1FHLA

Crystal structure of beta-1,4-galactanase from aspergillus aculeatus at 293k
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
334
structure length
334
Chain Sequence
ALTYRGADISSLLLLEDEGYSYKNLNGQTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFAENDIDIEIISIGNEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDDGWSWDQQNYFYETVLATGELLSTDFDYFGVSYYPFYSASATLASLKTSLANLQSTYDKPVVVVETNWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAVVEATTDGLGVYYWEPAWIGNAGLGSSCADNLMVDYTTDEVYESIETLGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
publication title Aspergillus aculeatus beta-1,4-Galactanase: Substrate Recognition and Relations to Other Glycoside Hydrolases in Clan GH-A
pubmed doi rcsb
total genus 123
structure length 334
sequence length 334
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhlA00
4OKDA 4QCEA 1HT6A 1EOMA 3LMYA 3WD3A 3RDKA 4DWSD 3WEZA 4AD2A 3CH9A 3PTKA 2D20A 2J7GA 3T2PA 3VNYA 1ISYA 3WBEA 4URIA 3VGDA 2CIPA 1W1VA 2E3ZA 2V3GA 2WMIB 2W4XA 4HPHA 3VIFA 4JCLA 1K9EA 4JFSA 2BY0A 2X8RA 1JXKA 5ABHA 2YL9A 1Q4NX 5A2BA 1UKPA 3WDIA 3M7SA 2AMGA 1V02A 3GM8A 3PZUA 5AYIA 4RE2A 1H0IA 5HOSA 5E9AA 2BNJA 1DWAM 4H04A 2WMIA 3ALGA 1NQ6A 1CXLA 1HN1A 4M1RA 3CGTA 1V3MA 2ZX8A 2WVSA 1ZBVA 1UKOA 3BMWA 1E72M 5A3HA 4W87A 2DDXA 2Y8KA 3VVGA 3KE0A 4BA0A 3GBEA 4F9DA 1UD6A 1FA2A 5FL0A 3SUSA 1UD4A 2VZSA 1NH6A 4BF7A 1OINA 1ISXA 5A6LA 4Z2LA 1NARA 4UFKA 4ML4A 1VJSA 4V2XA 2XPKA 1O6IA 2EPMX 3L4VA 1JNDA 3WNNA 5IHSA 1DWGM 5DO8A 1NWSA 4A3HA 3SIMA 3VD7A 5FKYA 1M04A 3SUUA 5IFPA 3FXYA 3A4WA 5KZ6A 5A69A 3SUWA 2WZHA 4CD7A 4X9YA 3CZJA 1OCQA 4HZ6A 5D9NA 4AD5A 6TAAA 1H41A 3EDKA 1FOBA 4PMYA 1LL4A 1V3JA 4HOXA 1QOXA 3VD4A 5CGMA 5A8QA 3VOCA 1OBAA 3EYPA 3FNDA 1G1YA 4HP5A 2E8YA 4OOZA 5BXPA 4JKLA 5JUVA 1UA7A 5JBFA 1NP2A 2ZUNA 3U57A 1OGBA 3U7BA 1J0HA 2WW5A 4MB4A 3SCTA 1JG9A 3CMJA 2JIEA 2YBUA 3IAQA 5IXEA 4CU6A 2WCSA 4LYPA 3RO8A 3VIJA 2FDMA 4LQ1A 4W5UA 4UFIA 4Y7EA 5D4YA 3WFLA 1BLIA 1GOWA 3QHOA 3TTOA 2XWDA 3FAWA 2VJXA 2MANA 3OGVA 1IT0A 3K8KA 2E0PA 4KWUA 1AQHA 3CZGA 4CUCA 3QR3A 2WC3A 3N13A 2BVYA 3M6DA 3WMSA 3AICA 4NSBA 3BLPX 1UR8A 4MDOA 1K9TA 1QHOA 3WQ4A 3APGA 1HJSA 3ZT7A 3A4AA 3GH5A 2ZWZA 1UWIA 2WBKA 2CKSA 1J0KA 1LJYA 1R7AA 5JIPA 1VEOA 4H7VA 1CWYA 4PMRA 5CSUA 3K46A 1MW0A 5A6JA 1EH9A 2B31A 4AC1X 2DQXA 4TOQA 3OLDA 3GXIA 3THDA 4M56A 2PI6A 1GCYA 4AXNA 1OM0A 3UEQA 4OBSA 5CG0A 1B31A 4RE3A 5D9OA 2XHYA 4EE9A 2ZOXA 3DHPA 3I3BA 1ZBKA 1J18A 1GOIA 1RP9A 2JF6A 4AZGA 1UUQA 3N18A 3UR8A 2YOCA 4PCSA 2OWCA 3BMVA 2W5FA 4N42A 1PX4A 3AHVA 1PX8A 5I5RA 1HKMA 4IUGA 3JUGA 2XG9A 2X0YA 2YL8A 1LQ0A 4W88A 3UR7A 1GHRA 1CLXA 3AXHA 3VGHA 4ZXLA 3N1AA 1XYFA 1GHSA 3T0DA 2QMJA 2BVTA 4D6CA 1FP9A 4HU0A 2EQDA 1JZ2A 5JBEA 2OLHA 4J3WA 2FHCA 5F7UA 2CBIA 1JZ4A 2WLZA 2ZE0A 2V3DA 1PAMA 1C92A 4WJXA 1KXHA 3VTRA 3ZJ8A 2E4TA 2YL6A 3BC9A 2WZEA 1KGUA 1XD1A 1JZ7A 4D6JA 2A3HA 1RP8A 5D8WA 2XM2A 1I1WA 4HZ7A 2VOTA 3ARQA 3D5HA 3AYSA 4XV0A 3IJ9A 1XH0A 4H41A 5EFFA 2JF7A 1B2YA 1V03A 1VJZA 3MANA 4HTYA 4TXEA 1HP4A 3BAKA 4PSPA 5I24A 3GXDA 5I2UA 2Y8VA 3SCRA 3NSNA 3VMPA 2PC8A 3WDJA 3CMGA 3CZKA 3NUKA 3IJ7A 3ZIZA 4J27A 1Q6DA 4MJ4A 1ZJBA 3WF3A 1ITXA 1YHTA 1UQZA 3AIWA 1PJ9A 5I78A 2VVSA 3WDPP 4RL3A 1WKYA 4HMDA 2VI0A 1UH4A 1X6LA 2DIJA 1W1YA 3VILA 4AZ5A 2AOSA 4HOZA 4F9JA 1XSIA 4PSRA 3HN3A 2WMFA 4UFJA 1OD0A 2NT1A 4DWSB 3WQWA 5A8MA 4B3LA 4M24A 4GI9A 2D24A 1V0NA 1G01A 2CCRA 1JIBA 4C7GA 3MUZ1 3AJ7A 3N11A 3B9EA 2QMKA 3WFZA 1OSEA 1M53A 4DWSA 4D71A 3ARPA 5M5DA 3BGAA 1FH8A 1QI5A 3L2LA 3PTMA 4U5IA 2XGIA 5GNZA 2GVYA 1E1EA 1HL9A 1ISVA 2XVNA 1C8YA 4WKHA 1UKSA 4HOWA 1JI1A 3T0AA 5CPQA 2EPKX 3FHAA 1E6ZA 2QLYA 2VX5A 3WL0A 4MNLA 1HNYA 3TTSA 1E56A 3ECQA 1KFWA 1UR9A 2QPUA 1JYVA 4W84A 1E0WA 2VQUA 1VIWA 3WL1A 2BHZA 2PBOA 2WK2A 3VIGA 4Z2KA 1V6YA 4TUFA 4AZHA 2TAAA 1HXJA 1US3A 4AY1A 4V28A 3VD3A 1K9DA 4XZWA 2QV4A 2XTKA 4ACYA 4UFMA 3WIJA 3OGSA 3CUJA 2XVGA 1CGYA 4MJ2A 1W91A 2CKRA 1VF8A 5I77A 3CIVA 5DMYA 3L4XA 3AZRA 3AMCA 3BCDA 1GZJA 4W93A 1BGAA 3PBGA 1XSKA 1UR0A 2OWWA 4AMCA 5BXTA 4S3KA 4AW7A 4P7NA 4J7RA 3ARRA 2HVMA 2EPOA 3RJYA 1XYZA 2FGLA 3WEMA 2CESA 2WM0A 3QOMA 3G6LA 2DGAA 4AEFA 2VRKA 2VZVA 3DYMA 5A6AA 1JFXA 3T0BA 1VFUA 2W67A 4ACZB 2YBTA 5D9MA 5CPSA 3SCVA 2WMKA 2O9RA 1ISWA 1QHZA 1XH1A 3BAXA 1B3ZA 2A3EA 1UKQA 2J7BA 2YLLA 2PWFA 3DECA 5GNYA 5A6KA 3ZOAA 1W9DM 1EDQA 1I1XA 1KB3A 4CU8A 2W61A 3RM9A 5CLTA 4M82A 3VX0A 4ACZA 1WDSA 3A3HA 3U7VA 1JF6A 3TTQA 1JZ5A 4MDPA 2VC9A 3VD5A 3M46A 1RH9A 2BY3A 4NRRA 1ZB5A 1HL8A 1MFUA 3AIRA 4OJYA 4OZOA 2OYMA 1EHNA 1RD6A 4CD4A 1TCMA 1XCXA 1M01A 3W27A 3PZQA 1GVIA 2GDUA 3LPOA 5ABFB 2DT2A 1I75A 1S46A 4PTVA 3WF0A 1A3HA 2ESCA 2JIWA 5AY7A 1F4HA 1IZJA 2WMJA 3W29A 1TR1A 1JYWA 4MADA 2J7HA 1KBBA 7TAAA 3CHFA 1CXKA 4UOJA 1UOKA 2VUYA 3I3EA 1V3LA 5CXPA 3W37A 3II1A 3N15A 5ABFA 3VUPA 1JAKA 2FHFA 2Y4SA 4EANA 3PHAA 1FHLA 1OT1A 3CPUA 2ZXBA 1N82A 2EPNA 5A8NA 1KR1A 4GXPA 4MTVA 3OZOA 1V6UA 1LL7A 3WH6A 3FY1A 4AWEA 1XGZA 4PMNA 3WF2A 2IXUA 9CGTA 3MMDA 5E0FA 4PBGA 5AC5A 2GJXB 4OUEA 2A3AA 1JD9A 3VDBA 1UWSA 2EJ1A 4P8UA 1TFVA 1BSIA 3TP4A 2WHJA 1LG2A 3WF4A 4KH2A 1QNSA 2JEPA 2GJXA 5LYRA 1U30A 1QNPA 