3H4GA

Structure of aldehyde reductase holoenzyme in complex with potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
324
structure length
320
Chain Sequence
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTRVPRDAGHPLYPFNDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase [NADP+]
publication title Structure of aldehyde reductase holoenzyme in complex with the potent aldose reductase inhibitor fidarestat: implications for inhibitor binding and selectivity
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 101
structure length 320
sequence length 324
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2009-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3h4gA00
3VXGA 1IEIA 3DN5A 3UZYA 2PDYA 3GHSA 2PDFA 1AH4A 4XAPA 2WZMA 3N6QA 3UGRA 1T41A 3CAVA 2IPGA 1PWLA 2VDGA 1Z8AA 2BP1A 3Q65A 1T40A 4PMJA 4PRTA 1AZ1A 2WZTA 2IPJA 2FZ9A 3T42A 1YNQA 3C3UA 2PZNA 2P5NA 4YVVA 3H4GA 2PDCA 4XZIA 3EB4A 3LENA 1M9HA 5M2FX 3CAQA 1SM9A 1RY0A 1OG6A 3LZ3A 2FZ8A 3BCJA 5LIYX 2PD9A 3BURA 5LIWX 3V35A 3LEPA 4WDTA 4WRHA 4DZ5A 1Z9AA 4H8NA 1EF3A 4IGSA 3WBXA 1YE4A 3DOPA 2NVCA 2ACUA 3UZWA 2FGBA 5HNTA 4JIHA 1MZRA 1IHIA 1UR3M 4L1WA 1MI3A 1ADSA 3R43A 4GQ0A 2PDHA 1RY8A 5AZ1A 1XGDA 1Z3NA 2ACQA 4ZFCA 2BGQA 3G1RA 1LWIA 2IPFA 4DBUA 2HVNA 1EL3A 3COTA 3V0SA 4JTAA 2DV0A 1VBJA 1S1RA 4XZMX 1GVEA 2PFHA 2HDJA 3UZXA 1X96A 3N2TA 3LD5A 5AZ0A 4Q7BA 3R94A 1PWMA 2ALRA 3MB9A 3GHTA 4I5XA 3LNMA 3V0TA 4GQGA 4XO7A 4YVXA 3H7UA 3R8GA 2HV5A 4JQ2A 2DUZA 4GABA 3U2CA 5DANA 1PZ0A 3QKZA 3RX4A 1ZUAX 2INEA 1PZ1A 3ONCA 4IJRA 3V0UA 4H7CA 2C91A 1AZ2A 3CASA 2PDNA 4LB3A 4LAZA 1EXBA 2PDLA 2IKHA 4FZIA 4L1XA 2PDJA 2HE8A 2PDXA 2R24A 2ISFA 2CLPA 4FALA 2F38A 2PDIA 3UP8A 4DBSA 2F2KA 2PDPA 1PYFA 3WBYA 3UWEA 2IQDA 5C7HA 3FX4A 2HE5A 3LN3A 4JTDA 3R6IA 3M4HA 1HW6A 2ACRA 4HBKA 2IQ0A 4QR6A 4WDWA 4JQAA 4JIIX 1X98A 4XK2A 2QXWA 3R8HA 4EXBA 2PDQA 1J96A 1QRQA 3CV6A 4FAMA 4QX4A 4XVDA 3RX3A 4WDXA 3FJNA 5KETA 1Q13A 5JH2A 4JTRA 3LQLA 2DUXA 3GHRA 3O3RA 3UG8A 1XJBA 2I17A 4LBSA 4JIRA 4XO6A 3M0IA 3ERPA 1AH0A 2I16A 2J8TA 4PR4A 3G5EA 1A80A 3WG6A 2ACSA 2HEJA 1YNPA 4AUBA 1AFSA 3P2VA 4YS1A 2PDKA 1S1PA 4JQ4A 2AGTA 4PUUA 4XZLX 3UYIA 3V36A 3CMFA 5LIXX 2INZA 2IPWA 1YE6A 3S3GA 3LZ5A 1EKOA 1FRBA 2NVDA 2FZBA 1X97A 2PD5A 4JQ3A 4Q3MA 2PF8A 2IKGA 4IJCA 1Q5MA 3LUTA 1ZGDA 4HMNA 4QXIA 4ICCX 3H7RA 2PDUA 1XF0A 4JTCA 1RALA 3F7JA 4DBWA 4YU1A 4FA3A 3Q67A 1ZQ5A 4F40A 1K8CA 4LB4A 4EXAA 2PDBA 5HA7A 3KRBA 4LAUA 1VP5A 3NTYA 4GIEA 1ZSXA 3D3FA 4LBRA 1R38A 3GHUA 3WBWA 5HNUA 2PEVA 4GA8A 4YVPA 1QWKA 3BUVA 4GACA 2PDGA 3LQGA 3EAUA 2R9RA 4XVEA 2IKIA 2PDMA 4JQ1A 4GCAA 4ASTA 2A79A 5JH1A 3B3DA 3BV7A 3CV7A 4XZNX 1MRQA 3GUGA 4G5DA 3M64A 3UZZA 1C9WA 4WDUA 4R9OA 3RX2A 4RPQA 1Z89A 3ONBA 3R58A 1S2CA 1JEZA 4JTQA 3UFYA 1AH3A 3MC5A 2BGSA 4OTKA 4WGHA 5LIKX 4XZHA 3R7MA 2HVOA 1LQAA 1S2AA 2IKJA 2PDWA 2FZDA 1HQTA 4MHBA 4PUWA 2FVLA 3EB3A 4QBXA 5LIUX 3LBOA 4NKCA 4WEVX 1US0A 3WCZA 2IS7A 4PRRA 3O0KA
chains in the Genus database with same CATH superfamily
3GHSA 1GYMA 2NUXA 2WM0A 4D1JA 4EAMA 1K6AA 5JBDA 5U7SA 2YXXA 3N13A 5RUBA 2RUSA 1EJXC 4I5RA 3ZLFA 4D6IA 1E56A 1QI5A 1V02A 1V7AA 2FB3A 3VKBA 2R82A 1XLAA 6XIMA 4XAYA 5AFDA 2VT0A 3LY0A 5GNZA 1YBQB 4XD3A 3EDDA 1D9EA 4PCSA 3TEVA 4ATLA 3SCPA 8RUCA 4DJFA 4JKKA 4R88A 2PDCA 3K13A 4CD4A 3UJSA 2OOGA 3T0BA 2G3NA 4GY1A 2V82A 2Z6IA 4JFTA 2EG8A 1JQVA 2DIEA 1GNXA 1N55A 4BEQA 3VUPA 1TJ1A 7XIMA 1W3HA 5FF0A 2PP3A 5CPOA 1UKQA 1PTDA 3STGA 3O6DA 2ZA1A 3M5VA 1W1YA 2JEPA 3QOMA 3KZSA 1CCWB 1UWRA 3OYXA 4LAMA 3UY8A 5EB8A 4GMEA 5LNWA 1OVDA 1G5AA 4QFUA 3ITCA 3N9KA 3UXKA 1N2VA 1S2VA 4G6CA 3TWBA 1R30A 1Q85A 3NJ3A 7A3HA 1UR2A 5G5IA 2XIQA 3A4XA 2ZQ0A 1TVLA 4YYCA 3GH7A 2CBJA 2VURA 3U0HA 3B0VC 1J6OA 3IJ6A 4H6QA 1XLKA 3NQAA 5PTDA 3CV2A 5A2CA 4K6AA 5F4XA 3MSYA 2DZTA 1VR6A 2JGQA 4QTGA 4AW7A 3EOSA 3O63A 2GJXA 1F6YA 2WB5A 3GXPA 3BWWA 4FSAA 3K4WA 3T2PA 1R46A 1TWSA 4LQ1A 1M1BA 4IMEA 2J78A 5CGQA 1ZJIA 3KW3A 3WQDA 1QNSA 1O1HA 5T9BG 3W76A 4W89A 5CH9A 3CB8A 4OUEA 4QQ3A 3DUGA 3FK4A 1C7TA 3ALFA 3AUJA 4GI4A 4LC6A 4PCPA 3F4NA 2DZWA 4GGHA 1M7XA 1ZCCA 3AZRA 1Q8AA 2R1KA 3H6OA 3WSUA 3QOKA 2O56A 4RXFA 1JI1A 2PE4A 1YLVA 1ZP3A 2VI0A 1YEYA 5DQPA 5EL1A 3MKCA 3R25A 5CXPA 1BYAA 5KITA 4MPKA 4HVXA 3UG4A 4Q8QA 1LYXA 3RILA 1Y8BA 5C7HA 4FOUA 1EFZA 1UB3A 2C1HA 5A6SA 4LNYA 1JD9A 5JBFA 4P8WA 3DG6A 2GJLA 4GH3A 1XFBA 4GG9A 2Q3RA 4WDWA 2I9UA 3LPFA 3PFMA 2NSOA 1P6WA 3B06A 2VC6A 4V33A 2XTKA 2J7HA 1M7PA 3R8HA 3L4ZA 3NOEA 2RGMA 3BOFA 4A2RA 1NIUA 1CBGA 3EA2A 4P7LA 3BMVA 1QPNA 3NQ8A 3B8TA 4IF2A 5JH2A 4KFPA 4C6BA 4AZGA 3G0XA 4DO5A 4H6EA 4H9ZA 4QNWA 3LLDA 3VCCA 2DT3A 5AYIA 3T07A 4H9TA 3VE9A 4HK5A 5AOUA 4BF5A 4PMDA 5BMWA 2BOGX 4QJ4B 3CTLA 4N9EA 4QDWA 2BXYA 4L6HA 3OTRA 2I1OA 3BGAA 3CAWA 4PBEA 1W9BM 3VMOA 2DIKA 5DCEA 4UTUA 3S3GA 4R7WA 3A64A 1ZU8A 2XDFA 3VD5A 2FZBA 4UFHA 3VNMA 4OECA 4NJIA 3G1DA 3GTHA 3TJIA 3DGBA 4OKDA 2HPIA 5H8UA 5HINA 5C71A 1JXKA 1HKKA 2E40A 1KA9F 1OIFA 5I2UA 1MEWA 1W2VA 1TIWA 1ZGDA 4L4MA 3M7SA 4XD6A 2BGNE 1LL4A 3BMXA 1IZCA 2R1PA 2WWCA 4E0CA 3I3EA 2HS6A 4MWAA 4NRRA 3BGJA 1CNVA 3W02A 2XVGA 3VM7A 1K9TA 