1GYMA

Phosphatidylinositol-specific phospholipase c in complex with glucosamine-(alpha-1-6)-myo-inositol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphatidylinositol-specific phospholipase C from Bacillus cereus in complex with glucosaminyl(alpha 1-->6)-D-myo-inositol, an essential fragment of GPI anchors.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase (phosphoric diester)
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 116
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1996-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1gymA00
1T6MA 4RW3A 4F2UA 1DJGA 3V18A 3V1HA 1O1ZA 3I10A 2ZKMX 1AODA 4S3GA 6PTDA 2PTDA 4RW5A 1DJWA 2FJUB 5T9CE 4QJ4B 4F2TA 3QR0A 2OOGA 2PLCA 3PTDA 1QATA 4QJ3B 5T9BG 1PTGA 2P76A 2OR2A 3QR1A 3RLHA 4Q6XA 4QJ5B 3EA3A 4I90A 3EA1A 3H4XA 1VD6A 5T91A 3CH0A 3NO3A 1DJIA 1ZCCA 1DJYA 3RLGA 1DJXA 4F2BA 4OECA 1DJHA 4R7OA 5PTDA 7PTDA 3KS5A 3MZ2A 4I9TA 1XX1A 4I8YA 4RV3A 2ISDA 2OTDA 4I9MA 3H4WA 4I9JA 2F9RA 3L12A 1DJZA 3OHMB 3EA2A 1PTDA 1V8EA 1T8QA 2PZ0A 3QVQA 1GYMA 3KS6A 1QASA 2O55A 4GNKB 4PTDA 3V16A 1YDYA
chains in the Genus database with same CATH superfamily
5I7GA 4CCDA 5FF3A 1XM3A 1H62A 1SPQA 3STPA 1JPMA 5CBIA 4LVAA 2WMJA 2C6QA 4E8CA 1JIBA 4N42A 2YB4A 3HV9A 1XQLA 5MKGB 4GNKB 2VURA 4IHCA 4UWMA 1E9IA 1PXGA 3XISA 3LSBA 3UCDA 4EXAA 1Q66A 4IICA 2BFGA 1I1XA 5D8WA 2Y7GA 4K38A 4JNZA 2ISWA 3R4IA 3LI0A 5FJIA 1YDVA 4WKAA 3QPEA 2QEZA 1XKYA 2O9TA 1QPQA 3LLXA 3QOMA 2DW7A 3E2QA 5M2FX 3O3RA 1BPLB 2A5HA 3W7OA 1PYMA 3STGA 3MSYA 4UNKA 4YWIA 5E0KA 4Z0JA 3DGBA 2YCLB 1XICA 1LWIA 4MZ1A 3RR1A 3WELA 3L23A 1QWKA 3M0IA 5EYWA 4HA3A 4W8BA 3LMZA 2WBGA 2O0TA 4O0QA 4GI6A 4F0KA 4O57A 1R8LA 4K8HA 1K8CA 3NEHA 4F0HA 4JFTA 1CXFA 1YTEA 3RCYA 4AXKA 3QSRA 1XPGA 4FHAA 1YXCA 2EG7A 3NTYA 3W28A 1DIEA 3H4XA 5CZTA 3T55A 2XU2A 1H1YA 2A3HA 3LD5A 4AEOA 3PY2A 3MT1A 5FEPA 1MEWA 2LLEA 2ZXDA 4A21A 1HVXA 3OQEA 3KXQA 1UD2A 1DL3A 6REQB 5I6SA 3AALA 3THQA 1HO1A 3C3UA 4RXGA 1H7OA 2GL5A 3R10A 1BF2A 5TIMA 3JVAA 3NQ7A 1Y65A 1V0NA 3O0KA 4S3EA 3LRMA 4PR4A 4K68A 1I2NA 3ZR6A 1ZP4A 1GVFA 4AB4A 5D04C 2VX7A 4B5UA 3WG6A 5H8PA 1OG0A 3EMQA 1A0CA 3W7IA 3KRBA 4YTUA 1B1YA 2PDWA 1R87A 2ZTKA 1VJIA 1HO4A 3ITGA 3N9SA 1QNOA 3HN3A 1E9YB 3VZXA 3DFTA 1KM6A 3VKKA 4FXSA 4DZHA 3SCVA 4DPQA 3VIKA 3LCGA 2OO0A 6TAAA 5D09A 4M82A 1YIXA 1ODZA 1MUCA 3GW0A 1NJJA 3P61A 4TIMA 3RN6A 4JAWA 3AISA 5BWAA 1ZAHA 3BC9A 2XVLA 3FSTA 3HM7A 3SCWA 2Z25A 3IK2A 3EOOA 1VEOA 1F2JA 4ATLA 2QCEA 5EMKA 3UXDA 5DY2A 2BVYA 2X16A 1W3NA 3VPLA 3W76A 2FVKA 2QF8A 2O56A 2VI0A 1TPH1 4HNLA 4D2JA 3NVTA 3SR7A 2HK1A 1OG6A 2VXNA 2FZMA 3WLLA 5LNVA 3DBNA 2RHGA 4PUUA 1XIFA 4HPJA 3VOFA 3SCTA 2Q8LA 3SQLA 3M9YA 3LZ3A 3GLCA 2CLKA 1E4NA 3GXTA 4O52A 2ZDSA 1M9HA 3VNLA 2Y62A 1FOBA 1HXJA 3TW7A 1CECA 4XSLA 3B04A 1DJNA 2CLIA 2YGYA 1TV3A 4XTDA 3VAVA 3NDOA 4Q32A 1XUZA 1M7OA 1GQIA 2DVXA 1SZFA 1XD0A 4MFDA 2A85A 1DWJM 3ZVIA 4WK9A 3GBDA 1J0HA 1UWRA 2WB5A 3LHZA 1OX5A 1CEOA 1MMFA 4P61A 1B3VA 4DJFD 1F3TA 4CNSA 3NQMA 5M17A 2VEGA 1W8SA 4FO4A 2RDXA 3PM6A 3FW6A 3B3DA 5EKYA 3SIMA 4WDUA 4IPJA 3PAOA 4CCCA 3WBXA 4PFMA 1SFSA 3VXGA 2VTFA 1EWDA 4KCVA 3OIHA 4LANA 4IPNB 4O4WA 5I24A 1ONWA 2RDUA 2DU2A 3ATYA 3C8FA 2WHJA 3HBLA 1HTIA 1Q8JA 3M0KA 4MIMA 1G4TA 4XAYA 2NQ9A 2VDHA 1EDQA 1PTAA 3ZMRA 2J75A 2PPGA 5AC5A 2QJNA 1OJXA 3SFWA 3I4KA 3KOYA 4WIWA 3QGAC 3CHVA 4ZCWA 4LV4A 4PE8A 1HQTA 2BMBA 3QPZA 4ZL1A 5A8QA 3IIOA 9XIAA 4HU3A 3PC0A 4AXNA 3SGGA 4L1XA 3G5EA 5GNXA 5AC6A 2VRQA 2TMDA 3EWCA 4R9XA 3GNNA 3N2BA 1ZENA 4H01A 3SZ8A 5JBEA 1GQJA 1AFSA 5HQMA 4WOQA 3BICA 1W8GA 4EXQA 4HYWA 3F4CA 3VDGA 3GU1A 4AD5A 3TTSA 1K9FA 4FB7A 1JULA 3OBKA 4WY0F 2BGSA 2DUXA 1M7PA 3OLIA 2VFGA 3U8GA 4A3YA 2XFRA 4Z0SA 4X2PA 1Q6OA 3ITYA 3AS0A 4IPPA 3W38A 2EG8A 3K30A 3BOXA 4JL2A 2BLEA 5CJ5A 3HMJG 4DJDC 4FX6M 3SJNA 2PWHA 3E1F1 2OG9A 4PL2A 7REQA 4ZXOA 4BI6A 5B7YA 1EJ7L 1RY8A 5CEWA 2H8ZA 1WZKA 4LB4A 4HA1A 4LF2A 3GXNA 3COTA 3LTSA 4KEVA 3U5YA 3VGHA 1ME7A 2X8RA 1WXYA 1NOUA 3T4WA 4YNGA 2AMGA 4MJMA 3CTTA 5LA0A 4Z08A 2W9MA 4RPPA 3TN4A 2CZDA 1O5XA 3TQVA 3EDDA 1L0PA 2RGMA 2FGLA 2OWWA 4J3SA 1DOSA 4B4FA 4AEEA 2X05A 1EX5A 4QISA 1VPQA 2GUUA 4I8DA 2BV9A 2R91A 1YNYA 5D05A 3CQKA 1O68A 4ZXLA 1PKLA 1NF7A 1RALA 1V0KA 3R12A 4KW2A 4PTWA 1AODA 1Z6KA 1EXPA 4PUMA 4CLMA 3J7HA 2PI6A 2OEJA 2BY0A 3WL0A 3NEVA 4JTFA 3L5LA 1ADSA 4BY3A 2XH2A 1M01A 1QNPA 1TIMA 4PH6A 4UTTA 1DORA 4DBUA 5GJMA 3OG2A 1XLHA 4KKXA 4HNVA 4JCLA 2XWEA 2QULA 3K8MA 4WKFA 1XV8A 3E2VA 1K03A 3T81A 2A3CA 3U2EA 5DQPA 3N2MA 3DEQA 4OV9A 4NJKA 5AYYA 2Q8ZA 4XZNX 1AQMA 2DH2A 3VU2A 3A47A 4LX4A 3ZOAA 4MSSA 2A79A 4YHGA 3TXZA 1TTQA 1W9BM 3MCOA 4UOJA 4Z2HA 1RVGA 5DELA 2FGBA 4PMOA 4Q8VA 1KKRA 3URQA 1XH0A 1FUYA 4WXZA 3NM1A 3I3DA 1G7VA 4HPHA 3OA5A 1WOAA 3HPFA 3REQA 3TSBA 4LVDA 3GVWA 4DHGA 3IIXA 5I03A 2NVDA 5EL1A 3MUIA 5ABHA 3MV11 1DQXA 4HCLA 5J5RA 1SO6A 3G1AA 4H6RA 4OGZA 1ZALA 4UZSA 1ZP3A 3RX2A 5D8ZA 4JEQA 2DZVA 4KQNA 3CLWA 1FCVA 5B7ZA 1KM5A 5AC4A 3AHXA 2YBUA 4XKYB 3MDWA 1IWBA 1LRQA 4FXRA 1MDRA 1J12A 4HKPA 3GBEA 3NQDA 3VA8A 1UA3A 4GUIA 4GNVA 2AGTA 3TNBA 2PDBA 3K1DA 2ACRA 3EYPA 7XIMA 