1GYMA

Phosphatidylinositol-specific phospholipase c in complex with glucosamine-(alpha-1-6)-myo-inositol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
296
structure length
296
Chain Sequence
ASSVNELENWSKWMQPIPDSIPLARISIPGTHDSGTFKLQNPIKQVWGMTQEYDFRYQMDHGARIFDIRGRLTDDNTIVLHHGPLYLYVTLHEFINEAKQFLKDNPSETIIMSLKKEYEDMKGAEDSFSSTFEKKYFVDPIFLKTEGNIKLGDARGKIVLLKRYSGSNEPGGYNNFYWPDNETFTTTVNQNANVTVQDKYKVSYDEKVKSIKDTMDETMNNSEDLNHLYINFTSLSSGGTAWNSPYYYASYINPEIANYIKQKNPARVGWVIQDYINEKWSPLLYQEVIRANKSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphatidylinositol-specific phospholipase C from Bacillus cereus in complex with glucosaminyl(alpha 1-->6)-D-myo-inositol, an essential fragment of GPI anchors.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase (phosphoric diester)
molecule keywords PHOSPHATIDYLINOSITOL-SPECIFIC PHOSPHOLIPASE C
total genus 116
structure length 296
sequence length 296
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 1996-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 1gymA00
1DJGA 4QJ3B 1VD6A 2ISDA 3MZ2A 3QR1A 4PTDA 1GYMA 1ZCCA 3EA2A 5T9CE 4QJ4B 3V1HA 1O1ZA 2FJUB 4GNKB 4RV3A 1T8QA 2OR2A 2PLCA 1QATA 3EA1A 3OHMB 2OTDA 1DJZA 3L12A 2O55A 3I10A 4I90A 3KS6A 4R7OA 3QVQA 3RLGA 5T91A 4OECA 3H4XA 3V18A 3V16A 4QJ5B 2PZ0A 2P76A 1DJYA 5PTDA 3QR0A 3PTDA 1DJXA 2OOGA 4RW5A 3CH0A 4I9JA 4I8YA 6PTDA 4I9MA 3NO3A 7PTDA 5T9BG 1PTGA 1XX1A 1DJHA 4S3GA 4Q6XA 2ZKMX 4F2BA 4RW3A 1DJIA 1YDYA 2PTDA 3KS5A 1T6MA 1DJWA 1PTDA 1V8EA 3RLHA 1QASA 3EA3A 2F9RA 1AODA 3H4WA 4I9TA 4F2TA 4F2UA
chains in the Genus database with same CATH superfamily
3CGTA 4H04A 1V77A 1CXFA 4AC1X 2ZUTA 3R13A 1TZZA 2DSUA 4YLWA 1XRTA 3TV8A 4H8NA 4A4AA 4RPQA 4QS6A 3ORWA 4LUSA 3M9YA 2WNWA 3RK8A 1U5VA 3HIJA 4Q22A 3F1QA 4A05A 3EWBX 1DJGA 1X8CA 2G3NA 2CLLA 2FDMA 2NT0A 3NYDA 4B5UA 3GC4A 3C86A 5GVJA 4GKTA 2VL4A 3EEZA 3T08A 2OWWA 5E6YA 5K4ZA 5EPDA 2YFOA 4C6KA 2QVHA 3DERA 5AZ0A 3WBAA 2BHYA 2Z29A 5M1TA 3H7RA 1NP0A 4J2MA 4WJ8A 3CHCA 4AWUA 4XZWA 1KBIA 3AMKA 1XFCA 1K4HA 1TWIA 4C6OA 4LEQA 3W7EA 4PR4A 3TYCA 2KAUC 4AZGA 2X40A 3QKEA 1GOXA 3ES7A 5JBFA 2BDQA 2B7PA 3ARSA 2EQDA 2JIWA 2ZVIA 3G1YA 1BAGA 3QJAA 2BLEA 3LHWA 4GIAA 3LK6A 3D5HA 4CQCA 4MG4A 2VGBA 3SCPA 1CGWA 3E0WA 4ORMA 4H9VA 3DG6A 5DMLA 3LY0A 3RU8X 1K8XA 3BAWA 1ZJAA 3ABRA 4MYXA 1UH3A 3W2NA 3GO2A 3N12A 4GQRA 1V6XA 1JG9A 1E0WA 3C2VA 3LU2A 4NASA 1PB0A 3ITOA 2QUNA 1AK5A 3N4EA 1V08A 1X7FA 1OINA 4F0RA 1E0TA 3HV8A 1J2BA 1JPIA 4UB9A 3L4VA 1E0XA 3SCRA 4HN8A 3C2FA 4Q4OA 1W5OA 1G01A 4NRSA 1FHVA 4YL2A 1UW9A 2PF0A 1GOMA 5AHMA 1E1FA 1BSIA 4FPSA 2PDQA 3GM8A 2Z4GA 1UIOA 1B3YA 3VKDA 4QG6A 1TA3B 2OGYA 3CQ0A 3MI3A 2Z00A 4RNFA 1W1IE 1S1PA 1R3WA 4MOZA 3BLLA 2VCBA 3GTXA 3IJ9A 5EY5A 3FYOA 3M07A 3UZ5A 2DT3A 3A4JA 2XIMA 1YEYA 2WM0A 2HBVA 2FZNA 1VR6A 2GJXB 5IFTA 5H8UA 2ZYFA 2JFEX 1ONXA 3CXOA 1A5KC 1AUSL 1WZMA 2NVAA 4UNIA 4MVAA 3S9ZA 1JI1A 3H7UA 3UPBA 2AMGA 3UJFA 5D4YA 3SIMA 3TOPA 3K4DA 1F3XA 1KW1A 4QAWA 1XDMA 5ABEA 1GK8A 1PCKA 1TX2A 4HMEA 1EPXA 3OA5A 1QWKA 3EWUA 1NWTA 4X9SA 1ZLPA 2O9PA 3ARXA 5EFDA 1CLVA 4LB3A 3I4EA 1VYRA 2JK2A 1HFBA 3H2OA 2EF9A 3G3MA 2HWGA 5TAOA 1O60A 3K1GA 2HNHA 4PMJA 1OEPA 4PTVA 1EIBA 3BC9A 1HJWA 2WSYA 4J1OA 3AS2A 1UG6A 4DO6A 3L0NA 5LA1A 2WWDA 3IGXA 3WNOA 1RPXA 1E5JA 2F7FA 2P53A 1H1NA 2Z2BA 3Q45A 3ZJ8A 1D3HA 3ANYA 3GH4A 4I9JA 1C8YA 2PWVA 3S9IA 2Y1HA 2A7NA 2NLYA 4KQNA 4GE8A 1X1ZA 2W92A 1JDCA 3BICA 3NQAA 3M0LA 3M5XA 3L5MA 2X0SA 4L6OA 5C55A 4QX4A 3UJ2A 3K13A 1ZBKA 1XYBA 1G9HA 4PMRA 3RG6A 2GSEA 2Y5SA 2QHAA 4L80A 1Q2RA 4J5NA 1S2UA 3AXMA 3R8GA 1AW2A 3VMNA 2PGEA 4H9XA 3G1SA 5EBUA 3FDGA 4GRSA 4B92A 1SJBA 7TIMA 2J88A 3KS6A 5BCAA 3PBYA 2NQ5A 5TNVA 1PHQA 5HA7A 1VS1A 1UH4A 2VR5A 1HO4A 3QMSA 3TQPA 1TJPA 4ACZA 3CL8A 2YR1A 3LCFA 1UKQA 2X7WA 3TJXA 1F73A 2X30A 4GCXA 1ODUA 1X96A 2QDGA 2NX1A 2R82A 4QSHA 4Z1AA 4JQAA 2WZIA 4MJMA 4LNCA 2ZX9A 5C5YA 2Z1BA 2ZUUA 4K38A 2RAGA 1K1DA 1CCWB 4EPKA 3GTIA 4V33A 2A1YA 4N2YA 5F2LA 4HJFA 4RLIA 3GR7A 4TX9A 5FJRA 2R9RA 1FWEC 1M6JA 4JTEA 5CBBA 4YWSA 4JQ1A 5HQLA 4Q4KA 3LXCA 3DFHA 4V2XA 1UP2A 3ARQA 1WUEA 3UU0A 4JNZA 3O3RA 4CNTA 2Z1WA 2XG9A 1LQ2A 4IGSA 2UBPC 1CECA 1SFTA 2CXEA 3FDKA 4N9DA 1TV4A 2VEMA 4IPNB 2QUTA 2QMJA 3GD6A 5E0KA 5CSRA 4HP5A 3PB0A 3GH5A 2IKGA 4IX2A 1TVLA 3QLDA 5G2HA 3SUWA 3L7RA 1TMQA 1W54A 4XZLX 6TIMA 1FA2A 4FNUA 3LHZA 1GVFA 4F2TA 5LXEA 4NG3A 1ZAJA 3QR1A 1DXEA 4JQ2A 1CEOA 1RLCL 2Q8ZA 3CH9A 4LANA 1MUMA 2WB5A 3S1UA 1QATA 1UZ1A 4BF9A 3SADA 4GQQA 3UQNA 2NQHA 2JGQA 3C0SA 5FEXA 4HU3A 2TPSA 4E38A 2YJQA 4H7VA 1FCBA 2POTA 1LCOA 2X42A 3BK0A 3ZS4A 1WYIA 2BBFA 2GDQA 3UT0A 2DFAA 3UPWA 5AYIA 3VGDA 1D7FA 3SI9A 2HEJA 2JKEA 2FZ8A 4O50A 2YCKX 2CLEA 3UD6A 4RE4A 3LNPA 1P6BA 3OO2A 4NAFB 3CAWA 3F5LA 2PZNA 1XX1A 1F8MA 1OG6A 3QMRA 2CZ5A 2FVLA 2DSWA 3REQB 4OZOA 4H2HA 1HJUA 4A3QA 4DJDA 4WY0F 4L6HA 4MY1A 4O4VA 1LQ0A 2NUYA 1OIFA 2QVNA 2O7QA 2R1KA 4JTDA 1R46A 4Q8MA 4L4LA 2CCRA 4FEZA 4Z1DA 4GYJA 1N8FA 1FWGC 5FD0A 3Q58A 4PB5A 5MHBA 1EX1A 2RDUA 3UF9A 3G77A 5HWJA 3H54A 2VEPA 2V68A 3C8FA 3WDRA 1H4PA 2OOFA 2PLJA 2PGWA 5BROA 2V2CA 3VGHA 4DJEA 3W7QA 4O0KA 2I5IA 3TN6A 3VNKA 4DIAA 3FEMA 3W2MA 1R8LA 