1FHLA

Crystal structure of beta-1,4-galactanase from aspergillus aculeatus at 293k
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
334
structure length
334
Chain Sequence
ALTYRGADISSLLLLEDEGYSYKNLNGQTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFAENDIDIEIISIGNEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDDGWSWDQQNYFYETVLATGELLSTDFDYFGVSYYPFYSASATLASLKTSLANLQSTYDKPVVVVETNWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAVVEATTDGLGVYYWEPAWIGNAGLGSSCADNLMVDYTTDEVYESIETLGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspergillus aculeatus beta-1,4-Galactanase: Substrate Recognition and Relations to Other Glycoside Hydrolases in Clan GH-A
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-1,4-GALACTANASE
total genus 123
structure length 334
sequence length 334
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhlA00
1QNRA 4PMXA 1UZ4A 2V38A 2Q8XA 1EGZA 4XZBA 1QBAA 4XV0A 3TTYA 3MUAA 3QOMA 4OBRA 4Z2GA 2BVYA 1GQKA 1CIUA 2JEQA 4MPKA 1UKTA 2HISA 3IK2A 4AXNA 3W6MA 3VIKA 4AZBA 2VI0A 3ARPA 2GJRA 3WD1A 2CPUA 2PB1A 1AQMA 4CU8A 1PZ2A 2Y4SA 3LMYA 1JZ5A 1XCXA 1OT2A 4ATWA 3QHOA 1NWUA 4FMVA 4FK9A 4AYSA 5CZKA 3A6OA 1LWHA 3ZJ6A 1US2A 3PBGA 4CN1A 4NF7A 2G4FA 4URIA 5A8PA 3CZEA 1V6UA 2WHMA 1SYTA 1GONA 1J10A 5GQBA 5CPSA 3NDYA 1W9BM 5HBFA 2CERA 4PEEA 3VD7A 4J3VA 4BQ4A 3M6DA 4P8VA 2PWHA 3NYDA 4PMRA 3CHEA 3BCDA 2XVLA 1B2YA 2C7FA 5A94A 3SUUA 2JF7A 1ITXA 1UWRA 4C7DA 3S6TA 4JIEA 1BGAA 1XRVA 2PC8A 5LA0A 1VFOA 1YHTA 1ECEA 5BXRA 1TUXA 3BH4A 1CWYA 1NM9A 1XYFA 2YDSA 3W29A 3BXWA 3GXDA 3WNPA 4LYQA 5I2UA 1QPKA 4MB1A 1BPLB 1G1YA 2XGIA 1GVYA 2RGLA 3BAIA 4B3KA 2VVNA 5TD4A 5BRQA 3KE0A 2WHJA 4XB3A 3PZVA 3SCPA 2UY5A 5FKYA 3VMOA 2E9MA 2GSJA 1DHKA 4MDOA 1E73M 1VFUA 5BXTA 3TOPA 4CN6A 3VNYA 1E4LA 4AD4A 3AZRA 2CKRA 2G3MA 2Y2WA 3VUPA 1NP0A 1W1PA 1CXHA 1OIMA 4BZYA 2O9PA 2WYSA 3ZR5A 2MANA 2GFTA 5CGMA 1OCQA 1UWUA 4PYSA 3SUWA 4M82A 2WWCA 2QF8A 1W9XA 3B8SA 2D3NA 7TAAA 1M01A 1RP9A 2WVSA 1NOUA 2WMJA 2E4TA 1F4AA 1CLXA 1UWSA 2VZTA 4M56A 3ARWA 1VFMA 4OKDA 4TXEA 3VGGA 1FFRA 5D8ZA 2B31A 2ZX8A 4MJ4A 1KBBA 3AYRA 3CUGA 3U7VA 1H4PA 1XGZA 3WSUA 1MXGA 1EIBA 4XZWA 3N17A 4F9JA 5CPTA 2WBGA 1E4IA 1EHNA 3POHA 3WENA 3L4VA 3TP4A 4WLCA 5FD0A 1CGYA 3AFBA 4JHOA 2XUCA 1XD1A 4HZ7A 1JYXA 3AISA 4CD8A 2E3ZA 1BFNA 3CH9A 4RE2A 1UQZA 3D3AA 1UH4A 3MSDA 4AW7A 1JZ4A 2VCCA 2CETA 2VRKA 2J7GA 4W93A 4U33A 3BAWA 3QOKA 4GPNA 3DC0A 4CD5A 4D6FA 2ZX9A 1V0KA 3N15A 2VR4A 4A3HA 4V27A 3WF1A 1AVAA 1BYDA 2A3EA 1UD5A 1GORA 4QLLA 4W5ZA 2J7DA 3VNZA 1KXHA 2ZUNA 1EHAA 4IUGA 4B9YA 1MW1A 1UZ1A 2XIBA 4UQDA 4AD0A 4PRWA 1P6WA 4H41A 2G3JA 2VX4A 3GNOA 4S3KA 4U2YA 3WF4A 3AJ7A 3NDZA 2FHBA 1I1WA 2PWFA 3WF0A 5GNZA 4ZENA 1R85A 1IV8A 2CBIA 2EO7A 2DT0A 1JZ7A 1PX8A 1ISYA 3AICA 1CYGA 1UD6A 3G6LA 4P7OA 3W38A 1GCYA 1PIFA 1NWSA 4LYPA 9CGTA 2W62A 3PZUA 2D0HA 2YJQA 4BQ5A 5JBEA 3VIFA 5CJ5A 1KBKA 4YHEA 3L2LA 2ZUVA 3N04A 3AZTA 3VIMA 3W81A 1B3YA 4J27A 4CU6A 2A3CA 2J47A 1B3ZA 2GJXA 1G94A 2E8YA 2WMIB 2EQDA 4UQ9A 4WSKA 1FHLA 1KXVA 1GZJA 1XSKA 3I3DA 1ITCA 1ZBKA 3AIRA 3N13A 2ZXQA 1OD0A 1R7AA 2X09A 3FAWA 2YL6A 1K9EA 2ZX5A 3K8KA 3W6LA 1TVPA 1W2PA 1XV8A 4ACYA 2EXOA 3I3EA 2VL4A 5ABGA 3KL3A 2WAGA 1WPCA 4D1JA 2X2YA 1HP5A 3WF2A 3AMDA 5A6MA 4GI8A 1Q6FA 1Y7VA 3WBAA 1WKYA 3WUGA 5D9NA 1ISWA 2YA0A 1BAGA 1C7SA 2GK1B 3ZM8A 4AD3A 3ARRA 3AS1A 1B90A 1E6ZA 5GNXA 3UG3A 5IHRA 3RM8A 2NW0A 3WFLA 1KGXA 4AZ5A 2BXYA 1JG9A 3PZMA 1E70M 3K4DA 3VPLA 1OGSA 1BHGA 3IJ8A 1W9VA 4P7LA 5IHSA 5DMYA 4RL3A 4WK9A 1OIFA 3WQWA 4Z2HA 4AC1X 2XG9A 4AEFA 5M5DA 2VUYA 5I77A 1NWTA 2QV4A 1R86A 2Y8KA 2XFFA 4UFIA 1WNOA 3WEMA 3T08A 4DWSD 1V03A 2A3BA 3F5LA 2XPKA 4A3YA 4S3JA 3S2CA 3IANA 4GXPA 2PBOA 3VMNA 4OOZA 4HPGA 3GXMA 3T2OA 1W9UA 3MO4A 1B1YA 3WD0A 3GBDA 2VC9A 2IXVA 5C8BB 1DTUA 1H3GA 3K46A 2FHCA 3LPGA 5BXPA 3OLIA 4EKJA 1FFQA 4LGXA 1BLIA 3AI0A 2Y24A 1GQJA 1V6YA 3AOFA 2DT2A 1QNOA 2YL9A 5D9PA 3OLDA 5A2AA 1LL4A 4MAVA 1CNVA 1GQIA 5AC4A 2JEPA 5AC5A 5ABHA 4AZHA 3M46A 2XM1A 1JDDA 3WDJA 3WQ5A 1VRXA 1VF8A 2DSZA 5DF0A 3WKZA 5CSUA 1CLVA 1J0YA 3CO4A 4H8VA 1J0JA 1M53A 2D20A 2EEXA 1KCLA 1OWQA 4PMZA 1K9DA 1J0IA 5FL1A 1TMQA 2EPOA 2VX7A 5A6SA 2QPUA 5FIPA 1GW1A 3WEOA 1A47A 3AHTA 5C70A 3CPUA 2WHKA 5EFDA 1DWJM 5E0FA 3A4XA 1KCKA 3MUY1 2DIEA 1U30A 5E70A 1E1EA 4OUEA 1K9TA 3GZAA 3UR7A 3TONA 2BY1A 3W4RA 2PBGA 3WMBA 5HPOA 3B9DA 4HA4A 2WVTA 1JFHA 5EFFA 3AQUA 1GJWA 1S46A 1TE1A 2DPEA 3FY1A 4TTGA 1ISXA 2YOCA 5A6JA 4UFMA 5CGTA 2EPKX 1W32A 4U2ZA 4PTVA 2E9BA 1WP6A 3WEZA 5ECUA 1VEPA 3WQ8A 3RM4A 1RPKA 1CGVA 3EDDA 4CCEA 2WMFA 2YDRA 1N82A 2W92A 4KMQA 1KFWA 3OGVA 4ZXLA 3GXFA 2VRQA 4GQRA 2X8RA 4AZGA 2PWEA 1KGWA 2DGAA 3WH8A 3CZJA 2F8QA 2WMHA 3TTQA 6CGTA 2ZXAA 4U3AA 2BHZA 5A8MA 2X0HA 5F7UA 4HA3A 1PX4A 2ZIDA 1MQRA 3VX1A 2O9RA 3T0BA 1GOOA 1MXDA 4UZSA 3A4WA 5DEZA 4L4OA 3I3BA 1HVQA 4GZIA 4MADA 4YHGA 4AEEA 2W91A 1HJVA 5BYWA 1K9FA 5A8NA 4QAWA 2FH6A 3OG2A 4P8WA 4F8XA 4X0VA 2XGBA 1J0KA 4QP0A 2VO5A 4M1RA 3BAYA 1FH8A 1E71M 1JD7A 1UD4A 1VAHA 2BS9A 1J9YA 4GI9A 1E3XA 2WW5A 1E3ZA 3QR3A 4E4PA 3VD4A 2DDXA 3WFZA 4QCEA 1GOQA 1UD3A 3BLPX 1XH0A 2XHYA 1LWJA 2BHYA 3ZJ8A 4ZFMA 1ZB5A 