3N04A 1JRBA 3U7VA 3G6MA 3CPGA 3N11A 3DFNA 1DXIA 3VC5A 2D0GA 3KUMA 3VGGA 2PAJA 1SO4A 3MHFA 4M6PA 3P8JA 3QR0A 4Q8PA 1XYAA 3RJYA 2WMFA 1G01A 1VBJA 3THUA 5D2TA 2NSXA 1VCFA 4JIEA 3QQWA 1BWKA 3AUJA 5J8LA 1F61A 4UXDA 5ABFA 4AHOA 3N2OA 1HGWA 3CBWA 3GDBA 1QW7A 4FI4A 5G2WA 4ENLA 1UP3A 2HQAA 2DSUA 2FTPA 3QW3A 4MAVA 2R94A 5KZDA 4OTKA 1PS9A 1WA3A 1W5PA 2D2OA 3NG3A 3IJDA 1E4LA 2Y2WA 4GMEA 3AOFA 3APYA 2J9ZA 2XZ9A 4F2TA 3V35A 3W2UA 5TNVA 1I2OA 3S6DA 1JFXA 3WNNA 3UW6A 4QDMA 4H9MA 4DO4A 3WQVA 2NUWA 6ALDA 5CPOA 1DYSA 1VQTA 2WKGA 3LM3A 1BGGA 1GONA 1J18A 2OZ3A 1NQKA 1EGZA 1KV8A 2BSLA 4GA8A 3B4UA 4HT3A 1YRRA 4TU1A 3H2FA 1RPKA 2WO5A 4PTDA 3GKFA 3TC7A 4HQVA 4AF0A 3UY8A 4XBSA 3HJZA 3H54A 1PUDA 1HFBA 4AG0A 1EF2A 1ITQA 5I3KA 2GGHA 1OFDA 3CHCA 3DESA 4O15A 3IJIA 1XPYA 1MVYA 3T07A 4DUOA 2GSHA 4LUIA 5HMSA 1V51A 4E5TA 5HQEA 2WC3A 3C0SA 3PZ9A 1WZAA 5G2IA 4ZB2A 3TONA 1IZCA 2A7NA 3M0XA 4MKVA 3AMKA 2DQXA 2I5QA 4MY1A 4YU1A 5H8UA 3V0TA 3FVMA 3IVSA 5DRIA 3KHJA 4YCPA 3CS2A 4UFJA 1O94A 1E1CB 3VNKA 5HINA 4Q4PA 4W4QA 2YDQA 5FAJA 3HFYA 4LC6A 3LHWA 3UJSA 4W9TA 2VOTA 3WCZA 3N14A 1E40A 3PBVA 3DKJA 5AVNA 1A4MA 2XWDA 2VZTA 3WDQA 2PCQA 3T0AA 3M5XA 2WHLA 2ZC1A 1AA1B 1AJ2A 4RUBA 2EQDA 5A6JA 1J2BA 4PULA 3MJYA 5DCEA 4F3HA 1D8CA 1YE6A 1T6MA 4F0SA 1B9BA 4F2UA 3TLLA 4MWAC 3VDAA 4B90A 4ATDA 4KH2A 5ECUA 3RPDA 2NQ5A 1LF1A 2QVHA 3W1LA 4RX0A 1HJSA 3FGCA 5CPNA 3NQBA 4I7VA 3W7RA 3U4AA 1WAWA 4M8UA 5DLCA 4MOZA 1MWOA 2J6VA 4LS1A 4F9JA 4GINA 4FR6A 4LJ3A 3WF0A 1M7XA 3UWWA 3NPXA 5DCDA 1GGOA 1XH1A 4TV6A 4UTFA 3L67A 3L9CA 2HS8A 4NASA 2HSAA 1UROA 3C61A 1GOKA 3ABOA 3PZTA 3PZMA 4BF7A 4N4PA 2CXGA 4EPDC 4PBEA 4KRTA 3W2LA 1UASA 2P76A 1HKMA 3P5ZA 1K8XA 4OOUA 1JZ4A 1JZ5A 2Y89A 3LS9A 1F3WA 2DEPA 4PEKA 1QI0A 4C6EA 3WBEA 5GPRA 4E2OA 3GXPA 2C18A 3GSMA 4Z17A 5BZAA 5F7UA 1US3A 3SCOA 4US5D 4AISA 1XIJA 4Q6JA 3W25A 4TR9A 2WC4A 1Q8AA 3KS6A 1OINA 5D03A 2YBTA 1GOMA 3NSMA 4JOMA 2ZDRA 1V02A 1SVDA 1W1YA 4OZOA 3BZGA 3KBVA 3TYEA 5G1YA 1YLVA 1XIIA 3FDKA 1EBHA 3W1NA 2J88A 3V0SA 2DH3A 3ABRA 4BFAA 4NUWA 1A50A 3EWUA 3WNPA 3ZJ6A 3KVKA 1UR3M 3EPOA 3VIFA 4Y9PA 5FL0A 5HPCA 1GVQA 3Q4DA 3BLOA 1XG4A 3GIQA 1LRTA 4IFOA 3OBEA 1W1VA 3S42A 2B31A 1JG9A 1YADA 3BCJA 5CSRA 1OFPA 1UUQA 5C9ZA 3GZAA 5HANA 3THDA 4KFPA 4H1ZA 1TTJA 3F4WA 4TTUA 3UR7A 3AXMA 1H63A 5I78A 1TV4A 2DV0A 3EA3A 4GRSA 4UR9A 1J2WA 2A21A 3OBAA 3ITCA 3RR4A 5IM51 4UTJA 3ZLGA 2D3LA 1XRFA 4EAYA 5FEWA 3KTSA 4QS5A 2VUNA 2AQOA 3N4AA 4JDBA 4D6GA 3LBOA 2OELA 1YBQA 2J13A 5IBXA 1O4UA 4MWAB 3LNMA 4DUVA 3N6HA 2OEMA 4D71A 5XIMA 3WQGA 3SUTA 3W26A 4ZENA 5BXSA 4K7VA 3URNA 4K39A 4CU7A 4YVPA 1DKWA 2BODX 4E3TA 1AL8A 1ZHAA 3GXIA 4Y8EA 4OBRA 3QMTA 4QJ4B 3AHYA 1FWNA 3GNPA 3U2CA 3WJZA 2XSBA 3B06A 2CFFA 1QK0A 1IXNA 1ZSXA 2GJLA 4UBPC 1XRVA 1XF0A 4XISA 3HTWA 4NJJA 3T42A 1XIMA 3W7GA 1NFPA 4IPIA 1XR2A 2OMAA 5BYWA 2E28A 3A12A 2XFFA 5T91A 2ZFAA 1EP1A 2QQ6A 3PJWA 1OK4A 4NZCA 1US0A 1RLDA 4FNQA 1ME9A 4LBSA 5G4WA 4DIAA 1Q65A 3M4HA 5DY3A 4YYCA 4N9DA 3PZGA 3W73A 3KOZA 2Q8XA 2VFHA 1DWHM 4H7CA 5D9MA 4NRSA 1P1XA 2E0PA 4N7QA 4PMRA 2ZRWA 3F2CA 2XIBA 2EJ1A 3W7DA 4MPKA 3G1VA 1OFOA 1I2RA 2CPUA 2XVGA 1CENA 4H9UA 3AS1A 2G4FA 3GK0A 4H9YA 1BVZA 5DN1A 3MSDA 3H2OA 1MQQA 1LORA 1O1HA 3ZVHA 1UZDA 3NL2A 5M03A 1H0IA 4HNOA 1UWTA 1XDLA 3KEHA 4YPJA 2OWXA 3MKVA 3TVAA 3IAQA 5FSEC 1G5AA 3K4WA 5H91A 3NGJA 4HNUA 3R0DA 3WK0A 3ITTA 1HP4A 1QWGA 1Q6RA 4X63A 2Q02A 1AD1A 2VD8A 2XFYA 3TYZA 4CVUA 1IE7C 4O50A 2OGJA 3D47A 1J0ZA 1E6XM 1W3TA 3RMEA 3OODA 4JS3A 2WYSA 4CUCA 3EB3A 4Z1YA 2DW6A 3VE7A 3UG8A 1W17A 3DOPA 4M1BA 2ZE3A 4GY1A 1UWIA 1EC9A 1Y0EA 3MO4A 1TELA 4HK5A 3N2CA 1G7UA 5LSMA 4JFSA 4TXEA 2AAMA 1FTXA 3TFCA 1VFLA 1EPXA 1CTNA 2V63A 1V6VA 4Z1DA 3TZNA 2VRJA 1IIGA 3D6NA 1H7WA 5F4WA 4KRUA 3PJTA 3GG0A 4FIQA 1BRLB 1HW6A 1W3IA 4H41A 3PZOA 3SQMA 1XBXA 4BQ4A 4Z2IA 4M7TA 2NV1A 4A8LA 3WUEA 3SQSA 1VCGA 3VUSA 4JTJA 3K46A 1GQNA 4KCWA 2YPIA 4A29A 1GUVA 1OC7A 3FK4A 3WEZA 2WVVA 3MWAA 1NDWA 3TWBA 2OYLA 2QPXA 1TPC1 3C8NA 3ITOA 2FVMA 5AHIA 3ES8A 2FMNA 3N9KA 4M6QA 5A3HA 5LYRA 5KTLA 5D9NA 5REQB 1WO2A 2Z1WA 3V18A 1GQKA 1A5AA 4MMWA 4Y9NA 3PTKA 1LCOA 3W07A 1UBSA 3ENLA 4W85A 1U2YA 2J8TA 3ZLHA 2BDQA 2W27A 3A4AA 4JTHA 1E1FA 2VC9A 1K9DA 1IEQA 4GFSA 4DI8A 4CD8A 3VVGA 1OYBA 4YYFA 1S38A 3VOIA 3LV5A 3MI3A 4WX2A 4XUGA 1R3YA 4HK6A 2ZRYA 5HUOA 3RUBL 3LXBA 2C3ZA 3FVDA 1CNVA 4X22A 2Z7KA 3R1ZA 1W56A 3EXSA 1MW2A 2VKZG 1A5CA 3WX7A 5JVLA 3DENA 4XG1A 3GM8A 2ZWYA 3WNOA 5CSSA 1VJSA 2FTYA 4KPLA 3A4JA 3SCQA 3MV01 4HPXA 1UW9A 4WSHA 2FZ9A 2QUNA 4GH1A 1UWSA 4XZHA 3GTXA 1RXOB 5T9CE 3TYUA 2QMJA 1HJWA 4GQBA 2A2IA 1I60A 1JYNA 1QOPA 3VDBA 3IUIA 1JGIA 2H90A 4JEJA 1TCMA 3A21A 3FA5A 4M51A 1OZMA 3WH7A 3LMYA 4XV0A 1C91A 1JPHA 4I9AA 3LHTA 3MJMA 2QGYA 3A23A 1AMKA 3OZMA 4S3BA 1IGWA 1W9VA 4ICMA 1RV8A 3GIPA 2PTXA 1A5SA 1H2JA 3FAWA 3SCPA 1ZBKA 5FF2A 4QE4A 4IXHA 3DZ1A 5LIWX 1PIFA 4GVHA 2VGIA 4LTSA 3CV2A 3E9AA 1GCYA 2BS9A 3FYYA 3M0JA 1PKNA 4KRZA 2YL6A 2QCCA 3VIJA 1P6WA 2RAGA 5EMJA 4UNIA 3MC5A 2XIOA 2PDJA 4NNAA 3GAKA 2WNNA 4QG9A 3W7NA 1ISVA 5AHMA 1DJQA 1IIHA 1OCBA 1ITXA 5HJLA 4DWDA 1KR1A 1G94A 5K4ZA 2YXXA 1OYAA 9XIMA 