1DYSA 3MHGA 4O0ZA 1R0MA 3KOFA 1UJQA 4RDWA 4WOZA 1W1ZA 5JBEA 2WJFA 5T9BG 1GNXA 4QM1A 2E5DA 4YVXA 1QNSA 2CZDA 1KCLA 3TYAA 1PCWA 1VB9A 2A3CA 4QDPA 4G7FA 4GH3A 4F2UA 4C6PA 4QLKA 4FOKA 4LUTB 3ZO9A 2C16A 2A3BA 3UXKA 3U5YA 1Z42A 3OTRA 4O28A 4D6JA 2Q02A 1IZKA 1A3HA 1GQIA 3FYPA 2FFIA 2EXOA 4IIFA 4JCLA 5LXXA 1TWSA 2REQA 2WC3A 3R25A 1KRBC 3FCPA 1CTNA 4U2YA 3KBVA 2V8ZA 3SSZA 3PZTA 3NM1A 5D2WA 2MUCA 1E9IA 5FSDC 4R7JA 1OZQA 1ZENA 1KGXA 4DI8A 1BKSA 2DIJA 4MKSA 5BWAA 2X41A 3EDKA 3NZGA 2V30A 3LCHA 1GVOA 5GJNA 2OG9A 3S2JA 3IJQA 4UCFA 1O1HA 3RCYA 3V5CA 2YOCA 3ARRA 1C3FA 4IPIA 2G41A 2RDXA 1X6NA 4J3ZA 3VZYA 4DUXA 1P6CA 1VLWA 4JFSA 3RPDA 2FMOA 2XVLA 5EA9A 4KWVA 2DUZA 1LUCB 5D37A 4OBSA 3PPCA 2B7QA 1XRFA 2Y7EA 2GJLA 3N6QA 3HQNA 4IIDA 4ZQRA 3AIEA 4E0CA 4JL2A 3GU2A 5IFPA 3COTA 2VEFA 5G1MA 3NPXA 1KBLA 2EG7A 3R8RA 3LGGA 2YA0A 4DELA 3AC0A 1F6YA 3MT1A 3MB9A 1TV7A 4RJEA 1A4LA 5JQ9A 1S2TA 3HFYA 1UWQA 1DWAM 4ZQOA 2P3ZA 4R85A 2OVLA 2XGZA 4H8UA 3TLQA 1Z6KA 2IKHA 5CPMA 1B9BA 5IDZA 3B8WA 3GNDA 3RM4A 1DIEA 5C71A 3QGKC 2EPMX 1EUAA 3UGVA 2PC8A 1AH0A 4LAOA 3WDJA 1B31A 1E3XA 3L4WA 3E12A 1JDAA 4JICA 3QMTA 3SCQA 2FHCA 3KRSA 3UG8A 4AAJA 2X1IA 4DJED 4XWUA 1H3GA 1WQ5A 4YJ5A 1N2VA 1W9BM 2DY3A 1Q65A 1TMHA 3WH9A 1GOQA 4W7UA 4HHLA 2OLSA 5CLTA 1PEZA 4WLCA 3AMLA 2YBTA 4B4HA 3VVGA 4LX4A 4GVIA 3WL0A 1XIGA 1CGYA 3QF0A 1FWAC 2FZDA 4LUTA 3R0DA 2GUBA 3U0HA 1YE4A 3B9AA 3KW3A 2GK1B 4MAVA 2CLOA 3ZVHB 1GYLA 3DESA 4NZFA 5CZTA 3EDFA 4LUYA 4U3CA 3IGUA 5D2TA 3USBA 4KEMA 1LBMA 3DU0A 4CN1A 4W7WA 1XS2A 1UD3A 1AJ0A 2HRWA 1UBSA 4MWAA 3FKKA 4QLJA 4MFEA 3SQMA 4MB1A 3EX3A 1EJXC 3M4HA 2EPKX 3K4WA 1DKWA 1K02A 1U1UA 3CUXA 4KFNA 3QGAC 4FIRA 3KWSA 3C2YA 4B2DD 2VZTA 1SMAA 5K3VA 3NDZA 4UTWC 3LHVA 2R1PA 2QDHA 3CWOX 3VTRA 2WC4A 3U2ZA 1V8EA 1MQRA 4FR6A 1D2KA 5LKYA 4HPNA 2WWCA 2Y89A 1Q13A 3OZOA 4JOMA 4AZHA 1OFOA 3VFCA 3GVRA 2NW0A 2WVVA 1KM3A 4FNQA 3L4UA 2OELA 3MY9A 4JAWA 1UWRA 2VTFA 2J27A 2Y61A 2XFFA 1DWFM 3IJIA 3RPMA 4C6LA 4I8YA 3GW0A 4KWUA 5H6HA 5KEZA 5BOOA 1LP6A 1J6PA 2ZRVA 4DUVA 2EBNA 1G4PA 3RPTA 3UG5A 4ZBCA 1TRDA 4MY8A 4OQVA 1XH1A 4RZ6A 2C1GA 5LNSA 4C5YA 1OT2A 5A5WA 1LT7A 4ERAA 3GVVA 5AYZA 3C0QA 4IG2B 3ZLHA 1PZ0A 2I5QA 1UWSA 1QI3A 3WNLA 3EX4A 1UR9A 4JTHA 4LVDA 3VIMA 1FHUA 5RUBA 3W1RA 1UD8A 4W4QA 5HNNA 1ZBCA 4HK7A 1FWRA 1OJXA 4FLQA 1EHAA 1EDGA 3GFZA 4FSAA 1VGAA 1YXCA 3AS0A 3T2OA 2ATSA 2WNQA 1WKYA 1QO2A 4ZB0A 4LFYA 4L65A 3UWQA 1R9YA 4FIQA 2QIIA 2QJMA 4US5D 3AISA 3NL2A 1DWIM 5CZKA 4ZQCA 3WLTA 2BODX 5DXXA 1K9DA 1J93A 5DN1A 4O17A 5REQB 4K39A 3BARA 4KGJA 3W1XA 2ZZ5A 4HA1A 1ECEA 1BFNA 1GJWA 3CUIA 3PZ9A 5DELA 5CEWA 5A2AA 3B05A 4L9YA 1LF1A 3ONBA 1UWTA 4ZR8A 3PFRA 4N9CA 2Y62A 1Q2SA 4JN7A 3DGRA 1JZ2A 3R0KA 4IMFA 3F4DA 6TAAA 1Q4NX 3PHAA 2YCLA 4YCOA 1S5VA 3BW4A 2I7GA 2ZC8A 2UZ9A 3ZR6A 5LZLA 3HGOA 2D23A 4ZENA 1OQFA 3O16A 4D6IA 3ARPA 1I2QA 1FDYA 4LS2A 4D1JA 2WSKA 4NXSA 5HR7A 4A8RA 2ISFA 1L2UA 3GKAA 4CQBA 3V5OA 1XLKA 3N13A 5C9RA 2OKOA 3ZSSA 4Y9OA 2B7OA 1NFBA 2E9MA 3G3DA 3P81A 4YU1A 2E7FA 4K8GA 1A53A 4ZTXA 2YA1A 2A5HA 3TU9A 1GPWA 3N29A 1YRRA 1DOSA 5CGQA 3BE7A 1EA0A 2YB1A 2ZXBA 3PR2A 4GA8A 1A5LC 3APTA 2A6NA 4UOZA 3DG3A 3A23A 4GI9A 2DIEA 2GVEA 5SWUA 1PKYA 3UWUA 5I3JA 2PWDA 4PUJA 1SJDA 2W66A 1ECQA 5F2GA 3O07A 2HE8A 3ITYA 3W7KA 5DLCA 3AQUA 3UZZA 3TMQA 4O4WA 3VO0A 5KZEA 4ZE5A 2J75A 1L6YA 2QV4A 4BF7A 4CCDA 1XGZA 4JPGA 5IHRA 1KFKA 4DB7A 1FCQA 2PD9A 2OQLA 1C91A 5C9WA 4RZBA 1AZ1A 4NJGA 2XZ9A 3USZA 3FOKA 3GIYA 3TFXA 1QASA 3G1HA 4DZ5A 4GBDA 5LIUX 4Y9NA 2QJNA 4XIMA 2GK1A 3KWXA 2ODOA 1E4MM 3W53A 1KM4A 2WM1A 4IFKA 4LF2A 3C2EA 3A9BA 3WQFA 3BG3A 3NSNA 1BXCA 5LIKX 4UOQA 4J4KA 1KC7A 1F9CA 3TTEA 3WLRA 1E6RA 3NWRA 4M56A 4PMZA 2QW5A 2CBJA 3KCLA 1U33A 1K70A 1KM6A 4IJCA 3K5XA 4C7FA 3WD4A 2WSRA 2WVSA 1NDYA 1FFQA 2HK1A 1W56A 5JXQA 3KXQA 2VX5A 2QQ6A 2DSKA 1TJ2A 1TQJA 3KRZA 2AMXA 3BAIA 3C2RA 3SFKA 3H23A 3L12A 4H9ZA 3VGEA 1OFBA 1VAHA 4S3GA 5J5RA 3GXIA 1GHSA 1W9DM 1N82A 1E5NA 1Q63A 4MWAB 5E0FA 4DRSA 4R9XA 4Y6GA 1OG0A 4HT3A 3B8SA 3LCIA 4WK9A 1V0NA 4MGGA 2PDBA 2POZA 2R91A 4QBXA 1A47A 1PTAA 5A8GA 4QEHA 4N42A 4KWSA 4JR5A 2A3AA 1W9PA 4FS9A 3WH6A 3PP7A 2WW5A 3D46A 4ASTA 4B15A 3DFTA 1CB2A 1M5WA 3SRHA 4DJFA 1ZGDA 1JUBA 1E43A 4H41A 1GZ1A 1LQAA 4LRTA 4H9YA 4ERIA 3B4UA 4BS0A 1DJWA 1V6UA 3KL3A 4O1BA 2GPTA 3ZFHA 3IJLA 4X2PA 3LXBA 2VDHA 1K77A 3TNBA 4V15A 1KWGA 3CL7A 1JCXA 4H83A 4DZHA 1PPIA 1WZKA 1VCVA 2XSXA 4GZIA 1Q4WA 3WLOA 2NQLA 1GYMA 4WZHA 1GKQA 1OT1A 2GWNA 3CUFA 3GBDA 3F5KA 4O8RA 3H24A 2BOEX 4IL0A 1DPMA 5CJMA 1EJWC 5BZAA 2RJGA 3W07A 2E6AA 2X0YA 5HDRA 1SFLA 4REQB 5HNUA 1W9UA 4ZZ9A 3TJIA 4REQA 2ISDA 5A6AA 5T9CE 4ZOAA 4QJ4B 3EOLA 2DVUA 1QBBA 3R11A 3FVMA 2P1FA 1HZYA 1QK2A 1XXXA 1UBPC 5FCZA 3UW6A 2BY0A 2E5BA 1BSLA 2OT0A 4URIA 1K8ZA 2YDQA 4PB4A 2CERA 3FA5A 1YDYA 3BOLA 3QY7A 3R10A 3T4CA 4CCZA 1UQYA 3WQCA 2E25A 4IP4A 1DXFA 3JU2A 2VCCA 3L67A 3VD5A 3W2JA 1RQEA 1VPQA 2ZQ0A 1OM0A 1XINA 1S46A 4L56A 4M80A 2WMIB 4F0KA 4PTNA 1HGWA 2ZXAA 4HN4A 2DZSA 2D0GA 2ZTJA 3R5EA 1KBKA 4ZXOA 2OYKA 3CTTA 1R47A 4Q3MA 3QEZA 4LW7A 1YIXA 1MW0A 1VFMA 3WEOA 2EKGA 3AMDA 2Z7KA 2CLPA 1DQWA 3MU7A 4FXFA 1LLZA 3M7SA 4MUZA 1XSJA 2HS6A 4ZOEA 1VEOA 3S2MA 3P80A 2UWFA 