1FHLA

Crystal structure of beta-1,4-galactanase from aspergillus aculeatus at 293k
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
334
structure length
334
Chain Sequence
b'ALTYRGADISSLLLLEDEGYSYKNLNGQTQALETILADAGINSIRQRVWVNPSDGSYDLDYNLELAKRVKAAGMSLYLDLHLSDTWADPSDQTTPSGWSTTDLGTLKWQLYNYTLEVCNTFAENDIDIEIISIGNEIRAGLLWPLGETSSYSNIGALLHSGAWGVKDSNLATTPKIMIHLDDGWSWDQQNYFYETVLATGELLSTDFDYFGVSYYPFYSASATLASLKTSLANLQSTYDKPVVVVETNWPVSCPNPAYAFPSDLSSIPFSVAGQQEFLEKLAAVVEATTDGLGVYYWEPAWIGNAGLGSSCADNLMVDYTTDEVYESIETLGEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-1,4-GALACTANASE
publication title Aspergillus aculeatus beta-1,4-Galactanase: Substrate Recognition and Relations to Other Glycoside Hydrolases in Clan GH-A
pubmed doi rcsb
molecule tags Hydrolase
total genus 123
structure length 334
sequence length 334
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2000-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1fhlA00
4Z2IA 4D1JA 2GFTA 2VVNA 1J10A 2VO5A 5IFPA 2CYGA 3CZKA 2CHNA 4L4PA 3RM8A 3GNRA 1WDQA 4UFKA 2XIBA 1DWHM 2J7GA 5CG0A 2UY2A 1QI2A 4HMDA 1QBAA 1GORA 5A3HA 3CZLA 2WMIB 1OGBA 3T08A 1GVYA 1CGYA 3UG4A 4P7QA 2CNCA 4PTMA 2J7DA 4UCFA 1EHAA 3OZOA 2DSUA 3VM5A 3VD9A 2VOTA 2J79A 1ISYA 3VGGA 4UFLA 2BNJA 1NWTA 3WBEA 4P8VA 1R86A 1EHNA 3F5KA 2TAAA 1PBGA 1CYGA 2E4TA 1N82A 2WMGA 3ALGA 4JZ5A 1H0GA 4QFUA 3CMJA 3NIYA 3W24A 2J78A 1ESWA 1IV8A 5CPSA 3BAWA 1KXTA 1H2JA 1QBBA 1JDAA 2DIJA 2BFGA 1P6WA 1B30A 2UWFA 4BQ5A 1MVYA 4Z2LA 1JFHA 3VD5A 1PZ2A 3CUJA 3ARTA 3BAXA 3T0BA 3W28A 2E9MA 1MWOA 1PPIA 3W53A 2FGZA 1JZ5A 4HOWA 3VVGA 3RCNA 1KQYA 4QDMA 1GOOA 4BQ2A 1E0VA 1Q6GA 1ISXA 3S6TA 1L8NA 4WKAA 1E15A 3L4UA 2E9BA 3N11A 3BAYA 1ISVA 1KCKA 1QNRA 4CN4A 3WENA 3DYMA 5D8ZA 4UQDA 2ZIDA 4GIAA 3AS1A 3VDBA 4BQ4A 2OYLA 3VIIA 1EQPA 3W4RA 1GQKA 4YPJA 3FY1A 1UD2A 3AZSA 4QCFA 5D9OA 3SUWA 1LWHA 4UQEA 5KZ6A 1JZ3A 4HTYA 4CU7A 4H2CA 1TVPA 3D5HA 2Y8VA 3M46A 1E4MM 2WXDM 2PI6A 2G4FA 2FHBA 3B9EA 3RMEA 2WWDA 3TTYA 1BTCA 3VGHA 1QHZA 2FH8A 1E6QM 1O7AA 5BRPA 2ZICA 4AIUA 4UQ9A 4JKKA 3IJ9A 1H11A 3GH4A 4U5KA 2ZXAA 1EXPA 3SCVA 3W26A 2DSZA 1UWUA 3AXIA 1YQ2A 3CHFA 1GZJA 4V2XA 5GNZA 1KWKA 1SYTA 3RDKA 4M1RA 4UQCA 5JBFA 2WANA 3CTTA 3AFBA 4JCLA 1LQ0A 4W89A 2CCRA 2WLYA 5BROA 1CGVA 2WCSA 2IUZA 3ZJ7A 4AWEA 2WCAA 3ZIZA 4F9JA 5HPOA 2XGIA 1C92A 3JUGA 4W87A 4DWSC 2CETA 1DWFM 4AZ7A 3EYPA 5E0FA 4YHEA 3U7BA 2BY3A 5F7UA 3ARVA 4PMRA 3WEMA 5ABHA 3OBAA 3WQ8A 2QHAA 1JFXA 2D23A 2J7FA 2A3EA 1UR0A 1JZ7A 3FAWA 2PWEA 3SCWA 2VX7A 3EMZA 3WD2A 1B9ZA 3CBWA 3DHUA 1LJYA 3HMCA 3WFLA 3WF4A 1BYAA 2EPKX 3SCNA 2YA1A 4CCDA 4D6HA 1W9BM 4ML4A 5DMYA 3AIVA 4CUCA 2OWCA 3LPGA 3ZO9A 3AHXA 1EOKA 3U5YA 4ZE5A 5C70A 3KZSA 2WMJA 5BXTA 2YA2A 1Z32X 4J3XA 5KEZA 1G01A 3K8MA 5BCAA 1W9PA 1WKYA 1B3WA 3KL3A 5A6KA 5D9MA 4CD4A 4UFIA 3BAKA 2OWXA 1JNDA 2X1IA 2DSKA 3A4AA 1M53A 1TZ7A 2Z1SA 1RPKA 3EDDA 2DDXA 1TUXA 4NI3A 4B9ZA 2WVVA 4URIA 1KXQA 1BVNP 3B9AA 1TCMA 1KFWA 2DT2A 2X09A 4AMCA 1V6YA 2GDVA 1OSEA 2XJ7A 2UY5A 2QV4A 1HKKA 1J0ZA 3CZGA 1R8LA 1HVQA 3GM8A 4MDOA 3VX0A 4CVUA 2WC7A 1JG9A 2Y24A 5CGTA 1MXGA 3ZT7A 2V3DA 3VMPA 2E9LA 2EJ1A 1TVNA 3PTMA 4ZEPA 4J3VA 1ZBWA 2BHUA 1B31A 1VBUA 3I3EA 1FHDA 1HJSA 4W84A 3WH5A 4JFSA 3TTOA 1MFVA 1UD6A 3QHNA 4TX6A 3I3BA 3WF0A 5ABEA 3WEOA 3CH9A 1PEZA 3ZT6A 1E6NA 2Z1KA 1BGGA 5CPQA 2D0HA 5IHSA 2CPUA 2J4GA 3PZIA 2XFRA 8A3HA 5CPTA 1R87A 4AW7A 4W85A 1LG2A 2VX4A 2VZTA 3WBAA 3LPPA 2YIHA 1RP8A 2X0YA 2PF0A 2XVKA 3FXYA 2JFEX 1HJXA 1TE1A 1HVXA 1WZAA 3F5LA 1UZ1A 1VF8A 2X05A 3PTKA 3L4TA 3PZ9A 3CUIA 4P7LA 4GO8A 2BVYA 1XYFA 2G3IA 1H5VA 2J7EA 3ZJKA 1TMQA 3MUIA 3CZJA 1R85A 3ARPA 1JAKA 1CECA 1V6XA 1AQ0A 2UY4A 4AZ5A 4GZJA 4JL2A 4S3JA 2XM2A 1EIBA 2NSXA 1GHRA 2UY3A 2VMFA 1L0PA 1D2KA 1B1YA 4HA3A 1V02E 2HISA 4CU6A 5I77A 4OZOA 3IANA 1UWSA 1BSIA 5BXPA 1PJ9A 5AC4A 1AMYA 1W3HA 2F61A 3AS0A 2VRQA 1UKQA 1FP8A 1GQJA 4DUXA 5EB8A 5A2BA 3WUFA 4P8UA 1V03A 2W62A 4FLRA 1OD8A 1LG1A 1M03A 3L2LA 1Q6FA 2FGLA 4MJ4A 1G5AA 3ZSTA 2IXUA 2FH6A 5ECUA 1MQQA 3NDYA 3A47A 1BPLB 4IPLA 1JGIA 2WSKA 3PZNA 5E70A 5AYIA 1H41A 5I6SA 3W25A 5A2AA 3AI0A 2XM1A 4D6EA 4M8UA 3GH5A 4CGTA 3A4WA 2NT1A 3FHAA 4CD8A 4JIEA 2YA0A 2AAAA 3MUAA 1H09A 4EK7A 1E6PA 1ODZA 3HJEA 1G9HA 1A3HA 1K9DA 2J62A 4OIFA 1VRXA 2VR5A 1BVZA 4NF7A 2VZUA 4A4AA 1BHGA 2DEPA 3N1AA 1GPFA 2YKKA 2J7BA 1GJUA 4C7FA 1HL8A 2XG9A 2WHLA 4PMQA 4U31A 3NUKA 1OCQA 4GZEA 2Q8XA 3AS3A 3VTRA 2GK1A 1C8QA 4P8XA 5FKYA 4WJXA 4XZBA 3PTQA 2FHCA 4P7OA 4EANA 4CN1A 4W8LA 3WFZA 3OLEA 1GHSA 4GQQA 1CTNA 2E0PA 5E9AA 2DPEA 1UHVA 2WZIA 2XUCA 4CCCA 4H8VA 2CBVA 4L4OA 1NWUA 1WDRA 1QW9A 3EBVA 4P8WA 1ZBVA 2BVDA 3AHVA 1UH4A 2YBTA 5CSYA 1DWIM 3VMOA 1NP0A 1VIWA 3FAXA 3MSGA 1PAMA 3PZTA 1J0IA 1EA9C 3WMSA 1K9EA 1JYWA 1OT2A 5EFFA 5I3DA 3FN9A 4W5ZA 1UWTA 1OGSA 3VO0A 5A6JA 2VC9A 4AISA 4RE2A 4MAZA 5CXPA 2J77A 1JI2A 1GUVA 5A2CA 2EBNA 1ZBKA 2EPNA 1H1NA 4UFMA 4C7GA 2W4XA 4Q22A 5M17A 3MV01 1M7XA 4CN6A 4PMVA 3L4WA 1V3KA 1EQCA 1J9YA 2VQUA 4AD2A 3POCA 1BFNA 2VI0A 5GPRA 1HL9A 4HU0A 1U30A 3IAPA 3CO4A 5A8NA 1UR2A 4EKJA 1ECEA 2YL5A 1CXLA 1WNOA 1SMDA 2WVSA 4JHZA 3BLKA 3WQWA 4X0NA 2XVNA 2CEQA 1SFSA 4MJ2A 4DWSB 3WQ5A 1EDGA 