5MF5A 4FNSA 4ERIA 4P7LA 1W31A 4W8LA 3AROA 4L1WA 3PFRA 2H9AB 4AZCA 1ISXA 2Y63A 3B9EA 4JQ2A 2H9AA 4S3JA 2HNHA 3HV8A 1F3EA 3QR3A 2O9PA 2VR5A 5BU6A 5AYZA 2IUZA 4GVIA 2D0HA 3UQNA 1K1DA 1RQHA 3P7YA 5M5DA 1JF6A 4X9SA 3FYPA 1P4CA 1F8IA 4GOAA 1DJXA 3O6CA 1AW2A 2Z24A 1QFEA 3BO9A 3L2MA 3RMJA 3VIGA 3A22A 2G8ZA 5C55A 1JR1A 4H6QA 1OD8A 2WCGA 3LERA 1XRSA 1F8MA 3M1ZA 1FVPA 3ARSA 2ZXBA 1R3RA 4LCSA 3W27A 1Q3NA 1POJA 4DAIA 1Q6QA 1OK6A 3VKCA 2CLMA 1NM9A 4IFKB 1QT1A 1YDNA 1UH3A 3HGSA 4IQEA 4MWAA 1GZGA 1PX8A 3NL5A 3P14A 4C6QA 1H0GA 5D30A 3EZ4A 1W1PA 3UWEA 5FD0A 2QJMA 1WP6A 5JMUA 3W1PA 2F2HA 1OM0A 4OE7A 2ISSA 4FX7A 1QCWA 3BJTA 3LGGA 2AGKA 3VKDA 3OP2A 4XAGA 4BWLC 2J7EA 3W87A 3P84A 2ASHA 2PDCA 3QC3A 3PSWA 3U2OA 4C6JA 2BY3A 4HOXA 1FCBA 1IYXA 2XH4A 4MZ8A 4LVGA 3W0KA 2ABAA 1Z69A 3S6OA 3BLLA 4LQ1A 2OT1A 3AHZA 4MKNA 3VILA 3OYXA 4QM1A 4W5UA 3GFXA 2X41A 1PYFA 1GK8A 2DZPA 3VGFA 2G3JA 5JUVA 4G7FA 3WD0A 4KT2A 3MVIA 1N82A 1BXNA 1QPOA 3PZNA 3VNDA 2OEKA 3CPUA 4UTUA 3W7MA 3NDZA 1GHSA 1X6LA 2OFJA 1CGWA 4S1FA 3PTDA 1I8JA 3G2GA 4S39A 1XLIA 1CGVA 4ICNA 4AZ5A 4Y6GA 3KAOA 1CB2A 4XO7A 1F5ZA 3E0IA 3SM0A 4U33A 2J9XA 2WAGA 5DRCA 1QDSA 1RLCL 2WSPA 1T41A 4CNUA 3NOYA 7A3HA 1F4AA 1ML1A 1S2AA 3S5NA 2OQYA 1LL6A 1K6WA 3T40A 8XIAA 4MJZA 1UR8A 1JI1A 1QI2A 4HZ7A 3KW3A 3QVQA 3QGKC 3G8RA 4NAEA 3SADA 4XKYA 1TZ9A 1NIUA 4AZGA 1TVLA 2JE8A 4LF1A 1BD0A 3WEMA 4YL2A 1Q6DA 2CZ5A 1IZKA 4LAUA 4FAMA 2HBXA 4PC8A 4LVBA 4A2RA 4S23A 3TH6A 2HK0A 5TAOA 1W54A 1S2UA 4EX4A 1JDEA 5FJOA 5CLWA 5MHBA 2J7HA 1BG4A 1ZTVA 1OCQA 4E38A 5HPOA 4MUPA 1EZ2A 1RP8A 1EWEA 3PK7A 2NWSA 2ALRA 1EJUC 2NQHA 3UERA 2V2HA 1XGDA 3JZUA 5BOFA 4O53A 1QHOA 1B0IA 3JU2A 5EMLA 5CBJA 5DANA 1CXKA 3N6JA 3CU2A 1GW9A 4AAJA 2IQDA 4LUYA 4K37A 3B40A 2QW5A 2ZIDA 3G8EA 3MZ2A 1TUFA 3ARZA 3PBWA 1F7BA 5DBUA 2WMGA 1CLVA 4QFUA 1Z41A 3G1RA 1V3KA 4MGGA 5JXQA 2XPKA 3VOGA 1ZCCA 1JZ2A 1W3HA 1QPRA 3OQ8A 3KFTA 3CV6A 4V28A 5CQ1A 1TA3B 3PNZA 4E2VA 3AHTA 1NOWA 1SMAA 1TKKA 5GNZA 5AC7A 2Y8VA 3QMSA 4KIEA 2H3DA 2ZWZA 2B0MA 4GBDA 4PMVA 2BOEX 2WSKA 1LT8A 3SRDA 1FFQA 3NZPA 2FKPA 3SCRA 1OFQA 3QZEA 3IIZA 4RW5A 3T6CA 4RLIA 3AIBA 2CIPA 1DJHA 3V1PA 2GOUA 2BX7A 1CLXA 4GG9A 3DDMA 2VWSA 4OIFA 3W1AA 5KZ6A 4LUTA 1MW3A 5BOEA 1K6AA 4MG4A 2YL5A 1XSKA 4CNNA 3PF3A 2Q71A 5E0FA 2J78A 3K4DA 2JKPA 3RCNA 2F2KA 1SFTA 1U30A 2PLKA 1VD6A 4OWGA 4AC7C 4XUYA 5CAKA 3L5MA 4NT0A 3B03A 1FHDA 1DHKA 3QTGA 2J7GA 2QPSA 3GG1A 3W23A 2OR2A 4JTTA 8RUCA 4ASTA 2WWDA 3WDIA 1NDZA 3QV6A 5CSYA 3MW7A 2QCMA 1AD4A 4LVFA 4H2HA 3ARVA 2C19A 3V1HA 2OKOA 3KBSA 3NURA 2WWCA 1UC4A 4AY1A 3NZRA 1WDQA 1IXQA 3GVRA 2C14A 3H8AA 3ARQA 5MKGA 3V7PA 1V5XA 4Q8TA 2OSXA 2PGWA 3MA8A 1C29A 5LHEA 1G9HA 2IPFA 3BH4A 4BF5A 4XD4A 4CQ8A 4TMCA 3HA1A 3M5ZA 1TG7A 4PUNA 1ALDA 1TZZA 2G41A 4HZMA 4CGTA 4OJYA 4TX9A 1TREA 2GGJA 3TNOA 3UP8A 1QATA 2Y61A 3F2DA 4JTKA 2W6RA 2Z1XA 3JS3A 3WDPP 3WQCA 4TX8A 4L80A 5CZJA 2W3ZA 4WGXA 1XYBA 3VGEA 2PZ0A 5A6AA 4M0XA 2BWGA 2VCCA 4YTQA 3VD7A 2RFGA 4GIRA 3CH9A 4DNHA 3NO3A 1UMYA 4Y90A 4F48A 3M43A 3JUGA 3F4NA 1NTHA 2VL4A 1EGVA 3MZNA 1XLGA 5EMUA 1EKOA 4J3XA 3FJ4A 1XISA 1FDZA 2CBIA 3EWWA 3LSCA 2ZRVA 1Z89A 2WLZA 5LIKX 6XIAA 3BLFA 3ABQA 4DLFA 3W1RA 1QO2A 1A5KC 1AZ2A 2F6UA 1KFBA 1Y5WA 1C9DA 1ONXA 1RAKA 1XH2A 4C5YA 1I45A 2GWNA 3F5JA 4AU0A 1EC8A 3APTA 1ITUA 1XBZA 1WKDA 3VIIA 2PDIA 1IWAA 3G1HA 1CXEA 1I0BA 2F38A 3HG4A 1XLBA 2JIWA 4HB7A 4HPNA 2O4MA 4RPQA 2L5HA 4R33A 3WY1A 1Q6LA 1ZBCA 4L9ZA 3BAJA 3SUWA 3QQ1A 3KOWA 1UWQA 3A64A 1A5MC 1PKMA 2HS6A 3B0UX 4PRWA 3TQ0A 3SJ3A 3FJNA 4IMAA 3AHVA 3L2IA 4KERA 1LROA 5D9PA 3NZGA 1VFMA 3ARWA 4JQ1A 3ZVHB 4BF9A 3U9IA 2YFNA 4GGHA 4QLKA 1VLWA 1EF3A 1G69A 2VZUA 5KEZA 1O66A 3G1YA 3FOKA 2BHUA 4PRTA 3VGBA 4ZQPA 1FHLA 2DZBA 1JPKA 2VEIA 1V77A 3NPUA 4OV4A 1DWFM 3N25A 3UJEA 2OGYA 3QOKA 3OGRA 1RK6A 3ISIX 4W7WA 2OX1A 2XIQA 1DTNA 3IJ8A 4HGXA 3VYLA 3L4YA 4PTVA 3UBPC 4ZQCA 3K8KA 2Y24A 4GQRA 3B8IA 2DGAA 5J04A 2CLLA 2NX1A 1SSDA 4O4VA 1QXLA 4RDWA 3Q2DA 1S5VA 2HVMA 1LRNA 1QPNA 1HL2A 3MMWA 3LXAA 1J5TA 2DVUA 3MCMA 2DZAA 2JGQA 3F5KA 1MW1A 4AD0A 4HA4A 2ADAA 2J9YA 4AVFA 9RUBA 3UA3A 2GDVA 1PIGA 4GY0A 2O92A 4LAKA 5G2HA 2PMQA 4AH7A 2OX4A 3BJSA 2HE5A 3ARRA 4Y9MA 3IV8A 3WMLA 1H60A 4DLMA 3DAQA 2Y7FA 2WZIA 4WDWA 2GDUA 1K4GA 1DJWA 4EWND 2PF8A 2WV8A 4UR7A 1F76A 3FSUA 3U57A 1E1CA 5M3WA 1DTUA 4DZIA 2FLIA 4YTTA 3NGFA 4OBSA 1OGSA 7ENLA 2VR4A 1T40A 3SSZA 2D1ZA 3CWNA 1GZ1A 1R9YA 1VIZA 2V30A 3GXDA 4Q4QA 1JAEA 2CXEA 5M1TA 5LKYA 3AXIA 2WPGA 4JFVA 1Q6GA 3QLDA 1LYXA 2JALA 5CGQA 1N2VA 4IIGA 3S47A 4IFRA 2C79A 3VIPA 3VIOA 3POCA 3B8WA 3IV3A 4J3WA 3TA9A 2QCLA 1B31A 3A13A 2W66A 4GUHA 4D6JA 1VPXA 3ITVA 4V33A 5CZ0A 4PMJA 3CZKA 2PB1A 1UJPA 1Q7ZA 4ADSA 3B8UA 5E1QA 1PEZA 1VCVA 3BTNA 1TSIA 4RE3A 3AMCA 4ROPA 2I57A 1PJ9A 1DV7A 4JIQA 3E5BA 1GVEA 5IXEA 1MW0A 3T2PA 1LQ2A 2XDFA 1VRDA 4PMQA 5K9CA 5I0DA 2E5CA 4C7FA 2XM1A 3O6AA 4A8RA 3APGA 1CW2A 4LYKA 3LBMA 5K7JA 1KLZA 3MI6A 3O8AA 3C2EA 2A3BA 3RO6A 1N8WA 1ZY9A 2Z29A 1GNXA 5CG7A 3R25A 2EPMX 3A24A 2NVAA 4ALDA 3UD6A 3O16A 1FWRA 5RUBA 3MP3A 3PWIA 2HPMA 3QM3A 3PHAA 3GTNA 1V6TA 3CGTA 1XIEA 3OHIA 2CZFA 4IMFA 3W7HA 1QTWA 3LQGA 3UZWA 