4Y96A

Crystal structure of triosephosphate isomerase from gemmata obscuriglobus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
250
structure length
250
Chain Sequence
TRKKFVAGNWKMNTTLAEAKALGAAVAKGVTDDRVTVAVFPPYPWLTAVGEVLKGSPVALGAQDVSSEKKGAFTGEVSPAMLLETGCKYALIGHSERRHIIGESETFINHKVHTALEEGLSVVLCMGETLAERERGLQERVFQRQVYAACAGLTDEQFGRIVIAYEPVWAIGTGKVATPEQAQEAHAFVRSKLRLLYGDKIADSTPIVYGGSVTPDNTVGLMSQPDVDGALVGGASLKADSFLAIVKAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate Isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Gemmata obscuriglobus
molecule tags Isomerase
total genus 93
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y96A00
1XXXA 4LC8A 4A2SA 3PUEA 2QAFA 1DHPA 2EGZA 3GLCA 1W0MA 1OYCA 4RLIA 1R30A 4WXYA 5D05A 2QCEA 2GVLA 5A5WA 2X16A 4HNUA 2V9DA 5CSRA 1TV5A 2ZZ4A 3UWUA 3N3MA 4GUJA 1I2NA 3G18A 1F05A 3W1LA 3G1VA 1RR2A 3NQ6A 4ADTA 1H60A 4RJEA 3A21A 1KLZA 3FEMA 2ZFAA 3N73A 1TPEA 2RFGA 2PRHA 3EX4A 4O17A 2QCNA 3WK1A 1VC4A 2E1DA 1TTPA 1ZJIA 4FEZA 4JTKA 5G2IA 3LBCA 3ATYA 3OG3A 4C1LA 2E6FA 4MVAA 3W73A 2AAMA 5HUOA 5TBOA 1KM3A 2C6QA 3LI1A 1EUAA 4IJBA 2ZZ7A 4EIVA 3NQ7A 5CZJA 3UPWA 4RXFA 2F84A 3GYEA 2VFIA 4OBTA 1YYAA 1JVNA 4HNNA 3MJYA 1NF7A 3NZRA 4EF8A 3W6YA 5FF0A 3HMJG 1VYSX 2GJLA 2ISWA 2QDGA 4X3ZA 4K36A 3GVGA 5FF2A 4OHQA 1ZAHA 3ZWSA 3W22A 3NAVA 4JD4A 4NZFA 2ZYFA 2ATSA 3O05A 2E09A 2DZTA 3LXCA 4UFHA 5GVJA 1N7KA 3STEA 2D73A 1O5XA 2TYSA 3W2JA 3T4CA 3TUUA 1MSSA 3N9SA 4A22A 4HNVA 3A22A 3L2IA 5E93A 4XTDA 3FJ6A 4IMEA 3S6DA 2GUUA 3EXRA 1QOQA 4GUFA 1I4NA 2VENA 5DY2A 4UMBA 2ZRVA 4JGDA 5I3KA 2Y88A 3IGSA 4O57A 2WOQA 3NO5A 3CLMA 1TSIA 1KV5A 2HS8A 1OFPA 5D09A 4XKYA 3PB0A 3UWVA 4L4MA 3FIGA 4X2RA 4RXGA 2RDTA 1XUZA 3KRUA 1EEPA 1JRCA 1TJRA 3L68A 3NYZA 5BOOA 4UTKA 3T7VA 2NXGA 5DCDA 3RF9A 4HKPA 1LZOA 4S2BA 2WNZA 4NX0A 2VKZG 4DPQA 5KMYA 4PA8A 3OVRA 2QEZA 4M19A 3DFTA 1G4TA 3G24A 2C16A 3A5VA 4Z1AA 1ONRA 3LOTA 4K38A 4YLWA 2ZBTA 3ATZA 4O12A 1FDYA 4N02A 4LC6A 3WJSA 3GDLA 1TPC1 