3M7SA 3WDIA 4JCMA 1KXQA 2CNCA 3VU2A 5GNYA 2WVVB 5DO8A 3AIEA 2XFRA 1B9ZA 2DIJA 1KQYA 5M3WA 3MS8A 3JUGA 4QFUA 2PF0A 4JFTA 3VIOA 1NARA 4PCTA 3GXIA 4HU8A 5FL0A 1OD8A 3BLKA 2YKKA 1GHSA 4PMYA 2CESA 2GJPA 2WKGA 4D6EA 2XVPA 3ZOAA 3L4WA 3PZTA 4D6CA 3ZJKA 4AZCB 4WIWA 2BVTA 2D0GA 4J3TA 1PIGA 1E5NA 3VD9A 2WB5A 1JZ8A 4WKFA 2ZWZA 2X0YA 4JKKA 2OYLA 5A3HA 1UYQA 4BQ3A 1KR0A 1Q6CA 2QMJA 2VTFA 2OSWA 1C3FA 3QHNA 1V6VA 3NSMA 1CXKA 4W7WA 1EDQA 3GTNA 1BG4A 4JKMA 2VCAA 1H09A 1H2JA 2BFGA 3CZLA 2OWCA 4IISA 3WY1A 3HMCA 1JI2A 4KH2A 4W7VA 4CUCA 3PN8A 5A95A 3E1F1 1W1TA 4M24A 5CXPA 2VCBA 4LXFA 5IFTA 5CSYA 5BWFA 3OZOA 1C92A 3WNOA 2DEPA 3BC9A 2OYKA 1CPUA 1W9PA 2D23A 4DWSB 1JL8A 3TTOA 8A3HA 5CLTA 4AMCA 2VJXA 4D6JA 5FCZA 1GPFA 2WC4A 4BF7A 1V02A 1EO7A 2ZUWA 1DWIM 1UR0A 4QDMA 5BROA 3APGA 4AZ7A 3B9AA 1HKMA 2CIPA 3RMEA 1V0NA 1EH9A 1JNDA 1J12A 3WDRA 1ODUA 5C71A 4AD2A 2J25A 3SCNA 4HZ8A 2EJ1A 3GH5A 2IXUA 1HL8A 1JGIA 2VOTA 3WMSA 4TUFA 1H5VA 1BYBA 2OSYA 2BV9A 1DWGM 4E8CA 4TVUA 1V6XA 3VIJA 4W8LA 4Q7NA 4Z2IA 1JYVA 3DECA 4AIUA 4LX4A 1OGGA 1WZMA 1KWKA 2WLYA 1LG2A 3L2MA 3QHMA 1B30A 4JAWA 3WH9A 4WF7A 1CENA 4L4PA 4PUEA 3IAQA 3VGEA 3SURA 2J7FA 4HMDA 3VIHA 4P7RA 5A2BA 1HP4A 1FA2A 1W2VA 4PSRA 3PZOA 3SCVA 1HJSA 2J7CA 3VTRA 2ZXBA 1V3JA 4OJYA 3WF3A 1QI4A 4P7QA 4WKHA 4ML4A 1CGUA 2OLHA 1DWAM 1L0PA 1ZU8A 1XSIA 3K1DA 5I5RA 1VIWA 2AOSA 5A8QA 1WCGA 2UY3A 3N1AA 1US3A 2OYMA 2VZSA 3OIHA 3CUFA 5KZ6A 2VVSA 3ALFA 3VKKA 2DSVA 3LPFA 1UR9A 4B3LA 5A6KA 5A6BD 2ZUTA 2EPLX 4ZEPA 3AS2A 2ZUUA 2XIIA 5A6LA 3WN6A 2W61A 1UKOA 2XSBA 1KR1A 5LYRA 4AIOA 4HOZA 3RCNA 1F4HA 3VX0A 3F4VA 4MAZA 4D1IA 1DEDA 2V5CA 2UY2A 5IXEA 1CXLA 4GI6A 5M03A 3HN3A 1H11A 1CGXA 2JF6A 4GO9A 2CYGA 3T0DA 1FP9A 2BY0A 4EK7A 4PTXA 1E6SM 2VT0A 2UY4A 1FH7A 1OT1A 3PTKA 5IFPA 3U5UA 3ECQA 4PMOA 1JI1A 4HOWA 1J0HA 3CIVA 3SUVA 2DSUA 2QPSA 1JAKA 3CGTA 4OOUA 2G41A 1MYRA 1BG9A 5A1AA 3IJ7A 1VEMA 4NRRA 3SCSA 2W4XA 4PCSA 1TA3B 3ARZA 1C91A 2JALA 2VURA 3VOCA 3VMPA 2D24A 4AZCA 3VDHA 2NSXA 1V0LA 5I0DA 2EPMX 4LQ1A 4U5KA 1TCMA 1PBGA 4NI3A 2CBJA 4AIEA 5ABFA 5HOSA 2YA1A 4LYRA 4V2XA 2UWFA 2WNWA 4GZJA 4PMDA 4U31A 1PZ3A 4W88A 2PI6A 1OB0A 3MV11 4B15A 2JE8A 1V0MA 4GINA 4TX6A 2FDMA 3ARSA 3FXYA 3MV01 4P8UA 2DH2A 2D3LA 3BMWA 1E0XA 3VIGA 1K6AA 8CGTA 1VEOA 2VNCA 2XWEA 2J75A 4UFKA 2WK2A 1FOBA 1W1VA 2BY2A 1PJ9A 3AZSA 3MU7A 2ZICA 3NCOA 1GUVA 4NZCA 2DT3A 4NRSA 3W37A 1V08A 1CGTA 3RM9A 1LQ0A 1OINA 3FHQA 2V3GA 1UWQA 5I3DA 5BCAA 3AHYA 3GNRA 3UERA 4M8UA 3SUSA 3VGHA 3EDJA 4C7FA 1MFVA 1H49A 1HF6A 4JKLA 1E6RA 4BCEA 3DHPA 4XX6A 1A3HA 2WMKA 3WD3A 4DUXA 3QGVA 3PTQA 4HMEA 4H04A 4PMVA 1LJYA 2DQXA 4MB4A 3VGBA 1LL6A 4QLKA 2XSAA 1BQCA 3IAPA 2CXGA 4EANA 3B9EA 4HA1A 2GDVA 4QLJA 3ARXA 1Q6EA 3L4TA 1E6NA 2NT1A 3M07A 1QI5A 1C8QA 2FH8A 5JBDA 1B31A 1LL7A 3OBAA 2WPGA 4HMCA 5EBAA 3A3HA 3VD5A 2WC3A 3N12A 3WQVA 4MNKA 1QNSA 4UOJA 3W28A 4Q22A 2D22A 3CUIA 4GKLA 4KWUA 1CDGA 3TTSA 1LLOA 3NSNA 1NWRA 2WCSA 2J74A 2Y5EA 3MUIA 2YIHA 3UR8A 1FHDA 3BAKA 2WCAA 4KGLA 5D9MA 1CTNA 2WZHA 1YQ2A 1H0GA 1HL9A 3PZGA 4ACZB 4NSBA 1DWHM 3UG4A 1FH9A 2O9OA 1ZBCA 3SCTA 1AMYA 5I23A 5E09A 1J11A 3AIUA 1SMAA 1TG7A 3PZNA 1JD9A 4J3XA 5D9OA 1JIBA 4XUYA 2V3FA 1JZ6A 4HTYA 1MW2A 3ZSSA 2GVYA 3L4ZA 3LPPA 2XJ7A 3SUTA 2J77A 3PZIA 3CMJA 1WZAA 3VGDA 3WIJA 1WB0A 3WUBA 3NUKA 2CHOA 4CN4A 3DYMA 1G01A 1VFFA 2G3NA 4IM4A 3CZGA 1QW9A 4PTWA 3CTTA 4UFHA 5A8OA 4AY1A 3NIYA 4JFVA 3L4YA 1QI0A 4W87A 3SCOA 2O92A 1TFVA 4UR9A 4D71A 3MMWA 2YLAA 3WNKA 3ZT7A 1ZJAA 4CCCA 5JBFA 1R87A 2G3IA 5ABFB 1QNQA 1UR4A 1XCWA 3WUEA 5AY7A 5LA1A 1SR0A 1UA7A 3VO0A 3UEQA 3ZMRA 4B9ZA 3AMCA 1NQ6A 1VBUA 4D72A 1WZLA 2CKSA 1WDPA 1W3KA 4F9DA 3VIPA 3EDEA 4GZEA 5A6AA 4P8XA 1V02E 1EA9C 2Z1KA 1HJUA 1E4NA 3FW6A 3BCFA 1XC6A 2AAAA 3EMZA 4W89A 4D6GA 1D3CA 1GNXA 4PBGA 3ZO9A 3N18A 3T09A 1XH1A 2O9TA 1V3IA 1BVZA 1HKIA 2XWDA 3WBEA 2BNJA 1PEZA 4DUWA 3W82A 2WANA 1BTCA 3VDBA 4Z2KA 3SCWA 3A4AA 3N9KA 2WSKA 4ZE4A 4W86A 1UWIA 1UKSA 3GH4A 4GIAA 1GOMA 4WSJA 3EDKA 3GNPA 3DYPA 2GJXB 2QLYA 4J7RA 4ATDA 1WDQA 3OGRA 4UOQA 4UFLA 1M03A 1J0ZA 3CLWA 2VRJA 1MVYA 1JF5A 4J3UA 4UQAA 1MQQA 1W1YA 1C7TA 3AIQA 1WZKA 3AIWA 3L4XA 1E5JA 3II1A 4MTVA 3KL5A 3WNMA 1UUQA 1W9DM 4BS0A 1XSJA 3ZT6A 3T0AA 5LA2A 2JFEX 1HJXA 1H41A 2ZOXA 4CKQA 1HT6A 3WMCA 1E9LA 5I79A 1X1NA 1RH9A 1KWGA 5IDIA 1AQ0A 1G9HA 3ARVA 3ARQA 3THCA 3ZT5A 2VX6A 5E6ZA 4CVWA 2CHNA 1AQHA 1VB9A 3CHFA 1WDSA 4TOQA 3WH7A 4MB3A 4CGTA 3DHUA 1E40A 2BHUA 3AYSA 1MWOA 2YDQA 1EXPA 1UR8A 4TTUA 1OM0A 2YL8A 1UH3A 2WZIA 1Z32X 4ATLA 1RP8A 4IPLA 2JIEA 2W67A 1QOXA 4GQQA 5EB8A 4ACZA 3VDCA 4W8AA 2ZUSA 4J3SA 1I75A 3PZQA 1WDRA 3G6MA 4PMQA 3FHAA 3EYPA 3ALGA 1QI2A 3U5YA 4MDPA 1V3HA 3ZJ7A 2XVKA 1VJZA 1UA3A 2WVUA 1W91A 3OGSA 2QMKA 2YA2A 3L4UA 2VQUA 4F66A 2XYLA 4M29A 2V5DA 2ZXDA 1WAWA 1KGUA 3NJ3A 2YBUA 3AMKA 1JFXA 4RE4A 4CVUA 2XVGA 2J4GA 5HNNA 1C93A 1E15A 3GBEA 3WD2A 2EBNA 4H8HA 1CXIA 4AZIA 4HZ6A 3WELA 4W8BA 1XD0A 5GPRA 3BAJA 1HJWA 2E8ZA 2ZE0A 1Q6DA 4ZXOA 3RJYA 1CZ1A 6A3HA 5I78A 4EAMA 4BQ2A 2W63A 4WJXA 3WNNA 5M17A 2GDUA 3UESA 4BA0A 3VILA 2VMFA 3UCQA 2CBUA 4KRTA 3ZQ9A 1NP2A 4H8UA 1D2KA 1V3LA 5BXSA 4JFSA 3VDAA 3W25A 4N0RA 3ARTA 3K4AA 3GDBA 3OB8A 2X05A 