1JAEA 3F5JA 1W1VA 1KR1A 2WZHA 4MNMA 1CGTA 5IFTA 1NARA 1W32A 2A3BA 3O9NA 3WY1A 2VVSA 2DQXA 5HBFA 3DHPA 1R7AA 1Y7VA 3VMNA 1OD0A 1JD7A 3K1DA 2XIIA 1BLIA 3AXHA 4M29A 1W3JA 1HIZA 3RILA 3WF2A 4U5IA 1W9VA 2O9RA 3RPMA 1HXJA 1WDPA 3WIJA 4JFVA 2JF6A 2VR4A 2XTKA 3KL0A 2D0GA 2CKRA 3WMCA 4IISA 3W29A 3VKKA 3CIVA 1KGUA 4OOUA 1VEPA 1WDSA 3WF1A 4LYRA 3VD4A 2ZX5A 3GH7A 4H7VA 2ZX9A 4HZ8A 4J7RA 1BF2A 4AZIA 1XH0A 4TVDA 2A3CA 1DWAM 1VJZA 5DO8A 3FNDA 1B3YA 1GVIA 1BGAA 4F79A 1UKOA 4LYQA 1HJWA 2W63A 3AIBA 1O6IA 2WPGA 1UOKA 1V0KA 4W7VA 2OLHA 3BLPX 3EDJA 1IZJA 4AC1X 4FLOA 3G6MA 3WQ6A 2D24A 1TG7A 4XUYA 3WNPA 2V5DA 4HA1A 3AICA 4NZCA 1J01A 4AD3A 1NM9A 1UWRA 1R7OA 1LL7A 4M82A 3VIKA 1VFMA 1E6ZA 1UH3A 3VUPA 3VGEA 3AISA 4PMYA 1E73M 3ARZA 5A1AA 1JIBA 4PMOA 3WL1A 3CUGA 3PZOA 2CBUA 1E1EA 2EPLX 2XFYA 3RO8A 4D6GA 3QOMA 1ZB5A 1XCWA 1CPUA 3UETA 1DHKA 4GZIA 3F4VA 3K8LA 1OM0A 1E56A 2VUYA 1E1FA 4PBGA 4Z2JA 3UR7A 4B15A 1UWQA 3CLWA 3N15A 2VCAA 4AY1A 3MMWA 5A8QA 5GNXA 2NW0A 3AHTA 1JYNA 3L4YA 1U33A 1TR1A 2YLAA 1V6UA 2YDSA 2PWFA 3M7SA 4GI8A 2VQTA 3AIEA 1C91A 1J0JA 5EFDA 1CGWA 1NWRA 2DH2A 2ZUMA 1FH9A 4F9DA 1VFOA 2O92A 5D9PA 1NP2A 3E1F1 3WELA 5HPCA 1WAWA 4PMNA 2WVUA 1JZ8A 2ZWYA 2GDUA 1JD9A 5A6BD 2X0HA 4WKHA 3RIKA 3SCUA 1UR1A 4UOQA 3TTSA 3I3DA 2DT3A 4A3HA 3LMYA 1V08A 3OGRA 1BYBA 3AXXA 1LL4A 4UQAA 1J12A 2WKGA 1V3IA 3NYDA 1EDTA 5M5DA 2BVTA 1I75A 1M01A 4WSJA 2X8RA 3M07A 3UEQA 2ZXDA 1CLVA 1BYCA 4GINA 5TD4A 2WCGA 3EDKA 1B90A 3PZGA 5IDIA 4HMCA 3ARRA 2PWDA 3KWXA 4UOJA 3ZOAA 1QW8A 1E70M 4C7DA 4AD5A 4PRWA 4MTVA 4Z2KA 2CITA 2YOCA 3AZRA 3OGVA 3ZQ9A 1GQLA 1EO5A 2WMHA 2J7CA 3ARYA 4W7WA 2QPSA 3EMQA 1F4HA 1E5NA 5BXSA 2J8FA 2VX6A 3CHCA 4EAMA 5HXMA 3WUEA 4KMQA 1FP9A 1KBKA 5BRQA 3AIUA 7CGTA 2JE8A 1MXDA 1ITCA 2CXGA 1QNOA 2PWHA 2JIWA 2WMIA 3POHA 3GBEA 4KWUA 4R5EA 5A6MA 1UQZA 4PYSA 1JDCA 4IM4A 1W1TA 2VL4A 3A4XA 1KXVA 3GXMA 4GI9A 6A3HA 3B8SA 3WMBA 1PX4A 3AIQA 4ZXLA 3ZR6A 4PSPA 3ZJ6A 2FHFA 4BS0A 4LXFA 2VRKA 1WZMA 1CXEA 4RL3A 2Y8KA 4DM2A 2J47A 2XSBA 3WDHA 4OOZA 1E43A 2WMFA 3SEPA 1QI5A 4ACZB 3OB8A 2BV9A 1HNYA 3W82A 2ZE0A 1NOUA 1ZU8A 1HJQA 1YHTA 4UFHA 1OWQA 2C0HA 2GJXB 1QHOA 1QI0A 4GQRA 5I23A 3VNZA 1AQMA 3IAQA 1VAHA 5EMYA 4LX4A 4WKFA 1XH1A 3ARQA 5A8PA 1UG6A 2ZX6A 3MKKA 3WNKA 4NRRA 1XHGA 5LA1A 2D2OA 4AZ6A 9CGTA 4PUEA 1MQRA 4ZENA 3VNYA 1HP4A 4UZUA 2ZX8A 1ZS2A 1JDDA 2OSXA 2WHKA 4NSBA 1OGGA 2ZUUA 4AEFA 2V38A 2X2YA 4D6FA 1LWJA 2BXZA 2WW5A 2QMJA 3QOKA 3OLDA 3PN8A 4UZSA 1I1WA 1MW3A 3NSNA 5DFAA 4WK9A 4U3CA 2Y2WA 2W67A 4D6JA 1XH2A 1VEMA 1VB9A 2XHYA 4U2YA 4KGJA 3BGAA 1I1XA 1JF6A 2WBKA 2CHOA 3K4DA 2JF7A 3U7VA 2XVLA 1H0IA 2JEPA 1ZBCA 1QNSA 5D9NA 1G1YA 4W5UA 3WN6A 1ODUA 3QGVA 3VGDA 2VRJA 3VX1A 3MV11 2YDRA 3II1A 1E5JA 5HNNA 3NSMA 4JHOA 4TTGA 4Z2GA 4HZ7A 5CGMA 5I2UA 3N04A 3TP4A 1OIFA 4JCMA 2WBGA 1HF6A 2NT0A 2WHMA 3CUFA 2VX5A 1US2A 2OYMA 2J7HA 1UR9A 1E4IA 5A6BA 1QOXA 4AIEA 5LA0A 4UFJA 3WH8A 2WNWA 4P7NA 1Q4NX 3SIMA 1C90A 4ATLA 3BCFA 2D22A 1UD3A 2CESA 1K9FA 1JZ6A 1PIGA 1PZ3A 3GTNA 2W5FA 3AHZA 1KGXA 3DC0A 4AZGA 1OBAA 1UKPA 5A69A 5BWFA 3MSDA 1AQHA 2E40A 3LPFA 1UD5A 3AMKA 2RGMA 3AZTA 2BHZA 5AYBA 1J0YA 2EQDA 1HJUA 2VCCA 1M04A 1ISZA 4PTVA 2C7FA 2G3JA 3A6OA 2VCBA 5JBDA 2MANA 2PBGA 1CBGA 2VT0A 3FW6A 2HVMA 3L4VA 1KGWA 3TOPA 3WQVA 2E8ZA 3GXDA 1V02A 4DUVA 2VTFA 1X6LA 4XZWA 3AROA 1GQIA 6CGTA 3CUHA 3THCA 4RE3A 4BCEA 3T2PA 1IT0A 3BMVA 2VZSA 4FF5A 1V0NA 4CKQA 2A3HA 2YL8A 5HOSA 2ZXQA 3APGA 1FH8A 4PTXA 2G3NA 5CLWA 2BY0A 2Y4SA 3KEHA 4J3UA 4YHGA 1WE5A 5E09A 5CQ1A 2YDQA 3UG3A 1LLOA 4TX8A 2O9TA 3HN3A 4MDPA 3NSXA 3VIOA 3VDAA 1D7FA 3WNOA 3W6MA 1HKMA 1VEOA 3L4ZA 4MB5A 3DECA 4PTWA 2IXVA 2XFFA 5A6LA 1J11A 1VENA 1E9LA 3CHDA 2D20A 1SMAA 5FL0A 5JUVA 4F66A 4HMEA 4CU8A 1CXHA 4AZCB 4AEEA 4D71A 4W86A 1XYZA 1UD8A 2A3AA 1C8XA 1X1NA 4LYPA 4JAWA 1OINA 4CD7A 3N13A 1V6WA 4OKDA 1E4LA 4WIWA 1DEDA 3AMLA 1KCLA 5AY7A 1QHPA 1SR0A 3U57A 3NCOA 4ATWA 3BCDA 4QAWA 3WD1A 3DYOA 4MADA 3VGBA 4PCTA 2E3ZA 2J74A 1EOMA 5FL1A 4ZE4A 2EO7A 4LGXA 4U33A 1MYRA 2VURA 2ZXBA 1J18A 3ARUA 1UA3A 1BAGA 2XPKA 5A6SA 4LPCA 2GJPA 5E0CA 3VD7A 4YN5A 5BYWA 4N42A 4UNIA 3N9KA 4OJYA 3BH4A 3WUBA 2WHJA 5I5RA 2G8ZA 5E6YA 5LYRA 2RGLA 2WKLA 2VZVA 4GO9A 4OBRA 5ABGA 1XRVA 2YBUA 4E8DA 3FHQA 3W81A 4PMUA 3VOCA 4Z2HA 4XX6A 1RD6A 1H49A 1UKTA 3BSHA 3THDA 1JZ2A 3MO4A 5ABFB 3LPOA 4H8HA 3N17A 1B2YA 2DT1A 4B3LA 3ARSA 1LL6A 1E55A 2O9PA 1CXKA 1W2VA 4V28A 3WL0A 1OIMA 3MUY1 2V3EA 2YJQA 1GNXA 4D6CA 2XWEA 1MQPA 2OYKA 4E2OA 5CLTA 3EDFA 4X0VA 3U5UA 5I79A 5EBAA 1W3LA 3RM9A 3WNLA 1V0MA 1JYXA 4X9YA 3VD3A 4TVUA 2XGBA 2W66A 3PZUA 2CKSA 1RP9A 2WC4A 1E71M 1H3GA 4DWSD 4JFWA 1ISWA 1D3CA 2B31A 3BAJA 2WVTA 2QMKA 3L4XA 1IZKA 4B16A 1UYQA 1CXIA 1CNVA 3UG5A 2XSAA 4JL1A 3VIMA 1US3A 1V0LA 3T2OA 1ZJAA 1H4PA 2WK2A 4U3AA 2Y5EA 1DP0A 3MU7A 2W61A 1Q6CA 2GUYA 5I24A 2GSJA 3SCPA 4HPGA 3GDBA 1WCGA 1CGUA 4GXPA 2J75A 2BY1A 2YL6A 2WVVB 4FK9A 2J25A 4TTUA 1WPCA 4CD6A 3QHMA 2ZUNA 2BY2A 4B3KA 4JFUA 3CZ8A 4HP5A 4TVCA 3WSUA 4J28A 1UWIA 4MB1A 5A6AA 1FHLA 1CXFA 3QHOA 4PUDA 2JALA 3EDEA 3WDRA 1VBRA 1WZLA 3MS8A 3AMGA 2GVYA 1FA2A 3AJ7A 4R27A 3WNMA 2V3FA 3GZAA 3AYRA 1W3KA 4AXNA 1CWYA 1KQZA 3AHYA 2WM0A 1J0KA 1XGZA 3SUSA 