1FHLA

Crystal structure of beta-1,4-galactanase from aspergillus aculeatus at 293k
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
334
structure length
334
Chain Sequence
ALTYRGADISSLLLLEDEGYSYKNLNGQTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFAENDIDIEIISIGNEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDDGWSWDQQNYFYETVLATGELLSTDFDYFGVSYYPFYSASATLASLKTSLANLQSTYDKPVVVVETNWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAVVEATTDGLGVYYWEPAWIGNAGLGSSCADNLMVDYTTDEVYESIETLGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspergillus aculeatus beta-1,4-Galactanase: Substrate Recognition and Relations to Other Glycoside Hydrolases in Clan GH-A
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
total genus 123
structure length 334
sequence length 334
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhlA00
3ARTA 4TOQA 4MJ4A 2J75A 4D6JA 4J3WA 3OZOA 4AW7A 2QMKA 4M1RA 1QW8A 3O2LA 3WH9A 2GK1B 3OIHA 2DGAA 3IAPA 3E1F1 5EMYA 1C91A 4PMDA 1KR1A 5CGTA 3WBEA 3BXWA 3AS3A 4JFSA 5IHRA 1FP8A 2OWXA 1JDCA 3VMPA 1LQ0A 2VC9A 4P8XA 1H11A 5HDRA 1L0PA 3GBEA 2YA1A 2ZUVA 1EHAA 3A4AA 4UZUA 4H04A 4HMCA 1CTNA 1SFSA 1UKSA 2VRKA 3N9KA 3WF4A 1G0CA 5M17A 1JXKA 3VVGA 3WDIA 1VFOA 1E55A 1UH2A 2WMHA 2OSXA 4AD3A 3SUVA 1ZS2A 3VMOA 3WUBA 5I5RA 1WPCA 1B3XA 1EDQA 1JI2A 1E4LA 4AIEA 3OLEA 1CEOA 5A3HA 1QOXA 3U57A 4P7NA 2WZHA 3WN6A 5EBAA 3AI0A 1C90A 1PEZA 2CHOA 3AQUA 4OOZA 3S2CA 4W89A 1MFVA 1QNOA 2J7FA 1CIUA 3KE0A 4KH2A 1GOIA 4H8VA 1CXFA 1UWUA 2WSKA 1V3MA 1NP0A 1QBAA 1C7TA 4C7GA 2JF7A 1PZ2A 4CVWA 5A69A 5JUVA 2GSJA 3B9AA 4NRSA 5E09A 2J7BA 5CLTA 4FK9A 3K4AA 3M46A 4UFHA 4MNMA 2WLZA 3AMCA 3KL3A 2WM0A 4NZCA 1LL4A 1S46A 1R7OA 2WWCA 1OINA 4CU8A 4GO8A 3AIVA 1JAKA 4TVCA 3U5YA 2C8NA 4LPCA 5D9PA 1D2KA 4CCDA 2X2YA 2A3HA 3HU7A 2CITA 3CUIA 3FNDA 4E8DA 3AZRA 4CD4A 1XRVA 7TAAA 5IHSA 1JYVA 4MNJA 1SR0A 1V3IA 2W92A 3WQ6A 1JXJA 1V02E 3EMQA 2JE8A 5CPQA 3WENA 5BWFA 1QI3A 1CNVA 2JALA 1H49A 4NRRA 4B3LA 4BQ3A 1FOBA 3VGEA 4AEEA 3VX1A 3EDFA 3MSDA 4JFWA 3VMNA 1QI5A 4ATWA 4J7RA 1XGZA 1SYTA 2WLYA 1MXGA 4W87A 2ZX8A 4H2CA 3EYPA 2PBOA 3WDJA 5I79A 1GOKA 3POCA 4H7VA 4CCCA 4AZCA 4LYRA 4KGJA 1FA2A 3WNMA 3OLIA 3WUFA 3AHYA 1KR0A 1H4PA 1PX3A 4ACZB 3WFLA 2AAAA 2V3FA 3UETA 2W63A 4TUFA 1XHGA 3VU2A 4HPGA 1J12A 1TVPA 4HA1A 4W85A 1TA3A 3ARRA 1M04A 4YPJA 4KWUA 1UD3A 3VDBA 1EDTA 4ZE5A 3AIWA 4DUVA 1UH3A 3NYDA 1QPKA 5I77A 1MW0A 4PMQA 2DEPA 3MANA 1E5JA 3ECQA 4B16A 1J0ZA 4J28A 5A8PA 1WO2A 4PMZA 2WYSA 2E9MA 5A94A 2PWFA 3MS8A 4HU8A 2VL4A 3VDAA 1UKQA 3BMWA 3GZAA 2WHKA 2YOCA 2V3GA 1I1WA 3BSHA 5DO8A 4CN1A 4FMVA 3RILA 1BSIA 3WNLA 3EMCA 3WH6A 1W9PA 3LPFA 3ZOAA 5EFFA 3UCQA 1V6UA 5LA1A 3T0DA 3WNNA 2VUYA 4RE4A 5AC5A 2ZXQA 4W84A 3MUY1 3UERA 2VX5A 3GYCA 3N18A 2BFGA 3ZSSA 3AIQA 1HL8A 3MO4A 4P7OA 3AMLA 1B3YA 4X0NA 2DQXA 4W7VA 2VO5A 3WH7A 1J9YA 2F8QA 3NIYA 4M80A 1TZ7A 3WD3A 4CUCA 1MW2A 1RPKA 5CJ5A 2CBVA 3GM8A 4RE2A 3F5KA 3D5HA 1MQQA 4CVUA 1MXDA 3N15A 1OIFA 1G5AA 2EPOA 2JEPA 5I6SA 2Y2WA 3N1AA 3VINA 1LL7A 1GOQA 5I3DA 3SCNA 2FGZA 3RMEA 2PWEA 1IZKA 2J8FA 3WQ5A 1C8YA 4JIEA 5ABGA 5FCZA 3T08A 4FF5A 4U2YA 4PMVA 1BFNA 3BGAA 4WKHA 4GQRA 4UFKA 3FW6A 2VTFA 3ZJKA 2IUZA 1V6VA 4ZXLA 1JZ5A 3W24A 1UWIA 3VM7A 5DMYA 3ZR5A 5JBEA 2WPGA 1IZJA 1VF8A 1W9XA 4MDOA 3MU7A 1GCYA 2BVTA 1ZBCA 2O92A 3F4VA 4B9ZA 3WQVA 5CG0A 1JZ2A 3RJXA 2MANA 1E0WA 3QOMA 2X0YA 1UD6A 3OB8A 4Z2GA 1EH9A 2VQTA 1DP0A 1ECEA 3OGSA 1EA9C 3PZGA 3GXDA 1VEMA 1UA3A 3MMDA 3SIMA 2FDMA 1UKTA 2J4GA 2HISA 1CXKA 2X1IA 5I2UA 1V0LA 2D0GA 4AD2A 3ZJ6A 1GVYA 3TONA 1TUXA 4W7WA 2GVYA 5DEZA 3K8MA 4UFMA 4GZJA 3SCOA 2J79A 2DIJA 5FD0A 3UG3A 3GH7A 2RGMA 1AMYA 2E9BA 2WKLA 1DWHM 1AQHA 1EIBA 1E1FA 2ZUSA 5BXSA 4AXNA 3CHCA 1UR8A 2BXYA 2GUYA 3DYOA 3WQ8A 2VCAA 2J77A 4CKQA 2PC8A 1XH1A 2B31A 4CD7A 4UOZA 1CGUA 2E8YA 1Q6DA 3WUEA 1QVBA 2YL9A 5IFPA 1K9FA 2X8RA 2F61A 4EKJA 3HN3A 2UY4A 2PB1A 4NSBA 1KBBA 4V2XA 5HPCA 3WD1A 4AD0A 2ZX6A 2CESA 1HJSA 3WD2A 4M8UA 3VD7A 1KGWA 4XX6A 1XD0A 3ARXA 4MPKA 3T0AA 3BH4A 5E0FA 3CH9A 3L2LA 4J3TA 2OYLA 2DT2A 2QV4A 3L2MA 1VEOA 3SCRA 2CIPA 3SUUA 1WDPA 4BZYA 1Y7VA 5JBDA 1BYAA 2GJRA 1VBRA 1YQ2A 3WNKA 4PBGA 4JKMA 2E0PA 3VPLA 3AZTA 3ARWA 3GBDA 3ZJ8A 2E9LA 2A3AA 1MQPA 1FFQA 1GNXA 3DC0A 2QPSA 3OGVA 1E6PA 2WVSA 2CEQA 4TX8A 1US2A 3AICA 3MV11 2CKRA 3TTSA 3WMSA 4D6EA 1EXPA 3WDQA 2VJXA 3LPGA 2XFYA 2CBIA 5AYIA 1DHKA 1J0YA 4X9YA 3THCA 3CGTA 3RM4A 3WH8A 5TD4A 4PMNA 1E6NA 1E3ZA 2EEXA 3W25A 2W62A 1XYFA 3PBGA 3NDZA 3QHOA 3DHUA 4ZENA 1HKIA 5M3WA 1RD6A 4WLCA 2EQDA 4HU0A 2VX4A 1HJWA 4JL2A 4ML4A 3RDKA 1TCMA 4UTFA 2ZOXA 4GXPA 3VIKA 2A3BA 1QHOA 3NUKA 2WZIA 1BG9A 1W3KA 5A6LA 4L4PA 5IXEA 1EQCA 1V6YA 2V3EA 3VGHA 1GQIA 1TR1A 2WK2A 4GI8A 2BHYA 3GNRA 4A3YA 3AXXA 3QGVA 2J7HA 2UWFA 1JFXA 1W1TA 4KGLA 5DT5A 1E3XA 3AYRA 3A4WA 1JL8A 5ECUA 4OBRA 4GZEA 1OGBA 2PWGA 2V5DA 1EDGA 1GOWA 4FLQA 1UKPA 1WKYA 1TMQA 4NI3A 1K9TA 1UWQA 5BCAA 5BYWA 1UWSA 2ZX9A 2VMFA 5A6MA 2VVNA 3CMGA 2VVSA 2O9OA 2TAAA 1PBGA 5D8ZA 1FHLA 1JFHA 3OBAA 3DYPA 1J18A 2C0HA 1EO5A 1QI0A 3IK2A 1WZMA 3G6MA 2CERA 3GXIA 3U5UA 1C8XA 1E40A 1CBGA 5D9OA 4UNIA 2Y24A 3EMZA 1E43A 5A6AA 5FL0A 2WW5A 4JHZA 