3WDJA 3LCHA 2XN2A 1K77A 4DF1A 4YJ5A 1J6PA 1GEHA 4K1GA 2H8XA 1OYCA 4EK7A 5FIPA 8CGTA 2V8ZA 3XINA 4YLWA 1B3OA 3WLSA 2C0HA 3D3AA 4M80A 1GJUA 3V5FA 1TV7A 1K7FA 4D8LA 3CAWA 3M16A 2Y70A 2J47A 2VFIA 3CMJA 3R94A 2GQ8A 3GDLA 3GUWA 1X8CA 1FQ0A 2XGIA 4KCUA 4JY9A 4J7RA 1TJ2A 1UD6A 2QCFA 2RJGA 1UA7A 3W24A 2B81A 3E0LA 3IJ7A 3DCPA 5DXYA 4GVGA 2E9MA 4IWWA 5EPDA 1G0CA 2J4GA 3GC4A 3N17A 4RJEA 2QCDB 1HKVA 2WVTA 4V1YA 2I56A 3AYSA 1EO5A 1Y7VA 3C52A 4JTUA 2X42A 3TIMA 1JD9A 3HZ3A 2ZX5A 3PJUA 3BCDA 4E4FA 3CNYA 3MP4A 1XLLA 1DPMA 1IWPA 3H4WA 4J2MA 4TQTA 4KWUA 1R2RA 1XSIA 4DZ5A 4XZMX 1ME8A 2PDUA 2YOCA 1GW1A 1TPEA 1UP2A 3EXTA 4AIEA 2X0SA 3W7CA 1VHNA 4Q3MA 2GJXA 1P6CA 3USBA 3G18A 3NL3A 1WXZA 1RA5A 2WHKA 4HHHA 2CZVA 3QRHA 1A3XA 3I10A 1JCTA 1GT8A 1OX4B 3B05A 2BG5A 1OCJA 3TSMA 1BVWA 4WLCA 3TU9A 2VGGA 5IFPA 1EP3A 4PCNA 4HOWA 3T08A 2PFHA 1YHTA 3KS5A 5TF0A 3SBFA 3S1VA 2PDYA 2QIIA 1R85A 4C90A 4KGLA 1RSCA 2GUBA 1TQJA 1W2VA 2FPTA 2G37A 3C4UA 3WUGA 2QZRA 4Q7BA 1M65A 1ADOA 3B0YA 3RLGA 1M41A 4ZE5A 1P6BA 3PR2A 5HJYA 3W7KA 3PZUA 3H7VA 3SFKA 2PU1A 1DEDA 2IS7A 2QKFA 4DO6A 3S5OA 5TBOA 1HKKA 2HE8A 4WVXA 1C9WA 2V5KA 4HHLA 3TC6A 4QAIA 4UFKA 2OO6A 4L56A 3WF4A 3WSUA 2RGLA 3A3HA 3ES7A 3EOLA 1PE1A 1BLIA 2VGBA 3W6LA 1PSCA 3T1GA 2CBJA 1V3LA 1QUMA 2GVGA 4AWEA 2TYSA 1X7FA 1TPVA 4R7OA 2GQ3A 2QUMA 2OSYA 4JQ4A 4JIIX 4O8RA 3KP0A 4C1NA 1BTCA 4QAWA 2TPSA 1KRAC 5DMNA 3WZ0E 1P0DA 2IKGA 3GG8A 1QK2A 4W84A 1GHRA 4JX5A 3QFWA 3MBDA 2C91A 2YL8A 1EOKA 1S2VA 3P6LA 2POZA 1GPFA 4CN6A 5A8GA 3AJ7A 4KESA 1W9UA 3EBVA 4HTBA 3B9NA 2VFDA 4PBFA 4CQBA 4UMAA 4LAMA 3AICA 3KBMA 4NL1A 4N9EA 3W3OA 1D2KA 4N2YA 4J4KA 1RR2A 3FJ6A 3GC5A 2G96A 5EY5A 1EUNA 4DYJA 4ERGA 3BARA 4KWWA 2VZSA 1EQPA 1QMLA 3SN0A 3AAMA 2JKAA 3QHNA 3C3NA 3C86A 1A0DA 2E9LA 1J0KA 2WZMA 5ABTA 2R14A 4JNMA 1VKFA 4GO8A 1UUMA 1A4LA 1H7NA 3LEPA 5A8NA 1FKXA 4IGNA 2P3EA 2Y5JA 4FMVA 1LTDA 3UNDA 3MVTA 2VEPA 3WJXA 3WF2A 4QCEA 1EJVC 2X7WA 1JFHA 2QLYA 3EKZA 1VRXA 1FWJC 3DFPA 3PFMA 4ZE4A 3WLKX 4F0RA 5JH1A 3DXIA 3F5LA 3QJAA 1VR6A 4I6VA 4PZVA 1W5NA 2POTA 3QY6A 1Z9AA 5FF7A 3G1XA 3EOEA 1AQ0A 3I4EA 3A9IA 4QQ3A 1MXDA 1BTMA 2G0WA 1YE4A 4LT9A 5A95A 3UJ2A 4M81A 4IQJA 1JCYA 2PURA 1OADA 3I7QA 2J7CA 2WMKA 3L0NA 4LNCA 2ZUSA 3WH9A 3BUVA 1AK5A 2INEA 1TJ1A 2FMOA 3RU6A 4BS0A 1ZZMA 3KVMA 4GYPA 3OIXA 1SW7A 4IPLA 1LDCA 3KX6A 3MPGA 4J2PA 4RNHA 1S5NA 1KTBA 2JBMA 3A3XA 2NSOA 1TJ0A 2DIJA 4NZJA 3W7JA 1CI1A 1U22A 4TX6A 1XG3A 3GC2A 2IKHA 3RIKA 4IIHA 3HG5A 2WQPA 4LALA 2EO7A 5DBTA 1XS2A 3CL6A 1G6CA 3HB9A 3GFZA 1PDZA 3CUXA 3ARTA 1V0MA 1O1ZA 4GIEA 2ZX8A 2ZVIA 5A2CA 1VFFA 4KFNA 1GKRA 1C93A 2WSQA 4MPQA 2CLOA 3ABSA 4PMYA 4PN2A 1UMLA 4CCEA 1E0VA 5BMWA 2D0FA 4QR6A 3N19B 1R86A 2NQLA 4O14A 4TVUA 1EYEA 1WV2A 4JTQA 1TWDA 3T05A 4BI5A 1CT5A 2BNJA 3TCEA 3H4GA 3EX2A 1O5QA 3UXKA 4MYXA 3AZSA 4WD0A 1KV5A 1B3YA 4LC8A 1PZ2A 2PGFA 1AG1O 1TX2A 1S39A 1MXSA 2X1UA 3LCIA 2YZ5A 2I17A 3EOSA 2VZOA 1TA3A 2PDLA 2EPNA 5IOBA 3TA6A 1QI5A 4PB5A 3AMLA 3SW6A 1AQHA 3WJWA 4ZOAA 3BGJA 3IJLA 5LXXA 3QY7A 3E2RA 4U5IA 5K3VA 2FHBA 1SQ7A 3OU8A 4QGCA 2V2CA 3GY1A 1W5MA 3GRIA 1BG9A 2QGHA 1HJUA 4XWUA 5FACA 1ZJBA 1E1EA 2ZUWA 3W1MA 2VGFA 4US5A 5AHFA 2P8CA 3H12A 2J27A 4XVEA 1DE6A 3B97A 4G5DA 2FB2A 4O8AA 1CLKA 1V6XA 3HU7A 1OF6A 3RLHA 4QROA 4MTVA 1GTEA 4KEUA 5HULA 1SYTA 4GCXA 2XVPA 1R3TA 1UWUA 3FV9A 2ZTJA 1E4MM 3GDRA 1HP5A 4LBRA 5CXPA 1E72M 2OLSA 1E6RA 1QRQA 5FA5A 1WUEA 4AWUA 1ENUA 2W62A 1XC6A 2IW0A 4AY7A 4H83A 2KAUC 1FXQA 4PTNA 3HG2A 3PUGA 4LS2A 4QEHA 1HJXA 4ZOCA 1IR1A 4I5RA 3VCCA 3LPFA 3O7UA 4L64A 3USZA 4EVZA 3TW9A 4DN1A 2W67A 1UQZA 3WLTA 3H26A 4J3UA 5CC5A 3BG9A 1F74A 5F2IA 2CYGA 2AMXA 4C60A 2UY3A 5U7SA 1P0EA 3O05A 4JY8A 1ZBWA 4ACZA 4KETA 3M0LA 2X1TA 1JXKA 3NYZA 4JX4A 1E43A 2PRHA 3B4YA 3CAVA 4MNLA 4NSBA 2V5JA 3ARPA 1JGMA 1CGYA 4HSOA 1SZNA 1ICQA 3GTFA 1GZJA 1SO3A 1QNSA 1KLYA 1V6YA 1JQVA 3BLPX 3WFLA 2GDQA 3W2JA 2PLMA 4FX8A 4XBJA 1UZ4A 5IDZA 1IF2A 3EWBX 4M19A 1RBLA 1W1A1 4B5NA 2OSWA 3WK2A 1WNOA 1S2TA 2D23A 3GKAA 1X97A 2DSKA 1KCLA 3ICJA 3EKGA 3KDNA 4JN6A 4MAZA 1XFBA 1E71M 3AUOA 2FPYA 4L6HA 3C5QA 3WIJA 4K7YA 1GJWA 1BFNA 3ANYA 3EGJA 3VFCA 2CLEA 2D73A 1J79A 4R3UA 1CYGA 2WNZA 4EE9A 2YB1A 2XZ7A 3MU7A 4BHYA 4C1NB 2O9RA 2XVNA 3W7PA 2DVTA 1B3XA 1EIBA 5A6SA 4MYAA 2V68A 1MFVA 3VUPA 1W1TA 2DIEA 3OGSA 2J77A 4A05A 1E56A 1V8EA 1VC4A 3P67A 1VFOA 1CX9A 4IP5A 3W7LA 4CD5A 3T2OA 4XKMA 3D3FA 2Z1BA 1SW0A 3S5ZA 3ELFA 5BU9A 4JICA 4YIWA 2PWVA 4GXPA 2AQWA 4JFUA 3EX4A 1XX1A 3PBGA 2ZZ5A 3BLDA 3L0KA 3SCNA 3EDKA 1P5BA 3ZWSA 1CGUA 3BQ6A 3CPRA 3ABXA 1NH6A 2J6XA 5F4SA 3ALGA 2V0TA 2GQAA 4FLQA 5IRPA 2GSEA 4LS0A 4C6DA 1IR2A 3N29A 4AHPA 4XO6A 2ATMA 3AYTA 2Y4SA 3HGJA 1KM2A 3IRSA 4IP4A 1VBGA 2VT0A 3BDKA 1EJSC 3NO5A 1KWKA 4GKLA 1TWIA 4I7WA 2PU0A 4NJHA 2WNQA 3AFBA 4DPPA 2PWEA 1ISWA 2Z2UA 3AZTA 2Y1HA 1J10A 5E70A 4ZA0A 4AC1X 4JYEA 1O5RA 4PMDA 1LUCB 4W89A 5EBAA 2PP3A 4IH3A 3FKKA 1QR7A 3RHGA 4CNTA 5A6MA 2OYMA 3W1UA 1QVBA 3CMFA 4EAMA 3CUJA 1UH4A 1E3XA 4HU4A 3RO8A 2OB3A 4D6DA 4GO9A 3C2OA 2QF7A 3WLMA 1V93A 3OEXA 4A22A 3EWXA 3QGVA 3WH6A 3M0YA 1ONRA 2VC6A 1KBBA 3LOTA 4D72A 1OX6A 3N2TA 3QSTA 2ISFA 