4M80A 3SUTA 2G3MA 3B9DA 4MB4A 4AZBA 2OSWA 4J3SA 4PMXA 4H41A 4OUEA 2WYSA 3AYSA 1K6AA 5DT7A 5M03A 1PX8A 1GONA 5A94A 2QF8A 3WH6A 1MW1A 4QLLA 1UD4A 3GNOA 1MW2A 1Q6EA 3IK2A 1HP5A 3BSGA 1J0HA 3W27A 1VFUA 4TXEA 3KE0A 4W8BA 3T09A 4M81A 4ZXOA 3QR3A 1QI3A 3KL5A 1B3ZA 3OZPA 1JXJA 3RJYA 2ZWZA 1CZ1A 1GOIA 1C8YA 3T0DA 4TUFA 1E6SM 2D0FA 3S2CA 1WP6A 3ECQA 4AZCA 5E6ZA 4D6IA 4PMZA 2QLYA 4BA0A 2PB1A 1JNEA 1GOMA 1E72M 4CD5A 4HOZA 2ZUWA 4D1IA 2VJXA 1QNQA 1XSKA 2W92A 4MB3A 3UERA 3UR8A 2WC3A 1C7SA 1C93A 1JL8A 1UR8A 1CEOA 2ZUVA 5DEZA 2PC8A 5IHRA 3BXWA 2CBIA 3EMCA 4UR9A 3WD3A 5D8WA 1QVBA 2E8YA 4QP0A 3O2LA 4IPNB 3WD4A 5CJ5A 1HT6A 1AVAA 3OIHA 3GXIA 1UA7A 3CPUA 3WKZA 8CGTA 4TOQA 1E4NA 4E8CA 4QLKA 2D3LA 4PSRA 3W37A 2DT0A 1CENA 4HU8A 3T2QA 1NOWA 1JYVA 4NRSA 1UH2A 3PZVA 3RM4A 5JIPA 1EGZA 3OGSA 1B3XA 4P7RA 1OB0A 1V3JA 4M56A 2F2HA 1V3HA 2VZOA 1GOWA 3UCQA 1ZJBA 3K4AA 4PN2A 1GCYA 2V3GA 3TONA 3AMDA 1CLXA 2ESCA 4DWSA 5CSUA 3OLIA 5ABFA 4ACYA 2WZEA 4HA4A 1MFUA 5AC5A 1E3ZA 3SCRA 1F4AA 4XB3A 2GK1B 3VDCA 1G94A 1RH9A 3IJ7A 4UTFA 4WLCA 1VJSA 4S3KA 4CCEA 2WWCA 2YL9A 1EH9A 4QLJA 2YLLA 1JZ4A 5HDRA 1E0WA 2WAGA 3CZEA 3WH7A 1GW1A 1KXHA 1E3XA 1WZKA 4B9YA 1FFQA 3WUGA 1Q6DA 4HZ6A 2OWWA 5A8MA 1KWGA 1ITXA 2DH3A 1W91A 1TA3B 3GNPA 5BXRA 1JXKA 4JKMA 1HN1A 6TAAA 5A8OA 2XVGA 4DUWA 3VIPA 3AS2A 3VGFA 3AIWA 4W88A 1PIFA 1X6NA 2WB5A 2DSWA 2WLZA 5A95A 3GXFA 4Y7EA 1WO2A 3AQUA 4HPHA 3T0AA 3ZT5A 5IXEA 1W9UA 3A3HA 3CMGA 4KGLA 3WNNA 1G0CA 1BG4A 2W91A 4M24A 3ZM8A 2G41A 4UOZA 4JKLA 1UKSA 3MMDA 4N0RA 3VIJA 1CIUA 1GOQA 1W9DM 2DIEA 2EPMX 2O9OA 4A3YA 2FDMA 1XSJA 4AD4A 4EE9A 1JI1A 1QI4A 1NH6A 2ZX7A 5DT5A 2ZUTA 3D3AA 3K46A 4IUGA 3SCOA 5GQBA 1XD0A 2GJRA 1E0XA 3VM7A 3WDQA 1XC6A 3WF3A 2CERA 2AOSA 1DWGM 3IJ8A 3SCTA 1NQ6A 3TTQA 3CGTA 1FOBA 3ZSSA 4AD1A 1QNPA 1B0IA 1BYDA 3SUUA 4WSKA 2PWGA 5M3WA 4PCSA 4DM1A 3W0KA 1PX3A 4H04A 2XVPA 2D3NA 3W38A 1BQCA 1NOFA 5JBEA 1C7TA 3ZMRA 3BC9A 3NJ3A 2EXOA 3SURA 4ATDA 1UQYA 4D6DA 1W2PA 5I0DA 2EEXA 3VINA 1HJVA 2D1ZA 5FCZA 4E4PA 4MNJA 3M6DA 1NWSA 1DTUA 1W9XA 2J8GA 3PBGA 4KRTA 5FOOA 3ALFA 1C3FA 3HU7A 2AMGA 1KB3A 4W7UA 3L2MA 2V5CA 3AIRA 3MUZ1 1V6VA 3BAIA 7TAAA 5FIPA 3DYPA 3WDIA 3K8KA 1WB0A 4XV0A 2WMKA 3ARXA 1LF1A 1ZL1A 5GNYA 2EPOA 4QCEA 3VIHA 2ZUSA 3PZMA 1W1YA 1UZ4A 3RJXA 4AZHA 5C8BB 3VIGA 3WEZA 2CBJA 3VIFA 1EO7A 1V3MA 4Q7NA 2VNCA 4FMVA 4U2ZA 3VILA 1W1PA 3G6LA 3SCQA 1E6RA 1FFRA 3ARWA 3VDHA 2JEQA 4LQ1A 4GKLA 7A3HA 3SUVA 4PEEA 4J3TA 1BG9A 4OBSA 1DWJM 3PHAA 4FLSA 4F8XA 2WSPA 4AIOA 2C8NA 3WQ4A 1UR4A 3GBDA 2PBOA 4FLQA 2XWDA 1E6XM 3CHEA 3VU2A 4MNKA 1HX0A 1HKJA 3NDZA 3MANA 1S46A 3BMWA 2CIPA 4W8AA 3N12A 4W93A 4CVWA 4H8UA 1U2YA 3VPLA 1XSIA 3AOFA 1GOKA 3OA5A 3OG2A 3SCSA 2F8QA 4HOXA 5CZKA 5D4YA 1E40A 3W6LA 1A47A 4MAVA 2XYLA 4AYSA 4WF7A 4BQ3A 1TFVA 1VFFA 1KBBA 1QPKA 3TA9A 1FH7A 3WD0A 3ZJ8A 1B3VA 3J7HA 1XV8A 2BS9A 2DGAA 5I78A 4J27A 2OSYA 4RE4A 4ACZA 3UESA 5DF0A 3MMUA 1UUQA 4V27A 4BF7A 4KH2A 4BZYA 1CGXA 1MW0A 2GJXA 2BXYA 1TA3A 3ZR5A 1GJWA 3N18A 4GI6A 4MNLA 4MPKA 4ZFMA 1KR0A 4KRUA 1HKIA 1XCXA 3O6AA 4PMDA 2JIEA 4GPNA 3WDPP 5JIWA 5FD0A 5C71A 2ZOXA 1OT1A 1EDQA 3WH9A 2DSVA 4JFTA 1CDGA 2BHYA 1XD1A 4J3WA 4D72A 3WDJA 5LA2A 1JF5A 4K68A 2QPUA 3GYCA 4AD0A 3PZQA 3AMCA 1K9TA 4UQBA 3OLGA 1V3LA
chains in the Genus database with same CATH superfamily
4D1JA 2GFTA 2VVNA 1J10A 1F3WA 2CHNA 4L4PA 4ICMA 4G7EB 3RM8A 1WDQA 4RNIA 2J7GA 2E1DA 1UZHA 2QGYA 4WY0F 1O4UA 2UY2A 4HMDA 3C0QA 3CZLA 1OGBA 4QSHA 3ABSA 4RW3A 4O10A 1SO5A 2XIMA 4N6EA 3LK6A 4O18A 1EHAA 4WD0A 3VM5A 1CB2A 1ISYA 4ZO8A 2D2HA 3PJWA 4YIWA 3P82A 1UUOA 1M7PA 2QJNA 1KM6A 4XBJA 1EHNA 2O55A 2TAAA 4YTTA 3WYZA 2E4TA 4IQEA 2G5WA 4L9ZA 4QFUA 1LLWA 2FVKA 4CQ8A 1IV8A 5CPSA 3LTSA 2E6YA 3C2VA 1TTPA 1P0KA 1H7WA 3R5EA 1JDAA 1L2UA 1W1B1 1KNWA 1WKDA 1JFHA 3MKVA 4FZIA 1H50A 2OX1A 4ML9A 3W53A 1KFKA 3Q65A 3W74A 2FIQA 4GBUA 2HXUA 4DJDA 3WLLA 3PBYA 3GZ3A 3BAYA 1ISVA 3HG4A 5F2MA 3LHUA 4C65A 5MKGA 3VDBA 5LNVA 4QQUA 4KWWA 4YPJA 5D9OA 1FQ0A 4DJEC 1H60A 1TVPA 3D5HA 1LYXA 1FHUA 2NUWA 1E4MM 3JZEA 1G67A 2WWDA 1LT7A 2YBVA 2RDUA 2PLJA 2NZLA 4ZA0A 2ZZ7A 3JZUA 3NQDA 4XKMA 5BRPA 3B8VA 4WDWA 4JKKA 5F4WA 5J04A 2VDHA 3ID7A 2ZXAA 5C55A 1WDDA 3SCVA 1W6TA 1EP3A 3T4WA 4H6KA 1PWLA 1JUKA 5GNZA 1KTCA 4A05A 4M1RA 5JBFA 3D0CA 4F2BA 4JCLA 3BDKA 1CGVA 2IUZA 3ZJ7A 4LF1A 1TWIA 4DBEA 1OC5A 4XSMA 3ZLGA 1YE6A 4H9TA 2FVMA 2XGIA 3CWOX 3EB2A 3JUGA 4W87A 3GW0A 3NVDA 4DWSC 2CETA 1DWFM 2RDWA 3CPGA 1FCBA 2BY3A 5F7UA 4PMRA 1HZYA 3ABXA 3B0UX 3SCWA 3GC4A 4PMJA 1RJRA 3SFWA 3L23A 3SBFA 3N4EA 4UBPC 1XI3A 3CBWA 1RZMA 5AB3A 1FDJA 3E5BA 3O05A 1BYAA 3ES8A 5FEXA 2WM1A 5DQPA 4Q32A 3PPCA 4PUMA 4ML4A 5HNRA 4AUBA 4LBSA 3L2IA 2OWCA 2FLIA 4GYFA 3LPGA 3UVIA 3CV6A 3PFRA 2MNRA 1EFZA 3UXIA 2VHLA 3KZSA 4IMAA 2WJEA 5C7HA 3GFZA 1E0UA 1FWWA 1YXDA 4J3XA 1A5SA 1FXPA 1IHIA 1W9PA 1WKYA 5AHIA 5KMYA 2PSNA 2WZTA 3KL3A 4ZL1A 5A6KA 4ES4A 3UZXA 5D9MA 2PAJA 4CD4A 4UFIA 4NU7A 5EMKA 2OWXA 4POCA 4F0HA 1EJWC 3A4AA 2A6LA 4E2BA 1DJXA 1SJBA 4JIPA 5HWNA 1KXQA 2X09A 2JKAA 1JCNA 1A0EA 1V6YA 1SZRA 5AZ0A 2UY5A 4CVUA 3RLUA 3CB8A 2WC7A 5LZLA 4LOCA 3RU6A 2YW3A 2V3DA 4MZYA 3GNXA 4DWDA 1FWRA 2PUZA 3MVTA 4UTLA 1TVNA 3KOYA 