2Y7GA 3TAKA 5EPDA 2R91A 1TREA 5G5IA 4FNQA 5AB3A 4LV9A 4K6AA 2V30A 4FNUA 2VEIA 1IXPA 4FXRA 1K7FA 3NPUA 2BZNA 3C4UA 4WY0B 3PB2A 3LCWA 3NDOA 3KVJA 3LHTA 3C6CA 5EYWA 1LP6A 1JQXA 4IXXA 5AC7A 3W71A 2R14A 1VPXA 1DJQA 4N9BA 5EBUA 1H5YA 2H3BA 3C3NA 4IQLA 2PURA 1TTJA 2CZDA 5U7SA 4IX2A 2WQPA 4YMZA 4U4MA 1G6CA 4BF9A 1LRTA 3DKLA 4GNJA 4BFAA 4TMBA 3RNDA 4JDBA 1JCJA 3CEUA 2C0AA 1M5WA 4H3DA 1VGAA 5F2IA 1QNVA 3EEGA 1I2OA 1QO5A 4LTSA 3WK3A 4WUIA 1PL9A 3GDTA 4JEQA 2DZVA 4MKNA 4RX0A 1SZGA 4GJ1A 1GTEA 2C1HA 5K9DA 1LDCA 1JQVA 3W9ZA 1H62A 3OEXA 1OYAA 4HIBA 1ZNNA 4FNTA 1GTHA 1D3GA 5KZMA 4HSNA 1IXQA 3DI0A 3NGJA 1VHCA 8TIMA 1ZHAA 4WD0A 3UD6A 3QQ0A 4AWUA 1JUEA 2OMAA 2QCGA 3AO0A 3QMSA 4S2CA 4RK8A 4BI7A 4M7TA 4DO4A 1QAPA 3IVUA 1FWSA 2QUTA 3THQA 1Q6RA 2HSAA 4UTUA 5SWUA 4JTFA 5HWJA 3IIPA 1Z44A 3NQGA 3NQCA 3RLVA 3DBPA 3L65A 4GFSA 3WJXA 1EX5A 1H63A 1ME7A 1LBFA 3O6YX 1W56A 4S1FA 4ZVJA 4MJZA 1W31A 3BG9A 2NX1A 1ALDA 3KVMA 4NQ1A 1Y0EA 3STFA 2ZZ1A 1P5BA 4AEOA 3MWAA 4MY9A 3L5LA 5AHFA 4O15A 4UTIA 1YXYA 4LW7A 5HR6A 3M44A 3GAYA 3LCGA 1J4EA 3L67A 4LU0A 4NXSA 4R53A 1FCBA 3W7CA 1GPWA 4OWGA 4LVGA 4ZQCA 2ZRZA 3MP5A 4UC5A 4MFEA 5L6UA 3W1PA 1O4UA 1BTMA 4DO6A 2ZRYA 3SJ3A 3R2GA 3HG5A 3SIZA 3C0JA 1B4EA 3G1FA 3NQDA 3TSBA 3S0CA 4DPPA 3MP4A 2C14A 3NL5A 2ZDRA 1H7RA 2VFDA 4QSHA 3PVFA 3W83A 4BR1A 3MW7A 4WXZA 3G0SA 2X1TA 1AW5A 3USBA 2E5BA 3MHUA 2DZWA 1DOSA 1BWLA 4WQ6A 3LTSA 2BTMA 5D02A 4LT9A 2CZFA 3QMRA 2CLIA 2Y62A 2UV8G 3HGSA 4Z0JA 5AHLA 3W2KA 3W7QA 1SR9A 2WO5A 4K8EA 5FESA 4XBSA 2QCHA 1R2RA 4NJHA 1CX9A 1PCKA 1KTCA 1TQJA 4HN4A 1Q6LA 4O14A 1TO3A 4OU1A 3NOEA 3P67A 3S9YA 2LLEA 3FFSA 4AWSA 4I7VA 1QPRA 5EL1A 4O0ZA 4MY1A 4LY8A 1K8YA 3OVPA 3CWOX 3W7OA 2YDAA 3GZ3A 3HPSA 3QEZA 3W7EA 1XI3A 2QCCA 5LSMA 1OFAA 3LB0A 3LTPA 3JRKA 4JICA 2IQTA 1R2SA 2GPTA 4M6QA 3I7SA 2ZZ6A 2A1YA 2CLEA 1THFD 4C1KA 3UWWA 5CG7A 3TQVA 4Q4KA 2YW4A 6ALDA 2QJHA 3TJLA 1HTIA 1DVJA 3U2OA 3R8RA 4M5PA 4CNNA 3VCRA 4UR7A 3HGRA 3QC3A 3P61A 2F7FA 2QR6A 3GB6A 3NQAA 