1JZ2A 4CCDA 2J7HA 1G5AA 4PUDA 1CEOA 1DWFM 1G0CA 4OIFA 4UTFA 1X6NA 1E0VA 4M81A 4MNMA 3AS0A 4QCFA 2VX5A 4PMNA 1JAEA 2E40A 1TZ7A 1PAMA 1UWTA 2NT0A 4DM2A 5I6SA 2C0HA 3SEPA 3NSXA 3K8LA 1M7XA 2DSKA 2C8NA 3F5JA 3VM5A 3CZKA 3AXIA 4UQCA 2VZVA 1GVIA 3W53A 3WDHA 4IPNB 1E4MM 2XVNA 1R7OA 1VENA 1HIZA 2FGZA 4FLOA 5HDRA 2EPNA 3U7BA 1JXKA 4FLRA 4DUVA 3OLEA 2RGMA 4Z2LA 2BY3A 2VZUA 1U2YA 4JCLA 1QVBA 1QNPA 1ZBVA 2YLLA 5E0CA 1JNEA 5BRPA 2ESCA 1B0IA 3KL0A 1GOKA 1X6LA 4HU0A 3LPOA 1UKPA 3AHZA 3OZPA 3WQ4A 1BYCA 1E6QM 1ZBWA 3AXXA 4UCFA 5ABEA 1JXJA 3AXHA 3ARYA 3AROA 1JYNA 2D1ZA 1B3XA 3PHAA 2ZWYA 2GUYA 3ARUA 3BGAA 2WXDM 1HKJA 3MSGA 3J7HA 1ISZA 4U5IA 1EDGA 4EE9A 2ZX7A 3RILA 5A2CA 3SCQA 4UQEA 3BAXA 4FLSA 2GK1A 2BXZA 2OSXA 1ZS2A 2A3HA 1XYZA 1HX0A 5AYIA 1MW0A 5EMYA 1E6PA 3VIIA 2FHFA 3PTMA 1EOMA 1MW3A 3W27A 3O2LA 1TR1A 6TAAA 3AHXA 3OA5A 4W5UA 3VM7A 4C7GA 1W3LA 3SIMA 3ZSTA 3VVGA 3CMGA 3FN9A 1MFUA 4HOXA 1BVNP 3PZ9A 2CCRA 1WO2A 4AWEA 2PWDA 3BSHA 5JIPA 2TAAA 2XM2A 3RPMA 2Y8VA 2FGLA 2WLZA 1KXTA 2YL5A 2DT1A 2AMGA 1D7FA 1C8XA 3VD3A 3UG5A 1I1XA 4E2OA 1E0WA 1MQPA 1E6XM 1QBBA 5CPQA 1PPIA 1EOKA 4DM1A 3SCRA 4MJ2A 5CQ1A 1JDAA 3ZR6A 1UG6A 3AMGA 3GM8A 4JFWA 4MB5A 5DFAA 2VZOA 3VINA 3WQ6A 2J7EA 2WSPA 1IZKA 1UQYA 4FF5A 4JL2A 4MNLA 4OBSA 4TVDA 2J79A 2CITA 1LG1A 4CD7A 1NH6A 3WL0A 3AS3A 3CZ8A 5HXMA 1HN1A 4RE3A 4R5EA 2OWWA 3W24A 3CBWA 4N42A 1E1FA 4TX8A 1CGWA 4UZUA 3W26A 4LPCA 3HU7A 5DT7A 3THDA 4J28A 4PSPA 1CBGA 2J7BA 2W66A 4PMUA 3WDPP 2XFYA 1J18A 4D6HA 2QHAA 1ZJBA 3MMDA 4UFJA 1EDTA 1UR2A 1OBAA 5A69A 1E43A 1KB3A 2E9LA 1GOIA 3AMLA 1GOWA 1WE5A 3U57A 7A3HA 2XTKA 4Z2JA 1O6IA 3CHCA 4HP5A 1TVNA 4J3WA 2WCGA 1V3KA 1EQCA 1V3MA 4UNIA 2IUZA 1UH2A 2A3AA 3K8MA 3MANA 4JZ5A 4K68A 4AISA 3EMQA 4M80A 3RO8A 2V3EA 2VQTA 4YN5A 3BMVA 4KGJA 4AZ6A 1RD6A 3A47A 3MUZ1 3WH5A 4AD5A 5CLWA 4JHZA 1SMDA 2J78A 1HKKA 2E0PA 4UOZA 2X1IA 4D6DA 1W3JA 5D4YA 1GJUA 2ZX6A 2J8FA 5DT5A 1HJQA 2J8GA 3AHVA 1QI3A 4DWSA 2ZUMA 1UKQA 4CD6A 3BSGA 1H1NA 4W85A 1XHGA 3FNDA 1BYAA 1CXEA 3KZSA 3O6AA 3SCUA 2F2HA 1PX3A 3FAXA 1HXJA 2PWGA 1CECA 4H7VA 1XH2A 1QHOA 5D8WA 1FP8A 4CD4A 1ZL1A 2OWXA 1NOFA 1HVXA 2F61A 3CUHA 5HPCA 1QHPA 3OLGA 1Q4NX 1V6WA 1OGBA 3KWXA 5AYBA 2JIWA 4P7NA 3WDQA 4E8DA 3WH6A 2DSWA 3KEHA 1UOKA 4A4AA 2J62A 3EMCA 4D6IA 2WMIA 1J01A 1L8NA 4WKAA 5JIWA 3AIBA 2CBVA 3WD4A 4TVCA 3MMUA 1DP0A 3WNLA 2WBKA 1JF6A 1Q6GA 1JYWA 1ODZA 1IT0A 3DYOA 1BGGA 1UD2A 1LF1A 3O9NA 1GQLA 1E72M 2WC7A 4YPJA 3UETA 4CU7A 1W3HA 3WUFA 4HPHA 3TA9A 3CHDA 3VGFA 1UHVA 3W0KA 1CXFA 1R8LA 5E9AA 2G8ZA 3EDFA 1EO5A 1E56A 1BF2A 2BVDA 2WHLA 1JZ3A 3RDKA 3CUJA 4ZE5A 2VR5A 2D2OA 4X0NA 1UR1A 3D5HA 3ZIZA 3T2PA 4H2CA 1M04A 3HJEA 1UD8A 4KRUA 2V3DA 3AIVA 1B3WA 2W5FA 2WVVA 4GO8A 3EBVA 1GHRA 2WZEA 4R27A 3GYCA 1NOWA 2D0FA 4U3CA 1OSEA 1H0IA 5FOOA 5E6YA 4PTMA 4F79A 5JUVA 1O7AA 2WMGA 3RIKA 1IZJA 2Z1SA 1SFSA 4MNJA 4W7UA 3GH7A 4Y7EA 3WL1A 1B3VA 1ESWA 3T2QA 1EQPA 5I24A 4W84A 3N11A 3RJXA 4UQBA 1VJSA 1TA3A 2WWDA 1C90A 4JFUA 4PN2A 2HVMA 1C8YA 5CG0A 1VBRA 1BSIA 2YBTA 2WKLA 5KEZA 2WM0A 4AD1A 2CEQA 3MKKA 4FLQA 4X9YA 4JL1A 1QW8A 4V28A 4B16A 1JDCA 5A6BA 1QHZA 2DH3A 4OZOA 1ISVA 3IJ9A 1HNYA 7CGTA 1E55A 3POCA 1KQZA 3F5KA 4DWSC 1U33A
chains in the Genus database with same CATH superfamily
1ONXA 3S9IA 3FK4A 3ONCA 4PMXA 3URBA 1IXPA 4RZBA 1EGZA 3D6NA 3U4FA 3ITVA 4XZBA 3STEA 3TTYA 1EC9A 3MHGA 2CC0A 4OBRA 5D38A 3MBDA 3ELFA 1WXZA 2FVKA 3TW9A 3R2GA 1X7IA 1PIIA 5J8LA 3LSCA 4FA3A 1U1JA 3WLNA 5CSRA 2PB1A 2YXOA 2H6RA 2HE8A 3CV2A 2Q71A 3EA2A 4UTUA 5SWUA 2G0WA 2QYGA 4ATWA 1Q4WA 2Q8ZA 3VKAA 3DZ1A 4AYSA 3ZJ6A 1US2A 4NF7A 1T5AA 3WK0A 4URIA 2HZGA 2VFFA 1X8FA 1SYTA 1GONA 1J10A 2A85A 2NXHA 2BTMA 3VD7A 3LU2A 3S5NA 3NQ2A 4JEQA 2PWHA 1QK0A 3CU2A 4PMRA 1XBVA 4RDYA 4GY7A 3SUUA 2NLIA 2PP1A 4DRSA 1BGAA 2BG5A 3G18A 3NXFA 1EWEA 1N7KA 2XISA 1VFOA 5EU9A 1ECEA 5BXRA 1XBYA 1TUXA 2YDSA 1O95A 1G4PA 4O52A 3WNPA 4IX0A 3GAKA 2ZZ6A 2VEGA 3APTA 3CPRA 2XGIA 2QS8A 1IGSA 3FJNA 3M41A 4XZLX 2VVNA 2HMCA 5K3VA 4LU0A 2WHJA 3QFWA 2QCGA 2H9AA 3PZVA 4XB3A 4D8AA 3SRHA 4Z1CA 3P74A 3P84A 1MNSA 2GSJA 4NQ1A 2PZNA 3TYDA 3ITGA 1SZGA 1VFUA 3TOPA 4QAIA 3PULA 4LB4A 1W3NA 3H6OA 2PCEA 4GACA 3JZEA 2G3MA 4S1FA 3BOXA 1CXHA 4BZYA 3ZR5A 4BK9A 1OF6A 5BOFA 3G1DA 3SGUA 2MANA 5CGMA 4G8TA 1F9CA 1OX5A 4LC8A 3MWAA 4FP1A 2QUMA 4O4VA 2WWCA 1M7PA 3KBVA 3B8SA 2D3NA 1U1HA 1M01A 1M9HA 2WVSA 4QEEA 3TA6A 4K1GA 3EA1A 4NZFA 1UWSA 4ZB0A 4M56A 1EPVA 4IQJA 1I2PA 5D8ZA 3S1GA 5DELA 4BEQA 4XSLA 5FESA 3CJPA 3AYRA 3TUUA 3C2FA 3IV3A 3U2CA 4LRSA 1IYXA 5CPTA 1EHNA 1E4IA 3L4VA 1EJSC 3TP4A 1CGYA 1RR2A 4YYFA 3U9IA 4BF5A 1XD1A 5JH2A 4GNVA 3CH9A 4RE2A 3D3AA 1UH4A 1AMKA 1JZ4A 4TMCA 2VRKA 1I2NA 3NVTA 2BMBA 1DQXA 4Q8NA 4QG9A 4U33A 2WSYA 3O0KA 3BAWA 2E5BA 3DC0A 2REQA 4REQA 3NZRA 4ZQNA 3SAZA 7PTDA 4YS1A 3N15A 4CQ9A 2VKZG 4V27A 1FUYA 3UZZA 3BK0A 4M19A 3CAWA 2V2DA 2IKJA 1EHAA 4AH7A 3CIWA 3U2OA 4PRWA 4B5SA 1PTDA 3Q67A 4O11A 4S3KA 3AJ7A 1TJ0A 1PKYA 2FHBA 4H9VA 5CBJA 3GDMA 3M0VA 2DT0A 3M16A 1UD6A 2Y6ZA 4JIHA 2TMDA 4IFKA 1JGMA 4H19A 1NWSA 3RFAA 2BP1A 4EX4A 4GVGA 2W62A 3HJZA 2YJQA 3TYCA 5JBEA 1E1CB 3VIFA 3QGKC 4DI9A 2AL2B 1H60A 3IJDA 3L9CA 3UZYA 3W81A 1B3YA 