2O55A 3AI0A 1VIZA 3TYDA 2WHMA 4Q4RA 3KWSA 3AJ7A 1SQ7A 4LFYA 3BG9A 4TXEA 3B0YA 4JL1A 5TD4A 5ECVA 3WF4A 4MNMA 4JN6A 2W4XA 2OZ0A 4R7OA 5FF4A 4AEOA 5CBIA 1ICSA 4W7VA 1KC7A 4R5EA 3D6NA 1ML1A 2IKIA 5C7VA 1B9BA 1W1TA 1SGJA 1UH4A 1ZAHA 1UHVA 3EX2A 2QUTA 3WELA 3T9PA 9XIAA 3WNMA 3ABQA 3T7VA 3QY7A 5CG0A 4C7DA 5JH1A 1R3VA 5DF0A 4CN4A 3L5AA 1BD0A 2J9YA 3PC0A 3BW3A 1J01A 5EMYA 2WKLA 3V16A 3TTYA 3TTOA 4A21A 2QDHA 5GVJA 1PL9A 1L9WA 4FI4A 5HWJA 3DFTA 5LA1A 3VGGA 3FYPA 1P4CA 2EG6A 2WSYA 4DJEC 4TX6A 3WQ5A 3GFZA 1DTUA 1TPWA 2QCDA 3VNIA 1G7VA 4MUPA 1GQNA 3ICJA 4JFWA 4AEFA 5EYWA 2Q8LA 3FXGA 2ZICA 3SY1A 2ZRWA 4S2BA 1YW1A 1UWSA 2IKJA 2PDWA 2ZTJA 2G97A 3KEHA 3EGJA 4B2DD 4MHBA 3RJYA 2FVLA 4C90A 1ZL1A 3AIVA 3LBOA 1H60A 5AN7A 2WVVA 4LANA 3LHVA 1E3ZA 2IMRA 4B92A 4GIRA 4WSHA 1QPQA 3EWZA 3TX9A 2P8BA 1RK6A 2A3CA 5DXYA 3C2YA 3RRXA 2TPSA 3A3XA 4H9YA 1T41A 4NXKA 4DUOA 5G4HC 2BP1A 1O6IA 3U5YA 5I5RA 3AXMA 3NIYA 1D3GA 3F2CA 4CD8A 2RDWA 4S23A 3MI3A 1XC6A 5DEZA 1FWJC 4IOTA 4HA4A 2WM1A 1JCJA 5E1QA 3SJ3A 5LYRA 1W56A 2JK2A 4EF9A 3WQ8A 1G4PA 1LBLA 2EF9A 3SO7A 1VRDA 1TYGA 3BAJA 1DIDA 2FZ8A 4R34A 5G2WA 2VZTA 1OM0A 3V35A 3AHXA 1KR0A 3TE9A 1FWWA 2DW6A 3ITTA 4WRHA 4QE1A 4QSFA 1JZ6A 2E77A 5A2AA 3CQ0A 4IGSA 2REQA 1ENUA 1GOXA 2E3ZA 1B5TA 3B0PA 3UZWA 1REQA 2JALA 1JNDA 1P0BA 2DQWA 2Q3OA 3IVSA 1XLBA 5LNSA 1AG1O 3IARA 2JFEX 1KKOA 3L12A 3OODA 3ZFHA 4KH2A 1AD4A 1BYDA 3BW2A 4JN8A 1A3HA 1KFCA 2ZZ5A 4F3HA 1SR0A 1H62A 4N0RA 4J2MA 1XQKA 1NH6A 3U57A 1VYSX 1HL9A 3QZ6A 2YBTA 3MWAA 2FTYA 1P6BA 3S5ZA 1L8PA 4Q7BA 2XVKA 2G4JA 2OWXA 3W3OA 1NDYA 4W88A 2W3ZA 1MSSA 4GBDA 3RYSA 2OGYA 2J8FA 4MJ2A 4C60A 1EO7A 4PMQA 4JTJA 5FOOA 3LHYA 2VEPA 1UZ1A 1WZMA 2P53A 3CIVA 4AXKA 5FF7A 4F0KA 2Z2AA 5J04A 3PG8A 3R1ZA 3DENA 3DAQA 2HVMA 1V08A 3T8QA 4IJRA 3GR7A 4H83A 3GB6A 3W82A 4DM2A 1LCOA 5CQ1A 1LRTA 2J66A 1EZ2A 4DXXA 3AIQA 3ITXA 4WK9A 1KD0A 1A53A 2WNQA 3MUAA 4FZIA 2PDJA 4DBDA 1UUOA 4E2DA 3WKZA 3BDKA 3IGUA 2PDIA 1OX4A 3MCMA 2QJMA 3N1AA 3S1VA 3L23A 3VPLA 4Z2GA 5AECA 2ICSA 4L6DA 4YL2A 1PAMA 1FCQA 4LYRA 4FXJA 3WQVA 2GUYA 1QU4A 3W6MA 3R6IA 1HW6A 1DWHM 4HZ8A 5CKSA 4C6EA 1Z44A 3NDZA 4JQAA 4K1GA 3WBAA 1HX0A 1RVKA 3DYMA 3L0KA 4XK2A 3WQWA 2ZUNA 3KCJA 3THDA 2X40A 4PSRA 3M0HA 3RPTA 4PODA 4WDXA 2A3HA 3FJNA 3UU0A 3WJYA 3WK1A 4K38A 1O94A 5AHFA 1XUUA 3GHRA 1XIJA 1RJQA 3RF9A 1TR1A 4W7WA 3UBPC 1PBGA 2DZPA 3EPMA 2BLEA 3M0IA 4GVFA 4B15A 1T96A 3PULA 4W5UA 3CQJA 2WANA 1W1VA 3KAOA 1EP1A 1YNPA 1QW7A 3HMCA 1TV2A 4HZ6A 1KV8A 1YDNA 4OBTA 2F84A 9CGTA 4YLWA 1MXGA 4E38A 3LYEA 4A8IA 4I9JA 1JIBA 4ORMA 4PMUA 3HZ3A 3P0XA 3QY8A 1KR1A 1PKNA 3RLUA 3CXOA 3S8HA 1MZHA 3EWDA 2PD5A 2WBGA 2B7NA 1RSCA 1WYIA 1JJKA 5IXEA 3OG2A 4IJCA 4KF1A 2VZUA 9XIMA 2VELA 1YKWA 2P76A 4NSBA 1O5QA 2OXNA 3G6MA 4LALA 3F7JA 4X22A 1X7FA 3QFEA 2VKZG 3POHA 4X63A 5DX7A 4K8EA 4DN1A 2FPTA 4BQ2A 1TO3A 1OY0A 1EBGA 4L64A 4TIMA 3APTA 4MB3A 4MYAA 1JYXA 2RH9A 4LBRA 3GHUA 1XDMA 1F6KA 1YDVA 3ARPA 5D2XA 4K36A 2FQIA 4EACA 2OVLA 2BVTA 3A21A 1AMYA 1CXHA 3WX7A 4B9YA 1X1OA 5D32A 4LX4A 1KLYA 3QTGA 3E0LA 4GISA 1EQCA 4M80A 3W24A 4ZMGA 1AJ0A 1RH9A 4UTHA 3GR8A 2Q8XA 4ML4A 3LI1A 4AD5A 3LHUA 1GZ1A 4GLEA 3JZUA 2V9DA 3W1UA 4KCTA 3VILA 3LS9A 4E8DA 1UJPA 4GI9A 2PTDA 1PKLA 4ZCWA 5A69A 3CV7A 4TVUA 1MRQA 4DX3A 3W7PA 4AXNA 1REQB 1N8IA 1GVYA 3VIIA 1Y65A 3KRZA 3S9ZA 3DESA 4M81A 2PS2A 1E0TA 3IPWA 3BXWA 3VIJA 5JVLA 4Z1AA 6PTDA 1JEZA 3QV6A 2OT0A 3PZMA 4PL2A 3F4DA 1Q65A 2BGSA 3CHVA 2FH6A 3LXCA 1NQ6A 4L61A 3RO8A 2EPKX 4AIBA 1JCNA 1YXDA 5AKQA 2FPVA 3ZO9A 3AC0A 3EXRA 2OG9A 4PMRA 1R5YA 1U5VA 1OD8A 2WMFA 1E15A 4Q4QA 3I4KA 5FESA 3C0LA 1M01A 1EP3A 3ARSA 2GWGA 4X0VA 5HAOA 4LV9A 2YW4A 1XG4A 5AVNA 3M41A 3TR9A 3OLDA 2TAAA 2GWNA 4CGTA 1HUVA 3O15A 3N6QA 3B8SA 5MHBA 3W00A 3SUUA 3GH5A 1GQKA 4DQWA 4PTVA 3L5LA 1GW9A 4NYUA 3EYPA 2HZGA 2FTPA 1H7OA 3PM6A 3KFTA 4HU3A 1W37A 4Q32A 4GOAA 4S2CA 4LVAA 3V1HA 4S3FA 5D2VA 3QYQA 3LBMA 2ZUTA 3DFSA 3VU2A 1QDSA 4G9PA 4ZTXA 4ZOCA 1BRLB 1ZJBA 3Q45A 4OOZA 1E9ZB 1GVOA 4HNTA 2FGLA 4TX8A 4IUOA 4ZSUA 3TXZA 3HM7A 1E0UA 4GJ1A 2D23A 1MI3A 1TPB1 4CCZA 2W61A 1ZJHA 1RUSA 2PDHA 3G1XA 2ACQA 2E1DA 3VZYA 2WVSA 3HQ1A 4CUCA 4D8AA 3P80A 2X16A 3UZJA 3O6CA 3V4BA 5C9XA 2ABBA 3BLFA 4RDZA 5BU9A 1GKQA 4B2DA 2HXUA 4O1BA 1MUMA 3S46A 1XH0A 1Q7QA 2GDUA 2G95A 4O8RA 3YPIA 1PV8A 2VWSA 4JQ2A 2VRKA 1HFBA 2G96A 2RJGA 3BQ6A 2HPMA 2ZADA 4MB1A 3TR2A 3MANA 1JFXA 1FWGC 3WD4A 2A3BA 3DX5A 4HSOA 3ARXA 2Z24A 3TN6A 1E6NA 1MVYA 4R9XA 2WMIA 2E5BA 4CEUC 4F2BA 1A0CA 4QJ5B 1EXBA 4XD4A 1MFUA 5F1VA 2QCMA 1KCLA 2VFFA 1D7KA 3GG7A 4JTIA 3FVMA 2V0TA 1PYFA 3U9IA 1K4HA 2VCAA 1WB0A 1LRNA 3TH6A 4PMVA 2C14A 1NP2A 1CGXA 2ZX7A 1U30A 4DVOA 1FHUA 3FLUA 6A3HA 5TIMA 1JPHA 1ZHAA 4O15A 3C5QA 4AB4A 1T8XA 4XZWA 5M5DA 5EFFA 1XRFA 1L6WA 3WQCA 4KEMA 5BOOA 4G56A 3PPFA 4H01A 3GO2A 3GYCA 1UR1A 1RJRA 1P43A 1AJZA 2C0AA 5H91A 5M3WA 3OJGA 1Y0EA 4M6UA 1TX2A 7TIMA 3GDTA 4JOMA 2HROA 4LBSA 3HQOA 4M1BA 3VD4A 4C7GA 1V3LA 4O18A 3B05A 1FWTA 1PX4A 5C2CA 3R4IA 3UWWA 3TWAA 3UGVA 2CHRA 5GPRA 4DLMA 1AW5A 1Q4WA 4AUBA 1GORA 2I5IA 4NL1A 4ATWA 4DHGA 3IUHA 3NM3A 1ZBWA 4ZQCA 3R10A 5IHSA 5FF3A 4IQDA 3BE7A 3NQEA 1QI4A 5FEWA 1EKOA 