2WA 2WVUA 3LERA 4O1AA 2O9OA 4C6JA 5A8NA 3C0JA 8XIAA 3IIXA 3VFCA 2WZTA 1KWGA 2ZUMA 4GKTA 3UGVA 3BSMA 3I10A 5CSYA 3DG6A 3U8GA 4HYVA 2PLJA 3T42A 1TMQA 1ISYA 2FFIA 3F2CA 3B8TA 2ZRUA 3BCFA 2NX3A 3U2OA 4ERAA 3CPUA 3SUTA 1OT1A 3IANA 4LV4A 3TTSA 2OYLA 3EZ4A 1Q6EA 1L6YA 3W1RA 4S2CA 1LORA 1GVYA 2A4AA 4L64A 4C6PA 3PNZA 1JZ8A 3NEHA 4QDPA 2CPUA 3LZ3A 3QHMA 1O7AA 1WDRA 5CSUA 3PPCA 5K4ZA 1W1PA 1LBFA 4DJED 5JXQA 1XIGA 4DBEA 1D3GA 3E49A 4E2BA 2WVVB 3QC3A 1XH0A 1IIHA 1J18A 3RX4A 2XUCA 1WV2A 3G6LA 4JD4A 1EIBA 3SQLA 3C8FA 3R79A 3WBWA 2J7EA 3VABA 2W4XA 4CU6A 1Z89A 4PCFA 3UR5A 3MKKA 2ZX6A 4FNTA 3BLIA 3EDKA 1OJXA 2NXGA 4DBWA 1Z42A 4CQDA 5DMYA 1GYLA 2FZNA 2WZEA 3W7GA 5A8MA 5G2IA 2B4GA 2V5BA 3N9SA 3EDDA 3L4WA 1YXCA 4AD2A 3N04A 5BOOA 3ABOA 4DYJA 3W00A 1B9ZA 2WSKA 3ZFHA 3M6YA 4HP5A 4YVXA 1J79A 1ZBCA 5KZDA 2XN0A 1VYRA 3WLNA 4KIRA 4MWAA 3HBLA 1YX1A 1MNSA 1BLIA 2MANA 1LG1A 2Q3RA 4JDBA 1CDGA 3WUGA 2D73A 3MVTA 4GVIA 3TJIA 2CZDA 3L67A 1K9TA 1QDSA 1VIWA 4AIEA 3PF3A 1RR2A 1XBVA 4JQ1A 1QXLA 2XM2A 3SZ8A 4LYKA 5REQB 2PLCA 3H2EA 2J8GA 4XV0A 3GVRA 3QV8A 3IRDA 1DKWA 4JZ5A 3K8KA 4C7FA 5TAOA 1LOQA 3JUGA 1FHVA 4W8LA 3VE9A 1V3LA 4LAUA 4XBSA 1EKOA 3BJSA 4O54A 1O5XA 3ARSA 3ONBA 1CZ1A 2BBFA 5A6BA 3W7JA 3SUVA 1ZCCA 2YYUA 2WHLA 2EHHA 4LBSA 3S9YA 2VMFA 4MDPA 3UCQA 1W9DM 1UKOA 1W1B1 3MWAA 4F0MA 3ZT5A 4LY4A 4AHOA 1VFHA 1GVRA 2PODA 4JPGA 4AAJA 4LVAA 3GVWA 2BS9A 2WNWA 3OYXA 1X96A 5FF0A 4GUIA 1QPKA 2C13A 2P1FA 4X0VA 2P53A 4GGHA 3ZSSA 4GX8A 4B5UA 4EWND 4NRRA 2WNNA 3PBMA 1EC8A 2VGGA 2ZYFA 4QEHA 1X1NA 5K9XA 3B9AA 4A6GA 3MU7A 4CNNA 2HTMA 4IFRA 4MVAA 2CZEA 5H6HA 4RPPA 1IWBA 3G77A 1TX2A 3RM4A 3BMWA 4KWWA 4ZENA 1H0IA 4A8IA 3QHOA 2HVNA 3MP4A 5CQ1A 2NX1A 4RV8A 4OTKA 1XPYA 4O0QA 5HK4A 3WD3A 