2G4JA 4GYJA 5HNNA 1AL7A 5KINA 3HPZA 5I06A 4C65A 4LYPA 1JYVA 2VR2A 4PTMA 4TTGA 4QS6A 2ZX7A 1JCJA 2VYOA 3R7MA 3N15A 3IIVA 4DJFC 4TVDA 4AZ6A 1BEUA 3CEUA 3MSGA 2V3EA 3VOCA 3SI9A 2VNCA 5T26A 2I16A 1W5QA 1KD0A 1E4IA 4WDXA 3O9NA 3NAVA 1W3KA 2FH6A 2FGZA 2BBFA 2IPJA 2OJPA 3LI1A 1KC7A 3SO7A 3CEPA 4JYFA 3U4FA 3GW3A 1L2UA 3R5EA 4GQQA 4LOCA 4L4MA 3CIWA 4ACZB 4M6VA 1CGTA 5REQA 5I3DA 3S2LA 3VK5A 3UG3A 1XIGA 3G0SA 1F4HA 3AIVA 4H04A 3CZGA 5C9UA 3PBMA 4S38A 2JQXA 3A9BA 3B0PA 2ZZ1A 2FTWA 3WQ6A 3VMPA 1AMYA 2XINA 1DHPA 2XG9A 3WDRA 4B3LA 2X40A 2VX6A 3FX4A 1Q7QA 3TWAA 1S2WA 1A3WA 2CBVA 2V67A 2WMIA 4U28A 1HUVA 4HSNA 3TMLA 1JDAA 4P8WA 1J11A 4JKLA 3RG6A 4PFHA 5D9OA 1AQFA 1R3QA 2YA2A 3FLUA 1KM3A 2CETA 5C0QA 3QKEA 1OWQA 3SAZA 2DZUA 4O11A 1RH9A 4E6MA 4UQCA 4DI9A 4LFYA 1JCXA 3M0HA 4O28A 3RCMA 4UTKA 2XH7A 1DXFA 3W6MA 2Y6ZA 4MNKA 4B5VA 1JZ6A 3CWHA 3CIVA 3FAXA 1UKSA 3NQVA 4R5EA 3BMVA 4AYGA 1C8QA 3QYSA 3VKAA 4JTAA 4Q8QA 3WEOA 4XAPA 1EUAA 5E9XA 3VOJA 4JX6A 1ECQA 2EF9A 3W6YA 4L9XA 1IXOA 4POCA 2WANA 3OO2A 1SZRA 1B30A 2BHYA 1RCOB 1C8VA 1BYBA 3R11A 2FPVA 1SR0A 4EWJA 3ALFA 1VFSA 3TQPA 4QTGA 3BCFA 1ZJHA 3VD3A 1Z7AA 1B4KA 4OFCA 3G1SA 2X09A 4FLOA 4X2RA 4UTLA 2E9BA 3ZWTA 5F4XA 3R0UA 4M5PA 2BHZA 3CWOX 1I1WA 1GOQA 3DX5A 3LX9A 5FJUA 4XZLX 4Y7EA 2ZA1A 3E3HA 2PDKA 2IXUA 4ORMA 5LNRA 2V3GA 2REQB 5I77A 1UD8A 1GVIA 4DWSD 4WY0A 3MANA 1B9ZA 1VB9A 2TAAA 4H00A 2YDAA 3WK3A 1NDYA 1KM4A 3YPIA 2EKCA 1ZJAA 3BOLA 4EPKA 2I7GA 3NA8A 3GTIA 3BMWA 3VCNA 1VZWA 3BLEA 3HMCA 3PANA 3QV9A 2DZSA 4W93A 3EEZA 5DX7A 1BGAA 2V5CA 4GJJA 2PWDA 1YTKA 4B92A 3G3DA 2QHAA 4BWLA 1J0IA 3OVQA 1SJAA 3LPGA 1HF6A 3WUFA 5T8GA 1QO5A 4XK2A 3WN6A 4GNJA 1TRDA 4JTCA 3UWVA 4XQ6A 1ECEA 1Q7MA 4FEZA 3WQ5A 4WZHA 1N8IA 1H11A 1ONEA 3L4WA 5CJMA 4MWAD 1DWIM 5A1AA 1QASA 2ZYFA 4GUJA 3MKKA 4LPCA 2GGEA 1CZ1A 4CD7A 4NAEB 4UR8A 1XWYA 1LL7A 3W29A 4DEFA 4NYYA 1KR0A 1WKYA 4C6BA 1BXCA 1X96A 4FSAA 2CU0A 3GDKA 1GYMA 3LUTA 4G6CA 4XZWA 2PEVA 2JEQA 3ATZA 2B7QA 3OOQA 3OVGA 3TE9A 4NP7A 1LOLA 1SJCA 2PSNA 2ODOA 4OOZA 2YCJA 3QEZA 3VNMA 2Z1KA 3EX6A 3WNMA 3VABA 4XIMA 3O2LA 2PWFA 3TV8A 1Q2SA 1TB3A 1LOSA 3RRAA 4PUKA 3FHQA 4I5XA 5K4XA 2Y88A 5G1TA 3FHAA 1WDDA 4GZIA 2W63A 3LN3A 1K9TA 1S5WA 2D2HA 3NWRA 5G5IA 1MRAA 2XYLA 5LNSA 1YNPA 4DM1A 3UWQA 4ZSTA 1M1BA 2Y8KA 4HBKA 1RHCA 3V0UA 1PHQA 3NIYA 3MS8A 1OFBA 1KA9F 5LGZA 3F2BA 3E49A 1CXHA 3AMGA 5LIUX 5LNUA 3CQJA 1B2YA 4HJWA 1OHLA 1QW8A 2GUYA 2CLPA 4H9TA 2XJ7A 4WCJA 2YCIX 2E5DA 4HMEA 5BNKA 1J5SA 4FNRA 1MYRA 1JDCA 1KGWA 1MEHA 1OFAA 3T9PA 1Z3NA 4RDZA 1WZMA 5BXPA 2BGQA 3ZM8A 1DP0A 4QG6A 1XIBA 5BOOA 3DYMA 3BV7A 3H55A 4JIPA 3MP5A 4IFKA 4YVVA 3B0VC 2XUCA 2QJIA 1F73A 1JDDA 3GDMA 3W7QA 2E8ZA 3FXYA 5B80A 1IQ8A 4TOQA 4ZZ9A 3KRSA 4KEMA 2J7BA 3CYJA 4LUSA 2FVLA 2Z27A 1HL9A 4DJEC 1OD0A 1CB7B 2CHOA 4AHQA 5BCAA 4UOQA 1VJZA 3E6EA 4DYEA 1REQB 3KTCA 4NAFB 4PTXA 3I6TA 3W75A 5CG0A 1DBTA 1U5VA 4CVWA 3O6DA 1NSJA 4DELA 1GYNA 4ICCX 4PMUA 3D46A 3NZ1A 3JZEA 2O4QA 5CJNA 2HTMA 1EGMA 1EH9A 4Q4OA 4UFIA 3T2QA 1A80A 1UKTA 5FJRA 2CBUA 3STEA 3FXGA 1IGSA 1F05A 3AS3A 1V6UA 3BGAA 4X0NA 3TK7A 3OZPA 1WDRA 3BW4A 3BK0A 4MY9A 2Z2BA 3TQKA 4GE8A 3BMXA 2YW3A 2ZUMA 1W91A 3THCA 3WMSA 4EKJA 4AUBA 1EXBA 1HJQA 4BR1A 1TQXA 3VD5A 4DB7A 1Q6CA 3L68A 1KFWA 1TPDA 3KBJA 4LCQA 3V5OA 4HCDA 2X1IA 1ICPA 1PX3A 1I6NA 3O07A 4GHRA 4Q8UA 3M41A 1R2TA 1SSGA 4LYQA 3S1WA 4JCMA 5C54A 3UZYA 1D9EA 4MNMA 4AIBA 3AYVA 4NQ1A 3CAQA 6REQA 3R58A 4H9XA 2WM1A 3MYPA 1ICSA 3HG3A 4QIUA 3SCSA 4QQUA 5TQLA 1GPWA 6XIMA 3LCXA 3NFUA 3W02A 2JGYA 3ERPA 2QUVA 5I3JA 2NXGA 3NR0A 2OQHA 3CL8A 3P0WA 4IMGA 1CDGA 3L4UA 5FESA 4EPBC 4ORIA 5DXXA 4AZCB 3URAA 4P7OA 1NWTA 3P3BA 4REQA 1UD4A 5A6KA 5E6YA 3W9ZA 5J5DA 4IJRA 4N9BA 1DIOA 4IGSA 1YKWA 3TC3A 4MWAE 5H1WA 4A8IA 3VX1A 2FHCA 3CT7A 3BSMA 1XKJA 3CB8A 2FZ8A 1LG1A 1REQA 4ZEPA 3WJYA 3IAPA 4GK8A 4BKNA 3M46A 4LEQA 3UXIA 3WK1A 3N13A 3TYAA 1NELA 7REQB 4ACYA 4JD4A 2HEJA 1XJBA 1V7YA 5XIAA 3M7WA 4HTYA 1P43A 2BY2A 2ZQ0A 1JXJA 5LZLA 1E15A 1W6TA 3UG5A 3IVUA 1T99A 2RDWA 2XSXA 3W72A 4LY4A 3IANA 3QR1A 2INZA 1GVYA 3MHUA 3HO8A 5JIPA 4NF7A 1BXBA 3TN6A 1YNQA 1B4EA 3GNRA 3BOFA 2YCLA 1WKFA 4QE5A 4E2BA 1V79A 1VH7A 3MI2A 1B3ZA 1IXPA 1R6WA 3H22A 4H9VA 4GACA 5L9FA 4NRRA 3S9IA 3EWYA 2GJNA 3MUCA 4INFA 3N12A 4IMDA 2VM8A 4H8NA 4J27A 4I7UA 2WVVB 4AEFA 2PDPA 3JRKA 3WLHA 3G77A 1PCWA 2YSWA 4M29A 4X3ZA 1MXGA 1XW8A 1M53A 3ZT6A 3H2EA 3PSVA 4R53A 2Z6IA 2PLCA 1XYLA 4X9YA 4RNJA 3IGSA 4JKMA 1E6QM 5I2UA 3EDJA 3W83A 3V75A 1BYCA 1F6KA 1GJPA 1S1RA 2YA1A 4NI8A 4NHVA 5I5RA 3UEQA 4QEEA 5HR6A 4MUZA 1EB3A 5FI8A 4HNTA 3TN5A 2A3LA 2ACSA 5DEZA 3WO8A 1EDGA 1V3JA 2NVCA 1EJWC 3KLKA 4JTSA 4E8GA 4B4HA 3E12A 2Y8UA 2I5IA 1X6UA 4UNLA 5HMFA 3E74A 3Q58A 4GKTA 1ZNNA 1YQ2A 3S5SA 1IHIA 1JDFA 4EACA 1MZHA 4GUFA 2NV2A 2VQTA 5C9RA 1UR4A 2WVUA 4IF2A 4P2VA 5E9AA 2SFPA 1KFJA 4FOJA 2C16A 1GOOA 4XD3A 1FA2A 1ODUA 4AW7A 1IEXA 4OUIA 1PPIA 4AD4A 5TD4A 1R5YA 3MTWA 3ZYZA 4G9PA 1LQ0A 2OODA 2P0OA 2DDXA 2ACQA 2PDFA 1DE5A 2Q01A 1TPUA 1KGXA 4IIFA 1H4PA 3H21A 3ZXWA 4D6CA 3VNZA 1FWEC 4U3CA 2QR6A 1ZAJA 2QT3A 1T5AA 4OT7A 4DQWA 3WLRA 1XBVA 2Y0FA 4US6A 5CSUA 3P5YA 2FHFA 