5C54A 1UASA 3INPA 5AYZA 4NT0A 3LLDA 4GC4A 1I8JA 4UMAA 3ZWTA 1H7NA 4PC8A 3DFOA 3IV3A 5J5RA 2VEMA 2CLLA 3A24A 3W2MA 4TO8A 1ZENA 3C56A 2B7QA 1SU5A 4JIPA 3I68A 1TPWA 1SZEA 1H61A 1B3OA 3GAKA 4AF0B 2J6XA 3HPXA 2JBMA 1FDZA 1WQ5A 1DQXA 2BLEA 4LS2A 1GOXA 4LUJA 1MEHA 1ICPA 2W79A 4QNEA 1QPQA 4UNLA 1TPUA 3B0PA 3W7IA 5BRBA 4UFMA 1Q45A 3HPZA 1AW1A 4U28A 3B05A 3U8GA 7TIMA 1ADOA 2QJGA 4Y96A 3WJWA 3GKFA 3IRDA 1F5ZA 5C55A 4BI5A 5LHEA 5FEWA 5AOUA 3M6YA 2Y61A 3ABSA 5FF7A 1H1YA 2V0TA 1LLWA 1ZY9A 4JR5A 1OX6A 3JR2A 4JYDA 1UJPA 4A3UA 2Q3OA 3G1XA 3N19B 1F6PA 2V8ZA 4K7YA 5U4NA 3TK7A 1C8VA 1AW2A 4NJJA 3S5NA 4MUZA 3I65A 2FTPA 3TC7A 3UZJA 1HUVA 3MBDA 4E0CA 2FQIA 2DJLA 3W7HA 2DU2A 1ZCOA 2YFNA 3S1WA 2ZRUA 4IXHA 3DI1A 3EWYA 3TV8A 3W7RA 4QM1A 2FFCA 2FIQA 1GT8A 3TC6A 2DORA 5AFDA 1W54A 3G0UA 5D2WA 2Q3RA 4MY8A 3BK0A 5DCEA 3W1XA 4NJGA 2WV8A 2H90A 1XBZA 4B5NA 3QJAA 3PG9A 4K7VA 1LTDA 4N4QA 3GKAA 3EX2A 2ZTKA 4DBEA 3W7LA 4ORMA 4G1KA 2E6DA 1Q3NA 1DKWA 2WNNA 2RH9A 4GXMA 4ZL1A 4R34A 3TMLA 4LS1A 2VEKA 1JUBA 3O06A 1AL7A 1TCDA 1X6UA 1QDSA 4HHPA 3EXSA 3VFLA 5EMUA 4MOZA 3C2RA 3KHJA 5FEZA 3E02A 2NX9A 1X8FA 3HG4A 2C18A 4NU7A 4WY0A 3G1SA 4MZ1A 1UUMA 3MYOA 3NQMA 2NUXA 1MXSA 1EPXA 1KM6A 2CW6A 1FXQA 5LNWA 4UTWA 1T0OA 3FJLA 4Z0SA 1QMLA 1T99A 3L5AA 1KM4A 5AYYA 4XTIA 2J9YA 4EVZA 3HF3A 3KFTA 3ZR4A 1JCNA 3G8RA 3O07A 4NUWA 1SO5A 3S5ZA 1S5TA 5AC8A 3C2VA 1XKYA 3R12A 3LRLA 2EAWA 1ZFJA 3MHFA 5KINA 3EWWA 3M7WA 3HG3A 1GVQA 1FX6A 4LV4A 4JYEA 4JTSA 3R89A 5D2YA 4CCCA 3ABOA 4Z08A 3ANYA 5LZLA 4MZYA 2QCDB 2GJNA 4M6VA 1OFEA 1DV7A 1ICQA 3LCIA 1DJNA 3W7PA 1JCMP 4FHAA 1TIMA 2JKEA 3QFEA 5FEXA 1U83A 4DXVA 1SO3A 2FB3A 1WBJA 5D2VA 5LHFA 1XBYA 5HR7A 4RZ4A 2O7QA 3GDKA 3M9YA 4MZ8A 1X1ZA 2V2CA 4MYAA 4IWWA 1L6YA 4GWEA 5BW6A 3KVLA 2EHHA 2DZSA 2C13A 3C52A 3U6WA 4GUHA 1N55A 3G1YA 3QYQA 1SSGA 4O18A 3HIJA 1K03A 3V75A 5KITA 1A53A 3E9AA 1NEYA 4DELA 3W23A 1MEWA 3NA8A 5G2HA 1FXPA 1XUUA 3DXIA 4ORIA 3EKLA 3SGZA 3SGUA 6TIMA 1U5JA 5K9CA 5D04C 4PFMA 4CLMA 