4J27A 4DELA 4CU6A 4AXKA 1Q2RA 2A3CA 4ZO6A 2GGEA 3WK2A 1P5BA 2FQIA 1WOAA 4HB7A 3RK8A 4LB3A 2WMIB 1KXVA 1GZJA 4R33A 3SN0A 4F48A 3BPWA 1U5HA 1P1XA 4F40A 2ZXQA 2WNNA 2X09A 3BICA 2YGYA 4ACYA 2EXOA 2CZDA 1W37A 3WF2A 4WY0B 2QJJA 4AVNA 1Q6FA 4NIRA 1P48A 3WBAA 3RU8X 3SSJA 3F7JA 1DBTA 4QXIA 4Q8TA 3ZM8A 1GEHA 3AS1A 4ENLA 2YCLA 3PBYA 4DHGA 5GNXA 3RM8A 3FJLA 1KGXA 1Z48A 4Y9AA 4GE8A 3PZMA 3K4DA 3VPLA 1GPWA 3VI2A 3EKZA 3NQFA 1SSGA 4WK9A 1KRBC 3WQWA 1FWTA 2QT3A 4K6AA 2XG9A 4AEFA 5I77A 2H3BA 1NWTA 3WLLA 4RZ6A 2Y8KA 2XFFA 3WEMA 3FDKA 3T08A 3TYBA 3LN3A 2W9MA 2R1LA 2XPKA 4A3YA 3QR0A 1XIFA 4DAFA 3L7RA 3IANA 3V75A 1YPFA 3T2OA 1W9UA 4PUNA 3WD0A 3GBDA 4FZIA 2ABAA 2R24A 5C8BB 3K46A 4S3FA 4JTFA 3B8VA 3LPGA 2A7RA 3OLIA 5HA7A 1MEWA 4LGXA 1VPXA 4WDTA 4XZIA 3VOJA 3DFNA 1YE4A 3LS9A 4WUIA 4FNRA 3W7RA 5D9PA 1X96A 4Q4SA 3DHDA 4L6HA 1ZHAA 4C6QA 3N2TA 5ABHA 4AZHA 1TV5A 2HVOA 3R1ZA 3M46A 4ZB2A 1QTWA 4D8LA 2E6YA 4ALDA 1XPYA 1L6GA 2CWNA 1RY8A 3IS4A 3H22A 3WKZA 1J0YA 3MA8A 2PDUA 1XINA 1M53A 2XH4A 2DVTA 3UWEA 1OWQA 1SJAA 4W9TA 1TMQA 2EPOA 1WOBA 3FVMA 1DJIA 3MI2A 5JXQA 5BNKA 1DWJM 1EFZA 3M64A 1KCKA 3MUY1 5E70A 1E1EA 2VEMA 4HYVA 1DJGA 3GZAA 5F4WA 3TYAA 4F0LA 4IL2A 2BY1A 2PBGA 3DCPA 1FCQA 2WKJA 4HA4A 2WVTA 4ZO9A 1JFHA 1YYAA 1GJWA 4CQDA 3RAOA 4MY8A 1ZUAX 5A6JA 3HG5A 5HNUA 1HL2A 1TRDA 4KERA 4PTVA 2E9BA 4FPSA 3WJZA 5JVLA 1DE6A 3H2NA 3L0NA 3WEZA 4DBEA 1RPKA 1AH3A 3GFXA 3PR2A 1XIIA 3ITOA 3R25A 4ZOCA 3PJTA 5FSEC 4KMQA 1KFWA 3LBMA 3GXFA 4ERAA 4NAEA 4DJDC 1XISA 2FTYA 3IV8A 4US5D 2X8RA 6ALDA 4NJJA 2ZXAA 2ZIDA 1RK5A 3D3FA 2AKZA 3NM3A 4HHMA 2RHGA 5DEZA 3I3BA 2E25A 5KZMA 4LF1A 2OMAA 1MEIA 1HJVA 3EA3A 3BE7A 3NXLA 3ABSA 1K9FA 3CT2A 3N6JA 3GSMA 3CV1A 1W5NA 4X0VA 2XN2A 2PC4A 2W6RA 3LUTA 4FOJA 4QHRA 3CWOX 5CG7A 5L9FA 1WUEA 1TWDA 1VAHA 1KBIA 1J9YA 1QFEA 1TCDA 4KEMA 3T4WA 1E3XA 1E3ZA 4GYKA 2DDXA 4X60A 3REQB 3W7DA 4Q3MA 4FR6A 3BLPX 1XH0A 3PJWA 3P62A 2BHYA 3ZJ8A 4ZFMA 3ZR4A 1TPFA 4GUIA 2CNCA 3VU2A 4JHMA 3C8FA 5DO8A 1ZCCA 3R89A 4JQ4A 2HRWA 2G4JA 2NXIA 2XH7A 1B9ZA 4TR9A 3JUGA 2PF0A 3DI0A 4IFKB 3VIOA 3TJ4A 4HU8A 1TZ9A 2Z0IA 2YKKA 3G1VA 4Q4KA 3WLSA 2GJPA 2WKGA 2XVPA 3P6LA 3ZOAA 4YVVA 2XGZA 3L4WA 1FBAA 1W3IA 1IZCA 3W1LA 4J3TA 2RJHA 4IQLA 3CASA 1E5NA 4XZMX 2PDBA 2ZWZA 2X0YA 4RNFA 5A3HA 2J27A 1KR0A 2QMJA 2OSWA 3SJ3A 2YB1A 2Z1BA 3VAVA 1S5WA 3F03K 3GG8A 3NSMA 3QMSA 3R4IA 3SECA 4HCHA 1ICPA 4LOCA 5LIWX 3GTNA 4JKMA 2VCAA 5DANA 1H09A 2OWCA 4IISA 2QUTA 3HMCA 1JI2A 4KH2A 4FAMA 3PFMA 2EPHA 3EXRA 1IEWA 3E1F1 2TYSA 4RJEA 4M24A 4JTQA 3QH2A 2I5QA 4LXFA 1CCWB 4GH1A 3NQBA 4BR1A 5C54A 3S6DA 2OX4A 1AQFA 4M0XA 3M0ZA 3QZEA 4XISA 1CPUA 2D23A 2TODA 1JL8A 5BMWA 3TTOA 5HULA 3FSTA 1Z3NA 4MZYA 5CLTA 2HE5A 2X30A 5EMMA 4AMCA 2VJXA 5FCZA 1GPFA 2Y70A 4XKYB 1FWSA 1EO7A 1KLZA 4EAYA 4ZO8A 3UXLA 4AWSA 1DWIM 3SFWA 3UY7A 1TKKA 1HKMA 5B80A 1J5TA 3M4HA 3N4AA 5T9BG 3GHSA 1RLCL 3R8RA 3KBMA 4IGMA 2KX9A 1NY1A 2GQ8A 5REQB 4IOTA 2IXUA 4OECA 4YWIA 4IGNA 4TUFA 3OVQA 4E8CA 4JBRA 1V6XA 1XG3A 3B8IA 4W8LA 3E0IA 3VNLA 1UP0A 2QULA 4JTAA 1Q6LA 4L1XA 4JTTA 1WAUA 4AIUA 4J35A 3T7VA 3BLEA 4FI4A 5LHEA 1JUKA 2A6LA 4L7ZA 4WF7A 4L4PA 4PUEA 3PBVA 3MMTA 5A2BA 2Y88A 1W2VA 3SCVA 3VTRA 2JK2A 1EL3A 4Q7IA 1XYMA 4AWTA 3WF3A 4P7QA 4WKHA 1CGUA 4H9TA 3K1DA 1F74A 1VIWA 3N1AA 1RZMA 3THUA 2OYMA 3OIHA 3F1QA 5KZ6A 1MUMA 3GG0A 1F6PA 2ZUUA 3GD6A 3KS6A 2XIIA 4ZTYA 4HD5A 3S0CA 1O5KA 1UKOA 2QCNA 5HJYA 4AIOA 4QSFA 3EWYA 3UGVA 3ORWA 4K36A 1YW1A 1H11A 2JF6A 1JCXA 3GTFA 3HBLA 4G1NA 2VT0A 4Q7BA 3PTKA 3U5UA 1QK2A 4HOWA 3CIVA 1Q8JA 3MKVA 1WA3A 2VEKA 1JAKA 4J9JA 1MYRA 5A1AA 2ISWA 5CZJA 2PLCA 2W4XA 4YVPA 4A8LA 1F8MA 8TIMA 3VOCA 3VMPA 3DENA 2HNEA 3LGDA 2NSXA 1PZ0A 4C6MA 2CZVA 1AH4A 1ICSA 1PDZA 5EBUA 3FEQA 4B5NA 4GZJA 2WNWA 4PMDA 3IJ6A 4Z1DA 1PZ3A 4AX6A 4W88A 3OZMA 4RPPA 1OB0A 1BF6A 2JE8A 4TX6A 3TN4A 3FXYA 3H4XA 2DH2A 1K6AA 5AOUA 3TKFA 2J75A 3EKGA 3GXPA 3NQDA 1BVWA 2E1DA 1SW7A 3TLQA 2DT3A 2DZUA 3SIZA 4B5WA 4WXYA 3RM9A 3MP4A 1EBHA 5I3DA 1FXPA 3UZ5A 4ZSUA 3TZNA 1J79A 1SZFA 1XIJA 3SQSA 3UERA 3QC0A 4LJ3A 3SUSA 4WRHA 3A4JA 1H49A 1MXSA 4M1BA 2A7PA 3KRUA 5DRCA 2ATSA 4BCEA 4LT9A 3ID7A 3P0XA 3E74A 4LUSB 2A4AA 3RRXA 4Q8PA 4DUXA 2GSEA 2OFJA 4B5XA 3H70A 1ZENA 2FTPA 1LJYA 2DQXA 4MB4A 2F9RA 1W1A1 3KCJA 1Q3NA 1KFBA 1LL6A 4Q8UA 3IAPA 3E12A 2EHHA 2CXGA 3B9EA 1XC4A 4FOKA 4GK8A 4EPKA 4YCOA 2NT1A 3M07A 1QI5A 1RCQA 1C8QA 3HG2A 3LNPA 3LCIA 4GCAA 4MYXA 4Y9NA 2FZBA 5EBAA 4O12A 5DBUA 1WXYA 1Q8AA 4GNJA 3WG6A 3N12A 3SQMA 1VBGA 4IJRA 2QVNA 4Q22A 1EF2A 3DN5A 3UVAA 1CDGA 4E5TA 3N6QA 4GVFA 4G5DA 1LRNA 2DVUA 3L66A 1YBQB 2C6QA 4ZR8A 1CTNA 1SSDA 4AUBA 1O94A 2I9EA 1F3TA 4QISA 1FH9A 2V30A 4MWAD 1ZBCA 4JYEA 3CS2A 3TSMA 2DFAA 4IMDA 1EJXC 3BGJA 4UTWC 2Y85A 2NUWA 4EACA 4XUYA 3M0YA 1JZ6A 3NQEA 2PURA 3NPVA 4HTYA 1IEQA 3B8TA 4PZVA 4IG2B 4KWOA 3O15A 3SUTA 1EJUC 3CMJA 2OOGA 3NURA 1YDYA 4PBEA 4E38A 1R3SA 3DYMA 3N2OA 2G3NA 2GUBA 3KOYA 4IM4A 3CTTA 3TMQA 4JFVA 3M0MA 3R13A 5HMDA 1V5XA 4YNGA 1TJ2A 4HPNA 4ZL1A 1JCTA 2I9UA 4CCCA 4MUZA 2G3IA 3VOFA 4G6CA 1XCWA 5AY7A 1W5OA 2VD9A 1SR0A 2ZRWA 3NO3A 1DJQA 3VO0A 4U10A 3ZMRA 3MUCA 4C6CA 2XZ9A 1WZLA 3P81A 3RLGA 2JKPA 3NQ8A 3VIPA 2J9XA 3MT1A 