2XIJA 4Q4RA 3BLKA 3ANUA 4KFOA 3K13A 3GU9A 4IMEA 4K6AA 1P1MA 3IARA 2JFEX 4KCTA 2PE4A 3UWYA 1GQLA 4XX6A 1WB0A 3C2VA 2DZTA 1KO0A 1UH2A 3GAYA 4I8YA 1N55A 3DYOA 5EBUA 1PAMA 2DUAA 2PP0A 3CC1A 1CPUA 3LU2A 4NZ5A 4XIAA 2CWXA 4ZFMA 4N6EA 1GOXA 4A3UA 4U3AA 4RKAA 1EP2A 1JPIA 3SURA 4V1XA 3TR2A 2CKSA 3AXHA 3QQ0A 4GXWA 2REQA 3CZJA 1T8QA 3IEBA 3PB0A 1RVKA 2BVWA 2O7QA 3TTOA 5D38A 3CUGA 4F79A 1XGZA 4EP8C 3DGRA 6A3HA 2XN1A 1Q85A 3NCOA 3OVPA 2J25A 3OZOA 2GQ9A 4E0CA 4FALA 4B15A 3QLLA 4KWOA 3HIJA 3C56A 2ATSA 3NL6A 2FZBA 2NZLA 2NLIA 2NUXA 3BAKA 2O7SA 4WJXA 1H61A 3WQOA 2VDGA 1K7XA 4X61A 1OT1A 3O15A 2G3FA 1IT0A 3L7RA 3UZJA 3NXLA 2PDGA 4PL1A 3IGXA 1X1ZA 1VYRA 4AZ7A 2PZNA 4HA0A 2H3BA 3MBFA 4CD4A 2AL2B 5I00A 1BQGA 3WQEA 1PB0A 2GFTA 3GG7A 1L8NA 1BSIA 1GTHA 4O1AA 4RL3A 3LM7A 1BHGA 4E2DA 4H6KA 2C15A 1J93A 1R47A 2NT1A 2CERA 2RJHA 4UTWC 3NQAA 1NAL1 5HQLA 3LTYA 5A6BD 4LAOA 1NFGA 1F6PA 4L6DA 4PUWA 3VDHA 4AX6A 3DHPA 3A6OA 4S3AA 4HMDA 2QVNA 2HRWA 3ZZ1A 3ARUA 2G3MA 4GBUA 1JVNA 2PTZA 1QBBA 3HQ1A 2VENA 4LV9A 3PS7A 3B8VA 4D6IA 4XSMA 3TAKA 5A2BA 2EPKX 2EHHA 4NILA 3DU0A 2GYIA 4UTWA 3GVQA 2WJEA 4S3GA 3URBA 4S2CA 3G24A 3RAOA 1EC7A 3IUDA 3NDYA 5PTDA 2CNCA 2EXOA 4KWVA 3GZ3A 2YZRA 4I9MA 1ZRQA 2A4AA 4O0ZA 2P1FA 1YYAA 4DJFA 1FDYA 4OUEA 8TIMA 3RITA 2I9UA 5E93A 1QNQA 3TYDA 1KRBC 3UESA 3W2NA 1P7TA 2E25A 1R0MA 4UZUA 3S2MA 1KFKA 4MFEA 3OLDA 2PRLA 2ON3A 4H7ZA 3S8HA 3QMRA 4IIDA 5CLTA 2Q6ZA 4O1DA 2EGZA 2E09A 3P81A 1Q45A 3AJXA 2HV5A 4UFHA 4ROQA 1SUXA 4KMQA 3FFSA 4YCOA 3L4XA 2YFOA 2NUYA 2C13A 1KGUA 3NQCA 1QI3A 3EMCA 2WPBA 4P5UA 2GK1A 5BROA 2E4TA 4MHBA 4IOTA 1BF6A 4H19A 4C1LA 1C8YA 1MO0A 1C90A 1YTDA 4EPEC 4F2BA 3BSHA 5CPLA 1A47A 1LBMA 3AO0A 4UCFA 2E6DA 3PBUA 2PF0A 4O17A 2Y7EA 2A0NA 1FCQA 4LRTA 1KCKA 3IGUA 4QE1A 5CZKA 1RQBA 1UKOA 2QDDA 3Q67A 3V4BA 3UZ5A 2BXYA 4P7NA 1J4EA 3M6DA 1XQKA 4AWTA 1TR9A 1UR0A 1V3MA 5IFTA 3KWSA 4FOUA 4IT1A 1VGAA 2KX9A 4WY0B 1YW1A 3BLIA 3CO4A 5A8MA 2J66A 3IK4A 4AD1A 2CWNA 2D2GA 4HOZA 3UPWA 3PPCA 3ARXA 5FJTA 4ML9A 4PB3A 2BP1A 3LYEA 1TJPA 1RPXA 3IRDA 2B7OA 3CASA 2HBVA 2P0IA 1JCNA 5FOOA 4CNOA 3U0HA 5A6BA 1OABA 1UYQA 1WOBA 4E4UA 3UWUA 2VO5A 1S5TA 1GVOA 2I9EA 1W3JA 1RD5A 2HVOA 1EJTC 1SJBA 3GWQA 1VENA 5BWFA 4W5ZA 2EAWA 1FHUA 1EIXA 4B5WA 2F9RA 1TX0A 4ZODA 5E0CA 4D6EA 2FFIA 4YHEA 5CPSA 4GGBA 1YDOA 3DIPA 4WR3A 3VNIA 4OU1A 5F1VA 4DX3A 1W1B1 4L1GA 3WF3A 3O0FA 3PTQA 4WJ8A 3B9AA 4AVNA 1FWDC 3LGEA 3G0UA 2YDRA 2ZADA 3PZIA 1HT6A 3W1XA 1MNSA 3L0GA 3P8IA 4WSJA 3TSDA 2DSVA 1NP2A 1TVPA 4MY8A 1V08A 3W01A 3PPGA 4ZO6A 3BG3A 1K7EA 2B7PA 3R89A 2BXVA 3E5PA 4LYRA 2WJZA 1B3WA 4FNUA 1VHCA 5AC8A 4L4PA 1G4PA 3ZT5A 2PC8A 1X39A 2HXTA 3CV7A 1PTDA 4O16A 2WXDM 4ZFCA 4ILSA 3IVTA 2QJHA 3T0DA 3GUGA 3ZS4A 2ICSA 4LCRA 3PUDA 4Y2WA 7TIMA 2Z7GA 4NAFA 3U5UA 1C3FA 2HPIA 4H7VA 1ZS2A 4FF7A 3E02A 1BWVA 3AU2A 1VAHA 4QSFA 2VX4A 4HHPA 3TOPA 4B9ZA 5BRQA 4NZ4A 2GK1B 2TRSA 3KCLA 5HWNA 3G1DA 2AQVA 4FPSA 2OCZA 5D2VA 2ISDA 4CNPA 1JEZA 4D6HA 3EX1A 4PYSA 1G4EA 2FDSA 2GZXA 1ZU8A 3NQ6A 2OKTA 4O13A 3WF1A 4NJIA 4LUJA 4R7JA 3V5CA 2BZNA 1RJRA 3P2VA 1QBAA 2WKJA 2ZUNA 1NP0A 1FWIC 3S5YA 1QJWA 3GNXA 3POHA 4Y9AA 4RZBA 3LTPA 1MUWA 1X1OA 2EPHA 1HG3A 2BOGX 5CKSA 4Q7IA 1E5JA 2QDEA 4GC4A 2A3AA 3GDTA 1AW1A 3CZ8A 5BRPA 1SW3A 3WYZA 4I5UA 1EYWA 1VEMA 2I14A 3GHSA 3F4VA 2UY5A 4KWSA 4IL0A 2ZA3A 1UC5A 3SUVA 1L6GA 5KZEA 4DO7A 1TPWA 2ZBTA 1WDWA 1I2PA 5DT5A 3AQUA 3DFYA 3BPWA 2VZVA 5CC6A 2INFA 1XLKA 3W81A 5ECVA 3DFHA 5A8OA 5FCZA 4U4MA 2ABBA 4HSHA 1XXXA 2OU4A 4ZGYA 2DY3A 4D8ZA 2PA6A 4NZ3A 1RD6A 2DT2A 3GH4A 4KEZA 1R3VA 5D2WA 5CC3A 4Z2KA 3UY7A 4ONVA 4GY7A 1NDVA 5ABFB 1VIWA 4HPGA 3A5VA 3FN9A 3KZSA 2IMRA 5HNTA 4JTRA 3D5HA 1VBUA 3N3TA 5LHFA 4A3QA 4REQB 1I0DA 3S2NA 1MUMA 2QCGA 1Y8BA 1W0MA 2PDMA 4QDPA 4C91A 4RE4A 3OVRA 4GABA 5HMDA 2JK2A 3OA3A 4D1JA 1XIDA 1WCGA 3C2YA 3LXCA 1J0JA 2MUCA 1UWAA 4J1OA 3RM9A 3WJSA 4TVCA 3PJXA 2PBGA 3RLUA 1OIFA 3TFXA 4B16A 1EDTA 4DBSA 3GNDA 2FJUB 2E6AA 4DXVA 4LU0A 3P62A 4ML4A 3T09A 4D6FA 3EPNA 2ZZ2A 3TOYA 4DJEA 3NXFA 2WLYA 3RPTA 3CO8A 4C6PA 1Z8AA 7ODCA 3REQB 3L4TA 4A2SA 3GS6A 5AZ1A 3AWNA 4O18A 2HZGA 3O1NA 1FRBA 5HXMA 1WBJA 1VFTA 3S83A 2DPEA 2P10A 4GFIA 1QHZA 2DFAA 1L2QA 4MF4A 3N18A 3P0XA 2WBKA 1BVNP 1GORA 3WBYA 4QP0A 2PGRA 1GG0A 2GJXB 1AW5A 2E68A 4J3TA 5E09A 1R7OA 1DVJA 2BXZA 2XIIA 3UF9A 5F2GA 4IX2A 1TFVA 2FZNA 3BV4A 1H1NA 2NLYA 3DHDA 1PBGA 2V6AA 1E0UA 2O9OA 4R9OA 5HATA 1W3LA 4EANA 3S0CA 1ADDA 1NF0A 3KCOA 4LXFA 3SY1A 1E73M 3IGHX 3DC0A 5D37A 3K5XA 3OTRA 2YXOA 1H49A 5F2MA 2YCEA 3PWGA 2YX0A 3GFYA 1S46A 2GVJA 3R0KA 1U83A 4JYDA 2OLAA 4GQGA 2D22A 4JN7A 5LXEA 4AFYA 4H4IA 3LPPA 4RV8A 4QNEA 3M7SA 4AZHA 4QBXA 4IJBA 2ZVRA 3TLQA 3DBPA 3E0FA 3WQ4A 3HFTA 3SN4A 4WHBA 3M5YA 2C1GA 4H9ZA 5AOUA 1JNEA 1YMYA 2DQWA 1US2A 1KBLA 2QCNA 2HISA 5JIWA 5CAHA 4DF0A 2W79A 1MI3A 5E6ZA 4QRNA 1TJRA 4DXXA 4CEXC 2BGNE 1AVAA 3A4XA 2QCHA 3VNJA 5A6LA 1XYMA 4R27A 1HKWA 3OLEA 3GR8A 2RDTA 1R3SA 2J24A 1KWGA 1LT7A 3W84A 1QOXA 5C2XA 1ZL1A 3AMDA 4HZ6A 5EU9A 2QJGA 3HQPA 3O06A 3S9YA 3PNUA 2V69A 3NQ2A 3WNKA 1OSEA 3ZSSA 4OVXA 1J8VA 1KM1A 4ZTYA 1FFRA 1JL8A 1VF8A 4BQ5A 1A5BA 3TTYA 4GYKA 