2X09A 3IJ7A 4K68A 3GH5A 2XIBA 5C8BB 3W38A 1UG6A 2YA2A 1HKJA 2D23A 1L8NA 1OGGA 5D9NA 1E56A 2CCRA 2J25A 4AZ6A 1E5NA 3CZKA 2WVTA 3VIMA 3L4XA 1KWKA 1R85A 1F4AA 3VD3A 3B9EA 1GQKA 3LPOA 1PPIA 3QHNA 1BYCA 3K8KA 3MMUA 3KL0A 1UR9A 4AD5A 1B30A 2ZIDA 4PRWA 2VR5A 3M6DA 4OZOA 1O7AA 4H8HA 1B9ZA 2BY0A 3W53A 5DF0A 1CPUA 2BVYA 2GJPA 2XHYA 4D6CA 1ISVA 1JIBA 5GNYA 1C3FA 1EOKA 3BCDA 9CGTA 1OD8A 2UY2A 1JGIA 4F79A 2JFEX 5EB8A 4IUGA 4MTVA 1SMAA 3PTQA 3WF1A 2J47A 1W9BM 4ACZA 4PCTA 4UFLA 3F5JA 2BS9A 1HX0A 2C7FA 4MB5A 3DHPA 1CGTA 3VDHA 1HKMA 4J3UA 1NWRA 4HA3A 4BQ5A 3CPUA 4QDMA 1MFUA 1JDAA 4MB3A 3AS1A 3W27A 4B9YA 4U33A 3SUTA 3CUFA 5M5DA 4W7UA 4Z2IA 4F9DA 1CXHA 3BSGA 4AZBA 1GJUA 2Q8XA 2BY3A 2ZXBA 3NSNA 2CBUA 1W3LA 4E4PA 2VZVA 1ZL1A 3VGGA 1CYGA 3TA9A 3GNOA 4OKDA 3WF0A 3BAIA 1MVYA 3L4ZA 1ZU8A 2OYMA 7A3HA 5GNZA 5D9MA 1PIGA 1UA7A 1ODZA 2AOSA 2NSXA 2ZX7A 1NH6A 4AIUA 2VOTA 1UR0A 2J7GA 1KXHA 3TP4A 2VZOA 3VIJA 3EDKA 1U2YA 2ZUWA 2V5CA 1GJWA 5CLWA 3U7VA 1NM9A 4JAWA 1H5VA 3BMVA 1UUQA 1GPFA 1JF6A 3W82A 2FHCA 1UD5A 2DH2A 3ZR6A 4Z2HA 4GINA 1VRXA 1HNYA 1DEDA 2BY1A 5BRQA 3KWXA 1GQJA 5A1AA 1W2VA 2W66A 1V3JA 3AIEA 3VGFA 4P8VA 1GZJA 1CXEA 2OLHA 4WKFA 1EQPA 1UR4A 4P7QA 1AVAA 3FN9A 1E73M 1BF2A 2BY2A 4QAWA 1ISZA 4J3XA 2ESCA 2CXGA 4LQ1A 2XYLA 1PX8A 4URIA 4S3JA 4WIWA 5CQ1A 1CENA 5HOSA 3SUSA 2WWDA 4FLSA 3AFBA 3PZUA 1CDGA 2XSAA 1J0KA 3THDA 3WUGA 2PBGA 2XSBA 4U3AA 1CGVA 1KXTA 4PSPA 1ISWA 2WKGA 2DIEA 3K8LA 2ZX5A 1B90A 3FHAA 3AHVA 3SCTA 3OLGA 1KXQA 1GQLA 5IDIA 1XC6A 3AS2A 4WKAA 4FLOA 3VD5A 3POHA 1NOWA 3GDBA 4PYSA 1ISXA 1UWRA 1WE5A 3II1A 4OUEA 2WCSA 4UFJA 4BQ2A 1QHZA 5E6YA 1LF1A 2VCBA 3RIKA 2O9RA 1E1EA 4GZIA 3WELA 4GI6A 1UZ4A 5A6JA 4HP5A 1GONA 2PWHA 3UG5A 4PMOA 3IJ8A 4EK7A 1QI4A 1MWOA 1OT2A 2DT1A 2XGIA 3CUGA 4S3KA 5A8OA 1V3KA 2YDSA 1NQ6A 1J0IA 5BXTA 1TG7A 1JYWA 6A3HA 4DUWA 1TE1A 2CHNA 1R8LA 3GH4A 1ISYA 3WMBA 1H2JA 4ATDA 4M24A 3FAXA 1PIFA 1EGZA 3NDYA 3AHTA 4AZIA 4J3SA 3SCPA 4AZHA 5ABEA 4D72A 2FHFA 1W9DM 4R5EA 4PN2A 2WVVA 2QF8A 4XUYA 5LA0A 4W8AA 4LX4A 3PHAA 1DWJM 2G3IA 2J78A 4MADA 4TX6A 1ESWA 5D8WA 4D1IA 4H41A 4JKKA 5HPOA 1XSIA 2Y4SA 3OG2A 3SEPA 5JBFA 1DWIM 4F9JA 3F5LA 5HNNA 3RPMA 3O6AA 1D3CA 2EPLX 1I1XA 1W3HA 4X0VA 2XUCA 3CTTA 3IANA 4UFIA 2BNJA 4H8UA 1XSKA 2D0HA 4TTGA 3TOPA 4Z2KA 4Y7EA 4MDPA 3MV01 2VR4A 3FAWA 1B31A 4PTVA 1OGSA 1XCXA 2A3CA 2XWDA 1V0NA 2E3ZA 1K9DA 4TVDA 2ZUTA 3EDEA 4B15A 2YL5A 1JDDA 5HBFA 3CUJA 4U5IA 3A47A 2W67A 2EXOA 2DSZA 4AD1A 1UOKA 2UY5A 1TVNA 3SUWA 4B3KA 4OJYA 3W37A 2IXVA 1VB9A 4A3HA 1NOUA 4BF7A 4AZGA 1E4NA 4IPNB 4HOWA 1W9UA 1W91A 1LG2A 1X1NA 1C93A 4OBSA 1QW9A 4GKLA 4TTUA 4D1JA 4ZFMA 3APGA 3W6LA 2VZUA 1VENA 1NOFA 3GXMA 1DWAM 1NARA 3VIHA 5DT7A 1BAGA 2YKKA 4UQDA 4QFUA 4DWSB 1HVXA 2E4TA 3L4UA 2QPUA 3QOKA 3CMJA 3OA5A 2J7EA 2V38A 2DH3A 4CN4A 3BAWA 2OSWA 3W28A 2XFRA 3K4DA 4W86A 2E8ZA 1WDSA 3GTNA 1O6IA 2WBGA 1CXLA 3PZTA 3I3BA 4MB4A 4V27A 4FLRA 4W5UA 1C92A 2J8GA 5ABHA 3IAQA 3W26A 4UQ9A 3VIGA 4L4OA 1ZBVA 1BPLB 2YBUA 3ALFA 3L4WA 2YDQA 2BV9A 4WSJA 1K6AA 1KXVA 1LJYA 1WZLA 2GDVA 1LWHA 4UZSA 5A8NA 1W1PA 5CGMA 1HIZA 2VT0A 3I3EA 1NWSA 1HL9A 3MSGA 2XVPA 1SMDA 1W1VA 2WMGA 1JNDA 3VIPA 3WNOA 2W5FA 2PI6A 3BC9A 1HJXA 1WDQA 3CZJA 4PEEA 5KZ6A 2QLYA 4ZEPA 3CIVA 3WY1A 3WEZA 4QLJA 1UQYA 3ZT6A 4Z2LA 1V02A 2WVUA 4KRTA 1W32A 1XH2A 3VIIA 1E6RA 1WAWA 1HP5A 3ZSTA 1N82A 3BAJA 3ARYA 2YIHA 1HKKA 1OSEA 3BLKA 1OIMA 3AJ7A 2W91A 1UD4A 3N12A 4AWEA 2CETA 2YBTA 1BTCA 2XPKA 2G3NA 3OGRA 3RO8A 4UQEA 1IT0A 8CGTA 3ALGA 4HMDA 1Z32X 1ZBWA 2JIWA 1F4HA 1D7FA 1VFMA 2BHZA 2VZSA 4QLKA 1HVQA 4M56A 3WDHA 3PZ9A 4BS0A 3EDJA 2WCGA 4WSKA 1Q6EA 1BGAA 3CHEA 3MUZ1 2DSUA 2CKSA 2XVKA 2HVMA 1HN1A 3VX0A 1CGWA 1AQMA 1UKOA 2XVLA 2WHLA 3UESA 4HA4A 1MYRA 1JZ8A 5LA2A 1C8QA 1LWJA 3AXHA 1E6QM 1Q6FA 3AMGA 2OSYA 1WZKA 1OBAA 4JCMA 3VNYA 2CBJA 1B3WA 1CXIA 1NP2A 3A6OA 4J3VA 5CSUA 2QMJA 2WB5A 4QCEA 3SCUA 4CN6A 4HZ8A 2JEQA 1QHPA 5M03A 2Y5EA 3SURA 1FH9A 1VJZA 2VRQA 3VGBA 3A4XA 2WMIB 1EO7A 3VTRA 4AYSA 3ZIZA 1EHNA 3CUHA 3W6MA 3EBVA 4UR9A 5I78A 3VD9A 4DWSA 4ZE4A 1DWFM 4JFUA 4HTYA 1WZAA 4MB1A 4CCEA 2JF6A 1E9LA 4HZ6A 1HJUA 2A3EA 3UR7A 4CD5A 1W2PA 1CGXA 1WDRA 3K1DA 1UHVA 3N04A 5KEZA 3VO0A 1JNEA 2BHUA 1CLXA 2NW0A 1KCLA 4DM2A 1GOMA 5JIPA 1H41A 1LL6A 4GIAA 2CPUA 3ZM8A 1FH8A 3BAYA 1JYNA 1B3ZA 1MQRA 1QNQA 4Q22A 3A3HA 5EFDA 3PZNA 2VCCA 2QHAA 4ATLA 4JKLA 3BLPX 5E70A 5JIWA 4UQBA 4P7RA 2XGBA 1UD8A 4NF7A 1VIWA 2IXUA 3PZIA 3B9DA 1CZ1A 4UCFA 2XVNA 2ZUUA 1R7AA 4LYPA 1JF5A 4PSRA 4U2ZA 1BYBA 5CXPA 4C7FA 4AZCB 4AC1X 2D22A 2D3LA 5CSYA 4AD4A 3CZGA 1XYZA 5A6SA 1G94A 2YL8A 3ARPA 1RH9A 1PJ9A 2VURA 3AIRA 1PZ3A 3GXFA 4XB3A 1JD9A 1XD1A 2XTKA 4PCSA 1GHRA 1KFWA 1ITCA 3ZO9A 4JL1A 4PMUA 1GOOA 1KGUA 3ZMRA 4AMCA 2F2HA 3ZT7A 4PUEA 3AXIA 1X6LA 3O9NA 5CPSA 3PN8A 3SCSA 5AC4A 4WK9A 1V08A 2CYGA 1QI2A 1JYXA 2XFFA 1US3A 2J7CA 3W0KA 1E6XM 4N0RA 2OWWA 1GUVA 1E4IA 4WJXA 3AYSA 4MJ2A 3WEOA 2UY3A 1J10A 3ARUA 3WD4A 1E6SM 1A3HA 4OIFA 3BAXA 1XSJA 4UQAA 1KCKA 2D20A 1NWTA 3WL0A 1CECA 4W8BA 3MUIA 3PZVA 3VIOA 1G9HA 3T0BA 5I23A 3VDCA 1GW1A 3CZLA 1H0GA 5IFTA 2WBKA 4M82A 1VEPA 3J7HA 1GVIA 2VNCA 3NCOA 4LXFA 1C7SA 2WHJA 1KWGA 2ZUMA 3WQWA 2G3MA 