2YA2A 4CNUA 2DIKA 3GDTA 2OYMA 4YYCA 2C15A 2I9UA 5TBOA 4A8IA 3U9IA 2RH9A 5DT5A 4O1FA 2EAWA 4B91A 3PAJA 4FO4A 5DBUA 3BGJA 1BTMA 3VI2A 2A7RA 2B0MA 4MTVA 5AZ1A 3OVGA 1TZ7A 1JNEA 1GJPA 3VGGA 2XYLA 2ZUMA 1ZP3A 3HGRA 2G0WA 4ZQPA 1FDZA 1AQFA 1SMDA 2QF7A 3EOUA 4LBRA 3C4UA 2VURA 2QUVA 1WKFA 2WSPA 4M3PA 2E40A 3WKZA 2OOGA 3NQ7A 2WJDA 3EKZA 2OWXA 2WANA 1FFRA 1W9VA 3WUGA 2R8WA 2PSNA 4BHYA 5AVNA 1FVPA 4HZMA 4HMNA 3O9NA 4KBXA 3L23A 1PWMA 1XLMA 5I3GA 2ZE0A 2W61A 3NZPA 3W6MA 4A6GA 5D2XA 4IUGA 3GB6A 4G2DA 1W3NA 4R9OA 2VWSA 4OT7A 4QEEA 3VA8A 1TWZA 3GRIA 1V3MA 2O0TA 4LUIA 3ZXWA 4AHPA 1IXPA 1GOKA 4ADTA 4PMNA 3WNKA 2DSVA 4O54A 2DH2A 1RR2A 3WFZA 3G0XA 3R58A 1UMLA 4QG9A 1LL7A 3RX3A 3TYBA 1WDDA 3GUGA 4B90A 5HBFA 3BPWA 4UQDA 3ANVA 2BXVA 3MWCA 4R27A 4Q8PA 2A79A 1A5CA 2CKRA 1DJYA 3L4TA 1JDDA 1PDYA 3ATYA 4IP7A 3TK7A 4PEKA 4JIRA 1SW7A 4KS0A 2E5CA 1YPIA 3W7IA 5I79A 4DUWA 4ZO6A 1RP8A 2NUWA 1KBBA 1JVNA 1WCGA 4XAZA 1PIFA 1K6AA 3KTCA 3R94A 2Z25A 1MEIA 1OHLA 4B5VA 4M6UA 1X8FA 1EDTA 2G3FA 4IXHA 2FTPA 1IZCA 3E1F1 5I2UA 2EHHA 4DO5A 2V2HA 4E2VA 2OEMA 1XKYA 4LAZA 1FCVA 4NI8A 4JX6A 1FWIC 3VIPA 2X1UA 1Q6EA 4N7QA 4HA0A 5CXPA 2XIJA 1LG1A 4KIRA 4X3ZA 3UXDA 3UZYA 3MVTA 5TD4A 2Y0FA 4RW3A 3NQBA 3AWOA 2VQTA 3UPMA 1TUFA 3TROA 3P7YA 3NUKA 4B2DA 3VDBA 4IT1A 1XI3A 3C3NA 4D2JA 1GVQA 1NFPA 1IE7C 4KGLA 2GFTA 3W9ZA 1BTCA 3SCVA 3A13A 3S3GA 4HSNA 2ISWA 3AXHA 1SSGA 3AHYA 5EKYA 4W88A 2E77A 4B3ZA 1UP0A 5ABFB 3SN1A 2VR2A 2HXUA 2CNCA 3LSBA 3LPFA 4HCLA 1BVZA 2E4TA 4D71A 2WOQA 2P8CA 3N2XA 4YYFA 3LEPA 3EBVA 4DYKA 4C6QA 4C1KA 4LVGA 3KCJA 4HOZA 1FKXA 4HIBA 1HF6A 4M7SA 2X1RA 2VZUA 1JZ4A 1XG4A 3GQYA 3NO5A 4QR6A 1H60A 5A8OA 4JTCA 2WPGA 1ADOA 4RE3A 2XM1A 3DYMA 3HF3A 3VIIA 2O92A 3R4IA 3M16A 1HKWA 5ABTA 3BO9A 3LUTA 3STCA 1IEXA 4FNTA 1MDLA 3ZZ1A 3RM8A 3VMPA 4LS1A 1B54A 4LSBA 4UQAA 2J25A 4GXMA 3E49A 4TV6A 4C7DA 1C92A 4WR3A 3HG5A 7REQA 2D24A 2XIIA 1ISYA 3TJ4A 1GHRA 1MSSA 1A4MA 5ABHA 1YBQB 3WEZA 2PAJA 3CMJA 4E4PA 1FH8A 4XAPA 1U5JA 4B16A 4O52A 3A6OA 1D7KA 1WXZA 2EKCA 5K2ZA 5HK4A 3MDUA 1D9EA 4HHMA 1J6OA 3U7BA 3QOMA 2OCZA 1FH9A 1RQHA 1AD1A 3QHNA 4RE2A 3ZIZA 1CGXA 4UTLA 3L5LA 1CLXA 3OEXA 3VINA 3U6WA 1TTIA 3O1NA 1JUKA 4KCVA 4PUDA 3QV8A 1SYTA 3VNMA 1B30A 1BLIA 3DFYA 3AHXA 4A3RA 2PU1A 4ENLA 3BCDA 3MW7A 3VIFA 5IOBA 1SO3A 4AD0A 2PTYA 2GZXA 3TYZA 2L5HA 1TV5A 3AIQA 4EAYA 2YLLA 4UCGA 4GZJA 3UJSA 1TMLA 3SCWA 5BYWA 4J3WA 1OD0A 2DPEA 1H50A 3PJUA 3ARUA 5EMLA 5CGMA 5CC6A 2H3BA 4U33A 1FOBA 1FWBC 2BHUA 2I17A 1UPPA 3CEUA 3PUGA 2PZ0A 4JN6A 5CZSA 3WK0A 3BLEA 5EL1A 1E6PA 4NZ1A 5H91A 1QWGA 2XWDA 3GS6A 4DEFA 3H22A 3WK3A 1C8QA 1TX0A 4RR4A 4UNLA 4FLRA 1D8WA 1YNPA 4AIOA 4J2PA 1HQTA 4JKKA 4Y90A 4DLFA 3IEBA 4NJJA 1OADA 1NVMA 3SUUA 1KCZA 4MSSA 1MRQA 2VZOA 1UH2A 2D73A 2V81A 3Q65A 1B3VA 3PTKA 1VHNA 1XC6A 1WP6A 1TZ9A 1ZL1A 2A21A 2DJXA 4UTJA 1EYEA 1F74A 3N04A 4M24A 4M81A 1K3UA 2QXWA 3CHVA 3BLIA 4QRNA 1YTEA 1ZSXA 4NF7A 4F4RA 1YMYA 3O15A 3H4GA 1TPUA 4CD6A 4BEUA 3YPIA 3IIZA 1K7EA 1GW9A 4UQ9A 2ZRWA 4H9UA 2NX9A 1DHKA 4GBUA 2XSAA 5A6SA 1XFBA 3NM3A 2BFGA 4OTKA 2ZXDA 3NQ2A 1KCXA 3A5VA 2A7PA 4N0RA 2TSYA 3NZ1A 4HHPA 1V3LA 2W6RA 1BG9A 2BS9A 2J7CA 1QXLA 3UXLA 4LYRA 4W8BA 5F1UA 1QT1A 3PZQA 4FX7A 5JVLA 3M5YA 4Q8NA 3G1VA 1WBHA 4GQBA 2WZHA 1WX0A 1LTDA 3SJ3A 1JYNA 5JH1A 1F05A 3B04A 3WX7A 3T0TA 3S83A 1GQLA 4WDTA 3DKJA 3N2OA 4RE0A 1VP5A 3QV7A 4HNTA 1G0CA 4MPQA 4U31A 1IXNA 3EDDA 2WPBA 3MSRA 4C65A 2FYMA 3W28A 5AYYA 1XC4A 5HPOA 4B5WA 1TWDA 2ACRA 1S38A 2FHFA 2WBGA 1Q6RA 4HPGA 3UXAA 3WF0A 4RNJA 3N17A 2BY3A 3KM8A 3KBWA 3AZSA 4DJEC 2DVTA 1LRQA 5I24A 1AQ0A 1MNSA 2J47A 3SM0A 3AYRA 1MW3A 4Z1CA 3UR8A 2YSWA 4KCWA 2ABBA 5A8MA 2X1TA 4WSJA 4DBDA 2X8RA 4P61A 3QQ0A 2QJIA 1ITQA 1MUCA 2EGZA 1B2YA 4F40A 1O94A 2P88A 1UKSA 2VEKA 3DG7A 4IP5A 4P8XA 4EKJA 2YBVA 1JYVA 1D3GA 1N8WA 2IPJA 3MBFA 4BKNA 5CH9A 4NJKA 3SN4A 3KBMA 4JFVA 3NSXA 1QO5A 3QW3A 4KETA 2PDJA 3K8LA 2XVNA 5F1VA 2P0IA 1H63A 3GDRA 4B9YA 2DVXA 2NLIA 1ZALA 1XYAA 4IH3A 4F9DA 5CC3A 3CLMA 1IEQA 2QNEA 2WZEA 4LJ3A 3PSVA 1UOKA 1P7TB 1KWKA 3K1DA 2E0PA 3U57A 3VM7A 3MUAA 4NZ4A 3RM9A 3GR8A 4WXYA 1ADDA 2E9BA 4Y7EA 3MZ2A 3OG2A 1KBJA 4DY1A 4W86A 3S5YA 1RHCA 4EXAA 2VVNA 3DFQA 4H1ZA 1VFOA 1SO5A 1NDZA 4Z0SA 1DWGM 4LVBA 1TVPA 5CLWA 3QTPA 3NPUA 3GVWA 2OXNA 1VQTA 4C6BA 3DENA 3E9AA 4WSKA 1P4CA 3RO8A 3VOFA 1RA5A 3NVDA 3ARVA 3LQLA 3DCPA 5A8NA 3P2VA 6REQB 3TFCA 3A64A 4Q7NA 3NXLA 5REQA 2E6DA 1PE1A 4AYSA 1IYXA 4PRRA 2JKPA 4AF0A 3UETA 1X1NA 1GT8A 4QITA 1FY6A 3LSCA 4BY3A 4JYFA 5LA0A 4GNKB 1HXJA 2YFNA 4EK7A 5BOFA 3GFXA 3V0TA 3LYEA 2BZNA 4G1NA 2ZWZA 3UZJA 3LTYA 3VZXA 2C91A 4GABA 5LHFA 4AD1A 4K36A 5FJJA 1LM1A 1KXTA 1C8VA 2O55A 3VKCA 3EB2A 4K68A 4G56A 1X6LA 2ACQA 4OV9A 5D9MA 3WN6A 1FBAA 4PYSA 5IM51 3GHUA 1WDSA 5J8LA 1DL3A 1IF2A 3H2CA 4NUWA 3FA4A 2DZPA 4EOUA 5I6SA 2J77A 1JI2A 5C9UA 3T4WA 4MNLA 1IR2A 4D9PA 4AIUA 3QTGA 5I7GA 3VGFA 5CPSA 2QIWA 2FTWA 3WL1A 2HV5A 1LZOA 3UERA 1P5BA 2VX6A 2WHKA 3TYEA 4Z2LA 4IJBA 3BURA 2D2JA 3CZJA 4N6EA 4JFUA 3ECQA 5EMKA 1J0ZA 4XD5A 5DXYA 3CHEA 1WA3A 1S2CA 4X0VA 1ZS2A 3DFPA 1RPKA 3ONCA 2AAMA 3AJXA 4QGCA 4OVXA 3FFSA 5D2YA 5LGZA 1HNYA 1CPUA 1OSEA 3Q2DA 4GZ7A 4E3VA 5FACA 4BQ3A 5AKQA 4PUWA 1JCJA 