2WV8A 5HR6A 4C6EA 1G4TA 3VC6A 1B4KA 5AC5A 4W7VA 3S6OA 5HXMA 4LEFA 2I57A 3MO7A 1G9HA 2A3AA 3BPWA 2G5WA 1AA1B 1ONEA 3OOQA 3WF3A 5D02A 2OEJA 4B5VA 2CLEA 1YNYA 1EA9C 2BGSA 3VOGA 1U22A 3G1HA 3BJTA 1GHSA 4R7JA 1T6MA 4LU0A 3TV8A 3PPHA 5ECVA 1K9DA 4C7DA 1GG1A 3C6CA 4FPSA 3ARWA 2VUNA 1V02A 1AQFA 3JR2A 3L0KA 4IPJA 4PMUA 1H4PA 1WBHA 3EMCA 5E0FA 3KOXA 5C9RA 4JQAA 4CEXC 1CLVA 2DJLA 3GD6A 2Y5EA 2JF6A 1XYCA 4XKMA 2J7GA 1V08A 5AYIA 1R9ZA 1W0MA 3UNDA 1U1JA 3WNPA 3BZGA 5G1MA 1UR3M 1NELA 3AIVA 1M6JA 3OZOA 4LCQA 5I6SA 3B03A 4JHMA 2CCRA 1RAKA 1IXNA 3BLKA 3FGCB 2X42A 1VEOA 2Z1KA 4D6DA 4J35A 3UCCA 4Q32A 4M6UA 3BLOA 2FVLA 1W5NA 1O5QA 2Z00A 1DXFA 4PRRA 1LUCA 1EF2A 2YLAA 1XWYA 1TQXA 2W91A 2QV5A 2XU2A 3WELA 2WVSA 4UTFA 4WDXA 1C93A 3RNDA 1IT8A 1R87A 2ZRYA 4MAZA 3BV7A 3WQFA 3KBMA 3UZXA 1VRXA 4EAYA 4DNHA 3W1MA 1CWYA 4QDWA 3L4TA 1RCOB 3VGFA 3M0MA 1JDDA 5HJXA 4O50A 2VZSA 3JS3A 1V79A 3K4AA 3NDZA 2W67A 1OQFA 4RZ5A 5DCDA 2V81A 1Y0EA 2NT0A 1TREA 4RDVA 4E5TA 4F2UA 3AALA 3M4HA 4HT3A 2FKPA 3KBNA 2G3IA 1Z32X 1PB0A 3LYEA 1RVGA 4P2VA 4QJ5B 1F4AA 2TODA 3WQDA 4GNVA 3NO1A 3LD5A 3VNJA 2PDHA 1QNPA 2VX6A 3TDFA 4JN6A 5FJTA 4LH8A 1UC5A 2CITA 3AWOA 4WY0A 4ZTYA 3UESA 1VKFA 2VENA 3VDHA 2QS8A 4ZQPA 4YXGA 3I3EA 5GJMA 4PSPA 5LNVA 1D3HA 5AZ0A 4NHVA 3EOEA 3DGBA 3AZTA 1RHCA 3KE0A 1EUAA 4AZ7A 4GYKA 3VKAA 3L68A 4MM1A 4I8DA 4Z2HA 3SCTA 3IEBA 4NJJA 2FVKA 4V2XA 5AN7A 1AD4A 1EO5A 3H6OA 3RXZA 2GOUA 3GDKA 1GVSA 1EB3A 5E1QA 3CEPA 1QT1A 2ZUTA 2BHYA 3A12A 1DWAM 3EBVA 4WR3A 2OYKA 3H8AA 2GQ8A 1MDLA 1KV5A 1XQKA 2Z25A 1M68A 5HINA 3ARQA 3CV2A 1V3MA 3MANA 1HN1A 4K8HA 3MP3A 3DG7A 4RE2A 3UG8A 2XGZA 2OSXA 2V5DA 2FB3A 4IIBA 5T8GA 1R2SA 1UJQA 4R53A 1YBQA 1R85A 2NQHA 1XIFA 1TCMA 3NQEA 4IXHA 2C7FA 1UMYA 4QXIA 3VX0A 