1FHLA

Crystal structure of beta-1,4-galactanase from aspergillus aculeatus at 293k
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
334
structure length
334
Chain Sequence
ALTYRGADISSLLLLEDEGYSYKNLNGQTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFAENDIDIEIISIGNEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDDGWSWDQQNYFYETVLATGELLSTDFDYFGVSYYPFYSASATLASLKTSLANLQSTYDKPVVVVETNWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAVVEATTDGLGVYYWEPAWIGNAGLGSSCADNLMVDYTTDEVYESIETLGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspergillus aculeatus beta-1,4-Galactanase: Substrate Recognition and Relations to Other Glycoside Hydrolases in Clan GH-A
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
total genus 123
structure length 334
sequence length 334
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhlA00
1UD2A 4JL1A 3WL0A 3VILA 3OZOA 2DEPA 4NI3A 2ZWYA 5FL0A 3W24A 1TR1A 3TTQA 1JDAA 4AZCA 2E8ZA 3I3DA 1CIUA 3T0BA 1OGSA 4LGXA 2VX5A 5CG0A 4WSKA 4W86A 4HZ8A 1PBGA 4P7QA 3RM4A 2V3GA 1EXPA 2EJ1A 1BYCA 4M81A 3QHMA 1FP8A 3M7SA 2ZX7A 4QDMA 3UR8A 3CIVA 4PYSA 4MTVA 1FHLA 1WE5A 5IHRA 2ZUUA 2VCAA 4HP5A 1KBKA 1TMQA 4DM1A 4TUFA 4W7UA 1HN1A 1V6UA 4AIEA 2Y5EA 2X05A 1ZBKA 4KH2A 3B9EA 1KQYA 3ARVA 2J8GA 3AZTA 1CGYA 4PTMA 4UR9A 4V28A 1RP8A 4FLQA 3IAQA 1XYFA 1GOOA 4BQ4A 1BVNP 2O9TA 3AXIA 3L4VA 1W3JA 1WZLA 3SCNA 4Z2HA 1CXIA 1KWGA 3UETA 3VIFA 1C93A 3N13A 4OKDA 2J78A 1OD0A 4X0NA 4R27A 1LG2A 1Y7VA 3BAIA 2WZIA 1JYXA 2V5CA 3WNPA 3LPOA 3QOMA 5HXMA 3CTTA 3EYPA 4CCEA 3WH6A 2RGLA 4M29A 1JAEA 3PN8A 1M7XA 4HA3A 4W84A 5DT5A 1C7TA 4DUVA 2XUCA 4NRRA 1VAHA 1FFRA 1K9FA 1UD8A 1OT2A 3AYRA 1ZL1A 5JBDA 3CZEA 3TA9A 4HZ6A 4D6HA 1XH0A 2PWDA 1XC6A 3GXMA 3WH9A 1A3HA 2XSAA 3N17A 3U7BA 2G3NA 1V0MA 4MNMA 1IT0A 4P7RA 1GUVA 4U5KA 4AW7A 1JZ4A 3AHZA 4UQ9A 3N11A 4GO9A 1QNRA 1VBRA 1OWQA 2WKLA 2J7HA 1TE1A 1C3FA 3EDDA 2CESA 5DO8A 3VDAA 2NT0A 3WN6A 1OGGA 3W6MA 1KFWA 1CLXA 1FH7A 3J7HA 2VCCA 1NP2A 4WKHA 1JG9A 3AZRA 3FNDA 4MAVA 1E71M 4CN1A 2XVGA 5FCZA 3LPGA 2O9RA 3WIJA 1FOBA 1G01A 4ML4A 2DT1A 2X8RA 3ARRA 1UR8A 3VIIA 4ATWA 4AD2A 4GI8A 2W63A 1J12A 1V6VA 2PB1A 3D5HA 3I3EA 4W88A 1TVPA 3A4AA 2ZUVA 4HPGA 1H0IA 2GUYA 5HPCA 3CUHA 2UY2A 5CSUA 4P7LA 1LL6A 4TVUA 1AMYA 2CYGA 4ATLA 1W3HA 3ZQ9A 1E6XM 1KXVA 1CXLA 2DDXA 4UQAA 4ACYA 1UWRA 5EFFA 4DWSC 3WQ6A 1CGUA 2YLLA 1CGVA 2BY1A 4UQDA 1H09A 1TA3B 3B8SA 2E3ZA 4PMUA 2VZSA 1U30A 2MANA 4QLLA 3N12A 3WMCA 4WIWA 2DPEA 3AS0A 5D9MA 1J9YA 3WF3A 4J3UA 2VZVA 1O6IA 3CHDA 5ABHA 3K1DA 2VRKA 2VVNA 1ITXA 3TP4A 4UZSA 4UOZA 3AMGA 1SFSA 2XWDA 2D3LA 3KL0A 1PZ2A 3CPUA 3ZJ6A 3W53A 1US2A 3AIQA 2VRQA 5TD4A 4CD5A 3MSDA 4JKMA 1W9DM 1UKTA 2DH2A 3DYPA 1DWIM 1DHKA 1UR2A 2GJXB 4R5EA 4CD8A 9CGTA 2J7DA 3WF2A 1QI3A 4BS0A 1XCXA 3ARQA 3UESA 2D0HA 1QI2A 3ZJ8A 2W91A 3IJ9A 4MB5A 4AC1X 1GVYA 3EDJA 2G3IA 5LA2A 2Q8XA 2XFRA 3T08A 2XM1A 3ALGA 5A8NA 4Q7NA 3N15A 3VMPA 1C8YA 1B9ZA 4JCLA 3RMEA 1PIGA 4AZ7A 1QBAA 1KR0A 3SUSA 1VFFA 2YDQA 2BY3A 2D23A 4JHOA 2WSPA 2YBTA 1UR9A 1CYGA 3WELA 3ZT5A 4UFHA 4BQ5A 2BHZA 3BMVA 5IFPA 1R86A 4UQBA 2WMIA 1E4MM 4AZHA 1HKMA 1HKJA 4JFVA 4PMQA 4ACZA 4AD1A 4PN2A 2WPGA 5IHSA 1BFNA 3D3AA 1X6NA 1XD1A 6CGTA 1QI5A 3FW6A 1CWYA 4FLRA 1GOWA 3VIJA 3VKKA 4JFSA 2YA1A 1A47A 4HMCA 1TCMA 3EBVA 1XRVA 1SMAA 3VDBA 1D7FA 1E56A 1QBBA 2WBGA 4FMVA 3ARZA 1I75A 1WDPA 1XH2A 1KB3A 3L4ZA 1EO5A 3N9KA 2WHMA 5DMYA 4XZWA 4ACZB 1C8QA 3T2OA 1ZJAA 3OLDA 1ODUA 3W25A 4LYRA 1JIBA 1NWTA 1R85A 3VIOA 4E2OA 3EDKA 3AS2A 2WWDA 3W82A 3G6LA 2V3FA 3APGA 4HU8A 1KXQA 1NQ6A 3PBGA 3ZM8A 4Z2KA 3WFZA 1UD4A 4W93A 3IK2A 1NWRA 2WW5A 2DQXA 1W3KA 2X09A 1MW0A 3AFBA 2Y8KA 2AOSA 1GHSA 5A6BD 2F61A 1UH4A 3N18A 1D2KA 3SUWA 1RH9A 3SIMA 2ZXQA 2WZEA 3WDPP 2WC3A 1V0KA 4JIEA 1J0JA 1LWJA 1K9TA 5A2BA 3SUUA 2IXUA 1ISYA 1UZ1A 4J28A 5A8QA 5A3HA 1FP9A 4KRTA 4HPHA 1MQQA 5I3DA 1UR0A 3WSUA 2FHFA 1Q6FA 3MV01 3VNZA 4W89A 4F9JA 1HJWA 2CIPA 1GNXA 5E0CA 5DEZA 5EFDA 1QNOA 2BXYA 2J77A 3WNLA 1JFXA 2X0YA 4GKLA 3WY1A 1Q4NX 2FH6A 2GJRA 3PZOA 2O9OA 2CCRA 1L8NA 3AMLA 3WEZA 4AD4A 1G9HA 1KBBA 3SCSA 4P8VA 2YA2A 2PBGA 1QVBA 3T09A 6TAAA 4EANA 4CD4A 5A6SA 2W92A 2C8NA 3L4WA 3VIMA 4D6EA 4PMNA 2D20A 2WBKA 4JHZA 1KCKA 2DT0A 5D9NA 3SUTA 3CMJA 1WZAA 1DTUA 1J10A 4AZGA 4MB4A 3WUBA 2Z1SA 4HA4A 2WLYA 1VJZA 5CPTA 4UQEA 4MNLA 4N42A 2DSUA 2VQUA 1GOQA 4MJ2A 2ZXAA 1CXEA 2GSJA 5D8WA 4AEFA 1UOKA 3FY1A 1VIWA 1G0CA 1HJUA 3WNOA 3OLEA 3OIHA 1M03A 1QPKA 4AEEA 5FKYA 1VF8A 3WEMA 2DIEA 3WMSA 1I1XA 4P8XA 3MUAA 8CGTA 2PWFA 5DF0A 4QAWA 2XM2A 1ISWA 1NH6A 2WHJA 1JZ3A 3VGDA 4GZEA 1VFMA 3FHAA 4U3CA 4TVDA 1ZJBA 5IFTA 3SUVA 3PZQA 1UWIA 2PF0A 4DM2A 2CETA 4CU6A 1PX8A 3W28A 5F7UA 3WUEA 3CZGA 2Y4SA 2WZHA 1ISZA 3MUY1 5IDIA 1E1FA 1JXKA 4LPCA 4M8UA 3HJEA 5M17A 1WZMA 3WQ5A 4B3KA 1MFVA 2WB5A 3FAXA 4M1RA 5BXRA 2DSKA 3CHEA 4V2XA 1K9EA 3SCTA 3GTNA 3F4VA 2YKKA 2BY0A 4HA1A 3S2CA 1EO7A 1ZB5A 1NP0A 2WVVB 5E6ZA 2WNWA 4MADA 1FH9A 6A3HA 5M03A 1E6PA 1GPFA 3VIKA 3F5JA 2VX7A 3T0AA 1PIFA 1V0LA 1B30A 1E9LA 4M24A 3TONA 5BXTA 1OB0A 1QW9A 4A3YA 4J3WA 3WKZA 2XPKA 1TG7A 1B3YA 4MNJA 4OIFA 3HMCA 1MW2A 4W8LA 3ARYA 3RPMA 1LJYA 2V3EA 4H41A 3VDHA 1UD5A 