5E09A 4V28A 1UPMB 1UBSA 1F3WA 1XGEA 2G0WA 1R7AA 1SJBA 5I3KA 4S1FA 1F6PA 2CZEA 4AVFA 2QV4A 3QJAA 1XS2A 5A5WA 3N6HA 2QR6A 1UROA 3N19B 4JHOA 3E0IA 3S4TA 3VDHA 1POKA 4XUGA 4A29A 1HKVA 1RLCL 4LV4A 5F4SA 5I78A 4O57A 3WENA 3ARYA 4LY8A 5HA7A 2JKAA 2WV8A 1TUXA 5A1AA 1ME8A 4UNLA 5EMUA 1JCTA 3BVJA 3GVQA 1FH7A 4EWJA 4F9JA 3NDYA 3BJFA 1KFEA 3W7RA 3UEQA 3TCEA 3BUVA 3H53A 3JR2A 3OQ8A 4N4PA 1F5ZA 3NPUA 2Y62A 1TA3A 2BODX 1M3UA 1MW1A 1J0YA 1XW8A 1S5VA 3LDVA 3UPMA 1YPFA 5REQB 1SFJA 3OU8A 3EA1A 4KPLA 1UD2A 5FJIA 2I5QA 1JUBA 1X8FA 3TOPA 3CYJA 1H09A 4Q8MA 4AX7A 1X6LA 5E93A 3M64A 3KHJA 2B4GA 2YDSA 2OU4A 4DJED 3CPUA 3A47A 4WXYA 3TN5A 2UY5A 4H7VA 1FH8A 1W3JA 1IE7C 4DNMA 5FL1A 1W9UA 1VYRA 4NJHA 2VGIA 4LSBA 4LCRA 2HCVA 1HJQA 1S46A 4AH7A 3R7MA 3D3AA 4O10A 1E4IA 5HMEA 1VQTA 3J7HA 1ZBCA 4D8ZA 1E6RA 2NVAA 3AXHA 1PDYA 1PS9A 1JQXA 2WXDM 4K8HA 4W9TA 2CHNA 5LIUX 2ZWZA 3VE7A 2O92A 3MP5A 3WLLA 2LLEA 2DVXA 3CWHA 5BWAA 3U2EA 1PXGA 1DXIA 3V5OA 2EO7A 2NUYA 4LNCA 1J12A 1W31A 3ZT7A 2E9MA 2DH2A 1M03A 3KXQA 1I9CB 1EHAA 1TWWA 4WIWA 3GBDA 2WMIB 1EJSC 3EMZA 4PMJA 3FEMA 2C19A 2Y7DA 1RD6A 4X61A 4J4KA 5KTLA 3MO7A 4BK9A 3EMCA 3T42A 1R3WA 2JE8A 4KESA 4PUDA 4X2PA 3UZ5A 4IXHA 2CCRA 4FXFA 5H1WA 3IWPA 3DFHA 3GDRA 1UR9A 4GHRA 2DSWA 1E5JA 2EKCA 1SMDA 1V7YA 1F8MA 1QJWA 1XC4A 4AWEA 2DZAA 5DT7A 1CGTA 3CZKA 3DYOA 1EBHA 4JTSA 3W7GA 4L1WA 2EQDA 3B8UA 3LPPA 2ZRYA 3KOFA 5AZ1A 1VF8A 1XGDA 1WXZA 2E5CA 5EA9A 1QW8A 1R9ZA 1Q2RA 5LGXA 2DZSA 2OB3A 1EL3A 4PUJA 4UTTC 3BAYA 3ITYA 1AL7A 1VBJA 2NXHA 3N18A 4Q8PA 1V6WA 2X1SA 4ZQMA 3EOEA 1X6UA 4DB7A 1RLDA 2CLMA 2OR2A 3N2TA 1BXCA 5AVHA 3SW6A 1WDPA 2PLKA 2X1UA 4BWLC 3N9SA 4M1RA 1BF2A 3H7UA 1QXLA 4UB9A 1EQPA 5ABGA 2G4FA 4J3VA 2DZVA 2OOFA 4H41A 3KLLA 5EMKA 2DUZA 3RUBL 4DAFA 5HJLA 1B2YA 5CC5A 3GNDA 2JQXA 3I4EA 1K77A 2CXGA 2QPXA 1OFAA 4MTVA 1RAKA 4G7EA 1H5VA 1MYRA 1XLEA 4H7CA 1QPOA 3CASA 3QSTA 1CGUA 1FWEC 4HYRA 2PWEA 4DY1A 3U8GA 4EIVA 1A3XA 3TYEA 2H3DA 4XQ6A 3GAYA 4QG9A 3RMEA 3SUWA 4NYYA 2XGBA 5HMSA 4PGLA 4FALA 1FH9A 2YSWA 1S3TC 4PTMA 4EK7A 4PYSA 4UTJA 2BOFX 3W83A 2A6LA 4ZGYA 1L6FA 4LUTA 2VGFA 1L8NA 3E0FA 1G6CA 1NSJA 3VGEA 3B8VA 4XIMA 5IM51 1MDRA 4LTSA 4JYDA 1US2A 1CIUA 2E7FA 3K8KA 1VFMA 4BI6A 4OFCA 1ICQA 3O1NA 1E0XA 2WNWA 4KEVA 3GFYA 1NJJA 1CGVA 2QXWA 5CSSA 3W25A 3TCSA 3BW4A 4DRSA 4DUVA 3UPBA 2Z28A 3ATYA 2E0PA 2P0IA 3RX3A 2XINA 1FDZA 2V68A 1XJBA 3MVIA 2PP0A 1XDLA 4D6CA 4F4RA 1YTEA 4ZB0A 2OEKA 1SO4A 3WLTA 5E0KA 3H2CA 3G5EA 4JDYA 4MF4A 4IX2A 4Q4SA 3RRAA 3C2FA 4I6KA 1KBBA 1LLOA 3H2EA 1LQ0A 5LXXA 4D71A 2OGJA 3JZEA 1X7IA 1JDDA 1QNPA 3ECQA 2CLIA 3W70A 1WO2A 1W0MA 3MCOA 2NVDA 1K4GA 2DT1A 3GVRA 5BRPA 3T2QA 4ROPA 3A12A 1PX3A 4ADUA 1RBLA 4FNQA 3RM4A 1F7BA 3UG5A 1U1HA 3BLOA 4URIA 2WZEA 4HU4A 3DIPA 5FAGA 3ZQ9A 1Z42A 4GINA 3MTWA 2AAAA 4C6IA 3IJ8A 1HJVA 1J11A 5LNVA 3W1QA 1NDVA 5CC7A 3E5PA 3FKKA 1N7KA 3WL0A 4M29A 2Y7EA 3AMKA 4QAWA 1FOBA 2PB1A 4JCLA 2EEXA 4QG6A 3IGSA 2XFWA 5MKGA 4IQLA 2D3NA 3BSMA 3UWZA 1R3TA 1YHTA 3RU6A 1GT8A 1E5NA 2E68A 2WZHA 1L6SA 4E4FA 2BY1A 1WP6A 5J8LA 2QMKA 2JKPA 1W17A 8A3HA 1Q7ZA 2Q8ZA 2ZDSA 3W84A 3W01A 3KE0A 2VNCA 1TRDA 1KCKA 1AQFA 4GD0A 1P7TA 2W79A 2X8RA 3B9NA 1XL9A 3S5OA 5T91A 4JY8A 1V3IA 4CQAA 1S2CA 1JCMP 1ZB5A 3SZ8A 1UR8A 3UWYA 4WKFA 4QIUA 4P5UA 3MI6A 4EE9A 1FWIC 4XKYA 4PUEA 2CBVA 1IEQA 3GH4A 4L65A 3SCSA 5LIKX 1RP9A 4EKJA 3GD6A 4O17A 3PZQA 5AHMA 1LF1A 1JDFA 2C13A 3QGVA 3V3WA 4Z2JA 4XZ9A 1TQJA 5A6KA 1IWPA 5DMLA 4PC8A 1OINA 1MDLA 2FMNA 3W1MA 4Q6XA 2NSXA 3WK0A 3RM8A 1OFDA 2ZUWA 4J3SA 3VNLA 3NZGA 1PJ9A 4RDYA 2QIIA 1TVPA 1XHGA 3E49A 2YA0A 3GE7A 3WQPA 3AWNA 3IRSA 4FOKA 1V02E 9RUBA 3FFSA 2X2YA 1XCXA 3DC8A 2XN0A 1DTNA 4PRTA 4FX6M 3RK8A 3QXBA 3PZ9A 3W07A 4AHOA 2HNHA 3C61A 1V03A 2CETA 3CZEA 4CQ8A 3H12A 1S3HA 1Q7MA 4MVAA 1VFSA 4HPGA 2WMGA 3LSBA 2XVPA 4H6RA 4YWSA 1KTBA 4R27A 4IISA 4IUGA 3C86A 3BCJA 2D20A 2FTWA 3B40A 4GUGA 1YIXA 2BVYA 1ISYA 4RZBA 4ZEPA 8XIAA 1R3YA 4Z1DA 1F07A 3NQ2A 4D6HA 1QATA 4J3XA 4DZ5A 4H8NA 6REQB 1ME7A 3BSHA 3HPSA 4HYWA 1IHIA 4G8TA 2PC8A 2QGYA 2HTMA 3QR3A 5ABHA 4P7QA 3MDUA 1ZS2A 4DJEA 4NXSA 3A23A 4ZENA 4ZFCA 5AC6A 2PF0A 3AQUA 3VKAA 2FDMA 1XLHA 3CZJA 2XG9A 2XM1A 3ANYA 3QSRA 4HMCA 5CPLA 1PO9A 3HV8A 3MJYA 1K9EA 4GC4A 3KVJA 4WOZA 4F48A 3MB9A 1TWZA 1OF8A 2OQHA 1FKXA 3GHTA 1HKJA 4I5XA 3GQYA 4GQGA 4PMZA 1TCDA 4JAWA 4HA3A 4J40A 2HV5A 3ENLA 3H2NA 4JYEA 2GSEA 4QAIA 2VJXA 1XIFA 4EAYA 2AL1A 4GX9A 3TMLA 3AO0A 5JMUA 4WVXA 2PMQA 3F03K 4H19A 4IIHA 3MA8A 2OX1A 3DHUA 3N15A 2PDNA 3T2OA 2GSHA 1R0MA 1OEPA 4H3DA 3M0ZA 2ZA3A 4E8CA 2HRWA 2OO6A 2VZVA 2PC4A 5H6HA 2DORA 1L6GA 2F38A 1SSGA 4PRWA 3AIBA 3TQKA 1K9FA 1UCWA 5I09A 3WBYA 5BROA 1LLZA 3AMDA 1CB7B 1Y7VA 1AK5A 4L7ZA 4H8UA 1KM2A 4RE2A 6ALDA 1V93A 2X1IA 3SEPA 2XISA 3LG3A 4IM4A 1YXCA 1KWKA 1LG1A 4JXCA 3ZVIA 2VC9A 7CGTA 2F9RA 4K2SA 3WQGA 3G22A 1KGUA 1DE6A 1AW2A 1P7TB 4YTRA 4IMFA 3FA3A 5LA2A 3UG8A 2V30A 1PZ2A 2G37A 1PUDA 1FDYA 4XO6A 3UXAA 2CPUA 2QUNA 1TPH1 3W88A 4W8BA 3ERPA 4HK6A 2X30A 4B5TA 1A47A 3CQKA 1OQFA 1XLGA 3SRDA 2Z1KA 1VFHA 1KRAC 5IRPA 1JDEA 5AHLA 3QW4B 4O12A 1HJWA 1S1PA 1V6XA 1ZJAA 1GHSA 2WC4A 4YXGA 3TUUA 4HJFA 4BEUA 1CI1A 1H51A 