3UA3A 3QQ1A 5BOOA 4UB9A 4P8XA 1V02E 2WOQA 5BRBA 4E3TA 4HNOA 2Z1KA 4W89A 1BVZA 1QPRA 1HKIA 3PUOA 4ROQA 3HQPA 2NQ5A 1UMLA 2VGFA 3SSZA 1K02A 1BTCA 3BLDA 5PTDA 3EPNA 4GUJA 2C91A 4G9PA 3HF3A 2WSKA 1UKSA 3DFYA 4GIAA 2WZMA 2HS8A 4WSJA 3S42A 3GNPA 3DYPA 5AN7A 2C18A 2FZMA 4H9XA 5MKGA 3E38A 3CLWA 2CXEA 4LRTA 3T0TA 4LH8A 3KTXA 1ZZMA 1C7TA 2PDNA 3L4XA 2F6KA 1TMHA 1QO2A 3TFCA 1SO3A 3KL5A 3OIXA 3WNMA 1KTCA 1UUQA 4HN4A 4DYKA 5TBOA 1K4GA 4UR8A 1LCOA 3T4CA 4CKQA 1I2OA 1E9LA 5I79A 3HQ1A 3G1RA 1THFD 1X1NA 5IDIA 4RE0A 2CWXA 4X3ZA 3EB2A 3ARQA 2FVMA 5LNVA 3ZT5A 1VGAA 2VWSA 6REQA 4CVWA 3HPZA 3A12A 4KFNA 4JTGA 4HNTA 4NT0A 1DXEA 1VB9A 3CHFA 3EGJA 4HU3A 3PPGA 4O4WA 3EX2A 4HHPA 2DP3A 4YIWA 3DHUA 5DX7A 3NGJA 2YDQA 4TTUA 1KNWA 1Z32X 1D3GA 1RP8A 3QW4B 4IPLA 3SY5A 3NYZA 1TJ1A 1UP3A 3W1UA 2BOEX 4IQDA 1XLAA 4J3SA 4WQ6A 4JTJA 4E8GA 3EYPA 3N4FA 1UA3A 4DEFA 2WVUA 1ZAHA 4F66A 3R0KA 1TMLA 4M29A 2Z6IA 1WAWA 3TIMA 1EF3A 1OQFA 2YBUA 1E9ZB 4O0ZA 4RE4A 1OCBA 3E02A 3TAKA 5EYWA 4AZIA 1YXYA 3WELA 1XXXA 2POTA 2QCDB 3UF9A 3PG8A 3MP5A 3A23A 3BAJA 2C71A 4FX6M 1CZ1A 3CV6A 6A3HA 3CYJA 4I7VA 2YBVA 4C1LA 4KCTA 4BQ2A 2W63A 4WJXA 2GDUA 3GC2A 4MM1A 4F0RA 1YTKA 1TPEA 4H9MA 3ZQ9A 1OY0A 2Q09A 2HROA 1D2KA 2BGNE 3VDAA 3NPUA 5HQMA 3PPHA 3ARTA 2YXXA 5F4SA 3K4AA 1JZ2A 3LV6A 1VLIA 4M51A 3DUGA 1G0CA 4OIFA 4A22A 5GVJA 3NL2A 3R12A 1JAEA 2D2HA 3RUBL 2GWGA 2NT0A 1V51A 1UCWA 4FNTA 3PBWA 4NX0A 4DY1A 3W53A 3WDHA 5FSDC 3QMRA 2XVNA 3T8QA 1JCNA 1R7OA 1HIZA 5AZ0A 3KWSA 3KBJA 4C91A 1WYIA 1YEYA 2RGMA 2BY3A 2VZUA 3CL7A 1PV8A 4QGCA 1QNPA 2YLLA 1JNEA 4N6EA 5BRPA 1B0IA 5I3JA 3AHZA 2WQDA 1A4LA 1A5SA 3LRKA 1W5MA 1JR1A 1WKDA 3WQ4A 4NI8A 3DX5A 4TMBA 4HPJA 1TPVA 1DQUA 4XZNX 3KRBA 4GX8A 4AVFA 1JYNA 1V79A 3NPWA 3TROA 4ICMA 4GG9A 3FJ4A 1PCWA 3MSGA 4U5IA 5A2CA 1ZFJA 4UQEA 3MI6A 4IP4A 2DORA 2E5CA 3FX4A 1VQTA 1W3TA 2NWRA 2GK1A 2QR6A 3H54A 1HX0A 5AYIA 2E09A 1ADSA 4B91A 2QCHA 5M2FX 1GGOA 1EOMA 3IK4A 6TAAA 1FKXA 3VM7A 1W3LA 4MWAC 4D2JA 3QTPA 4UTTA 4AWEA 4K3ZA 4MFEA 3BSHA 2ZA1A 1TE6A 3KVJA 3UPMA 1XQKA 1H7NA 2PA6A 3CQHA 3GKFA 3QR1A 1I1XA 1MQPA 1SR9A 1E6XM 1ZTVA 3WQDA 1PPIA 2IPGA 1EOKA 1EXBA 2GVLA 2QJNA 5CQ1A 3AMGA 2WSRA 2VZOA 3O63A 4FF5A 3ITCA 4OBSA 1LG1A 1NH6A 3WL0A 2A21A 3LHWA 4XAZA 3DEQA 3LXCA 4R5EA 3WFAA 3W24A 2ZKMX 1KW1A 1E1FA 1CGWA 4RUBA 1VYRA 4UZUA 3MUXA 3IIVA 3B4UA 5CC3A 2J7BA 2W66A 4PMUA 1QJWA 2ANUA 4XD6A 3QY7A 3W07A 3SW6A 1E43A 2E9LA 3C0JA 4AVOA 2OZ0A 2ZDRA 3L2IA 3NR0A 3WJSA 1KFLA 5JU6A 1GTEA 3E2SA 4R53A 4UNIA 2IUZA 4DZ5A 2A3AA 4JZ5A 3K8MA 4K68A 3TCEA 4AISA 4EP8C 2Y1HA 2VQTA 2AKMA 5DCBA 1FWIC 3VA8A 4AZ6A 3C2YA 2D2GA 5CLWA 5KTLA 4BI7A 3TWBA 2E0PA 2FZNA 4LSBA 4D6DA 1W5QA 4FOUA 1GJUA 2ZX6A 1HJQA 2GLKA 2F2KA 5ABTA 2YW4A 1ZLPA 4JTKA 3PAJA 2QCMA 3BDKA 1OG6A 1XIBA 2F2HA 3PNZA 4NVTA 4LUIA 3I7SA 4CNNA 4GZ7A 1Y5VA 1S5NA 4H9UA 4B90A 4YTSA 4O1DA 1HVXA 3ISIX 3H7RA 5AYBA 2DSWA 2ACQA 3DU0A 3KOFA 4K7VA 1F3EA 4D6IA 3Q45A 3KOZA 3U2ZA 1J01A 4A2RA 1L8NA 3GK0A 1JF6A 1Q6GA 3BW2A 1IT0A 1XRSA 3TN5A 2EKCA 1XKJA 1WBHA 2FFCA 1E72M 1V7YA 4KRZA 3WQOA 2ZRUA 1R2SA 4B5TA 3ITTA 3O0FA 5H8MA 4N7QA 1PWMA 3AO0A 2P10A 1BF2A 2BVDA 3CMFA 1RUSA 5LXXA 3CUJA 4Q4MA 1X39A 3DERA 3R8GA 5K7JA 2D2OA 3ZIZA 4J5NA 1M04A 3HJEA 4H00A 2CLMA 3AIVA 1B3WA 2W5FA 2WVVA 1KKOA 3G77A 1KRAC 3FS2A 3EBVA 2HTMA 2D0FA 4U3CA 4OBTA 1IIGA 1MNZA 3W73A 4PTMA 1IZJA 4R9OA 4HIBA 4MNJA 3CWNA 3RGTA 4Y7EA 4X63A 2IPJA 4FR1A 1LORA 3T2QA 1EQPA 2O56A 1OK6A 4W84A 1VJSA 3GDLA 1FWAC 3M0IA 4JFUA 3U6WA 3BWWA 3UWUA 3GDRA 2GOKA 1T7LA 1VBRA 3EX1A 4UTWA 1FWEC 5KEZA 1HUVA 3UXKA 1QW8A 1U83A 2DH3A 2XINA 7CGTA 1NIUA 4DWSC 3MBFA 3HGRA 4IXHA 3USBA 4PUWA 2ZC8A 1KM1A 1QNRA 4CQ8A 2OVLA 2QDEA 2V38A 2Q8XA 4NAFB 3DAQA 1QBAA 4XV0A 4FNSA 2PDIA 2YDAA 5HANA 3MUAA 3WBXA 4ICCX 4Z2GA 1DQWA 1CIUA 1AZ1A 3RLUA 4DI8A 4IL0A 4K37A 2JEQA 3HPFA 3W1MA 4AXNA 4AZBA 2P0IA 1XLGA 3WD1A 3SRFA 1ADOA 2RJGA 1TPH1 2Y4SA 1UW9A 4CLMA 5G4HC 4PCFA 1OT2A 4IMFA 4PUMA 1N8FA 3STPA 3BG9A 1KFEA 4NYYA 2J66A 5CZKA 4I5XA 3AWOA 5HNRA 3A6OA 3ABRA 3TN3A 3UQNA 3UW6A 2R1PA 2BDQA 3DFPA 5A8PA 3L0GA 1V6UA 3E2QA 3XIMA 3U4AA 1E1CA 2PDWA 2X0SA 3STFA 5HBFA 2CERA 3OHIA 4O1EA 4N2YA 3NYDA 2HEJA 3QQWA 3BCDA 4EXAA 2XVLA 2PFHA 1TWIA 4O1FA 1TJRA 4Z0JA 3S2MA 1HFBA 1QNVA 1SVDA 2KAUC 1XRVA 3N19B 2PC8A 4XIAA 1P7TA 1VD6A 5KINA 3BH4A 1CWYA 3INPA 3W29A 3I4EA 4S3EA 1YNQA 3MDWA 2XIJA 2SFPA 4N02A 5CPNA 1GVYA 4IICA 1XIGA 4B3KA 2G3FA 3BV4A 4WY0A 5TD4A 2ZA2A 3KE0A 3H12A 4RNIA 3GU2A 3MP3A 1EC7A 1IXOA 2UY5A 5FKYA 4PCNA 4EIVA 4MDOA 5E9XA 3W7OA 4P2VA 5BXTA 4CN6A 1TB3A 3VNYA 3TN6A 4AD4A 2RFGA 3HPAA 2CKRA 4HA0A 4AYGA 2WYSA 1YNYA 2GGIA 3L5AA 1XICA 2GFTA 4IQEA 1UWUA 2YSWA 3TV8A 1VRDA 4WY0F 1W9XA 4Y90A 4GRSA 1NDVA 2FMOA 1XW8A 4C6PA 4LCRA 4LUTB 3GYEA 1DJXA 4AY7A 4L80A 2JKAA 2ZX8A 1R47A 5H8UA 1KBBA 1NAL1 3QLDA 2VYOA 3PSWA 3D47A 1H4PA 1XGZA 3WSUA 3NQAA 1K1DA 4XZWA 1HZYA 1RHCA 3N17A 4F9JA 3PPFA 1S2WA 3P80A 3POHA 4CQCA 4I6VA 1D9EA 4WLCA 5E1QA 4H9ZA 2V5BA 1LUCA 3LBOA 4S3DA 3F4DA 2XUCA 4IFRA 5I07A 4HZ7A 3NM1A 1JYXA 4A6GA 3AISA 3FYYA 1J6PA 2Y89A 3CL6A 2CETA 4KEZA 3IRDA 4JN8A 1XI3A 3OTRA 4GISA 4GPNA 5BMXA 1ADDA 1SFTA 1ZCOA 1EZ2A 4D6FA 3WLPA 2ZX9A 