1CGTA 2WVSA 5GNYA 1UKPA 4TX8A 3U7VA 4F8XA 1SMDA 3DC0A 2ZUWA 1WPCA 2WC7A 3CHCA 2YA0A 1XYZA 2BXZA 1V6WA 1HT6A 1SR0A 3RILA 3WDRA 2ZXBA 3T0DA 1E4IA 1IZJA 3UEQA 1B3WA 2JEPA 5FOOA 4U3AA 1GOIA 5HBFA 4UCFA 4GZJA 2A3BA 4PMVA 5CLWA 1LG1A 1B31A 1QOXA 3L4YA 2CHNA 1BYAA 4AZ5A 3M6DA 2QF8A 4TX6A 4ZE5A 4UOJA 3AIVA 3AHTA 3CZKA 1JFHA 2EXOA 5E70A 3AMCA 4U33A 2BVDA 1TA3A 1EQPA 3MKKA 4CVWA 1H2JA 4GI6A 1OD8A 3THCA 2E9BA 1V3HA 1E6ZA 1FA2A 3AICA 1E4LA 1KCLA 4F9DA 2D0FA 4TXEA 2GJPA 4AZ6A 4DWSA 4JFWA 3VPLA 4F66A 2GVYA 5C70A 5FIPA 4K68A 3GXDA 5ABFB 2G3MA 3IJ7A 4GI9A 4LX4A 1Q6DA 5D8ZA 1IZKA 1R7AA 2GDVA 4CD7A 3VGEA 3VGHA 1AVAA 2XVNA 1VJSA 4NZCA 2ZE0A 2WWCA 1XSIA 3AXXA 2OYLA 1CDGA 1ITCA 3WQVA 1HJSA 1JDCA 2VUYA 1MW3A 5HPOA 4UFJA 2V5DA 4AWEA 1V02E 1UD6A 1UKQA 3IANA 1E73M 1TFVA 2FHBA 2C0HA 5BROA 1MWOA 2XWEA 2V38A 2Y2WA 2E9LA 3W0KA 1KWKA 2XIIA 4H8HA 4EK7A 1PPIA 3E1F1 3QOKA 3RM9A 3T2QA 3RCNA 5A6KA 2FGZA 2WMKA 5E0FA 5CXPA 3WH5A 4JKKA 4PCSA 3VX0A 2VTFA 4CU7A 1HL8A 3ZO9A 1GJWA 1XD0A 5AYBA 4BQ2A 2AMGA 4UTFA 2EO7A 4JFTA 2E0PA 4B9ZA 3L2LA 3W81A 4PRWA 4LXFA 3FAWA 2DH3A 4HTYA 4UOQA 4XUYA 1CXKA 4Z2GA 5GNXA 3VINA 3RM8A 3RO8A 2O92A 3OBAA 3ZMRA 3BH4A 3SCWA 5ABFA 5LA1A 2WCSA 3DECA 3OA5A 3SCVA 1HVQA 3UR7A 3AMKA 3SCPA 2JFEX 1V3JA 3BSHA 2OYMA 4AZCB 2WHLA 2B31A 3QGVA 1NOWA 2GDUA 1LL4A 3BAXA 4GZIA 1OIFA 3OGSA 4QP0A 3PZGA 1HP5A 2VO5A 2WHKA 3THDA 4U2YA 3N04A 3K46A 4U5IA 2OWWA 5CQ1A 1VEOA 2CKSA 2F2HA 4MJ4A 1W91A 2HISA 2UY4A 3PZTA 1BSIA 1ZBCA 4GINA 1MYRA 3ALFA 4AIUA 2XTKA 4MB1A 5BXSA 4D71A 4B16A 4DUXA 3SCRA 4TTGA 2IUZA 4AZBA 1RP9A 2CBUA 3GYCA 4S3KA 4UFMA 2AAAA 4OOZA 1PX4A 1GQIA 1XSJA 1W9BM 1E5NA 5GPRA 2EEXA 1BG9A 1QI0A 4HOZA 3BXWA 4CU8A 2FDMA 2X1IA 3MS8A 3W6LA 2ZX9A 1EGZA 2WK2A 1FH8A 3VM5A 3W37A 2VZTA 4CN6A 4XX6A 1W1PA 2PBOA 2CEQA 3BAJA 1WDQA 1EH9A 1JL8A 1BAGA 1UA3A 3ZR5A 1AQMA 4Z2LA 3WQ8A 4ZENA 2W66A 2J7EA 3VU2A 1BPLB 1PAMA 2NW0A 1U33A 3GBEA 3BAKA 1W2VA 2C7FA 2OYKA 2FGLA 2G3JA 2YJQA 1E1EA 1N82A 1Q6EA 4H8VA 1X1NA 3KL5A 1ECEA 1GW1A 1KGXA 3OGVA 1E55A 3WEOA 3UG3A 7A3HA 3WNKA 4OBRA 5KZ6A 4MPKA 3VGBA 4YHEA 2VX4A 1GORA 3AOFA 2FHCA 4NRSA 1E6QM 2OWXA 2EBNA 3UG4A 1NWSA 3QHNA 1OBAA 3A6OA 4QCEA 3ARSA 5CPSA 4OOUA 4QCFA 4WKAA 1EHAA 3KWXA 4D6FA 4D6IA 1UA7A 1MQPA 3WL1A 2X2YA 4AY1A 4HMDA 1VFUA 1ZS2A 4RE3A 3WF0A 4ZXOA 1UKSA 2IXVA 1EDQA 1LWHA 3CO4A 1JD9A 4KGLA 1EQCA 3BAWA 2ZICA 3O2LA 1DWFM 4PCTA 4CGTA 2CITA 1WDSA 1M04A 1CNVA 2TAAA 4PMYA 4J7RA 3VGGA 1JNDA 4C7FA 3IJ8A 3BSGA 3CZ8A 3CUIA 3VD9A 3PTQA 2XFYA 5I79A 4HOWA 3O9NA 2WVTA 1E70M 5LYRA 5HDRA 4PUEA 2VR5A 4PTVA 1J0IA 3VX1A 3CBWA 4JAWA 1BHGA 2JF6A 3VD5A 4LYPA 1WNOA 4DUWA 2VL4A 2CXGA 2CKRA 3K8LA 3B9DA 3GDBA 5AYIA 2YDRA 2W67A 1DWJM 1QHOA 3HN3A 3AIBA 3U5YA 2OLHA 2NT1A 2VQTA 2ZXDA 3OLGA 4W5ZA 2A3AA 4KWUA 4D6CA 3GNOA 5ABGA 1ISVA 3VIHA 3K4DA 3GNPA 4W85A 3PZVA 5A8MA 1QNPA 2A3CA 1E3ZA 1DWAM 3T2PA 3WD1A 4GIAA 1PJ9A 5I0DA 1W9PA 3NCOA 5A8OA 5I77A 2WLZA 3WD4A 1ISXA 1NWUA 4XV0A 2WVVA 5I23A 2D1ZA 1MFUA 4UZUA 3CHFA 3CZLA 3AMDA 4L4PA 3WD0A 3IAPA 4CKQA 1E3XA 1ZBWA 4AISA 4BF7A 2XYLA 5A6JA 5BWFA 2UWFA 2VRJA 5CPQA 2W5FA 2ZX6A 3VIPA 4PSRA 4CVUA 4UNIA 3AS3A 2EPKX 1H4PA 3AROA 1CPUA 1NM9A 1G94A 5EMYA 2BY2A 3ZSSA 2E40A 1BTCA 1HKKA 3PZUA 5C71A 5M3WA 4HU0A 5A94A 2WSKA 3CGTA 3LMYA 2OSYA 1JNEA 3VO0A 1OCQA 4J3SA 1OINA 2PI6A 1R7OA 4HMEA 3QHOA 2JEQA 4XZBA 1HJXA 5I24A 3O6AA 3BCFA 1UQZA 1E43A 5A1AA 3ZR6A 3GXIA 4EAMA 2CERA 1QHZA 5CGMA 1HX0A 1C8XA 3SCUA 1XV8A 3PZ9A 1X6LA 2XIBA 4ZEPA 1JYWA 2D3NA 2OWCA 5JIWA 4AMCA 1WO2A 4HZ7A 1FFQA 2PWGA 1QHPA 1C90A 2PC8A 3U57A 1G1YA 2DSVA 3WQ4A 3A4WA 2CHOA 3MMDA 2GJXA 3NSXA 4BZYA 3WH8A 5CLTA 4CCDA 1GCYA 3VUPA 5ECUA 3W29A 1HF6A 3POHA 1J0ZA 1CGXA 3CH9A 4PSPA 1WCGA 1E0WA 3WMBA 1LLOA 1UHVA 3W26A 1H41A 4J3VA 4OBSA 1VFOA 1HXJA 1WDRA 1E40A 3M07A 2XFFA 3RJYA 2BS9A 4AIOA 2XGIA 5D9PA 5I5RA 2X0HA 1W1YA 1KR1A 3VD4A 2J8FA 1EDTA 1GONA 4J3XA 4B9YA 2WMFA 1H0GA 1UH3A 2VR4A 1W32A 1EOKA 4GXPA 3KZSA 4X0VA 3K8MA 1JYNA 2D0GA 1V0NA 3KEHA 2WMGA 3WUFA 3L4TA 1AQHA 3LPFA 2BHYA 3BLPX 4J3TA 1JF5A 2QPUA 5CJ5A 1BF2A 3JUGA 1JD7A 5BXPA 5A6MA 3DHUA 4Z2IA 3W38A 1R8LA 1DEDA 2QPSA 4NF7A 3WF4A 1V3LA 1CXHA 3NDZA 4UFIA 4D72A 5A6LA 3PHAA 1E0XA 1M53A 3L4UA 4H2CA 3OLIA 3ZSTA 1E4NA 2QLYA 2WKGA 1UYQA 2YOCA 3EMQA 1JZ8A 1ESWA 4MAZA 1V08A 3W27A 2YL9A 1PX3A 4A4AA 1GOKA 1JF6A 2ZWZA 1H1NA 4BCEA 3GZAA 3MMWA 4QFUA 2ZOXA 1HJVA 5D9OA 4GQRA 1C7SA 4PTWA 2XVPA 2VC9A 2D22A 1EA9C 1XGZA 1E72M 3NSNA 3WH7A 2XSBA 3WENA 4HOXA 3WF1A 1WB0A 2YLAA 4TOQA 2CNCA 4Y7EA 2J75A 4ZFMA 1B0IA 4ZE4A 3U5UA 3VIGA 2D24A 2J74A 1TZ7A 4A3HA 1DWHM 1ZBVA 2VX6A 1J0YA 4W87A 2J47A 3BMWA 4B3LA 4YHGA 3VVGA 2BVTA 2YDSA 1NOFA 5E09A 2WMHA 3VGFA 4H8UA 4D1JA 2YL8A 3AHVA 7CGTA 4PMZA 3CUFA 3AZSA 1J18A 4AD0A 3WFLA 1W9VA 2QHAA 3NIYA 2J4GA 4U31A 4GPNA 1E6RA 2W62A 3GBDA 3VNYA 4P8WA 3TOPA 5E6YA 3AIUA 4EE9A 3GXFA 1GHRA 1MXGA 2JALA 1G5AA 3S6TA 1JZ7A 2WXDM 3TTOA 3M46A 5A95A 2O9PA 4FK9A 3DHPA 4D6DA 4WLCA 5BRPA 2CPUA 3ZJKA 1TUXA 1K6AA 2BFGA 3BGAA 3PZIA 4P8UA 1XH1A 2BVYA 1EHNA 2VT0A 1VEMA 2J79A 3FHQA 1VBUA 2BNJA 2EPMX 4PUDA 3VDCA 2PWEA 1J01A 1UWTA 2VJXA 1NOUA 2VI0A 2YL6A 3DYOA 1BYDA 1UWQA 4CD6A 1V3KA 