3LPPA 1OWQA 2GFTA 2WZEA 4D6HA 5C71A 1M03A 1CWYA 1MW1A 1G01A 1AQ0A 5CPTA 4JZ5A 3AISA 2WC3A 4IM4A 3AIBA 1JZ6A 4CU6A 1BYDA 3WF3A 1Q6CA 3VGDA 1ZJBA 4M81A 3TTOA 3OZPA 4E8CA 2XWEA 3WF2A 4J27A 3T2OA 2WC4A 3NSMA 5GNXA 3BAKA 3T09A 4Z2JA 5C70A 4DWSC 1VFUA 2D3NA 3WFZA 4N42A 3UR8A 5F7UA 3CZ8A 3TTYA 3WIJA 3JUGA 5AYBA 1UWTA 4CU7A 2G41A 4HOXA 3W29A 1E71M 1XV8A 3VUPA 3CHFA 2ZWYA 1FH7A 3WDPP 5I0DA 4PTXA 1BGGA 1OCQA 5FL1A 3T2PA 1PX4A 2O9TA 1V0KA 3WBAA 3EDDA 1WB0A 2DSKA 4E2OA 3WKZA 1W1YA 4ZXOA 2Z1KA 1IV8A 1V03A 5HXMA 3CZEA 4HOZA 4W5ZA 6CGTA 3NJ3A 4D6FA 3CO4A 1P6WA 3DECA 3DYMA 4TVUA 1UQZA 2Z1SA 1QNSA 4YN5A 4XZWA 3PZQA 4D6IA 1JG9A 3AROA 1H0IA 3WL1A 2BXZA 4Q7NA 3PZMA 3CHDA 5A8QA 2EJ1A 1E15A 2YLAA 1VFFA 4EANA 2X0HA 1WNOA 4QCFA 1TFVA 3N11A 4PMXA 1HXJA 2J62A 5A6BA 3GNPA 3PTMA 2GK1A 1JD7A 3CLWA 4F8XA 3PTKA 2GDUA 4EAMA 2YL6A 2WSPA 1J0HA 5A2BA 5E6ZA 1YHTA 4XV0A 1ODUA 1QNRA 1DWGM 2FH6A 4GPNA 1W9VA 1KQZA 1R87A 3RCNA 2BVDA 4PMRA 1UR2A 2WHMA 1QNPA 2Y8KA 2O9PA 1WP6A 1V6WA 2YDRA 4KRUA 4DM1A 3ARQA 4GO9A 1VAHA 2EO7A 2VRJA 1J01A 2J7DA 3RM9A 5FIPA 2XG9A 2DSVA 2VX6A 4AZ5A 2NT1A 4YHGA 2DT0A 1JAEA 3SCWA 2D1ZA 5ABFA 4D6DA 4U3CA 2AMGA 5I24A 1E0VA 1B2YA 1V0MA 3NSXA 1JZ3A 2GJXA 2FHBA 4MNKA 3K46A 4AEFA 2E40A 3LMYA 1XCWA 4M29A 1HF6A 3G6LA 3MKKA 3W81A 3L4TA 1H1NA 4U5KA 5FKYA 1BQCA 1ZB5A 1EOMA 4MNLA 5AY7A 1OB0A 4JHOA 3QR3A 4AZ7A 1J0JA 1V6XA 1BHGA 5A6KA 3WDRA 2G4FA 3AIUA 2NT0A 4AY1A 2XM2A 2DSWA 2EPNA 2WMFA 2VZTA 5A8MA 1BVNP 2J74A 3SCQA 2DPEA 4QLLA 1HT6A 3WH5A 3QHMA 3ZT5A 5GPRA 1GORA 3VILA 1CGYA 3KEHA 1FHDA 1LLOA 3VNZA 1MW3A 3HJEA 2WMIA 1WCGA 4A4AA 1FFRA 2DDXA 2XJ7A 1U30A 2FGLA 4HZ7A 1I75A 2WXDM 5BXRA 1GHSA 3ZQ9A 3IJ9A 2D24A 4BA0A 4JCLA 5LYRA 1OD0A 2G8ZA 8A3HA 2G3JA 4LGXA 1OT1A 3VM5A 2W61A 4P8WA 3M07A 5E0CA 2D2OA 5D4YA 3TTQA 2JIEA 2ZUNA 5GQBA 1RP9A 1HP4A 3L4YA 5BROA 3AHXA 3AS0A 3UG4A 6TAAA 3OLDA 4C7DA 4XZBA 4PTMA 1FP9A 2Y8VA 4TXEA 3D3AA 3W4RA 4RL3A 2WCAA 1HJQA 3SCVA 4EE9A 3AMKA 7CGTA 2ZE0A 2WMKA 2XVGA 5DFAA 2RGLA 4D71A 1VBUA 1LG1A 4DWSD 4AISA 4DUXA 2WANA 5E9AA 4CD6A 1E70M 1ZBKA 3WSUA 2WNWA 3WEMA 4OOUA 5FOOA 3VOCA 1M7XA 2ZXAA 2X05A 1JZ7A 3ZJ7A 1Q4NX 5A95A 2VQUA 4WF7A 3MUAA 4P8UA 4MAZA 2ZICA 3WQ4A 2ZWZA 3N13A 1UYQA 4W88A 4D6GA 1H09A 1V3HA 1E4MM 1KGXA 3MMWA 1UR1A 2WVVB 5A2CA 3N17A 1OM0A 2OWCA 1CLVA 1B0IA 3M7SA 3RM8A 1TA3B 4UQCA 1G1YA 3VIFA 1KBKA 1XH0A 4GQQA 3I3DA 3VD4A 1BLIA 4CGTA 3FHQA 3AHZA 3UEQA 2GJXB 3KL5A 3FXYA 4W93A 3B8SA 3AZSA 4ACYA 2XM1A 2FH8A 3PZOA 1HJVA 3ARZA 1E72M 2DT3A 3WMCA 1B1YA 3S6TA 4U31A 1H3GA 4MAVA 4R27A 1NWUA 4IPLA 1M01A 4QP0A 1UZ1A 5A6BD 4W8LA 1V3LA 1A47A 2WMJA 4HPHA 2CNCA 3WNPA 3RJYA 1ZJAA 1E0XA 4KMQA 1PAMA 4JFTA 1Q6GA 1UH4A 3FY1A 4V28A 1E6ZA 1JZ4A 4IISA 4RE3A 1R86A 4GI9A 5BXPA 5ABFB 3L4VA 5CZKA 3CBWA 3U7BA 2EPKX 1BVZA 3KZSA 2YJQA 3ARVA 4BCEA 2YA0A 5BRPA 1W3JA 1UD2A 4PTWA 2PF0A 4HMEA 2OYKA 3AOFA 2D0FA 2WC7A 4LYQA 2V3DA 2VI0A 1K9EA 4AIOA 3AMDA 4PUDA 3BCFA 4P7LA 4PMYA 2XIIA 1X6NA 4YHEA 2PWDA 4UOJA 4UOQA 1DTUA 2YLLA 1B3VA 4JFVA 4BQ4A 3WD0A 3ARSA 3T2QA 2WAGA 1ITXA 1KB3A 1VJSA 2VX7A 2ZXDA 1U33A 3HMCA 2EPMX 4CD8A 1JI1A 1KQYA 3VKKA 1M53A 1QBBA 1J11A 1RP8A 1BG4A 2W4XA 2EBNA 4F66A 5A2AA
chains in the Genus database with same CATH superfamily
2OTDA 3ARTA 3LERA 4UNKA 1LUCB 4BY3A 4TOQA 2J9YA 3LLXA 1HGWA 4FAMA 4KWWA 5HR7A 3NEHA 1KR1A 4HSNA 8TIMA 3UXDA 3RCYA 2I9UA 1LRTA 3S2MA 1AUSL 3IIZA 2CXEA 5HDRA 5CH9A 1EEPA 1L0PA 5CSSA 3QFEA 2OZ8A 3AU2A 3EZ4A 2Z1BA 1JCMP 1EHAA 1WBJA 2ZUVA 1U1JA 1K4HA 3MCOA 4UZUA 3HGSA 3NEVA 3NL2A 1O5KA 3G2GA 2Y5SA 3GXTA 3PSWA 3UJ2A 1SFSA 3WF4A 2B81A 5AOUA 1G0CA 3GRIA 1TX0A 4R33A 5M17A 3WDIA 3KVKA 4IIDA 2OOFA 1UH2A 4IGSA 3EAUA 3QMTA 1QO2A 2QUMA 1B3XA 3DBNA 2ASHA 2BB0A 3W7OA 4RDWA 3PF3A 1P0BA 4PCFA 4WQ6A 3U57A 4DAIA 3PUOA 2QCEA 1K7FA 2ZA1A 4W89A 8RUCA 4Y90A 1CIUA 4KH2A 1W31A 2H3BA 1WKEA 3TX9A 1QBAA 1XLDA 1ICPA 2HZGA 1SZFA 2YPIA 4C7GA 1S39A 1RCOB 1XPYA 5JUVA 1ZHAA 3IGSA 4NRSA 5DX7A 4AWUA 4YCPA 2J7BA 4LALA 5EY5A 4FK9A 1CLKA 1ZQ5A 3P93A 3IIPA 4NZ1A 2Z29A 2GGJA 3C8NA 4GX8A 4HK5A 4NZCA 1LL4A 3ZLFA 4B2DA 3G3DA 3WG6A 1YMYA 3CS2A 3TW6A 5FF2A 3H53A 4Q8NA 1EJWC 4GO8A 4TVCA 4Z0SA 3U5YA 3I4EA 5D9PA 1D2KA 3UR2A 3M9YA 1TPUA 4M5PA 4O19A 4IICA 3TQ0A 2X2YA 3LMZA 4XZMX 2CITA 3FNDA 4HQVA 3VC6A 5EA9A 3L0GA 1JYVA 4MNJA 3B8WA 4L61A 2PCQA 2W92A 3WQ6A 3PPCA 3EMQA 1X8FA 3UXAA 3UA3A 3C52A 3CK5A 3IEBA 4Q8VA 3EKZA 3WLNA 3W1NA 1IWAA 1Y65A 4NNCA 2ZRZA 1PHQA 4Q8MA 1QI5A 4DBSA 4J7RA 1SYTA 1KO0A 4INFA 4H2CA 3EYPA 4P2VA 3HMJG 1UZHA 3ITLA 3WMLA 4M6PA 1PCWA 1GOKA 3POCA 3U2ZA 4JQ1A 2CZEA 3ABZA 4MKVA 3VOFA 3UGVA 3W07A 3WNMA 3GC4A 2J6VA 1PX3A 2AAAA 4WOQA 2F84A 4GJ1A 1O1ZA 3VU2A 2GSEA 3TROA 1DJQA 4LF1A 3GKAA 3A9BA 2Y7DA 4K7YA 3QV6A 1FWGC 1TA3A 3NTYA 3UZ5A 3ARRA 1M04A 3ERPA 2VFIA 3L23A 4RZ6A 1D3HA 4Z1CA 3NGJA 4E3VA 4RNIA 1B5TA 3VDBA 3MUXA 3H7VA 4Q4QA 2NXGA 4ZE5A 3FK4A 5D2XA 1XKYA 1VJIA 4DUVA 1R2RA 2X7WA 3TNBA 2DJLA 3S2NA 1RALA 1QOPA 1J0ZA 1KKRA 3EWDA 3ITCA 1QJWA 2WYSA 3MS8A 4LCQA 4HU8A 2VL4A 1KCZA 1KFEA 2IQDA 4PCNA 3O06A 3BSHA 3MDUA 3RILA 1BSIA 4Q4MA 3KCLA 2RFGA 1W9PA 5HJXA 3LPFA 2QT3A 3M0MA 3UXLA 5LHFA 1V6UA 5JH1A 2NLYA 4WJEA 2HVNA 3CASA 