1Z8AA 4S3BA 3UWYA 3LHUA 1ICPA 4PMQA 3AXKA 1V3JA 2RGMA 3I10A 1A80A 1B1YA 4R53A 4UTUA 2VD8A 4X61A 3ITLA 4IJRA 1L6FA 3B8IA 3TA9A 1TVNA 4ZOCA 5DF0A 1F4HA 4H00A 3CUZA 2HCVA 3TQVA 4I3GA 3TXVA 3WBWA 2WCAA 2OMAA 3OVPA 3E5BA 1G7VA 1CXHA 5XIMA 1C90A 3VUSA 1QPQA 1TWWA 1Q45A 1I75A 5TQLA 4CNNA 3N2TA 3AUJA 4W85A 3LOTA 3IIOA 5H8PA 3FGCB 1G69A 1B0IA 3C0LA 1MYRA 3G24A 3GU1A 1CYGA 1CW2A 5HINA 1EUNA 3M0HA 1K6WA 1QPRA 1LLOA 1XCFA 4JYEA 1PJ9A 3CPGA 2JALA 3GG0A 1QJWA 4D6EA 3QY8A 5JMUA 2FPYA 1XLHA 1H1ZA 3MANA 4WVXA 3R43A 2X7VA 4HU8A 1E6ZA 1JQXA 4W5UA 2DUAA 3TCEA 2J79A 3SY1A 4IMGA 2V5DA 1RY8A 2Y5EA 4ZSUA 3BQ6A 2WVUA 2XGBA 2FH8A 1EF2A 4M82A 3SRFA 3WLJA 1HVQA 4M6VA 1WUFA 3VM5A 3A9IA 4UFKA 3U7VA 4PRWA 4WEVX 1WDQA 2NVDA 3GBEA 2CEQA 4W5ZA 3CV1A 2GJNA 1VD6A 1YADA 2VC9A 2YCEA 3O0KA 4UC5A 1O7AA 1ZHAA 1DE6A 3VK5A 5A6BA 1OF8A 3WQVA 2I16A 3TSMA 3UG4A 1KFWA 1TPVA 3IRDA 3MMUA 3LGDA 4DX3A 3OLGA 2JF7A 1ZRQA 3LCLA 2GVJA 1KRMA 3WSUA 3THUA 1EOKA 2BY2A 2NWRA 3B06A 1SW0A 4H6KA 2Y7DA 4AZ6A 4JTLA 4IPJA 3FN9A 5G2IA 4O13A 3UCCA 3BAYA 2P76A 2VCAA 2C13A 1SSDA 3ZOAA 3OJGA 2TMDA 1UWAA 4OE7A 4YTRA 2CZVA 3BGGA 1PDZA 1H41A 3NURA 5GJMA 4QHRA 3VU2A 4JFWA 3NGFA 3GDKA 4R33A 2D2HA 2Q3OA 3FGCA 4HD5A 1B5TA 3TNOA 4DBEA 2C1IA 4AX6A 1HG3A 3QQ1A 5KZDA 3QYQA 1TV3A 3B03A 4FXRA 1IV8A 3MHFA 4MFDA 2VC5A 1NARA 1O5KA 1IT8A 5LNVA 2FJKA 3N2MA 3EMQA 1EWEA 5CPOA 2XSBA 1SUXA 3MYPA 1TREA 1J0KA 5EU9A 3RHGA 1PKLA 3W3OA 1C7SA 4NXKA 4C90A 2VDIA 3UGRA 1TJRA 4DWSA 3VC5A 1J10A 4UQBA 1LRNA 4RK8A 3P3BA 2QEZA 3FW6A 1U22A 3L65A 3NXFA 1OBAA 2J24A 2RJHA 1IWAA 3HB9A 5EMMA 3T0AA 1V6YA 4XAGA 5M17A 3GXFA 4GVHA 1AQHA 2NXIA 2OGJA 5I00A 5C7VA 2GQAA 5FA5A 4EPEC 1FKWA 1OGBA 3T9PA 1IWBA 3UWZA 2XDFA 1E9ZB 3S1XA 1TQXA 4PSRA 1GOWA 3G5EA 1F6PA 5HATA 3VIJA 3IIPA 5MF5A 1US2A 1MRAA 2ZKMX 1G94A 1TPB1 2WHJA 2NV1A 3MKCA 2ZC1A 1XGEA 4CD4A 3EA2A 3MSDA 2DJLA 3OLDA 4YTQA 5D38A 4XO7A 2CWNA 2VFDA 4IIBA 2NXHA 2JQXA 4P8UA 2J6XA 2RKXA 4RKAA 5CC7A 4PCPA 3TAKA 4AIBA 2CHRA 1JD9A 1QI2A 3CZ8A 4DWSB 1J0YA 4IIHA 3N2BA 4MY9A 1T0OA 4UFJA 4OU1A 1PO9A 2W67A 3CK5A 3UVIA 2HDJA 3CO4A 4Q8UA 3LMZA 4KIEA 2V0TA 1R85A 3W88A 4GGBA 1M9HA 3A12A 3OGVA 3GTHA 2PEVA 3OQ8A 1OYCA 5FIPA 1L8PA 1KV8A 5A95A 3BH4A 2CC0A 3LRMA 1KM5A 3S46A 3S6TA 1E40A 4Q8QA 3W2LA 1V0LA 3WMSA 4V1XA 1WKEA 3B97A 2A3HA 2AL2B 4GYPA 3V0SA 1AL7A 1S3HA 2XINA 4L9ZA 4H6QA 3V75A 4AVNA 1EJSC 3W7NA 4XZBA 2FVMA 4NX5A 3L0GA 1O12A 4J28A 4FA3A 4L1GA 4CQ8A 1QUMA 1J8VA 2GQ8A 3UNDA 3I7RA 3IRSA 5AHNA 2PDPA 2V38A 1HJVA 1O1ZA 4J3UA 5CBJA 3CUGA 4XZ9A 1XPGA 2ZXQA 3F4WA 5T91A 3W87A 2JE8A 2Z24A 3KOZA 5FJIA 3W72A 3CH0A 3RILA 1H09A 2VEGA 5AB3A 1XBZA 3ZMRA 2WQDA 3HG2A 3GNRA 3GXDA 4KERA 5D9OA 4GUHA 4HCDA 4RDYA 5IBXA 3O05A 1IGWA 1B3WA 4DBUA 2HTMA 3ZYZA 1ZJIA 3WJYA 3BUVA 1A5UA 3ITXA 1T5AA 1LL4A 5K7JA 1JXKA 1WXYA 4ATLA 4XUYA 1EJVC 4TMBA 1EX5A 1V7AA 3CAQA 1AG1O 1RAKA 1P6WA 4JHMA 1KO0A 4JTTA 5FJUA 3AIWA 2A3LA 3GSMA 2YZRA 2CHOA 2CYGA 1Q3NA 4GI4A 3O6DA 3UR2A 4HHHA 5CKSA 2BHZA 3AIBA 4NY2A 4XSLA 2NQ9A 4XKYB 3MV11 4YIWA 3WLMA 2NV2A 3AFBA 1XSIA 1NF0A 3M0XA 1B3OA 3ABSA 3EKGA 4DXKA 1C8XA 4X22A 4W89A 3VC6A 5AFDA 1HO1A 4ECLA 4LS0A 4ILSA 4GJ1A 5B7YA 4WDXA 4Z17A 3FJLA 3M0ZA 1SFSA 3OZPA 1XLJA 3N3TA 3EWCA 5FL0A 1R3VA 4A3UA 5FSEC 1CGTA 4KRTA 1MEWA 3EB4A 3GXNA 3H2AA 2XH0A 4GC4A 5KZ6A 3ABZA 1FWFC 4M29A 1ZJHA 2C6QA 3EWDA 1H0IA 1SZNA 3EGJA 4H8VA 4N4QA 4HYVA 3BTNA 4Q6JA 1VH7A 1TTQA 1Q6QA 3T1GA 2PDIA 3E2RA 2J13A 4EVZA 4US6A 4XISA 1UCWA 1H62A 1GEHA 4XTDA 2IUZA 1IXOA 3OOQA 1BYBA 4MM1A 3BVJA 1CGUA 4ZL1A 3WQ4A 1ODZA 4NT0A 4H7ZA 1V6TA 1OGSA 3REQA 5LGXA 2ONEA 3CL6A 4MWAD 3GLCA 3VIOA 3D6NA 1AFSA 1WE5A 3PPHA 4NAFA 3W7GA 2BSLA 3IPWA 2ZUSA 5BNKA 4B9ZA 2PDLA 1CT5A 4Q8VA 3CIVA 5D9NA 2Y70A 4AY1A 2FPVA 4HU0A 1RD5A 3PUOA 1O5XA 4YWIA 1JFHA 2J78A 1B3ZA 2EG6A 5G2WA 4GFIA 3M64A 4JDBA 2ZX6A 5CPNA 2EJAA 3VCRA 3WJSA 1KGWA 3LBCA 4PH6A 3EWZA 1Q6GA 4EF8A 5C0QA 2J6VA 1HL9A 2RFGA 5L9FA 1XLDA 3I65A 4Z42C 1RVGA 1WZLA 4A35A 5HMSA 3H2NA 2CLFA 1RLDA 3LX9A 1J2WA 4WXZA 2R1LA 1T99A 1HUVA 1U30A 4UQEA 4FI4A 2Z0IA 1T41A 1TIWA 3DZ1A 4F2BA 3CZGA 5XIAA 4K1WA 4UMAA 2VELA 3LMYA 5HR6A 5KETA 3C52A 4JFTA 7ENLA 2A3EA 4GK8A 1R7OA 2QF8A 3H12A 2GOKA 1ZAIA 1Q7ZA 2G3JA 1YYAA 3JZUA 3VUPA 3R79A 1DEDA 3W24A 2ZDSA 3IK2A 1SVDA 2BOFX 1WDPA 3OGSA 2GGIA 2ZX8A 4XB3A 3NQMA 3GDLA 5E5CA 1UA3A 1DQUA 4O1DA 2JF6A 2PP0A 4CCCA 5KITA 4G7EB 3ARYA 1QPKA 1V51A 6REQA 3WZ0E 2GLKA 1QOPA 4GQ0A 3DOPA 1ITCA 1J11A 4J3SA 2AQOA 3NQFA 3A4WA 2R14A 1Q7MA 1GVEA 3NPVA 1I0BA 1QFEA 3QQWA 1VFHA 2PE4A 2BVWA 2YDRA 4P7NA 4DQWA 4KPLA 3OYXA 4J3XA 2QKFA 1X98A 1PKMA 1BHGA 2UV8G 3EWWA 3I3DA 4NZ5A 5D30A 3FKRA 3W1UA 3VNJA 1J0JA 3TYUA 4DPQA 2J7DA 3II1A 1ZP4A 2D0FA 4NP7A 1EOMA 1S2VA 3CPUA 3MMWA 4UTTC 3LTSA 4Q8TA 1GPFA 1UR4A 1VFLA 4B3KA 2VFGA 1XF0A 2AQWA 3WLNA 2PP1A 1EC7A 4BZYA 4JEJA 2Y8VA 3N9RA 8TIMA 3VIKA 4XV0A 1FTXA 2PDUA 2QPXA 3IUHA 4RZ5A 4MNMA 4RDZA 4NYUA 3WENA 4M7TA 1EJTC 2QAFA 3VNLA 1VIZA 1Z9AA 2C71A 5AVHA 1V03A 3VD4A 2REQB 4Z08A 2Q09A 4O8AA 2BY1A 3BSHA 3LV6A 3N3MA 6CGTA 4HMCA 1E73M 1B9ZA 1EP3A 2DGAA 4I90A 2AOSA 2J8GA 1EXPA 3LLFA 4YCPA 2WNZA 4DI9A 3WJXA 1REQA 4FHAA 3GG8A 5D33A 3VD7A 1AW1A 1NH6A 1Q85A 