2XVKA 1B3XA 5AC4A 4H04A 3LPPA 3A47A 2VZUA 1VB9A 3DYMA 2VZOA 4N0RA 1S46A 5CZKA 4PTXA 3EMZA 1DWGM 1VRXA 2J7GA 1JDDA 3OG2A 3PZNA 1YHTA 5FL1A 4QLJA 3VMNA 3GH7A 4GO8A 4AD5A 1V6XA 3EDEA 2WMJA 4D6GA 2E8YA 3WQWA 2JIEA 3K4AA 8A3HA 1LF1A 4PMRA 3GH5A 2YBUA 5EB8A 3BC9A 4UQCA 3RDKA 2ESCA 4PMXA 4Z2JA 3NSMA 2OSWA 1KXTA 3AS1A 2JF7A 4TTUA 1W2PA 3SCOA 3W4RA 1UUQA 1CECA 1CBGA 1QNSA 1QNQA 1B1YA 5HOSA 1CZ1A 2BHUA 1KQZA 3OGRA 1JAKA 4FLOA 1H5VA 2QMJA 4JFUA 3KE0A 3A4XA 7TAAA 4ATDA 5CGTA 3G6MA 1F4AA 2XG9A 2XGBA 2G8ZA 2E4TA 1SYTA 2Z1KA 1F4HA 3GNRA 1B3VA 4MDOA 4WJXA 5A8PA 2GK1A 2UY3A 1H49A 4B15A 3F5KA 4KMQA 2DT2A 5A2CA 2WCAA 3VM7A 2BV9A 1CENA 1B2YA 2DGAA 2WAGA 4IISA 4M80A 3CMGA 3WBAA 4D6JA 3ZIZA 2J25A 1XSKA 3SURA 4WKFA 3POCA 1HKIA 1JGIA 2ZX5A 5GNZA 1UQYA 4OZOA 1OGBA 3WNNA 4GQQA 3BLKA 4UFKA 5KEZA 3MU7A 2W4XA 3UERA 3VTRA 1V6YA 4WK9A 1WZKA 2CBIA 1GOMA 1GQJA 2WYSA 2WM0A 3UCQA 3WDHA 4IUGA 1W1TA 2WCGA 3AIEA 1IV8A 3WBEA 2DSZA 1UD3A 3AISA 3AIWA 3ARTA 1V03A 5JUVA 4YN5A 5I2UA 4AZIA 4IPLA 1E15A 1GQLA 4IM4A 3ARXA 1JYVA 4E8CA 1US3A 2F8QA 2YL5A 2QMKA 4ZXLA 1CGWA 5CSYA 5I6SA 5M5DA 4TVCA 1VENA 1O7AA 1BVZA 2EQDA 3PTMA 3ARWA 4H7VA 3WD3A 2GK1B 2HVMA 2PWHA 3OB8A 4W7WA 1UZ4A 3N1AA 1BGGA 5GQBA 1JXJA 5A69A 1KGWA 3KL3A 4E8DA 3ARUA 1JZ2A 2RGMA 3UG5A 5HNNA 4BA0A 5JIPA 2VVSA 3SEPA 4QLKA 1MVYA 2ZUTA 3AQUA 5AC5A 3VOCA 4C7GA 5DFAA 1CEOA 4CCCA 1RPKA 2EPLX 1QW8A 4WSJA 3EMCA 4DWSB 2J7CA 1UWUA 3ECQA 1V02A 2WMIB 1E6SM 3CUGA 2ZUNA 2GFTA 3CUJA 3SCQA 3AIRA 1XHGA 3BCDA 1GZJA 1L0PA 2WC4A 3WDJA 3ZT7A 3WNMA 4M56A 3NUKA 4JZ5A 3ZOAA 3MV11 5A6AA 1XCWA 1M01A 1PEZA 2G41A 5ABEA 3EDFA 4KGJA 3K8KA 1BQCA 5EBAA 4P7NA 2XHYA 4FF5A 1W9XA 5BRQA 1HNYA 4LYQA 4FLSA 4AYSA 3MO4A 1HIZA 2ZUSA 4D1IA 1OT1A 2EPOA 3HU7A 1YQ2A 1B3ZA 1FHDA 1QI4A 3WUGA 2CBJA 1W3LA 3ZT6A 3NDYA 5D4YA 3MSGA 4OJYA 4W7VA 4RE4A 4BQ3A 3CZJA 1H11A 5AY7A 5FD0A 1MXDA 1UR1A 1WAWA 2FH8A 3GM8A 2VOTA 1J11A 1JI1A 4MB3A 1K9DA 4J27A 1MQRA 1OSEA 1Z32X 2D2OA 3AYSA 5A2AA 3NJ3A 4W8AA 2ZX8A 4KRUA 4CN4A 2VMFA 2XJ7A 4M82A 1GQKA 1LQ0A 1UR4A 4DWSD 3A3HA 1EDGA 4E4PA 4UFLA 4EKJA 4L4OA 2W61A 3QR3A 1CLVA 1OIMA 4XB3A 1V3IA 3OZPA 1ZU8A 3I3BA 2G4FA 1GJUA 1BG4A 1JI2A 3TTYA 1J0HA 2V3DA 1HL9A 1UH2A 4W8BA 4URIA 1B90A 4F79A 1I1WA 2CBVA 5I78A 2A3EA 5DT7A 5LA0A 2VNCA 4YPJA 3AHXA 2UY5A 3VMOA 4CUCA 3B9AA 2Y24A 1HVXA 3MUZ1 4PBGA 2EPNA 4LQ1A 3AI0A 4NSBA 1NARA 2ZUMA 2WVUA 1EOMA 2OSXA 1AQ0A 3MANA 2DSWA 4OUEA 4JL2A 1WKYA 1BLIA 1EIBA 1E0VA 3VD3A 1VEPA 1W1VA 4PMDA 3ARPA 1JZ5A 2XVLA 1H3GA 1ODZA 3MUIA 3VD7A 1CXFA 2NSXA 1CTNA 1R87A 3PTKA 5BYWA 2WANA 3FXYA 2JE8A 3AJ7A 3L4XA 2Y8VA 1E6NA 3F5LA 4U2ZA 3GH4A 5A6BA 1BYBA 4W5UA 3FN9A 4P7OA 1C92A 5E9AA 3NYDA 1RD6A 2VURA 4AD3A 5BCAA 3AHYA 1UKOA 2J62A 1HJQA 2ZIDA 4WF7A 3WD2A 1TVNA 4PEEA 1DP0A 1Q6GA 1V3MA 1UWSA 3L2MA 4IPNB 2J7FA 2J7BA 1OM0A 2DT3A 1MW1A 2JIWA 3MMUA 3BAYA 1C91A 1GVIA 4C7DA 3AXHA 4JCMA 1D3CA 2DIJA 1KGUA 5IXEA 1U2YA 2A3HA 4JKLA 3ZJ7A 1P6WA 1KXHA 5JBFA 3WDIA 3RJXA 3CLWA 1E5JA 4RL3A 4X9YA 4V27A 1PZ3A 1W9UA 1Q6CA 4RE2A 1JZ6A 3TTSA 4PMOA 4MNKA 1J0KA 1UG6A 4Q22A 1WP6A 4MDPA 3RIKA 1BGAA 5JBEA 3PZMA 2YIHA 3II1A 2VCBA 3WDQA 2QV4A 4S3JA 1LL7A 1HP4A 2E9MA 4AXNA 5C8BB
chains in the Genus database with same CATH superfamily
1UD2A 2AL2B 3S5OA 3OZOA 4E2DA 4NI3A 5FL0A 3W24A 4HU3A 1TR1A 1TTIA 4ZA0A 1KTBA 2ADAA 4JEQA 1JDAA 2E8ZA 5FEZA 1J2WA 2QT3A 1OGSA 4LGXA 3KBJA 4R7OA 1FVPA 3UYIA 4PFMA 1J5TA 4P7QA 4WOZA 4FB7A 1EXPA 4M81A 5FEWA 1JPIA 1XIEA 1GKRA 4MY9A 2PWVA 1UIOA 2REQA 5HMFA 4WR3A 2ZUUA 2VCAA 4H8NA 1KBKA 4HP5A 5H91A 3W22A 2RJHA 4LB3A 4AIEA 4JYDA 1S5WA 1NIUA 1CB2A 4MZ8A 3UT0A 4V28A 3EPNA 1UPPA 3IAQA 4JTQA 1BVNP 1CB7B 3RFAA 1M65A 3QC0A 4XAPA 1UP3A 1XIHA 3W84A 2XH7A 3CT7A 1TWDA 5CPLA 1RY8A 3N13A 1IT8A 2KX9A 4PTNA 1QUMA 4DNMA 2XIJA 3LPOA 5HWJA 3QOMA 1EYEA 4CCEA 1NDWA 1G7VA 1OYAA 2E6AA 3ABXA 1C7TA 4NRRA 3W3OA 1FFRA 2FPYA 3OP2A 4DJFD 1XH0A 2PWDA 1XC6A 3GXMA 1UC5A 2OKOA 2R1KA 1V0MA 1IT0A 4HSOA 1GUVA 2W27A 1JZ4A 2X30A 1HTIA 3D0CA 2Y8UA 5DMLA 1PZ1A 2PMQA 4KERA 2YFNA 4IL0A 1SU5A 4DI8A 2WKLA 1TE1A 4JQ4A 1C3FA 3HBLA 3EDDA 1BXCA 3LUTA 1PB0A 2R1MA 2E6YA 3CV1A 3VDAA 1LOSA 3WLOA 4TV5A 2PDGA 3G0SA 1K03A 4EOUA 2W3ZA 5TNVA 4WKHA 3H2NA 1FWRA 3AZRA 1E71M 4CN1A 2XVGA 4R9XA 3CU2A 3WIJA 3DAQA 3MBDA 1G01A 4ML4A 1AH4A 2X8RA 3VIIA 4AD2A 2NWRA 2NVCA 3ONCA 1GJPA 1IWPA 4GI8A 1V6VA 2VFFA 3VNMA 2ABAA 3UWVA 5BU9A 2PODA 1TVPA 3FDGA 3KBMA 4ICCX 3PJUA 4P7LA 3TX9A 3QZAA 5EL1A 2CYGA 2I14A 4ATLA 5E5CA 2D73A 2HXUA 1E6XM 3EOUA 2FVMA 4HHLA 4GMEA 2DDXA 3MWAA 4UQAA 4ACYA 4NZ3A 4H19A 1YNPA 1CGVA 2BY1A 3N25A 3HMJG 4JXCA 2IW0A 3B8SA 2MNRA 4AHQA 1F3WA 1WOBA 3AS0A 2GWGA 2TRSA 3IVUA 1J9YA 3ITLA 1O68A 2Q01A 3ABRA 4MGGA 3HPSA 3W72A 1O6IA 3CHDA 2A85A 3SZ8A 1QAPA 3K1DA 5GJMA 1ITXA 3TP4A 4UOZA 1OFRA 1SFSA 4Q4KA 3W7EA 1C29A 3ZJ6A 3W53A 2XIOA 4GBDA 3AIQA 1XLHA 3SRFA 1XDMA 4CD5A 2Z2AA 3WZ0E 3MT1A 2YCEA 1TPC1 4K1GA 2I56A 4FSAA 2IKHA 3EZ4A 4DJFA 4KW2A 4D9PA 3SY8A 3S42A 4GCAA 7PTDA 3UESA 1J79A 2GSEA 4PZVA 2W91A 3UD6A 1GVYA 2E28A 3C2EA 5LA2A 3PAJA 3T08A 5BMXA 2XM1A 3ALGA 1OFEA 5C7VA 4JOMA 2GZXA 3VMPA 3AO0A 3T8LA 4CNPA 4QJ1A 1B9ZA 2FQIA 3W2NA 1UJPA 1PIGA 1DTNA 