3EXRA 3R8RA 3KOYA 2J6XA 4B5VA 4HIBA 2XH2A 2FJUB 2ZXQA 4AH7A 2VX5A 3GYCA 4K1GA 4O1FA 2GGIA 2PLMA 4UTIA 3E12A 3ZSSA 1OK6A 1HL8A 5D2TA 2YDAA 3PG8A 5C55A 3WJYA 4X0NA 2DQXA 4AFYA 1K3UA 3WH7A 5FSDC 2F8QA 3M44A 4RDVA 1F7BA 3E5BA 4M80A 5I02A 3TZNA 3LHYA 3UZXA 3F5KA 1RA5A 1MQQA 3GVQA 4FXSA 2Y70A 3GC2A 3IUDA 3MWCA 1GOQA 3SCNA 1LOSA 2FGZA 1OQFA 2QKFA 4FEZA 4IXXA 1XKJA 4PMVA 1BFNA 5K4XA 4PE8A 3QMSA 1R46A 3ZJKA 2IUZA 1ZY9A 1DJNA 1XFCA 3OP2A 2XIQA 3R89A 1UWIA 3W24A 2ATSA 5DMYA 1H61A 3ZR5A 1WOAA 4YLWA 2Y6ZA 1A3WA 3MU7A 4MDOA 1GCYA 2OEMA 2VD8A 2A2IA 4O57A 4B9ZA 2IPJA 2XINA 3W01A 5CG0A 3AU6A 3SQMA 1TWIA 2W27A 4PTNA 4QE5A 5IBXA 2G50A 3FEQA 1EH9A 1DP0A 5EL1A 3BLLA 1UA3A 3FKKA 5CCZA 3CWOX 4QDPA 3MMDA 2FDMA 4S3FA 3DFPA 1XLHA 2HISA 5I2UA 1UBPC 4I9TA 1IIGA 3L5MA 3DOPA 1WX0A 1TUXA 3IIOA 4H3DA 2A85A 5DEZA 3K8MA 2YCLB 2Z6JA 3SCOA 3UG3A 1MEWA 4C6FA 2OZ3A 1GG1A 2OEKA 2ISFA 3GH7A 5FSEC 5LKYA 3O0FA 3TJXA 4Y8FA 3W72A 1T40A 3G1DA 1KRAC 1E1FA 1OX5A 1XIMA 1TWWA 4CKQA 5FESA 2B31A 2E8YA 4H1ZA 4IMAA 3W02A 1QVBA 4AHOA 3PBMA 2F61A 4Q32A 3NQ8A 2PB1A 4NSBA 4EXAA 5HPCA 4YNGA 2REQB 4ZBCA 2ZX6A 4Y8EA 3PJUA 4HMNA 4A21A 1BQGA 1J2WA 1XD0A 3OVGA 1QRQA 1F61A 3BH4A 2TYSA 1GT8A 1K77A 4GRSA 2V2CA 3NQFA 1H7RA 5T9CE 4BZYA 4O53A 1TJ1A 2CLHA 1IR2A 1YQ2A 3G1VA 4MM1A 1SM9A 4JKMA 4PGLA 5HK4A 3GBDA 3ZJ8A 3RUBL 1A50A 4KS0A 2IKGA 1GNXA 1EF2A 4IHCA 4H4IA 3LBMA 3OGVA 1FWWA 1US2A 1YTEA 1SGJA 1EXPA 2HK0A 2R1MA 1XICA 5L9FA 1ZZMA 2AQWA 5AYIA 3EWUA 4N6EA 4X9YA 1PWLA 1TREA 3KVLA 5TD4A 2A21A 5K9CA 5D09A 3W25A 2CW6A 4M0XA 3QHOA 3NM1A 1SFLA 4CEUC 3WLIA 4JIQA 3KVMA 2R1NA 2QCGA 1E9IA 3OQ8A 1IEIA 1LBMA 5B80A 1JRBA 3VIKA 3TAOA 2XU2A 2QJJA 1UCWA 3NVDA 2NQJA 4J3ZA 3DBPA 1EQCA 5PTDA 1K8ZA 4AEOA 1TPFA 2OQHA 1F73A 1P43A 2WJFA 2VEKA 1IXOA 1P48A 2C91A 5BOOA 5DT5A 4DJEC 3M0XA 1KLYA 1JL8A 5ECUA 4OBRA 1A5MC 2PWGA 2V5DA 1EDGA 3W7KA 3XISA 1UWQA 2E6YA 1JGMA 1QATA 2VMFA 4KEVA 3CMGA 4PTDA 4WDXA 3NQCA 4ZSTA 1JPDX 1FHLA 3C56A 1JFHA 3DYPA 3EOEA 1J18A 4Q8PA 2X7VA 4C6IA 5D9OA 3TA6A 2Y24A 3EMZA 2OEJA 1A5OC 4B5XA 1E43A 3U3HA 4NX0A 5FL0A 4FSAA 3IJ7A 2XIBA 4DJFD 2YA2A 3PTDA 2XISA 5D9NA 4AB4A 1K02A 3L4XA 4GLEA 3H8AA 1GQKA 1I4NA 1PPIA 3QHNA 3WJSA 1UR9A 1MEIA 4PRWA 3BZJA 2VR5A 4FHAA 3R8HA 4H8HA 1X98A 3W71A 3PFRA 4R85A 5GNYA 1EOKA 3FYYA 3K2GA 5CC6A 9CGTA 1JQXA 4F79A 4AF0A 2I5GA 3ES8A 5EB8A 1K03A 1SMAA 1W9BM 1IXPA 5KZEA 4PCTA 4UFLA 2BS9A 4V33A 2BZNA 2PZ0A 1HX0A 2C7FA 3NO5A 1ZGDA 3P62A 1T8XA 4J3UA 4HA3A 5C0QA 3CPUA 2JGQA 4RV8A 1JDAA 3S9ZA 3N6JA 1P0EA 1A0DA 3FSTA 1CXHA 4G1KA 3GDMA 1GJUA 3BOLA 2RDTA 4XISA 4QIUA 1A5SA 1ZL1A 3HIJA 4UTKA 3TA9A 4KCTA 4ZB5A 2AQVA 3S8HA 3WF0A 4JY9A 2PAJA 4LCSA 1QO5A 1XLKA 2HSAA 1ODZA 3PNUA 3XIMA 3S42A 1NH6A 4AIUA 1GKPA 1KXHA 2VZOA 4Y9MA 4MWAE 4JTDA 1CCWB 3LCFA 3A3WA 1KTCA 4PMJA 1UB3A 1GPFA 3PY2A 1JF6A 1PZ1A 5LNWA 3Q58A 4XAGA 1VBHA 4IQEA 1P0DA 2RJHA 4RXGA 1DEDA 3KWXA 5A1AA 1GVSA 3W83A 1QOQA 3I7QA 3QFWA 1AK5A 3VGFA 3N2CA 2OLHA 3UY7A 4HNCA 1EQPA 1UR4A 1AVAA 4J1OA 1PYFA 3S1UA 1ISZA 3TTEA 3F2CA 4LQ1A 4CLMA 1TPB1 3DFYA 3QKEA 1PX8A 5CQ1A 3L9CA 5HOSA 5CPLA 4MZ8A 4FLSA 1DJGA 1J0KA 3THDA 4QSHA 4NL1A 2F38A 1KXTA 5D30A 4GYPC 1ISWA 3VCRA 2DIEA 3O0KA 1GQLA 3NG3A 5IDIA 4JBRA 3AS2A 1OZMA 3JVAA 4FLOA 1XC4A 4GVFA 1FUYA 3GDBA 2P1FA 3SFKA 3II1A 3P3BA 4GE8A 1LF1A 3HQPA 3C3UA 4OV9A 1Q2RA 1E1EA 1UZ4A 4AMAA 1GONA 1FWSA 3IJ8A 2Y85A 4LS1A 1E0TA 1JEZA 2P0IA 1QI4A 3C2YA 3L21A 1MWOA 4JQAA 1BD0A 4FP1A 1V3KA 2YDSA 1NQ6A 1J0IA 5BXTA 3EKGA 1JYWA 5F2GA 2NUXA 4YTSA 6A3HA 4DUWA 1VQTA 4KFOA 1TE1A 3DFOA 3GH4A 4ATDA 2FYMA 1EGZA 3SSJA 3RLUA 3AHTA 3VCCA 3SCPA 3OU8A 2XN2A 4OQVA 4BR1A 4DELA 4R5EA 5LNRA 3I7RA 4XUYA 2UZ9A 3PHAA 3E0WA 3ANYA 4MADA 5LIKX 3CT2A 2JKPA 1GZ1A 5D8WA 4JNMA 4D1IA 4H41A 4GCAA 4JKKA 4JD4A 5K4ZA 5HPOA 3CAKA 4JYFA 3SQLA 3T44A 4LB4A 3F5LA 4LFYA 3O6AA 3ELFA 3FJLA 4LAKA 4KWVA 2BNJA 3M5VA 4H8UA 2WSRA 3EWXA 2D0HA 3VCNA 1S5TA 4TTGA 2DIKA 3DC8A 3MP5A 1XCXA 1U83A 1V0NA 1BXCA 4WR3A 3JZEA 2QAFA 3KXQA 2CC0A 3WQEA 4JQ3A 2V5JA 2Y62A 2W67A 4DO6A 5HMFA 2DSZA 1V79A 1RAKA 3B0XA 1Q3NA 4GJJA 3QZAA 3GDTA 1WQ5A 2Y61A 4HOWA 1LG2A 2NXIA 4LSBA 4KWSA 4XQ6A 1LQ2A 1C93A 1TPWA 1QW9A 3LA4A 4TTUA 3T0TA 3RU6A 2B4GA 3EWZA 1G4SA 1HKVA 3GXMA 2JKAA 3VIHA 4GKTA 5DT7A 2C1IA 3S3GA 4QFUA 4DWSB 2HBXA 3L4UA 4XSMA 1O5QA 3OA5A 1H7XA 4JTUA 4QROA 1BRLB 3BPWA 4I3GA 2OJPA 4O1EA 4CN4A 3BAWA 2IPGA 3PM6A 3H2AA 1R30A 4C6JA 2QDGA 2OZ0A 3W7EA 4CNPA 4MB4A 2VFDA 2Q02A 4FLRA 4AHQA 3C0LA 2J8GA 2PP1A 1ONXA 4UQ9A 4UUIA 3B9OA 3SY1A 5LGXA 1RJQA 3AC0A 4H9XA 1GTEA 1NFGA 4JN7A 4NYYA 4N4QA 4LOCA 2FVKA 1S3TC 1FDYA 3HFYA 1FWRA 2H3DA 3T8LA 4LYKA 1OFAA 1DVJA 1XI3A 1SMDA 3GU1A 1W1VA 1A5UA 3CV6A 3ZLGA 3HA1A 1PV8A 4MUPA 5A8GA 1MZHA 3VOGA 4IG2B 3DG6A 1KM6A 1UR3M 4IMCA 4Z1YA 3ZT6A 4Z2LA 1V02A 3T7VA 1M5WA 1W32A 3I7SA 4HTBA 1HP5A 4JEQA 3QBUA 2FLIA 3PBVA 1OSEA 3BLKA 4GH3A 4O12A 5F1UA 3W3OA 1L2QA 1BTCA 1VKFA 3RO8A 2HPIA 8CGTA 1Z32X 1TV3A 2VZSA 1OABA 4QAIA 4M56A 2FZMA 1J96A 5JXQA 3EOSA 1NSJA 5AHMA 2NWSA 1J2BA 1AQMA 1GVOA 3UESA 2PRLA 1OK4A 1MYRA 1JZ8A 1C8QA 1LWJA 3AXHA 4WXZA 1IR1A 3KDNA 3OOQA 1JPIA 2JK2A 3ABOA 4O1CA 5K7JA 1UJQA 1IZCA 1PB0A 4JCMA 