2O9TA 1HKIA 3KZSA 1DTUA 4ZE5A 4FLQA 4CVUA 1BG9A 1NOUA 1UA3A 3AS0A 4YHGA 3VDAA 2CBJA 1C8XA 4ZFMA 3CHDA 3CHCA 1SMDA 1JZ3A 3W24A 4J3VA 4UTFA 3VMOA 7A3HA 1MW2A 1UWQA 2G41A 4ZENA 1B3WA 2J25A 1WNOA 4GINA 3W26A 1TVPA 5I0DA 3B9AA 3IAPA 4H2CA 2V3FA 3WDRA 5E70A 4GO9A 1KCLA 1E0XA 3L4UA 2XJ7A 1G94A 1TMQA 3CUFA 1MQQA 2DEPA 3SURA 1ITCA 4V27A 1H2JA 2E9BA 2J74A 2Z1KA 3WNMA 1E3ZA 2WHMA 2UY4A 3OB8A 1CYGA 3PZIA 4JFWA 4LYRA 3F4VA 1W9PA 1W9UA 2D1ZA 1V6WA 4IPLA 3BSHA 1WB0A 4EAMA 2ZXDA 1MXDA 2XVLA 3AXIA 1KGXA 5BWFA 1E55A 1H1NA 2BY1A 2GK1B 4UFHA 2ZICA 1U2YA 3TA9A 4XZBA 3THCA 4CKQA 2EBNA 4AD1A 2VVNA 3AOFA 1KXQA 1HX0A 2XFRA 2XGBA 3AROA 3WQ5A 1B0IA 4JFUA 4FMVA 2ZWYA 4FLSA 1E4NA 2WMGA 3LPGA 3VIMA 3ZSSA 3PZGA 1PIGA 3AIEA 2GK1A 2DT1A 1V0LA 2ZX7A 4U3AA 3VM5A 1V3IA 3GNOA 3EDEA 3WNLA 4CD5A 1KQZA 3SCUA 3PZOA 2WC4A 4KGLA 3MV11 3WH7A 4UQ9A 3ARVA 4AEEA 1L0PA 4WK9A 3WN6A 4C7DA 1EDTA 1WZKA 2J4GA 3L4TA 4D1IA 1BF2A 4TVCA 5E6ZA 2GJRA 5LA2A 1J01A 1GOKA 1BYDA 4L4OA 3WD0A 1MQRA 3OA5A 1IV8A 2ZUTA 1E6QM 3OLGA 2J7FA 3GTNA 1NP0A 2VCAA 3IJ8A 2DIEA 5AYBA 1VFMA 4QLKA 3RM4A 3POHA 3U5YA 3WMCA 2WPGA 3CUGA 1PEZA 4U2YA 2G3MA 5BCAA 4F66A 1UH2A 2O9PA 2VRQA 4CN1A 3VINA 1CXIA 1GW1A 1PZ2A 2JEQA 2D3LA 3A47A 4ZEPA 1WP6A 2VZUA 1A47A 4D6EA 5A94A 1QNQA 2WYSA 3PZMA 2XM1A 2VR5A 1CXHA 3OIHA 4GQRA 3SEPA 1W3HA 4CD8A 3SUTA 1UZ4A 1E71M 1MQPA 2WXDM 4JFVA 4AZCB 2D3NA 3MUY1 4Z2GA 4Z2HA 3W28A 4DUXA 5CLWA 3PZVA 5I3DA 5CZKA 3LPFA 4TVUA 5FD0A 4AIEA 1JXJA 1E1FA 1EO7A 1GQIA 1JYXA 3BCFA 3GXMA 3KL0A 2CHOA 2WMHA 3CO4A 1GUVA 3LPPA 4N0RA 1Q6GA 1CLVA 2V38A 2X0HA 4AZCA 1VFFA 1QVBA 3NIYA 4A4AA 3GDBA 3AYRA 2QHAA 1C90A 4IISA 5E09A 3GZAA 5AC4A 1H4PA 1E6XM 1WDPA 2WHLA 2Q8XA 2WAGA 5IFTA 1B90A 2UY5A 1TA3B 5BYWA 4CU7A 1E6PA 1QBAA 2DSZA 2HISA 4D6HA 2VZTA 1FFRA 1W32A 2F8QA 2XSAA 1TVNA 1UQYA 2ZXQA 3DHUA 4AD4A 3B8SA 1P6WA 1GONA 2UY3A 1TA3A 3VIPA 4WKAA 3MUAA 1CIUA 4AIUA 1OIFA 5I6SA 1JZ8A 1W1PA 3EMZA 3GH4A 4D72A 2V5CA 1MXGA 3FHQA 1JAEA 1R7OA 1KGWA 2VX7A 4QLLA 2VL4A 4Z2JA 3K8MA 1E5JA 1UWTA 3WQ8A 3IANA 2WLYA 2WSKA 1CTNA 3W0KA 5A6BD 5BXRA 2WWCA 4AD3A 1CEOA 4ZE4A 4PMVA 1AVAA 3AHXA 1LWHA 3BLKA 4WSKA 1G5AA 4UOZA 4B15A 1FH9A 4R5EA 3SUVA 4CN4A 5JIWA 3WEOA 3OLIA 3ARXA 1J11A 4QAWA 4UQAA 2WVTA 1HJUA 4F8XA 4A3YA 3RJXA 1H3GA 1CZ1A 4MB3A 4P7LA 1NM9A 4AD0A 2G8ZA 1US2A 2CERA 6A3HA 3VKKA 5M03A 1D7FA 5EFDA 2WKGA 1HVXA 1F4AA 4GPNA 4U3CA 2PWHA 3KL5A 5HXMA 1E43A 1V0MA 1DWHM 4MB1A 1BG4A 2WCGA 4M81A 4YHEA 2PWDA 1EGZA 4B16A 3KEHA 2WBGA 6CGTA 5CGTA 1CPUA 2E8ZA 5GPRA 3F5LA 3W38A 3MKKA 3GXFA 1EO5A 2D23A 1JDCA 1UWRA 2YL5A 3NYDA 3ZR5A 4AIOA 1SYTA 4W8BA 2ZX9A 3VIHA 1GOQA 1OD8A 4M29A 2X05A 1ISZA 3MSDA 1E6RA 3VGGA 2XFYA 2UY2A 3WH9A 4E4PA 1MW1A 4S3JA 4F79A 3ZJ7A 1WZMA 1JDDA 3AXXA 4Q7NA 2D22A 2AAAA 2YJQA 5A8PA 1BVZA 1UH3A 4UZUA 5IDIA 2VRJA 2VQTA 1YQ2A 3M07A 1W3LA 3T2OA 2W62A 3BAYA 3MO4A 2BFGA 3VGEA 4MNJA 2QPSA 1OB0A 4QDMA 1JL8A 1Q6CA 1GNXA 4JCMA 3VDCA 2DPEA 4FK9A 4QCFA 1ZJAA 1R85A 4IM4A 1FH7A 4H8UA 5DF0A 5CSYA 3TTYA 4QLJA 1EOKA 5TD4A 2WNWA 4J3TA 5D8ZA 2YIHA 2J8GA 2Y24A 4KGJA 2DSUA 4GKLA 3N12A 1HVQA 4OIFA 2XIIA 4HA4A 1EXPA 2YDRA 4WIWA 3WY1A 3PN8A 1AQMA 4PMQA 4W7VA 2XIBA 2O92A 2G3NA 4CD6A 3VX1A 4C7FA 2NSXA 5I23A 4MNMA 1UWUA 4W89A 2OWXA 2ZX6A 1TG7A 2A3CA 1C8QA 1SR0A 1LF1A 3EBVA 3WH8A 4D6FA 1VEPA 3VIKA 2ZUWA 1WDQA 2J8FA 1DWJM 1B3VA 1XRVA 2DT0A 1GVYA 3AIVA 3ARSA 2J47A 1UD2A 5C71A 4NI3A 3WKZA 4LX4A 4Q22A 1TUXA 1D3CA 4U5KA 1HIZA 1W2PA 3POCA 4UQEA 3OBAA 4U31A 4PUEA 2VCCA 1EA9C 4XB3A 3VIOA 5HPOA 2VURA 2WB5A 2D0HA 3W4RA 1QI3A 2EEXA 1W9VA 1R86A 1E9LA 1CGUA 1W3JA 3QOKA 3GH7A 3ZSTA 1O7AA 4UQDA 2WCAA 4PMZA 3D3AA 3G6MA 3GNRA 3WNKA 5HDRA 3AIBA 1NWTA 2F2HA 4MB5A 2OSWA 2G4FA 4BS0A 1L8NA 1TE1A 2VR4A 1FHDA 1J9YA 2Z1SA 1BTCA 2J7CA 5LA1A 3A6OA 2YKKA 2W63A 4MAVA 4W7UA 1FFQA 3AMGA 4TX8A 5HNNA 3K4AA 2ZUUA 3W81A 2GDVA 1XHGA 4RE4A 3GYCA 1D2KA 3ZO9A 4W8AA 1XD0A 4BQ3A 1ZBWA 1SFSA 3AQUA 3MS8A 4GO8A 4AZ7A 3AZTA 4DM2A 3O9NA 1E3XA 3WNPA 1H49A 1CECA 5HBFA 4R27A 1GORA 4EK7A 3ZT6A 2O9OA 2WC7A 1KXVA 1QI4A 2WWDA 4JL2A 4B9ZA 2J7DA 4JKMA 3EMCA 1VEMA 2PWEA 5HPCA 3E1F1 3CBWA 5JBDA 2UWFA 4UOQA 2YLAA 1MWOA 3QGVA 4ATLA 3BH4A 3MSGA 1KXTA 1K9FA 8A3HA 1UYQA 5A6BA 1HJXA 2BHUA 1EIBA 1PIFA 4FLRA 2DSWA 1Y7VA 1KR0A 2CETA 1W2VA 1UD3A 4JL1A 1WZAA 5A8OA 3W6MA 4MNKA 3PZNA 1ZL1A 4QP0A 4DUVA 3FN9A 1CXFA 2IXVA 2XWEA 1E0VA 1U33A 4KMQA 5BXSA 5EMYA 4D6GA 1X1NA 2G3IA 4B3KA 4JIEA 2NW0A 2DSKA 3SCNA 1K6AA 4AZBA 3VM7A 1DP0A 3L4ZA 4AZ6A 4HPGA 1LL6A 3UG5A 2VCBA 3WD4A 2GJPA 2RGMA 1VBUA 3J7HA 5A1AA 4J28A 3WNOA 2ZUSA 5A95A 3QHMA 5A6SA 3NSMA 1WE5A 3SCSA 4W8LA 1E4LA 4P8WA 3ZJ6A 3WDQA 3CZ8A 2X1IA 1UKTA 1SMAA 3SCPA 2EXOA 3FW6A 2PBGA 3CZLA 3MMUA 2JALA 1VB9A 2J79A 4K68A 2CHNA 4E8DA 3T09A 1XH2A 4TX6A 4W5ZA 2V5DA 2J77A 4H8HA 3VNZA 1BYBA 3DC0A 4NZCA 1ZU8A 3FAXA 3B9DA 2W91A 4JHZA 1QI0A 1BVNP 3RIKA 3HU7A 4LPCA 4PMUA 4LXFA 1QNOA 4PUDA 1OIMA 1H5VA 3PZTA 5M3WA 1WZLA 2CITA 1JGIA 1MYRA 2W66A 3VIIA 5C70A 4WLCA 8CGTA 4J3UA 1W9XA 3RCNA 2A3BA 3AHTA 4D6DA 3GBDA 1BYCA 1WDRA 2CNCA 1LLOA 1WPCA 3WENA 4JAWA 3O2LA 2JE8A 4D6IA 4XUYA 3ARTA 4DM1A 2VX6A 5A6MA 1HJWA 2YDSA 4ZXOA 1R8LA 2E9LA 1ODUA 3TOPA 