1XCFA 5AC8A 1U33A 5FJIA 1TCDA 2A6LA 1S3HA 3GZAA 3L65A 1AQHA 1AJZA 5IDIA 3HTWA 2J24A 3TSBA 3UFYA 4YIWA 1EXPA 4FX6M 1JZ2A 2PDQA 3GBEA 4K8GA 4GYFA 2JIEA 2IKJA 5JMUA 5AHNA 5ABEA 1PIFA 2QCFA 1V03A 3RYSA 4UBPC 1BVWA 3UJFA 4OV9A 1YADA 4CD7A 1SM9A 3TR2A 4YL2A 4AHQA 3NL3A 3LOTA 3TW7A 4E0CA 1G1YA 2YCLA 1MRQA 4E38A 5IDZA 1W37A 4Q4QA 1TTJA 2VM8A 4NAFA 3PZIA 5DRIA 3QV6A 4HPNA 3C8NA 1VEPA 1VFLA 3XIMA 4PL2A 6TIMA 1KM6A 1LRQA 1ISWA 1KBIA 1QJWA 3GBDA 5A2BA 3N2CA 3OP2A 5D05A 5CEWA 3PTKA 3W7IA 4CEUC 3ORWA 1WAUA 1UR4A 4BFAA 1B3WA 4TVCA 5JIWA 1HJXA 1OWQA 3UR2A 1VFMA 5FF4A 1YTDA 3VKJA 2D20A 3C2OA 4NU7A 1PTAA 3KP0A 2CEQA 5DELA 3B9DA 3T81A 3AHTA 4OT7A 2DW7A 3G5EA 3UA3A 3VOCA 3IUIA 4EP8C 3VK5A 3W7DA 1V6WA 2EAWA 3MYOA 4G7EB 3WH5A 4D6CA 4AWTA 1TV3A 1WX0A 3EWCA 4B3ZA 1M53A 3WJYA 1U1HA 3BW4A 1DL3A 1YNQA 2IQDA 2BOFX 4O14A 1E3ZA 2J6XA 4YWIA 4HU8A 3NURA 1WZLA 2I16A 1TMHA 2GK1A 5BU9A 4JTEA 3U5YA 1JCTA 2ZDRA 3WJWA 4Q3MA 1X97A 4NT0A 1OIMA 4XAPA 1F76A 4PUWA 3FOKA 3F7JA 3PAJA 1QU4A 3PFRA 4A05A 3KX6A 4MDOA 2VI0A 3UPMA 2VD8A 2OQLA 4OV4A 1BWVA 2XTKA 3TQ0A 3PBUA 4FIRA 1EEXA 2C16A 4AXKA 3OYZA 3WQVA 3UG4A 3NPXA 1SFJA 3N19B 3CQKA 3S2CA 4ORIA 1UUOA 1XH1A 1S5NA 3AJXA 3IVSA 3W7MA 1UP0A 4LUJA 2ZIDA 1UOKA 4IM4A 3GQYA 4XKYB 5HWMA 3PZTA 4LS2A 4UOQA 1XLBA 4U3CA 2PC8A 1OY0A 1XXXA 1UH2A 1UKSA 1V51A 4ZQMA 2RGMA 3BAKA 4S3CA 2J8TA 3P84A 4M6QA 1W54A 4X3ZA 3EAUA 5BXRA 4M6PA 3CZ8A 3VD9A 1VEMA 1J96A 1RY0A 1W1IE 1DJHA 3E0VA 3H4GA 3DERA 4OOZA 3W82A 4AWEA 4ERIA 4LQ1A 1H7OA 3UR7A 2BVTA 4M82A 3IGUA 2HBXA 2XIQA 2IPGA 4LUTB 3GNNA 4KFPA 5DXYA 5DY3A 2I5GA 4DB7A 4JKKA 5FJOA 4E8CA 4H6EA 2V30A 1R3TA 3GZ3A 4JTFA 3TCEA 4S3FA 1BKHA 2D24A 3P8IA 1X8FA 1R47A 1EDGA 3VPLA 1UKPA 3WQ4A 1R5YA 4ICNA 1I2QA 4F2BA 