3PTMA 3KRBA 2YB1A 3GU2A 2IPGA 4W84A 3TJ4A 5D2VA 1MFVA 4TX6A 5HMEA 1TJ2A 2E5DA 1F6YA 3LBCA 3NL5A 3N3MA 3MW7A 5G1YA 2A79A 2GLKA 1E6NA 3GDTA 3ZLFA 2A7PA 1BGGA 5CPQA 5IHSA 3BOXA 2XFRA 4F48A 3UWYA 3LPPA 4LBUA 2W79A 2YIHA 1TUFA 4PUKA 2X0YA 2BOFX 4QJ4B 1KRCC 2E1WA 4XBKA 1WZAA 4GQ0A 2OPJA 3F5LA 1UZ1A 1VF8A 3PTKA 3L4TA 3CUIA 4P7LA 4GO8A 2QXWA 1CECA 4C6EA 2UY4A 4JL2A 1EIBA 2E09A 2NSXA 1GHRA 4TQTA 4DNMA 3RXZA 2E7FA 2OJPA 3IPWA 4CU6A 3GIQA 1UWSA 4UTHA 4NX0A 5CZ0A 1PTDA 3GHSA 2VRQA 3S1WA 1FP8A 1GQJA 1RUSA 4JTGA 3V7PA 1M03A 5DXYA 3BOLA 3L2LA 2OLSA 3QW3A 4JYFA 1IIGA 3W7GA 3K2GA 5ECUA 3A47A 1JGIA 3B04A 3HGJA 1PVNA 3FSUA 1OK6A 4PE8A 3AI0A 3GTIA 3LBOA 4Q8QA 1V7AA 3KW3A 1G7UA 1Z42A 1K9DA 4NF7A 3NQ2A 2VZUA 5A5WA 4RV3A 4A4AA 1BHGA 2DEPA 3N1AA 1GPFA 3GFXA 2XG9A 1EJUC 2WHLA 1XRTA 3NUKA 3BJSA 2Q8XA 3AS3A 2GK1A 1C8QA 2QCCA 1GWJA 4PBFA 4XZBA 3MDWA 1AD4A 1FWAC 1QPQA 5DY3A 2BSLA 4MMWA 4QG9A 3H23A 2FVLA 2CBVA 4L4OA 3P62A 1LBLA 4DF1A 4HN8A 2PDKA 2A7NA 6TIMA 2ZVRA 1YDOA 1TTIA 3FAXA 3MSGA 2W0UA 3ABQA 4GFSA 2ACQA 3RF9A 4GUFA 3WMSA 3OHMB 2FZDA 1JYWA 1Z41A 4C6JA 1OT2A 3QLLA 3CT2A 1UWTA 4RK8A 2VC9A 4AISA 4RE2A 2B4GA 2GQAA 5CXPA 5AVHA 2Y63A 2J77A 4GX9A 1PYMA 2EPNA 3UZ5A 3D3FA 2DZTA 3M47A 1XW8A 4BI5A 3MV01 4Q33A 1M7XA 3EB3A 1VPQA 3FK4A 4PMVA 1GTEA 2X40A 3C3NA 3CO4A 4EKJA 1XLEA 1ECEA 4DEFA 2Z1WA 4AF0A 1KFLA 4ORMA 2V5LA 3ENLA 1W1VA 3C0JA 1MUCA 2WZHA 4FNPA 2Y7DA 3GNNA 4AYGA 2Y0FA 3O9NA 3WY1A 2GUUA 5A8GA 4WXYA 4S39A 1FHVA 1W1ZA 1Y7VA 3VMNA 1OD0A 1BLIA 4XAPA 3AXHA 1LBFA 1SZEA 4UTJA 4XWUA 3BVJA 4GY0A 2REQA 3WF2A 3R6IA 3BLDA 1SSDA 4ZOEA 4DJDC 2WPBA 4Q8MA 4EXBA 3DKLA 4FB7A 1FCQA 3KTSA 1R2RA 3SSZA 1AG1O 4CQ9A 4YVPA 2D0GA 2G96A 1R2TA 2CKRA 3VKKA 3CIVA 4LH8A 4CNTA 1KLYA 1WDSA 3JVAA 3WF1A 2V5JA 3W2UA 3GH7A 1PWMA 4ENLA 1XH0A 4QNWA 3FNDA 1B3YA 1R3TA 3RFAA 3AIBA 3GTHA 3EOOA 2WPGA 4IZGA 2CLKA 1UOKA 1TB3A 3BLPX 4LFYA 1EC9A 3BCJA 4KCTA 4LUTB 3G6MA 3S6DA 2D24A 5F1UA 3S9ZA 3QV8A 1TG7A 4XUYA 4RNFA 2PMQA 4XUGA 2SFPA 2V5DA 5I3FA 4XZMX 2HXTA 2FYMA 1UWRA 4E8GA 1R7OA 1VFMA 1E6ZA 1UH3A 3C8NA 4PMYA 2EKCA 1HKWA 4HPJA 3TFXA 1S5TA 3WL1A 2ISFA 3R8GA 2DIKA 2TPSA 4G5DA 1VPYA 3RO8A 4JTUA 4D6GA 2ZZ1A 3QOMA 3VABA 2ZRYA 3UETA 5BRBA 1DHKA 4GZIA 3TYAA 1OM0A 2HROA 2P8BA 3RCYA 4Z2JA 3UR7A 4NYUA 3KOFA 3CLWA 3THAA 4UTWA 1R3VA 2FPVA 5GNXA 2ISDA 1E1CB 4IP7A 4N6FA 1PXGA 3B8TA 5G1MA 2VQTA 4JN7A 3MBDA 5EFDA 1NSJA 4JQ3A 1MNZA 1NWRA 3BPWA 5D9PA 3MI6A 3WELA 4J9JA 4NKCA 2TYSA 3TEVA 3LDVA 1JZ8A 2HK1A 3V18A 3SY8A 1R0MA 1TPFA 2IKHA 1YBQA 3NZRA 1ME8A 1M68A 3DG7A 3I3DA 2QF7A 3LMYA 3URQA 8XIMA 1V08A 1Y5VA 3EGJA 1ONWA 4K1WA 1V3IA 1FWDC 5B7ZA 5BNKA 3P5ZA 1N8IA 2RJGA 5FAGA 4A22A 3EDKA 1B90A 1O94A 2PWDA 3ZOAA 4BF9A 1HL2A 3GDKA 4AD5A 4Z2KA 1OZMA 2YOCA 3AZRA 3ZQ9A 1EO5A 4ZB2A 3EMQA 1JDFA 3DI1A 4ZQNA 1UWAA 2J8FA 3TLQA 2VX6A 1QO5A 3WUEA 2HDJA 5BRQA 3AIUA 3GAKA 5DMMA 1ITCA 2HE5A 4AHPA 2PWHA 2P3EA 1Y0EA 4R5EA 1XIGA 4KWUA 5A6MA 1W1TA 3GXMA 6A3HA 3B8SA 5KINA 3FFSA 3AIQA 4ZZ9A 5H91A 4ZXLA 4PSPA 1Z8AA 2XSBA 2J8TA 2WMFA 1W54A 2QCNA 1XISA 3USBA 4F2TA 4K38A 1G4EA 1PDZA 3STPA 1QHOA 1QI0A 3UW6A 1XH1A 5A8PA 1SVDA 3O0FA 2I16A 1XHGA 4Q8OA 3KHDA 4AZ6A 1QMLA 1A5MC 1X8FA 1TE6A 4X2PA 3M16A 3QR1A 3GKAA 4E0CA 1S39A 4OHQA 3OLDA 3B8WA 4UZSA 3V4BA 1MW3A 3KLLA 3KBSA 2Y2WA 1DORA 3M0YA 2VEKA 5KITA 1IWBA 1RJQA 3NZGA 4QDWA 2VELA 2KAUC 2GVLA 2VEFA 4GC3A 2PLKA 3BGAA 2OO0A 4Y2WA 4US5A 4HKPA 2JF7A 3U7VA 4J2MA 4X3ZA 2XVLA 5B80A 3WLMA 1ZBCA 1QNSA 1UP0A 3P67A 1G1YA 3NPWA 3VGDA 1T5AA 1M7OA 2VRJA 3G22A 3CQIA 4MY9A 4JHOA 1DVJA 4TTGA 1FRBA 1T40A 2YZRA 3A24A 2A4AA 3BQ6A 3FOKA 1TO3A 1US2A 4HHMA 1WOAA 3DFTA 4XISA 4JTDA 3UYIA 5A6BA 4NNAA 4OQVA 3H4XA 2Z6JA 4NXKA 3UPBA 4P7NA 2HMCA 3VCCA 1Q4NX 3UQNA 3KCOA 3CWNA 1UD3A 3NQBA 3ITTA 2PRLA 3PBVA 4LAKA 3GTNA 1KFBA 2YYUA 1F9CA 1XYLA 3T40A 1UKPA 4GVFA 4AZGA 5C9WA 2NVCA 5A69A 1AQHA 3LPFA 1UD5A 3EWXA 3AZTA 1H7PA 2BHZA 2PTYA 2VCCA 2CLPA 3XISA 1ISZA 4PTVA 1YNPA 2R8WA 3TJIA 3A6OA 1RY0A 5CPLA 3TN3A 2VT0A 1BRLB 2D2GA 2E8ZA 2B81A 2VTFA 4XZWA 1GQIA 1XYCA 2NVAA 4RE3A 4BCEA 4F40A 4OFCA 3TH6A 3GR7A 3ISIX 3FKRA 4N9DA 4CKQA 3SM0A 2CLHA 1XP3A 5CPNA 5HOSA 2NX1A 4F0MA 3PS7A 4PTXA 1FH8A 2GJNA 2BY0A 2Y4SA 4PCNA 1WE5A 1WXYA 2WSYA 1L6WA 4HTBA 4ROPA 4TX8A 3P8IA 3NSXA 1I60A 3VIOA 3UPWA 2CWXA 3OO2A 1JDEA 3IIOA 3L4ZA 4FR1A 2G0WA 4FEZA 4XQ6A 3DECA 3UFYA 4PTWA 2NX3A 5EU9A 3RX3A 4O52A 4TU1A 3DZ1A 2ZZ2A 5DBUA 1VENA 2OO6A 1OZQA 2PGRA 2D20A 1EJSC 5JUVA 4HMEA 4CU8A 4ORIA 3B0PA 4AX7A 2ZDSA 4NJGA 3SDOA 2FTYA 4AZCB 2PGFA 1C8XA 4LYPA 1H61A 3N13A 1W1IE 1E4LA 1U5VA 2TODA 1DEDA 3JR2A 6ENLA 2GSHA 1R5YA 2CZDA 3FV9A 2ZVIA 5FSEC 3NCOA 4S1FA 3BCDA 4QAWA 1DJZA 3WLIA 3ITLA 7TIMA 1GVOA 3MCOA 2GOUA 2PLMA 3EOUA 2E3ZA 7REQB 1EOMA 2VURA 5HK4A 3EX4A 3EWYA 3ARUA 4PUUA 4IFKB 4LPCA 2GJPA 1GPWA 4YTUA 3VD7A 4FF7A 8TIMA 4O15A 1GW9A 3M4HA 1EP2A 4IGMA 9RUBA 2WQDA 3WUBA 3MTWA 2I9UA 3QMRA 2G8ZA 3MJYA 4NZJA 2RKXA 4MFEA 4E2DA 5T91A 3RMJA 1XRVA 5G2HA 1DE6A 3FHQA 4PMUA 1AK5A 1UKTA 5CGQA 1LOSA 1XLJA 8XIAA 3EEZA 3N17A 4E3VA 1B2YA 3OVRA 3ARSA 1LL6A 3MHFA 4DI9A 3BW4A 3WLJA 4YJ5A 1W2VA 1MZHA 2XIOA 5JQ9A 1F74A 2PTXA 4HK7A 3OZMA 1K1DA 5LKYA 3VK5A 3IV3A 