2XIQA 2IKIA 4EWND 5LHEA 4O16A 1TPEA 4JIEA 2PDNA 4XX6A 3W83A 4RXFA 2PDCA 1UR0A 5CBIA 1YBQA 3P62A 4XAFA 1GORA 3EPNA 1WDRA 2PLKA 5E70A 1PL9A 3BOFA 3P82A 3PJTA 3URAA 2PRHA 4FK9A 1JF5A 2TODA 1KM1A 3L2IA 3SUSA 1TSIA 3KZPA 5BWFA 1P0EA 4TVDA 2VRQA 3BCFA 3F4NA 4JBRA 4WKHA 5HWMA 3VCNA 3R12A 1WOBA 4O1CA 2XUCA 1T6MA 2IPFA 1GOOA 2VDGA 2GDVA 3MI2A 4FF5A 1Q6FA 3P0WA 3RFAA 1Q66A 3DC8A 5A6KA 1KFEA 2GVGA 4ERGA 3W26A 3GNNA 4J9JA 1E6XM 4E2OA 2OZ8A 4S3AA 2R1NA 1XLLA 2VOTA 4HZ8A 3STEA 1XQLA 4QROA 3EPOA 1KQYA 2VFIA 3U2OA 3VCCA 4QAIA 1TTPA 3T81A 1XHGA 1JGMA 3V36A 4LWWA 2JKAA 3S8HA 1NEYA 1WBJA 4ML4A 5A2CA 3P93A 4E4FA 2QPSA 1EC9A 1V3HA 4MKVA 4KFPA 4P5UA 1JF6A 3TUUA 1RBAA 3EOEA 2WBKA 2BTMA 1XRSA 1A3XA 2YPIA 3H2MA 3CMGA 2G3IA 4HA4A 2F2KA 3HGJA 1UD2A 1CNVA 4FAMA 3ITTA 5K9XA 4FP1A 3WF2A 5HXMA 3RCNA 1KA9F 3NGJA 2IQDA 5A6TC 3OG3A 1UUQA 1Q6CA 2VWTA 1WAWA 3QFWA 4FX6M 2J7HA 3SCTA 3WQWA 1B3XA 5K9CA 3UY8A 4IIGA 4FB7A 1UKPA 1OCNA 1FX6A 1TELA 4G5DA 1ME7A 1TV8A 4K6AA 3WFAA 2G96A 3CZKA 4G9PA 1US0A 5TF0A 4DUOA 1UUMA 2Y6ZA 3S5NA 1A3WA 3EX2A 3W7CA 2MANA 2R94A 2BV9A 3SGGA 1BD0A 1V0KA 2EEXA 2WC7A 3VOGA 4IPPA 1XIHA 4NSBA 1GONA 2I57A 4DNHA 3W73A 5I3HA 4BF5A 6XIMA 3LLDA 4KT2A 3JW7A 1FWHC 3ME3A 2NUXA 1AJ2A 3T8LA 3VOHA 3WF1A 3FYYA 4GPNA 2FGZA 3SY5A 1JZ5A 1QNRA 9CGTA 1OFRA 3PJXA 4DF2A 1LDCA 3KVMA 4IGMA 4OV4A 3E5PA 1XCWA 3NO1A 1OYAA 3S1WA 1J96A 1KTCA 4JDYA 4QJ3B 4JXCA 4C7GA 4DXVA 1OCJA 4DO7A 1MNZA 5LNRA 2PLCA 2V5JA 4BI6A 5U4NA 2Q8LA 1BWVA 2Q01A 2WV8A 4AW7A 3FSTA 5M2FX 4UNKA 3HN3A 1CX9A 4H9MA 1TPDA 3GZ3A 1JQVA 4ZVJA 3V35A 2Y4SA 9RUBA 1PZ1A 4WIWA 5DMMA 3T78A 3OODA 4YTSA 1DIKA 4PUKA 4K7YA 4FALA 2OT1A 3E2VA 4MMWA 3W85A 4U3AA 3RITA 1XIDA 1XWYA 4IQLA 3I6EA 3BLOA 4P7RA 3BW3A 4IGNA 3ABQA 1ONWA 2PMQA 3RJXA 1UJPA 4AD2A 1FRBA 5F2IA 3W7DA 1VENA 4CU7A 3HPFA 1KLZA 4EPDC 3CV6A 2HZGA 1EIXA 2PUZA 1O95A 4TXEA 4QNWA 3BAKA 4GXWA 5FL1A 1Y5VA 1MUWA 4H19A 2IW0A 1F2JA 4JNYA 3D0CA 1LT8A 5C2XA 1UROA 4ZB2A 4JKMA 2WCGA 4PL2A 2O7SA 3WMLA 1L6SA 1W5QA 4XVEA 2PDFA 3WJWA 3IARA 2P5NA 3UESA 3I6RA 4AZCA 1IEIA 2Z27A 5AOUA 3TE9A 3UZWA 1JCYA 1GQKA 3FA3A 4OUIA 3DBNA 1GQJA 4S3CA 3U5UA 3VYLA 3MV01 2JEQA 3KUMA 2QUMA 2WHLA 1XG3A 4JX4A 4DPPA 3FXYA 2ALDA 2WLZA 1W1A1 1P0KA 3VNIA 5LIYX 4DYJA 2DV0A 3O06A 1MFUA 4UOJA 3GXTA 1OX4B 2XH7A 3L66A 1C93A 1SFJA 3HPSA 3WLPA 5E6ZA 1PTGA 4ZEPA 2WVVB 1E6SM 3UR5A 5HNRA 2VGGA 3SURA 2PRMA 1B57A 3A21A 2HNEA 4L61A 4ZE4A 3T8QA 1X38A 3VILA 4W7VA 3VKJA 3VD9A 1VBJA 2WJEA 1F3WA 2YW4A 5BXTA 3PN8A 2AKZA 3N15A 3KVLA 4O12A 1DBTA 3W75A 2PS2A 1W32A 1BRLB 3M0MA 4WOQA 2ZA2A 1W8GA 1PS9A 2QCMA 1M1BA 2ABAA 1FP9A 2QCHA 1W2PA 3BLFA 2W27A 3A5FA 1ZQ5A 4Q4PA 5DMNA 4KW2A 3BZJA 1EGZA 1H11A 4ZXLA 5A6LA 1DHPA 3QOKA 1QBAA 3IJ8A 4L4PA 2FFCA 2I1OA 4QIUA 2QCGA 1HGYA 3POCA 2VFEA 4GUGA 3PTDA 4Y9PA 2UY4A 1PYMA 3T05A 3LRKA 3W70A 2JEPA 5XINA 4PSPA 2ZUWA 2QGYA 4UTHA 4BK9A 2WYSA 4DJFD 1X7IA 4UTWA 5FF3A 2PP3A 1AQMA 2ADAA 5D05A 1FWJC 1IR1A 3MVIA 3F2DA 2A85A 2Z28A 2PGFA 5I0DA 1RJPA 4A22A 2HQAA 1E9LA 2VGFA 3LPGA 2GGEA 3S1VA 1XDJA 4MKNA 4AUBA 4B5SA 4GIRA 3SO7A 4KEVA 4AY7A 1R2SA 1BVNP 1XP3A 3G1AA 1VPXA 4JTJA 3WNMA 1V02A 3I68A 1QCWA 1AZ2A 4AZIA 3ZSTA 2MNRA 2DT1A 3UYIA 3KBSA 4FXJA 4UFHA 5HOSA 3FY1A 2VZSA 4POCA 4G8TA 2OZTA 3AMGA 4PBFA 4BWLC 3B4YA 1XCXA 3PZGA 1E15A 3P61A 1TJ1A 5C54A 1N8IA 4J40A 1RCQA 1Q6DA 4ICCX 1MO0A 4ZA0A 1OFEA 1J0HA 4HYRA 3KVKA 3HJEA 1PIIA 2WZMA 1RZMA 3WD1A 3W76A 1YDNA 3ZVIA 1IEWA 2I9EA 1WDWA 3PZUA 3DYPA 2BNJA 2ACUA 3RUBL 4XD4A 2XFYA 1DIDA 3RR1A 4CNOA 3A3XA 5IHSA 3IGHX 1W1PA 4MB4A 4D1IA 5G5IA 4FOUA 3WUBA 3T42A 5JH2A 3OB8A 4WDWA 5FF0A 2QLYA 4EPBC 3B0YA 5DT7A 1XV8A 4XBKA 5HULA 1E4NA 3ELFA 1GTEA 2C0HA 1BQCA 4E5TA 1EF3A 4PC8A 4GXPA 4DJDC 1U1JA 3GW3A 4JL1A 3SY8A 5C2GA 4HPJA 3JVAA 4Q7IA 1EEXA 4GIEA 5D03A 4RL3A 5FEWA 1RVKA 4AVFA 4OOUA 3TC6A 1EPVA 8RUCA 3E3HA 5AYXA 4YHEA 1JZ7A 3LM3A 3HG4A 4C1NB 3WFLA 3PK7A 5HPCA 3W23A 1EFZA 4CD5A 4JTUA 2XM2A 5T8GA 1OF6A 3VABA 5EFFA 3F5JA 3GKFA 4KCTA 3EX6A 3AZRA 5LSMA 4UWMA 3FJ6A 3WDHA 4V28A 2FH6A 2HE5A 1VBUA 4ROPA 4AEFA 4WJXA 4KH2A 4JTIA 4PE8A 2WO5A 3WF3A 3MO7A 2UY2A 5K4XA 2O4MA 4C60A 1PAMA 1JUEA 3WLQA 4TU1A 4AXNA 1XYMA 3ITVA 4MPKA 1VZWA 2YXGA 1YNYA 4R5EA 1AODA 3WK2A 1XLGA 3TEVA 2FMNA 1UUOA 3S42A 4AD3A 1G1YA 1NP2A 1V93A 1E1CA 3AO0A 4C6MA 4H2CA 3BQ5A 4A8LA 3SR7A 5EMYA 4CNPA 1S5WA 5HJLA 4ZOBA 2KZHA 4GY1A 4CD7A 3PAOA 1RCXB 2VKZG 4XKYA 1FXQA 1R87A 1GW1A 3QSTA 1UR1A 1YHTA 2IPWA 2CZEA 4EANA 3M5VA 4IG2A 1PUDA 3AROA 1X6UA 2Q6ZA 1MXGA 2VI0A 3W74A 2PODA 4AYGA 1KD0A 1RALA 1J9YA 3WUEA 2X0HA 3OA3A 1HJSA 3BOXA 5DBTA 5FJOA 1A50A 3GNOA 3FSUA 2EPOA 3FV9A 3HA1A 3W1QA 3ENLA 4PCFA 1B90A 3F2CA 1HX0A 1UMYA 3NQDA 1S2WA 1D3CA 3BZGA 2OEJA 4YS1A 3NL5A 2Z7GA 1IIHA 2DORA 4GYKA 2PDKA 3RU6A 1WOAA 1ISVA 3OU8A 3FVDA 4GVGA 1NM9A 4YHGA 1EJUC 3ABXA 1YE6A 1G6CA 3L0KA 2HXTA 4WUIA 1FCUA 1SW3A 1UD6A 5CQ1A 4XZHA 2D69A 5AC4A 4O53A 3V16A 1PZ3A 1OGGA 1LYXA 4QE5A 2C1HA 5ECVA 4DM2A 3FAXA 2EPLX 3W2UA 2G4FA 3THAA 5G4WA 4WJEA 3RF9A 1I0DA 4LEFA 4S3KA 1US3A 2W91A 2GGGA 1EGMA 4ZCWA 3P0XA 4JYDA 3MJMA 2HSAA 3T2PA 4A3HA 2PBOA 3ES8A 2INFA 3B9DA 3CV7A 4I9AA 1JDEA 3S2CA 4BQ2A 4QDMA 4QCEA 4KRUA 4GLEA 3ID7A 1K8YA 