2R82A 1DVJA 1LBMA 3KW3A 3WF1A 1QO5A 2A3EA 3PWAA 3LQGA 4G2DA 3IGHX 3VNZA 1KXHA 2ZFAA 3K5XA 3BVJA 1UZ1A 3G1FA 3VABA 4ZQMA 2BGSA 2VX4A 2XH2A 5CZSA 1LBFA 1NF0A 3LB0A 5GNZA 4ZENA 4KFOA 4LBSA 2OZ3A 1DJWA 3A64A 3S1VA 1AODA 1JZ7A 1O1ZA 5DMMA 3G6LA 3QPZA 2IMRA 4KESA 2Q02A 1SZEA 4P7OA 4JTLA 4LUYA 4DF1A 4GNKB 1ZALA 3N73A 1F8IA 4LYPA 4ZOEA 3P5YA 9CGTA 3WLKX 3GWQA 4YHEA 1XGDA 3L2LA 1EUNA 2ZUVA 3KVMA 3AZTA 4DO6A 5MKGB 4I9MA 2ZYFA 3FA5A 3O7UA 4EF9A 1OYBA 4JX5A 2J47A 2V0TA 5DMLA 1B3ZA 3I6TA 4O57A 3QJAA 1AH0A 1G69A 3CQKA 1AJ0A 4UQ9A 4WSKA 2X16A 2GYIA 3AYVA 2GZXA 1ITCA 5C5YA 3N13A 1OFRA 3VKBA 1TZZA 2ZX5A 3K8KA 2DZXA 3LXBA 3W6LA 5H1WA 2PDFA 1W2PA 1XV8A 4BJHA 1A3XA 3SN4A 2CZFA 1JPKA 3GR7A 3B0PA 1HP5A 3AMDA 5C0QA 2BZNA 5D2TA 4GYPC 1I6NA 4ZSTA 1LQ2A 1ISWA 2YA0A 4HNNA 3ARRA 3FA4A 4ASTA 4JQ3A 4HSOA 3OBKA 3G1YA 3TXVA 1JCJA 2NW0A 1R0MA 1JG9A 1E70M 1OGSA 1BHGA 3FCPA 1S2UA 1W9VA 4P7LA 4MVAA 2W27A 2Z26A 3P61A 1T99A 3B03A 1L6WA 1F07A 3I7RA 3NEVA 1A50A 4UIOA 2Y7EA 4RXFA 4NXKA 4UFIA 4QIUA 4GFIA 3CPGA 4KCVA 5U7SA 4GXPA 2PBOA 3RX4A 4OOZA 4RNHA 1OYCA 3MO4A 2IXVA 3C5QA 5BXPA 4FXSA 1BLIA 2CW6A 2ZQ0A 1TPUA 3G24A 2O4MA 1GQJA 1V6YA 3NO1A 1CW2A 4E2BA 2RKXA 5A2AA 5K4ZA 4MAVA 4EXBA 1CNVA 1GQIA 2NLYA 1FWJC 1KM2A 2JEPA 4LNYA 5AC5A 1AW5A 2PWUA 4O10A 1JDDA 3WDJA 3KZPA 2Y7FA 4PR4A 3GY1A 1EJWC 3WJWA 4D8ZA 3CO4A 1BWLA 3QSTA 2D20A 1KCLA 1J0IA 2QPUA 2XN0A 2PU0A 1GW1A 3WEOA 5CZTA 3AHTA 1KBJA 4LAUA 4O14A 3CPUA 2WHKA 5E0FA 3A4XA 2DIEA 1U30A 2FPYA 4O1BA 3F2CA 4CQBA 4OUEA 4KT2A 4M7TA 5FAJA 3TONA 2NX9A 3NZPA 3W4RA 4NASA 5EFFA 1RJRA 3PFRA 3G3DA 1S46A 3RR4A 1EPXA 2VC6A 1TWZA 4XKMA 5DMNA 4EOUA 4GVHA 2EPKX 4IIFA 4L64A 4IP7A 4U2ZA 3B4YA 1WP6A 2GWNA 2OO0A 1LZOA 3DFSA 3RM4A 5J5RA 5LXEA 4GXWA 3EXTA 1N82A 1P7TB 1SJDA 4ZXLA 3OO2A 2PGRA 2V5JA 1MRQA 4AZGA 3WMLA 5AYXA 2QCLA 2DGAA 4B2DD 3TSBA 4L5ZA 2ZRVA 2NZLA 3GXTA 5A8MA 5EMUA 3BGGA 1JQXA 4GVIA 1PX4A 1P6CA 3KP0A 1KBLA 3C2OA 5U4NA 5C9XA 1DXIA 2WM1A 2ZC1A 2PGWA 3A4WA 4L4OA 4Y9MA 5GJPA 4PFMA 1IIHA 2W91A 3O6CA 6XIAA 4IIGA 5BYWA 1Z8AA 4GY0A 3W76A 4QAWA 2FH6A 3OG2A 4KWWA 4XBJA 3EOLA 3C2EA 1J0KA 1AL7A 2C14A 3B9NA 4O0KA 1R3RA 1OFQA 4L9ZA 4MIMA 1ZP4A 3S2JA 4FNPA 3UJRA 1H7WA 3UCDA 3S5OA 4GI9A 1K03A 3QR3A 4E4PA 2PP3A 1ONEA 1VHNA 1XYCA 1UR3M 2AQWA 4QCEA 3AXKA 3UU0A 1EP1A 3TE9A 4PUUA 3G0SA 5FEZA 2JKEA 1J4EA 3NQ6A 3RLVA 4LVAA 5F2MA 1RBAA 4H3DA 2V5KA 4NL1A 4JFTA 2FKPA 3IEBA 1NARA 1UUMA 5FL0A 3BLKA 3LCFA 4GI4A 4PMYA 1LUCB 5FJUA 3XISA 1RJPA 4DJEA 1PS9A 1HKVA 3B0VC 4GIYA 3OW1A 3TWAA 4D6CA 1KM3A 4WIWA 2BVTA 2X42A 1PIGA 3ZZ1A 4WKFA 4XAGA 5HMSA 4BQ3A 1Q6CA 5JQ9A 3TQ0A 3V5CA 4MOZA 3O6DA 4LTSA 1CXKA 1SUXA 4W7WA 7ENLA 5LNSA 1H2JA 3WY1A 1W17A 4DAIA 4CUCA 3WLOA 3QBUA 5HJXA 4QSHA 4MMWA 3E5PA 5CXPA 3DC8A 3FVDA 3MCNA 2NVCA 2Y8UA 3N34A 3BJTA 1RCOB 5IFTA 1Q2SA 5AHNA 2ABBA 3OZOA 1C92A 1O1HA 3I65A 4F2UA 2DEPA 3GDKA 1ELSA 4XUGA 4GGBA 3SGZA 1ZJHA 4IPJA 4LC6A 1IE7C 3WQFA 4LS1A 1BQGA 4QDPA 4D6JA 3GIYA 1X38A 2C19A 3APGA 4FALA 4AG0A 2CIPA 1NDYA 3WDRA 5MHBA 1TTIA 5HATA 4KS0A 4L4MA 2Y61A 2VENA 3LEPA 2NVDA 3T0CA 1ZSXA 3R58A 1S3TC 2EJ1A 3GH5A 1JGIA 5TIMA 4BWLC 5AECA 1X97A 2OSYA 4UXDA 2BV9A 3O6YX 4KPLA 4BWLA 1JYVA 4HMNA 2V2HA 2F84A 3QHMA 4JQAA 3UWZA 1EP3A 2J24A 3IPWA 1CENA 3TNBA 3FDGA 1Q5MA 3S47A 5EPDA 1YTDA 3VIHA 4P7RA 1O5RA 4PSRA 3SZ8A 3C61A 3LHTA 1QI4A 1DWAM 1L0PA 1ZU8A 3A3WA 1YXDA 2WV8A 3K30A 5CPMA 1CB7B 3QSRA 2QEZA 1OC5A 1JULA 3M1ZA 4JD4A 3N3TA 4XBSA 4KEVA 2VVSA 2DSVA 3LPFA 1UR9A 1TV8A 4B3LA 5A6KA 5A6BD 2ZUTA 3TDFA 1DPMA 3AS2A 3LV5A 4IX2A 5F1VA 1Q7QA 4OUIA 5A6LA 3UJFA 1LBLA 4IMAA 4OT7A 2W61A 3T81A 3E0WA 1KR1A 3P82A 4GIEA 3VX0A 2GQ3A 1HKWA 1DEDA 2V5CA 2UY2A 5IXEA 4GI6A 3HN3A 4EPDC 1CGXA 1FVPA 3T0DA 2BY0A 2VFGA 5BU9A 1H61A 1E6SM 2UY4A 5T91A 1J0HA 3SUVA 2FB2A 2QPSA 4GHRA 3XINA 4BHYA 1XRFA 1BG9A 3IJ7A 2PF8A 3SCSA 4HQVA 1TA3B 5HUOA 2FZDA 1C91A 2VURA 2D24A 4A29A 1V0LA 3CC1A 4ZODA 2E6AA 1UOZA 3UJ2A 1V77A 5ABFA 5TNVA 3UR5A 1GYNA 2AL1A 3UCCA 5AHFA 3G1SA 3VCRA 3MV11 2WJZA 4B15A 2B81A 4C60A 1V0MA 1F2JA 1SJBA 2FDMA 4ORIA 2P3EA 3BMWA 1W0MA 3VIGA 3EEZA 8CGTA 1VEOA 1ZPTA 2Z7GA 3EOSA 3FGCA 4UFKA 4DJFA 2WK2A 3FXGA 2BY2A 2QUNA 1HTIA 1CGTA 2D73A 4WVXA 1O66A 4O8RA 5BCAA 1UIPA 3LCWA 3HM7A 4CNTA 3GNRA 2QAPA 5DY2A 2PEVA 3EDJA 1AW1A 4C7FA 5LGXA 3GW0A 1E6RA 3DXIA 3W01A 3GVVA 1GYLA 3VDGA 3H4WA 2CLOA 2BOFX 3QGVA 4JYDA 4O1CA 3G1HA 4A3RA 4HMEA 4OVXA 2F6XA 1K8XA 1VCVA 4NZJA 3QKEA 4QLKA 1BQCA 3BJSA 1K3UA 3M6YA 3PBMA 2XZ7A 3JU2A 4HVXA 2ACSA 1KC7A 4HA1A 8RUCA 1VHCA 4QLJA 5HR6A 3HGJA 3V35A 3W70A 3HZ3A 1WDWA 2F38A 1US0A 3E0VA 3PBUA 5JBDA 1LL7A 1MMFA 3A5VA 4I5UA 3A3HA 1NDZA 3WQVA 4ZFCA 1XS2A 1Z7AA 4UOJA 4NU7A 3UYCA 3ERPA 2V67A 3ANUA 3BQ5A 4UR7A 1PSCA 3NSNA 2NX1A 2P8CA 1TVLA 2WCSA 2Y5EA 4GUGA 4K1WA 4O19A 3MUIA 2WCAA 4XZ9A 5D9MA 4XAPA 4GYPA 1H0GA 1HL9A 3PZGA 4ACZB 4OU1A 3V18A 2Y7DA 2PZ0A 5I3HA 1UJPA 1H7PA 1AMYA 5I23A 5E09A 1J11A 1EKOA 2HS6A 2WNZA 1YRRA 4NZ1A 1TG7A 1JD9A 4J3XA 1JIBA 2QJMA 3NZQA 3BO9A 4BFAA 1MW2A 3ZSSA 3PJUA 5K4XA 4C6JA 2GVYA 5HJLA 1K8ZA 3PZIA 3CIXA 1WZAA 2QGYA 4V1XA 1TTQA 3C86A 1VLWA 4JQ1A 3P8JA 1TJPA 3WUBA 3NUKA 3OEXA 1KO0A 4CN4A 1G01A 4PTWA 2E77A 