2XWEA 2PDCA 2YXXA 2OYKA 4HVXA 3EDFA 1VFLA 3U5UA 4JTAA 5CG7A 1JYXA 4PUNA 4MLRA 3VD3A 4LS2A 1RP9A 1H3GA 1KM5A 4IL2A 4JPGA 4GHRA 5CBBA 3Q94A 4KCVA 1CNVA 1X97A 3VIMA 4HD5A 3QPYA 1US3A 3ERPA 4TR9A 1ZJAA 5LXXA 4IL0A 4HA0A 4U3AA 3LGEA 2W61A 3U0HA 3AU2A 3RRAA 2NQ5A 2WOQA 4GXPA 4ZCWA 2YL6A 4EPKA 2WVVB 3RLGA 1FWFC 1YPFA 1KTNA 3MC5A 1F5ZA 2XZ7A 4AU0A 4HP5A 3SZ8A 3CJPA 3WSUA 4J28A 3V36A 4MB1A 3R8HA 1CXFA 3QHOA 2H3DA 1VBRA 3TQ0A 4KIRA 3N2TA 4Z1BA 3AMGA 3WNMA 3AYRA 4UTWC 3AHYA 4G6CA 1REQB 3E74A 1VPXA 1J0KA 2WO5A 2G3MA 4AQLA 2ZCGA 2OSWA 4J3SA 4S3EA 1MEIA 2OOFA 3KTXA 3AYSA 3EOEA 3MP3A 3WH6A 1MW1A 2Z6IA 2HVNA 2TSYA 1MW2A 1DJIA 3C2YA 4TXEA 5IRPA 1MRAA 1XLKA 3NM3A 4HT3A 1B3ZA 3M0HA 1S2AA 3P81A 4PEKA 2D0FA 3S2CA 3CQ0A 5CC3A 3E0IA 2OTDA 2QLYA 1SW0A 3O6YX 1T7LA 4O12A 5LIXX 1EA0A 1QNQA 1H7OA 3PWGA 5HUOA 4B5XA 2J13A 2Q09A 1WX0A 3MP5A 1RY8A 3HTWA 3THUA 1UR8A 2ZUVA 2VDGA 1GVFA 3IIPA 1A5LC 2PC8A 2CBIA 3EMCA 5I06A 1RR2A 4UR9A 2GVGA 1R3RA 1R9XA 4AMAA 1FY6A 4Y9AA 4UR8A 2FZMA 2EKGA 5EA9A 3OIHA 4RDVA 1F3EA 3H2AA 3SN4A 3LA4A 3GHRA 3HPAA 4MWAE 3F2CA 2XH0A 5BMWA 4TOQA 2R91A 3MUXA 1E4NA 3R58A 3CAWA 2D3LA 4LYKA 1QRQA 2DT0A 5H1WA 2ISVA 3L5AA 1NOWA 1JCJA 2E5BA 2F6KA 4G2DA 4FXFA 3OGSA 2TMDA 4K7YA 4P7RA 1QWGA 1OB0A 2VZOA 3IARA 3UCQA 3B06A 3IRDA 1TELA 3G24A 1VBHA 4L1WA 4ACYA 5IDZA 4K7VA 1MFUA 1E3ZA 2DVTA 1WBJA 3QSTA 5LGXA 4XB3A 1EXBA 3FLUA 3YPIA 3EEGA 1EH9A 1XG3A 2PP3A 3CZEA 4MLJA 3NL3A 1RCXB 4B9YA 3WJWA 3UYCA 2CU0A 3EX3A 4HZ6A 2OWWA 4ZOCA 2E77A 1OX5A 4GY7A 1ITXA 2X1SA 3GNPA 5BXRA 1JXKA 2DVUA 1HN1A 2G95A 6TAAA 4DUWA 4JEJA 1XQLA 1PIFA 2DSWA 2EF9A 5A95A 3GXFA 5I3KA 3P6LA 3SB0A 2V69A 1WA3A 3CMGA 3WNNA 1LOLA 4M24A 1KLZA 1XFBA 4XSLA 2G41A 3O06A 2PU1A 6PTDA 1UKSA 3NQ8A 1JPMA 3VIJA 4LUTA 1CIUA 3DFOA 1W9DM 2EPMX 1SR9A 2FDMA 1ZY9A 2PDLA 4EE9A 1Z69A 4LEQA 3SCOA 4XZLX 3WDQA 1XC6A 3WF3A 3W1NA 4K36A 3IJ8A 4EPDC 4PUWA 3C52A 3SCTA 1Y5WA 3CGTA 4G7FA 5DX7A 1FWGC 1K03A 3HG3A 3Q4DA 1LORA 1FVPA 3DC8A 2F6UA 2OQHA 1PX3A 3URNA 4WDXA 3W38A 2HS8A 1BQCA 1Q7MA 1NOFA 5JBEA 4FNSA 2B7NA 2VFFA 4V33A 3C2RA 2EXOA 3SURA 1UQYA 4F2UA 1GYNA 1ZP4A 1Y8BA 3E0WA 3EZ4A 1QOQA 1HJVA 2VP8A 4RKAA 3UG8A 3HQPA 5E9XA 4FSAA 1W9XA 2J8GA 3SIZA 3EWCA 3MCMA 3N34A 1AW1A 3FCPA 4KETA 3RX2A 3L2MA 3D6NA 3TC7A 3BAIA 2Y1HA 5FIPA 4DIAA 1DHPA 2E6FA 3K8KA 3WX7A 3T9PA 3BICA 1LF1A 5GNYA 4ZO6A 3HG5A 3LHTA 1JQVA 3VIHA 2ZUSA 1W1YA 1UZ4A 4O50A 3VIGA 4AH7A 2CBJA 3VIFA 1EO7A 1M41A 3GVWA 3TYBA 4BKNA 1ZPTA 3QLDA 3C56A 4QIUA 5I09A 2VNCA 3B8IA 3EOSA 4UUIA 2OT1A 1R30A 2QCDA 1BEUA 3ARWA 4GIRA 4LQ1A 1XCFA 1QK2A 5FJOA 3TA6A 4OBSA 1DWJM 2GVEA 1OX6A 3L5LA 4RUBA 3DX5A 2C8NA 4LAOA 3HQNA 2XWDA 4O1CA 2PD5A 1E6XM 3TUUA 1FDYA 4C1NA 3L66A 3Q2DA 3NDZA 3G1HA 2CIPA 4QS6A 4W8AA 2Z4GA 2ZQ0A 4GRSA 4H8UA 3STCA 1IEQA 1GOKA 1PYFA 1JEZA 3NDOA 1GEQA 4PODA 5CZKA 1EP1A 1A47A 4KEZA 3FVMA 2XYLA 4WF7A 2QV5A 4BQ3A 4ERAA 1VFFA 4NJKA 5HQEA 5EKYA 3IGHX 2OX4A 1FH7A 5M1TA 3QKEA 4ASTA 1XV8A 2OOGA 4MY8A 5TF0A 4H19A 3FA3A 2A1YA 1YNQA 3MMUA 1UUQA 1W5OA 3IK4A 4FP1A 4O13A 5CH9A 3C0LA 4M6QA 2EJAA 4HJWA 3LYEA 3KCLA 1BWLA 5DLCA 4AY8A 3ZR5A 3N18A 4NJIA 4O4VA 5D2XA 1XCXA 4XK2A 4A29A 4B2DA 3H53A 2QIIA 3SJNA 5JIWA 1HTIA 4HGXA 2ZOXA 1K7FA 3TV8A 1EDQA 3W71A 3NQCA 2YYTA 1UR3M 1POKA 4JFTA 1CDGA 3B03A 3QTPA 4D72A 4L4LA 3WDJA 3HQOA 1P5BA 1TX2A 2QPUA 4AD0A 2PLCA 3RLVA 1A0CA 4IPIA 4ONVA 1LZOA 1J93A 1D3HA 1Z9AA 2VO5A 3CZKA 3W2JA 3GNRA 4UFKA 1MDRA 4NJJA 4OGZA 3S46A 2O7QA 4M3PA 1OG0A 2VEGA 3WLNA 1QBAA 4HSOA 5A3HA 3M0XA 4NAFB 1GVYA 2HV5A 2ANUA 3MWCA 2WSRA 4P7QA 3ZWTA 2CNCA 2B7OA 2UZ9A 3TAOA 1T96A 4MWAD 2GYIA 2AAMA 1KKRA 2DSUA 1CT5A 3VD9A 2J79A 1UBPC 3VGGA 3TQKA 1R3WA 4JTRA 1PBGA 1CYGA 2NV2A 1N82A 2XSXA 4Y9OA 2PP0A 4L4MA 3IJLA 2J78A 4HHPA 3W24A 4UTIA 4A2SA 3BAWA 4JEQA 1QBBA 2UWFA 4JNMA 4BQ5A 3VD5A 4DPQA 3OZYA 3ITVA 3GVVA 4LC8A 3IUIA 3DU0A 1RA5A 4HOWA 3W7CA 4RZBA 1BRLA 4WRHA 3AYVA 3GLCA 1JQXA 2DUXA 4BQ2A 1E0VA 1ISXA 3FYPA 4L6OA 4XZ9A 2IKIA 2P0IA 3N11A 4DO5A 4TO8A 1BXCA 3UZZA 1ZJHA 1Q7ZA 1QNRA 4CN4A 3MMTA 2JGYA 4JIHA 4UQDA 1RXOB 2ZIDA 4GIAA 1OYCA 1F05A 3AS1A 4MKNA 3EX1A 4GUGA 4CEXC 4B5UA 4LSBA 3VI2A 2OYLA 3VIIA 1EQPA 3NGFA 3PG8A 1GQKA 4L7ZA 3W4RA 3W75A 3C86A 3LXCA 3FY1A 3AZSA 1TIMA 3SUWA 5KZ6A 4HTYA 2J66A 4U4MA 5DCEA 4YTSA 5C9RA 3M46A 2WXDM 2G4FA 1LM1A 2FHBA 4A21A 3B9EA 3RMEA 3NL6A 2UBPC 3LV5A 1L9WA 2PTDA 1WXZA 3TTYA 3M7WA 1PKYA 3W2KA 2FH8A 1E6QM 4AIUA 3QV6A 3G1RA 3WFAA 3GH4A 4U5KA 1EXPA 1R46A 4GFIA 3RUBL 4V2XA 4MPQA 2WJDA 1SYTA 2VC6A 2GL5A 2QCMA 2E68A 1JCLA 4LUYA 2P5NA 1VR6A 3GU1A 2AL2B 2OEKA 4W89A 2CCRA 3C2OA 1U1HA 1A80A 2WCSA 5C9XA 3U2EA 7REQA 4PL2A 4JX4A 2PCQA 3GR4A 3ZIZA 1UC4A 1IXQA 4R34A 3RN6A 4MYAA 1C92A 1T8QA 3UWEA 3EYPA 5E0FA 3UWZA 1X38A 4YHEA 7XIMA 3U7BA 2H8XA 3WQEA 1RLCL 4UMAA 2X42A 4X22A 4C6IA 1VFSA 3WEMA 4M6UA 3ITYA 3VZZA 3OBAA 3CIXA 4I7UA 4UIOA 2QHAA 3QC0A 4C5ZA 4HMNA 1JZ7A 2DY3A 1SO6A 3FAWA 4H01A 1DJQA 1C9WA 2VX7A 2OLAA 3L7RA 3KVMA 3ZS4A 3WK2A 3H4WA 3H7RA 4I3GA 1VYSX 1B9ZA 3W7MA 3DHUA 4QROA 4ZO9A 1TJ0A 2YZ5A 3WF4A 4BHYA 4YNGA 5REQA 1S2TA 3N29A 1M3UA 2YA1A 3XIMA 1W9BM 1JGMA 5DMYA 4CUCA 3MVIA 1XGEA 1LCOA 1QWKA 2YCLB 1XIBA 4OT7A 2O0TA 1F07A 3ZR4A 