3MUCA 1KR0A 3SUSA 1FXPA 3GG7A 1KM1A 4A22A 3TQKA 2OODA 2WSPA 1UR9A 2ACRA 1CYGA 1TRDA 1KV5A 4UFHA 2BHZA 3BMVA 4UTTA 1TWWA 1E4MM 3MZ2A 4AZHA 3KCOA 1HKJA 1JPKA 4C1KA 1NJJA 3L0NA 3TDFA 1DVJA 4A2SA 3S1UA 1XD1A 3T7VA 1QI5A 2QUUA 1GOWA 1TCMA 1WUEA 4UR7A 4GUGA 4GQBA 3BL3A 3MDUA 1EEXA 3VOJA 2QCNA 3QN3A 3IVSA 5HULA 1P43A 1LT8A 3P62A 5TAOA 4UCGA 1I75A 1XH2A 1R9ZA 1KB3A 3L4ZA 4IG2A 1EO5A 2P10A 5HQMA 4NJIA 2C3ZA 3T2OA 3FOKA 4LVGA 3C2FA 3NL2A 5H8MA 4LYRA 1O4UA 3HF3A 1OG0A 3EDKA 4V1YA 3AS2A 2WWDA 4EVZA 5FF4A 3B03A 5C9UA 3VAVA 2EF9A 4LW7A 1FCQA 3M1ZA 1KXQA 3ZM8A 3WFZA 5DMMA 3MC5A 5JU6A 1B9BA 1NWRA 1PTAA 5I3FA 3IIZA 3KOZA 2A6LA 5A6BD 1GHSA 4LUTB 1D2KA 3SUWA 2GQ3A 2RDTA 2ZXQA 3WDPP 3TV8A 4JIEA 4IH3A 3DFHA 4MHBA 5A2BA 1OK6A 2Y5SA 1Z8AA 3Q4DA 1ISYA 1UZ1A 4J28A 5A3HA 1EEPA 1DJHA 4X9SA 4ZOAA 2NUYA 3QM3A 4KRTA 5BMWA 4HPHA 4MY1A 3F2CA 1UR0A 4C6NA 3WSUA 3V5FA 3R4IA 4W89A 4KPLA 4F9JA 3WJWA 2CIPA 3N3TA 1QOPA 4US6A 2FJKA 3WNLA 1ITQA 2CWNA 2X0YA 4BEUA 3WY1A 2GJRA 5KITA 3W73A 3URBA 2DZWA 1H50A 1I0BA 3SCSA 3UZ5A 1FQ0A 2PBGA 2L5HA 5FACA 4RXFA 4CD4A 3U2OA 3LSCA 3U9IA 2W92A 5E9XA 4DWDA 3L4WA 4H1ZA 2Z4GA 4A6GA 4GE8A 1KCKA 5D9NA 2JKEA 3SUTA 5AN7A 4AZGA 4I9JA 3WUBA 3IS4A 4GC4A 1YYAA 1RA5A 3HQ1A 3RN6A 1S5TA 4MNLA 3LXAA 2FPVA 3WQEA 2ZXAA 1CXEA 3B9OA 5D8WA 1GEQA 2J24A 3G0UA 3GLCA 4LOCA 3WNOA 4FPSA 3QPZA 3W07A 1NU5A 5EKYA 1M03A 3H24A 4AEEA 3WMSA 4EF9A 4S3EA 1LRNA 5DF0A 2YGYA 3NL6A 5J04A 1T8XA 1VFMA 2X41A 5IFTA 3SUVA 4KCTA 1UWIA 2PF0A 3OVGA 4DM2A 2VEPA 3VDGA 1PX8A 3CZGA 2Y4SA 2WZHA 1ISZA 1DL3A 5M17A 4M8UA 4Q6XA 2FDSA 4GKTA 2WB5A 5T26A 2DSKA 4V2XA 4G8TA 3F4VA 1ZB5A 4C1LA 1NP0A 2WVVB 1TCDA 2YFOA 2WNWA 1U1HA 6A3HA 5M03A 1GPFA 3RCYA 2VX7A 3UG8A 1V0LA 2XIMA 2VGGA 3TONA 1VIZA 3DG7A 5BXTA 1OB0A 1G4PA 4J3WA 4OIFA 4AHOA 3BTNA 3PUEA 3RPMA 1LJYA 1TRIA 1WA3A 1CGTA 3V36A 4N9EA 2NX1A 2WVSA 3LA4A 2HZGA 2J6VA 4KWSA 4AG0A 3VA8A 3TOYA 3CHCA 3UXLA 4KFNA 2OMAA 1VPQA 1XLIA 1YE4A 2HRWA 3T0DA 1WKFA 3NEHA 4U3AA 1GOIA 5HBFA 4R88A 2PUZA 5CLWA 1LG1A 1QOXA 5AHLA 1EF2A 4YIWA 2CHNA 4AZ5A 4TX6A 2C79A 3AIVA 3QZ6A 3AHTA 4PB5A 4GIYA 3HG5A 2PTXA 4XQ6A 5CPOA 2AGKA 3TYZA 4QXIA 3N6HA 1EQPA 3UWQA 4GI6A 3GB6A 4G5DA 3C2YA 2E9BA 3O0KA 3GC5A 1BRLB 1OEPA 3G1XA 1FA2A 3AICA 4DJDA 1E4LA 5FJOA 4TXEA 4YJ5A 3C3UA 4QE4A 2AQOA 3BGGA 4LX4A 1Q6DA 2GDVA 4KEZA 3DX5A 5F4WA 1VJSA 1ADDA 3I4EA 3NQGA 2OYLA 3DKLA 3WQVA 3A13A 1XBZA 2HS8A 2QIWA 5HPOA 4UFJA 2V5DA 1V02E 1UD6A 2PDKA 3IANA 3AC0A 2HNEA 4FAMA 1XXXA 4YTTA 1TVLA 3GYEA 2VEGA 2XIIA 4H8HA 3E1F1 1YLVA 1KFCA 4ZOEA 2FGZA 4BWLA 3B8TA 2H8XA 3W1QA 3QFWA 2G5WA 1PKLA 3H2AA 3T4WA 2Z7KA 1GJWA 5AYBA 5A8GA 4Y96A 2AMGA 4UTFA 2ZZ1A 1QRQA 5IM51 1DJXA 1JGMA 1P0DA 2A0NA 3W81A 1LLZA 4LXFA 4UOQA 2V82A 3BW4A 5F2LA 3C0SA 3RM8A 3RO8A 5EMKA 3ZMRA 2YW3A 2P53A 2WCSA 5FF2A 1HVQA 4BR1A 3UR7A 4TV6A 4O15A 2WNZA 3SCPA 1SJBA 4QJ4B 1AJ2A 4B2DD 1V3JA 1RY0A 2WHLA 2B31A 2OQYA 3KOFA 3E0LA 5L9FA 2P88A 1OIFA 4NP7A 3GNXA 1TIWA 3K46A 4U5IA 2OWWA 1VEOA 4Q8TA 4S38A 3QW3A 4AIUA 4C60A 1XIFA 2P1FA 2XTKA 3CXOA 1XX1A 3QR0A 4WSHA 3SCRA 2QJIA 3PB2A 4AZBA 3GO2A 1RP9A 4S3KA 2AAAA 4LAKA 1XSJA 3G3MA 4Q8NA 3P7YA 4L9YA 3R0UA 2C91A 3NPVA 3MBFA 3EWBX 2GGJA 5DBUA 4CU8A 4ZO9A 2H9AA 3UY7A 2Q6ZA 3GFZA 2V81A 3NGJA 7REQA 4CN6A 2CLEA 1W1PA 2CEQA 1EH9A 1BXNA 5K7JA 4IIFA 3E3HA 4O8RA 8XIAA 3LYEA 3VE9A 1A4MA 3LGDA 3S9YA 2NQHA 1TKKA 1A5SA 2C7FA 1X8CA 2OYKA 2FGLA 4WGHA 5T91A 1XFBA 1SUXA 3NM1A 2YJQA 3DESA 1Q6EA 4H8VA 4V15A 1E55A 7A3HA 3WNKA 4OBRA 2GJLA 3VGBA 3EB4A 3AOFA 3EKLA 1TV7A 2FHCA 4A8IA 3V3WA 4NRSA 5C6MA 3E49A 2OWXA 2EBNA 3S1WA 5M2FX 1REQB 1S5NA 3PG8A 4WRHA 4ZR8A 4QCEA 4K6AA 3B40A 3WLJA 4LB4A 3IV8A 1OF6A 3F4CA 3KWXA 4D6IA 3QMRA 1YPXA 3WL1A 1OY0A 4AY1A 4HMDA 4PUMA 1ZS2A 4QSFA 4ZXOA 2IXVA 1EDQA 1YXDA 5C2CA 4I9AA 4ZB2A 4UB9A 1EQCA 3BAWA 2PDIA 3O2LA 4KS0A 4UUIA 4CGTA 1NDVA 2YYTA 4BK9A 1CNVA 4PMYA 3T6CA 3VGGA 5J8LA 1JNDA 1G7UA 4FX7A 3CWOX 1N2VA 3BSGA 3M5YA 2PDWA 3CZ8A 3CUIA 3FA5A 3LRMA 4XBSA 4J9JA 3H54A 1E70M 2IPJA 4PL1A 2ZRWA 2QXWA 2VR5A 1J0IA 3VX1A 3CBWA 3JRKA 1EBHA 3BG5A 5XINA 2JF6A 1TPVA 3VD5A 3N9RA 4GYPA 4Z0SA 2CKRA 1X8FA 1QW7A 3K8LA 3TJLA 3LG3A 1JQVA 1UMLA 3HN3A 3U5YA 3LNPA 2ZXDA 4W5ZA 2A3AA 3SM0A 1SFJA 3HA1A 3PZVA 2QJNA 1QNPA 1E3ZA 4GLEA 1SZNA 1Z7AA 2HPIA 4GIAA 4L6DA 3P5ZA 4HMNA 1W9PA 3BARA 2Y5JA 3NCOA 2WLZA 2R14A 2VEIA 3U4FA 1NWUA 4F2BA 4XV0A 2WVVA 5I23A 3CL7A 4F2TA 3GUWA 3CZLA 3AMDA 2C19A 4UTWA 4ZO6A 1L6SA 3WD0A 4GHRA 4A8NA 1P48A 5CKSA 1ZBWA 4AISA 1OF8A 4KCWA 2ZX6A 2Y7EA 5DELA 3AS3A 3G8RA 1C9DA 4MYAA 2HQAA 1NM9A 3ENLA 1FHUA 1S1PA 1TR9A 3I68A 4DZHA 2E40A 3EWUA 5C71A 5XIMA 1RK6A 3UP8A 5A94A 2J66A 1OCQA 1I2PA 3WQPA 2PI6A 2GWNA 3W7GA 4HMEA 1IYXA 4L4MA 4EPDC 3VZYA 4QRNA 1A5UA 2Y89A 3BWWA 4S23A 1IZCA 4ASTA 3KBWA 1E43A 5A1AA 3LBCA 1XUUA 4EAMA 4YVXA 1C8XA 4C6PA 1OFQA 6XIAA 1EJRC 4WEVX 2VKZG 2NQ5A 4X3ZA 1EPVA 1SO5A 1WO2A 4HZ7A 4LWWA 1FFQA 3PFRA 3PTDA 2PWGA 1EJ7L 1C90A 4ZTYA 3U57A 1G1YA 3KXQA 1R47A 1XS2A 3MMDA 2PFHA 5U7SA 2GJXA 2C1IA 3NSXA 4GUHA 5CLTA 4IQEA 3UZZA 3POHA 1CGXA 3CH9A 1WCGA 1E0WA 1OX6A 3TYAA 3WMBA 1H41A 4I7VA 2GOKA 4S1FA 1SO4A 1G4SA 4AVNA 1E40A 1OK4A 4AX6A 3M07A 2XFFA 