4UFHA 5A8OA 1P0BA 3NIYA 4O50A 3KUMA 1QI0A 4AEOA 1CT5A 3W7GA 3GAYA 2C1IA 3OQ8A 2YLAA 3ZT7A 3ANYA 4DIAA 1YKWA 3UGRA 5HUPA 1N55A 2AGKA 3WK3A 1DV7A 4HK6A 4JEJA 4K8HA 4Q6XA 1R5YA 4HHHA 3GB6A 1JRCA 3IIPA 1MUCA 2X7VA 4B9ZA 4D72A 1D8CA 3VKCA 1WDPA 1V4YA 3Q94A 4AIBA 3EDEA 3VZZA 3BOLA 5FEXA 3I6RA 3E2VA 1W6TA 1N8IA 2B7QA 1EA9C 3CAKA 1HJUA 3G2GA 1XC6A 2C1GA 4D6GA 4PBGA 1XH1A 4N6FA 1V3IA 3TFXA 3WO8A 3STGA 4H2HA 4HT3A 3WBEA 2J8TA 3W82A 2WANA 4AC7C 3SCWA 3N9KA 2VXNA 4W86A 2ISSA 3VK5A 8XIMA 4LF2A 5REQA 5HWMA 5J5DA 2YB4A 2QLYA 2GVJA 2ZADA 3OGRA 3H7VA 3LSBA 4R7OA 4EVZA 4UFLA 1M03A 1EGVA 1R3YA 3TU9A 4JDBA 3P67A 1JF5A 1W1YA 1WZKA 1YLVA 1E5JA 2REQB 3SI9A 4I9AA 4YTRA 4GJ1A 4MTVA 5G2IA 4F0KA 1QU4A 1D7KA 4BS0A 3L68A 1JDEA 1FWHC 3CLMA 4PUJA 5KZDA 3WMCA 1T41A 2HPIA 3KTCA 1A5MC 1AQ0A 3ARVA 5G2WA 3U8GA 3OJGA 1TO3A 1DL3A 3IUHA 4QDWA 3VNJA 2PODA 2VX6A 3MSRA 5E6ZA 1K7EA 4MLJA 3WCZA 3B05A 3DIPA 3EB4A 1WDSA 1NEYA 5AB3A 3TNOA 2ZRYA 4WJ8A 2BHUA 1MWOA 3DKLA 1EXPA 3NOEA 4GMEA 2PGFA 4ATLA 2JIEA 4ACZA 4DO7A 3GHTA 4YTTA 1PKNA 4QNEA 2QIIA 3MW7A 1Y5WA 2NUYA 3PZQA 3G6MA 4OFCA 3ALGA 3C0SA 4MDPA 4QM1A 1FWBC 4GCXA 1OADA 4FNQA 2YA2A 3L4UA 2VQUA 3NGFA 1ZAIA 2ZXDA 1KGUA 1MRAA 4UUIA 2XVGA 2J4GA 1BWVA 3VNIA 3WD2A 2EBNA 4HNUA 4LAZA 3LBCA 2E8ZA 2PS2A 1Q6DA 3RJYA 1LLZA 3OQEA 4R9XA 3P93A 1NELA 3I6EA 3QTGA 5M17A 3TR9A 4BA0A 1S3HA 2VMFA 3UCQA 3VILA 4KRTA 2IS7A 4H8UA 3TJIA 1P0KA 1BEUA 2BSLA 1LOLA 4JX4A 1LQAA 1RBLA 1S2CA 2X05A 4CCDA 1IT7A 4NZ3A 1G5AA 1EX5A 1I60A 2OGYA 3RRAA 3CQIA 3G22A 1X6NA 2I5IA 5KETA 3UG8A 4QCFA 2VX5A 2DZAA 3COTA 4PMNA 1EEPA 3VFCA 4Z08A 1PAMA 2G95A 1H51A 1P0EA 4QEHA 1UWTA 4F4RA 2HVNA 4DM2A 5I6SA 2C0HA 3SEPA 1U5JA 3PP7A 2DSKA 1XQLA 3R6IA 2WNQA 3VM5A 5K9DA 3AXIA 2PTWA 4KKXA 4TQTA 1GVIA 4KIRA 3DFQA 1VENA 2FGZA 4GBUA 2EPNA 1JXKA 1N2VA 1XDLA 1QATA 3LK6A 3PNUA 1XLCA 3KRSA 1I2QA 1ZBVA 4XAYA 3CAVA 4K39A 5L6UA 4XD4A 3RMJA 4DO4A 4I8YA 2B7NA 3KL0A 3R43A 2DIKA 1X6LA 2QDDA 4HU0A 1KTBA 3P7YA 3BLFA 3OZPA 1FY6A 4XO6A 4ADTA 2OLSA 4ROPA 1BYCA 2VGGA 3AXXA 5ABEA 1JXJA 3PHAA 4FHAA 4HSHA 4N4QA 3BGAA 4C6OA 2WXDM 1HKJA 4MZ8A 1SPQA 1OFOA 3V0SA 1J8VA 2ZX7A 1M6JA 3SCQA 2QAFA 3BAXA 4GXMA 3DBNA 1ZJIA 1IWBA 2A3HA 2X1SA 1XYZA 1MW0A 4C5YA 3GU1A 3PTMA 1MW3A 1RA5A 3OA5A 1RV8A 4ORMA 3VVGA 1YDNA 3FN9A 1MFUA 4ML9A 3MPGA 4HOXA 4YCPA 3QY8A 1BVNP 2PU1A 8XIAA 1OFPA 2FJUB 3MI3A 4JXCA 2BX7A 2WLZA 3TK7A 4XVEA 2AMGA 1D7FA 2OB3A 1J5SA 5D09A 3UG5A 6PTDA 1WKFA 4E2OA 2I17A 3TSDA 1GOXA 4H1ZA 5CPQA 1Z89A 1Y0EA 1SO4A 2YCJA 4DM1A 2YPIA 1OX4A 4JPGA 3G0XA 5AZ1A 1JDAA 4C65A 4MJZA 2WSPA 4L1GA 4JL2A 4MNLA 2EG8A 2J79A 4MWAA 4EPEC 1TQJA 3OBEA 3UFYA 5HXMA 2OEMA 1E9YB 4IMCA 2ICSA 4EF8A 1UBPC 3UNDA 2ATMA 4Y9OA 4RLIA 3KBWA 3W26A 5CAKA 3HU7A 5DT7A 3SJNA 3DKJA 4PSPA 1CBGA 3WDPP 2FVLA 4D6HA 2QHAA 3N2CA 1KV8A 1DJZA 1XLEA 4DJDA 1ZQ5A 1WE5A 3W3OA 4DXVA 3TQKA 1PZ1A 2VOMA 3MYOA 1TVNA 4J3WA 5E5CA 4K7YA 2WCGA 1V3KA 3BURA 5F4XA 4DPPA 4JNMA 4N4PA 4XO7A 4RDVA 2EGZA 3EMQA 3RO8A 2V3EA 4YN5A 1DKWA 4KGJA 1WQ5A 1RD6A 3BW3A 2C3ZA 4AD5A 2D2JA 4JHZA 1SMDA 3W00A 1HKKA 1SW0A 2XH0A 2X1IA 4OV4A 1GW9A 1V7AA 5D4YA 4Q4PA 1Y65A 2J8FA 2J8GA 3AHVA 3OPSA 3BSGA 3N29A 3FNDA 1BYAA 3KXQA 4WSHA 3O6AA 4LANA 2W0UA 1H1ZA 5FF3A 4C6BA 2AGTA 2I5GA 1PX3A 2PWGA 4MKVA 9RUBA 1FWNA 2GGHA 1XH2A 1QHOA 5D8WA 2OTDA 4EXQA 1B9BA 4CD4A 1ZL1A 2OWXA 4J3ZA 3HURA 3CUHA 1IXNA 5DCDA 5JH1A 3GLCA 2JIWA 3WDQA 3M44A 4WGXA 5FA5A 3KEHA 4NJGA 3WK1A 3BL3A 5I06A 1UOKA 2J62A 2OOFA 2WMIA 4IIBA 1S38A 3TC7A 3MWCA 4FXFA 3T8LA 1I2RA 3WNLA 3GIQA 4XAFA 1ODZA 4JTIA 3DYOA 1BGGA 3AWNA 1XDMA 1S1RA 1GQLA 2C16A 2WC7A 4YPJA 3SN1A 5EMLA 3WUFA 5CZ0A 3JZUA 1CXFA 2G8ZA 4HNVA 1SJCA 2QF7A 3ENLA 2Q6ZA 3W7NA 1SM9A 4ZE5A 2VR5A 4YU1A 1WKEA 3IACA 3NQ7A 3T2PA 2ZZ4A 4H2CA 3M9YA 2E6FA 3V0TA 4ZO7A 2AMXA 1EEXA 1XLKA 3EKLA 3UWYA 2WZEA 1R3WA 4YJ5A 3GYCA 3TMLA 5HMEA 1NOWA 3BSMA 4A2SA 5FOOA 2Z1XA 2VEIA 4YTUA 3UPWA 2JGQA 5HMFA 2B4GA 3RIKA 2XN1A 4AU0A 3TJXA 1GKQA 3QF0A 2EG7A 4JTEA 4G7EA 1O60A 2QW5A 3HQOA 2ZRXA 4NNBA 4XSMA 1PXGA 3E2RA 1LT8A 1S2AA 1XIDA 3PVFA 2HVMA 4DNMA 5CG0A 5D2XA 3FIGA 3VNDA 1BSIA 3MC5A 1BKHA 4U4MA 4AD1A 4X9YA 2WSQA 4V28A 4B16A 2DZTA 1DHPA 1ISVA 3HFTA 1TPB1 1HNYA 3UJEA 3VOIA 1E55A 5DQPA 3URQA 1B57A 3F5KA 4C6IA 3TAOA 1SFLA 4Y96A 4JTUA 2NWSA 3QOMA 3KS5A 1XGEA 3ABXA 1GQKA 4Q8VA 4L4LA 4MPKA 3IK2A 2HISA 4QBXA 2C15A 1ZP3A 4LYKA 3DG6A 2GJRA 1GZ1A 4E0CA 5XIAA 2CPUA 2PDMA 4JQ2A 3ONBA 1AQMA 4JN6A 1PZ2A 3R79A 4UTMA 1JZ5A 4B5UA 1EP2A 2Z7KA 4DUOA 1VP5A 1GVEA 3H2EA 4LALA 1XCXA 2HCVA 1XDJA 3QHOA 4FMVA 4F3HA 3GS6A 1UMYA 3QEZA 3V5FA 4OE7A 2W3ZA 4O53A 3PBGA 1RD5A 1AJ2A 2G4FA 1GKRA 1F05A 1ECQA 1W9BM 4PEEA 4L1WA 4PTDA 5GJNA 4J3VA 1XWYA 3M6DA 4P8VA 4X2RA 3CHEA 3EWBX 2C7FA 4EWND 4K8EA 2DZBA 3S6TA 4JIEA 5LA0A 1PB0A 1VKFA 1YHTA 1LWIA 3ANVA 1NM9A 1XYFA 4E6MA 5HQLA 4LYQA 3UZJA 3GTHA 1YPXA 4J4KA 1QPKA 4MB1A 3W84A 2FMNA 2BWGA 1AFSA 4UMCA 3AUOA 3BAIA 2ZZ5A 5BRQA 4NZ4A 1Q66A 3SCPA 2ZRZA 4ZVJA 3VMOA 3N3MA 2E9MA 2BODX 3PJXA 1AG1O 3DBPA 1UZDA 2ZCGA 2GSHA 3KCOA 1E4LA 2PUZA 3SB0A 2Y2WA 5H8PA 4PBFA 4E4UA 5CEWA 2XDFA 4YYCA 1OCQA 3F4CA 4PYSA 4PODA 4RCXA 2DU2A 3W7MA 4M82A 2QF8A 4GUFA 5I02A 7TAAA 