4ZE5A 3UPMA 4ZGYA 2V2CA 2P3ZA 4CEUC 3G5EA 3QH2A 3SI9A 2YA2A 4FA3A 3Q45A 3TN5A 1G01A 1XBXA 1FUYA 5BCAA 3GVQA 1R6WA 1B3WA 4N2YA 3WZ0E 3UD6A 4E2VA 1NF7A 2VM8A 1JNDA 2NXHA 2DSKA 4LCSA 1M53A 3QMSA 2AKZA 1RPKA 2DDXA 2WVVA 4XBSA 4WDUA 5U7SA 1ALDA 4PCPA 4URIA 3UZWA 3R94A 4AMCA 1KTBA 4KPLA 3GM8A 2ZE3A 4YWSA 2OQLA 1MXGA 3VMPA 3GDRA 1ZAJA 4L1GA 3O7UA 2E9LA 1KCXA 1VRDA 1ZBWA 2BHUA 3W1UA 5KZMA 3KVKA 5D09A 1VBUA 4Q7BA 3BG9A 4JFSA 3B0XA 1HO4A 3I3BA 5M2FX 1FWHC 1GJPA 2WKJA 2AQOA 3WQCA 2R1NA 3EWZA 1AJ0A 2J4GA 3PZIA 3DGRA 3U2CA 8A3HA 1R87A 3W72A 3WBAA 3T81A 1YNYA 3TSDA 3OIXA 3UXLA 4MKSA 1RP8A 4DXXA 4K37A 2PODA 1YADA 1EWEA 3GKFA 3NXLA 3PZ9A 3H7VA 2G4JA 3ZJKA 1PE1A 3MUIA 1R85A 1AQ0A 2O7SA 5JH1A 4AZ5A 2DV0A 1RAKA 1VCFA 4GZJA 1XYBA 2HEJA 5BZAA 3R1ZA 1XIHA 1K3UA 4UTKA 2UY3A 4M1BA 2NQZA 4JY9A 1B1YA 3R10A 4DJFA 2HISA 3HA1A 5I77A 1W8GA 1XIMA 3VKCA 2AGKA 2DZXA 2Y8UA 1X7IA 1AMYA 2F61A 4NXSA 3CEPA 1JR1A 1VGAA 5EB8A 3FYOA 4WQ6A 3WUFA 3KBWA 5EMJA 1K8ZA 1OD8A 3HPZA 1Q6FA 1R9ZA 4MJ4A 4CCZA 1QASA 3JS3A 2XIJA 1G5AA 2IXUA 2FH6A 2A7RA 1X39A 3MY9A 4GY1A 5E70A 2EG8A 3PAOA 5A2AA 3NG3A 1TR9A 4CGTA 4IPJA 2NT1A 2AAAA 3MUAA 2PDUA 3G3MA 3HPSA 2J9ZA 1VD6A 1VYRA 3LCIA 1A3HA 1AMKA 3CYVA 4CNOA 1NFGA 4DJDD 1VRXA 4WY0B 4YVVA 2V5BA 4PULA 3SY1A 2VFIA 3PPHA 3O16A 3VFCA 2YKKA 3LLFA 2J7BA 1GJUA 2X0SA 3TE9A 4C7FA 5AC7A 1HL8A 3DGBA 1PTAA 2HRWA 1X98A 4WJXA 3PTQA 2FHCA 3QN3A 1OG6A 4CN1A 3LUTA 6XIAA 3NOEA 1CTNA 1F3TA 1QATA 2WZIA 4HNTA 5AHMA 1YDYA 4GNJA 4H8VA 3CAVA 1QW9A 5FF2A 2E6DA 1ZBVA 5AHLA 4TX9A 1TJPA 3T1GA 3O6CA 3WJZA 1IEWA 3REQA 1PAMA 3PZTA 2Y5SA 3W22A 4K8EA 1N2VA 4S23A 1OFAA 2PDNA 1AH0A 3E0LA 4P5UA 2YXOA 1M7JA 1L6SA 2QCFA 3W1LA 5AOUA 3GS6A 1JI2A 1GUVA 2EBNA 3LENA 1H1NA 3G18A 4UFMA 2ATSA 4Q8TA 3M5ZA 1M5WA 1P0BA 1I4NA 5EPDA 1XIEA 1EQCA 4JD4A 1M9HA 4Q4KA 1OF6A 3A23A 3DG6A 4HU0A 3SADA 5A8NA 1IR1A 4DUOA 3VOGA 3IRSA 3TOYA 1XIIA 1WNOA 1OC6A 4AFYA 4JHZA 3WQWA 2XVNA 2CEQA 1UW9A 1JCMP 3EKGA 4OV4A 3PPFA 1FKXA 1N7KA 2AQVA 3NQ6A 1R3YA 5IFTA 2BB0A 5CPMA 1NARA 4PZVA 1W32A 2NX9A 2PDJA 4LAUA 1XX1A 3KDNA 3R11A 4L6DA 3NM1A 2X7VA 4N02A 2XIIA 3WQFA 3LB0A 4W4QA 5D2WA 1XRSA 4K8GA 3DDMA 1ITQA 2R1PA 3W9ZA 1HXJA 1ZALA 3I7QA 2JF6A 4B5WA 1PTGA 1KC7A 3W29A 2YCKX 4A8NA 4DXVA 1VEPA 1GZGA 1YRRA 1E51A 1ZAIA 4NQ1A 3O1NA 1TJRA 4HZ8A 2ZZ4A 5HNTA 3S0CA 1DWAM 3U4AA 3WLHA 1GVIA 1NDYA 4F79A 1LQAA 2IPWA 4LYQA 1ZNNA 1HJWA 2OR2A 2QIWA 2W63A 3CQHA 4HSNA 1QFEA 4K6AA 1V0KA 2OLHA 3T8LA 3W1QA 2OEJA 2V5KA 3EDJA 3NO3A 1IZJA 1XUUA 4AC1X 1Z48A 3H2FA 2ON3A 3C61A 3PVFA 5BU9A 1J01A 4AD3A 1NM9A 4UCGA 4GKTA 3TMQA 3TR2A 4EWJA 1VKFA 2QUMA 1VIZA 5A1AA 3C5QA 4PMOA 3UY8A 2QDGA 3SAZA 4GLEA 4GBDA 2CBUA 3I7RA 3W7RA 1A5BA 1E1EA 5EMMA 5FI8A 1ZB5A 4BI6A 3BE7A 3W7OA 3F4VA 3S9YA 1E56A 1W3NA 4IJCA 1UWQA 1YIXA 1TRDA 1DJNA 3N15A 2VCAA 3MMWA 4AXKA 3WJSA 2GGGA 3WK1A 3AHTA 2W3ZA 3L4YA 1U33A 3BURA 2YDSA 3AIEA 4GI8A 1SQ7A 1KV8A 3NO1A 2NSOA 1LRTA 1AD1A 4FPSA 2BP1A 1FH9A 3WG6A 2JGQA 1ADDA 4O1EA 5HPCA 2QPXA 1KM3A 2WVUA 1XBZA 4F3HA 2GDUA 1DIEA 1JD9A 4CNNA 2VGIA 4FNQA 4QJ5B 3R89A 5D04C 1TQXA 1PV8A 2X0HA 3RIKA 2VC7A 3KOWA 3SCUA 2NV1A 1UR1A 2VWTA 1GQNA 2P0OA 2DT3A 4Y9MA 3OGRA 1BYBA 3HGOA 3CYJA 3RPDA 5M5DA 1IEXA 3VOIA 4QG8A 3UEQA 4ZQPA 2Q3RA 1CLVA 4GINA 3MQTA 4X60A 4GZ7A 3KWXA 3QF0A 3HPFA 1V5XA 4C7DA 3L9CA 4MTVA 2FB3A 3N2XA 3OGVA 1EB3A 1GQLA 4IJRA 4I5XA 4HNUA 4NVTA 4JQAA 5DXXA 1E5NA 1H63A 4MGGA 3P8JA 3CHCA 4I9JA 3ORWA 3CT7A 4V15A 4KMQA 2ALRA 1J5TA 3B05A 4EXQA 3S5SA 1OADA 2JIWA 1AL8A 4NAFA 2GGEA 1P1MA 1XFCA 4FAMA 1IQ8A 4YL2A 2VL4A 3A4XA 1KXVA 4GI9A 2CZVA 2X2GA 3WMBA 1V8EA 4C1LA 2YDAA 3F1QA 3C0SA 2FHFA 2ZZ6A 4BS0A 4M7SA 3JRKA 5CSRA 3FDKA 3AXMA 3EWWA 2J47A 1G4PA 1EEPA 1RVKA 1X8CA 1QI5A 3ZYZA 2PDMA 3OB8A 2BV9A 3M43A 3W82A 1NOUA 1ZU8A 4JTTA 1VBJA 1WOBA 4H8NA 3K1GA 1PHWA 2FPYA 4LAZA 3AUJA 1XR2A 4ROQA 4DZ5A 4WKFA 5LA1A 9CGTA 4RZ4A 1JUEA 3S4TA 1MQRA 3VNYA 4ZFCA 1TPC1 1HP4A 3TXVA 3OOQA 5MHBA 2C19A 1JDDA 2WHKA 1OGGA 3LERA 3P93A 5HQLA 1DQXA 3VNKA 1ENUA 2V38A 3GK0A 2BXZA 1K8YA 4JX5A 4LRSA 1NF0A 4IOTA 4E38A 5DFAA 1RQHA 4GC4A 2BASA 2W67A 4D6JA 3E2VA 1R2SA 1XH2A 3KBJA 2XHYA 4JQ2A 3FEMA 1I1XA 4OE7A 2CLOA 4REQA 2I5GA 5D9NA 2IPFA 4TV6A 2ISSA 4O16A 4AG0A 1ZGDA 3PUOA 3LCFA 1T0OA 3MV11 5GJPA 1E5JA 1RA0A 1SUXA 4PTDA 5CGMA 3N04A 4DJFC 5D38A 1O5XA 2WBGA 5C7VA 2J7HA 3S9IA 4AIEA 2E25A 4KFPA 5D03A 5LA0A 1LBMA 4UFJA 2TRSA 2GGJA 3WH8A 3SN1A 1OCNA 2VD8A 1C90A 1H62A 1J2WA 4AC7C 4XAZA 3M6YA 3LNPA 4O1AA 4E5TA 2CESA 1I2NA 1K9FA 3V3WA 1JZ6A 1P43A 2W5FA 2XISA 3DC0A 4O53A 5AHNA 3AMKA 2RGMA 1IIHA 4MYXA 3PBMA 1J0YA 5J5DA 1M04A 4GYJA 4Z1AA 3B9NA 1IWPA 1BTMA 3GG7A 1DIKA 4EAYA 1XICA 5CC6A 2MANA 4AIBA 1CBGA 4C6QA 1KO0A 2VUNA 1KGWA 3WQVA 5I3IA 3DENA 1X6LA 3AROA 4HIBA 6CGTA 3QYSA 3THCA 5CC5A 3T6CA 2XDFA 4H9VA 3P3BA 4MM1A 3T2PA 1IT0A 3BMVA 1XJBA 3KBNA 4FF5A 1V0NA 3WBWA 4YXGA 1E9IA 2LLEA 3ZVHB 2ZXQA 3T78A 2GDQA 1OC7A 2ASHA 5CLWA 3KEHA 4YHGA 3DOPA 2QS8A 2YDQA 5TBOA 3TC6A 1YKWA 3R8RA 1TV8A 4QE4A 2QCEA 2NWRA 1D7FA 2FZNA 4GUHA 3WNOA 1XKJA 3E5PA 4PH6A 3NWRA 3BQ5A 4ADUA 4MB5A 3TQVA 1KKOA 2OZ8A 3KRUA 4D9PA 4QS5A 3CHDA 5FL0A 4GJIA 1TCDA 3S83A 1OCBA 4D71A 3CIWA 1TTQA 4JICA 