3MSRA 4JNYA 3RJYA 4AIOA 3NQVA 3BE7A 1TUFA 3TA6A 2QGYA 3DN5A 3O06A 3W1XA 2ODOA 4J3XA 2ISFA 1UH3A 5K9DA 3LRLA 3K8MA 4X0VA 1OABA 1GPWA 2D0GA 1MZHA 2EGZA 1V0NA 4HK7A 3TJ4A 3WUFA 3PM6A 3GAYA 2PP3A 4J40A 2PDCA 4GXMA 4J3TA 3I4KA 3NQ6A 3UU0A 1ZP4A 3SECA 3DHUA 5LHEA 3EWXA 2VC5A 1P0BA 2QPSA 4UXDA 4XUGA 4LBSA 3ZZ1A 1J6OA 4MLRA 3U8GA 3UWZA 2A1YA 3H4GA 3HO8A 1IR1A 1RLDA 3OLIA 3ZSTA 1MNSA 3TE9A 2QLYA 2ZZ4A 2YB4A 1GYNA 3KM8A 5JH1A 2YBVA 1TMHA 3MVTA 4G1NA 4GUIA 1XYAA 4R9OA 5TQLA 2Y1HA 1EUNA 2TMDA 2AGTA 2ZOXA 4LRSA 4QBXA 4O0ZA 1WDWA 3G1AA 1A49A 3SIZA 1TELA 3NSNA 4M7SA 3EOEA 3L9CA 1K77A 4Q4RA 2CNCA 2J75A 4OE7A 3HGJA 3U5UA 2BASA 2C1HA 1TZ7A 4CNSA 1QPOA 1MDLA 1KCXA 4I6KA 3STFA 3WLLA 2H6RA 4GJIA 3VVGA 2BVTA 3BLDA 1SJCA 4AFYA 1SO3A 1W56A 1UR3M 5E09A 2WMHA 5CC3A 4H8UA 4D1JA 3R25A 2NX3A 3AHVA 3CUFA 1J18A 3SY5A 5EYWA 2QHAA 2VWTA 2OFJA 2J4GA 4GPNA 3H22A 4ZQPA 4JQ3A 4Y8EA 4Z0JA 3IPWA 1GWJA 1MXGA 4RUBA 4YXGA 4FP1A 3S6TA 3IGXA 4YYCA 3M46A 3W1UA 1RPXA 2O9PA 4FK9A 4D6DA 2I5QA 1XBVA 5BRPA 4H9XA 3ZJKA 3AUJA 1TUXA 2I9UA 3FSTA 1KM0A 3VZZA 3JVAA 3LB0A 4FOKA 3PWIA 4O12A 4IP4A 4MWAD 3V1HA 3FHQA 1K3UA 1ONEA 3GXTA 1P1XA 4A8LA 2YL6A 3DYOA 3FGCB 2WSRA 3LPPA 3DYMA 5D33A 3PZNA 3LTYA 2R91A 5H6HA 4QLJA 4HD5A 4HNVA 2A6NA 3M5ZA 3CAKA 3CH0A 3WQWA 1F2JA 1LF1A 3GH5A 3QSRA 3SGUA 1AG1O 3NAVA 2ESCA 4QISA 4PMXA 4Z2JA 3XINA 1HL2A 3AS1A 4B5NA 1ZNNA 2QGHA 3SSZA 3W4RA 4LBRA 4ERIA 2ZA3A 2GYIA 1QNQA 5HOSA 1JPDX 4HB7A 3GU1A 3OGRA 4FLOA 1A5AA 1H5VA 4JFUA 5FA5A 4ATDA 5CGTA 4JIIX 2OCZA 3L12A 3MA8A 4B92A 1S2TA 2W0UA 3K4WA 4WJXA 4MDOA 3E38A 1JUBA 2UY3A 1H49A 4B15A 5T9CE 3F5KA 4KMQA 3W7HA 4ENLA 4JQ2A 3VM7A 4K7YA 1ME8A 2WAGA 1TTPA 3ZIZA 1S2CA 3RF9A 3W2MA 3M0HA 3OVQA 3FVDA 1KRBC 3N2CA 2B81A 3OBKA 1BD0A 4GQQA 2Z1BA 9XIMA 3OTRA 4Q8VA 3BLKA 2WO5A 4UFKA 1KFJA 3MU7A 3PBYA 4ZSTA 3C86A 1JULA 3C4UA 3S83A 4LAMA 3CYJA 1FTXA 3HIJA 2VEKA 1KLYA 1GQJA 2WM0A 3CQKA 3WDHA 3PBWA 2WCGA 4EF8A 1LBLA 2ISWA 3AIWA 5JUVA 1JYVA 1SZFA 4E8CA 2XDFA 4U28A 1AJ0A 2F6XA 2P0OA 2QDHA 1ICPA 1VYPX 4DUOA 5M5DA 4C6JA 2EQDA 4IFKA 1JJKA 1BGGA 3E0FA 1JXJA 5A69A 2BX7A 4XKYB 3UG5A 1AMKA 2FZMA 3SEPA 1K8YA 1R6WA 3FX4A 3RLVA 3M0JA 2V30A 1CEOA 4NYUA 4GI4A 3I6EA 1RPKA 2EPLX 2HSAA 2Z7GA 3HQOA 2RHGA 4Q6JA 4DWSB 1JDEA 1UWUA 3ECQA 1V02A 3MI6A 2ZUNA 1DXFA 1U5JA 5B7ZA 3CUJA 3LCFA 3SCQA 3S1GA 3ZLGA 1XHGA 2O4MA 1FWAC 1KFLA 1L0PA 3WDJA 3NOEA 3B8IA 3I7QA 1IT7A 3NUKA 3O15A 3F7JA 2ISDA 1A5CA 1XCWA 1M01A 1PYMA 5FI8A 2O7QA 3EDFA 4KGJA 4KT2A 1BQCA 5EBAA 1EP2A 2GQ9A 1GVEA 4P7NA 4J4KA 2XHYA 1WXYA 4FF5A 4ZTXA 5BRQA 3WLKX 1EC8A 2YCKX 2ZUSA 4D1IA 2EPOA 3C61A 3HU7A 1Y65A 3WUGA 3CAQA 3ZT6A 2HS6A 2E6FA 3MSGA 1TV3A 4RE4A 4BQ3A 4RK8A 3Q2DA 2ZRYA 4XZMX 4C6MA 4J27A 3SADA 1QWGA 4XZIA 3FV9A 2VD9A 1ICSA 1BWKA 1YTDA 2ZX8A 4CN4A 3O8AA 2QNEA 2VMFA 4M82A 1EDGA 3NO1A 4UFLA 3URQA 4PGLA 4L4OA 3R7MA 3QR3A 5DBTA 1BTMA 3W2JA 3O3RA 2G4FA 4RW3A 2OPJA 1BG4A 1OYBA 4PE8A 1HL9A 4W8BA 1Z89A 4F79A 4AF0B 3WQFA 2CBVA 4O1EA 1OCBA 4NAEB 5DT7A 1R3YA 2QCDA 5IBXA 5LA0A 1X7IA 3VKJA 5H1WA 3I7SA 1HVXA 1O66A 5AKQA 4MOZA 1TPWA 5I03A 3AI0A 4LH8A 3NURA 2ZUMA 1IWAA 5MKGA 2PE4A 1H5YA 1B57A 3S47A 4PTDA 4JTDA 3FEQA 1IEQA 1EIBA 3QXBA 4S3CA 3O63A 1H62A 4O8AA 3VXGA 1H3GA 4BEQA 2NSXA 3F2DA 2WANA 3TLQA 3P81A 1SW0A 3UWWA 3BCJA 1AA1B 2W6RA 3F5LA 2PLJA 3KHDA 1L6GA 2H9AB 3QH2A 4L80A 1C92A 3ZYZA 2VURA 4RDWA 3PWGA 5BCAA 3S2LA 3AHYA 2Y61A 3UYCA 5T8GA 2J62A 4WF7A 4O1BA 4DO5A 5KZEA 4PEEA 1UWSA 2DT3A 2FVKA 2A7NA 4GBUA 2JIWA 3BAYA 1C91A 1GVIA 1DKWA 1SSDA 1D3CA 5FF0A 3PBVA 3ZJ7A 2DZUA 4O13A 4AY8A 3TQVA 4NI8A 4RL3A 2NQLA 4PA8A 4GVHA 3QF0A 1Q6CA 4NXKA 3C0LA 4PMOA 1J0KA 1SFTA 4Y9AA 3MWCA 1WP6A 4P2VA 3DENA 4NVTA 5DMNA 2DUAA 4H9VA 2O56A 2VCBA 4QS6A 3WDQA 2QV4A 5CBIA 4AXNA 5C8BB 3WL0A 4R3UA 4XD6A 5JQ9A 3RX2A 4PCNA 3FGCA 3TTQA 2BVWA 4LUSB 3T0BA 3RRXA 4W86A 1MUWA 5G2HA 1GYMA 3GR4A 3RM4A 2V3GA 2EJ1A 1Z48A 2Y7FA 3NZGA 2YX0A 4JX4A 4XISA 3AWNA 4QDMA 3UR8A 3CIVA 3W88A 3H4WA 1XG3A 3E5PA 3A3WA 2V2CA 3FCPA 5IHRA 1K4GA 1TMQA 5EPDA 4W7UA 1HN1A 4XD4A 4ZOCA 3FK4A 4QX4A 1Y5XA 2Y5EA 4ROQA 4IFRA 4AH7A 3MMTA 3IACA 1S3TC 3EKGA 4KH2A 3CB8A 2J8GA 4PFHA 5HAOA 4UR9A 5LNVA 4FLQA 2ZC1A 4BQ4A 2QF7A 3PBUA 2HBVA 3R0DA 4RDZA 3L4VA 3SCNA 1CXIA 1XPGA 1ZPTA 1RSCA 3ANVA 4GABA 1ZSXA 4OKDA 4F3HA 2QV5A 1OD0A 4X0NA 4R27A 1Y7VA 4K8HA 2V5CA 4PUUA 1P0NA 3G1DA 3R89A 1N7KA 4H7ZA 4K3ZA 3CTTA 5HJXA 1JAEA 3R1ZA 1B54A 4DUVA 2XUCA 1H7PA 3QMTA 4MWAC 4IHCA 3YPIA 5BWAA 1H60A 1OT2A 1ZL1A 2CZ5A 4XSLA 3N19B 4C6EA 4UTTC 3O1NA 4W4QA 5AYYA 2GGHA 3E2SA 2G3NA 3U7BA 3QJAA 4U5KA 4AW7A 3BLIA 1X97A 3N11A 3GAKA 4GO9A 1QNRA 2PDFA 4OT7A 3NL3A 1VBRA 4OECA 1SSGA 3QR1A 1R9YA 1NFGA 3NQ7A 2GQAA 1FWFC 1DJGA 4EXQA 4M6VA 3UF9A 4C6OA 4EXBA 4C5ZA 9RUBA 2GQ8A 2NT0A 5DY2A 3WN6A 2BLEA 4Y8FA 5GVJA 3RRAA 3W6MA 3GIQA 1EKOA 3WLTA 3BOFA 3BDKA 4I3GA 1XRTA 1SO6A 2XN2A 1MUCA 3FNDA 3RR1A 1TWZA 1W0MA 3QYSA 4XAGA 2O9RA 1KTCA 3ARRA 3E2RA 1UR8A 3CL6A 2PDBA 3T55A 3CK5A 2RDUA 1H1YA 2J9YA 2PB1A 2TODA 2ACSA 3EXTA 3I3EA 3GTHA 1F61A 4W88A 3NZQA 4Q4MA 2AMXA 3LGEA 5HPCA 3CUHA 2UY2A 2ZADA 5KMYA 3KOYA 2IPGA 1KXVA 1QPQA 1UASA 1N8WA 4K37A 3TQPA 4TX9A 1W3IA 4A2RA 2ZRVA 4JBRA 