4FA3A 3TV8A 4E2DA 3NPVA 1DHPA 1WDDA 2NVAA 4QCEA 3VKJA 1LOLA 3MA8A 3N9SA 4EF9A 3HBLA 1DJYA 1VJZA 2DUZA 2VRQA 5D2YA 5DRCA 3WLSA 4NJKA 3VTRA 2GVEA 3CUHA 4KWOA 1LZOA 3W6MA 5HMSA 4ILSA 3RX4A 5E9XA 4MB1A 4HKPA 2A4AA 4CCEA 4HZ6A 3DEQA 4CD5A 1WDRA 1CGXA 3LQLA 4FOKA 1UHVA 3RITA 3VO0A 1JNEA 2BWGA 1MUWA 4NUWA 1KCLA 3ENLA 2GJLA 1LL6A 4O28A 1EF3A 2CPUA 3ZM8A 3V4BA 3NPWA 3HPFA 1J5TA 3A3HA 1P7TB 3Q94A 3PZNA 2E09A 2QHAA 4O11A 4IQDA 4NF7A 2OR2A 3TAKA 2IXUA 1DQUA 3WLRA 1GYMA 4GVIA 4PSRA 2WO5A 3D3FA 5F1VA 4AC7C 4AU0A 2D3LA 5CSYA 4AD4A 4JYDA 4Y6GA 1RH9A 4GC3A 4PA8A 3QLLA 5CC7A 5CPOA 4L9YA 2F2HA 4NZ4A 1TRIA 1JRCA 1SW7A 5EMLA 2YXGA 1ZUAX 3AXIA 1ZALA 3G1FA 3O9NA 5CPSA 3SCSA 1R3TA 1RXOB 4NKCA 1Y5XA 1V08A 3NQEA 5C9RA 3UNDA 4TQTA 3TK7A 1XS2A 1E6XM 3GVGA 3A3XA 3WEOA 1J10A 3GNDA 3C86A 3WD4A 3CQIA 1VGAA 1A3HA 3ABXA 3BAXA 3SZ8A 2QVHA 1XSJA 1F5ZA 4JHMA 2QJIA 2VC7A 1I2NA 1H0GA 4G7FA 4O17A 2WBKA 1EYWA 2PFHA 4QEEA 1C7SA 2PGWA 3CYJA 3ZVIA 1NIUA 4Q7IA 3WQWA 4ZSUA 4IPPA 4RDYA 3LPPA 3N2TA 4KFNA 2J9XA 5BZAA 1XIBA 5C71A 2VDIA 2PGRA 1MW1A 4L6DA 4RPPA 4P61A 5CPTA 4JZ5A 3BWWA 1KM5A 1VCFA 2PDQA 2QGYA 2NQ5A 4CU6A 3WF3A 1EZWA 2I7GA 1J93A 4RE0A 2J88A 4JNZA 4E8CA 2RDXA 4ZO7A 1KBJA 4J27A 3CL6A 3T2OA 3QRHA 4LAMA 3TMQA 3T09A 1PDYA 2NWRA 3O1NA 4JY8A 3CO8A 4GBUA 8XIAA 3TFXA 1TTQA 3KW3A 3JUGA 1Y8BA 3DERA 1MI3A 4NI8A 4CU7A 3W9ZA 3WDPP 1OCQA 1PX4A 2O9TA 1K70A 3S1XA 2DSKA 3LBOA 4E2OA 3WKZA 1W1YA 4X9SA 2Z1KA 3NDOA 1V03A 3C2RA 1TV8A 3VOJA 1YKWA 5CGQA 2G3FA 3W70A 3CO4A 3LRLA 3V18A 4YN5A 3OBEA 4KCWA 4EVZA 4XZWA 5LNVA 1OX4B 1G7VA 4AX7A 3EOLA 4HHMA 3U2CA 2GVGA 1HQTA 2BSLA 4XO6A 1P7TA 2QCFA 4JTJA 4O4VA 4WUIA 3GFYA 1HXJA 2J62A 4G56A 5A6BA 3TC6A 4JTQA 1JD7A 3CLWA 3JS3A 3NQBA 2PDYA 2GDUA 3O16A 5G1MA 3T78A 3A5VA 1Q65A 5LIXX 3R25A 1YHTA 3OQEA 3KBJA 2FGBA 2VUNA 2OB3A 4GPNA 1L6YA 1KQZA 1R87A 1OYAA 3CQKA 3DH7A 4DIAA 1F3XA 2ZTJA 3L68A 1ZENA 1WP6A 3VABA 1V6WA 3FV9A 4KRUA 3ARQA 4GO9A 1VAHA 3W7LA 2VRJA 3LGGA 1J01A 3LZ3A 2QF7A 2XG9A 4Q4OA 3DGRA 2G97A 5IDZA 4AZ5A 2DT0A 3SCWA 2HVOA 3OVRA 2E5DA 1V0MA 1W37A 3GHUA 2ZZ5A 1JZ3A 2GJXA 2FHBA 2ZZ3A 4AEFA 2E40A 3LMYA 4XO7A 4M29A 1HF6A 3MKKA 4HPJA 3WBYA 2PC4A 3M5ZA 1S1RA 4AUBA 1NFPA 4HCDA 4JHOA 4AZ7A 3W1UA 4LNYA 5A6KA 3WDRA 1O4UA 3TN4A 2EPNA 2WMFA 5EU9A 4J40A 4LVBA 3NGFA 2HWGA 4GYFA 3E0VA 4XVDA 4B2DD 1O5RA 4RZ5A 1TCDA 1NVMA 5FJTA 2YB4A 1D9EA 1FHDA 4AHPA 1MW3A 2FB3A 4WJ8A 2WMIA 3GFZA 1FFRA 4PBEA 2FGLA 4HZ7A 2WXDM 4BA0A 1L6WA 4EIVA 3V3WA 3TFCA 3PB2A 2XDFA 1OT1A 3LM7A 3VM5A 4GYJA 4HNLA 1Q13A 1LRQA 1IYXA 3TYZA 1K7EA 2D2OA 1LRNA 2OVLA 2Z2UA 3IARA 1TJPA 2ZUNA 1BWKA 2OLSA 1EJXC 5ENLA 4RR4A 3QY6A 4R7OA 1RQHA 3RPDA 2ZRWA 4JQ4A 2VC5A 5MF5A 3UG4A 5AHFA 3OLDA 4MFEA 4XZBA 4ONVA 2Y8VA 3F4NA 2IKHA 4RL3A 3MHUA 7CGTA 2XVGA 4DUXA 2QCHA 2RKXA 1O66A 2V6AA 4GVGA 3N4AA 2WNWA 3BARA 2RUSA 4F48A 3OHMB 4KCVA 1C9DA 2X41A 2CLLA 2NV2A 1IEXA 2VQUA 1K8CA 1XXXA 4AVFA 1RBOB 2ZICA 3LZ5A 4ZR8A 4NAFB 2ZWZA 5EYWA 3KBMA 3N13A 4G8TA 1V3HA 1KRMA 3MMWA 4AX6A 1UR1A 1LCOA 1R9ZA 1VC4A 1CLVA 4F2TA 1ZTVA 3RM8A 1G1YA 3I3DA 4WDTA 4CGTA 3EGJA 3AHZA 2GJXB 4HPXA 1KM3A 5EGRA 4W93A 5BRBA 3TLLA 3B8SA 3AZSA 4ML9A 3RR1A 2XM1A 4N9BA 4PBFA 1AJ2A 2DT3A 1GEHA 3NPUA 3A12A 4K36A 4AWSA 4MAVA 1XYBA 1GGOA 5E5CA 3NZQA 4LV9A 3MQTA 1A47A 2QCLA 4BI7A 3P14A 2WMJA 2ACRA 5HWMA 4Q33A 3QR0A 3ITTA 3WFAA 4KMQA 4Z1BA 1G6CA 1UH4A 2HCVA 4JPGA 3LCIA 1E6ZA 1OHLA 3BZGA 1R86A 3LV5A 1ADDA 4IGNA 4Z1AA 3CBWA 3KZSA 2CFFA 2BDQA 1UD2A 3KBNA 4GH1A 4IZGA 2PF0A 5FEWA 3AOFA 4HN4A 4LYQA 2V3DA 1K9EA 3AMDA 4PUDA 4UCGA 2Z6IA 3NQVA 1X6NA 4XKMA 3H7RA 2PWDA 3PJWA 2XIMA 4UOQA 4JR5A 4G7EA 4B91A 2A3LA 4MLJA 4IIEA 3WD0A 1RK6A 1TO3A 3CQ0A 2HNEA 2WAGA 1UASA 2ZVIA 4GGBA 1XL9A 1ITXA 3QQ0A 1VJSA 3F03K 4MGGA 2NZLA 3HMCA 3FA4A 4CD8A 1S2TA 4F2BA 1VBGA 1KQYA 1J11A 2FMOA 1RP8A 3G1XA 5AVNA 2EBNA 5LIYX 4F66A 4MJ4A 4D6JA 2VDGA 4AW7A 4GWEA 4M1RA 1V6TA 2GK1B 2DGAA 2PDJA 3E1F1 1C91A 1C29A 2DZSA 3BXWA 3HG5A 1FP8A 3L5AA 3W7JA 3VMPA 4IFKB 3A24A 1H11A 4L6OA 3OO2A 3STPA 3CUXA 4HHPA 4B5TA 3GBEA 2P0OA 1F74A 1KBIA 4FALA 3A4AA 3MPGA 1IXNA 1WA3A 3SO7A 3CAQA 1CTNA 2VRKA 5B7ZA 2NQHA 3N9KA 4FXRA 4LWWA 5G1TA 1XF0A 3IJLA 1TTPA 2VELA 2YYUA 2C14A 3VVGA 4DN1A 1G7UA 1WAUA 3DG7A 2CZVA 3DFQA 2AGTA 2NX9A 3IIXA 3VMOA 5I5RA 1WPCA 3W2MA 4ZQPA 1JI2A 3EX1A 4H7CA 1YNPA 4IGMA 4R88A 1ZJHA 5FA5A 3OLEA 1CEOA 2PDHA 4RDZA 4NIRA 1OJXA 3AI0A 1D8WA 1TTJA 3LDVA 3B0YA 4LV4A 2J7FA 4F3HA 5EPDA 1GOIA 4O0QA 1UWUA 3EX3A 3PULA 4BHYA 1Y5WA 2F6KA 1C7TA 2JF7A 4CVWA 4K7VA 2XFWA 3L12A 3ZYZA 2OELA 5E09A 1OADA 4JTHA 1XG3A 3M46A 2HS8A 4MNMA 2HJPA 4I5UA 4ZOCA 2WLZA 3KL3A 2WM0A 3M0YA 1Q7MA 4EX4A 2E68A 3QQWA 4ASTA 2X1SA 1OINA 4UR7A 3WQDA 4I90A 1P1MA 3CH0A 5LZLA 4KCUA 1AODA 3G1YA 1RQBA 4CCDA 1D8CA 4PL1A 3GUWA 3TWAA 1WXYA 3HU7A 2DY3A 4E8DA 7TAAA 4MLRA 4G6CA 4QNEA 3N3MA 3WLHA 1V3IA 2OKOA 4C91A 3GXNA 4XVEA 3W7DA 5BWFA 4NRRA 2I9EA 4BQ3A 5JU6A 5DMMA 5TQLA 3VKBA 3BDKA 3H70A 2I5QA 3K1GA 3MSDA 3R13A 5DY3A 3N4FA 2J24A 4ATWA 3BJSA 2FB2A 4F0SA 4W87A 1XRTA 3GYEA 2DZAA 3M43A 1FTXA 3TJIA 3WDJA 4QS6A 4ZODA 2ZKMX 4AZCA 1EJTC 3W7RA 4KGJA 3W7MA 3OLIA 1OC7A 1KR0A 3BLOA 1H4PA 3EX2A 2V3FA 4TUFA 3H4GA 