2CXGA 3CZEA 4H8VA 2GUYA 3VMNA 4BCEA 1QW8A 3K1DA 2YA1A 2XVKA 5FCZA 4CCDA 1JYNA 2GFTA 4D1JA 2X09A 4J3XA 1CGVA 1UR4A 3A4XA 1BGGA 3K4DA 3RMEA 3T2QA 3WD2A 3PZ9A 3OZPA 1CENA 3CLWA 1X6NA 1CDGA 1BAGA 1R87A 4BZYA 4PEEA 2VT0A 3CTTA 3VU2A 3BAJA 2D2OA 3ARYA 1UZ1A 2E9MA 1C3FA 4ATDA 1UD5A 3HJEA 5DT7A 2DH3A 2C7FA 3AMLA 2J62A 4JZ5A 3AI0A 3WSUA 4QFUA 1EQCA 1JDAA 2E40A 2F61A 2GSJA 3F5KA 3PTQA 1DWIM 4GZEA 3WUEA 2FGZA 1E70M 2CEQA 4UR9A 3N17A 1V6VA 5CJ5A 2Y2WA 3NJ3A 4HU8A 3WH5A 1Z32X 1WO2A 1PZ3A 2J75A 3ZMRA 2C8NA 2PB1A 4E8CA 1GPFA 4P7QA 3DYPA 4PYSA 4BQ2A 2DH2A 4P7OA 1DWFM 4GQQA 3BSGA 1M03A 4JFTA 2YDQA 2PWGA 4W86A 1J10A 2QF8A 3DYOA 1UD8A 5BRPA 5GNXA 4KRUA 4HZ8A 3ZQ9A 1XV8A 3SCWA 2ZX5A 1VENA 1DHKA 4PRWA 4CGTA 1J0JA 5A2CA 1HKJA 2JFEX 1Q6FA 4UFLA 4YN5A 1V6XA 4CCCA 4P7RA 2OSXA 1E4MM 2OYLA 1TZ7A 2CYGA 3T08A 5I79A 2ZIDA 3UG3A 2VMFA 1WAWA 1OWQA 1KCKA 1M7XA 3MV01 1UHVA 1IZKA 1UG6A 1CXEA 4J3SA 2DSVA 1NOWA 1FP8A 3K8LA 2XUCA 5M17A 1JF5A 3ARUA 3RILA 1BFNA 3WD1A 5ABGA 3AISA 2EO7A 3UESA 1JNEA 5CPTA 4M80A 4GIAA 1VBRA 4NF7A 3ZR6A 5DFAA 3EDJA 1CGXA 1CGTA 3VD9A 4LYQA 1OGGA 3VPLA 4BQ4A 4P8XA 4X0NA 4L4PA 4CVWA 2BVDA 2ZUMA 1PX3A 1GJUA 2OSYA 1E4IA 3MU7A 2C0HA 4GI8A 1CBGA 3L2MA 4HA1A 4W85A 4PCTA 3AS1A 5D9PA 2WSPA 3CUHA 4WKFA 1JFHA 3AIQA 5GQBA 1GQLA 1WCGA 1NWRA 1ODZA 2DT3A 4MPKA 3SCOA 1MW3A 1VRXA 4U33A 1V0KA 3BAWA 4UZSA 1HJVA 4LGXA 1DEDA 1B1YA 1E6SM 5A2AA 1J0IA 3AHZA 1C91A 2NT0A 1QHPA 3MMWA 1JD7A 1BHGA 1W3KA 3UCQA 4PTMA 2BXYA 2ZUVA 1B9ZA 3ZM8A 1W1TA 5KEZA 2WKLA 3N9KA 1NWUA 5EBAA 1E40A 1GQKA 1QI2A 3NSXA 3CUIA 4WSJA 3L4YA 1UR1A 3W53A 3BAIA 1EHAA 5E6YA 4TVDA 1JZ6A 1QPKA 1E6NA 1OT2A 1VAHA 3AHYA 4HA3A 3WBAA 4IPNB 1W9BM 3EMQA 2CBUA 1C7TA 1B3XA 1V3HA 3VGBA 4PMXA 4PMOA 2D0GA 4ATWA 3AS2A 2VNCA 2YA0A 3UETA 1VFOA 3WUFA 5IHRA 3AFBA 1MFVA 3AMDA 1J0YA 3ARWA 1XSJA 1E73M 1H09A 4KRTA 3WUGA 2RGLA 2VTFA 4X0VA 5EB8A 3EDDA 1RPKA 3UG4A 3VDHA 1C93A 1V08A 3VO0A 3NDYA 5FIPA 2IUZA 3MUIA 1HKKA 1EDGA 4JHOA 1GOMA 3HMCA 4PTWA 2WANA 3WDHA 4MAZA 4XX6A 2VO5A 3ZJKA 3UERA 4OOUA 3W6LA 1ZS2A 1GOOA 3RPMA 1V3KA 2BHYA 2FHBA 3GNPA 2PF0A 4AYSA 3VGFA 2CPUA 3ZT5A 2W92A 2WZIA 3NCOA 2VX4A 4UCFA 3AIUA 1OGSA 5DEZA 4BQ5A 5DT5A 1BPLB 2WHKA 2BY2A 5CQ1A 4YPJA 4HMCA 3WQVA 1QW9A 1LG1A 4CN6A 1EQPA 3I3DA 2BXZA 4GZJA 4WF7A 1KWKA 1KWGA 1HF6A 1KQYA 3NDZA 3L4WA 1CNVA 2OYKA 3W82A 4TTUA 2XFFA 4EKJA 3KL3A 1G9HA 2J7EA 1E5NA 4AZIA 4GI6A 3WQ6A 5LA0A 3AS3A 2YA2A 3WELA 3OLEA 2X2YA 2G3JA 4CCEA 4DUWA 4OBRA 1AQ0A 1ESWA 3RM8A 3CHEA 4FF5A 1UR2A 3OGRA 3U5UA 4PMDA 3QHNA 1C7SA 4UQCA 3BXWA 5ABEA 3WF1A 1B30A 4UQBA 3S2CA 1B3YA 4UNIA 1QBBA 1H11A 2ZXAA 4Z2IA 3F5JA 1CGWA 1KBKA 3WMBA 4NRSA 4M8UA 4JKKA 5BROA 3OG2A 4HMEA 3AZSA 4B9YA 3WUBA 1GJWA 5BRQA 3ALFA 3O6AA 4GZIA 1HJQA 3TONA 1LWJA 2CBVA 2FH6A 3S6TA 4FLOA 1PPIA 2EPLX 2XSBA 2V3EA 3KWXA 1J0ZA 5E0CA 4DWSC 4W7WA 1BYAA 2D0FA 1PBGA 1XC6A 2WVUA 2FH8A 2WVVB 3N04A 3IK2A 5FOOA 3SCQA 4E2OA 4TTGA 1J12A 2J78A 1Q6EA 2XVPA 7CGTA 2VZOA 3EDFA 1BQCA 1JI2A 1V02E 1MVYA 2XYLA 5ECUA 4P8VA 4PN2A 1XCWA 1E15A 1ECEA 1ZBCA 2BS9A 3ARZA 1QNRA 3AMKA 1G0CA 4U2ZA 3W25A 1HP5A 2WVVA 4AISA 1AMYA 1H0GA 5C8BB 4PTXA 5FL1A 1NOFA 1GQJA 2BV9A 2Y5EA
chains in the Genus database with same CATH superfamily
4FXSA 4LNYA 3C5QA 1TPWA 4DBUA 2FPVA 3RDKA 4KCUA 1VFLA 3WEZA 3C6CA 2XH0A 3VNYA 2A6LA 3CHVA 4LJ3A 3WBEA 4URIA 2CIPA 1PL9A 2WMIB 3LBCA 2W4XA 2X1RA 4XD3A 1QDSA 4MY1A 1K9EA 4NX5A 3LERA 4YLWA 3M7SA 3T42A 1LYXA 2AMGA 1FWCC 3GM8A 4RE2A 5E9AA 3PG9A 3ALGA 4M1RA 3SY1A 2O4MA 2QV5A 1V3MA 1ZBVA 5A3HA 4W87A 3LENA 4Q3MA 3VVGA 4YCOA 3CQJA 5BNKA 4YTTA 4MGGA 1UD6A 2GVGA 2QUNA 5LHFA 3C2FA 2VZSA 5KTLA 4J35A 2FLIA 4V2XA 4TV6A 1KM3A 1WKEA 1PB0A 1SFLA 2DV0A 1JNDA 3WNNA 1P6BA 3W3OA 2D2GA 4A3HA 2VEGA 3VD7A 1EWDA 3GIYA 5FKYA 3SUUA 1XX1A 3A4WA 3H26A 5D03A 1L6WA 5BU6A 4XZ9A 5D9NA 4HZ6A 2Y5JA 2H3BA 1F07A 3VD4A 3IJ6A 2PDLA 3VOCA 1OBAA 3IIZA 3FNDA 5EKYA 4HYRA 4M6UA 4HP5A 4LCRA 4JKLA 3EX4A 5JUVA 5C9ZA 1N7KA 1NP2A 3U57A 2INEA 1OGBA 1G6CA 3U7BA 1AW1A 3GR4A 3HGRA 2QUVA 4O13A 2WW5A 1XYBA 3PS7A 3C3NA 3NPUA 3CMJA 5IXEA 4GJIA 4W5UA 1O5KA 4Q4QA 4UFIA 4Y7EA 2OKOA 1DTNA 3QHOA 2HNHA 3TTOA 2XWDA 5EMLA 3OGVA 1N8IA 2PFHA 1AQHA 1OCBA 4CUCA 8RUCA 2NUXA 4YU1A 3TXVA 1W54A 3L0GA 2ZQ0A 5I3JA 1DYSA 4MDOA 2W6RA 1K9TA 1TJRA 4FXRA 1QHOA 4KIRA 2GGHA 1HJSA 4RDZA 4FPSA 3TW6A 4QAIA 2WBKA 2W9MA 1J0KA 3N14A 4K8EA 5CSUA 5A6JA 2JBMA 1TPUA 4M56A 3THDA 2FVMA 4AXNA 4DI9A 4MUZA 1UZHA 3ABSA 3DFPA 5CG0A 2Y88A 3ZFHA 3UWUA 3GG1A 2V5JA 3M0XA 1GOIA 4WRHA 2OX4A 4AZGA 3KXQA 1JCYA 3UR8A 1PTDA 1PX4A 5I5RA 2E68A 5CSRA 1HKMA 4H6KA 4G7FA 2XG9A 2YL8A 3WLPA 3UR7A 1GHRA 1CLXA 4ERIA 3VGHA 3TFCA 1K4HA 1S1PA 1GHSA 2RDTA 2QMJA 2ISDA 1JCJA 2NV2A 4CEUC 4MG4A 4Z1DA 4D6CA 4GWEA 2A21A 2XIOA 4EPDC 5JBEA 4UC5A 2FHCA 4MLJA 3NQ6A 1XBYA 2INZA 1JZ4A 1YNPA 2ZE0A 1A5UA 1Q65A 7TIMA 1B4EA 4GFIA 1KGUA 2ZZ7A 4GYJA 1O5XA 4JOMA 1XD1A 3C0QA 5JH1A 4FP1A 2XM2A 4HZ7A 1O1HA 3D5HA 4F2BA 3TX9A 4LUSB 1EYEA 1V03A 4PCNA 1H7WA 3VFCA 1HP4A 3QSTA 4Y9AA 5AHNA 2ASHA 3VMPA 2PC8A 3WDJA 3CMGA 3CZKA 3NUKA 3IJ7A 3TTEA 4DBEA 1PCKA 4AB4A 1YHTA 5I78A 5BMWA 4E6MA 3FGCB 2VVSA 3LNMA 4RNIA 1X6LA 1W1YA 4AZ5A 2AOSA 