1WXZA 3UBPC 1N8FA 2BOGX 4R88A 1A3XA 1GEQA 4GY0A 1V5XA 1VZWA 1XYZA 4O10A 3UZ5A 4JOMA 3TSMA 4REQB 5ECUA 3AOFA 3EA1A 1TRDA 4M6VA 3USZA 2G4JA 2PPGA 3WF0A 3VD5A 1T96A 3GUWA 4QE4A 5I06A 4O13A 1UZ1A 2XH0A 4HNCA 2XH2A 4QTGA 3QPYA 1NFPA 1J0HA 4MJMA 4KW2A 4RZ4A 1X39A 1US2A 3FXYA 1K7EA 2HDJA 1DJYA 1UIOA 2ZRWA 3H2OA 1XLJA 3W9ZA 4DXKA 5BNKA 5D09A 1H1ZA 1F4HA 1U1UA 3BWWA 1H41A 1YDYA 3USBA 3C3NA 4JTIA 1V3HA 4FNRA 2G4FA 2POZA 3MJMA 1RD5A 5CZ0A 5CKSA 1RD6A 1A53A 2BY0A 3PP7A 3MI3A 2WHJA 1NF7A 1UD3A 2ZBTA 3VIMA 4DVOA 3VMPA 2A7RA 3SRHA 5AHLA 1SO3A 2GFTA 1ZU8A 5FIPA 1C90A 2WQDA 4O0ZA 2FTPA 2Y8UA 1EYEA 4RDYA 2E1DA 2ZZ7A 3SO7A 2VZVA 3SUWA 4A8NA 1Q66A 3W1AA 1C3FA 4LC6A 1B9BA 4IP7A 2QCNA 4JBRA 4B3LA 4FXRA 4ONVA 3UZZA 2V6AA 3ARUA 3PG9A 5GJNA 2PURA 4H7VA 3U4FA 5I00A 1J01A 3KVMA 1LT7A 2FGBA 3ZR4A 4GYPC 3VM5A 1A80A 1WAWA 2V3EA 2WNZA 3F4WA 1B3XA 1REQA 5K3VA 1ZQ5A 5KEZA 1J2BA 1RPKA 4UOZA 3WL0A 5E0KA 4U10A 2O4MA 1KTCA 4S3KA 3IVTA 3W83A 1OK6A 5CZTA 4QSHA 3VOHA 2VCBA 4IMGA 1LBMA 3GR8A 2VWSA 5G4WA 3P5ZA 2ZZ6A 4L4MA 1KLZA 1YW1A 3ITXA 3LPFA 3B0XA 3DGRA 4O4WA 1TPUA 4MUPA 1FWGC 3P81A 1SPQA 1PBGA 2YW3A 3E74A 4K68A 1CIUA 1MUCA 2PDLA 5FJJA 5LGZA 1QO2A 3T4WA 1OG0A 3EB3A 4HZ6A 1HL8A 2I56A 4O52A 1W5QA 3AZRA 3HQOA 3VNKA 2GOKA 4LYRA 1IWAA 1N8IA 2POTA 4DJDD 3MYPA 4WDWA 1P6BA 2AMGA 2FQIA 5BWAA 4ZXOA 2YB4A 4MB4A 1C7TA 5CPOA 2HZGA 1OC6A 4NYUA 4H9ZA 2ALRA 9XIMA 1G6CA 4GC3A 3EWUA 3FFSA 4PB4A 2ZA2A 5C9ZA 3CQ0A 1XSKA 3U57A 4B2DD 3C2YA 1W3TA 3W70A 2NXHA 2FTWA 3E2RA 3L0GA 1JYXA 4H3DA 2OGJA 3I68A 4UUIA 2OKOA 4CU8A 1XINA 1XKYA 3GDMA 3ITCA 3B8DA 4IMAA 2AOSA 1CXLA 3I4KA 3WK1A 2IPJA 1R9XA 3H21A 3C0QA 3UY8A 1JPMA 3FCPA 4DJDC 4QEEA 1H1NA 3B97A 1JD7A 3ARVA 1PZ0A 2PAJA 4MWAB 3ONCA 2WB5A 1Q6LA