1ME8A 1FBAA 3KXQA 5HWMA 4QISA 1KM2A 1J5TA 2XN1A 3C2FA 5K4ZA 2J9ZA 3LCXA 1B57A 3PS7A 3IVSA 1RQHA 4JX4A 3B04A 1KW1A 1SZNA 5DELA 4CQ9A 2RHGA 4CNPA 1VCFA 3STGA 5K4XA 2YR1A 5C2XA 4N9CA 3GK0A 1GVOA 3TCEA 2ZCGA 3PAJA 3IGUA 3WK2A 4Y6GA 4UR8A 3NPXA 1QO2A 2A2IA 3B0UX 3PF3A 1LLZA 2YFOA 3W7JA 1OX4B 1IF2A 3L5MA 4GUGA 3L0NA 2OT0A 3DU0A 3MP3A 3OIXA 3TW6A 1XCFA 1XBXA 3R5EA 3IIOA 3QW4B 4MYXA 4LRSA 4WX2A 2JK2A 1GVSA 4AXKA 1RPXA 2X1RA 1W5QA 4A21A 4AHOA 5ABTA 2DZPA 2Z1BA 1G4PA 4EOUA 1XBVA 1WA3A 1LOLA 3CIWA 4N4PA 1L6SA 3WJYA 3TU9A 3IIVA 3NL2A 1YADA 5HWNA 1OF8A 3UWZA 3HBLA 1NAL1 3TH6A 3W74A 4GBUA 1OF6A 1S5VA 1VCVA 2YSWA 1SFLA 5G4WA 3MO7A 3P74A 4I7WA 3NQVA 3LXBA 1VZWA 3P5ZA 1GJPA 1HO4A 1ZAJA 5F4WA 3SR7A 5AC6A 3H54A 1YXDA 2GVGA 2TMDA 3MI6A 4P2VA 3TDFA 3W2LA 5TQLA 1UCWA 4O16A 3W7KA 1KM0A 1TPFA 1KFLA 1X1OA 2QCFA 3M16A 4E2DA 3LCLA 1W5NA 3MI3A 5MHBA 5AHMA 1I2RA 1ME9A 2G95A 3TQKA 3SSJA 2V5BA 5D03A 3MMTA 3TQ0A 4H4IA 3VNDA 1YLVA 3DFQA 5G2WA 4XUGA 2QDHA 2ABBA 1VH7A 1G69A 3IEBA 1KM5A 1P4CA 3EWUA 1WDWA 2FJKA 1OFDA 3DZ1A 1A5AA 2YYTA 4Z1BA 3E96A 3BGGA 1I2PA 2NV1A 4N9EA 3TIMA 4BWLA 3BO9A 4JXCA 3W3OA 4JTUA 2QF7A 3PSVA 4NVTA 1I45A 1NF0A 1JCXA 5IBXA 1SZFA 2Y7FA 2FDSA 2RDUA 5D2XA 1AK5A 2YXGA 1LYXA 3G22A 1DBTA 2VFEA 3G0XA 3I7RA 3Q94A 4K37A 4NNCA 4DO5A 2JKPA 3I7QA 3TE9A 3KOFA 4XKYB 1GG1A 1HG3A 3TKFA 1XM3A 1IIGA 5DXXA 4UFKA 5D37A 3UY7A 1UUOA 3CM4A 2NXIA 3Q37A 2VFFA 1F73A 3W87A 1VR6A 5CGQA 1LCOA 4CCEA 4DF2A 1MZHA 4OT7A 5HJLA 2E6YA 1RQBA 3QRHA 3W1AA 2JGQA 1IIHA 4PL2A 3TR2A 3BW2A 1VYRA 3GXTA 5D30A 3S5YA 2A0NA 3CIXA 3EX1A 1LRQA 3KX6A 3NL6A 1XFBA 1A5SA 3FS2A 3O16A 2X30A 5LNRA 1VHNA 3IGXA 2CLOA 1TQXA 4RZ5A 4FF7A 2OZ0A 1LOQA 3W1MA 3EX3A 1B4KA 4TX9A 4Y90A 2C15A 5CZTA 5HNRA 5DN1A 3MBFA 5F1VA 1W5PA 2G5WA 3E0IA 3OHIA 5EY5A 3B03A 2BSLA 1SO4A 4ZZ9A 1H51A 5CZSA 3PULA 2A6LA 4JTGA 5C5YA 1H50A 3P62A 1EA0A 3W1NA 5CZ0A 1S3HA 4UMCA 1YDOA 2JKAA 1R46A 1WX0A 2QKFA 5IBXC 2ZQ0A 4CNOA 1OHLA 3LHWA 2TRSA 2CLFA 4EWND 4MJMA 2FPTA 