1DJYA 4QQUA 4LCSA 3REQA 3W2LA 3LGGA 3G1XA 1R3QA 1XIEA 4TXEA 3H53A 2VR2A 3GC4A 4JDYA 3BCJA 3GW3A 4MJ4A 1P1MA 1VFLA 5HK4A 3GVGA 3KLKA 1R3VA 3M0JA 1MXGA 3QXBA 1EIBA 4Y2WA 1YNPA 3NA8A 3CK5A 4C6EA 4IPIA 2HBXA 2WQPA 3EX3A 1DIEA 2ONEA 4ZZ9A 2ZTKA 4HSNA 1G4SA 3M0XA 1BXCA 1CX9A 3Q58A 1AJZA 2XIMA 1IR2A 3LA4A 3D46A 2INFA 3KVKA 2H3DA 3W88A 3CEUA 4CD8A 1MZHA 3KBNA 1BFNA 3MSDA 1OFAA 4O16A 4QS6A 5A8GA 4HCLA 2J7GA 2RH9A 2ZZ3A 5DBTA 4Z1BA 3GVWA 4W93A 4H8NA 5A5WA 1U5VA 2F6UA 4CD5A 3PUEA 1BRLB 3MVIA 1V0KA 3MDUA 4A3HA 4S3GA 2J6VA 1EGMA 2Z1VA 3FGCB 4N9BA 1KRCC 5ENLA 4QLLA 2Q3RA 4W5ZA 1Z6KA 3A24A 3PANA 1XYLA 3LX9A 3GVRA 3EWDA 3QZ6A 4IUGA 1B5TA 4B9YA 1GQNA 1MW1A 2XIBA 4AD0A 1TPDA 5CPOA 4H41A 3W7HA 4DYJA 3GNOA 3T07A 3LMZA 3WF4A 1C8VA 1TWWA 1NQKA 1GWJA 1F6YA 1R85A 3GQYA 4FIRA 2CBIA 1KV5A 2EO7A 1AD1A 3GTIA 1PX8A 2CLHA 1ISYA 4GQBA 3TEVA 4JIRA 3W38A 1GCYA 1PIFA 3WQPA 4I9JA 3QY6A 3TH6A 1Q6OA 2NXGA 4JYFA 3TVAA 5BOEA 5CJ5A 1KBKA 3N04A 2Q3OA 2A2IA 3TTEA 3I10A 1XR2A 2YX0A 3LRLA 3T05A 4UTJA 1I4NA 4HU4A 2EQDA 5AHMA 1FHLA 1XSKA 2R9RA 1MSSA 3QGAC 1ZBKA 1TR9A 1OD0A 3UT0A 3FAWA 2YL6A 3M7WA 1K9EA 3KCLA 2FFIA 2GUUA 3I3EA 2VL4A 1OK4A 5ABGA 5C7VA 3KL3A 2WAGA 4D1JA 2X2YA 4Z1AA 5A6MA 5HQEA 3O06A 5F2LA 4UMAA 1Y7VA 2DQWA 3WUGA 5D9NA 5A6TC 1BAGA 1C7SA 2GK1B 4AD3A 5IHRA 2C13A 3KOWA 4IJCA 3WFLA 4L6OA 4AZ5A 1PWLA 3BZGA 4BY3A 2PDCA 3TR2A 2VM8A 3N2BA 4KWVA 1QWKA 5EL1A 4DJFD 2V2CA 2GVGA 3OVPA 4Z2HA 3ZVHA 4QE1A 3R8HA 4DQWA 4Q8WA 1TWSA 2QUUA 3RLHA 4IMGA 1V03A 2A3BA 3F5LA 2WJFA 2HK1A 1VYPX 3S2CA 2OU4A 4AMAA 3HGOA 3THAA 3VMNA 4NKCA 3FLUA 2R14A 1B1YA 5IRPA 3P3BA 1DTUA 1H3GA 1T8XA 2FHCA 3S5SA 4EKJA 3W9ZA 1FFQA 1VPQA 3TW6A 3W2KA 1NFBA 2DT2A 1QNOA 4DZIA 4O15A 3L21A 5AHLA 5LHFA 4V1YA 4DBDA 3HG3A 1H63A 1EB3A 3VKDA 3CB3A 3KRZA 4L61A 4IJBA 5LIKX 3WQ5A 1VJIA 3N9SA 2ODOA 1VRXA 1RQHA 1VF8A 2DSZA 3B0XA 5DF0A 1CLVA 2IKHA 4JGDA 4WOQA 2EEXA 5HWJA 2VX7A 1A47A 1IGWA 1Q45A 4I3GA 1VYSX 5TF0A 2QDGA 3AYTA 3T6CA 5EFDA 3BQ6A 4QNWA 1H62A 2YCLB 3I4KA 2C1HA 4BI6A 1DE5A 2YFOA 1K9TA 3G0UA 3UR7A 4A35A 4B4FA 1Q6QA 5D05A 4H7CA 4IH3A 1GYMA 3AQUA 1NFGA 1TE1A 1GG1A 1Q7MA 2DPEA 4I6KA 3ZWSA 3A22A 4UFMA 1GZGA 1FRBA 1XF0A 4OWGA 3LZ3A 3N9RA 1W32A 1VPYA 3M5XA 2P0OA 2OKOA 1VEPA 1DIKA 3WQ8A 2Y7GA 4QG8A 1CGVA 1DJHA 3PC0A 5JMUA 1UP2A 1GVRA 1T40A 2VD8A 3TXZA 4DZHA 4O28A 3MB9A 2PWEA 1KGWA 3RYSA 3WH8A 4AAJA 2F8QA 3TTQA 2WMHA 6CGTA 2BHZA 4R7WA 1WX0A 2PTXA 3RF9A 2X0HA 3C56A 4HA3A 3SO7A 3E9AA 3VX1A 2H9AB 5AYZA 4FB7A 2RUSA 3GG1A 3WZ0E 3T0BA 1MXDA 1FCUA 4UZSA 3W74A 4MYAA 4LBRA 4MADA 4AEEA 5CSSA 3DHFA 1B4EA 4P61A 4R7JA 4Y9PA 2XGBA 5LSMA 4QP0A 3BAYA 1FH8A 4WGHA 4REQB 1E71M 4INFA 1IEXA 1UD4A 4CNSA 3W1PA 4LS0A 2NQLA 5D2VA 7REQB 3IJQA 3TQVA 5DLCA 4Q32A 3WFZA 3S1XA 1L8PA 1UD3A 1QOQA 1MZRA 3BTNA 2XHYA 3U48A 1H7OA 3VNKA 4A8IA 3ES8A 3WBWA 2BVWA 4JCMA 4H6RA 2HK0A 2CZEA 3BMXA 2CLIA 3AIEA 4PTNA 2XFRA 2YZ5A 2A6NA 4FS9A 2VDIA 2V9DA 1KQYA 3GDTA 5M3WA 5IM51 2DZSA 3MS8A 1BKSA 2ALRA 3EOEA 3AJXA 2P5NA 1IT8A 3O16A 4R3UA 3GXIA 3O8AA 1OD8A 4MWAB 3AXMA 3SBFA 2ZZ7A 1POKA 3TW7A 4GWEA 5IBXA 1O5QA 2I56A 3P60A 3PZTA 1FDZA 4AZCB 2G96A 2D0GA 1LOSA 2QJGA 1JZ8A 4JKKA 2OYLA 2O4QA 3K13A 2QCFA 1UYQA 3H24A 2OT0A 2VTFA 3LNMA 1EWDA 1C3FA 4AB4A 1BWKA 3PWIA 1HO1A 3EZ4A 3UWQA 3PY2A 3VFLA 1BG4A 2GVEA 1UZHA 4WDUA 1VR6A 2BFGA 3KHJA 4W7VA 3PN8A 1NTHA 1L2UA 3M47A 4MFDA 4WZHA 3APYA 3PB0A 4HYRA 4DWDA 5CCZA 1ONWA 2VCBA 5HNTA 1XL9A 3WQEA 3W7KA 3S9ZA 2CLEA 5CSYA 3CNYA 3WNOA 5E0KA 1UC5A 1XIMA 3BC9A 2OYKA 2V82A 1W9PA 4IPPA 4DWSB 4CEXC 5D33A 1UC4A 2AAMA 4MHBA 1X8CA 3B40A 2WPBA 4QG6A 1OFBA 2IQTA 4BF7A 2XSXA 1CLKA 1AL8A 1DTNA 4XK2A 5BROA 1ZRQA 4UTKA 3B9AA 1XLFA 4TV5A 2Q01A 1V0NA 4MY9A 1JNDA 2IQDA 3W02A 3LCLA 5CC6A 4AD2A 5T26A 3SCNA 2PLMA 1KM6A 4HZ8A 4YVXA 2FGBA 1HL8A 2EJAA 2ISFA 3WMSA 1H5VA 1BYBA 1A5UA 3LHYA 4J1OA 3VIJA 2NUXA 5BU6A 5FEWA 3DECA 1WZMA 1LG2A 5EKYA 4JAWA 3WH9A 5BW6A 2HXTA 4WJEA 2ZZ2A 3W22A 1E9IA 3SGGA 3IAQA 3VGEA 3SURA 3H2MA 1HP4A 1XG4A 4I8DA 3PZOA 1Q7ZA 1HJSA 3LTPA 1GT8A 3PM6A 1V3JA 3N25A 5HWNA 2OLHA 2AOSA 2X2GA 3UXAA 4JR5A 1WCGA 2UY3A 1L9WA 3WLTA 1US3A 3IGUA 1TIMA 5LNRA 2VZSA 3CUFA 3ZVIA 4J2MA 4PEKA 2EPLX 4ZEPA 4IHCA 1L6YA 4Z1YA 4PRRA 2XU2A 3NQCA 2QJIA 1A53A 5FEPA 1PYFA 4LEFA 3NL3A 3URNA 3RCNA 1F4HA 2I57A 9XIAA 3F4VA 1OG0A 4MWAE 3JRKA 4GO9A 2CYGA 1FP9A 3MTWA 4PTXA 5D03A 5F2GA 2PGEA 1OT1A 3ECQA 4DYEA 2OLAA 1FWWA 2DSUA 5LZLA 4F0MA 4PULA 4OOUA 1KA9F 1POJA 4ECLA 2H8XA 3N6HA 1VEMA 3MQTA 4RX0A 4A8RA 1HO4A 2V63A 2JALA 2YCIX 4AZCA 1BSLA 2EPMX 4U5KA 3EWXA 2LLEA 1QXLA 1PBGA 1SW3A 5HOSA 2YA1A 2DV0A 3GNNA 2UWFA 4U31A 3E6EA 2HBVA 3AUJA 2PI6A 4XBKA 5J04A 3KP1A 4IMEA 4GINA 1QR7A 1A3WA 3MV01 3UD6A 4FEZA 1OC7A 1E0XA 3T55A 2VNCA 2XWEA 1ZGDA 1TTJA 5HINA 1M41A 1VIZA 2VC7A 4CEUC 1FOBA 4H6QA 2P3ZA 3AZSA 1GUVA 1XFCA 3CL8A 4OHQA 2VEFA 4NZCA 4NRSA 3W37A 5IOBA 2GGGA 3QV6A 1UWQA 3TC3A 4J2PA 1OEPA 3LGEA 3AHYA 4M8UA 2P76A 1DXFA 2NV9A 3VGHA 3HFYA 1MFVA 1HF6A 3M5YA 2R1NA 3I7QA 3FYPA 4XX6A 1A3HA 2WMKA 1RQBA 4LUTA 3PTQA 3EWWA 4HJFA 2DUXA 4PMVA 5GJMA 4HBKA 2QCEA 1KM4A 1JQVA 5CAHA 2XSAA 4M5PA 3P14A 4EANA 2X40A 4JTHA 3CXOA 2PDHA 2Z25A 1Q6EA 4ICNA 1G7VA