1K8YA 4GO9A 3PAOA 4KIEA 1FWSA 5CZJA 1THFD 2INZA 3W0KA 2OYLA 5ECUA 3WDHA 1VC4A 4L1GA 1E3XA 1X97A 4O19A 3RDKA 1DKWA 1MXSA 4N02A 2WC3A 4RKAA 3L0GA 1EPVA 3VKJA 2Z7GA 4YCPA 4Y9PA 1JULA 2ZKMX 5KINA 1SW0A 3OGSA 4AZCA 4GXPA 4MWAE 3G8EA 1K3UA 1UUMA 4UTKA 2GZXA 4HMNA 4B4FA 4QXIA 4F79A 2D73A 4YMZA 1JGIA 2D22A 4C91A 2X7VA 4FXSA 2GOUA 3WQ6A 1YTKA 3RHGA 4GY7A 3CQIA 3NSNA 4I6VA 2G50A 4RNIA 1FHLA 5HPCA 1WZLA 4A3HA 2NW0A 3GBEA 1B54A 4HCHA 3IJ9A 4O1EA 1DJXA 2RHGA 3KL5A 2VMFA 3T0TA 5CZSA 2PUZA 4M0XA 2B7PA 1KKRA 3WLMA 1KRCC 2EKGA 4KWWA 2ZX5A 2FHFA 3AMCA 5IFTA 4C6LA 3SCOA 4JQ1A 2D2JA 4ASTA 2A79A 1BF6A 3O06A 3P5ZA 3G24A 1UW9A 5JBEA 3IEBA 3NQBA 2XH4A 3P67A 3VIKA 3G1FA 5TNVA 3BC9A 3GIPA 1Q6LA 1K8XA 3GNNA 4H7ZA 4BQ4A 3PSWA 2XFYA 1ESWA 5KZDA 1VPXA 3ZXWA 1EGZA 3R58A 2WO5A 5CC3A 1BGGA 3GG1A 4NX0A 1N82A 2XIJA 4OTKA 3WUBA 2Y88A 4NASA 4WGHA 1KXQA 4UOZA 4M3PA 3A13A 2CLOA 1UA3A 4B5VA 3TTQA 2PWFA 4UR9A 2X0YA 1TJ2A 1LRQA 3DYPA 4G7FA 4IPNB 1HQTA 2POZA 2VX4A 4OZOA 1OFEA 1QOQA 1J5SA 4HP5A 3PB0A 2PBOA 4S39A 1MW3A 5EBAA 1GGOA 2PPGA 4JTTA 4H00A 3CH9A 1F61A 4KWUA 5SWUA 4KBXA 2IW0A 3AYVA 1WDDA 4GI6A 4LF1A 1GVFA 3IRDA 5J5DA 1LTDA 2GGJA 1UP3A 3MBDA 1XRVA 1G9HA 1TWDA 2JBMA 5CZ0A 3JU2A 1UD8A 3HA1A 4F0SA 2GUBA 5FJPA 1C8XA 1TJPA 3EWYA 1I4NA 2Z2UA 5D4YA 3IJDA 4F2TA 3L4XA 2PD9A 3KBVA 4J27A 4M82A 4E3TA 4JN7A 1SMAA 4D6GA 3WLNA 4L9ZA 3KOWA 3CS2A 5D2WA 4WDTA 2V2CA 1S5WA 3PK7A 5AYXA 3STPA 1OABA 1YE4A 3DOPA 5HNTA 2VVSA 3C56A 2HNEA 3ZMRA 1DJIA 2V5BA 2VDIA 1ODUA 3ITVA 1NFGA 1SVDA 3UXIA 4UCGA 2PGEA 3LX9A 1B4KA 1GOMA 1K02A 2BG5A 4IICA 1E6XM 3TROA 4HJWA 3CIWA 1GQLA 3OLIA 1K70A 2ZZ1A 4UQCA 5BXTA 2QJIA 5EFDA 3CZLA 2Y5SA 3R0KA 1C8VA 4A2SA 4AY7A 1NU5A 3NSMA 1C93A 1R9XA 2CERA 3QZAA 1SFLA 1XSKA 5I00A 2H3BA 4LYQA 3V0TA 3H4XA 1PKYA 1ECEA 2PGFA 2VFGA 1JZ5A 2TODA 4HPNA 3EX1A 3T40A 5BWFA 2YCIX 5E70A 5TF0A 2YDQA 1WDQA 2DPEA 3I3DA 3MP4A 5FACA 4HNCA 1UC5A 3QPZA 4IIDA 1XCWA 1OB0A 1XSIA 4QE5A 6XIAA 1W5QA 1FHVA 2ON3A 2QVHA 3S6DA 5LKYA 1DYSA 4YHEA 4AZCB 3KP1A 5IHRA 3QC3A 4NT0A 4PH6A 3S5YA 1SO5A 3LTSA 3Q94A 3WQOA 1EGVA 4G2DA 6CGTA 3L67A 1FCBA 5GQBA 1XM3A 3UP8A 4MNLA 2C6QA 2PDPA 4B90A 4QGCA 2O4MA 3F5LA 5C55A 2E8ZA 1OZMA 1ZALA 4CNSA 2Z1XA 2A5HA 4OBRA 1QNVA 3A4AA 1DJQA 3GC5A 3VNZA 4GZEA 2CLEA 2VOMA 2ZA2A 4NY2A 3AZSA 1GQIA 4DJFD 1HIZA 4CQBA 1L2QA 2A1YA 3U48A 1ALDA 2HWGA 4JTGA 4G1KA 3CV6A 4FAMA 4GNJA 3TJ4A 4IPLA 4GI8A 4MJMA 2CHOA 2XGIA 2YDAA 4E4UA 2TYSA 3BJTA 4O16A 1E0WA 1ZP4A 2QCHA 4E2VA 1BHGA 2HK1A 3PS7A 4JCMA 3FY1A 1VFTA 5I3IA 2CIPA 3PPGA 5EGRA 5H8MA 4GVHA 1DWGM 1JF6A 4GGBA 1FVPA 3T4WA 2R94A 4RL3A 2ADAA 4NZFA 4U31A 3B8WA 3AHZA 3NQDA 1I2QA 3W27A 2VEKA 3W2KA 4JGDA 1SO6A 3I65A 1KBKA 5HANA 2QCFA 1XQLA 3CMFA 4LUYA 2ZDRA 1SZGA 4GYKA 3F4CA 4BCEA 4AY8A 1VLIA 2OLSA 1DJWA 2GVLA 3NXLA 3MYPA 4DJDD 4QRNA 1Q5MA 3OZYA 2UV8G 1FUYA 4IP7A 3OA3A 1GOKA 5D02A 1P0NA 2DVUA 3N17A 2VZOA 2V69A 4NF7A 1KO0A 1RALA 3B9AA 1DWIM 1SW7A 3WNPA 5I6SA 2PA6A 1ITXA 4R7JA 5A2BA 3AXKA 1BG4A 2GQAA 4UQAA 3KL3A 1BLIA 5A8NA 2HBXA 4IMGA 1W9VA 2DT2A 2OX4A 1CENA 1TV3A 2QS8A 3WBWA 1OJXA 4MDPA 3M0VA 4YVPA 4HOZA 2DVTA 1XBVA 1A4MA 2JF6A 2VWTA 2YW3A 3S0CA 3G8RA 3NO5A 4FPSA 5CPQA 1XWYA 3LMYA 3NURA 3HGSA 1EGMA 4PB4A 3HBLA 1NY1A 3THCA 3MMUA 4LOCA 3DH7A 3W73A 4C6QA 1TZ9A 4UZSA 1FY6A 4GE8A 1VS1A 1FWAC 3PG9A 3W1AA 3DHDA 3ABXA 3VIMA 2ZRZA 1E1FA 3SQLA 3TJXA 1JUKA 1V8EA 2BASA 3CT7A 4WKAA 3LU2A 1AH3A 2WHKA 3SQMA 4KFNA 3WNNA 3GG0A 3DI0A 3IJQA 5F1UA 4K7YA 1LBFA 2VXNA 4Z2HA 3RCNA 4XZHA 4ZTYA 3E2QA 3SQSA 4J3UA 2OZTA 7PTDA 2VZSA 5T8GA 3KUMA 3GKAA 1CLKA 1G4TA 5K9CA 1QR7A 2PRLA 1PTAA 4AYSA 3TTSA 3UQNA 2X42A 1OCQA 2I7GA 3WEMA 1VHCA 2P3EA 2PDFA 3WNKA 4MADA 1SW3A 3L7RA 3WL1A 2DH3A 3BSGA 3TMQA 1WDWA 2GVJA 1E71M 3LB0A 3CB3A 3CWOX 3RR1A 5FJJA 5XIAA 5HQEA 3LNPA 1S5TA 2Z26A 3VNKA 4UR7A 3H26A 2H8XA 1LWJA 4TU1A 3KRUA 4CD6A 3UWUA 3UR8A 5D2TA 1GTHA 3OA5A 1OGBA 1GQJA 1UQZA 2YGYA 1J0IA 1NEYA 1QPRA 2VC7A 4D72A 5LIYX 2CWNA 4L9XA 1B1YA 2WKGA 4ICMA 1XYLA 3NSXA 4E2BA 4IG2A 2QMJA 1QTWA 3PSVA 1BSIA 4O4VA 3ZJ7A 1EF3A 4ZO6A 2P88A 4JIHA 1SJAA 3UF9A 2ZXQA 5DRIA 4OWGA 1SYTA 4XBJA 3T1GA 3FIGA 4ACYA 1E70M 2NUWA 1PX8A 5GJNA 3WMCA 2J79A 3NOYA 4PULA 5I79A 3OQEA 2GDQA 4IX0A 3CL6A 4MFEA 4Z0JA 4BQ5A 3ARWA 3F4WA 2HVNA 4JX6A 4XZMX 2XM2A 3MDWA 3GVVA 4BQ3A 2CYGA 3GG8A 3IV3A 4X3ZA 2HXTA 1XIEA 5BW6A 4UIOA 4DF0A 4X60A 1JZ2A 1H7WA 1ONEA 2VYOA 3URBA 2SFPA 4EANA 4BY3A 2B81A 3EWXA 1WXYA 3E2SA 5HMFA 3DZ1A 3LM7A 3W2MA 4V1YA 4YPJA 2Y24A 1UP2A 3FA4A 3QLDA 4OGZA 3ALGA 4O8AA 5HOSA 2YYUA 4QISA 1O1ZA 2VUNA 4IGMA 3MT1A 3EDEA 3ONCA 4DUWA 4WJXA 5FEXA 4BR1A 2EJAA 2PWGA 5LZLA 3EMQA 1AZ2A 2VR4A 3V5CA 4U5KA 1TV4A 3MU7A 4L1XA 1R7OA 3RN6A 3ZT6A 3P82A 2PDXA 1FWDC 1EWEA 1GPWA 4BF9A 4ZZ9A 1HG3A 2EBNA 5F2GA 3IVUA 5K4XA 4AD2A 3BLLA 3UY7A 3VMPA 3LBCA 4PBFA 2FPYA 4QCEA 3W1LA 3IUIA 5K4ZA 5E9AA 2FYMA 3GNRA 1AUSL 1NF0A 2VR2A 4GUHA 3FX4A 4Y8FA 1TKKA 1HVXA 1EC9A 2HE5A 4ZBCA 1CW2A 1SSDA 5HATA 4PFHA 5C0QA 3GKFA 2BY0A 5F7UA 1FP9A 5HUPA 4CD7A 4RNJA 3RITA 2IQ0A 2OLHA 2R6OA 4FEZA 3NXFA 3U3HA 3LTYA 3A9BA 2WHLA 1C91A 1M65A 4EXBA 5C2GA 3M46A 1Q13A 4O14A 2E4TA 4LUSA 4B3LA 2GJNA 