4HOZA 3D0CA 1MZRA 1PV8A 1LLWA 3R0KA 2TPSA 1WXJA 3OZYA 1O94A 1OD0A 2NT1A 1A49A 3MBDA 4JQAA 4M24A 3VZYA 1JULA 3GB6A 3NNTA 4HHLA 2E5BA 4QEHA 5L9FA 4C7GA 4NASA 5RUBA 4I9TA 4UR7A 2OELA 3C2EA 3WFZA 1OSEA 4DWSA 3M0HA 1QPRA 3BGAA 2OGYA 3PY2A 5J04A 1R3TA 3PTMA 4U5IA 5GNZA 2XFWA 1E1EA 2XZ7A 1ISVA 1UKSA 4GYPC 1LUCA 2PTZA 3FHAA 3BGGA 2VX5A 2YW4A 2YZRA 4MNLA 1FTXA 1E56A 4H7ZA 4RKAA 3UY7A 2BHZA 3VIGA 2VEPA 1UMYA 3BOXA 1UZDA 4TUFA 1SQ7A 2PDNA 3L0NA 2F38A 4L6OA 3LV5A 3RLUA 3VD3A 5TNVA 2CWNA 2XTKA 1SO3A 3WIJA 5DMNA 3CUJA 1CGYA 1P7TA 1W91A 4A3UA 5C9XA 4AWTA 5FEWA 3WQEA 1H51A 2CLOA 2OEJA 1OCJA 2DFAA 1FXQA 3AZRA 3BCDA 3GYEA 1QWGA 2IW0A 1AD1A 3BJFA 4JS3A 4J7RA 4QHRA 3ZXWA 3RJYA 3GVRA 4ZSTA 2PDBA 3QOMA 3V35A 5K4ZA 3I7RA 3LA4A 3SR7A 3CYJA 4GIRA 1Y5XA 3A9IA 3MHGA 1FWNA 1JFXA 1VFUA 4ACZB 2YBTA 2PD5A 2QJHA 1KRBC 3SCVA 2WMKA 3B40A 1QHZA 3S1XA 3EWXA 3BUVA 4JTFA 3EWWA 2A3EA 3DECA 1TE6A 3C86A 3ZOAA 4Z17A 1EDQA 1V4YA 4CU8A 3U2EA 4AQLA 1WKFA 4RNFA 1WDSA 3A3HA 3CWOX 3HQNA 4ILSA 3IS4A 4I7WA 1JZ5A 3VD5A 1VLIA 3LB0A 2PS2A 3L68A 4C6EA 3EZ4A 4RCXA 4S3EA 5AHLA 1EHNA 1TCMA 3TCSA 1M01A 3IJQA 3W7IA 5U7SA 1F3XA 3OVGA 1EJ7L 4HJFA 3OIXA 4PTVA 4EP8C 3CO8A 4GVIA 4X3ZA 4GY0A 2KX9A 3NEVA 4OU1A 1JYWA 7TAAA 1UP0A 2UZ9A 3I6RA 2PUZA 1XLGA 5AYZA 2FJKA 1F9CA 3II1A 4PGLA 1SJDA 3G22A 4Q8OA 4ZB5A 4LEFA 3HPFA 1JAKA 3VOHA 4EANA 1FWBC 1KM6A 3N6JA 4MTVA 4GXPA 3OZOA 3RUBL 3WH6A 3PVFA 3URBA 2IXUA 2JGQA 3SN0A 2IKGA 4QTGA 1OFQA 3VDBA 4DAIA 4YIWA 2WHJA 1K8ZA 3CB3A 2OQHA 3QPZA 2VUNA 1LG2A 5ENLA 1T8QA 1UPPA 1YDNA 2OO6A 4FNPA 1RQHA 3GXTA 3KZSA 1YBQB 4HCLA 4RE0A 2QXWA 3B0UX 2WQPA 2NSOA 5GJMA 4FR1A 5KSWA 3HO8A 5LGXA 4ZFMA 4NZJA 5B7YA 1S2VA 3CHCA 4LTSA 1EF3A 1GWJA 3E12A 3VMOA 7A3HA 1I0DA 4LU0A 1HGYA 3W26A 1TVPA 3NOYA 2W79A 5I0DA 1W3TA 3IAPA 2QIWA 1EJVC 1PDYA 4GO9A 5E70A 3I65A 3L4UA 3NWRA 4JIQA 4PTDA 2RDWA 3SURA 2G5WA 1TSIA 3H55A 3QFEA 4LVAA 2Z1KA 2GGGA 1RLDA 4I9JA 3G18A 3F4VA 4IIEA 3R0UA 2D1ZA 5G2IA 1AUSL 1V6WA 1LOQA 2ZXDA 1MXDA 3AXIA 1L2QA 3EA2A 4POCA 2ZRWA 1E55A 3UXKA 3G8RA 2QGYA 1H1NA 5HNTA 2ZICA 4XZNX 3THCA 4CKQA 4LALA 4O12A 1P6CA 4AD1A 4TMBA 2XFRA 2XGBA 2CLFA 3LCLA 1YMYA 1B0IA 2C16A 3GTXA 3E9AA 5KINA 2ZWYA 2ICSA 2DZXA 1E4NA 3LPGA 3VIMA 2BMBA 1PIGA 1ONRA 4WDTA 4U3AA 3S1GA 3MB9A 1V3IA 4AWSA 1ME8A 3EDEA 3OPSA 3EKLA 4JQ4A 1KQZA 3SCUA 3PZOA 1FWGC 4E38A 4KGLA 2FVLA 3MV11 1WDDA 4EPEC 4AEEA 1ELSA 2RUSA 3WLSA 4ZB2A 2PGRA 4IF2A 2PDYA 2J4GA 5AZ1A 1XCFA 4TVCA 2GJRA 1AL7A 1W5QA 1J01A 4FNRA 3URQA 2VD9A 5AHFA 1IF2A 4AC7C 5CJMA 1IV8A 2ZUTA 1E6QM 5EGRA 4UTJA 3GTNA 3OZMA 4DJED 3IJ8A 1YKWA 4FNTA 3N73A 4DF2A 1LBFA 6REQB 3RM4A 2V63A 3POHA 3CV6A 3H21A 1OY0A 1VCFA 2ZDRA 3VINA 1CXIA 1PZ2A 3A47A 4ZEPA 1TPC1 5T9BG 1WP6A 1KTNA 2VZUA 1A47A 1KLYA 4OGZA 3PR2A 3GU1A 3GW3A 4XIAA 3UCDA 3GQYA 2VR5A 1CXHA 2EJAA 1XLBA 4HGXA 1SW3A 3CM4A 3CQKA 3MWCA 4CD8A 2DJXA 1NAL1 3SUTA 5FF4A 4XVDA 4Z2GA 1FRBA 2Z4GA 1ZLPA 1XICA 4A8NA 4AIEA 1JYXA 4GIYA 2AQWA 3AJXA 2NXIA 1EEXA 2WPBA 4LT9A 2Z1VA 5EA9A 3L23A 3WLOA 3LPPA 3LXBA 1Q6GA 1CLVA 2QIIA 3NQMA 5K3VA 1F8MA 3NIYA 1DIEA 5CBBA 3GDBA 3AYRA 2QKFA 3GZAA 2GOUA 2E28A 3AC0A 5IFTA 1B90A 5FJIA 4HK5A 2I5IA 3HPAA 1E6PA 5ECVA 2VZTA 1W32A 1TVNA 2R1KA 3DHUA 3GNDA 1O68A 3W1XA 2QDGA 2HVNA 2F9RA 2WJEA 1JCXA 1X38A 4AYGA 2UY3A 2VYOA 1SPQA 4JTLA 3MUAA 3SRHA 1OIFA 3RX4A 2Y70A 1SO4A 4D72A 3CU2A 3FHQA 2VL4A 2A2IA 1TRIA 3W7LA 1UWTA 3WQ8A 6ALDA 4Z1CA 5A6BD 1RQEA 2DW6A 3PNUA 3SW6A 1RCOB 3K30A 3UCCA 4NXSA 4UOZA 1FH9A 2IKIA 2FDSA 3WEOA 1XLMA 3WLQA 4R7WA 1J11A 4UMAA 4UQAA 1KTBA 1HJUA 3UG8A 4F8XA 1VYSX 3KRBA 3VCCA 3Q65A 3MT1A 1KNWA 5MF5A 4AD0A 4WHBA 3VKKA 2ZZ6A 1VRDA 1XYLA 4LBRA 4I7UA 3HV9A 2PWHA 3RR4A 1JUEA 5LIUX 4M81A 2YZ5A 1FXPA 4JEQA 4O50A 1EGZA 1IWBA 4GGHA 1AZ2A 4NQ1A 1TZZA 2WBGA 4FR6A 5CGTA 1CPUA 1SZFA 3W38A 3MKKA 3VNIA 3NZPA 5TF0A 1T96A 4Q6XA 3QV8A 1O66A 4Y2WA 3MMTA 1SYTA 1TMHA 3WLRA 2ZX9A 5FF7A 3MKVA 4F0MA 3F03K 2SFPA 3MSDA 4JBRA 4JN8A 4P61A 3VGGA 3LOTA 3APTA 3TW9A 1H50A 1TCDA 4E4PA 4F79A 1K7FA 4A35A 3B97A 2QJNA 4R9XA 4IGSA 5AB3A 1WZMA 1IHIA 2YJQA 5A8PA 5C7VA 4NJHA 3DOPA 2EG6A 4UZUA 5IDIA 4K36A 2VRJA 2OT1A 1YQ2A 3WLMA 1W3LA 5IBXC 3BAYA 2F6UA 3LUTA 2E6AA 4GGBA 2BFGA 3IRSA 3VGEA 4AH7A 4MNJA 1EJUC 1XIJA 4HVXA 3GFZA 3G0SA 4IMGA 3GAYA 4DO7A 4IM4A 2B4GA 3WFAA 1K1DA 1RBLA 1EX5A 5CSYA 3TTYA 1EOKA 2YIHA 1V8EA 2J8GA 4LRSA 1IR1A 2VC5A 1H63A 1SVDA 3TLLA 4PR4A 3UZJA 2YDRA 4WIWA 3NEHA 1JUBA 4PMQA 1XIGA 2XN1A 4HNNA 3V7PA 4JDYA 3W7PA 2J6XA 4ZR8A 5I23A 3GHSA 1VH7A 1KKRA 3EB3A 4HB7A 1C8VA 2ZX6A 1TG7A 3GU9A 5CKSA 4ERGA 1SR0A 4JQ2A 1RY8A 3O63A 1U1HA 2WSQA 3DG3A 1R0MA 4Y96A 3UXIA 1NVMA 2DT0A 1GVYA 2YCLB 3ARSA 3DFHA 1GPWA 2J47A 1UD2A 5C71A 3LSCA 5FJUA 1H7PA 1NF0A 4IFKB 4F0LA 4Q22A 4HT3A 4UBPC 1I45A 3UZWA 3CUZA 2P0IA 3UR2A 3W9ZA 3ZVHA 4AMAA 2OX1A 3PBYA 2AGKA 4PUEA 4DVOA 4XB3A 3RMJA 3GK0A 1A0CA 2WB5A 3VNDA 1XLIA 2GGEA 3W4RA 1KCXA 3BQ5A 5T9CE 3P6LA 1EC8A 1W6TA 1W9VA 1R86A 4DXVA 1A5AA 2D73A 1LP6A 2Q8ZA 1W3JA 4PUNA 3UWWA 1FWIC 3QOKA 5CCZA 1MEHA 1EB3A 3T7VA 3R58A 1NFGA 3CJPA 4LANA 2F2HA 3WLTA 1S3HA 2G4FA 4BS0A 1TE1A 4AXKA 1K6WA 1FHDA 3NO1A 1J9YA 3PSWA 5LA1A 3A6OA 2YKKA 3C8NA 2VFIA 4MAVA 