2G50A 1KBJA 3KHDA 2J8FA 4IX0A 1OBAA 1R9XA 2XIMA 1LJYA 1CXIA 1UCWA 2PWGA 4I3GA 1Z44A 4LAZA 3QKZA 2YYUA 3F03K 3I6RA 1H41A 4MNJA 2ZXAA 4H8UA 4HN8A 3WBWA 1OB0A 1KXVA 3MKCA 4Q7NA 4PSRA 1MQRA 3MYOA 2YKKA 5HMEA 5AVHA 1VBHA 2ANUA 1XLAA 3GXMA 4JIRA 1QNRA 2WJFA 4MLRA 5FJJA 1JRCA 1H7RA 3CYVA 1IT8A 4CU8A 2CEQA 2HJPA 2BTMA 1LM1A 1E9ZB 4BZYA 1UQYA 3KL3A 1ISZA 4BCEA 4TUFA 1H7XA 1A3HA 1AUSL 1UPMB 1IEIA 3M5VA 4NI3A 1AH0A 3F7JA 4DAFA 2E1WA 4C6MA 1TWWA 1L6FA 2YBVA 1AZ1A 1OT2A 4W87A 4W7VA 1Y5XA 3RYSA 4LY8A 3LDVA 4FZIA 1AH4A 4UMCA 1Z42A 1QU4A 1TE1A 3CZEA 1SO5A 3UNTA 1PWLA 1JYWA 1SMDA 1DWAM 1WXJA 1OFEA 1LP6A 3PB2A 2WMHA 2GSJA 3R8HA 1RUSA 1WBHA 2E5BA 3VD4A 3FEMA 4DVOA 3PULA 2VFFA 1CGXA 3UT0A 5FEZA 3RM8A 5HWJA 4JTEA 3QYQA 3BQ5A 4TV5A 1O7AA 3ME3A 3BURA 2R1NA 2Z2AA 1KFLA 1MSSA 1TO3A 5A94A 3AIQA 1U33A 1A0EA 1B57A 1W37A 3ECQA 2C7FA 5HWMA 3SGZA 1E9LA 1KCZA 3VM5A 3VO0A 3DHUA 3TMQA 1KNWA 3PPFA 1XHGA 4JBRA 2OZ8A 3GHRA 5ABEA 1R7AA 5I79A 3RF9A 1FY6A 2QAPA 3PUEA 2XFWA 4RDYA 4CEUC 3FDGA 3L66A 1GVRA 3ZJ8A 3I7RA 4CCZA 1NARA 3LA4A 4JFWA 2Q09A 4GI8A 2CZEA 3CQ0A 5BMXA 3B9OA 3W53A 5KZMA 3TTQA 1PVNA 3KVJA 4PB4A 2AL1A 4ZR8A 4I6KA 2HXUA 2P53A 4F4RA 3VI2A 5I23A 3L4ZA 4UMBA 5HAOA 4R34A 4IG2A 2E3ZA 5D4YA 1R3WA 5AB3A 4GH3A 2NX9A 2F84A 1BAGA 3VTRA 1LG2A 4V15A 3CQHA 2RKXA 1PZ0A 2WZTA 5CBBA 1YPFA 5FSDC 3FJLA 1YBQB 2VFEA 2UBPC 3EWZA 1DQWA 4J35A 2OOGA 3WQDA 1W2PA 3NQ8A 8XIMA 4DWSB 3SUSA 3SGUA 1XCFA 3SB0A 4MDOA 3KCJA 5HBFA 4UCGA 1KRCC 3ONCA 2W0UA 2FDMA 1UHVA 2YXGA 1OGBA 4UC5A 4ZQRA 2R1MA 4Y9OA 3HJEA 4XZIA 4GC3A 3WQ8A 4ZTXA 4IQLA 2X1RA 4PCSA 3CHEA 1XLDA 2AKZA 3MUAA 3EDEA 1EFZA 3VINA 4FP1A 2ZZ4A 4LUSB 4G7EB 3FS2A 3PPHA 4DO5A 4QHRA 3CT2A 4IP7A 1X1NA 2OLHA 4Q8NA 2KZHA 4UQEA 4DYKA 1Z32X 1A49A 1XLEA 4OKDA 2DT1A 1NVMA 3KBWA 2YR1A 4S3CA 3BAYA 4UQAA 3GIYA 3UZZA 5IHRA 2WHMA 3M07A 2EBNA 2CHNA 2G5WA 3PTMA 1LLOA 1FH7A 3S6TA 3OB8A 3FNDA 2QXWA 1G4SA 1EBGA 3AIEA 2BVTA 3UETA 3P93A 4NJGA 3CXOA 2QPUA 4GLEA 4C6NA 3UVIA 5GVJA 1UOKA 2VCAA 1WUFA 1XLFA 2D3NA 1FH9A 3LHVA 3AYRA 4C6CA 1ZCOA 3VIMA 2ALDA 4JXCA 1JCMP 2PP1A 4J40A 4PRRA 3IACA 4UUIA 3G6LA 4Q22A 4WJEA 2RUSA 3WL1A 1X7IA 3BZJA 3T78A 3VKBA 4V2XA 1TYGA 2X2GA 3CH0A 3N4FA 2EKGA 1XYFA 2Q3OA 5LA2A 1BSLA 2PDXA 2UZ9A 4N6FA 4YTRA 5F1UA 2R1PA 1MFUA 3MSRA 4B5SA 2X30A 4HU8A 5FF0A 4LWWA 4RCXA 4QCFA 5A2AA 5D32A 2OTDA 2Z00A 4WRHA 2QUTA 4CD6A 2QAFA 5AKQA 4PMXA 2VMFA 4AD3A 4D9PA 1E6NA 4MJ2A 4KGJA 1JUKA 2F6XA 2HWGA 2XM2A 4XBKA 3CZLA 4PCTA 4Q8MA 3UZXA 1J0YA 2VCBA 1L8PA 2UY4A 2NX3A 3DFSA 2ZRUA 2XISA 4ZVJA 1L6WA 3NYDA 2VX5A 1Q5MA 4EF8A 4P7RA 3DFQA 4G7EA 3ZQ9A 7CGTA 1JZ8A 3VC6A 3S1GA 2QMKA 2X2YA 3RXZA 2XH0A 3PVFA 2AOSA 4Z1CA 3NNTA 1GOIA 5HNUA 4H6EA 7TAAA 4RNIA 2QS8A 3ANVA 3F4DA 2B4GA 1ZQ5A 4DUXA 1SJDA 3GH7A 3I68A 3R8GA 1DJYA 2ZC8A 1OZQA 2HROA 3PZQA 4L61A 3QHMA 5CPMA 2J8GA 1QPKA 2A6NA 1D3GA 1XLCA 1FWCC 1KTCA 3MHGA 3LRLA 4TO8A 4U31A 3CHDA 3RDKA 3RRXA 2P8BA 3T7VA 4YWSA 1F07A 1K4HA 4DBEA 1H3GA 1H51A 1UD3A 2ZUVA 5C70A 3MDUA 1E6ZA 1JQXA 1PKYA 2G95A 4AY8A 2AL2A 2OQLA 4DWSC 3WENA 2QV5A 1UR2A 4CQAA 2C71A 1LBLA 2WSYA 4QJ3B 5LA1A 1EHAA 4LW7A 5ABGA 1PZ1A 4G2DA 5AHNA 4ZB0A 5DFAA 3QHOA 3K1GA 3M47A 3OJGA 1M5WA 3OPSA 3RX3A 2PS2A 1AH3A 4UTHA 2PLJA 3T8LA 5HNRA 4S3DA 4DUWA 1SU5A 4DRSA 5CGMA 4RK8A 1C92A 4J28A 3FGCB 3KWXA 3GYEA 2PD5A 3E2SA 3ZIZA 4JNYA 1TPB1 4Z2JA 3CUZA 2OOFA 4XAFA 1OC5A 3UYCA 4GXMA 4QX4A 1LUCA 4A6GA 2PC4A 5AFDA 4GIYA 4NYUA 5C5YA 1WZLA 2P50A 4LEFA 1ZUAX 3S1XA 2PWUA 3KZPA 2WOQA 1LL4A 3H23A 4A3RA 3CTLA 2EPOA 3PUOA 5FL1A 4O1BA 3A3WA 1M3UA 3QV7A 1LOQA 3B9DA 4OQVA 2OVLA 3I3BA 2E8YA 2OXNA 3GR7A 3ZJ7A 4LGXA 4MM1A 3WBAA 5K2ZA 3HQNA 2PODA 3UCQA 3MMDA 3NUKA 2V5BA 3CMGA 2QIWA 4GIAA 3UJRA 1XCXA 2GWGA 1Q4WA 2F6KA 2ZZ3A 3SRHA 1VYPX 1OQFA 2GGIA 3KL5A 5EMYA 5LGXA 1VYSX 1MNZA 5BXTA 3W70A 2D2JA 3WLNA 3KLLA 1XBYA 4HN4A 3CLMA 4FLSA 1HJVA 1JPDX 1V3IA 3C2RA 4GX9A 1XFCA 4O10A 2DT0A 1JF5A 4HYRA 2Y7DA 4JPGA 4M56A 1FWFC 3CK5A 4M6UA 3WFZA 4AMAA 4DBWA 1KXQA 1JUBA 3IJ9A 2Z4GA 3ZJKA 3CB3A 4YMZA 4IIEA 3KBNA 3AC0A 4U5KA 6CGTA 7PTDA 1LBFA 3UGVA 2V82A 3AI0A 3FIGA 1EOMA 4H8HA 3I65A 2CLHA 1OF8A 1O95A 3EKLA 2E77A 3S2JA 3GNOA 2A1YA 2QJJA 3KVLA 3K4AA 3UYIA 1LZOA 4W7UA 1LLZA 3NOEA 1H7PA 3GH5A 2DSWA 4WDTA 3PWAA 1OCNA 1TRIA 1TMHA 2MANA 1XRTA 3LK6A 2ACUA 1UBPC 4ZO7A 2WC7A 1EA9C 3LRKA 3TP4A 4IL2A 1PIIA 2DP3A 1HX0A 3M64A 4KS0A 4AZBA 3KOFA 4C7GA 1QW9A 3IIPA 2F7FA 3V16A 1TV5A 3LZ5A 5DF0A 3GX9A 3OG3A 4JQAA 2PDNA 4A3HA 2ZKMX 3L65A 2B7NA 4HK7A 3FEQA 2X0YA 1H5VA 1GVSA 5CC7A 3RNDA 3NO1A 3LCWA 3SRFA 2VQUA 2R8WA 4GJ1A 1S2CA 1RBOB 2QNEA 3QC0A 5JU6A 5ENLA 5D02A 3S4TA 1GOWA 2A3EA 3PZVA 3CHFA 1T7LA 2Z6JA 3NPVA 1D3CA 4Z1BA 1XIHA 3SCUA 1KKOA 2JEPA 3UVAA 1TPFA 4J5NA 2J79A 2BOFX 1CCWB 3K2GA 3UR8A 4PEEA 4Z2LA 1L9WA 5C8BB 4I9TA 1K8ZA 3Q65A 4H3DA 1Y5VA 4XD5A 2R82A 5EGRA 2OWCA 4GPNA 4C6FA 4B3ZA 5K9XA 2J7FA 3GO2A 1R2SA 4JHOA 1SFJA 3UPBA 4HHMA 4I90A 3EA1A 4MJ4A 1UG6A 1V6WA 4QNWA 1W5OA 2PTWA 3G3MA 4XAZA 4IISA 3O6YX 2C1IA 2GJRA 3W85A 2PTDA 3DG6A 1U5JA 1TMQA 1OEPA 3ZR4A 2NV9A 4JTDA 3C6CA 1W9XA 2ZZ7A 4AYSA 4HZ8A 3MUZ1 5EB8A 3VIHA 1DJZA 5HK4A 3OLGA 