1TB3A 4GI4A 4HPGA 3MVTA 5CC5A 5H2ZA 3UWEA 1TVPA 3EA3A 4YYCA 4YU1A 1A5NC 3SY8A 4KWUA 3GG1A 1UD3A 2VR2A 3CWNA 3SGGA 4QGCA 5LIWX 1UH3A 1G67A 3NYDA 4I6KA 2KX9A 4IX2A 1E5JA 3ECQA 2ZCGA 4J28A 1FCVA 4PMZA 2PDCA 2FJKA 2ONEA 5AZ0A 4C6MA 1UKQA 5TAOA 2WHKA 4DBWA 3FCPA 2YOCA 4QG8A 4MWAC 4XD5A 1X38A 2OX4A 3URAA 5EFFA 2RHGA 1YYAA 2VUYA 2JBMA 4C6CA 3MUY1 1QPNA 3N18A 2BFGA 2Y5JA 3AIQA 3W74A 3GTHA 2PDLA 4QITA 1J9YA 3M0ZA 4WGXA 4K8GA 1RPKA 2QUVA 3U2OA 2X1RA 3LRKA 2CBVA 2B7QA 3D5HA 1R3VA 2A1YA 1RR2A 3UZJA 1OIFA 2VFFA 7PTDA 4MG4A 1QASA 2JEPA 5TIMA 3SGUA 4B5UA 3VINA 5AHEA 2PWEA 5HNUA 1IZKA 1VPXA 2QUNA 1W6TA 5DCBA 1Q85A 1LQAA 5FCZA 3DI0A 3BGAA 4WKHA 4FNQA 3N14A 2PSNA 5CC3A 4JNYA 4LRSA 3LCXA 1VYRA 3UPWA 1F2JA 3NL3A 5CZTA 3RR4A 3UZWA 2WPGA 3IVTA 1JDFA 2BVTA 1SQ7A 1ZBCA 3VI2A 1VBJA 3WQVA 3LGEA 1JZ2A 2MANA 3LLFA 2FZBA 1A4MA 4K6AA 2X0YA 4Z2GA 3FJ6A 4IMGA 1JCXA 2HEJA 1R47A 3RG6A 3PZGA 5MKGA 2QCNA 1FQ0A 2O0TA 2PDWA 2IPFA 1UKTA 3S46A 3CPRA 2X1IA 4AD2A 4Y2WA 4W9TA 3M7WA 3WQPA 2GVYA 1AMKA 4NJJA 4GZJA 2J79A 1W5OA 3UNTA 2RGMA 2DQWA 3SECA 1LDCA 2WKLA 4AVOA 1IGWA 4JQ2A 4IJCA 5BXSA 2PLKA 2BXYA 2GUYA 1VHCA 3DYOA 4ERAA 3OA3A 2J77A 3CWHA 5AHIA 2PC8A 3WUEA 2CLEA 4DPPA 1RQEA 2YZ5A 2ODOA 4XKYB 3HN3A 2UY4A 1TX2A 2FZ9A 3G18A 2FDSA 3LHZA 3WD1A 2XH4A 1HJSA 2O56A 3VD7A 1KGWA 3NQGA 3ARXA 4UTMA 3BOXA 1QAPA 1KBLA 3M64A 5H8MA 4X22A 2QV4A 3L2MA 2CIPA 3SUUA 1WDPA 1Y7VA 1BYAA 4EOUA 1VBRA 4A29A 2NVCA 4XWUA 3CAWA 3ARWA 3R6IA 1EPVA 2PDPA 2YB1A 1FFQA 1EFZA 1R9YA 3UP8A 4G5DA 1KNWA 3KCOA 5B7YA 1TIWA 3LNPA 3BJTA 1XBYA 5REQB 1T96A 3LPGA 2HE5A 1A5AA 2CBIA 4O14A 4ADSA 3EOOA 3DHDA 4HK7A 2O7QA 3CGTA 2WSQA 4I5RA 2RAGA 3NQ6A 2OZTA 1XYLA 2V63A 4IIGA 5DRIA 4C1KA 2DZBA 3REQB 2BX7A 3QEZA 1XYFA 4PCPA 4ZENA 4Q4RA 1AD4A 4DZHA 1RD6A 4WLCA 4HU0A 2VX4A 1HJWA 4ML4A 4GXPA 2A3BA 2DU2A 2WZIA 4MWAB 1V6YA 3N4EA 1GVFA 1I9CB 3P5ZA 4GI8A 1OZQA 3BANA 3GNRA 3AXXA 3CIWA 3QGVA 4NU7A 3W1TA 2J7HA 2UWFA 1DXFA 1DBTA 1JFXA 4CNSA 1W1TA 1SO3A 4M6VA 4NJHA 5LIUX 1RUSA 4N02A 3HQ1A 1XR2A 1TMHA 3AYRA 2VHLA 5F4WA 4ORIA 3DFSA 1R3SA 3N19B 4PH6A 1WKYA 3SW6A 4ROPA 4ERIA 1UWSA 2ZX9A 4MSSA 4CNNA 4GQBA 5FJJA 3GNNA 1PBGA 4D8LA 2TMDA 3DGBA 2XIOA 3CV1A 2C0HA 1QI0A 1WZMA 3GXIA 2CERA 3U5UA 4NNBA 1V93A 5HQLA 5A6AA 4HYVA 2WW5A 4DXXA 1GTHA 5CPMA 3GH5A 1N8WA 3CHVA 4YL2A 5C8BB 3P7YA 1UG6A 2D23A 3GQYA 1L8NA 3G77A 1TQJA 1E56A 2CCRA 3MI6A 4KBXA 2P50A 3IJQA 2W3ZA 3RHGA 2NXHA 2BP1A 1BYCA 3MMUA 3WK1A 4AD5A 1AW5A 3E9AA 3M6DA 3QGAC 3B04A 5DF0A 1CPUA 2BVYA 3QSTA 1ZP3A 3T81A 2C3ZA 1ISVA 3QPEA 4PFHA 4PUJA 5FJUA 3PWGA 3BCDA 3LGDA 4JX6A 4IUGA 1UIPA 1C8VA 3EWYA 3HOJA 3WF1A 2J47A 4HA0A 4I9AA 2V9DA 2ABAA 1CGTA 3E0IA 1MFUA 3DFHA 3AS1A 3W27A 4B9YA 4U33A 3SUTA 2H6RA 2CZFA 2RDWA 4DX3A 5T9BG 4I6VA 3G0SA 3BSGA 4AZBA 2BY3A 4N4PA 2OG9A 4BKNA 3STCA 1DIDA 3PUEA 3E6EA 1TWSA 2X2GA 3HV8A 1CYGA 4L65A 1L8PA 1I0DA 3RRAA 4DXVA 1QFEA 3BAIA 3CNYA 1ZU8A 1B54A 1JQVA 7A3HA 5D9MA 3KX6A 3ZWSA 2AOSA 5LGZA 1UR0A 1VRDA 4NNAA 4JIHA 3EXTA 2YXOA 2P76A 3C2VA 1U2YA 4DZIA 2FZ8A 1XLBA 5CLWA 4MJMA 1H5VA 1ZSXA 3TXZA 1UC4A 3W82A 3VFCA 4GINA 1HL2A 4DY1A 3MUCA 1HNYA 4DLMA 1KM1A 1XLAA 3ITYA 1W2VA 5I3KA 4AWTA 2FPVA 4FPSA 1Q5MA 3H12A 2F7FA 4GFSA 2YR1A 2ZFAA 4P8VA 1GZJA 3K13A 3KBWA 1IWPA 2ZZ4A 1RHCA 1BF2A 2BY2A 4QAWA 5F4SA 5EMKA 2DP3A 3WX7A 1CENA 3GW3A 1BXNA 1CDGA 2XSAA 4WZHA 5C9WA 2QZRA 4K37A 4UTWC 4GVHA 2WKGA 3ABSA 2ZX5A 4Z0JA 4CNTA 4JDBA 4L9XA 4AVNA 5DQPA 4JTKA 4WKAA 3BLIA 2G4JA 3VD5A 4ES4A 4CNUA 4TMCA 1NOWA 3TOYA 3BG5A 4OUEA 3KRBA 4UNLA 4UFJA 4BQ2A 1RPXA 2O9RA 5A6JA 3APYA 3S9YA 2PWHA 4PMOA 2RH9A 3W1AA 5FJPA 3EPNA 3HG2A 4L7ZA 2DT1A 4S3KA 5A8OA 1QTWA 3T4WA 1F3EA 2Y0FA 3ONBA 3C4UA 3L0NA 1PXGA 1TG7A 5H1WA 1V4YA 4GY7A 1R8LA 4J2PA 3WMBA 1ISYA 1H2JA 1EJVC 3RNDA 4AZIA 4J3SA 1Q7ZA 3NR0A 2J13A 2BBFA 3NQ2A 2GUBA 3MSRA 3R4IA 2ZA2A 2O55A 2R1LA 4PN2A 4JOMA 2QS8A 5J04A 1VFTA 3QW4B 1EGMA 3HFTA 2Z7GA 2G3IA 3T4CA 2QR6A 3L5LA 4TX6A 1HO1A 5JVLA 1ESWA 5IRPA 3TUUA 3RFAA 1XSIA 2VXNA 1N7KA 1PTGA 1EB3A 4F9JA 5AYXA 5HNNA 5T8GA 3RPMA 3LK6A 2EPLX 3ABRA 4JXCA 1XSKA 1S5VA 2CLOA 3TOPA 3FDKA 3R10A 4MDPA 1XLMA 2ZA3A 5G4HC 4PTVA 1FDJA 1CI1A 2A3CA 3UWZA 1RBLA 4B92A 2ZUTA 2E5CA 5HBFA 3CUJA 4QRNA 4U5IA 4FNRA 3M4HA 3IIVA 1TVNA 4OJYA 1UPMB 3G8RA 2IXVA 4A3HA 2TSYA 2HQAA 3LN3A 2WM1A 4IPNB 5CZ0A 5J5RA 4O52A 3ATZA 4OBSA 3V16A 4GKLA 2Y8UA 4JYEA 3W6LA 2VZUA 1VENA 1HFBA 4AXKA 1NARA 4IMDA 1BAGA 2YKKA 1XQLA 5HANA 3LG3A 3CMJA 3GFXA 4GD0A 1RV8A 2V38A 2E1WA 2E77A 2DH3A 3M16A 3W28A 4GUIA 4YYFA 4MJZA 5DANA 3IWPA 1ITUA 1H7WA 1NFBA 3GTNA 3MYPA 1GEQA 4GIEA 4UC5A 4RW3A 1CXLA 3QGKC 4O0ZA 1PIIA 3K30A 4YTTA 2DZUA 4GNVA 4W5UA 4UTHA 3PP7A 3E38A 3UG8A 1VYSX 3STEA 1ZBVA 1BPLB 2YBUA 3UZZA 3ALFA 1YADA 4ZB2A 3UYCA 1K6WA 1LJYA 1WZLA 3P8IA 4X2RA 1LWHA 2YXXA 1W1PA 1CB2A 2VENA 1VFHA 1NWSA 1HL9A 1ZCOA 2XVPA 3GXPA 2WMGA 1JNDA 3VIPA 4RLIA 2W5FA 2PI6A 1CW2A 4XAFA 1AQFA 3E2VA 3VYLA 4ZEPA 3U0HA 3WY1A 5D05A 4N2YA 3R7MA 2VFHA 2Z4GA 1P0KA 4H9VA 1UROA 4E0CA 1E6RA 4EWJA 1ONRA 1WAWA 5KINA 3A64A 3ZSTA 1N82A 1PKNA 3ARYA 4YWSA 2G37A 2YIHA 3S5YA 3N12A 4AWEA 2XPKA 4E8GA 3OGRA 4UTTA 1IT0A 1ONWA 1JJKA 4HMDA 2VGBA 4I9JA 2JIWA 5K3VA 