3AMGA 4UTHA 1OG6A 5HNNA 3K4AA 3CB8A 3CTLA 2ZUUA 3GAKA 3LYEA 1TJ2A 2GDVA 4RE4A 1D2KA 5D38A 3HQOA 4DUOA 1JCMP 3GTIA 4GNKB 2POTA 3WNPA 1H60A 1GORA 1KLZA 4PC8A 4B9ZA 4RNJA 3CASA 3R13A 3VE9A 3CBWA 4IH3A 2Z2UA 3PBVA 3QMTA 1U22A 4ATLA 1E0UA 1FDJA 3MSGA 2PLCA 4XTDA 4WDXA 8A3HA 4C1LA 1VBJA 5HR7A 4FLRA 1PIFA 1F73A 3MWAA 5EBUA 1W3NA 1UD3A 2C79A 4JL1A 4QJ4B 5FESA 3W6MA 4MNKA 2X7WA 3MI2A 3M16A 2Z25A 3DBNA 1DVJA 4QP0A 3NPVA 2IXVA 2IS7A 3L66A 2HCVA 4OUIA 4D6GA 1GKQA 2G3IA 2R1MA 2RHGA 4R53A 2DSKA 2DUXA 1DJQA 3IJLA 4AZBA 1D9EA 3CAWA 2FYMA 1WBJA 1LL6A 3UG5A 3TAOA 2VCBA 1KRAC 4PH6A 4G8TA 2GJPA 2RGMA 1L6GA 4Y6GA 2P76A 2ZUSA 2VEKA 3A23A 3QHMA 5A95A 4BI6A 4F0RA 2OMAA 3FA4A 4W8LA 3E74A 5F1VA 2PU0A 2YGYA 4P8WA 3CZ8A 2OODA 2BBFA 3LDVA 1UKTA 1TIWA 2E6DA 3SCPA 4A8LA 3ME3A 1BSLA 3FW6A 3CZLA 2ZA1A 4W5ZA 3QN3A 3SZ8A 3K5XA 2NXHA 1BYBA 3EKZA 3DC0A 3SO7A 1VHNA 3TQVA 2W91A 4F2UA 4JHZA 1BVNP 1QPQA 2AL2B 3HU7A 3RIKA 4C1NA 1EA0A 3GHTA 5F2LA 2Y0FA 1QNOA 1XM3A 1UJQA 4LXFA 4PUDA 4PODA 5K9CA 1NDYA 2ZRUA 3PZTA 3BLOA 2H6RA 5DQPA 1TZ9A 4FX8A 3V0TA 8CGTA 1W9XA 1RBOB 1BVWA 1NF7A 4E0CA 3CK5A 3HG2A 2ZDSA 1JPHA 5KITA 4JAWA 3EWCA 4CQDA 1QFEA 3BV7A 3MHFA 1HJWA 3W7HA 2HE5A 3IJDA 3TN5A 5FAGA 2X09A 3A4XA 3FDGA 1BGGA 2NQ5A 1GVRA 1CENA 4DBDA 3QBUA 2QW5A 3MC5A 3GTHA 1R87A 4R3UA 1VR6A 3P0XA 3LG3A 2VT0A 3VA8A 1UUMA 2Z1BA 3UJ2A 3HF3A 1GKRA 4TV5A 4AG0A 4JYDA 3L2IA 1MUWA 3PB0A 1C3FA 2DVXA 3HJEA 1WUEA 1KFJA 2YXOA 4K1GA 2FFIA 2C7FA 4JZ5A 1IGWA 1U5VA 4QFUA 3CL8A 2X41A 4JIHA 1B9BA 4GZEA 3WK0A 2IQTA 2FGZA 4DWDA 3HIJA 1AH4A 4O0QA 1V6VA 5CJ5A 2Y2WA 1S5VA 4LC6A 3COTA 4XD5A 1PZ3A 4E8CA 2AMXA 4A21A 3B9NA 1OC6A 1F6PA 3BSMA 4GZ7A 3ITYA 1A53A 4MVAA 4ZSUA 1VQTA 3LN3A 4Q8WA 2B7OA 2DH2A 1DIDA 4LYKA 2YDQA 4QISA 1LOSA 4W86A 2VFEA 1J8VA 1W1ZA 4CNOA 2O7QA 1Z89A 2PDIA 1J10A 2B81A 3BW3A 3UBPC 1PTAA 5GNXA 1ICPA 4HZ8A 3LI1A 1G4SA 2QYGA 3ZQ9A 1KO0A 3QQ0A 3SCWA 1SO5A 2QCDA 4JYEA 3W1MA 4GYKA 2JFEX 3M0KA 1UUOA 2OSXA 1E4MM 1X97A 3T9PA 4IT1A 1KCKA 4Q8NA 3MV01 5CGQA 3PF3A 3KOZA 4O1EA 2CW6A 1POKA 5CG7A 4F0HA 4AUBA 1PDZA 1FP8A 5M17A 1JR1A 1BFNA 5ABGA 4JTAA 3BICA 1DXIA 2FQIA 2GUBA 2HQAA 3RRXA 1JNEA 3UESA 1XBZA 3UWVA 3G1DA 4XBKA 4GACA 3W01A 4BF5A 5C2XA 1KA9F 1TV5A 3DENA 3ZWSA 3VPLA 4BQ4A 4P8XA 2J13A 1S1RA 2NVDA 4X0NA 5C7HA 1OC7A 3MYOA 4L4PA 3KP1A 5BRBA 3IIOA 1E4IA 3MU7A 3SADA 3L2MA 4HA1A 3INPA 3WO8A 2PODA 4RDYA 2WSPA 3NQDA 3ELFA 1M7PA 2HPIA 2FB3A 3AIQA 5GQBA 3N3TA 4ZO7A 1IWAA 4LS0A 2PP3A 2DT3A 2A7PA 3ENLA 1VRXA 4WR3A 5EU9A 3W85A 1NQKA 3FA5A 2Q09A 1HJVA 1KM5A 3FJ4A 3NZGA 4O4VA 5CZSA 3GDKA 3IACA 2HWGA 1J0IA 3W7OA 2F2KA 2HBVA 3MMWA 1BHGA 1W3KA 2BXYA 5KEZA 5CC5A 4H6RA 5EBAA 3CWNA 3W53A 2EKCA 4CQ8A 1F3WA 2PC4A 4REQB 1XBXA 3EXSA 4Y8FA 1EX1A 5H8UA 1SUXA 1E6NA 3MUXA 1GZ1A 4HA3A 3W2KA 1OX6A 4C6CA 3BJTA 1V3HA 3KBJA 2EKGA 3V3WA 3R25A 4PMXA 1YPFA 4ZODA 3AS2A 2VNCA 3UETA 5IHRA 1MFVA 4PZVA 1L2UA 3TQKA 1R9ZA 1E73M 1PXGA 3BW4A 2PRHA 3FIGA 4KEUA 5CC7A 3VC6A 1PE1A 5EB8A 3CV2A 3VO0A 3GTFA 3M0JA 2IUZA 3MUIA 4JHOA 3QTPA 4PTWA 2DQWA 1KM4A 4I5UA 2VO5A 3W1TA 1TPFA 2KZHA 2OEKA 1V3KA 2BHYA 2E67A 3D47A 3TU9A 4GI4A 4GC4A 4NU7A 2GZXA 2R82A 3OA3A 1TJ1A 1M68A 4DF1A 1AJ0A 4A3QA 2NZLA 4A05A 1HO1A 1PYFA 4MYXA 3V16A 5DCDA 1YDOA 4PBFA 2P5NA 4N9EA 2WJFA 1G69A 3PBWA 4R88A 3KL3A 1TYGA 1G9HA 5F2MA 4ICCX 4KCWA 3WQ6A 3VNMA 3GR8A 1KRMA 1ZP3A 3AS3A 3OLEA 2R8WA 3U5UA 1P1XA 3QHNA 3UWEA 1VBGA 4UQCA 3RO6A 4E4FA 1CT5A 3WF1A 3W76A 3LGGA 3B9OA 4J1OA 3QR0A 2CU0A 5HULA 3H4GA 2GGIA 4Q8PA 2VGGA 4NRSA 4M8UA 5BROA 3OG2A 3U48A 4S2BA 1I60A 1RK6A 4XKYA 5BRQA 1YPIA 3ALFA 1HJQA 3TONA 1LWJA 1KTCA 2CBVA 2I9EA 4ICMA 2EPLX 3H4WA 3W2UA 3W71A 1J0ZA 5E0CA 1JPIA 2NX9A 3GG8A 3CPRA 4PBEA 3LX9A 3IIXA 3NPWA 2P88A 3PFRA 4XWUA 1XC6A 4BY3A 2PDUA 1UPMB 5FOOA 2Z2BA 1KKOA 2J78A 5HQMA 3EDFA 2PE4A 2WKJA 4LUTA 4M7SA 1GK8A 1FCUA 1MVYA 1Z42A 2XYLA 4IPJA 2BB0A 5ECUA 1RBAA 3IIVA 1ECEA 1AMKA 1P5BA 3NG3A 1HP5A 1FWRA 1IXNA 3M1ZA 4PTXA 4KEZA 5HWNA 5FL1A 1NOFA 4WY0F 1WOBA 4DIAA 1HT6A 1ZRQA 1XLAA 1RUSA 1GTEA 3REQB 3WD3A 1R3QA 3UT0A 4DWSD 1WBHA 3PWGA 3P67A 3CH9A 3PTKA 2D20A 3TMLA 2J7GA 3T2PA 1LCOA 2BGQA 1P0NA 1ISYA 2FJUB 3SECA 4E3TA 4Q8MA 1W1VA 2E3ZA 1Z6KA 4B5WA 3H12A 4HPHA 4XO6A 4L65A 2BY0A 5F4XA 1JXKA 4HNLA 1Q4NX 5A2BA 3APYA 3WDIA 4ADSA 3E6EA 2QJGA 2V0TA 1DWAM 2WMIA 4PMJA 1CXLA 1I2NA 3CGTA 2WVSA 3BMWA 1FWAC 3OVQA 3E0FA 5LNRA 3PAOA 3VNLA 3S6OA 1VJIA 3R79A 3GBEA 1I2RA 3SUSA 3USBA 1EGMA 1NH6A 4U10A 1HKWA 1OINA 1ISXA 3QF0A 1ZSXA 3P8JA 4ML4A 1MRQA 2XPKA 2YFOA 4B90A 1IXQA 3WQDA 4Q8TA 3KBMA 5IHSA 3HTWA 5DO8A 3SIMA 3F2BA 3B03A 3NAVA 3W22A 1F2JA 4CD7A 4X9YA 2JKPA 5IRPA 1H41A 3EDKA 1FOBA 5CGMA 1Q13A 5A8QA 1F3TA 2QR6A 4Y9NA 3H24A 3JZUA 1VC4A 2E8YA 4OOZA 4L6HA 4PB5A 5BXPA 1UA7A 2ZUNA 4H83A 4KIEA 1J0HA 1DQXA 4MB4A 1LOLA 3HFTA 4Q4KA 4DO4A 4K38A 3GKAA 1YXYA 3IAQA 1O95A 5DY2A 2WCSA 3QSRA 2DUAA 2QCFA 4JTEA 4O18A 4JNYA 3WFLA 3DFOA 4LF2A 2IPFA 3QEZA 4EOUA 4BWLC 2DVUA 4S39A 2GPTA 3N3MA 3K8KA 3R12A 2VDHA 2E0PA 3CZGA 2AKZA 4AFYA 3GHUA 4F3HA 4A8IA 3K2GA 3AICA 5FAJA 4UMBA 3BLPX 4WDWA 4B92A 2B7QA 4L61A 4HNUA 3A3XA 3APGA 3W7JA 3A4AA 5CAKA 1HZYA 5TAOA 2ZWZA 1R9XA 2AQOA 4N7QA 