4MSSA 4JPGA 1U30A 1M6JA 4QLLA 3N12A 4KFPA 3IEBA 3WMCA 2DPEA 3QGKC 2VM8A 5D9MA 3PNUA 1RBAA 4ZQRA 3WF3A 3DFSA 2G4JA 4QR6A 2VZVA 4KETA 4E0CA 5ABHA 4DF1A 4FOUA 1RHCA 4UZSA 3AMGA 3UJFA 2A7PA 3VFLA 3S4TA 4WY0A 1S5VA 4FXFA 1US2A 4NZJA 4GD0A 1EJSC 1W9DM 5DCBA 1UKTA 3DYPA 3LN3A 3HGRA 3MCMA 3WYZA 4B5SA 3MKCA 4R5EA 3LSBA 4H2HA 4TO8A 4YL2A 5C0QA 4ES4A 2J7DA 4IPJA 3WF2A 5K4ZA 5CH9A 1DJNA 1QI2A 3IJ9A 3OO2A 3VNDA 3OHIA 4QGCA 2XFRA 2XISA 1WAUA 3BV4A 1G4TA 4BWLC 5IRPA 4AX7A 1AQFA 3N15A 3R58A 3SI9A 5H2ZA 1WXJA 1KBJA 5HWMA 2FLIA 1A5OC 4JHOA 3G1SA 3FKRA 2YBTA 2Z28A 3WELA 3SR7A 3ZT5A 4OGZA 1Q85A 3FYYA 3NPUA 5IFPA 5D09A 1R86A 4IG2B 4N6FA 4GK8A 1HKMA 4JFVA 4IIHA 4ACZA 4DB7A 5LXEA 1VR6A 2QW5A 4AD1A 4PN2A 4XD3A 3P2VA 1Q2SA 1N55A 1V6TA 3A23A 2BB0A 4WY0F 2YXOA 3CAWA 4ICNA 4M7TA 4GNJA 3NGFA 1PKYA 3RO6A 2A5HA 4GQ0A 1BQGA 2NQZA 2Y0FA 1RV8A 3TZFA 1D3HA 3EBVA 1SMAA 3U48A 1EJTC 1D7FA 4Q4SA 2ZDSA 4HT3A 1FX6A 5HANA 1QBBA 2WBGA 3KTSA 4IGNA 4WJ8A 3G3DA 3VFCA 2OKTA 4XAFA 4JTHA 3N9KA 1ZAHA 2YXGA 2PTZA 5DMYA 4ACZB 1KW1A 5SWUA 4HHPA 3U3HA 3S9IA 4NASA 1ODUA 1R5YA 3MJYA 3ITCA 4O4VA 3OYZA 3ZLHA 2NX9A 3DU0A 4JTSA 4Q4OA 1U22A 3PBGA 4LC8A 1DJYA 4KWOA 4W93A 3H8AA 2WW5A 2DQXA 3NTYA 3AFBA 1XLAA 2AOSA 4GIEA 2H90A 1RH9A 3HB9A 1XC4A 3IIPA 4O0QA 3B4UA 4ALDA 4LYKA 4BI7A 1A80A 2WZEA 1FDZA 4KF1A 3BOXA 4H6RA 1EYWA 1K9TA 1F73A 2ZTJA 1BWVA 3E2QA 3ZXWA 1PDYA 3CQ0A 4RDYA 4DJEA 4QROA 4PRTA 2RH9A 3UFYA 2OVLA 1YNYA 1UB3A 1MQQA 5I3DA 1Q6FA 3LS9A 4EP8C 3MV01 1ZLPA 3A12A 5D2WA 3AJXA 5DANA 1E9IA 1CLKA 4DRSA 5E0CA 1NTHA 2X1SA 1QNOA 3PUDA 2INEA 1DQWA 1SZRA 4K8EA 4ZZ9A 1MEIA 2Z29A 2FH6A 5FAJA 5I3GA 3UNDA 3TAKA 4MKSA 1RQBA 2J88A 1DE5A 3H7UA 2Z2UA 3GTFA 5CSSA 3K13A 1L8NA 4HYVA 3AMLA 3FJ4A 1KBBA 3IJ6A 3DHDA 2YA2A 4NX0A 1K4HA 4MG4A 3T09A 1DHPA 1FHVA 6TAAA 4EANA 4DNHA 5A6SA 2C8NA 3D6NA 1XLKA 2WBKA 5G4HC 5LGXA 1X6UA 3CWHA 3C0QA 4GG9A 1RCQA 2WQDA 1J10A 1LM1A 2Z1SA 3BICA 3T07A 4GY0A 2BXVA 3DFQA 1ZCCA 2ACQA 1UOKA 1Z6KA 2BP1A 4M1BA 4N6EA 3EWWA 4NZ1A 1VIWA 2X42A 3OLEA 4LCSA 1WYIA 4HBKA 1VF8A 3H21A 2D2HA 4P8XA 2JBMA 2DZTA 4S3AA 5C9RA 1KRMA 3TYEA 3QKEA 1JZ3A 4PH6A 5K9CA 4U3CA 5AC6A 3O6YX 2VGIA 3GTXA 5K3VA 1ZJBA 4RLIA 4KEVA 2G3FA 4RZ4A 2CETA 2CFFA 3W28A 1DXEA 3MUY1 3VCNA 1JXKA 3HJEA 1MFVA 1FDYA 1I2NA 3CHEA 1K9EA 3RPDA 3MYPA 3S2CA 5LNRA 1EO7A 4RNJA 4GUJA 4MADA 1PZ0A 3VIKA 3F5JA 4JTAA 2ZA1A 3KCJA 4JTFA 4I5RA 4R85A 4JNMA 5F1VA 4NZFA 2XPKA 1B3YA 3INPA 2ATSA 1MW2A 3CV7A 2XFWA 4W8LA 1TPFA 1DV7A 4C6KA 2V3EA 3LCWA 2X7VA 4H41A 3BGJA 3VDHA 1UD5A 1UKPA 4TX8A 3U7VA 4F8XA 3DC0A 2BTMA 3Q67A 4KRZA 3IIVA 2ZUWA 3WLIA 1V93A 1XYZA 2YA0A 3TMQA 2DIKA 2BXZA 2GDQA 1V6WA 2FZDA 3DC8A 2R24A 3UWUA 1MSSA 1SR0A 3RILA 3WDRA 4QNEA 1G6CA 1S39A 1TWIA 1XPYA 3CQIA 5EMLA 4C65A 4OQVA 3KBVA 4DBWA 5EMMA 5REQA 3L4YA 3PJXA 1K02A 2VFDA 3M6DA 5HUPA 3CZKA 3HV9A 2HV5A 3C5QA 5E70A 2VEFA 4TMCA 1RCXB 4GH1A 2BVDA 3MKKA 1P0EA 4WY0B 4CVWA 1H2JA 2E25A 1AL8A 3PPCA 5F2IA 2XN0A 6ENLA 1KCLA 3LHYA 4AY7A 4I90A 2W79A 5DLCA 4F9DA 1JCNA 2D0FA 1GOXA 4AZ6A 3EWYA 3B04A 1XLJA 3ITVA 3G8EA 4DBEA 5C70A 3GXDA 1OQFA 3ES7A 2OX1A 5D8ZA 1R7AA 5FJIA 3VUSA 1DE6A 2XVNA 5HK4A 4NZCA 2D69A 2PZ0A 2ZE0A 4IX0A 3ZWSA 1R3QA 3AXXA 4MJZA 4IXXA 1XYBA 4AWEA 5KZDA 4NIRA 4I7WA 5JXQA 3L23A 2FHBA 2OGYA 2C0HA 2GOUA 3V16A 4B5VA 2XWEA 2V38A 1T6MA 2E9LA 4JDBA 2QCHA 3UY8A 1SGJA 4EK7A 4Y9PA 3T2QA 4X63A 5A6KA 2DORA 4D8LA 5M1TA 5G1MA 3WH5A 1VKFA 1YEYA 3TW7A 3KAOA 5BZAA 3VX0A 1HL8A 2Z1XA 2CLHA 2V6AA 4GYPC 4LY4A 4JFTA 3PY2A 1J4EA 5AZ1A 3L2LA 3FAWA 4HTYA 4XUYA 3TYBA 4Z2GA 2OG9A 3VINA 5I3JA 1IEXA 2OELA 3JZEA 3OBAA 3SCWA 5LA1A 4AQLA 3SCVA 3C8FA 4LSBA 2ZRZA 1S3HA 3AMKA 4XVEA 3P3BA 1GZGA 2OYMA 3QGVA 3TNBA 1I4NA 1I8JA 1NOWA 4FNTA 4LJ3A 4GZIA 3HQPA 1PSCA 1HP5A 4ROPA 1VGAA 4U2YA 4N4PA 3N04A 5G4WA 4FNSA 5EMUA 2CKSA 2F2HA 1W91A 2HISA 2UY4A 1QASA 1LWIA 1BSIA 1ZBCA 1VBJA 4WXZA 3DFNA 2EG8A 5LXXA 1DIKA 1MYRA 1V79A 3WLSA 3W2KA 2F84A 1T96A 4D71A 3LCIA 2W9MA 3UCCA 4B16A 4DUXA 3UBPC 1YTKA 2IUZA 4GH3A 2F7FA 4UFMA 4XTDA 1GQIA 1W9BM 1SVDA 1BG9A 2QDGA 2Z00A 1XCFA 5BNKA 3BXWA 4H4IA 2O7SA 1XLMA 2NV2A 2X1IA 3MS8A 3W6LA 4G2DA 5DRIA 4IIDA 3VM5A 1FWWA 3I6TA 1JL8A 1BAGA 5AC8A 5FESA 1TX0A 1K8XA 1AQMA 4Z2LA 2OT1A 1DQUA 4PEKA 5D2XA 4ZENA 1T7LA 4S39A 3VU2A 3SQLA 1PAMA 1MEWA 2DZBA 2V68A 3BAKA 1RCOB 1W2VA 1NSJA 4L65A 1GT8A 4CQCA 4GY1A 5HQLA 1E1EA 3B8UA 4M0XA 4S2BA 3DOPA 3MQTA 1ECEA 1GW1A 1VHNA 1KGXA 5MHBA 1S2VA 3GNDA 2RUSA 2WZTA 2BGQA 2NUXA 1GORA 2Q3OA 4WDWA 2CU0A 1F6YA 2F2KA 1E6QM 3SFKA 3GR7A 4GVFA 3N2MA 1HKVA 1OBAA 3A6OA 4O16A 1TJ0A 4EWND 1SFLA 2A79A 4OOUA 3FLUA 4XTIA 1UA7A 1BEUA 2PGRA 2X2YA 2OX4A 2J6XA 4HPNA 4UNLA 1ALDA 1UKSA 4IIBA 5A5WA 3E0IA 3GVVA 2EHHA 1ZUAX 1EA0A 4LUSA 4DXXA 2ISVA 4C7FA 3WLPA 3W7IA 3IJ8A 3R2GA 1A50A 3G1YA 5I79A 4JN8A 1DJQA 4J3ZA 4Y9NA 3VI2A 1M3UA 5HDRA 3E6EA 1QMLA 3DG3A 4PTVA 4US5D 1V77A 4MWAA 1W31A 4QQ3A 2QUVA 3A4JA 4LYPA 2VL4A 2E7FA 4D8AA 4H3DA 3GDBA 5AYIA 3NO3A 2OTDA 5HR7A 1DWJM 2E1DA 2OT0A 2DZSA 2JK2A 3AIBA 2VQTA 2NT1A 2WPBA 3OLGA 3RNDA 2TPSA 3GNOA 3VIHA 1EC7A 3K4DA 5A8MA 2HMCA 2A3CA 1OC5A 1DWAM 2PDHA 3GXNA 2PTDA 4JYEA 5A8OA 5H8UA 5I77A 1F7BA 1Y8BA 2ZKMX 3W71A 