2V8ZA 1VFMA 2DJXA 1CB7B 3PZ9A 3U8GA 3W22A 2VEFA 1Q6EA 3LI1A 4GX9A 3GTIA 7XIMA 1RY8A 1X7IA 2VEMA 4PEKA 2HVMA 1VHNA 5LXXA 1KKOA 1K7XA 1OG6A 5I3FA 2WHLA 2KZHA 4HA4A 5XIAA 5LA2A 4QX4A 1E6QM 3AMGA 2OSYA 3QVQA 4L6HA 4IMFA 3FIGA 1NP2A 3SAZA 4J3VA 3IUHA 1XM3A 3W7NA 2QMJA 3CV7A 2WV8A 4GFIA 1HKWA 2Y5EA 2IMRA 2A6LA 1KTNA 3MVIA 4PRTA 2IW0A 4IL0A 5FAJA 2AL2B 2PZNA 3RLHA 1EO7A 1M68A 2OODA 1EHNA 3EBVA 4UR9A 4XSLA 6ENLA 3GTXA 3CQJA 3GB6A 4HTYA 1WZAA 3MSYA 4MWAA 3THAA 2JF6A 3VOIA 3UR7A 4FZIA 1PL9A 1W2PA 3HV9A 4ICMA 3P67A 4HJWA 4XBSA 1CLXA 3AUOA 5KTLA 4DM2A 1GYNA 4AQLA 3U4AA 1FH8A 3BAYA 1JYNA 1J8VA 1OC6A 2QXWA 3SM0A 5GJMA 5EFDA 3WLLA 1W56A 4YMZA 4UQBA 4P7RA 2XGBA 1DE5A 2XZ7A 3RX3A 3PZIA 4L9ZA 3B9DA 1Q4WA 4QDWA 1CZ1A 4UCFA 3TCEA 2ZUUA 5TF0A 2WZMA 2CWXA 4LYPA 1JF5A 5FJOA 4S2CA 4PUWA 4GABA 3P84A 4NAEB 3LS9A 2NX3A 4S3EA 4LBSA 1G94A 3KDOA 3TXVA 4QQUA 2YL8A 4EAYA 2DZXA 1U5JA 4B4FA 3W76A 3P82A 2OQLA 3F1QA 4JL1A 4MHBA 4A05A 4C6BA 4PUEA 3TU9A 4JTCA 3NYZA 3TLQA 1AW1A 2IS7A 3V35A 2EG7A 1JYXA 1NDZA 3TH6A 1T41A 1US3A 2J7CA 4PC8A 4YVXA 1GUVA 4DZ5A 2PLCA 1E4IA 3CLMA 4DXKA 3KRUA 3SDOA 4KW2A 3ARUA 4F0HA 1JUKA 3SRDA 3TYBA 1U5VA 3HQNA 1BKSA 2OU4A 1KCKA 2D20A 4UQAA 3WL0A 3TSMA 3MUIA 4JTIA 1DOSA 1G9HA 3T0BA 4GQ0A 3CZLA 4GYKA 3J7HA 1XDJA 1UP0A 2VNCA 4C90A 4M19A 4LXFA 1EX5A 5HAOA 2DZWA 3PC0A 2WHJA 1KWGA 2ZUMA 2VEPA 2PD5A 1M7JA 2G3MA 2RDUA 2HPMA 2WZEA 4XKYA 1KV8A 1G01A 2QIWA 1YE6A 3TC7A 3H2FA 1V7YA 4IM4A 3AIBA 3E2QA 4WSHA 4L1GA 1BYDA 1OCBA 3S5ZA 4IFOA 3FJ4A 4H19A 2WC4A 3BLFA 3LENA 5GNXA 3BAKA 1WUFA 5F2LA 1VFUA 4G7EB 3EB3A 1FX6A 5HNRA 1MDRA 3CZ8A 1LBLA 3DU0A 5HATA 3WIJA 4H6KA 3GUGA 4ZTYA 3H2EA 5FACA 2G41A 3KUMA 2DVTA 3CHFA 4S3AA 1PTDA 2AL1A 1F6YA 1X1ZA 2E6FA 3W1PA 4X2PA 4PTXA 1BGGA 4Z42C 4WRHA 3T2PA 1V0KA 4H2HA 2WJDA 4F0LA 1IV8A 1IWBA 4DB7A 4XBJA 1BSLA 4W5ZA 3N2MA 6CGTA 2Y63A 3DENA 2C19A 1SO4A 1H7NA 3UGRA 4D6FA 3E02A 3C2FA 3DECA 1PCKA 4TVUA 2ACQA 3REQA 4FS9A 2I16A 4IUOA 3AROA 5GJPA 3SN0A 1H0IA 3UJEA 4G1NA 3C5QA 3WL1A 5LSMA 2BXZA 4V15A 1V7AA 3LTPA 1J6OA 4ZMGA 1H63A 5F2IA 2EJ1A 4DUOA 1VFFA 4EANA 2X0HA 3M0VA 3SJNA 4C60A 3UJFA 3N11A 1XLFA 4PMXA 4GC4A 1EIXA 4LTSA 3GNPA 4DJDC 3PTMA 4L1XA 3QN3A 1YLVA 4C5ZA 3KP0A 4FIRA 2PS2A 4EAMA 2WSPA 3H21A 2YGYA 1JVNA 4XV0A 5AC8A 1DQWA 1PE1A 1DWGM 3AYTA 4JX4A 2FKPA 4PMRA 2PGFA 2YBVA 3GG8A 4D8ZA 2WHMA 1QNPA 2PD9A 2Y8KA 3P61A 1BTMA 2O9PA 1UIOA 2YDRA 4DM1A 2EJAA 3GK0A 4QTGA 3RM9A 4O4WA 3THUA 2VX6A 3CV2A 2NT1A 1IXQA 2D1ZA 3W2UA 4D6DA 1FHUA 4C1NB 5I24A 3KP1A 4O1AA 1I45A 4NVTA 4MNKA 3NO3A 2F2KA 3G6LA 4S3CA 3V7PA 2ZE3A 4U5KA 3WK3A 1EOMA 5AY7A 3QR3A 1V6XA 4BK9A 2I56A 1MUMA 2FVMA 2DSWA 2VZTA 1EC7A 3QY8A 1H7PA 5CZJA 2J74A 3AAMA 1HT6A 4PUKA 1LLZA 4NG3A 4UMAA 1CGYA 2A6NA 2VEGA 3H2MA 3ZVHA 3W23A 2QNEA 4QJ5B 3MBDA 1FXQA 3W2NA 3ZFHA 4C6QA 5BXRA 1GHSA 4IMEA 3VAVA 3G22A 2D24A 3OODA 5LYRA 3LI0A 2G8ZA 4QHRA 4DWDA 3LX9A 2C16A 1FWFC 2X40A 5EKYA 4F0MA 1KFKA 5E0KA 4P8WA 1Q6QA 5GQBA 1HP4A 5A6TC 3L4YA 3AHXA 5E93A 1PTAA 4XIAA 5FEPA 2DZTA 3RGTA 4RW5A 1QNVA 3VUSA 4TV6A 3F4CA 2IKJA 3CTLA 1A0EA 3AMKA 2ZE0A 1LG1A 2WNNA 3SQSA 5LXEA 4UR8A 3KRSA 3LCGA 1ME7A 3R0UA 3WSUA 3HPZA 1OCNA 3H23A 3VOCA 1M7XA 2ZXAA 1JZ7A 5A95A 4CQDA 3APTA 3D6NA 2W0UA 4P8UA 1ENUA 5M1TA 3NL5A 4ZVJA 3WQ4A 3H22A 5EMMA 5KITA 1EA0A 1H09A 3TZFA 2E5BA 2TPSA 1E51A 3SN4A 4RK8A 2Q8LA 4XD6A 3CB8A 3RN6A 2QULA 3T9PA 1XH0A 3VD4A 3W1QA 3B06A 3TN6A 1EC8A 1H7OA 4WD0A 1X8CA 5IOBA 2FH8A 2BOGX 3OG3A 3ARZA 3H2NA 4IPLA 4O1DA 1YTKA 3URBA 3FLUA 2GWGA 4IIHA 4B4HA 3WNPA 4LVDA 2FVLA 2PEVA 3RJYA 1ZJAA 1NELA 1TPDA 3RF9A 4JFTA 3E96A 3FY1A 3C6CA 5CSRA 2ZZ2A 4WY0B 4IISA 3RK8A 3EA1A 3OTRA 3PUGA 1V5XA 5BXPA 5ABFB 3L4VA 3GR8A 3MI3A 2YSWA 3U7BA 4ECLA 2EPKX 3IPWA 3W6YA 1UMYA 1KTBA 3OVPA 3MKVA 2WC7A 2HXUA 5HJYA 1RLDA 1AW2A 4P7LA 1IGSA 4PMYA 2XIIA 4YHEA 1TV4A 3T8QA 1BWLA 4YTRA 2INEA 1YE4A 3R12A 1DTUA 2ACSA 4JDYA 1VFLA 2WKJA 3GSMA 2B7PA 4JFVA 3QH2A 4ZQMA 4HCLA 2ISWA 4DJFC 1KB3A 2W6RA 4DRSA 1SO5A 2ZXDA 4IT1A 2ATMA 4OE7A 2IKIA 1JI1A 4DJDD 1ZAIA 1HG3A 1TV2A 3ZR4A 1XUUA 3GVWA 5C2XA 2BOEX 1SUXA 2W4XA 1OFOA 1RZMA 4QE4A 4A6GA 1XG4A 4YS1A 4LB3A 3O05A 1TKKA 3WQOA 2Y89A 2P3EA 3GX9A 3L2IA 3OZOA 2GOKA 5BU6A 1T99A 2J66A 3WH9A 3OIHA 5EMYA 4PMDA 4RNHA 5CGTA 3WBEA 2GWNA 3AS3A 3U9IA 5IHRA 1FBAA 1HO4A 4WX2A 2OWXA 1PHWA 2O4MA 3OW1A 3ITGA 1LQ0A 3UXIA 1KCXA 1NDVA 2YA1A 4H9UA 3DDMA 2Z2AA 4MOZA 3TYAA 1M3UA 4H04A 3KLLA 3QW3A 2PU0A 1ZJIA 3S2JA 3N73A 5G2HA 1HUVA 1JXKA 2WMHA 1U1UA 3P2VA 3VZYA 3WUBA 5AYYA 1XLGA 1EDQA 2VP8A 4FNUA 4AIEA 2EKGA 5CJMA 1QOXA 6REQA 2WZHA 3WN6A 2Q71A 1C90A 5KMYA 1PEZA 4OUIA 1Z44A 1I2PA 2Q3RA 1MFVA 3LLDA 2WJEA 4H8VA 3MWAA 1V3MA 1OFBA 2C15A 1NP0A 3VE9A 2INZA 3NWRA 2I57A 4A8NA 3NQAA 1OFRA 1PZ2A 3GZ3A 5A69A 4XAPA 3ZS4A 3B9AA 3P5YA 4AAJA 4IQJA 1TR9A 4NQ1A 5CLTA 4R7WA 3K4AA 3G1AA 4UFHA 3RX2A 2ADAA 4B5WA 2REQA 4FNPA 3AMCA 5DXXA 4X3ZA 5AHLA 3SR7A 2ANUA 1VFSA 1UOZA 3CEPA 4N9DA 2ZZ6A 3IACA 4LH8A 1VH7A 3AIVA 1JAKA 4R3UA 3OPSA 1DJIA 4LBUA 2P10A 2E28A 3VNKA 4DJDA 3UPBA 3CUIA 2C79A 3P80A 1XRVA 4QSFA 1UP2A 4K1WA 1A5CA 1G4EA 1SZEA 3W84A 4QISA 4G9PA 1V02E 1Y0EA 3WLTA 4ERGA 3VNIA 1OF8A 3S5SA 3MBFA 