3HMCA 2CETA 1AMKA 3ARZA 1XYLA 5FEPA 4QISA 2WSQA 1GZJA 3O6CA 4TX6A 2YDAA 2XFRA 3TMLA 4JTRA 5CPQA 1QNQA 3C8NA 2QV5A 2GQ3A 1QHZA 1G5AA 2Z6JA 2VD9A 1JZ6A 3D47A 3EXRA 3ITGA 4TUFA 4HNCA 3GFYA 1HN1A 1A5AA 1T7LA 3SZ8A 5G1TA 4U5KA 3A24A 3LA4A 1TR1A 5IDIA 3AZTA 3TZFA 3TVAA 3GZAA 4GWEA 1YPFA 1ZTVA 3G2GA 5FESA 2Y7FA 3UZXA 1PX8A 1XUUA 3PUEA 4JN8A 4KFOA 3E2QA 4AWTA 2C18A 2ZWYA 2CFFA 2PB1A 4XG1A 4D8LA 2UY3A 1OK6A 4PMVA 4DBWA 1K9TA 3OGRA 1JCMP 4CN4A 1QI5A 1G4TA 5DMYA 5D8ZA 3PC0A 3ZVHA 4GUIA 3UEQA 3VKAA 3EMCA 1PSCA 4FNRA 2XN2A 5AHLA 2ZTKA 2QCNA 3KL5A 4R7WA 2NQZA 2PWFA 3ZR4A 2FQIA 4MB3A 2J7BA 3G1FA 1Z48A 3BW2A 5CC5A 2QCEA 4XQ6A 4D8ZA 3RLGA 5LNUA 2J7EA 3WQPA 6PTDA 5FF4A 1GKRA 3KVJA 3PANA 4I7VA 1R3SA 3PTQA 4MZ8A 5F2MA 3VFLA 4LCSA 1KQZA 3RGTA 1H2JA 3TXZA 4HSHA 4IZGA 3GC2A 2ZOXA 8A3HA 4A2RA 1EKOA 3HZ3A 2VFHA 5B80A 3VE9A 4N9BA 3FEQA 2XH4A 1POJA 3S0CA 1R86A 5A69A 2OJPA 3RMEA 3MYOA 3ARTA 4PCTA 1W1VA 5DX7A 1U5HA 1KLYA 1XD0A 3T40A 3RMJA 4MHBA 3W1LA 3VOCA 4IMAA 1M68A 2UY5A 3T44A 5KMYA 3QY6A 4GD0A 4FOJA 2PC4A 3L21A 1Z69A 1O6IA 3TCSA 2WMGA 4MWAE 4AZ7A 3V1HA 1AD4A 3WQ5A 1CIUA 4BCEA 3OPSA 1TTJA 3JS3A 4I9MA 1XSKA 1M04A 4P8VA 4CU8A 5EMUA 4NJHA 3DXIA 3IGSA 4HVXA 1SR9A 5HANA 3BMVA 2FVKA 3RLVA 3W02A 3ATZA 3CQHA 1BWLA 4GKLA 1HJXA 2FZMA 4UBPC 1J5SA 4UQCA 4XKMA 4BFAA 1TCDA 3W7OA 2PCQA 3HFTA 2CLKA 4A21A 2DQXA 3NQGA 1QW9A 4ICNA 3S6DA 3VGBA 2QR6A 3KCOA 3GHTA 1BYDA 1W91A 1VJZA 4O1EA 1VPYA 3DYOA 3L4ZA 3P6LA 1UIPA 4FF7A 5G4HC 3DX5A 4IXXA 2YL5A 4OIFA 5BRPA 1EO5A 3QKZA 3TLLA 1EP2A 2OODA 2A4AA 5FI8A 4FLSA 4LRSA 1I60A 1VFFA 2HPIA 4HNNA 5HJYA 4F8XA 3RX4A 5A94A 4IFKB 2GSHA 2VT0A 3PZOA 1PX3A 1MMFA 1XIMA 2DP3A 1E4LA 1Z3NA 5LNWA 4NNBA 4BA0A 1XLIA 3S5OA 1X1OA 4HU4A 3WNNA 2Z1SA 3LHTA 3TR9A 2OSWA 4CEUC 3MKKA 4W93A 1NU5A 1OCBA 1I2PA 1UHVA 1H1YA 4GX8A 3W4RA 4PMUA 1KCKA 1Y0EA 5H2ZA 4G7EA 4GVFA 4LGXA 2A6LA 1H49A 2QCFA 3PZMA 3W0KA 2AKMA 2WMJA 2X05A 2I56A 4DZAA 1BXBA 3B8TA 2J8FA 1CBGA 4RPPA 2E9LA 4RXGA 2OKTA 5HQMA 4HK6A 1J01A 1UP3A 4LYKA 3CLWA 4LYQA 3ICJA 4Y8EA 4K7VA 3B0XA 2H3DA 1W5PA 4L7ZA 4LCQA 1LBLA 4Q6XA 2ZFAA 1DORA 4LY4A 4GI8A 4O11A 5AHEA 1ME9A 2P3EA 4PODA 1I8JA 1UR8A 5KZMA 1XIEA 1R7AA 2HROA 3CS2A 2JIEA 1WB0A 3EDJA 4M6QA 2VUNA 2PD5A 1ZPTA 4HBKA 4HNVA 4F3HA 1LOQA 3RNDA 1W3HA 3V3WA 3LTPA 1YKWA 1GOIA 3C61A 3NFUA 3VKBA 3NVTA 3VDAA 1SGJA 3VOJA 4LB4A 2BXYA 3F03K 5ENLA 4IX0A 1XISA 4TTUA 3SQLA 4JS3A 3HQPA 2XPKA 4BI5A 1W5NA 4W8LA 1VRXA 4H3DA 4TQTA 2OWCA 3ZLGA 3DHFA 3NPWA 3IUIA 2HVMA 2YBUA 1V0MA 4IL2A 1W31A 3AXXA 2ZADA 1WZAA 3DIPA 2JGYA 4R34A 4E8GA 2W79A 4C5ZA 4PUMA 5D02A 3O63A 1B4EA 1LOSA 4YXGA 4JZ5A 3WY1A 3JUGA 2XTKA 4F0MA 3SCUA 3LXAA 5HMEA 4PL1A 2PWUA 4GZEA 4MJ4A 1H7RA 1VJIA 3XINA 4BJHA 4Y9MA 1CXLA 2OTDA 2R1MA 1W17A 4L9XA 1DJXA 2DZAA 3BMWA 4QXIA 5JUVA 4U4MA 1BF2A 3LBMA 3P8JA 1RXOB 2GJPA 2PDHA 5EYWA 5I07A 3EWYA 1ZCCA 4CNSA 4JGDA 1V6WA 3I6TA 3ERPA 3L4XA 4RDVA 1XLAA 1K7XA 1UYQA 4HPXA 3CZEA 3U4AA 1MZHA 4HOWA 4JHOA 3TJLA 4M6PA 1JCTA 2CZFA 3OHIA 1FXPA 4ZTYA 3FIGA 2FDSA 3NOEA 1A5SA 3QLLA 1K7FA 5D04C 9XIAA 1XBVA 3G8EA 4RNHA 4H01A 5BMXA 4KEUA 2C3ZA 2OO0A 3UWWA 4MLRA 3PB2A 3IWPA 4GCAA 3PPFA 2Z1VA 1YX1A 5HJXA 5E9AA 2W4XA 1B4KA 4O1AA 3S4TA 4LNYA 3RO6A 1PHWA 4MDPA 5DRIA 3MKVA 1EBGA 2CPUA 3H4XA 4G6CA 3TQKA 1UWIA 1ENUA 4I7UA 4WHBA 1J12A 1HT6A 3FJ4A 3UXIA 4ES4A 2BX7A 1XGDA 1QOQA 3WIJA 3M5ZA 2R6OA 1HIZA 3R89A 3M43A 3IJ7A 3E74A 4CVUA 2VJXA 3U48A 3IJDA 4P7QA 2WNNA 3S9YA 2DEPA 2ZICA 4LALA 3KP0A 1CXIA 4Q7BA 3KLKA 1ZFJA 2FB3A 2OU4A 4AMCA 3BSGA 2TAAA 4AWSA 4GY0A 4DLMA 5CG7A 2IKJA 4IQEA 4GIYA 4DF1A 2Y85A 1ESWA 3GAYA 4KRZA 3CQJA 4M0XA 3PBMA 2Y24A 1XDLA 1XR2A 2FIQA 3HGSA 2NVCA 1FP8A 1TYGA 2ZRXA 3O6AA 3TZNA 3ZWTA 3T07A 2PDMA 1OZMA 2DZTA 1MEHA 1VKFA 4CLMA 4TVCA 4KF1A 4AVOA 1BYAA 2CBUA 1UOZA 3KHJA 2VC6A 1E71M 4GINA 2GOUA 1Q7QA 3NJ3A 4XUGA 4OBTA 5HNTA 1JR1A 3AI0A 3CT7A 3FNDA 4PUUA 2Q3RA 3CWNA 3HU7A 3IIVA 1UA7A 3L5AA 4PMYA 2PA6A 2WKJA 2WCSA 1CWYA 1XIBA 1FH7A 1SZEA 4E3TA 3M0JA 3QV6A 1DVJA 3DBPA 2VVSA 1ML1A 2YCIX 3HQOA 4XD6A 2CHNA 3TC7A 3GHSA 3LZ5A 4J3VA 3TOYA 3HOJA 3EAUA 1H7NA 2F38A 2G8ZA 3BV4A 1KB3A 5GNZA 1CB7B 1V3IA 4XD3A 1G67A 4LOCA 1QTWA 4OBRA 2E6FA 3HV9A 3IUDA 1SQ7A 2BGQA 2GUYA 4OECA 4HNUA 5JIPA 3WBYA 1OX6A 4B5XA 2QUUA 3W6YA 4XZIA 4OWGA 5M3WA 4KEZA 1PIGA 3LPPA 2QCDB 4GNVA 2V6AA 1PX4A 2XN0A 1Z44A 2VX4A 2O9RA 5I03A 3L68A 5MKGB 2VR4A 3ZJ6A 1DTNA 4NQ1A 1TIMA 5AC7A 5FF7A 4ALDA 2H9AB 4LAMA 2HPMA 4P7OA 4TVUA 1I9CB 1X39A 2RHGA 3DFNA 1T8XA 2A0NA 5EGRA 3WG6A 5LYRA 3VX1A 4A29A 2PTXA 3Q94A 4Q4RA 5A6BD 1W5MA 5D32A 3I3EA 1RA0A 3GVGA 1JPMA 1TO3A 2YB4A 1JXJA 4HCHA 4WY0B 3QW4B 3TTOA 2W5FA 3WBEA 1QNPA 1YW1A 3NQCA 1SJCA 3W7HA 3MS8A 3N34A 7A3HA 4L4MA 5AHIA 3SGZA 1XYCA 4ZQNA 4LCRA 1ISZA 2IMRA 3QZEA 1SM9A 2ZA1A 3POHA 1M3UA 1FDJA 4DF0A 3DHUA 3GK0A 1BGAA 1KKOA 1OC5A 4ACZB 2F2HA 3MMDA 5I23A 3S2NA 3W00A 5DY3A 4AHQA 3OZMA 5E0CA 3IANA 3SRKA 3E0IA 2XISA 1P7TA 2DW7A 2QMKA 4AD4A 1GG0A 3WQ8A 3PS7A 1KTNA 2WKLA 1H61A 1EJRC 5DANA 8XIAA 4FNSA 5IRPA 1JAEA 1UKOA 1H5VA 1LWHA 2J4GA 1I4NA 3VOIA 1ZZMA 2PWEA 4QJ5B 4EP8C 4UZSA 3LENA 4JIPA 4INFA 5I77A 3CEPA 3M0YA 1Q8JA 3FXGA 3W29A 3LHYA 3HTWA 1XIJA 3TW9A 3ZT7A 1F6KA 1Y8BA 