2FMOA 1XIDA 2PA6A 3BLEA 4PL2A 3CHFA 1P4CA 2E77A 1E1CA 2WQPA 4L4PA 1K7FA 3L68A 2QCDB 1QOQA 3KBNA 3LM7A 2XYLA 3DHFA 1V7YA 3P5YA 2DVTA 2VRJA 1ONWA 2W5FA 4H7CA 1H4PA 3WQDA 1G94A 4H01A 2QKFA 3ABQA 3LMZA 3WQGA 1VHCA 1BTCA 3EX2A 5M3WA 3Q37A 2WSKA 3N4AA 4X2RA 1OINA 3QHOA 2VDIA 4EPBC 2JEQA 5CPMA 5I24A 5EY5A 3O6AA 4RJEA 3GK0A 3GDTA 5B80A 2HPMA 2DQWA 2CERA 1HX0A 1LLWA 3M16A 4ZFCA 1Q45A 2HXTA 3PZ9A 5BOFA 2XIBA 1JYWA 2G95A 3ZWTA 5JIWA 2PU0A 4AMCA 3OZYA 1PO9A 3QLLA 3H12A 3WQ4A 3A4WA 2J8TA 4I5UA 5PTDA 3ONBA 1KA9F 4BZYA 3DFTA 1GCYA 1PCWA 3VUPA 3SN1A 3W29A 1HF6A 2QAPA 1GTEA 1HUVA 4OBSA 3DIPA 4AB4A 3FVMA 1HXJA 3H6OA 4FXJA 4MUZA 2BS9A 2INZA 3P8JA 3VABA 5I5RA 1KR1A 4DIAA 4B9YA 1KM5A 1P0KA 2NXIA 2WMFA 3R10A 3UXAA 3VCCA 5C7HA 1JRCA 5JVLA 5CC5A 2CLLA 3KEHA 1XIMA 3M44A 1VP5A 3BLPX 4DYEA 1JF5A 1DIEA 2QPUA 4AVOA 3JUGA 5I06A 1JD7A 2FFCA 2VOMA 4Z2IA 2DJLA 1H7WA 3S2NA 3TWBA 2GUBA 1DEDA 4L1XA 2OQHA 3EB2A 4NF7A 1V3LA 1XLDA 4GX8A 4D72A 5A6LA 3A5FA 5BOOA 4K38A 1E0XA 3NO5A 1M53A 3L4UA 2Z24A 1E4NA 6REQA 1ESWA 3AXMA 4MAZA 3W27A 1GOKA 1JF6A 2ZWZA 4JTRA 3LTPA 3S5ZA 4BCEA 3GZAA 5F4XA 4O1AA 3UJ2A 3GG1A 4DZ5A 3SRHA 1E0UA 5CSRA 4LCQA 1FWNA 4GY7A 1US0A 4HN8A 4B5UA 3HFTA 2D22A 1EA9C 3WH7A 3UXIA 2XSBA 4TOQA 3XIMA 4FI4A 4ZE4A 3TZNA 3IRSA 3IV3A 2J9ZA 3TNOA 1EJUC 2D24A 3H2CA 1NF0A 3BMXA 2VX6A 4W87A 2J47A 4GGBA 3NOYA 4MWAE 2X16A 1NOFA 5FAGA 3G1RA 2YL8A 4O53A 2ZZ6A 4JTJA 2NUWA 3LK6A 1GYLA 1EUAA 3KS6A 4OHQA 4HNLA 2YB1A 1TQJA 1E6RA 1K7EA 3GBDA 3VNYA 2HTMA 4PUNA 3W70A 4P8WA 3TOPA 5E6YA 3AIUA 2PEVA 1GHRA 2CW6A 1G5AA 2FB3A 4KQNA 3C2OA 3QY6A 5A95A 4A3QA 4CNUA 2GUUA 4FO4A 3P61A 4JTTA 4YTQA 2VGBA 4UTIA 3CIWA 1JUEA 2CPUA 3LHVA 3PZIA 4P8UA 2BVYA 2NLYA 5IOBA 3W85A 1RA0A 1MZRA 1VBUA 5HA7A 4PUDA 1UWTA 2VJXA 4C91A 4UNKA 1UWQA 4NY2A 3UCDA 3E74A 5AC4A 4H04A 3EPMA 2VZUA 1VB9A 1LTDA 2NVAA 1S46A 4Q7BA 3EMZA 1UROA 2J7GA 2R82A 3OG2A 4HNTA 4AD5A 1V6XA 3EDEA 4AF0A 2WMJA 5D2VA 3HGOA 4LNCA 3HTWA 3B3DA 1SJAA 3TR2A 4K36A 3RDKA 2VFEA 2ZE3A 1YKWA 2OSWA 1KXTA 3LERA 1IGWA 1PKNA 2JF7A 4WUIA 3NXLA 1W2PA 2GSHA 1ELSA 1QNSA 3N2TA 3MI2A 2V69A 2PSNA 4DJED 1F4AA 3P93A 2DU2A 3TJIA 2XGBA 2VDHA 4JGDA 4MPQA 4FEZA 4IJBA 4HK6A 1PIIA 1NAL1 2DT2A 4Z1BA 2WCAA 3R6IA 1AD4A 1B2YA 1B5TA 1X98A 4IISA 1JDFA 3CMGA 3WBAA 1H61A 2XU2A 4D6JA 3CIXA 3GFXA 4MWAB 3CTLA 4WKFA 3W7DA 3POCA 1ZAIA 5FEXA 4IQJA 5AB3A 3LCXA 1WUFA 4X22A 3UQNA 5CAKA 4GVGA 5FJRA 1PHWA 4U4MA 2ICSA 4F0SA 4EXAA 1V6YA 5IBXC 4WK9A 1WZKA 2CBIA 1LQ2A 3W2LA 3NQDA 2Q8ZA 2MUCA 1HZYA 2WYSA 4IZGA 3OEXA 4IUGA 3TJXA 1R0MA 2DSZA 1UD3A 4KCUA 1EJXC 1W5QA 5I2UA 3KDNA 1E15A 2F6UA 3B0YA 2F8QA 3U2EA 1OFBA 4ZXLA 3KS5A 1DORA 5I6SA 4TVCA 1O7AA 1BVZA 4I7UA 3TSMA 3PTMA 5AHIA 3ARWA 3WD3A 3H53A 3TKFA 1Q63A 3S5SA 2PWHA 1Q3NA 3GQYA 1H7XA 4W7WA 1UZ4A 1IIGA 1KGWA 1JZ2A 3QZEA 1EGMA 4ECLA 1FRBA 1RALA 1GGOA 1OFPA 4JIRA 4KIRA 3A22A 4WXYA 3ABOA 4C7GA 3LI0A 5DFAA 4DJEC 3E2VA 4XSMA 1PTGA 3BQ6A 3EMCA 3SY1A 2WMIB 2ZDRA 4POCA 3H4XA 1UP2A 4QITA 4LS1A 1ONRA 4YMZA 1EWDA 3BO9A 2AQWA 3CHVA 3H2EA 4QG8A 3WLHA 3DGBA 3VYLA 4JTLA 3WNMA 3B8WA 4LANA 1D9EA 4M56A 3I10A 3RX3A 1LL7A 4LUJA 1PEZA 2G41A 4ZGYA 5ABEA 5J5RA 1I2RA 4EAYA 1Q7QA 4O4WA 3NFUA 1HNYA 2J27A 4F0HA 3FEMA 3B0UX 4FLSA 3GHSA 3MO4A 3C6CA 3NZRA 2NSOA 4OBTA 2A7RA 3V18A 1W3LA 2PDMA 3G18A 5D4YA 3GD6A 4OJYA 3THUA 3U0HA 5T9BG 3NVDA 3WJSA 3LHWA 1KRCC 2FH8A 2VOTA 4DXVA 4B3ZA 3EWDA 1K9DA 3TN5A 1MQRA 1DJWA 3NQMA 3AYSA 1OZQA 3ID7A 2JGQA 4GQGA 3KP1A 3C2VA 2B7QA 1LQ0A 1UR4A 4DWSD 5MKGB 4R33A 4JTEA 4MKVA 2W61A 1OIMA 4P5UA 1TPEA 1V3IA 3OZPA 3N14A 4IXHA 1ZU8A 3I3BA 3W7QA 4DZAA 1KBIA 3LCHA 1T5AA 5LNUA 2V3DA 1UH2A 4GOAA 5D2TA 1PTDA 1K7XA 5I78A 4IMDA 3A24A 4YPJA 2UY5A 4LF1A 4CUCA 1VJIA 3B9AA 3MUZ1 1M9HA 4LQ1A 4HHHA 3IVTA 1EZ2A 4NSBA 3M0YA 1NARA 2ZZ3A 3N9SA 2OSXA 3IJIA 1IEIA 4JL2A 1AH3A 1JPMA 4L7ZA 3OJGA 4F40A 1WKYA 3NQBA 5CPNA 4WDTA 1N8IA 3VD3A 1VEPA 3JW7A 5FF7A 3FSUA 1ODZA 3KHJA 3ZS4A 2JGYA 4S3FA 3VD7A 1GZ1A 4Z17A 3PTKA 4YVVA 1H7NA 3IWPA 2BODX 1V8EA 3C3NA 3ES8A 4Y9OA 3GHUA 3GH4A 1TV4A 3PBMA 4P7OA 5AHNA 1RD6A 4AD3A 4DY1A 4EPEC 3H2MA 3LCGA 1UKOA 2ZIDA 2PCEA 1V3MA 2P3ZA 3L2MA 1XGEA 2J7BA 3TYCA 1OM0A 1OCNA 4OTKA 4JIPA 1RVGA 2HEJA 8XIMA 4NAFA 3E5BA 3JU2A 3PC0A 2R94A 4OWGA 2DIJA 5D38A 5DX7A 4Z1CA 1KGUA 3RITA 5IXEA 2A3HA 3H23A 1P6WA 3T0CA 3WDIA 3RJXA 4C6IA 1AZ1A 1VFHA 3CLWA 2V5JA 4X9YA 1FXQA 1GG0A 2PDJA 1PZ3A 2VC6A 1W9UA 4M6PA 1JZ6A 3TTSA 3ANYA 2GVGA 3H55A 3W00A 2CZVA 4DLFA 4MDPA 1PYFA 5JBEA 3IARA 2YIHA 2ONEA 4NHVA 4S3JA 5TF0A 4JL1A 2ZCGA 2ZWYA 1A5MC 4UTKA 3R8GA 4RE0A 3UJSA 4KBXA 3CQHA 1CIUA 4MFEA 1MDRA 1QFEA 2C18A 1FCVA 4GFSA 2VX5A 3G22A 1PBGA 1OZMA 3QHMA 1SW3A 4IF2A 4LT9A 3L5LA 3M7SA 1Y5WA 3HG3A 2DFAA 2ZX7A 4KEUA 4E4FA 3FS2A 4PYSA 2FGBA 4ADSA 3P67A 4C1NB 1FHLA 5C54A 1TTQA 2PDLA 5BW6A 4TUFA 1KFBA 2NXGA 2NXHA 2CHRA 3AWOA 2X05A 4IJRA 1U1UA 1TTJA 3H7VA 3QVQA 1JQXA 3DDMA 4ERAA 1A3XA 3B9EA 1KQYA 3FJLA 3ARVA 1AZ2A 3AZTA 4PTMA 4DF2A 1NY1A 1RP8A 1FWGC 2D2JA 1XYFA 1SM9A 1GOOA 4EPKA 1LOLA 3AXIA 7TIMA 2IPWA 1WZLA 4I8DA 4OU1A 1VCGA 5D03A 4LBUA 4QM1A 2GGGA 2XZ7A 4Z08A 3NG3A 3O0FA 3VIFA 3NEVA 4HYRA 3TC7A 1C93A 3GE7A 3NXFA 5HMDA 2J78A 