2I17A 3QEZA 4HSHA 2Z1VA 3LK6A 2A3EA 4IH3A 4IL0A 4JBRA 3TYBA 2ZUUA 3W7DA 2FVMA 2J4GA 2PTZA 2HEJA 1BXNA 2ZVRA 3IVTA 2QYGA 1WV2A 3OLGA 3CEPA 2EHHA 3VC5A 1J0HA 1JGMA 1W3LA 1R3SA 5BU6A 3TXVA 3ZR4A 2YCJA 3OZOA 3MHGA 3AS3A 5D9PA 3GTFA 2XIIA 2CBUA 2D0HA 1E6QM 4P7NA 3FJ6A 5DBTA 2A2IA 3V5FA 3VUSA 4ML9A 4GY0A 4N42A 1X8CA 3STEA 5FJOA 3GVWA 3UCDA 2V5DA 3P5YA 4A3RA 1RV8A 1KBIA 2WJFA 4MLRA 1N8FA 3T81A 3HPZA 2GVEA 3RLGA 1EA9C 1XI3A 3QPYA 4ACZB 4PUMA 2GJPA 1IZKA 4JYFA 3SDOA 3CV1A 2WSPA 1U1JA 1BVNP 1OFBA 3WZ0E 4Z1BA 4Q33A 1E55A 4H1ZA 4HOXA 5JU6A 2EPHA 2BVWA 3B8DA 4HB7A 1QCWA 4J28A 1J4EA 3AYTA 4EXAA 4OV9A 1JFHA 3IIOA 2CITA 4Q7NA 2CESA 1EA0A 2YFOA 4PB3A 3EX3A 4GIEA 4CKQA 3D3FA 3W1XA 3LRMA 3OVPA 3NYZA 2VEFA 1QWKA 5E9XA 3MMDA 3URNA 1UZ4A 2KX9A 4MKNA 2ZE0A 2WCGA 3S5SA 1PZ3A 2RGLA 1GZJA 4BJHA 4XVEA 1UKSA 2PDMA 3AU6A 3TSMA 4LVFA 3DG7A 3UJFA 3EOUA 4R33A 1KRMA 5M1TA 4S3GA 5EU9A 4DF1A 1A5CA 1EDQA 3KX6A 1H50A 3LV5A 4WJ8A 3PF3A 4MKSA 4RZ5A 1LZOA 4NQ1A 4P8UA 3CHDA 1I2NA 4GFIA 4N9DA 5JUVA 3QH2A 3IS4A 3RU8X 2YBUA 3UFYA 3N4EA 3E0WA 3IIPA 1LL7A 4JIEA 2O9OA 4UQEA 5D9MA 1QNQA 2OKTA 3T09A 1E9YB 3KLKA 4YN5A 3QM3A 3M0LA 4BF7A 3GM8A 1MW0A 1P0EA 4F0RA 4BI7A 1SZFA 3APYA 3FDKA 4WLCA 2Y85A 2VTFA 1Z6KA 2QF7A 5BRBA 3S6TA 5AC5A 1JCYA 4FR6A 4TQTA 1US0A 3UA4A 3A24A 1I8JA 1JL8A 2VX7A 3SB0A 2EPLX 3MCNA 4DJDA 3T0AA 3KVKA 3QQWA 2X7WA 3THAA 4ZQNA 2Y2WA 4XD5A 2EGZA 3S47A 4IHCA 5T9CE 4PCNA 1H1NA 3FGCB 1V0KA 1C90A 1EXPA 1B9ZA 3OPSA 3EZ4A 1TV8A 4GNVA 4Q8UA 3Q58A 2DEPA 5I3FA 2BNJA 5CZTA 1I2RA 3QHNA 1Q6CA 1L2UA 4ZA0A 3HGJA 3G1SA 4H2CA 4UTWA 3WLSA 1RP8A 1LUCB 3TIMA 4HNLA 2G3FA 4J7RA 1O60A 3HGOA 4B5XA 1Q6FA 3PPHA 1A5KC 4Y2WA 3CUFA 2D69A 1OWQA 4LVGA 5FD0A 3GXDA 3RIKA 2OZ8A 2FDSA 1S2TA 2ACUA 3PWIA 1IXOA 4QJ1A 3SGGA 1UR3M 3A3WA 1YNYA 3OEXA 3TNOA 1Z7AA 2XYLA 4MAZA 2D0FA 3AFBA 5F4WA 3W1RA 3CUHA 1B3WA 2ASHA 2J75A 1EC7A 4DBUA 4UC5A 1V4YA 4L5ZA 3WD1A 3M0JA 2V67A 2DV0A 3VA8A 4LUSB 5JXQA 5M17A 5T26A 1LJYA 3VK5A 1V0MA 2MANA 3BCFA 3AAMA 3A3HA 1CXLA 3B0XA 3P74A 2YB1A 4INFA 2J6XA 2UBPC 1A5LC 3WF0A 3AIWA 1EDTA 3C2VA 1X1NA 3NQFA 3AYSA 2PLMA 1PSCA 3VIOA 4F66A 3R8GA 6TIMA 1JZ8A 3WH5A 4G1NA 2PGRA 2ABAA 3PWGA 5I07A 4NJJA 1RQHA 2AL2B 4QE4A 4MKVA 1F4AA 2ISWA 2BFGA 2CLHA 1U1UA 2ZXBA 4H8VA 3QV7A 3SRFA 1VGAA 2R8WA 3TOYA 4GJJA 1IQ8A 3W7CA 4LB3A 3UVAA 2PDLA 2R1LA 1VCVA 5IDZA 2ZE3A 2PI6A 4YTSA 5C9RA 3EA3A 1KGXA 2E6YA 1V51A 2XVNA 3T6CA 2NZLA 4PMOA 1B90A 1UASA 2JGYA 3WDIA 1OSEA 1NP0A 1HF6A 1WKDA 2GGHA 2Q09A 3NVTA 4E4PA 1OBAA 3WH9A 4P2VA 3W87A 5B80A 4HSNA 3PTMA 2J7FA 1JRBA 3BK0A 4NZ4A 2NXIA 3N29A 5M03A 4ICNA 1KXTA 3GR4A 2YBVA 5A6MA 2B7QA 4A4AA 4AYGA 4QLKA 4IQJA 3QMRA 2ZC1A 3F2DA 4REQA 1TMLA 3BARA 3AJXA 2VO5A 4GCXA 3NQVA 2QVNA 3MQTA 5KETA 4TX9A 2XIMA 1B30A 2QJGA 1C3FA 2DUXA 1XRTA 3TYCA 5XIMA 4GXWA 1AODA 3FJ4A 4NJKA 3W28A 4E6MA 2I16A 5AY7A 5G4WA 4DYEA 4PZVA 4GIYA 3TYZA 3OW1A 3S5NA 3UG3A 4B4HA 4E8GA 2DY3A 2CW6A 1F3XA 2XUCA 3EDKA 5FF2A 4M56A 1LORA 3UW6A 3DFYA 1BAGA 1TIMA 1W5PA 3PUOA 4B3ZA 4XZLX 4CLMA 1LL6A 1G01A 3A5VA 3TZFA 2CZ5A 1PIGA 1QMLA 3KTXA 2Z6JA 1VJIA 1DWFM 2GJXB 3BAKA 3DFQA 4MB4A 3EWCA 4JHZA 2EPNA 3LUTA 3N34A 2C16A 4WF7A 3ABOA 4WR3A 1E72M 4QITA 5DMMA 4YNGA 4LPCA 1BPLB 5TAOA 3Q67A 1ZQ5A 3VD7A 4S3CA 3SCUA 3IV8A 1D3CA 1DV7A 3THQA 4Q8TA 3L2LA 1BVWA 1MQRA 2PLJA 4AU0A 1VP5A 2Y0FA 3EXTA 3CLWA 3G1VA 3MZ2A 4RLIA 1CYGA 4GUIA 2YCEA 3OB8A 1UG6A 1BG9A 3R0DA 3HN3A 5I23A 2PEVA 3FW6A 4UFLA 3M16A 2B7OA 2BX7A 2WW5A 2P0OA 4GACA 3EPOA 3REQA 3VGDA 3VGBA 2GUUA 3P84A 3PN8A 1R85A 3BOXA 4DWSD 5AHEA 4QS5A 4Q7IA 3AIRA 1K1DA 4GO8A 4JY9A 1TE6A 2AQOA 3B4UA 1AW1A 1A5UA 1NTHA 1PHQA 3WJWA 3PR2A 2GVGA 4NUWA 3VIGA 4U4MA 2AMGA 4JHMA 1UD4A 4JFSA 2DJXA 2ZZ6A 3GTNA 2WPGA 1GOQA 5C5YA 1ISZA 2FGZA 3WDJA 3FEQA 1DEDA 3WFLA 4HNNA 3GZ3A 1ISXA 4M7SA 3LCHA 1LQAA 3BMWA 4PTWA 3DXIA 4MY8A 1O4UA 3TAKA 1GJWA 1NOWA 4GKTA 3N4AA 3VDAA 4LVDA 4YHGA 2C15A 2O7QA 1GWJA 5IBXA 4Y9OA 2OEMA 4CEXC 5CG7A 3W1TA 3ZLHA 1YX1A 2ATSA 3CO4A 2J7BA 4K3ZA 2CBIA 1E1CA 3LCFA 4PTXA 3UGRA 3TP4A 1DHKA 1C8QA 2QUMA 3ME3A 1Q6OA 1IGSA 5LXEA 1HT6A 1NWSA 1SZEA 3O07A 1TELA 4QSHA 2AAMA 1RCXB 3KZPA 3VOJA 2PWVA 3R89A 3NYDA 1RZMA 4EPEC 1I45A 3WMSA 2FJUB 3H7VA 4MWAB 3DI1A 3GW3A 2XVLA 1OG6A 4UXDA 4JPGA 1S38A 1XH1A 4W7UA 1CPUA 2DDXA 2BHYA 3O0FA 3OOQA 1PDZA 3GAKA 1I6NA 3FCPA 3NQ6A 3S83A 3THUA 3PZGA 3XINA 2NVCA 3QVQA 2GQ9A 2CZDA 5I06A 4WY0F 2BWGA 2XSAA 3L21A 3EWUA 4EP8C 1XIIA 1OC6A 4IFOA 4HMEA 1H61A 1RY8A 4QNEA 2WJZA 4FX8A 3MSGA 4H9UA 5A8GA 3V0SA 4EVZA 4EXQA 3TQ0A 2TMDA 1DIKA 1E43A 1A5NC 1UD6A 2UZ9A 2POTA 4JNZA 2FJKA 3R94A 2EPMX 5HBFA 2QCDB 4LAOA 4I7VA 1Z32X 4JTHA 3E6EA 4YVXA 1QW9A 2WQDA 2D1ZA 1E6SM 4PMXA 1VKFA 3WLIA 1K7EA 4O0KA 5D09A 3LV6A 4XBKA 3BLKA 3NAVA 4JD4A 1XD1A 2DIJA 2YL6A 1J2BA 2UY3A 1GHRA 3U2CA 5BRQA 3TZNA 4ZQOA 3CL7A 5ABEA 1W6TA 2WVVB 3ORWA 1F3EA 1T6MA 4S3KA 4NNAA 3PAJA 3N2OA 4NNCA 1IXQA 3K4AA 4L6OA 3WF3A 1NDZA 2E6DA 1XYZA 3RNDA 2FB2A 1KNWA 3U7VA 4NAEA 1IV8A 1KFWA 3UYCA 5G1YA 3AUOA 3S1UA 4MOZA 1W3NA 2WSQA 3EX6A 3XIMA 3K1GA 1POJA 4M6QA 2G3MA 8CGTA 4IP5A 4QG8A 1O7AA 3IAPA 4H9XA 2O0TA 1CWYA 3HQPA 4IZGA 1ODZA 2BTMA 4S3JA 1P1MA 