3U3HA 3LEPA 4NNBA 5FF2A 5I09A 3K46A 5AECA 4S3AA 2DQXA 4TOQA 2VFFA 3GXIA 4E5TA 3M0YA 2QUMA 5FJPA 1KFLA 3RFAA 4QQUA 5AZ0A 3U2CA 3IJIA 4EPKA 4A8RA 1OM0A 5BU9A 4H9TA 4I6VA 2VGFA 2Y1HA 5D9OA 2ZOXA 3DHPA 3I3BA 4TO8A 4HNVA 4UTTC 2CWXA 3W1AA 3HG5A 2YOCA 2OWCA 5C9WA 3BMVA 2QDDA 2W5FA 1YPXA 3AHVA 1PX8A 3P62A 2BGNE 3QW4B 3WLIA 1LQ0A 1OX4B 2PDHA 3D46A 2DUZA 4ZXLA 3TNOA 3EWBX 2PDCA 1K77A 3LD5A 2NQZA 4G1KA 1FWJC 1W1IE 2OLHA 1W5PA 3ABXA 2CBIA 1A0EA 1ZALA 2V3DA 1C92A 3VTRA 2OFJA 3OEXA 2E4TA 3ZVIA 2YL6A 3BC9A 4OWGA 1JZ7A 2XH2A 2A3HA 4Y8EA 1RP8A 1XUZA 2BX7A 1TTIA 3EOSA 4A22A 4NIRA 4XV0A 5HJXA 4WY0B 3IJ9A 1XH0A 4H41A 1KD0A 5EFFA 2JF7A 3LHUA 3MANA 4TR9A 4NX0A 2IPWA 5I24A 5I2UA 1RHCA 3FEQA 3B4UA 4LAUA 3ZIZA 1TTPA 1OFAA 4MJ4A 1Q6DA 4CEXC 4LUSA 1ZJBA 3W02A 3N2CA 1M7JA 1RA5A 1UQZA 3TKFA 1XIMA 4PULA 3LQGA 3WDPP 3PPHA 4RL3A 1VPYA 1VS1A 2PD9A 3O16A 1UH4A 1TWIA 2J66A 2NX1A 3W1QA 3H4XA 4F9JA 4KF1A 3P14A 4LCSA 5A8MA 4Q8UA 3FGCA 2D24A 4YXGA 4GXWA 3EWYA 1XRTA 2CCRA 1UB3A 4JN6A 3G3DA 1G7UA 5DXYA 3B9EA 4YTRA 4D71A 5FA5A 4YVXA 2Q01A 3CIXA 4BK9A 3NL6A 1QATA 3LRLA 2XVNA 1NTHA 1OF8A 4CQ9A 1GVFA 5CPQA 3W2MA 1K8YA 3WL0A 1N55A 1UR9A 3NQFA 1E0WA 4W84A 3N2XA 3VZXA 3HGSA 2PBOA 3S83A 5AVNA 1SZRA 2QCEA 1YNQA 3HQ1A 4LB3A 1US3A 4AY1A 3AAMA 1QCWA 2GSHA 2P3ZA 4IXXA 4RUBA 4XZWA 4ACYA 4UFMA 1ME9A 3G1HA 1JDEA 4RJEA 3CIVA 2PRLA 3AMCA 3HFYA 3PBGA 1UR0A 4PCPA 3GFYA 4I6KA 1VBHA 3LM3A 2A4AA 5LIXX 1XYZA 2CLLA 2HK1A 1YDVA 1C9WA 1KM0A 5C5YA 4RV3A 2C91A 3DYMA 3PTDA 1PKMA 5D9MA 1DXEA 3SQMA 3DEQA 4I3GA 3SGZA 4GIEA 5GNYA 2PWFA 5HANA 2PGEA 4ZQNA 3TWAA 1GVEA 1JPMA 4IQLA 4O17A 2BGSA 4N6EA 3E5PA 2W61A 3RM9A 3I4KA 4LY8A 5CLTA 4B5TA 2VFGA 3VX0A 4ACZA 5AOUA 1MO0A 4R7JA 1RH9A 3NVTA 1HL8A 5KETA 4OZOA 1XIIA 4GX8A 4B5NA 4CNPA 2PF8A 3PZQA 4US6A 3LV6A 1HQTA 3R94A 2ESCA 2JIWA 5AY7A 2PGFA 4FO4A 3W29A 1TR1A 3TZFA 4BI7A 4MADA 5LZLA 1KBBA 2A5HA 2PTYA 4JIIX 1Q6LA 3CHFA 1CXKA 2VUYA 3I3EA 3UYCA 2OR2A 1BD0A 4US5A 4XSMA 1VGAA 3W37A 4NJJA 1EZWA 4I9AA 4MJMA 2FHFA 1FHLA 1OT1A 5A8NA 1FY6A 3HG4A 5AVHA 1V6UA 4UTIA 3W83A 3FYPA 1OHLA 4AWEA 4DXKA 3WF2A 3YPIA 9CGTA 3G3MA 3MHUA 5AC5A 3NL2A 4CNUA 3M0MA 2GJXB 1VLWA 4LV4A 4LUYA 1TJ0A 4DYJA 3UW6A 3W2JA 5KZMA 1BSIA 4H4IA 2REQB 2A7RA 2PWUA 4AY8A 3W84A 4KH2A 3U2OA 1EJSC 5HWJA 4CVUA 1NOUA 1OFOA 1JGMA 2FZBA 2CBJA 4XKMA 3GG0A 3WK3A 1RA0A 3CHDA 3I4EA 3QZAA 3GVWA 4DI8A 3W24A 4UTFA 1QT1A 3LGDA 4IMCA 2G41A 4ZENA 1B3WA 1YBQA 3QYSA 2J25A 4X22A 4GINA 3B9AA 3BLIA 4UTKA 2XJ7A 1F8IA 1Q6RA 3M0VA 3CUFA 4GOAA 4DBWA 3HMJG 5G5IA 2C3ZA 1ITCA 2NLIA 1H2JA 2E9BA 2WHMA 1CYGA 5DX7A 2NLYA 4LYRA 4ZOCA 1TWWA 4QS5A 2FGBA 2XVLA 2NQLA 1XIHA 4JICA 1KGXA 3ABZA 5BWFA 4MLRA 2BY1A 3GZ3A 3UU0A 2GK1B 3GDRA 2VP8A 4UFHA 2PP1A 3KWSA 3KS5A 2RFGA 3RR1A 1KXQA 3C2VA 1HX0A 1BRLB 1ZAHA 3CAKA 4IP7A 1ICQA 1V7AA 1WOAA 3NFUA 3NVDA 3ZSSA 3AIEA 2DT1A 3IVUA 4OV4A 3T1GA 3GG7A 1AL8A 3WNLA 2ZZ4A 3LGEA 3WH7A 1WA3A 4WK9A 1PSCA 3WN6A 3H2FA 1EDTA 2QNEA 4PCFA 1UBPC 1WYIA 3AU2A 3L4TA 3GKFA 4QQ3A 4D1IA 3B3DA 4GQGA 3A64A 3RAOA 1GOKA 3VXGA 1VIZA 3W72A 1LORA 1MQRA 1FHUA 2PZNA 4IGHA 1O1ZA 1TREA 4C6LA 4C91A 3AYTA 1QNVA 3UNDA 1Z48A 2DIEA 4GG9A 4MFEA 4HZMA 3KLKA 5AYBA 4QLKA 4IJRA 3U5YA 3CUGA 2G3MA 1R6WA 4F66A 5BCAA 1UH2A 2O9PA 4CN1A 3BG3A 1QASA 3DERA 3MPGA 3DCPA 2DZUA 4KWOA 4FXFA 1TV3A 2ZA2A 3Q4DA 3B0VC 2R94A 4DAFA 4D6EA 3VNKA 3GNXA 4H9ZA 5A94A 6REQA 3WQOA 2WYSA 3PZMA 4B2DA 2POZA 3OIHA 3BV4A 4JGDA 4AU0A 3SEPA 1W3HA 3RNDA 1KBLA 1WQ5A 1UZ4A 1E71M 1H7NA 1YXCA 3T40A 4AZCB 2D3NA 3TZNA 1S2WA 3PZVA 3ONBA 5I3DA 5CZKA 3LPFA 3P84A 5FD0A 2CZ5A 1S5TA 1JXJA 4L1WA 1AW2A 1E1FA 4GHRA 1GQIA 3SM0A 2CHOA 2RKXA 3KS6A 2WMHA 4GYPA 2V38A 4GD0A 2X0HA 1X39A 3NQEA 1EBHA 3A12A 2QJIA 3KUMA 2GSEA 4HSHA 3T78A 4O4WA 3QC3A 3AU6A 2QHAA 1C90A 4L64A 3LNPA 4MM1A 1H4PA 3OODA 2XN0A 3LS9A 2QCCA 2WHLA 2Q8XA 1NY1A 3HBLA 2HS6A 2PURA 4CU7A 2NUWA 3P5YA 2Y5SA 2PDFA 1FFRA 8XIMA 1ADOA 4EWJA 1NIUA 1I2QA 4GC3A 4HPXA 4AD4A 1KFBA 7ENLA 3P61A 3W70A 3O0FA 3ITXA 4WKAA 2QAPA 3N2TA 5E9XA 1CIUA 5I6SA 1TV7A 2Q8LA 3GH4A 2YSWA 3DBPA 1T5AA 4WZHA 2NX3A 4K7VA 1R7OA 3G1FA 3FXGA 4H9XA 4QLLA 4RZ4A 3P8IA 4RZBA 4NG3A 4CQCA 1XINA 1FBAA 2IKHA 3IANA 2WLYA 2WSKA 1CTNA 3W0KA 5BXRA 4KEMA 4ZE4A 2A0NA 2YCJA 1LWHA 4WGHA 3BLKA 4QSFA 3IVSA 4M51A 3SUVA 2XDFA 1S2UA 2NWRA 3NQAA 1NDWA 2C6QA 2PGWA 3ARXA 2BOFX 3UA3A 4UIOA 1PS9A 3BTNA 3WQPA 4A3YA 5D32A 4KQNA 1H3GA 3W75A 3A24A 4MB3A 2V81A 1NM9A 3WZ0E 2G8ZA 3IV8A 3CAQA 1PKYA 6A3HA 1D7FA 5EFDA 1PKNA 2WKGA 1F4AA 4U3CA 5DMMA 3KL5A 1E43A 1V0MA 1AFSA 1TWSA 4JTGA 3H7UA 2Q3OA 3M44A 4HD5A 2XIMA 1LT7A 4G9PA 3H2OA 4B16A 1NELA 2PU1A 3M47A 4LBSA 1IXOA 1ZZMA 5K4XA 3O05A 3S2JA 1EKOA 1EO5A 1UASA 1UWRA 3BARA 1YADA 1XYAA 4HSNA 3R1ZA 1GOQA 3LCXA 1RSCA 3SN4A 4RXFA 4L56A 3LLDA 4K2SA 3WH9A 4KT2A 1M7OA 1DHPA 4Q7NA 2D22A 4LEQA 2YYTA 4H8NA 4O52A 1BVZA 1UH3A 3GFXA 2VEMA 4OQVA 4ZO8A 2XIQA 3DFNA 1UOZA 3OO2A 1P0KA 2QPSA 4QDMA 1JL8A 2OZ8A 2DPEA 2AL1A 2DZSA 1FH7A 3ICJA 3VAVA 5DF0A 3V75A 2WNWA 1NDZA 1MDLA 5H91A 3UP8A 4JTIA 4KGJA 1Q6OA 3TSMA 1X1OA 1X96A 4FIQA 1P0DA 1EXPA 1TPVA 1XFCA 3NZRA 1AQMA 3B8TA 4H7CA 1CLKA 4GVFA 1J6OA 3ABOA 2QQ6A 2GJNA 4CD6A 3VX1A 