2OEMA 1LG2A 5ENLA 3BAIA 1POKA 1JYXA 3WH6A 2RGLA 3QTPA 4PUWA 4DYJA 2VDGA 3PN8A 1M7XA 5EGRA 3G2GA 2QIIA 5F1UA 2QAFA 1K9FA 1UD8A 3AYRA 3RHGA 5JBDA 3RU8X 3CZEA 4D6HA 3THAA 3WH9A 4GA8A 4P7RA 3DCPA 3PULA 3T8QA 3LI1A 4UQ9A 5FSEC 1OWQA 1EJVC 1CT5A 4DZIA 4N02A 5I09A 2CESA 3GG8A 5U4NA 1OGGA 2A4AA 1CLXA 1FH7A 2PPGA 3NQ2A 3OOQA 1RQHA 2VCCA 1JG9A 5LIWX 3U4AA 1W3TA 4KCVA 3NM3A 5C9XA 5FCZA 1DBTA 3LPGA 3LU2A 1FOBA 2DT1A 3W23A 3R94A 4YWIA 4ATWA 2YSWA 3HJZA 2DW6A 1KBLA 4QTGA 2W63A 3ISIX 3D5HA 3WK1A 3I65A 3PANA 2BGNE 3A4AA 4HPGA 1A0DA 2GUYA 5CSUA 3A9IA 1QK0A 1LL6A 4GXWA 1AMYA 4LTSA 3CWNA 1W3HA 2YZ5A 1XM3A 1E51A 1QWKA 4WGXA 1YNQA 1UWRA 5EFFA 1CGUA 3L0KA 2YLLA 4RZ5A 4UQDA 3QYQA 2VWSA 3SQSA 3MHGA 4PMUA 3MCNA 2WJDA 2HE5A 3NPXA 3QTGA 2QCGA 1VFSA 3RGTA 1KC7A 1P7TA 4B4FA 4ILSA 1SR9A 1M5WA 1YBQB 2HK0A 2XWDA 3SN0A 2D3LA 3KL0A 3CPUA 1ZFJA 3H7RA 4ML9A 3KRZA 3AU2A 1IIHA 2PDPA 3KFTA 4F0LA 1IXQA 1SZGA 3NL5A 1UOZA 2VFGA 1ME7A 2DH2A 1DWIM 1DHKA 3CB3A 2GJXB 4CD8A 4HGXA 4BS0A 3ARQA 3V0TA 5ABTA 2FZNA 3ZJ8A 4DN1A 1BKSA 1NF7A 2GLKA 3EDJA 1TYGA 2Q8XA 3R11A 2CLKA 3TN6A 4Q7NA 4OV4A 4TMBA 3PK7A 4JCLA 3RMEA 1QBAA 3T40A 4G6CA 2H8ZA 4RPQA 3UPWA 4U10A 4Z1YA 3IUIA 2YDQA 2D23A 1A0EA 4QAIA 2FFIA 2G50A 2OQLA 3BLFA 4C6DA 1X1OA 2WMIA 4LVDA 1W17A 3CAVA 3Q65A 5AZ0A 3B9NA 4CEUC 4JX5A 1K8CA 2WPGA 3ME3A 4NG3A 2IKIA 3WLQA 3GTIA 3D3AA 1X6NA 4IX2A 6CGTA 2V5KA 2QCEA 4PCFA 7ENLA 2VHLA 4FLRA 3VKKA 4QDWA 4M19A 3GSMA 1A47A 3BQ5A 5EMJA 4I8YA 4GFIA 3VDBA 1E56A 2E5CA 2YDAA 1S2WA 3SO7A 4K7VA 4O1FA 4ZBCA 5RUBA 2DP3A 3VKDA 4FMVA 3ARZA 4REQA 3V0SA 4O18A 2V0TA 1M1BA 1F5ZA 4RV8A 1YDNA 4XZWA 1C8QA 3P8IA 1ZJAA 2LLEA 3OLDA 3KUMA 4IIGA 1JIBA 1NWTA 1R85A 1UCWA 2Z0IA 4JDYA 3KCLA 3W82A 2V3FA 1GVRA 3H2OA 1JCJA 1EGVA 2WV8A 4HU8A 5F2GA 5DN1A 1NQ6A 2P8CA 4DO4A 3EA3A 2QQ6A 4CQ9A 4Z2KA 3IJQA 3EXSA 3T81A 3W2UA 1XFCA 3IK2A 4ICMA 2Y8KA 3WBXA 3PUGA 5HNUA 1P5BA 3PVFA 3N18A 3W76A 3OZMA 3SIMA 5LIKX 1J0JA 3LV5A 3MJMA 5CC7A 1JR1A 3VC6A 4UTMA 4HU4A 3SUUA 1PXGA 4IMEA 3EA2A 5C5YA 4AWUA 4Y9MA 4Q8PA 2R6OA 2Y85A 3N4EA 2GGEA 2FHFA 3A9BA 2G0WA 3VNZA 2VR2A 4QDPA 1HJWA 1GNXA 2BXYA 4YYFA 2J77A 3M5VA 3L5MA 1JFXA 1VQTA 1Q13A 4DJFC 4GYJA 1XYLA 3S1XA 2O9OA 5DRCA 4XIMA 1A53A 2CCRA 3WEZA 3B0XA 3NQEA 4AD4A 3TXVA 4E3TA 1H7RA 1QVBA 4ZQNA 4ERGA 2QPXA 2BDQA 4S3BA 3W02A 3VIMA 4D6EA 4PMNA 4PUKA 1BSLA 3BG9A 3SW6A 2DT0A 2UV8G 3CMJA 3WLNA 2NQJA 1J2BA 4MB4A 4F2UA 4HA4A 4NKCA 1SW7A 2WLYA 1VJZA 5CPTA 3KTCA 1JCXA 1YDVA 2VQUA 4NT0A 1GOQA 4MJ2A 5D05A 2GSJA 3WK2A 2Q71A 1WX0A 4AEFA 4INFA 3FY1A 1P7TB 3KVKA 1HJUA 4WOQA 5F2MA 1QPKA 2JKAA 1O1ZA 1Z9AA 1CCWB 1MMFA 2PGEA 2DIEA 1J96A 1I1XA 3MUAA 3H2FA 1ZQ5A 2PWFA 3AU6A 2TSYA 4QAWA 1KM3A 2WHJA 3VGDA 4BI6A 4ZO7A 4CNTA 4O19A 1H51A 2OR2A 3NZ1A 1LCOA 4CU6A 1JCYA 5F7UA 1E1CB 3WUEA 4LVFA 4FXSA 3T42A 1E1FA 2B4GA 4LPCA 1WZMA 3WQ5A 4B3KA 3FAXA 4NX5A 4C6QA 4BFAA 3GTNA 3UZWA 4HA1A 4GACA 4NZ5A 3KLKA 5D02A 3VOGA 5E6ZA 1FH9A 3UR2A 5KTLA 1E6PA 3T0AA 1E0TA 4A3YA 2CZFA 4MNJA 3CJPA 1LQAA 3DG6A 4F0MA 3TIMA 1N8FA 1SMDA 4E2BA 3CPGA 1WPCA 4DJDC 3CO8A 5D04C 4XZ9A 3MP4A 4IQLA 3HPFA 1L2QA 2ZXBA 3NZPA 3MP5A 4B91A 1E4IA 1IZJA 4NU7A 1B3WA 2JEPA 5FOOA 2QZRA 1JCMP 1HW6A 2Z25A 1P6BA 4UCFA 5KINA 2V67A 3OIXA 4GZJA 3P82A 2A3BA 4PMVA 1GVOA 1XP3A 4WDXA 2QJJA 4NNAA 4K39A 4Q8QA 1SQ7A 3QV9A 4FNRA 2EKCA 1BWLA 3VE7A 4BF9A 1QR7A 4U33A 1OCJA 1ZY9A 4O17A 4FNPA 5I7GA 1OD8A 1ECQA 1MO0A 1V3HA 4LNYA 3N2OA 1TO3A 3TC6A 1YE6A 3TYDA 1XLCA 2GJPA 4JFWA 3VPLA 2GVYA 4K68A 1Q7ZA 4WD0A 5FEPA 2G3MA 3NQCA 3QY7A 1IZKA 4CD7A 3VGEA 2DVUA 3GHTA 1AVAA 4G56A 2PGWA 2FZBA 2WWCA 3EKZA 1R3VA 1XSIA 5AHEA 3V35A 4PBEA 1TREA 2EJAA 2ALDA 1JDCA 2VUYA 1MW3A 1XDJA 4PR4A 2G37A 2QJHA 1UKQA 1E73M 1TFVA 2RAGA 2VENA 4JTKA 4Q33A 2ZYFA 3S46A 3SGGA 4JY8A 2TYSA 3NWRA 1MWOA 5AYXA 2WKJA 3NQ8A 1NELA 2Y2WA 3W0KA 1I9CB 1O94A 1KWKA 1HGYA 3HQNA 2HCVA 4RPPA 3M4HA 2IQ0A 3QOKA 1F8MA 5E0FA 3OVPA 3QC3A 2EPHA 3BVJA 3WJZA 3TN4A 1IEWA 1XD0A 4BQ2A 2EO7A 1TZZA 3W9ZA 4CQ8A 2P5NA 4GRSA 2DH3A 5EU9A 1I60A 3OQ8A 1CXKA 3HOJA 5HNTA 3LHUA 2O92A 3BH4A 5ABFA 4US5A 2DZVA 5LIUX 4C5YA 1Q65A 3ITGA 2QUTA 3AALA 4Q4QA 1WV2A 4DXKA 5HATA 5CAHA 2JFEX 3BSHA 3HPAA 3HG4A 4A21A 1I2OA 2ZZ5A 3GVWA 3DKJA 1JCTA 3USZA 3OGSA 1W3NA 4UIOA 3PZGA 4IP5A 3UVAA 2VO5A 2WHKA 3THDA 1S1RA 3LD5A 4W9TA 3PZTA 3N34A 1LRTA 4A8RA 1T99A 2PRHA 1EWEA 5BXSA 4RXGA 2CLFA 4TTGA 3WK0A 4HCDA 2CBUA 3GYCA 1KM4A 2R1PA 4ZSUA 2EEXA 1H1ZA 3E9AA 5GPRA 4YCPA 3F03K 2FDMA 1YXCA 4NXSA 2Z27A 4IJCA 4QIUA 3W37A 2VZTA 4YU1A 2I17A 3BAJA 2BGSA 1WDQA 2RDXA 3ZR5A 4IPPA 3MHFA 3WQ8A 1GK8A 2J7EA 5AVNA 2NW0A 3RLHA 4FIQA 1R30A 1J6PA 1O1HA 2G3JA 2IKJA 4Z1DA 4BJHA 1X1NA 1SJDA 1F9CA 3APTA 3KL5A 3OW1A 3OGVA 3WEOA 2OO0A 4LAOA 5KZ6A 2PLKA 1L6WA 5LGZA 2VX4A 3I6RA 3BG3A 3TN3A 1OVDA 1RJRA 4DBUA 1XWYA 3GWQA 1GG1A 3M0KA 1ENUA 3QHNA 2FKPA 3ARSA 5CPSA 2YPIA 3KBSA 1EHAA 4D6FA 3EA1A 1MQPA 4MMWA 4LUYA 4QEHA 4Y6GA 1VFUA 4RE3A 4GYKA 1EX1A 5CEWA 4S3DA 2BBFA 4KGLA 3GW3A 3PJWA 2ZICA 1DWFM 4PCTA 2CITA 4ZMGA 5LHFA 2YYUA 1BVWA 3RK8A 1O5QA 3VD9A 3PTQA 4RZ6A 1E9ZB 1SZEA 3O6DA 3W86A 5LZLA 4PUEA 4HJWA 1THFD 1BHGA 2QCCA 5L6UA 3SFWA 4DUWA 2P3EA 1V4YA 1RQEA 1ZGDA 3EXRA