2VCBA 4NG3A 1GK8A 3W2LA 1EEXA 4D1IA 4NI3A 4CNPA 4CCCA 4WX2A 1UBPC 3I7SA 3QY6A 1TJ0A 2PDQA 3RXZA 1ZAJA 3MPGA 3NL2A 3TLQA 3H2FA 2REQB 2GOKA 4QX4A 2Z25A 4IQEA 1LQ2A 4WCJA 3WNOA 3NQ7A 4XUYA 1FQ0A 3ES8A 4PMYA 4HD5A 4HN4A 1NWUA 2Y61A 3E38A 3URQA 5HWMA 4J1OA 4ZOBA 4A35A 3UJRA 4E3VA 1AMKA 1I60A 4GYPC 2J8TA 1E0VA 5DMYA 4PR4A 4H9VA 1BTMA 2ACSA 4AZIA 4EPBC 3VIFA 2A3LA 2PTWA 2Z4GA 2NV2A 3PBGA 1UD3A 4MMWA 4JQ4A 1OGGA 4US6A 3CIXA 1DXEA 4FLRA 3R13A 1RQEA 1VFLA 5C9ZA 2C1GA 4B5SA 1R2TA 1HL8A 4PUKA 3V36A 5TQLA 1TFVA 3SECA 1UOKA 3ABZA 1WA3A 3BOLA 3OBEA 1XBYA 2QPUA 2AGKA 2J7DA 3WLHA 4K68A 2WCAA 2YLAA 4C1LA 2FFCA 5C2XA 5GNXA 2X09A 4LYPA 2F61A 3OVQA 1E1CB 4ZODA 3WY1A 4E2OA 1YBQA 4DLFA 1QBBA 5F2LA 3SJNA 3IJLA 3O9NA 2XN1A 3OLEA 3L65A 3I7QA 4AY1A 4FA3A 4RZ4A 3SRHA 2BXVA 4W93A 3T0DA 1QVBA 3WK3A 4CNTA 3EXSA 1W3IA 3BV4A 3R12A 3SY8A 2NQ5A 5A3HA 1WKEA 2XH2A 4U33A 1QOPA 3AS2A 3C4UA 5I3GA 1OX4B 1TREA 4MNJA 4ZXOA 1JDAA 5CSUA 5CPSA 1J0JA 3BQ5A 3LGDA 2AQWA 4U3AA 3FS2A 1UWUA 4UQDA 1TSIA 3LQGA 3SCVA 4J2PA 3W38A 1EYEA 5GNYA 2R9RA 4FMVA 5DFAA 4GYJA 1M68A 3O7UA 4IL2A 5HULA 3OBAA 3EDJA 1UWAA 1Z41A 4GKLA 5A8QA 3BV7A 1U22A 4DAIA 4NZ3A 3QPEA 1XG3A 4GQBA 2BHUA 3P62A 3QF0A 3UPWA 4Q4MA 4LEFA 1ZLPA 4R9OA 3RX2A 3AZTA 4TV6A 1XUZA 4GZ7A 4ZB2A 1EEPA 3WF2A 4IPIA 4W85A 1BQGA 2YPIA 4ATDA 4YIWA 3HG3A 1Q45A 3EB2A 3VTRA 3QRHA 4GX8A 1ZBKA 3GXIA 3NQMA 1JDCA 5JIPA 4ZR8A 2ATMA 4A8LA 1FTXA 3MI2A 3PBWA 3UJEA 3FDGA 4CU7A 3KVMA 3ITOA 1QNRA 3WF1A 3UD6A 1P5BA 2OKOA 1CGWA 4PEEA 3PBMA 5DELA 3VDGA 1ADOA 3N4FA 2HSAA 3NZQA 5J5RA 3HO8A 3K4DA 1KGWA 4UTLA 1R6WA 2J7CA 1EX1A 3NWRA 5FJRA 4XAGA 1A5BA 3WLKX 2ZX9A 4HU0A 3WEZA 1XYMA 3JS3A 3HURA 4JX5A 2YYTA 4LT9A 2WBKA 2OLAA 1Z8AA 1M53A 2P50A 3UWVA 3Q65A 5FEPA 1RA5A 1T40A 3ZS4A 1ELSA 4GZJA 4KEZA 2G3JA 1E4LA 3QMSA 1Q6RA 5D8WA 3ZWSA 1IEXA 3P7YA 2J77A 3HTWA 2FZ9A 4NAEB 2VEGA 1A5MC 1YXYA 3NVDA 1XIGA 1TWIA 4XZIA 3EB4A 3I6EA 4FIRA 3CAQA 1KBLA 5HMDA 4YJ5A 1JYWA 2OJPA 3OG3A 3V7PA 4XIAA 3CZGA 3SURA 2DQXA 4DWSA 5K2ZA 4U2ZA 1YPXA 1GEQA 1EF2A 2YL9A 3A22A 3W81A 2A7NA 4UTIA 3LLXA 3PJXA 4GPNA 3UR2A 5HK4A 1LP6A 3GRIA 5KZ6A 3WBEA 2XHYA 4J3TA 4MY1A 2FGBA 3IGXA 3GK0A 4LU0A 3AHYA 3LERA 2ZBTA 1K03A 1T5AA 3LM3A 2IUZA 4QEEA 1WBJA 1PIFA 4UMBA 3BGGA 3WH8A 2IPFA 5A8PA 3L4TA 1Y5XA 3KL0A 1WUFA 3U2ZA 2NX1A 3S1XA 1JYNA 2QDGA 1RBAA 4AAJA 5AZ0A 1CX9A 3CHCA 4AHQA 3FOKA 2DT0A 4X9SA 4KQNA 2BY2A 4CQ9A 3M5ZA 5CPMA 4KCUA 4Y6GA 3U4AA 4D8LA 1IYXA 4N9BA 2J9ZA 4M51A 1GKPA 1W91A 3HPXA 5DANA 4P8XA 1JUEA 5I03A 2I56A 4RE3A 2ZUSA 2P1FA 1DIOA 3H2OA 2J13A 1F8IA 3NL3A 4UCFA 3V0UA 1XSJA 1IWAA 3FN9A 3WFZA 2C91A 4HQVA 4UWMA 2CEQA 2ZTKA 2HMCA 2IKHA 1GKRA 1VD6A 3CEUA 3CK5A 5LNRA 1BFNA 2X41A 4QP0A 1Q63A 4X2RA 5CSRA 1V3KA 1TPDA 2J25A 4L4PA 1MNSA 2VVNA 4DBSA 2F2KA 3SIMA 3LPOA 2I14A 1ZPTA 4YYFA 1O5RA 3EDFA 1ZENA 1S39A 4UFKA 3I6TA 4OT7A 2C18A 2EG7A 1I1WA 4AD4A 1VEOA 3WDRA 1Q66A 3LXBA 3CJPA 3WLQA 3TFXA 4TO8A 1FWNA 3CL8A 3GY1A 3QTPA 1OD0A 3FYOA 1H11A 3LTPA 3TLLA 2PRHA 5FAJA 4ENLA 2GPTA 4CN6A 3KBSA 1V79A 1PHWA 2P8CA 4M8UA 1B3VA 4MY9A 2Q71A 1VAHA 3ZYZA 7ODCA 1UUQA 4B3KA 1AVAA 3NEHA 4IFRA 3UESA 4NI8A 2WYSA 1QK2A 1SU5A 3VI2A 1HN1A 2G41A 1BGAA 3VGFA 1ITCA 3CHEA 1FWRA 3UVIA 2XJ7A 3MV01 4Q4PA 1HXJA 2NWRA 1A5AA 5XINA 3LHTA 1UKPA 4RDWA 4GWEA 5EPDA 3EOOA 2PDKA 3W7IA 1IR2A 4K39A 4O0ZA 2VX6A 3DERA 5LIXX 1IT7A 2QDEA 2AQVA 1VCFA 4LBUA 5D05A 2GGEA 4IIGA 2VM8A 3W7HA 3SY5A 4JKLA 5BOEA 2DJLA 1QBAA 2Y89A 3IJIA 1SFSA 4MPQA 3M44A 3TVAA 2V3FA 3NFUA 1D8WA 3LLFA 4EPKA 4RE4A 4DXKA 4RR4A 2YKKA 1XISA 4KGJA 2Z1WA 2Y8KA 3FSUA 3VGHA 3OGRA 3VNYA 1RJPA 2J74A 2O9TA 2PCEA 3I7RA 5D37A 3GU9A 1M7JA 3DG3A 4V15A 3NZ1A 3W7EA 3NTYA 3GDMA 3VOCA 3WEOA 3H55A 1O5KA 3L68A 3PB2A 4CNOA 3GU2A 4Z2IA 3C6CA 1JAKA 4C6JA 4M6PA 4A3UA 2Z1SA 4DWSB 2C71A 4KETA 1U2YA 1SJDA 1NWRA 5GJMA 1B4EA 4WD0A 5FSDC 5C9UA 4QS6A 1OADA 3SI9A 1UWIA 4AZHA 1IXPA 2CKRA 2QLYA 1O66A 5K7JA 4GCAA 5E0FA 3ZT5A 1QPKA 5HR7A 2W9MA 5E6YA 1I2PA 3E9AA 3TU9A 4G5DA 4WDUA 3HJZA 3W7JA 1PB0A 1C92A 4RPQA 3ONBA 2RFGA 2WLZA 1RQBA 2PWDA 4IGNA 4FP1A 4XTDA 1Q6QA 5A6LA 5CGMA 3KBJA 4A3QA 2HVOA 3EOLA 1XYCA 4LCQA 3WK2A 2VDHA 4CCEA 4O28A 3EEGA 1GUVA 3QBUA 5DCBA 1JPMA 4DYKA 4AC1X 3OZMA 4NRSA 2W5FA 4XAZA 3FKRA 3O0KA 3NUKA 5EBUA 3VXGA 4RW3A 1IEIA 4WJEA 3M0KA 3GUWA 4MM1A 4OOUA 1AA1B 4XAPA 5AHIA 3CAVA 1D8CA 4I7UA 4NX5A 4CU8A 4KWSA 1B31A 5F2IA 1J8VA 2NLIA 3ISIX 3OP2A 2PAJA 3DBNA 1AZ1A 2FLIA 4MZ8A 1E51A 1XPYA 3E2RA 1FCVA 3GTXA 3OHIA 1YNQA 5CZKA 4AIOA 2P5NA 1XBXA 2V38A 2C0HA 2A3AA 4A8NA 2Y5EA 2H90A 3E5BA 3LZ3A 3QGKC 3N2MA 1HZYA 3S9IA 3RM9A 4KCVA 4POCA 3BURA 2VHLA 1C7SA 3OYZA 2QNEA 3R79A 3ZVHA 2OSYA 3VOHA 5FI8A 1DJZA 5FSEC 4MG4A 3MBFA 5MF5A 1TPFA 5JQ9A 3MP3A 5BMXA 1Y5WA 2XN2A 3L4UA 4F8XA 2FH8A 4TV5A 1F73A 2YX0A 4X9YA 1TA3B 1R8LA 1V3HA 1JZ3A 2ZZ4A 1IGWA 1DJYA 1EH9A 4ZE4A 1Z3NA 4F0HA 5LNUA 3Q37A 4S3BA 3MV11 4BKNA 3COTA 2QT3A 2YB4A 5AC7A 3WUEA 2X0HA 1JXJA 1M6JA 4IIEA 5EKYA 1G69A 3IIXA 4QEHA 1OC5A 5I3JA 1UD5A 2V63A 1VZWA 2I5GA 5DRCA 1X96A 4AD0A 3PBUA 3WD2A 4DPPA 2VFEA 3IJ7A 3MW7A 3TW7A 3ELFA 2V2HA 3ZSTA 1WXJA 2XGZA 4ZQPA 2EJ1A 5EMLA 1FX6A 2RDTA 3KBNA 3UNTA 