1VJSA 3DAQA 3GH7A 1TJ0A 1MVYA 2Y63A 2ZBTA 3EYPA 1Y7VA 3H2EA 1N7KA 4S23A 4CN6A 2GJRA 3KE0A 1OY0A 3PWAA 3R1ZA 3BWWA 3TN4A 5E9XA 1LG2A 2V3FA 2ZUNA 4HZ6A 3NOYA 1OX4A 1UZ4A 3N4AA 2DQWA 3NO3A 1WXJA 1M53A 5AHFA 3WK1A 4HPHA 1HKVA 4DM1A 2QYGA 1HJQA 3H21A 3D3FA 3VNDA 4UR9A 5DQPA 2ZZ7A 3SBFA 3M0VA 1R3YA 3GWQA 2BGSA 1W1B1 3QBUA 1CENA 3QH2A 1V02E 3OZYA 2D3NA 4O15A 4I5XA 1YNQA 3KHDA 4J7RA 1NDWA 2A2IA 2GJXA 1THFD 2QJGA 3CHDA 1JYWA 1E4IA 1EQPA 4DO4A 3PPGA 3HMJG 5GQBA 1W6TA 1KXVA 3O6YX 4LT9A 2IPGA 3IVTA 3B9OA 5I09A 3FLUA 4HK5A 2VUYA 4NYYA 4W8AA 2GVYA 4C6FA 2V3DA 4EAMA 2OLHA 5JIWA 1E0UA 2NQJA 4RZ4A 3W27A 3KX6A 3T55A 1W8SA 4PGLA 3W82A 3I7SA 3PBGA 4ZO7A 1F76A 3QPZA 2XIOA 5T26A 4B3LA 2QCDA 3C6CA 1NWRA 3N2CA 3CHFA 2ZRUA 5U7SA 3NDOA 4D6DA 2VNCA 3G1RA 1NOWA 1GYNA 4NKCA 2CKSA 4TX8A 3GYCA 4UTTA 2VZVA 4ZO8A 3AS3A 3AJ7A 3CUHA 2R24A 2CLHA 1E9YB 3MP3A 1A5NC 2Z26A 3NEHA 2J9YA 2X2YA 4L5ZA 4LH8A 3KP1A 1TPWA 5BOEA 2OX1A 3VX0A 1VF8A 4ZODA 1ITUA 2ZZ4A 1HTIA 4AY8A 1SO4A 3PVFA 5I06A 2V3EA 1QK0A 4GUJA 2XIBA 3N1AA 4EWJA 1VBRA 4IIEA 1LRTA 1J5TA 4MLJA 5F4SA 2V5LA 2Y7GA 2Q71A 4IUOA 4AB4A 1SJAA 5JBDA 1PYFA 2CESA 1XRVA 3AU2A 4UMCA 3W7PA 2E68A 4HNLA 1FWWA 3SN0A 4WRHA 3CYJA 4M1RA 1KKRA 3HBLA 4W84A 3UYCA 4HTYA 4JTQA 4AQLA 4CU6A 2F6XA 3W6LA 4JIIX 3PSWA 5A3HA 1F8IA 1YDVA 2AAAA 3E96A 2AQVA 1XW8A 1N55A 4CKQA 3M1ZA 3PULA 4Q4SA 4LTSA 3WF4A 2OLAA 4AC7C 3IV8A 4PRTA 4BEQA 4N9EA 5I3FA 3CU2A 4LBSA 2ZZ6A 5D09A 1K03A 4D6HA 2QJJA 3APGA 3DC0A 4RNIA 1E70M 5D8WA 3W7RA 3SCNA 1BG4A 1NOUA 2FZBA 2WZTA 3WYZA 2H6RA 4QE4A 3V1PA 2DT2A 3UJEA 4PZVA 4NZ3A 1VBHA 4XTIA 4LV9A 5F4XA 3UVAA 1BKHA 3MCNA 1DQXA 1TG7A 3B8DA 4RV3A 4TIMA 3QZ6A 3AIRA 5A6JA 1JCLA 1UR3M 3WELA 1NWSA 3MSYA 1G7UA 1P0NA 4WKFA 2XGIA 4UTIA 1DJHA 1SPQA 4XAYA 4WD0A 4D8AA 4EX4A 4LPCA 2VFFA 1W37A 2BVDA 5DO8A 3TN3A 3W7LA 4ONVA 3W1PA 1E55A 2ZDRA 3QGVA 3G22A 3VE7A 2F6UA 3URQA 4HB7A 3A4AA 3NAVA 1XBXA 3CT2A 2KX9A 4RW5A 4E6MA 2WMIA 1QW8A 1F61A 4C6EA 3QC3A 2QGHA 3SECA 2YGYA 1VC4A 1ZB5A 3RJYA 4EF9A 2QAPA 3MBDA 3CWHA 5C7HA 1K9FA 4I5RA 1S5MA 4KMQA 3TR2A 3N6HA 1PZ2A 1R2TA 1JULA 1A0DA 1W0MA 4LC8A 4GJJA 5AN7A 3H7VA 3LN3A 4NIRA 4NU7A 3SUTA 1L9WA 3VKKA 1UZHA 3ZQ9A 1Z41A 3TTQA 3T0DA 1ZAHA 1GG1A 3GNXA 3B0VC 2E67A 1EHNA 3HG3A 2IXUA 3CV2A 2YL9A 2VO5A 5FAGA 2ZZ2A 5H1WA 1XL9A 1HKJA 2FB2A 3CMFA 4Z2IA 1L6WA 3I4KA 2OO6A 3W1NA 4XIAA 2BMBA 2PI6A 4H4IA 2E1WA 4PMOA 2P50A 4YPJA 4DZIA 3LI1A 5D9PA 2VYOA 1E0VA 4DYEA 1WNOA 1JPDX 3NG3A 4GGHA 3RDKA 2V2DA 4GMEA 3U8GA 1QI4A 2CBVA 2Y2WA 2P0OA 2DZXA 4WSHA 3QRHA 1JD7A 4UR7A 1KRAC 4PTMA 1I6NA 1KFJA 1JNDA 4Q4MA 1Z32X 2FKPA 1AL8A 4Z2HA 1J79A 3LZ3A 1H7XA 1TPFA 3G1DA 4QQUA 3UNTA 3H53A 1JEZA 3P14A 1ZCOA 4YTUA 2O9OA 3W7JA 2GYIA 1M01A 4AG0A 3CBWA 1JYXA 4LUJA 3VD3A 4UIOA 3B0PA 3AYVA 4IPLA 3IACA 4CQDA 3EX1A 1X97A 1KFBA 1BYCA 1EC8A 4LAKA 3VMOA 1H7PA 1F07A 3PWGA 1M7PA 3WEMA 3ZJKA 3BJSA 1QAPA 1VLIA 4A2SA 1E6NA 1K8CA 4UR8A 1BF6A 1KM0A 3S47A 1XBYA 3LS9A 4XBJA 2IXVA 4CUCA 2CXGA 3WQEA 1O4UA 1AA1B 2RGLA 4K8EA 2XHYA 4NI3A 1OK4A 3NSMA 3SCOA 3WUFA 3CASA 3EA1A 3GDMA 2E8ZA 4MZ1A 1RSCA 2PRLA 5FOOA 4AH7A 2FGLA 4PN2A 4O19A 4UMBA 3E0LA 5GNXA 3G6MA 3WH5A 3H55A 4L1XA 3O8AA 3M41A 2PU0A 3CAVA 3OYZA 2J62A 2XJ7A 5CZJA 1JZ3A 4O10A 4MIMA 4HOXA 3KTXA 4DWSD 3F4CA 1RV8A 2PDGA 2DZVA 1PWLA 3AXIA 3S6OA 4OGZA 4XK2A 5LIWX 1CZ1A 3NZQA 4LBUA 3KLLA 3TYDA 1Y5WA 3G1XA 1GVYA 1T96A 1DJQA 2FHBA 5FEZA 4NL1A 4IOTA 4M1BA 2VP8A 2ISSA 3MI6A 1YDOA 1LJYA 4UTMA 2ESCA 3W37A 2RUSA 3EXTA 4GISA 4QDWA 1O5RA 4LXFA 3GX9A 5KSWA 2WVTA 5HUPA 3PFMA 2X2GA 1NWUA 3OQEA 2VHLA 2Y8KA 2H9AA 3GE7A 3BLKA 3RRXA 1G4EA 2E3ZA 2BB0A 3P84A 1KM2A 5FF2A 4DAIA 2D22A 1P1XA 3DDMA 7ODCA 2YL8A 2FGBA 4DVOA 1W3JA 2ZIDA 1M7XA 4A8NA 1VEPA 3JRKA 3SQSA 2PFHA 3M44A 3AIUA 1XYFA 5DY2A 1MQPA 1YPXA 3P5YA 2PGRA 2WQPA 3E2SA 4OOZA 3NQEA 1J4EA 1GVIA 1RJRA 3ABOA 5C9XA 3LCWA 3AS1A 1VFSA 3UR7A 3OLIA 3VPLA 5FKYA 1QNVA 1HKMA 2PWHA 3MUIA 4AZBA 4ZFCA 3OHMB 4FZIA 2J9XA 1LUCA 3QYSA 2GDUA 3GC5A 4HKPA 2F8QA 3RXZA 1L0PA 2W62A 2XVGA 2ZX5A 3K2GA 4OJYA 1K4GA 3PNZA 3A3WA 4UUIA 1EZ2A 1F7BA 3U3HA 3FK4A 3GTNA 1W2VA 3MWAA 3S1GA 1RP9A 3C0JA 3AICA 4PEEA 2V5KA 2XWEA 2FZ9A 1EYWA 1ZJBA 1JRBA 3LDVA 4CQ9A 1ITXA 3R2GA 5KINA 4JTFA 4HGXA 5CAHA 1D8CA 1A5BA 4R7OA 3EOOA 1DJNA 5ECUA 3P8IA 4GG9A 2GUUA 4AEEA 2VENA 4XO6A 3N73A 2ISVA 4DJFC 2QCCA 2PTDA 2YLAA 1JJKA 3PF3A 3OP2A 1P43A 4IQJA 3R8HA 4JY8A 3SW6A 4O18A 4GYFA 2J9ZA 2IS7A 3VDCA 2GGHA 3TX9A 3BDKA 4TOQA 4AXKA 4CQAA 5HQEA 1E1CB 2G4JA 2XZ7A 3QR0A 3M6YA 4YNGA 1OD8A 3VIHA 1ICQA 4K2SA 4US5A 3BANA 3MO4A 3QZAA 4GI6A 4IM4A 3N25A 2TRSA 3TONA 4WGHA 1NQKA 3OW1A 2QCLA 3K8MA 3S5SA 3QPEA 4GACA 2OZ3A 4IMEA 1WO2A 1UQZA 1H0GA 3ITCA 5GNYA 3M0KA 4MDOA 4AFYA 3E38A 1A5OC 1TCMA 1IT0A 4OKDA 3EEGA 4A3YA 4CGTA 3O2LA 1QR7A 7PTDA 4J35A 2VRJA 4KKXA 2VX7A 4GQGA 1RK6A 1P1MA 4GFSA 2VC7A 3C2OA 4D6GA 4C1NA 4NILA 1GVSA 1R5YA 1UWUA 3GYEA 4WY0A 4Y2WA 2PBGA 3GG1A 3ZT5A 1I2RA 4JX5A 4NHVA 4E8CA 1V6VA 8XIMA 5PTDA 5C8BB 1EBHA 1GKPA 4P7LA 3OLEA 3A22A 3TAOA 4K8HA 4JKLA 4EIVA 3V0UA 1C9DA 3PBVA 2NT1A 3QC0A 5TIMA 1C7TA 2WLYA 3NYZA 3WMBA 5B7ZA 5I3IA 1LWIA 4YTTA 4N6FA 3STFA 2H8XA 1PXGA 1QHPA 4ROQA 5CPTA 5C9ZA 4MZYA 3PBUA 1GZGA 