4UTWC 1LROA 4MNMA 1UWUA 3TW7A 5AHEA 1K8XA 1M5WA 2E6YA 1C8QA 1S38A 2PCQA 4CNSA 1ZCOA 3WH8A 6XIMA 2LLEA 3WCZA 3DC8A 5E1QA 4D6FA 1D8WA 1FHVA 2ZUWA 2J8FA 3U8GA 4L9XA 1TELA 3CIWA 3S9ZA 4MPQA 5C54A 3KDOA 3M6YA 3T8LA 4LX4A 3BLDA 2ATMA 3DUGA 1T40A 3EWUA 1TUXA 4YYFA 3PBMA 4U5KA 1FWTA 3N9SA 1OFRA 4EWND 3CL6A 4IX0A 3SFKA 2YCLA 1F05A 3LRKA 1RV8A 4U31A 1GKPA 1XYCA 3VIOA 1J5TA 4TU1A 3W7CA 4IFKA 1F7BA 4IOTA 4I7VA 1QI3A 1EL3A 2ZC1A 4JIPA 1EJTC 3GH7A 8XIAA 1O7AA 2DU2A 2PWVA 1F61A 4XSLA 3TFXA 1AJZA 4RDVA 1SSDA 3O6CA 2CZVA 4XBJA 4QE4A 4YJ5A 2O56A 3E0LA 4ZQOA 2J7CA 4L7ZA 5C55A 3L65A 3P81A 5HMDA 3KOWA 3RYSA 2Y63A 1N2VA 1FFQA 2X2GA 2IPGA 3E0WA 5BOFA 3H2AA 3W81A 2BWGA 1XHGA 1XD0A 4JTDA 4BQ3A 3W2NA 1BKHA 2I14A 2YPIA 4LUTB 3R2GA 2YXXA 4QIUA 4GO8A 1HGWA 1QJWA 1XIFA 3O9NA 1H49A 3TQPA 3O1NA 1OCNA 3ZT6A 3WLJA 2WC7A 4IQEA 3PWAA 1FVPA 2J7DA 4I5RA 3PUEA 2PWEA 5HPCA 4UOQA 5DBTA 3MO7A 4C5ZA 4Q4RA 1GEQA 1MWOA 3BK0A 2ZFAA 3HPZA 1K9FA 3UJRA 1UYQA 3KHDA 1RPXA 3H2CA 4FF7A 3V4BA 3V5OA 2D2JA 5HR6A 3SRFA 4DJDC 3S9IA 1PWLA 4LAMA 2DSWA 1Y7VA 1KR0A 4DO5A 2VWTA 2Z0IA 3DN5A 3S5OA 1D3HA 3PZNA 1ZL1A 5EPDA 5F1UA 2OTDA 1CXFA 4FNQA 1I8JA 2A3LA 1U33A 5CJNA 2QF7A 4PRRA 4JXCA 5EMYA 3OQ8A 3HGOA 4B3KA 2FTYA 1A3XA 2NW0A 1JVNA 1K6AA 1DP0A 3KZPA 4K37A 4YYCA 2PDWA 2CLEA 1K02A 1VBUA 3J7HA 1A0DA 4JY9A 5A1AA 1EJWC 4YTSA 4YS1A 1ECQA 3WNOA 4LRTA 4E3VA 5A6SA 2HJPA 3NSMA 5LNUA 4GY7A 3I7SA 1K70A 4ROPA 4OECA 4HCHA 5G1TA 2X1UA 3FVDA 2EXOA 2RJGA 5D05A 4KFOA 2ONEA 2PBGA 4JX4A 4DEFA 2GYIA 3CLMA 3W73A 3DFTA 4TX9A 4MY8A 1W3IA 3CNYA 1QI0A 1RAKA 3OG3A 1OIMA 1H5VA 3S42A 1WZLA 1Y0EA 5C9RA 3KVLA 2W66A 5C70A 4WLCA 4J3UA 2RH9A 3SSJA 1TKKA 2ISWA 3GO2A 5K2ZA 5TQLA 1BYCA 1WDRA 2CNCA 1LLOA 2AL2A 4MJZA 2JE8A 4DM1A 2VX6A 3UNTA 4XAFA 1O5QA 4LY4A 2WNNA 3EXTA 3OTRA 2Q02A 3VZZA 4ZXOA 2ZVRA 4IPPA 1HW6A 1R8LA 3R0DA 2BLEA 2GUYA 3GDMA 4BCEA 3K1DA 2ISSA 4IG2A 4GNVA 5FCZA 3FX4A 4Q8QA 3RITA 1JYNA 3ITCA 2GFTA 4PB3A 4D1JA 3N4EA 4YWIA 1S3TC 1CGVA 1X8FA 1UR4A 4E2DA 3TSDA 1YLVA 3TYCA 1R2TA 3CLWA 3T44A 1CB2A 4AX7A 4M6PA 4R85A 4BZYA 4PEEA 3ES7A 3VU2A 1LTDA 3ARYA 5IBXA 4WCJA 1UZ1A 2OLSA 1UD5A 4MWAC 1VKFA 3EX1A 1VPQA 2EF9A 3AI0A 3UJSA 4INFA 2XZ9A 2F61A 3F5KA 4RZ6A 3LBMA 2PTWA 3PTQA 1LBLA 4LCQA 3R10A 3QM3A 3NJ3A 1PWMA 5MKGB 1WO2A 3WK1A 2HEJA 1FX6A 3W7KA 4P7QA 3SAZA 5I3FA 3NOEA 1NEYA 1G67A 1DWFM 1M03A 3BG5A 4HK6A 2PWGA 3USZA 1S5MA 3LK6A 1C9DA 4NHVA 3DYOA 4QE5A 4HPJA 4N02A 1FCBA 1IE7C 4LAOA 1VENA 1XIEA 4PRWA 2OXNA 1UP2A 2DZPA 5A2CA 1HKJA 2FKPA 4YN5A 3AWOA 4FX7A 4NAFB 4CCCA 3QLLA 4P7RA 1IEWA 2OYLA 2CYGA 3QV9A 2VMFA 4HMNA 1WAWA 3TE9A 1V79A 1M7XA 5A5WA 4DJFC 2RDUA 1IZKA 3QY6A 4OV9A 1EPVA 3NQBA 4MZ1A 1T6MA 1NOWA 3K8LA 2XUCA 1OG0A 3RF9A 3GC4A 4HPNA 3AISA 1P48A 3GS6A 3CAVA 3OW1A 5EYWA 4GIAA 3QZ6A 3ZR6A 1OABA 4Y9OA 4WXYA 4F0SA 2OU4A 5CBIA 4DO6A 3FFSA 3ABRA 3ITGA 4CVWA 2BVDA 1DJYA 3THUA 1XIBA 2C0HA 4MIMA 1ZTVA 4GI8A 1CBGA 1P43A 1H7RA 4M3PA 4QJ1A 1UIPA 3AS1A 1TQXA 4GXMA 4HN4A 4UR8A 4YCPA 1GQLA 4JNMA 1NWRA 1ZJIA 1TO3A 3M43A 1QOPA 3AXKA 4A2RA 1TB3A 3M5XA 3JU2A 3WBYA 3BAWA 1JUKA 2P1FA 2NV9A 4DLFA 5DRCA 4M5PA 2XH7A 1E6SM 3AHZA 2FVKA 3ITOA 1C91A 2NT0A 1B9ZA 1RJQA 4XAZA 3NPXA 2I16A 2WKLA 3N9KA 3EOEA 3DKJA 3CQHA 3NSXA 4WSJA 3CUIA 3DG6A 1MEIA 3KBSA 4TVDA 1XG3A 1FWSA 1YIXA 1GJPA 2G95A 3H2EA 4REQA 1B3XA 4EPBC 2QDEA 1X8CA 2YA0A 1S5WA 1VFOA 3WUFA 4ZMGA 9RUBA 3ARWA 1XSJA 4DZAA 3UJEA 4H3DA 2W3ZA 2G50A 3ITLA 3F4NA 3WUGA 3WLLA 2BODX 3UG4A 5G4HC 1RPKA 3GXPA 3ANVA 1C93A 2RJHA 1TMLA 5FIPA 1HKKA 3HMCA 2QGHA 1XG4A 2E5DA 4OOUA 1GOOA 4LH8A 3RPMA 5G1YA 2FHBA 3GNPA 2PCEA 4AYSA 5B80A 3VGFA 4F4RA 5AC8A 3ZT5A 3BLEA 1A5KC 1I9CB 2W92A 2WZIA 3N2MA 4UCFA 3AIUA 4BQ5A 1XLLA 4DNMA 4RW5A 2WHKA 5CQ1A 4MZYA 2PEVA 2FZNA 1QW9A 3VFLA 3VNJA 1EQPA 2V69A 2W0UA 3SDOA 3CH0A 3NM3A 2OOGA 4GZJA 3C2YA 4M0XA 3LM7A 1KWKA 1HF6A 1KQYA 3WG6A 3L4WA 7ODCA 3W82A 2CC0A 2R6OA 3N19B 2ISFA 5IOBA 3XINA 5LA0A 3UZYA 4J4KA 4CCEA 3ORWA 3QGKC 3BO9A 3DIPA 4QJ5B 4O10A 1A4LA 1AA1B 5D30A 4C6BA 1J2BA 1F76A 3A22A 5AHIA 5ABEA 4K1WA 1B30A 3M7WA 4LNCA 1DJZA 1QBBA 1H11A 2ZXAA 4QDPA 4C6QA 4Z2IA 1Q7MA 1H7XA 4I8YA 4JKKA 4DZHA 1AZ1A 1Q6QA 3E49A 1GJWA 1Y5VA 4C6PA 4GZIA 1JQXA 2FH6A 3EKGA 3HQPA 4FLOA 3NXLA 2V3EA 1MNSA 5C2CA 3TXZA 3JRKA 4ZQRA 3W7MA 4A2SA 5I07A 4MWAB 4W7WA 3KP0A 1PBGA 3NTYA 1RVGA 2WVUA 2FH8A 3MZNA 3IK2A 3SCQA 4TTGA 4DZIA 1J12A 3BDKA 3DFYA 1RCXB 2VZOA 3LTPA 3MW7A 1H62A 3OBKA 4P8VA 4PN2A 1XCWA 2BS9A 1XKJA 4GABA 1QNRA 3GDLA 1ITUA 3S1UA 3W25A 2FMOA 4F40A 1YTKA 1AMYA 3E2VA 3FJ6A 3PSVA 1GQJA 4Q4SA 4YNGA 4LWWA 4QCEA 1YE6A 1SFJA 3P74A 5FEPA 3K13A 4AD2A 3KAOA 1VPXA 3VABA 5DCBA 4P2VA 4K7YA 2V3GA 5CPLA 5G4WA 4XAGA 3KRSA 3VIFA 4JCLA 3MZ2A 2X8RA 4H1ZA 3REQA 3THQA 4H2HA 3F4DA 4B91A 1V02A 3PBUA 1H0IA 1WDWA 1MDRA 4H04A 4M1BA 4RZ5A 1Y5WA 4JPGA 3ZR4A 1UKOA 1E72M 3GU2A 2DDXA 2Y8KA 3QQ1A 5FJTA 3KE0A 4H9UA 4BA0A 1DIKA 5XIMA 4F9DA 3H8AA 3FSTA 1UD4A 2PSNA 2Y85A 4Z2LA 3D3FA 1Q2RA 1NARA 4UFKA 1O6IA 2EPMX 3QZEA 1W1B1 1Y65A 3L4VA 3BZJA 1NWSA 1H7OA 3TH6A 3FXYA 1ZPTA 5KZ6A 5A69A 2VDIA 4JTUA 3C0LA 1PUDA 3CZJA 1OCQA 1O4UA 4PMYA 3TLQA 1LL4A 4HOXA 2DVTA 4DYKA 3E2QA 3E0IA 3O8AA 4MSSA 