4S3BA 1UOZA 4JDBA 1WAUA 4WIWA 5L9FA 4QBXA 1R3SA 3MBFA 3VC5A 5AY7A 4LUJA 5AC6A 1S5WA 1QHPA 3U57A 1X7FA 2FMOA 3TTEA 5FEZA 3DYOA 4Z1CA 4OBTA 4DYKA 3VGBA 3FGCA 4R88A 3TSBA 5FL1A 1ELSA 4LGXA 1EJTC 2E28A 4U33A 1MYRA 2ZXBA 1J18A 4AVFA 1OYAA 2QNEA 1TPVA 1UBSA 3UJRA 4A3UA 4IG2A 2A85A 4YN5A 3M0KA 3NYZA 5BYWA 4N42A 3N9KA 3BH4A 4PC8A 1JPHA 1IT8A 3TX9A 1XWYA 2PP1A 2WKLA 1RQBA 3P7YA 5ABGA 1Y5XA 1XPYA 5HNUA 3M9YA 1H49A 4MWAB 3VOFA 4OU1A 1JZ2A 3BLIA 5ABFB 2QCHA 2DT1A 4B3LA 3NQVA 3A3XA 2DZUA 3B0YA 4NG3A 4PCFA 1XKYA 3WL0A 1OIMA 1MXSA 2V3EA 2VFHA 2YJQA 3D47A 3CV2A 1GNXA 3BSMA 2PE4A 4Z08A 4E2OA 4F0KA 3DKJA 3H2CA 4X0VA 1K7XA 5EBAA 5LXEA 2J6XA 4TVUA 2XGBA 1O5KA 2CKSA 2XH7A 4FALA 1TRIA 1ISWA 2WVTA 2DZSA 2QMKA 3L4XA 3S6OA 2XSAA 2DZVA 3O0KA 1K8XA 1Q6CA 2R82A 3QSRA 1UMYA 3TCEA 5I24A 4PRRA 3RCMA 1RALA 2J75A 3ANYA 3BANA 3T8QA 1F6PA 4CD6A 1YX1A 2ZUNA 3MKCA 3IGSA 4JFUA 3CZ8A 4TVCA 1UWIA 2Z0IA 3PUEA 3SRKA 1QU4A 4DB7A 4EXAA 7PTDA 4PUDA 3MYOA 3NQMA 4LTSA 3BJTA 4UR7A 1UJPA 4FOKA 1I2RA 3GZAA 3IUHA 1CWYA 4HN4A 4KKXA 1V93A 3SUTA 1KFCA 3B9DA 2ISWA 3G77A 4MB4A 1VQTA 3G0UA 3NZPA 4OUEA 2WYSA 1YTEA 1K6AA 4LC6A 3VKAA 4BR1A 3QPZA 2QF8A 3LLXA 5KETA 3GC5A 1NDZA 1FCVA 1UD4A 4FX6M 4PL1A 4LB3A 1Q6EA 6REQB 5FESA 3KE0A 3L67A 4US5D 3M5XA 4IQJA 4C6NA 3KL5A 1JXJA 3RJYA 3S1UA 1CZ1A 4LF2A 3AALA 1E6SM 1WP6A 2BGQA 5E6ZA 3VCNA 1QT1A 3MDUA 3CAKA 4NY2A 4BA0A 2PB1A 1BKSA 1JNEA 1E72M 1ZLPA 2VJXA 4N4QA 4GYPA 2W92A 3UERA 1JL8A 4QQ3A 5JVLA 5DEZA 4CQBA 1NY1A 5D8WA 1QVBA 2E8YA 4LS1A 3O2LA 5CJ5A 1AVAA 1PIIA 3F7JA 4WGHA 3CASA 3DFYA 1W17A 1OX4B 3KHJA 1S2VA 3O3RA 4RNHA 4QLKA 3TN4A 4PSRA 4WHBA 3W37A 1CENA 3DIPA 3T2QA 2PDPA 4NILA 2J24A 3PZVA 5JIPA 1VZWA 1B3XA 4AY7A 1V3JA 1V3HA 3RGTA 1A0DA 3W70A 1GOWA 4GACA 3THQA 3K4AA 1GCYA 2V3GA 1AODA 1EWDA 5L6UA 3AMDA 1O5QA 1CLXA 2OGYA 4A8IA 5CSUA 3SGZA 3ZXWA 2YCEA 5AC5A 4O4WA 2Y5JA 3SCRA 4PGLA 3W2NA 3DFHA 4Z1YA 4H6QA 3S2LA 3FJ6A 4YMZA 3IJ7A 4DF0A 4UTFA 4WLCA 4QEHA 4S3KA 4CCEA 4QLJA 3H21A 5HDRA 1UPMB 3N4FA 1RBLA 1EJRC 2WAGA 3UP8A 1E3XA 5FF4A 1OFPA 1WZKA 1FFQA 4KCWA 4JTQA 3WUGA 1AA1B 4S3DA 2DU2A 2PDXA 4NAEA 1W91A 1L6FA 1IEVA 4JKMA 2XH4A 2PD9A 4KIEA 4HU3A 5A8OA 3M0MA 3VIPA 4LNYA 3AIWA 5ABTA 2AKMA 2WLZA 3IVTA 4IGSA 3T0AA 4LUSB 1W9UA 3A3HA 2ZC8A 4GVGA 1KW1A 2W91A 3R0UA 3WQPA 1F6KA 3ZM8A 4UOZA 1FTXA 4B3ZA 4YCPA 1LWIA 5K9XA 4IMDA 4AWUA 3LRKA 5E5CA 2O9OA 1QI4A 2ZX7A 3D3AA 3VNJA 1NDVA 2HNEA 4IGHA 5GQBA 2GJRA 1HQTA 1OYBA 2CERA 4XTDA 4BEQA 2GOKA 1NQ6A 3TTQA 1NQKA 4FIRA 1FOBA 4M7TA 2EAWA 4JTSA 4Q6JA 1QNPA 1S2UA 1B0IA 1WUEA 3OPSA 4DM1A 3LSCA 2ZRVA 4H04A 2XVPA 4H9ZA 4BWLA 5CZSA 1YTKA 5I00A 1M1BA 1B54A 3BC9A 3W85A 3A5VA 1OCJA 4JN6A 5I0DA 4CNSA 2EEXA 4NJHA 4A8LA 4WR3A 3V0TA 1L8PA 4O19A 2VFEA 2PS2A 4OV9A 5FCZA 1H51A 3SECA 1NWSA 1TMLA 3KS5A 2QDDA 1QK0A 2BLEA 3MCNA 2AMGA 2JKEA 4DX3A 3HIJA 3UR5A 2V5CA 3TJXA 3MUZ1 3E2SA 7TAAA 3TKFA 3DYPA 4QNEA 1WB0A 2WMKA 3ARXA 4LEFA 3AO0A 2JBMA 3ANUA 3U48A 1Q6OA 3PZMA 4C6MA 1DXFA 5C8BB 1EUNA 4DF2A 5HATA 4GUIA 4S3CA 1UPPA 4A35A 4Q7NA 3N6QA 3OBKA 1I0DA 1E6RA 3GG8A 2JEQA 4GKLA 1TWWA 3SO7A 3SUVA 3F4NA 3PAJA 1BG9A 3PHAA 4FLSA 1XBVA 4AIOA 2A5HA 2PBOA 4FLQA 4RZ6A 2Z1VA 3GAYA 4K39A 3UA4A 4LALA 1HX0A 1Q6RA 1X6UA 3DESA 2R6OA 1J2BA 2Z27A 3USZA 4CVWA 2VR2A 1XSIA 3TW9A 2VOMA 1A50A 1RVGA 3SQSA 1E40A 1FXQA 4HK5A 4MAVA 2RFGA 5CKSA 3UGVA 4Q3MA 1TWDA 3P74A 1Q6QA 3AYTA 3OQEA 4O11A 3WD0A 1LP6A 1B3VA 2BS9A 1KRBC 2DGAA 4FOJA 2INEA 4J27A 2OSYA 3UESA 3W86A 1IT7A 1SJDA 1Q13A 3MPGA 2P1FA 3CQJA 4BZYA 3VNDA 1CGXA 3VKBA 1TA3A 1I9CB 1MRQA 1L6GA 5DBTA 1GJWA 1ECQA 4MNLA 5HJLA 4KRUA 1HKIA 4I5RA 3O6AA 4PMDA 2VDIA 2JIEA 3WDPP 4L65A 1W8SA 3TLLA 4RLIA 5C71A 1H7RA 3A64A 5DY2A 3RHGA 3B4YA 4F0RA 1O5RA 1K4HA 3WJYA 1MDLA 4C6OA 4J3WA 1HO1A 1ML1A 1JF5A 3H2OA 3W83A 4DELA 3G1VA 4XD6A 1W31A 2ZRWA 2CHRA 4S3FA 1I45A 3GHTA 3IIXA 3IGUA 4Z2IA 1EF3A 5B7YA 4RE0A 5IFPA 3TW7A 2FKPA 1YE4A 4A3RA 5EY5A 4U10A 1AZ1A 2XIBA 1DWHM 3HB9A 1YXCA 5CG0A 3PG9A 3WBYA 1QI2A 4RDZA 1DQWA 5K2ZA 3PFMA 1CGYA 1XBYA 3BW3A 2QGHA 2INZA 2J7DA 3KBMA 3QMTA 4WSHA 2Q8ZA 1T6MA 3OZOA 1EUAA 3HV8A 1MI3A 4UFLA 2BNJA 3WBEA 3URAA 4P8VA 3F5KA 2KZHA 5HA7A 1VFHA 4HB7A 3RNDA 4ZOBA 3N4AA 4MKVA 3CMJA 3NIYA 3A5FA 5D33A 1CCWB 3GTXA 4B92A 3QTGA 1KXTA 2FZ9A 4K8HA 2DIJA 2BFGA 1W37A 4XAYA 3DFPA 1MVYA 4Z2LA 2O56A 3VKJA 3BAXA 3T0BA 2OKOA 3W28A 5FSDC 1EGVA 2E9MA 1UB3A 1JZ5A 4HCDA 2F84A 1K77A 3NZ1A 3RCNA 4Q8VA 2H9AA 2XZ9A 4FS9A 1GOOA 1Q6GA 4EWND 2VC5A 1A5OC 1L8NA 5C54A 4WKAA 5FAJA 2BG5A 2E9BA 3TVAA 1EPVA 4XIAA 2I5QA 1YDNA 1LQ2A 1KCKA 3QQWA 3WENA 2DORA 3QXBA 3ZVHA 1I2QA 4IF2A 5K9DA 3OYZA 1DXIA 3EXRA 4IMFA 3E9AA 5GJNA 1LWHA 4CU7A 1FBAA 4H2CA 4J35A 4GYPC 4LVAA 3H54A 2EPHA 2XN0A 3W1PA 1MEWA 2PI6A 2VEPA 5CJMA 3T4CA 1WKFA 4ERGA 4M6PA 3VGHA 4FX7A 4GXMA 3SQMA 4UQ9A 3EWUA 4JTLA 3DBNA 2IS7A 2CXEA 2GWGA 4G56A 3S47A 3DAQA 3R0DA 3LGGA 3H2EA 2ICSA 5FJIA 1YQ2A 3CHFA 2WNZA 2F2KA 1O12A 3MSYA 1KWKA 5TQLA 2DW6A 3RDKA 3CL6A 4K2SA 4OECA 1A5KC 4NIRA 1LQ0A 1U22A 1LUCA 5BROA 1RBAA 3RAOA 1TKKA 1GZ1A 1IEIA 2WCAA 1ONEA 1S2WA 5FEWA 4F9JA 2PC4A 2ZTJA 2J27A 3C4UA 4AZ7A 5EL1A 4HQVA 3KOXA 3MB9A 1T99A 2WQPA 4H6RA 4RPQA 2ALDA 3N73A 1KA9F 