2DZUA 1I1XA 3WLKX 4HMDA 4ZO9A 3R0UA 5FJPA 3FHQA 1POKA 1AVAA 3EDEA 4HYWA 3B9NA 3WO8A 1EDQA 1J0IA 1FHLA 5CJNA 1TUXA 1DXIA 3IK4A 3BLDA 1GGOA 2LLEA 2B7NA 1TPC1 2PDXA 1TE1A 1U1HA 4UZUA 4XZMX 1RBOB 2Q8XA 1F5ZA 1J18A 2YYUA 4XBSA 3OVRA 4ACYA 4S38A 3URBA 1WV2A 3RIKA 3OBKA 3R6IA 1R6WA 4H8HA 1DIOA 1JPKA 3LB0A 5EBAA 1O66A 3AU6A 4IMCA 3BV7A 5CAKA 3ISIX 1V7YA 4U2ZA 4BR1A 1S39A 4UXDA 4NZJA 1R30A 2YKKA 4Z2JA 1KGUA 2YXOA 3KDNA 1VYSX 2YZ5A 1V4YA 1XJBA 3CJPA 2V3GA 5ABGA 3W71A 2IQTA 1FWTA 1XYZA 3RLUA 5BXPA 4YVVA 2G95A 1PKNA 4B4FA 1JFXA 3T0BA 1MZRA 3E6EA 1RQBA 6ENLA 4GH1A 3UA4A 3BLPX 2YL6A 3KFTA 3GDBA 3MSGA 4M5PA 3TN5A 1L8NA 3BGAA 3DI0A 4JEQA 3AHZA 4AISA 3RYSA 1EXBA 4GO9A 2D1ZA 4I5UA 4X60A 2EPNA 2G3MA 4F9JA 1EEPA 1OWQA 3A4XA 4O0QA 1M65A 4QQ3A 3UFYA 3WQDA 2J8TA 2PWGA 1I2OA 1KRCC 3AWNA 3INPA 2V67A 3SSJA 4F48A 3AMCA 5HMDA 3NNTA 3BG5A 3CAKA 1QW7A 1W9XA 3KTSA 3R7MA 5C6MA 3MUZ1 1DE5A 4WCJA 4DNMA 4K1GA 3HPAA 3FHAA 1FWNA 3E02A 1NY1A 2YCLB 3HURA 3T09A 1QHOA 4IICA 3UCDA 1OFPA 1UASA 2BWGA 4R3UA 1T8QA 4Q4QA 1JDFA 1V3KA 4PTWA 2NSXA 1NSJA 1KR0A 1RUSA 5A8PA 3F2BA 2CW6A 3F4VA 1R2RA 1WAUA 3KOXA 5H8MA 2SFPA 3IIXA 2HJPA 4U5IA 2NZLA 3C3UA 3UBPC 2BXZA 1QOXA 1HL8A 1XH2A 1CLKA 3QSRA 2CLMA 1CXKA 1C9WA 4YMZA 2ZZ1A 4RX0A 3J7HA 1RBLA 1U83A 4TV5A 5BU9A 4EXBA 2C7FA 1H51A 1NFGA 4U28A 3NQ8A 1S3TC 4G1KA 1I2NA 4DJDD 4M8UA 3AOFA 4Q33A 2V5CA 2OSYA 2Z6IA 4IF2A 1MW1A 4JD4A 3NL6A 1IWPA 4HNOA 1EP1A 1NJJA 1A49A 1P48A 1PBGA 3BCJA 1OC7A 4PB3A 2PTZA 5CCZA 5CG0A 3MCMA 1DTUA 3GXPA 1H7OA 3W22A 3W1TA 2RDWA 6A3HA 3H70A 2FJUB 5BRBA 3UY7A 4AMAA 4HSOA 1BPLB 4AZCB 3LCGA 3UA3A 2V9DA 4GY7A 4MAZA 4TMCA 3OIXA 4M51A 5G1YA 3TA6A 1UZDA 1F3EA 4JTKA 3M7WA 3F7JA 3UWEA 3WQ6A 2ICSA 5AC8A 3SDOA 3TSDA 5AECA 1UB3A 1XUZA 2HS8A 3KEHA 3LG3A 4ATDA 4PFMA 4QJ1A 3B0UX 3JR2A 2WJZA 4Y8FA 2F61A 5BXRA 4FR1A 3GG7A 2YIHA 4F66A 6XIAA 1OIMA 5M5DA 1F4AA 2NX3A 2B81A 2GGJA 2WMHA 2HMCA 4NX0A 3THQA 3JZEA 3S2LA 2D2GA 4HTBA 4C6CA 3MP5A 3OBAA 1R9XA 2F84A 2HISA 5E1QA 3KS5A 3W84A 4EE9A 1MFVA 3IV3A 4PTXA 2Y8UA 2WHMA 2YW3A 1SO6A 2OEKA 3SRDA 4K3ZA 3AHTA 3M47A 4LVFA 3UWVA 1R3TA 4Y9AA 2EO7A 2V63A 3ARWA 2OYLA 3STGA 4D72A 1QPOA 1BWKA 1WPCA 3MA8A 4NJIA 3ALGA 2V69A 4PUEA 1IXQA 2ZRYA 2CLIA 2D2OA 3CC1A 3KRUA 3N9KA 4YVPA 3B40A 5DCBA 2TYSA 1ISWA 3C56A 4HJWA 1ZU8A 2B31A 4S3FA 2DT0A 4PBEA 3TC3A 4H7CA 3KZSA 2O56A 5CZ0A 4IWWA 3VNZA 3FAWA 4RV8A 3PG8A 4CD8A 2OQHA 4EXQA 3K46A 1W3TA 1TB3A 3TIMA 2ALRA 2XVPA 1UR2A 2QS8A 3MC5A 1H5YA 3ZLFA 1VHCA 4I7WA 5HAOA 2BP1A 3GAKA 3XIMA 3U2CA 4W9TA 3P60A 4PCSA 4GNJA 1QVBA 2OSXA 3WDIA 2XVKA 5K9DA 3EA3A 1OC6A 5FAJA 1M03A 1YXDA 1EWDA 2F6KA 3NCOA 4UFLA 3IAPA 3W1MA 1GVRA 5DFAA 3WD3A 1O5QA 3QR3A 3RX2A 1NDVA 2PTWA 3Q4DA 4DAFA 5AYBA 4WQ6A 2DZBA 1OVDA 4PUNA 1E72M 3THDA 3CQKA 5BMWA 3KDOA 4E2BA 1C29A 4PTDA 2ANUA 3QFEA 4Z1YA 3RR4A 4RCXA 4ZQMA 3LLXA 3LERA 1HL2A 3I7QA 4ADUA 4U10A 1KFCA 4MNKA 3M46A 4BI7A 1S5TA 1ZBVA 4FNPA 3MP4A 3WJZA 4S2BA 3CB3A 4GX9A 1RH9A 4JIQA 2YDSA 2GVLA 4QS5A 3DECA 3SEPA 4PFHA 3C5QA 1Q6OA 3LPOA 3E0VA 1NIUA 4E4UA 1CI1A 5GPRA 3DHDA 3CZLA 2GSJA 3CB8A 2Y88A 4S3EA 3B9EA 1GWJA 3TW7A 3N11A 1R38A 3EZ4A 3SIZA 2YX0A 3WD2A 3A3HA 3CTLA 2CITA 3SGUA 4L4OA 2XFWA 2ZE3A 2PDYA 3N14A 2FPTA 4BQ5A 4DXXA 3OIHA 4ATWA 3NA8A 1FWSA 4GUFA 3NDYA 3CUJA 7XIMA 1CDGA 4Z2GA 4JHZA 4TR9A 1EQCA 1QRQA 1VCGA 1SR0A 5I3KA 2OPJA 3TQ0A 1P0DA 3DKLA 2XN1A 4UFMA 4N02A 1YLVA 3GXMA 5I02A 2DW6A 3OVQA 3W38A 2O9TA 3EOSA 1ADSA 2DUXA 3MUY1 1VFTA 2C0AA 2ZX7A 5ABFA 1A0CA 4QNEA 3SFWA 2BG5A 1NOFA 3BG9A 2I5GA 4F0SA 5DEZA 3DN5A 2DSZA 1LROA 2WMFA 1DWHM 2BOGX 1TFVA 1OYBA 4PMXA 1EJ7L 1UPMB 4K37A 2V5BA 1HP5A 3AYSA 3PWIA 1YTKA 2X1SA 3CNYA 1DP0A 1GTHA 2J66A 4AHOA 4KCUA 4Q8WA 2ASHA 1HKIA 1QI0A 3L9CA 1ZBWA 4JIHA 1F3TA 3MQTA 3T2QA 2D3LA 1EZWA 1KV5A 4LQ1A 4PMDA 4X63A 3W81A 4QG8A 5BXSA 3OBEA 4QSFA 1W1TA 8CGTA 4L1WA 4M19A 3CIWA 5CJ5A 4JQ3A 4V1YA 1E51A 1ZUAX 4BWLA 3LBOA 3VDHA 3WCZA 1NELA 4N4PA 1BVWA 2P10A 4MJ2A 3IAQA 2CIPA 3B8UA 4J27A 4LU0A 3NQ6A 4V27A 5JU6A 1XD1A 2ZRZA 1AH3A 5I78A 3KAOA 4KESA 1JIBA 2XU2A 5KTLA 4GC3A 3LCXA 1VEMA 3GNPA 3STPA 2AL2A 1CGVA 3M6DA 2VM8A 1EO7A 1I45A 4S3DA 3EWXA 1XPYA 4C1LA 4DBSA 1JRCA 2PCEA 2E8YA 4I6VA 4IHCA 3GHRA 1Z89A 2CU0A 2QPUA 2EPHA 2W3ZA 3T7VA 2QDEA 1MW2A 3NEVA 2Z2UA 4OUEA 9XIMA 4MYAA 4B5TA 2E09A 5AC6A 1DWJM 4L64A 3KBNA 1M7JA 3K30A 5C2CA 1GQNA 4E2DA 4QCFA 4HA3A 4IFRA 4ZGYA 2C19A 2CWXA 1ZY9A 3AYTA 4ORIA 1JCNA 3IS4A 4O57A 2ZVRA 3NIYA 3Q67A 4FLOA 4RUBA 3MTWA 3TP4A 4NRRA 3H26A 3WNPA 3BMXA 3FX4A 1OFQA 3BL3A 5C70A 1EGVA 3ZM8A 3G8RA 3IVSA 4ICMA 7CGTA 2W9MA 1A0EA 1TPH1 1YQ2A 4Q8OA 5L6UA 2NSOA 3H2FA 2J74A 4OFCA 4PA8A 3XISA 3GY1A 5J04A 3K8KA 1FWDC 3VZZA 1MXSA 3KOWA 3P5ZA 4IQDA 1ICSA 1LBFA 1XICA 3URNA 3SUVA 5E93A 2ATMA 1M41A 4JTGA 1QU4A 4TO8A 3SAZA 2OX4A 4AZ5A 1HW6A 1XKJA 2QT3A 1RJQA 4GHRA 4BQ4A 3UG3A 2VRKA 4JNMA 1R3QA 2VXNA 3RAOA 1LWJA 1VRDA 1YXYA 3EMZA 1IGSA 5MKGA 2BVYA 4E8DA 2J7GA 2ON3A 3NTYA 1S2AA 4C6JA 1JGIA 5G4EA 3UJRA 4ZSTA 3RN6A 4AEOA 3W2KA 5EMJA 3V4BA 1XLCA 4F0LA 4PULA 4Z1BA 1VYPX 3WBXA 3ZJ7A 1W3KA 2H8ZA 4IGHA 4CVWA 2ZUVA 3W7MA 3LD5A 1MI3A 2B4GA 1YTDA 2WXDM 3NZRA 1W3LA 1XM3A 3MCOA 3NQVA 3O0FA 4LAUA 4F79A 4I6KA 2WKGA