2F7FA 1U33A 4DEFA 5CBJA 3N12A 1KM5A 1T0OA 3LCXA 2J27A 1ZBVA 4TR9A 2BOEX 3OZPA 3IAQA 1S5MA 3QHMA 3N11A 3GNPA 1RK5A 2YCLA 2INEA 4MUZA 3B04A 4F2UA 1QI2A 5AYBA 4PBGA 1OHLA 1C9DA 2Z7KA 1EJUC 3TV8A 5HNRA 4GH1A 1ISVA 3F1QA 3W22A 2D0GA 2WCSA 3VNDA 2ZZ3A 4ERIA 1IIGA 4LAZA 1UOZA 1VBRA 2CXEA 4O1AA 1A49A 3MKKA 3VC6A 2E25A 2W62A 1GOIA 1UWTA 4XTIA 2E9BA 1GPFA 5I7GA 4AVOA 5HR6A 1HJUA 4FK9A 3W6LA 5AB3A 1FWBC 1GVIA 1RCQA 3W2JA 4IPJA 2Z1BA 2WLYA 3PNUA 1M7OA 3CZ8A 2HJPA 1H5YA 3WD3A 5E0CA 2FFIA 3N2CA 3T8LA 4HNOA 2X0SA 1R2SA 2OSXA 4GQQA 4I7WA 4TUFA 2QCGA 2A6NA 1EYWA 2ODOA 3S2LA 5G1TA 5A6TC 3TYUA 1J96A 1V0LA 1QRQA 3P0WA 1XLDA 2ZOXA 3BANA 2P10A 3GS6A 4JIPA 1U83A 4JZ5A 4FNUA 4HHHA 1JCXA 1QO5A 3GVGA 3ZLGA 5BYWA 3RPDA 1H7NA 2GLKA 4KCWA 4JIRA 4MDOA 3CH0A 5C9WA 2QJNA 7TAAA 4ERGA 2GJRA 3PZNA 3EKZA 1Q4NX 4XAFA 3PHAA 4M7TA 3SGUA 3GWQA 1MWOA 2V5LA 1V6TA 3NQCA 2NLYA 1BQCA 3M7WA 3C2OA 1E6PA 4IJBA 3T0CA 4GK8A 2ZFAA 1U5HA 5HDRA 1XGZA 1HKIA 2Y63A 1H0IA 3NNTA 1J0KA 3W7KA 4Z08A 1CLVA 4L80A 3M5YA 1H49A 4JTEA 3Q2DA 4CQDA 1KBJA 3W6YA 2PBGA 3CGTA 3HFYA 4A22A 2Y1HA 4AISA 4CNUA 3S6OA 1WKFA 1OFPA 1H0GA 4H2HA 2ZYFA 4D6JA 2L5HA 3EBVA 4C6NA 1PPIA 3HIJA 1CT5A 4GXMA 4G7EB 4C6PA 1US3A 4LB4A 1ME9A 4W87A 1MFVA 1BRLA 3AOFA 3O6YX 5DT5A 1L0PA 1QHZA 5AHNA 3PFRA 1ICPA 2WPBA 2W6RA 3AS0A 3CPGA 3FHQA 2YIHA 2HQAA 4OV4A 4E5TA 2GGGA 1QFEA 2OYKA 3B0UX 4EPDC 3UCCA 5EY5A 1VLWA 2PODA 3ZVHB 3L9CA 4WZHA 3EAUA 4LUTB 1XD0A 2Z27A 1K7XA 2YR1A 3BL3A 1R47A 4W86A 2ZXAA 2DSUA 2YJQA 1KFLA 3ZOAA 3LHWA 4R85A 4YTUA 3GUGA 2BDQA 4XG1A 4GC3A 2YXGA 4W8AA 1KM0A 3HG5A 2I57A 2W27A 4GIAA 1Z89A 3TKFA 3IACA 4HA1A 3VFCA 4NP7A 3MVTA 3UNDA 1DE5A 5JIWA 3LCGA 3LSCA 3DHFA 3BZJA 2AKMA 3SN1A 4N7QA 3VFLA 4XISA 4RV3A 3POCA 1F4HA 1S2AA 1WCGA 3ID7A 2PCQA 4ZE5A 5H8PA 3PWAA 3EB3A 3DCPA 3A6OA 5G1MA 3TW9A 1WAUA 4EOUA 4B91A 3M6YA 3GDLA 2IS7A 4GRSA 1SUXA 3GLCA 2DGAA 3UZYA 4HHLA 4DI9A 4UFIA 1HNYA 4ES4A 2V8ZA 3MMWA 1UH3A 4AWSA 1GCYA 1E4NA 1SJCA 2IPGA 2YCLB 2WWDA 3WQFA 1HVQA 3NG3A 4PN2A 1BTCA 4O0QA 4WHBA 1LROA 4H9MA 2PWHA 3KHDA 1WQ5A 2C79A 2X1RA 2ZUVA 1QUMA 3UWQA 1OZQA 2CKSA 1Z69A 4LH8A 3M9YA 3H22A 3CHFA 1A5SA 3G1YA 4DM1A 4FS9A 5LIWX 2QPSA 5IOBA 1IR1A 4H4IA 5MKGB 1FKWA 1P0DA 3NPWA 4UR8A 2YL8A 3M43A 2H9AA 1SR9A 1DORA 2BB0A 3PUEA 3UR5A 1DJHA 3WBXA 4I8DA 2WVUA 2XSBA 3O8AA 4LUIA 4RZ6A 2CFFA 1HP4A 4HT3A 1YMYA 4ORIA 2PGWA 1OIMA 4QDPA 3E3HA 2IQTA 3BCDA 4DO7A 4Z17A 5C6MA 1B0IA 5AYZA 3P81A 1YQ2A 3USBA 3G1RA 1VHNA 4M19A 3L4YA 1MMFA 3IIVA 3VKCA 1RHCA 4IP4A 3T78A 2O4QA 3K30A 3TDFA 1VPQA 1FWHC 3LRKA 4PSPA 3I68A 3U5UA 1DHPA 1CXIA 1D3HA 3ARZA 5IFPA 3R11A 3F4VA 5CPNA 1NOFA 4XKYB 2J24A 2WMHA 4HHMA 1SFTA 4I9MA 4LRSA 4GVIA 1DJNA 2BXZA 4HHPA 2WMKA 4AF0A 3A9IA 3TTEA 1YADA 3G2GA 3BAWA 1H1ZA 1R2RA 3TC3A 3U7BA 3H24A 4M5PA 5G4EA 5A6AA 1OK4A 5CEWA 1UH2A 1UPPA 5HQMA 3HG4A 1UKTA 4LVBA 3RX4A 3RAOA 2XFRA 3E74A 4Q8OA 5K9DA 2Y70A 1OF6A 1XDJA 3FAXA 4BFAA 1ADDA 1HJSA 1PZ1A 3WQEA 2J88A 2J7GA 2D2OA 4U2YA 4PE8A 1E4MM 3NDOA 2OMAA 2B0MA 1GONA 4MNKA 1Y5VA 3LCIA 3INPA 4XSLA 2ISFA 1S2UA 1J5TA 1DQUA 3LGGA 4GUJA 3DKLA 6TAAA 2R1NA 1FWCC 2UWFA 1NM9A 1TTJA 1XYAA 2PU1A 2OQYA 4DI8A 3PBYA 3SUTA 3UWEA 3MUY1 3WN6A 1V3JA 4HN8A 3VD3A 3ZJ6A 4ZSTA 1BSLA 5I24A 3V1PA 5FKYA 3MSDA 1E9LA 2ACRA 3RJXA 1YTDA 5REQA 4LAKA 4NHVA 3B97A 4HCDA 1ITQA 1H4PA 5ENLA 1JPDX 1XIMA 4DPQA 3CUXA 1Q3NA 2KZHA 4V1XA 4O11A 3RLHA 5BXPA 3NR0A 3VDBA 1ZNNA 4FHAA 4JX4A 3SCTA 4XVDA 4JEJA 3VX1A 4PB5A 1JRCA 3O3RA 2IXUA 1UZHA 3ABRA 3URAA 3VKDA 2UY2A 4O50A 1A80A 2J8GA 3JVAA 3V18A 4FNPA 1UR4A 3WQ4A 3B8IA 2V2DA 1XLCA 3W85A 2WNZA 2VQTA 3K5XA 4B16A 4JNMA 4QHRA 1IEVA 4C6OA 3PZTA 1B57A 5FJTA 5CBBA 3KS5A 2YL5A 2A7PA 3BZGA 3JUGA 3A4JA 1YE6A 1I1XA 1LDCA 2QEZA 5KMYA 3W74A 2VX5A 3IK2A 1HO1A 5C54A 4Q3MA 4RX0A 1MUWA 1J93A 1XKJA 2FMOA 1VB9A 1XP3A 4FLSA 1CB2A 4V27A 1TPEA 5GJPA 3W7MA 1VFFA 4LGXA 2ZUMA 4FNTA 2DZBA 3MZNA 3WJXA 3MUXA 1RCOB 4O52A 2CZVA 4I8YA 1ONXA 2PU0A 1DWJM 4BI5A 4Y90A 4F40A 4O53A 2C3ZA 1TB3A 1QO2A 1NQKA 5ABTA 3C0JA 3DC0A 2QJJA 1XRSA 4M6VA 1GVSA 3WLRA 1EB3A 3QGAC 2RKXA 3SRKA 3QN3A 3BPWA 2GFTA 5KZEA 4JKMA 2BSLA 2QCEA 4D2JA 4QCFA 3WD0A 2QV5A 3NM1A 4DO4A 4NAFA 3H70A 2O9RA 5BNKA 1T7LA 3P61A 4TOQA 4AZBA 3SM0A 2H9AB 4RPPA 3W1NA 1EC8A 1MRAA 4ZL1A 1WZAA 1XINA 4ECLA 3TC6A 5A8MA 1FHDA 5K3VA 1XR2A 2FHBA 2OZ3A 4XZNX 2NV1A 1P0KA 1BWVA 4GYPA 2V3EA 3GU1A 4RV8A 5LSMA 2W92A 5HNNA 3XISA 1H2JA 2E28A 2DSKA 3S42A 3H4WA 1NARA 3A4WA 4Q6JA 1T99A 3M07A 4HPJA 4LC8A 4B5NA 3BO9A 1KFBA 4AZ7A 4IIBA 1OT2A 3CYVA 4GBUA 3HG2A 3EWBX 1DQWA 3QV9A 2VD9A 1WE5A 2I9EA 4C65A 2FZDA 1JI2A 1WBHA 1P1XA 2J62A 4PUWA 1VJSA 4DELA 5G2HA 4AF0B 1S5NA 1DOSA 1I2OA 4IWWA 4WSKA 2CZFA 1HKWA 3B4YA 1HL2A 3NZRA 3UETA 3WMLA 3I10A 2NQLA 3VAVA 1KB3A 4DNHA 3DN5A 3U4FA 3IGHX 4A05A 1KRBC 4UZUA 1AH4A 3FXYA 2PP1A 2WZMA 1B3YA 4K37A 3K1DA 1IXNA 3M1ZA 1XFCA 3VM5A 4XWUA 5BCAA 3WJSA 2WSRA 5EMJA 4A8RA 3MHUA 1EDGA 5I0DA 3CMJA 1A0DA 1LLWA 4C6MA 3CLMA 3RG6A 1EIBA 1JG9A 3DU0A 1J2WA 3MO4A 1KTNA 3WJZA 4YVVA 1AQHA 4NNBA 1UYQA 3RGTA 1M9HA 4OQVA 3P3BA 3TA9A 1WNOA 1A0EA 2BVDA 1DVJA 1HGYA 1TX0A 4U3CA 3PP7A 3W2NA 3HQNA 3KCLA 4J3ZA 4W4QA 