4AY7A 1H49A 1TV5A 5HULA 4R9OA 5REQA 4QJ1A 3UVAA 3PJTA 3VGEA 1EC9A 1S2AA 3VX1A 4KIRA 3EDFA 4M7SA 3STFA 4UMCA 2WNQA 1XGZA 3V0TA 2BLEA 1MXGA 4C1NA 1EWDA 2Z1WA 3NOEA 4GY1A 5I79A 4EPBC 4XZLX 1DIKA 2E6DA 4ZO6A 5U4NA 4H7VA 4CCCA 3BE7A 3TQVA 4ZO8A 4LYRA 1FA2A 1YBQB 2OKTA 3AHYA 1AD1A 2PUZA 3TQKA 1RA0A 1TUFA 5E1QA 5C9UA 5AYZA 1AFSA 1S5NA 1J12A 2XSXA 9XIAA 3WQGA 1I2QA 4HA1A 3H26A 5C5YA 4YPJA 1Z42A 3KVJA 2VFEA 2BG5A 1ML1A 4Y9OA 3RPTA 1EDTA 4DI9A 4IP4A 3AIWA 3LY0A 4WGHA 1VYPX 1XPGA 3HZ3A 3MANA 2EGZA 4B16A 1AJ0A 2FQIA 1NDWA 1HGYA 4HBKA 1WO2A 5K9XA 4J35A 5A94A 4CQBA 5CBIA 3VDAA 3BMWA 1YNYA 1W0MA 1R3YA 3GG0A 3EEZA 3WBXA 4FMVA 3WNLA 4R7JA 3WH6A 3GDKA 3UQNA 3ZOAA 4KIEA 3GKFA 3W86A 3T0DA 4YTUA 5BU9A 5CG7A 3WNNA 3CM4A 1KA9F 4RE4A 3WQFA 3UERA 2ALRA 3ICJA 3GIYA 3NZPA 3TW9A 3MO4A 1B3YA 4QE1A 2VO5A 1NY1A 1XBVA 6PTDA 3U6WA 2NUWA 5H91A 1FXPA 3WD3A 4CUCA 3WBWA 5CJ5A 3GM8A 4RE2A 2TRSA 4LC6A 6TIMA 2CLKA 5BNKA 4N7QA 3HGOA 1TE6A 1H62A 4MKSA 2EPOA 4XK2A 5I3DA 3RMEA 2J8FA 3WQ5A 2E6AA 3V36A 2V0TA 4NP7A 3AXMA 4GZ7A 3FKRA 3NQDA 1H1ZA 4M51A 4GQRA 4UFKA 3NA8A 1KD0A 1SSGA 2ISDA 4ADUA 3FW6A 4N6FA 1Q45A 4EPDC 1JZ5A 1SPQA 4C6DA 3VM7A 2Y7FA 2Q3OA 1I2OA 3F2DA 1VF8A 2YW4A 4G2DA 3F4VA 1TIMA 4KERA 3JW7A 1E0WA 4ENLA 3QOMA 4UTUA 3OB8A 1FVPA 3A9IA 2VQTA 3B8DA 1EA9C 3LEPA 3TR2A 1B4EA 3JR2A 3RAOA 3FOKA 5HUOA 1VEMA 3ISIX 1EEXA 3B0PA 2V82A 4K2SA 1T7LA 3SIMA 2QVNA 1FWEC 5C7VA 1VR6A 2D0GA 3ZJ6A 4H8NA 3O6YX 2PTXA 4RJEA 4XAYA 3TONA 1ZPTA 4GUGA 5EMUA 5FD0A 1PSCA 1L2UA 5FF0A 3MCMA 1AQHA 1EIBA 5J8LA 3ZZ1A 4AXNA 1DJZA 1UPPA 2VCAA 3PPGA 3QZEA 3IJIA 3BW3A 1XH1A 2PDFA 4UOZA 3B9NA 2CLPA 1Q6DA 2UV8G 1Z3NA 5IFPA 3G3MA 2X1TA 3GHRA 4YWIA 2X8RA 4ZL1A 3ORWA 1KBBA 3S6DA 1YPFA 1F9CA 4ZQNA 2CESA 3WD2A 2OLAA 4BI6A 4XX6A 3MMTA 1YXYA 4JTGA 1GOXA 4XTIA 1M7PA 1OYBA 1TTIA 3V75A 1DXIA 1OC5A 2DT2A 1R6WA 1VEOA 2PWUA 5JBDA 1M41A 3P0XA 3WNKA 1J79A 3WZ0E 4PBGA 1W1ZA 3VPLA 4HNUA 4R53A 3AZTA 1ZP4A 1SFJA 4DF1A 3V5OA 3DC0A 3N25A 2HTMA 1DIOA 2VEIA 1E6PA 2WVSA 1I0BA 1A4LA 2CEQA 3MV11 4OT7A 3WMSA 3TTSA 1XIFA 4D6EA 1B57A 3QXBA 3WDQA 5DBUA 4LVAA 4LAZA 1ALDA 2DZPA 4LW7A 4AYGA 1DHKA 3WH8A 4F0RA 2Y7GA 1EJUC 3LB0A 4PMNA 2EEXA 2W62A 4ZQRA 2ZZ7A 3F2BA 3PSVA 1XIIA 3NQMA 2AAMA 2GZXA 2Z27A 2EQDA 3AYVA 3C3NA 3R11A 1TCMA 3N6QA 2ZOXA 3VA8A 2C0AA 3CQHA 1QHOA 2VDHA 3NUKA 5D04C 1BG9A 5A6LA 4L4PA 5IXEA 3IVSA 2V3EA 3VGHA 3DUGA 2VWSA 1TR1A 2WK2A 2BHYA 1VLIA 1EWEA 4Q8QA 1Z6KA 3L0KA 4H6QA 1MXSA 2Q8ZA 1A49A 1XIGA 3A4WA 3GWQA 2CZDA 4DF0A 4GZEA 3VKAA 2Y7EA 3ANVA 4DNMA 4FLQA 1LROA 3S2LA 1F3TA 4DI8A 1O60A 5BCAA 5BYWA 2VD9A 5CKSA 2VVNA 1LT7A 2O9OA 3Q45A 5D8ZA 3GG7A 3R43A 4S3GA 3C2OA 3NOYA 3IK2A 4RUBA 1E40A 1CBGA 4UNIA 3KS6A 4O54A 5DN1A 3BGGA 3VOHA 5I3HA 2X09A 4K68A 1M9HA 4GCXA 4NXKA 1HKJA 1RVKA 2X30A 3B8UA 2J25A 4AZ6A 1E5NA 3CZKA 2PTZA 2WVTA 2PF8A 1R85A 5FJRA 1PS9A 3K8KA 3KL0A 3W85A 1R3WA 3PWAA 2AKMA 5ECVA 1B30A 2ZIDA 3G1HA 4DO7A 4HT3A 3M6YA 4JICA 4OZOA 3G5EA 1O7AA 3TSBA 1NJJA 4GQGA 1S38A 3LSCA 2GJPA 2XHYA 3BLDA 4A8RA 3BLEA 1JCJA 4NJIA 2OT0A 2CWNA 4L80A 1C3FA 2AKZA 4GIRA 1OD8A 2UY2A 1JGIA 4LVGA 4RX0A 2JFEX 3RCMA 2X16A 1F07A 5FAGA 3UWQA 4PB4A 1KRCC 4UWMA 4NJGA 4MB5A 4EPEC 2D73A 1PVNA 2H90A 3VDHA 2WNZA 4LUSB 4BQ5A 2QCDA 4HGXA 4J5NA 4M1BA 1PO9A 3WLMA 2D2JA 1RJRA 4W7UA 4Z2IA 1ICSA 3HPAA 4F9DA 3SI9A 2ZXBA 2CBUA 4IL2A 1JPMA 4E4PA 4HSHA 5MKGB 3E2RA 2OOGA 3FGCA 5FF7A 4H01A 4M3PA 1MVYA 5GNZA 3EB4A 5DXYA 3UFYA 4PODA 2ZX7A 4JTSA 2J7GA 1TMLA 3MC5A 3TP4A 3KS5A 4ROQA 3G0XA 3GU9A 3EDKA 3VIJA 4KEMA 3HG3A 3W7QA 3FJNA 3WO8A 3U7VA 3U4FA 1NM9A 4JAWA 3BMVA 1UUQA 5I07A 2FHCA 1EUAA 1UD5A 2Z0IA 2E1DA 3ZR6A 1VRXA 3DN5A 2ON3A 3E3HA 2BY1A 1GQJA 1X96A 1I2RA 3N29A 2W66A 1W5QA 1V3JA 2PURA 3AIEA 4D2JA 3KLKA 1CXEA 3IGXA 1M6JA 2BVWA 4JTFA 4MPQA 4P7QA 2V69A 3FN9A 1E73M 4J3XA 4GYPA 2ESCA 5EBUA 2CXGA 4GIYA 2PP3A 1X97A 2XYLA 2Z25A 4QS5A 3UWVA 4LANA 1FHVA 2WWDA 3RXZA 4GUHA 3GVRA 4GGHA 2PBGA 1AH0A 4U3AA 1Z89A 2V2DA 4PSPA 4FX6M 2NV1A 1U5HA 4TX9A 4R34A 1POKA 3FHAA 3AHVA 4I9MA 2QDHA 2XH7A 1KXQA 1DL3A 1XLJA 2EKCA 3T05A 3SJ3A 2ZBTA 1AH3A 1X1OA 4DLFA 3POHA 3CC1A 1AJZA 2BXVA 2PU1A 4L4MA 1OYCA 1UWRA 3TNOA 2EG6A 4N9CA 4GZIA 3T42A 4GI6A 1SU5A 5HQEA 3V5CA 5H8PA 1AL7A 3MP3A 4Y9AA 3CUGA 4H7ZA 4L64A 1RBAA 3DESA 3UWWA 2PDKA 3P0WA 4NHVA 1IT8A 4Q4KA 4M24A 3C61A 3FAXA 1PIFA 3NDYA 3VC5A 1P0NA 4AZHA 1GZGA 1B9BA 2NQZA 3C8FA 4D72A 2FHFA 2ZZ1A 1DJXA 3GAKA 5DBTA 3B03A 5HNTA 3TMLA 2WVVA 4Y9PA 5LA0A 5CBBA 4W8AA 4LX4A 2HMCA 1TSIA 1DWJM 2J78A 1BXBA 4PZVA 3N3TA 2IQ0A 2HV5A 3UW6A 2DFAA 2Y4SA 3NZRA 3SEPA 1DWIM 1F76A 1XIHA 3A5FA 3AJXA 1W3HA 4WY0A 4X0VA 2H8XA 1ME8A 1EJSC 4UTTC 1E0UA 4O13A 4OHQA 4O18A 1OF6A 3Q2DA 4L56A 4Z2KA 4Y7EA 3OZYA 4KEUA 5D02A 5DCEA 1TWDA 2GVJA 2VR4A 3FAWA 3LCLA 3MT1A 5FJIA 1B31A 1OGSA 4XZ9A 2EF9A 3Q67A 2QGHA 1F6PA 1I6NA 2R14A 4GJIA 1K9DA 4B15A 2YL5A 1JDDA 3QV9A 1CT5A 1EP3A 4KFPA 2EXOA 3QR1A 4AD1A 4QG6A 4B3KA 1PUDA 3W37A 2XZ9A 1NOUA 3LQGA 3WJWA 2OO0A 4AZGA 3E49A 4H00A 1W9UA 2OPJA 5C9ZA 2WSYA 3MCNA 1Z69A 4TR9A 4D1JA 4ZFMA 5I7GA 1LTDA 4NILA 1NOFA 3R8GA 4CNOA 3GLCA 1RLCL 2QIIA 3GHTA 1N8FA 4ZCWA 4UQDA 5AFDA 1EXBA 2NX1A 4PR4A 2B7NA 2D2GA 2QPUA