5EMUA 5FJJA 5HJYA 3O0KA 4C6IA 1RY0A 3TROA 4HYWA 2YBUA 4L80A 4CU6A 4WJ8A 2BASA 3RO8A 3VIJA 4ZFCA 2AGTA 3BW2A 1E9IA 3M0IA 4XAPA 5D4YA 1A5MC 2WNQA 2E09A 1GOWA 1F74A 3KFTA 4KCTA 3FAWA 2VJXA 5REQB 5LIWX 1K8CA 2MANA 3W86A 4XQ6A 3MI3A 5H1WA 4KWUA 4M6QA 3QR3A 2WC3A 3S5YA 5HUOA 3SGGA 1UR8A 3WQ4A 4US5D 3ZT7A 3IGSA 3B8WA 2HXUA 1ADSA 3GR7A 1VFHA 3P80A 3NQ7A 1SZEA 4C65A 2V5KA 4FOUA 3EXRA 5JIPA 3D6NA 1VEOA 4JTRA 4H7VA 4ZCWA 4IMEA 3V18A 1MW0A 4TQTA 1XW8A 4XIMA 3DHDA 2VENA 4PUMA 1ICSA 3QPYA 4O15A 3EOUA 2E7FA 2PI6A 4GISA 3LMZA 1K7EA 3UEQA 4YL2A 4RE3A 1OK6A 5JXQA 2XHYA 5HA7A 1ZP4A 4GFSA 1ZBKA 3TC3A 4FNUA 1V77A 1YTEA 2P3EA 4KW2A 1SU5A 3GRIA 4PB4A 3OVPA 3S1WA 3CWHA 4IUGA 4MWAD 3JUGA 2X0YA 4U4MA 4W88A 3AXHA 3N1AA 2BVTA 3I68A 1FP9A 2EQDA 1JZ2A 1OX4A 3BQ6A 2VDGA 3O06A 5CZ0A 3RLVA 1PAMA 3UZXA 1DQWA 3F4CA 4YTUA 4DPQA 2WZEA 4UNLA 1OYAA 1PIIA 3SRKA 1OADA 4D6JA 4M7TA 1I1WA 1O12A 2VOTA 1BXCA 3ARQA 2B7PA 3TC7A 1YNYA 2WOQA 3W88A 4OHQA 5F4SA 1B2YA 3TWBA 4GA8A 1VJZA 4HTYA 4TXEA 1R47A 4PFMA 3BAKA 2PAJA 4KWWA 2Y8VA 3SCRA 4G56A 4WY0A 4J27A 3WF3A 3VOFA 1Y8BA 3B4YA 3AIWA 2JK2A 1VD6A 1B3OA 1ZJHA 2Y61A 1EFZA 1WKYA 4Q7IA 2VI0A 2IMRA 2DIJA 2FB2A 3U9IA 3HN3A 1XLEA 2WMFA 3M0LA 1FCQA 3WQWA 2H9AA 2ZTJA 4GI9A 3UGVA 1V0NA 3HM7A 1KBJA 1A5OC 2FPYA 1G01A 3P5ZA 3MUZ1 4JTKA 3AJ7A 3N11A 2VC7A 1LRTA 2QMKA 3IUDA 3RG6A 1FH8A 1QI5A 3L2LA 3W1LA 2Y62A 1XQLA 1J96A 2ISVA 3VDGA 2V6AA 4H01A 4MKNA 2TMDA 4WKHA 2IPJA 5FJOA 5DLCA 4U28A 3VUSA 4D2JA 3T0AA 2EPKX 1E6ZA 1PO9A 2QLYA 3P2VA 1HNYA 4ZQMA 1KFWA 2QPUA 3ECQA 5FSDC 2VQUA 3G0XA 4JYFA 2ZZ1A 4Z2KA 4M6VA 1V6YA 2GQAA 4AVNA 4B2DD 1UIOA 4AZHA 4NVTA 3MDUA 2TAAA 1HXJA 1K9DA 2QZRA 2X1TA 1XBVA 4W4QA 3O6YX 3VK5A 3LHWA 3L4XA 3UXLA 1LBMA 4W93A 1BGAA 2OWWA 3WJZA 4AMCA 3NXFA 5U4NA 4RPQA 1FCVA 3L0KA 2ZZ5A 2HPMA 2FGLA 3S0CA 3WEMA 2CESA 2WM0A 1OX5A 4AEFA 3KCLA 1WKDA 1V6TA 3T0BA 1Z8AA 3R7MA 5CPSA 1ISWA 1XH1A 3NURA 3GVQA 3NZ1A 1UKQA 4C6NA 1W56A 1W9DM 1XLDA 1KB3A 4V33A 3NQVA 2CLPA 4M82A 3U7VA 4IWWA 1EBGA 3SB0A 4UTMA 2G4JA 3BLFA 3C0JA 4RW3A 4MDPA 1W8SA 2VC9A 3M46A 1GYLA 2BY3A 4NRRA 1HUVA 1AW5A 1ZB5A 1MFUA 3AIRA 3TUUA 3U2ZA 2ZKMX 6ENLA 1A5LC 3I7QA 1IGSA 3H53A 3TR9A 4B5SA 1RD6A 1IR2A 1XCXA 3OJGA 3P7YA 3TDFA 3LQLA 1GVIA 4JHMA 3LPOA 2OG9A 3WLKX 5ABFB 1I75A 5G2HA 3WF0A 1F4HA 4DY1A 1VYRA 1IWPA 1LDCA 2Z26A 3T0CA 2DZWA 2HZGA 3N9RA 4IIHA 3W7EA 3LHTA 2J7HA 4ML9A 3KM8A 5I02A 4UOJA 5TBOA 1V3LA 5AFDA 2XIJA 2HXTA 1UMLA 3MY9A 3K1GA 2Y4SA 1W31A 3CPUA 2YYUA 1A3WA 2EPNA 3GIQA 1BTMA 4GYFA 1KR1A 2E5CA 1LL7A 1XGZA 4PMNA 4GRSA 5E0FA 1UWAA 3WLHA 3LZ5A 5EY5A 4BWLA 3V1PA 2EJ1A 4P8UA 5FJRA 3TP4A 2XGZA 2DIKA 3ABQA 1H1YA 3KVJA 3WF4A 1R2SA 3KRZA 3RN6A 1QNSA 2BP1A 2GJXA 3PC0A 5LYRA 1U30A 3PM6A 1HKIA 4NJGA 3FKRA 3ZYZA 4LV9A 3W74A 1V5XA 3HPSA 3TYAA 4HA0A 2REQA 1C8XA 2TRSA 3UD6A 3RHGA 4N9CA 3W7RA 1MW2A 5GJPA 3O7UA 4ZBCA 2A79A 4KERA 2ZRXA 2EG8A 1E0XA 1MQQA 2DEPA 3LU2A 1XFBA 4UTTA 4V27A 2J74A 3WNMA 3OB8A 5K9XA 1QAPA 1MNZA 3NZQA 3STFA 4JFWA 2QCGA 1W9PA 3OP2A 4IPLA 3BSHA 1WB0A 3EGJA 4PFHA 5F2IA 3LLFA 3BVJA 1KC7A 1TWDA 1F5ZA 3H2MA 3H23A 5T26A 1A5BA 1U2YA 3TA9A 4XZBA 4KKXA 1WXZA 1BWKA 2VVNA 3LLXA 4NNCA 3N4AA 3IARA 7REQB 3WQ5A 4DJEC 5I03A 4FLSA 4NILA 1OFPA 3KCOA 4XBSA 2C19A 5D04C 3MYPA 7XIMA 3PZGA 2GK1A 5E5CA 4CLMA 1V0LA 3OBEA 2ZX7A 1OFEA 2TYSA 3GNOA 4CD5A 2Y8UA 1BXBA 1BRLA 2Y7FA 1MUCA 3ARVA 1L0PA 2YXGA 4UXDA 3CPGA 1FDYA 1WZKA 3TAKA 2R9RA 5C9UA 4JTJA 4XUGA 3BGJA 1U5JA 4BR1A 4C6MA 3GD6A 4X63A 3WD0A 5XINA 1GG0A 4LAZA 3OLGA 3SN1A 5AYXA 2ZVIA 4IMAA 1SJCA 5BMXA 4HNCA 3PJUA 3LHZA 3VKDA 3WMCA 5CAHA 1LQAA 3SQLA 2VRQA 3BLLA 3NL3A 3T6CA 5LXXA 1GW1A 2JEQA 1XISA 4O0KA 2D3LA 1W17A 1XR2A 5C6MA 2QT3A 4IX2A 3P0WA 4IG2B 4FAMA 4HQVA 3TJIA 1IIHA 3BE7A 1TPEA 3U6WA 2PLMA 4IL2A 2Y7DA 3ITTA 2CZFA 2QJJA 4J5NA 3R8HA 3C2OA 4MY9A 4DF0A 4IMFA 1GTHA 4IPIA 3R4IA 1MQPA 1MZHA 4G1NA 3TMQA 3RK8A 5FEXA 3MUY1 1OC5A 2BVWA 2WNZA 4JTSA 1L6FA 1F6KA 1YE4A 2E6FA 4HNOA 1G4PA 3BCFA 3GXMA 1VCGA 1DJGA 2ZZ3A 3HPXA 5HQLA 3S5NA 3CO4A 3GW0A 2HSAA 1GUVA 2HTMA 4AZCA 1DKWA 1QVBA 1WXYA 4JN7A 4QE1A 3HOJA 4A4AA 4RR4A 4LVBA 4JY8A 2QCMA 4IISA 2YW3A 5AC4A 1E6XM 2YB1A 1WDPA 2WAGA 2Y7GA 1TX0A 3FJLA 5J8LA 1TA3B 1EC9A 1AH0A 2HISA 3FDKA 2C1IA 1SFTA 4D6HA 2DY3A 4JQ3A 4NAEB 2OEMA 3BMXA 3K4WA 2DJLA 1LRQA 3IVTA 1E9YB 2HNEA 2ZXQA 4UCGA 3S47A 4DB7A 3B8SA 1GONA 5J5RA 5H2ZA 4R9OA 4PUWA 4AIUA 1HG3A 3OOQA 1W1PA 3EMZA 1MXGA 4G6CA 4ZL1A 4BEUA 1JAEA 2NV1A 1ENUA 2VX7A 4J9JA 2BZNA 4Z2JA 3K8MA 1E5JA 9XIMA 2A85A 2WWCA 4HBKA 4AD3A 1CEOA 3XIMA 1PHQA 3JS3A 3QKEA 3F4WA 2J24A 3PNZA 1WX0A 2ZRYA 4R5EA 3UPWA 5JIWA 1QW7A 4S1FA 4Z1YA 2X30A 3OLIA 1V7YA 4KWSA 5DMLA 1SZGA 4C6FA 5LSMA 3AO0A 4E2BA 1BKSA 3E0VA 3EEZA 1CZ1A 4CCZA 1QMLA 2R1PA 4P7LA 2QUTA 1W0MA 4GUGA 5D2WA 5HINA 1R30A 5M03A 2Z7GA 1HVXA 4RV8A 2XH4A 2R1LA 1DWHM 4L9YA 2WCGA 3O15A 2GVLA 4YWSA 1M65A 2PWDA 4LC8A 4WUIA 1XLHA 4V1YA 4DQWA 4JTTA 1DJXA 6CGTA 5CSSA 3WMLA 3GXFA 3FEMA 3TJXA 2YX0A 3TYUA 1P4CA 1JDCA 3NYDA 2YL5A 2J88A 3ZR5A 4AIOA 4QRNA 2ZTKA 3VIHA 4AEOA 1E6RA 1VCVA 4G5DA 3ATZA 2OQYA 4DNHA 2C15A 3E2RA 5G2WA 1K7XA 4C5YA 3ID7A 1JDDA 3NO3A 3AXXA 4OE7A 1I2PA 3TYDA 2VQTA 3M07A 5E0K