3GIPA 3URBA 1P4CA 3WQ8A 2A3EA 2PWEA 2A6NA 2QKFA 4P2VA 2Q02A 3NPXA 4HBKA 3LQGA 3SQLA 3HQ1A 4MWAA 4FXRA 3EMZA 3OHIA 3WD2A 3N25A 3UT0A 1ICSA 1DBTA 1Q8JA 3IWPA 1O1ZA 4G7EA 4WDTA 2EPKX 3H26A 1B4KA 1XIJA 1F8IA 3OP2A 2HWGA 1S3HA 1FWTA 4JIIX 4MVAA 3UJEA 9XIAA 3ZO9A 3AHXA 1SZFA 1EOKA 3E2RA 3O8AA 1DPMA 3RPTA 3GQYA 2WMJA 3GRIA 1TV7A 3W7LA 3QBUA 5BXTA 3VNMA 5HMFA 1K7EA 5KEZA 2Z24A 1Q7QA 2R14A 3TAKA 3BAKA 3GB6A 4D8LA 4QGCA 3LM7A 4LVDA 3K4WA 1OFEA 4EPEC 1TZ7A 4CNPA 2Z1SA 1KRAC 2J6VA 3EDDA 1TUXA 4NI3A 3KAOA 3WLTA 5HJYA 1BVNP 1KFWA 2DT2A 2GDVA 1OSEA 3CZGA 1R8LA 3W87A 1Q85A 2NUYA 3M1ZA 5CGTA 3ZT7A 2L5HA 5DMLA 1D8CA 3PUDA 4R7WA 2G3FA 2BX7A 2EJ1A 1H1ZA 1JULA 4WUIA 1TPB1 4BWLC 1B31A 3I3EA 1FHDA 1HJSA 3CUXA 4GVHA 3WH5A 4RR4A 1EF2A 5E0KA 1PKMA 3LZ3A 3K13A 1UD6A 3QHNA 4AWSA 3LSBA 3QM3A 4OTKA 1GKQA 3WF0A 3TWAA 3WEOA 5ABEA 1RD5A 4GIYA 2X1TA 2Z1KA 4C6KA 1JRCA 2CPUA 2DUAA 3ONCA 5KZDA 3DG3A 4AW7A 2WSQA 4FOUA 4W85A 4ZQMA 1LG2A 2VX4A 5E93A 1SZGA 4S38A 6REQA 2V2HA 1XLMA 1OHLA 4GJ1A 3TNBA 2D69A 2XVKA 1AW5A 1IWAA 3LN3A 3FXYA 4N9EA 1QPOA 2JFEX 4IIBA 3VFLA 1TE1A 1T41A 1HVXA 2OELA 4RW5A 1K02A 2NLYA 2BVYA 1XYFA 2G3IA 1H5VA 1TMQA 2XN1A 3LLDA 3UU0A 1S1PA 4XD3A 3W76A 1ZENA 4H7CA 1ZTVA 2XM2A 3BWWA 5TIMA 3R43A 3N2BA 1B4EA 1EKOA 3U2OA 1V02E 4Q8NA 3IANA 5U4NA 1BSIA 4O8RA 3PB2A 1PJ9A 1WV2A 5AC4A 5BXPA 2FPTA 1EC7A 1FDZA 3AS0A 2BVWA 2HVOA 4DUXA 5A2BA 4S2BA 4P8UA 1V03A 4FLRA 1LG1A 4YTRA 4GQGA 3R12A 4CNUA 3RK8A 2OG9A 3MA8A 3NDYA 1BPLB 3I6EA 3AJXA 4IPLA 3PZNA 4H9UA 1H41A 5I6SA 3UA3A 3W25A 3PM6A 1A4MA 3GH5A 1ZP3A 3A4WA 3FHAA 4NZ1A 2YA0A 4RX0A 3S2MA 5BU6A 1E6PA 4UNKA 1ODZA 3HJEA 2V67A 4OIFA 2VR5A 1BVZA 3DEQA 1DYSA 3VZXA 4AVOA 5BW6A 2VEMA 3CV7A 1Q66A 4PMQA 4U31A 1OCQA 4R7JA 3TZNA 3VTRA 3KFTA 4P8XA 4P7OA 1GVRA 1GHSA 2DPEA 2ABBA 1UHVA 2PDIA 3VAVA 4IWWA 2O4MA 4KT2A 3LCLA 5CSYA 3VMOA 1NAL1 1NP0A 2OT0A 1VIWA 2DQWA 1J0IA 1A5CA 1EA9C 5HJXA 2E67A 3MO7A 4EIVA 3PNZA 1P0DA 1K9EA 4Z0JA 2J88A 1S5MA 1B57A 5EFFA 4XAFA 3FN9A 1B9BA 4W5ZA 4R9OA 4F0SA 3PY2A 1OGSA 3VO0A 2PF8A 5A6JA 3PNUA 3TYCA 2CLEA 4GNKB 1VYPX 3LG3A 1OFOA 3AWOA 3M0VA 3EX2A 4NT0A 3TMLA 3NZQA 2QCLA 1ZBKA 1AH3A 3SGUA 4LW7A 4C7GA 1SW7A 3ABRA 4Q22A 5M17A 2JQXA 5DELA 4LY8A 1NIUA 1V3KA 1J9YA 2VQUA 3T0TA 1J4EA 2FFIA 1J79A 1BFNA 1TTJA 5GPRA 1HL9A 1U30A 3CL8A 1ME7A 1UR2A 2Y7FA 1CXLA 4JNZA 2BTMA 1SMDA 2WVSA 3ME3A 4Q4SA 2R24A 5F2GA 5H8UA 1YDVA 1MNSA 1EX5A 4JBRA 2C1HA 3IIZA 1ITUA 2P76A 3I7SA 4X9SA 3WQ5A 4QISA 2I56A 1ZZMA 4MNMA 1CGTA 2AGTA 5G4EA 2Z7GA 3Q37A 1ZAHA 1EL3A 3PUGA 3QY6A 2QEZA 2VVSA 5HBFA 1R7AA 1DJWA 4C6CA 2FMNA 4A3QA 3G2GA 3S5OA 1W3JA 1HIZA 5F2LA 3RILA 3H55A 1JVNA 2OEMA 3V1HA 1W9VA 2O9RA 1VP5A 1DL3A 3W2LA 3TN6A 1OQFA 1WDPA 3WIJA 3I4KA 4L5ZA 2VR4A 3EX6A 3KOZA 3KL0A 3WMCA 4HU4A 4IISA 4V1XA 3MUCA 4Q7IA 1KGUA 4NP7A 3E38A 3CB3A 1YXYA 4NZ5A 5TNVA 3APTA 1X1ZA 3NPUA 4J7RA 4AZIA 3QKZA 4LAMA 4TVDA 1VJZA 1IGWA 4H3DA 1CI1A 1O6IA 4W7VA 4PUJA 3EKLA 2R1LA 2OMAA 4FLOA 1EBGA 3WNPA 1A3WA 3W7HA 3AICA 4NZCA 4QG6A 4M82A 3VIKA 3H24A 3VGEA 3H8AA 2C13A 3AISA 1CX9A 5JH2A 1E73M 5T26A 3ARZA 2ZRZA 4ILSA 1JIBA 3UWUA 3NEHA 2VEIA 3K30A 2EPLX 1QUMA 4DBUA 5H6HA 3G0SA 4LVGA 1XCWA 5C2GA 3EWDA 1DXEA 1BD0A 1OABA 3GG1A 3K8LA 4O8AA 2VUYA 2EG6A 4PBGA 3F4DA 4KBXA 4B15A 4AY1A 3T0CA 4Z1DA 3W7QA 1EZ2A 4KEMA 1JYNA 4UTUA 4J2PA 3M7SA 4WEVX 2VXNA 2PWFA 3KDOA 1EX1A 3C6CA 1J0JA 4B90A 3CNYA 1N8WA 4GH1A 1CGWA 2ZUMA 2QDHA 3IGXA 3UNTA 6ALDA 3QW4B 1XYMA 3W7NA 2O92A 1NP2A 4RNJA 1TJ1A 5KZEA 1WAWA 3PB0A 3EB4A 4XZHA 4OVXA 2ZWYA 3UJ2A 1WXJA 1IR2A 4XO7A 2EGZA 5IOBA 4MWAC 2QJHA 1QPRA 4WKHA 1IGSA 1KD0A 1KV5A 2Y70A 3HPXA 4Q8UA 4UOQA 3TTSA 4A3HA 3IJQA 3OVGA 5CBIA 1FX6A 3AXXA 1LL4A 3UCCA 2WKGA 1E9ZB 4JN8A 1I75A 1M01A 4DJFD 3W1RA 3M07A 4IFRA 3M44A 5TD4A 2WCGA 3QEZA 1QJWA 1R47A 4IQDA 2P88A 5IDIA 4QE5A 4HMCA 3ARRA 4UOJA 4NZ3A 1QW8A 3VOHA 1E70M 2W9MA 4PRWA 1S3TC 2CITA 2HBXA 4KW2A 2WMHA 2J7CA 1SW3A 3NO5A 3ARYA 2QPSA 1F4HA 5BXSA 5C5YA 3OU8A 2V0TA 4RXGA 5H8MA 4EAMA 3ABOA 1PS9A 3GFYA 3HMJG 1Z3NA 1KBKA 2I57A 4R85A 4ZODA 7CGTA 2JE8A 1A4LA 4I5UA 2CXGA 1V77A 1TMHA 1QNOA 4BFAA 4RXFA 2X41A 3V5CA 4Y96A 4IM4A 3QVQA 2GQ8A 2NXGA 4L61A 2CWNA 1PX4A 3LS9A 3ZR6A 2VRKA 1WZMA 1CXEA 4RL3A 5I03A 2Y8KA 4DM2A 1F2JA 3G0XA 3TW6A 3WDHA 3GUGA 4LT9A 4HPNA 4ACZB 3N6HA 3UWWA 3A13A 2ZE0A 3DFQA 5DRIA 4F0LA 3QYQA 4JY8A 1DQUA 1HJQA 1Q2SA 1OWQA 2C0HA 4Q4PA 3UWVA 3VNZA 1VAHA 5EMYA 4C6FA 4E6MA 4E4UA 4LX4A 3ARQA 3G3DA 2ZX6A 4GH3A 2XFWA 3WNKA 2BBFA 1UIPA 2NVDA 3LM3A 1BWVA 4UZUA 1RHCA 2V8ZA 2ZX8A 2FTWA 3B9OA 4IXXA 1ZS2A 2OSXA 4NSBA 2ZUUA 1HGWA 3W7PA 4DI8A 4MUZA 3F4WA 2X2YA 4D6FA 1LWJA 2WW5A 1BVWA 2RJHA 3E0VA 3CC1A 3QOKA 3PN8A 1IE7C 5AN7A 5LIUX 5KSWA 3DH7A 1I1WA 5F1VA 1QDSA 1US0A 3WLQA 4G8TA 3FA5A 2ZRUA 1VB9A 3HOJA 4U2YA 2ZFAA 3MYPA 4YCOA 5CZJA 3AUOA 4MOZA 2C1IA 2WBKA 2CHOA 1LRNA 4WOQA 3BARA 3VNIA 2H3BA 2JEPA 5I3GA 4IXHA 2P53A 2ZA1A 5K7JA 3WO8A 2CFFA 4W5UA 5C6MA 1ODUA 3QGVA 3VX1A 3KLKA 1UROA 2YDRA 3II1A 5HNNA 4GCAA 3CEUA 1PZ0A 4LS0A 3NSMA 1TVLA 4Z2GA 2YR1A 3TP4A 2C14A 2PDGA 3IJDA 2Y62A 4DYEA 4N9BA 2OYMA 1UR9A 4NL1A 3NGJA 4QTGA 1OVDA 5XIMA 1QR7A 1H1YA 1E1CA 1IZCA 4IIDA 5LNSA 4X63A 3SIMA 3QZ6A 2FZBA<