1JR1A 2NV9A 2VEMA 2NX3A 4B5UA 4CCDA 4CQCA 1KQZA 2QCNA 1CLXA 5C8BB 1A50A 4K1WA 2AOSA 3CWNA 3FNDA 3P93A 4CVUA 3CMGA 5B7ZA 3PJTA 4WY0A 2J6VA 4AX6A 4U5IA 3O6AA 1YPIA 1J6PA 2VQUA 3QZEA 4KWOA 1IT8A 3S2JA 3CAKA 2OCZA 3G77A 3FYYA 5K9XA 2OWWA 1BWKA 2Y6ZA 4P61A 3PUDA 2PFHA 3UZXA 1SPQA 1WDRA 2XZ7A 3MHFA 4AHPA 3M0MA 1EHNA 1AQMA 3N6JA 2W91A 3AHTA 3CM4A 3LNMA 1BKSA 5DXXA 2F8QA 3W7QA 2VD8A 1EIXA 3FJLA 2E6AA 4LRTA 3TC7A 3AISA 2VR5A 1PCKA 2ZVIA 1DWAM 3EKGA 1GOWA 1GJPA 1KCXA 2YZ5A 1Q8JA 3E02A 1UWQA 4KFOA 1JF5A 2ESCA 2DU2A 4FO4A 4NIRA 3B9EA 2OEJA 4K8GA 3LPGA 1YYAA 4MZ1A 1VBHA 4JTFA 4UQBA 4PA8A 3PUGA 1PYMA 2NXGA 2YLLA 3JRKA 3W72A 4PL1A 1EO5A 1MQQA 2QW5A 2YFNA 1UIPA 1G4SA 3W37A 3MUIA 2DSVA 3B03A 3LMZA 2CLKA 2Z00A 2WAGA 4O54A 1W5MA 5A8OA 3AIUA 1HTIA 2QDDA 4WUIA 1VH7A 4C6DA 1EOKA 1H7XA 1ISWA 2XFFA 1NVMA 1YDOA 4I3GA 2W66A 1S2WA 1K8ZA 3ANUA 1EPXA 2O9PA 3NEVA 4UFJA 2BS9A 1WZKA 2INFA 4S3AA 1DXFA 4NAFB 3AS1A 2V3DA 3L2IA 4ZO7A 3AWOA 3W4RA 3USZA 2GYIA 4D6EA 2GK1A 4GFSA 3GZAA 4HA0A 1TMQA 2G5WA 1BEUA 1BKHA 4AIEA 3ABSA 1OC7A 4FF7A 3VOGA 3ARUA 2YOCA 1X6NA 3EWWA 1HO4A 3E0VA 1AL8A 1DIEA 1KXVA 2FVKA 3BG5A 5H2ZA 4Y7EA 1O95A 2X1TA 2H8ZA 3VINA 4RW5A 4NZJA 4HZMA 5CJ5A 4A6GA 4TTUA 2FHCA 1WUEA 4IMCA 3I6RA 4EF8A 2BY3A 3SIZA 4H6KA 2WKJA 2Z0IA 1R87A 3N2BA 1J10A 5D04C 1SZRA 1DL3A 1MXDA 3C0SA 4MLJA 1CDGA 4MB5A 3H23A 3GNXA 1CECA 1V6VA 3ARTA 1FRBA 4QDMA 1D2KA 4JQ3A 4JFUA 4J3WA 2D24A 3NA8A 1C29A 1ZZMA 2PZ0A 1W54A 2AMXA 3GXNA 1H1YA 1RXOB 4BHYA 5CAKA 1NFBA 3N2XA 4XBSA 3IANA 2QF8A 3KOXA 1PEZA 4YCOA 2QHAA 4ZQRA 3PNZA 1UIOA 1TR9A 1UKOA 4Y9AA 2XH0A 2PRMA 1WDSA 1XYBA 5EMMA 1QASA 1QNOA 3HJEA 3QLLA 2DFAA 3W1PA 1VIWA 2CNCA 3PZIA 3NQGA 1G7UA 3BLIA 3G3MA 4GA8A 1XXXA 1WOAA 2J9XA 1GYLA 6REQA 4RE0A 2QGHA 4DJFC 3VO0A 3MYOA 1W2PA 2JIEA 2PDGA 4L56A 1SO3A 2QAPA 1W1IE 1OGSA 3N3MA 2WC7A 1MUCA 4UOQA 1OCNA 3NPXA 4I5UA 4DYJA 3S2NA 1BYBA 1YRRA 4DO6A 3HMJG 3OGVA 4UFMA 1XV8A 5HPOA 3ITLA 3QFWA 4PTNA 2Y4SA 4WY0B 4LY4A 3VNJA 1TE1A 1F74A 2VL4A 1C9WA 1J18A 3C2EA 5CSYA 5I3DA 3MSRA 4WGXA 1TQXA 1UP0A 4KEUA 2JEQA 2BBFA 2V5CA 3GXTA 4Z0SA 3P60A 1AJ2A 4PFMA 2ZRXA 1KM6A 2W67A 1TUFA 2A0NA 4AC7C 3GC2A 1OYBA 2V5JA 3CQHA 3NO1A 5DY3A 4WEVX 1R9YA 1TTIA 1QAPA 4PRRA 3C52A 3GTIA 1B3ZA 3LA4A 2VP8A 3BAXA 3KCOA 2PDYA 2EAWA 4DJDC 2QCLA 4B5WA 4IGHA 4PUNA 1RD5A 4KMQA 1KFJA 2VFDA 2VDGA 1H41A 3GC4A 3NL5A 3E2VA 1PE1A 1RVGA 4JFVA 4Z2KA 2Y5JA 4OVXA 4KS0A 1QK0A 5CLTA 1K7FA 1IEWA 3C3UA 2PZNA 3H4GA 5DBUA 3CBWA 3LENA 4I9TA 5M2FX 3GW0A 4UTWC 1SM9A 3TSBA 3NL6A 1VENA 1X38A 1KM1A 4DF2A 2WMJA 2QULA 1TVNA 1XIBA 1XIHA 2PURA 4P7RA 4MIMA 3GNOA 1FWFC 1NWTA 1RA0A 4WSJA 4R3UA 4MSSA 4OIFA 3LGEA 1PCWA 4N4QA 5FJUA 2CC0A 2ISSA 2VC5A 1UJQA 3N25A 2D3LA 3AROA 1ITUA 1W8SA 1B3XA 4UTMA 2UY4A 2GK1B 4UTTA 4AWTA 3EPNA 3LOTA 4R53A 3N9RA 3UERA 4U10A 1R3RA 5KSWA 1E9IA 1LWIA 1WPCA 6ENLA 1O12A 3U6WA 1S1RA 3KS6A 3ZWTA 3D46A 4DWDA 1XH2A 4V2XA 2TRSA 3CT2A 4BWLA 2ALRA 4CU6A 3GDBA 4AIUA 3KM8A 3D0CA 5I3HA 4O1CA 4Z2LA 1OX5A 3SAZA 4AWUA 2HISA 4O13A 4EWND 3TA6A 1ZAIA 2EPOA 4JNYA 4N2YA 3WUFA 4D9PA 2F2HA 3TNBA 3KVLA 3ZZ1A 5CPTA 1O5XA 1LM1A 4QJ3B 1KLZA 4O1DA 4PCFA 3MUCA 3MJMA 1V6YA 4H8HA 4D6DA 2E8YA 1ZCOA 1PTGA 4LEQA 1TPUA 3SSJA 2R91A 4MFDA 3NPVA 1RR2A 2JIWA 4KRZA 4HOWA 1TCMA 1J0ZA 2PWUA 2VENA 3TN3A 3QQ1A 4WXZA 3AMLA 1EJ7L 3QW3A 2R24A 3CO8A 2CLPA 5D2YA 3STFA 2CU0A 3L5MA 1I0BA 1HP5A 3PTDA 2Y8VA 3N73A 1TTQA 1KM4A 1IZJA 4MWAC 4D6FA 4F9DA 3DFNA 3EX4A 4Y8EA 2IQDA 1EZWA 3W75A 3M0XA 3KOZA 1GJUA 5DO8A 3LN3A 3W29A 1CZ1A 3RFAA 3FVDA 4AFYA 3HPAA 2GDVA 3LCLA 4Y96A 5F2MA 1LOSA 2J7EA 2AKZA 3PPCA 2G8ZA 4IG2B 1E1EA 3PJWA 4CN1A 2WHJA 5I02A 4PTDA 4UUIA 1FFQA 3TK7A 5KEZA 2Q6ZA 3B9OA 1QT1A 5C70A 3JW7A 1DPMA 1LT7A 4QLJA 3NZPA 3KRSA 1GEHA 2TSYA 2WVTA 2Q02A 3NGJA 5FA5A 3ARVA 3NGFA 2V6AA 3WO8A 4Q8WA 4LS1A 3WDQA 4MYXA 3SSZA 2OSWA 5KZMA 3LXAA 4Y9MA 2AGTA 4O4WA 2ZWYA 3KBMA 4LS2A 4TMBA 3UYIA 1WOBA 2A85A 1W3KA 1Z48A 2XH7A 3VIHA 4QLLA 4LW7A 3SR7A 4BA0A 2YCKX 4RNHA 3E12A 3BLEA 3CU2A 1XLFA 1R3QA 4I9AA 1M5WA 3AICA 1VBUA 4HCLA 3PVFA 3SUSA 1WX0A 4RUBA 4IFKA 5A94A 1OFRA 5HJYA 1IT0A 1Q2SA 2QUVA 3DEQA 3WFAA 1W1ZA 3G0UA 3MUZ1 5CCZA 4RDVA 3BICA 2PDUA 1XF0A 5D9NA 4UMAA 3GXMA 2WSKA 3T08A 3VMNA 2HBVA 4S38A 4XKMA 4NVTA 3MY9A 4S3EA 3PTQA 4LS0A 3VCRA 2RDUA 4OU1A 3KTCA 1TMHA 1W1A1 4XV0A 1R38A 4W5ZA 3N3TA 1IF2A 4WKHA 3H21A 3ZR6A 1F2JA 1FXQA 1ZY9A 1MNZA 3QKEA 4US5D 5U4NA 1XYFA 3U2OA 3WLPA 1LG2A 2QIWA 2E1WA 2Y7FA 1ONRA 1LOLA 1WKYA 1NF7A 4C6CA 4TVCA 4GJIA 1QI0A 4FLQA 2DZXA 3WH7A 5CJNA 2OO0A 1G67A 3W2UA 4Z1CA 4HKPA 3E1F1 1JD7A 4FIQA 3SCNA 4IMAA 4YTTA 2F6UA 1OFQA 3ZJ8A 2DW7A 2ZXDA 1IIHA 1QI3A 1A3WA 3MWCA 3QC0A 4W8LA 3UXLA 5E6ZA 5B7YA 1I0DA 4C1KA 2Z29A 1A4LA 3TFCA 4MAVA 2WK2A 4N9CA 3CUZA 4GZIA 1KW1A 7REQA 1GVRA 3BLDA 3K2GA 1G4EA 5LA0A 4QM1A 2NT0A 3UCQA 3G0SA 2YZRA 3P14A 5A6JA 4QBXA 3PJUA 3VOFA 3N14A 4TMCA 2YA2A 4NKCA 5CGTA 3WNLA 4C7FA 4KW2A 4IXXA 3LRLA 2VUYA 1QWGA 1V6UA 2E67A 3KWXA 4LCSA 1Q6GA 3OBKA 5IBXC 3AXXA 3F5JA 2VRJA 3K8LA 2ONEA 3T4CA 4OHQA 4Q8NA 3DFPA 4I90A 2J47A 1OX6A 4C5ZA 4FR1A 1XICA 3QV8A 3SGZA 3SFWA 3PANA 2H6RA 2WNNA 3GIQA 1VFUA 4FB7A 1TPC1 1YDYA