1SZGA 5IBXC 3BG5A 3AXKA 3ZLFA 3GVGA 2QDGA 1Q13A 5AHLA 5GQBA 4DM2A 1WDSA 4U2YA 1XYCA 5C2CA 3P60A 4DF2A 3AZRA 5CH9A 1HNYA 4K1WA 1U1UA 3WLJA 3W1QA 3BW2A 4EIVA 3WQWA 1UP0A 3C0LA 3OZYA 2ZUTA 1S1PA 2G3NA 1CBGA 1DIDA 4PMNA 4K36A 2PUZA 1X98A 1ESWA 3PAJA 5C6MA 1M04A 3H6OA 3WD4A 1AJ0A 5A5WA 1FH8A 5DMYA 2YL9A 1XDJA 3R8RA 4IGHA 2WKLA 1YPIA 4ZOEA 1SGJA 3QZAA 2VUYA 1KB3A 2WSRA 4PBGA 2DT3A 4K8EA 1PO9A 4JZ5A 1WPCA 2V5LA 4N0RA 3W74A 1MQPA 3DYPA 1UD5A 8A3HA 3E38A 4MLJA 1K8YA 3ZSTA 3H53A 4MB3A 4N02A 3SN1A 1O12A 4PODA 3S1UA 1P0KA 3W7EA 3A4WA 4WKHA 3NQEA 2NWRA 3BSGA 4JKKA 3DG7A 4Q8WA 3TYBA 5HOSA 1Q6FA 5HA7A 4N9CA 4C5ZA 2ZX6A 4O1CA 4Y96A 1RCQA 3EPMA 1XYZA 2CW6A 3OHMB 3VZZA 3LENA 3DUGA 1ZLPA 5KMYA 4HCHA 3IUHA 4FK9A 5I07A 1VP5A 2C0AA 4AVOA 1FWBC 1TWSA 5GJPA 1H09A 4P8VA 5CZSA 2ZRZA 1UJQA 1JJKA 4URIA 1IEWA 4IZGA 2D69A 3VOHA 3W2MA 2WCAA 4CN1A 2D20A 1DJGA 4PCPA 2R9RA 5JH2A 4U10A 4DNMA 3P80A 3VD9A 5C7HA 4GZ7A 3BAIA 3AU6A 1Q63A 3MY9A 2VOMA 4ZQNA 1G67A 1B5TA 3RX4A 1TE6A 3AXXA 3QY8A 3AWOA 3DI1A 1U5HA 1D8WA 3C0QA 3E0WA 1QAPA 4F0LA 1DJIA 2XN0A 4Z2GA 1AJZA 3I3EA 2ZICA 1PCKA 4Q4KA 3VZYA 4JQ3A 3TX9A 1TWZA 1R9ZA 1T8XA 1Q6EA 3DC8A 2H6RA 3DERA 3OYZA 4KF1A 4NG3A 4XZBA 4ADTA 2VEMA 5AECA 4AX7A 4LH8A 5C9XA 1WDPA 3TZFA 3FA4A 4WQ6A 1TV2A 4IM4A 1QI4A 1V3HA 2R1LA 1K3UA 1ZAIA 4HVXA 2FJKA 2WMIB 5I02A 2OYKA 2ISVA 1VBRA 2P5NA 1K9EA 3WNLA 1V02E 2VELA 1PZ3A 3SDOA 4WEVX 4QXIA 5I09A 4I9JA 2ZZ6A 1RJQA 4JTGA 4O19A 2BVDA 2QDHA 2BASA 4PSPA 1ITCA 1TTIA 4ERAA 5EFDA 3B0XA 1EEXA 4GI4A 1H5YA 5E5CA 2P88A 2IPGA 2J7DA 1M6JA 4ZSUA 3DHFA 4V27A 1LWJA 4XVDA 1R38A 3KP1A 3MMUA 1QOQA 4QSHA 3UFYA 5JBFA 1KBIA 2QUUA 3S3GA 4BI7A 5SWUA 1JAKA 4WOZA 3NM3A 2VEKA 1HN1A 3ORWA 1P0NA 1FX6A 5KITA 2AKMA 1X8FA 4NKCA 1DWGM 2G97A 3ITXA 1KQYA 5IHSA 2E7FA 2PDQA 3S9ZA 1E51A 3SY5A 3INPA 3G1FA 1A53A 1EQCA 3WLQA 4G1KA 3JR2A 1D3HA 4WUIA 3CV1A 3I6EA 4Q4SA 3NSXA 3GVVA 3IPWA 3TN3A 4TMBA 1EJRC 4M24A 3W00A 1NQ6A 2OPJA 2VC7A 2AAAA 3T44A 5GJNA 5C71A 1UB3A 4L4OA 3H2MA 1TVNA 5A69A 3SSJA 2UWFA 1F9CA 2NQZA 3CL7A 3TJLA 1EPVA 1BQCA 1X6NA 3LLDA 4UQDA 1R46A 4QG8A 2DIKA 4C6KA 3DI0A 4LNYA 3N34A 4CQ9A 3WUBA 1KFEA 4NXSA 1I9CB 4BEUA 1UPPA 1TIWA 1JD7A 3M0VA 4F8XA 3FKRA 4RE2A 4ZBCA 3L12A 2CLFA 3CUIA 3N9RA 3STCA 1RBAA 3II1A 3GU2A 4W86A 1A5NC 1WQ5A 2CHRA 1U1JA 3BGGA 3H2CA 2MNRA 3QZ6A 4MB4A 4NZ1A 1V0LA 3WLPA 2PGEA 3AIRA 4FLRA 1T0OA 3JW7A 2FQIA 1D7FA 3VX0A 3CQIA 4M1RA 4NU7A 4S3KA 4MKSA 2OZTA 3MMTA 3VCRA 1K02A 5HUPA 4CU6A 1ELSA 4AF0B 1O6IA 3GYCA 3XIMA 3ARYA 4G56A 5AN7A 4J3VA 3T0CA 2A7PA 4OECA 2I5GA 2IKJA 3TW6A 1EZWA 3BJFA 5U4NA 1KCXA 4GI9A 4L65A 1UZ1A 1VFUA 2Z1VA 2EEXA 1YPXA 4PGLA 1M03A 4JR5A 1IT7A 1PHWA 3H70A 1JUEA 2HNEA 4U2ZA 4CKQA 5D2YA 5DT7A 1T96A 4HNCA 4AIOA 5AZ0A 4Y8FA 1POKA 1SR9A 3DKLA 4P8UA 2UV8G 3EWDA 1GG1A 4FR1A 2X1SA 4R85A 3TJXA 1RCXB 2GVYA 3E0VA 3SIZA 4ZB5A 2HDJA 3SY8A 1NU5A 3LGDA 1RJPA 4DBDA 5XINA 1YXDA 2YLAA 1XI3A 4K3ZA 2VVSA 1HIZA 2WW5A 4M7SA 3H24A 4J9JA 1B54A 3WH5A 2YLLA 1QNVA 1KXHA 3ITLA 4GX8A 1N8FA 1OY0A 3LCLA 4NIRA 3UPMA 5FAGA 4UFMA 3W37A 4HMNA 2YCKX 3QFEA 4L5ZA 3MUXA 2X7VA 1L6YA 4AZIA 1QHPA 1FWTA 1BKSA 4EXBA 1MEIA 1XL9A 1NFBA 4IJCA 1JZ3A 1E5NA 4Q8OA 3K8LA 3SRKA 3HPAA 1BYDA 3KRZA 3RLVA 1WE5A 3MWCA 1E6PA 1A5LC 6ENLA 2CC0A 3H7RA 3BAWA 3M0MA 1BRLA 5DCBA 1FP8A 1KM0A 3N2XA 5AYXA 2R1KA 4NNCA 1RZMA 2Z0IA 1OFRA 5LIXX 3HGOA 2E6YA 4PMZA 1IZJA 3U48A 4Z42C 2XTKA 4P7QA 4LRSA 4MDPA 3U2ZA 3ZT7A 3QN3A 5HDRA 4RZ5A 1ZPTA 2HMCA 1KBKA 4R88A 3O63A 1S3TC 3KRUA 1E6SM 3LHYA 5GNYA 2Y85A 4WGHA 1TMLA 4DJED 1G1YA 1HL8A 1HKIA 1GYLA 1C7SA 3EB4A 1W9DM 5F2LA 1CWYA 2GPTA 2RH9A 3G0XA 5JBDA 3BE7A 4JDYA 2W92A 3FCPA 4GD0A 4JTLA 1CXLA 3T0TA 4O54A 4NVTA 3EA2A 2G3IA 2O55A 2Y5EA 4L7ZA 3UU0A 2OT0A 3GTHA 3LG3A 2WK2A 3N1AA 1WX0A 3QTPA 1BYAA 1TV8A 4B5XA 4EF9A 4QITA 4EOUA 1DIKA 3BVJA 2EG6A 4W8AA 2W5FA 2GJPA 4IMCA 2ZA2A 3GXFA 3DFOA 3GHUA 4MB5A 3RGTA 2FIQA 1V4YA 6TIMA 2VD9A 1C7TA 4Q6XA 4NXKA 2V2DA 2YYTA 3UR2A 4E3VA 5I3IA 2ZRXA 1NWRA 1FWHC 3AIUA 2E40A 1H1ZA 2WZEA 3DECA 2ZCGA 2X0HA 4JL1A 1E0TA 2PRMA 3WMCA 3WD2A 2ONEA 4AIUA 5BW6A 5AYBA 2C1HA 2V3FA 4Q4MA 2ESCA 3U7BA 1UIPA 3L2LA 3B8TA 3RK8A 3M0ZA 1VFHA 3N3MA 1CIUA 1HVQA 1J9YA 4AWSA 4RXFA 2EPLX 5BRBA 2VEFA 4XD6A 4MADA 3VFLA 2WZHA 1PTGA 3PP7A 3WLIA 3UXAA 2FH8A 4C1KA 4RV3A 1EJXC 1I4NA 2YDSA 3FYOA 3NPWA 2CITA 2E1DA 3L5AA 3EDFA 3EOUA 3ZR5A 5DMMA 5D2XA 4XTIA 1XC4A 4AQLA 3DG3A 4F9DA 1M7JA 3QF0A 4O0KA 2E67A 1RQEA 1VEPA 5K9DA 2A6LA 3WD3A 3LPOA 4S2BA 2JIEA 5LIYX 5I3FA 3WKZA 5C7VA 4ATWA 3BWWA 1XDMA 3EB2A 3ONBA 3H2NA 4F0MA 3W82A 3EX3A 3EMZA 1E3ZA 1Q2RA 1IV8A 5EFFA 4NX5A 4UTTC 3VE9A 2V38A 1XINA 4CN4A 1OGGA 3T8QA 2V81A 2PTYA 5BXRA 2XSAA 3W88A 2CKRA 1ZB5A 2OZ0A 1UZHA 3KTXA 4K8GA 3IS4A 2JF6A 4LBUA 4IIBA 3B8DA 2YIHA 4IUOA 1J96A 1TTPA 3GB6A 3NVDA 3R79A 4IUGA 5C2GA 3IWPA 3LQLA 4FA3A 5EMMA 2E6FA 4QDWA 4IXXA 2GVLA 1P7TB 4UOZA 4QLLA 2HCVA 2Z26A 2VHLA 1HGYA 4RE0A 3QBUA 4R7WA 3TDFA 1UKPA 3VMNA 2YJQA 3LLFA 4D8AA 5FF4A 3MB9A 5T9BG 5H8MA 4YS1A 4UTIA 1E70M 1HZYA 4B91A 3GQYA 2V9DA 4O1FA 4H8VA 2VVNA 1PDYA 3NJ3A 4HP5A 3P82A 5KSWA 4RNFA 1NWSA 4B3KA 4BK9A 3W4RA 4F66A 1HKJA