5F2LA 4ZMGA 2J24A 1QOPA 3LCFA 3T40A 4M6PA 1C29A 3GR8A 1TTQA 3EWBX 1FWWA 5K2ZA 1OK6A 1O60A 3TMQA 3SI9A 2ALDA 3IVTA 3TX9A 4LUIA 4UTJA 2E5CA 4DEFA 3O15A 1PHQA 1YDNA 1PCWA 1JR1A 3O1NA 3OBKA 1P0KA 3P80A 3W7DA 2YYUA 1M6JA 3IIZA 3RK8A 1W5OA 3T44A 4YCPA 3BLEA 3S1UA 2Z2UA 3G8EA 2ZA2A 1L6WA 4BI6A 1FCUA 1EWEA 1KA9F 3BG5A 3BLIA 3M41A 4QJ1A 3M43A 2ZTJA 4QITA 2CFFA 3NQ2A 4JNMA 4O1AA 1SSDA 2GVJA 4IPIA 3L9CA 4UFIA 3LXAA 5I3GA 4QIUA 3QF0A 1SFJA 5CKSA 1OFOA 3LGEA 1RD5A 5G4EA 2VEPA 1SO6A 2OJPA 2J88A 1MO0A 1YTDA 1SPQA 4E38A 5C6MA 1DQWA 5EKYA 1OFRA 1KBIA 1FCVA 3GNDA 3DHFA 4XBKA 1P0NA 1VRDA 5I3IA 3LDVA 3MI2A 1TJPA 5F4SA 3DENA 3V1PA 3VE7A 2YW3A 1F76A 2TPSA 5F1UA 3TNOA 2FB2A 3THAA 3EWXA 5HINA 4QAIA 2NWSA 3NM1A 4POCA 2E6AA 1J2WA 1KLYA 3CT7A 4O13A 5FI8A 1VQTA 1ZAIA 4JDYA 3HJZA 1SW0A 3DFNA 1G4EA 3NZ1A 2ZA3A 4JX5A 5KZEA 1E51A 3LERA 3FA5A 3BV4A 1H1ZA 1LM1A 1AG1O 2H8ZA 1H7PA 4O8RA 3S8HA 5DY3A 3CU2A 2CZ5A 4UNKA 1T96A 1TYGA 4UXDA 3W1RA 5I3FA 1TPH1 2NV2A 1W3TA 2VELA 3HO8A 4UUIA 5H91A 3HB9A 5HUPA 4KWWA 5KZDA 4DF0A 3GXNA 3E49A 3O6DA 4HNTA 4ICNA 3G3DA 1OYBA 2RKXA 2BX7A 2KZHA 3W2UA 5F2GA 1A5CA 1GG0A 3NQFA 3TFXA 2OCZA 4LVAA 2Z6JA 3GNNA 1KFBA 2Y89A 1XDMA 2WJZA 3JS3A 3M5XA 5AHIA 4PTNA 3BLFA 4TMCA 1YDVA 1IGSA 3WJZA 5I3HA 3PM6A 2XN0A 4JTJA 1X7FA 3DHDA 2PC4A 4Y8FA 2VFHA 1ML1A 4K8HA 1OFQA 1SW7A 1EP3A 1KBJA 1KTNA 3R13A 5DXYA 2H8XA 2QCLA 3UNDA 3PBWA 2TSYA 1H7XA 4AH7A 3QSRA 1F7BA 2ABAA 5AHNA 3W86A 3LHZA 3GR7A 2Q8ZA 3TROA 3W75A 5AHEA 2YX0A 4Z1CA 3TXVA 3LV6A 1F6KA 3QW3A 1W1ZA 3GXPA 4XZ9A 5J5DA 3A23A 4UTMA 2PE4A 2Y70A 3LHYA 4FNSA 3TXZA 4CQAA 3LRKA 2A7NA 1RZMA 4K39A 3E12A 4ONVA 3N2XA 3LHUA 1OX4A 3L0GA 3P7YA 4AB4A 3BVJA 4FIRA 3FLUA 4N9DA 3CWNA 3LCHA 1Q6OA 3PUDA 1RQEA 1L9WA 3HG2A 4UIOA 4H6KA 2RDWA 1YTKA 1KFJA 1TRIA 4W9TA 1A5BA 3M5ZA 1B9BA 5K7JA 2NZLA 1VS1A 2G96A 4CQ8A 4O4VA 2I9EA 2B0MA 2YCEA 5DBTA 1PIIA 4NX5A 1TPB1 3L21A 1KV8A 1LBMA 3M0ZA 1GVRA 3LRMA 4OV4A 3FYOA 2GOUA 4LNYA 2GQAA 1BEUA 3EX6A 1YTEA 3UWQA 1VJIA 3M5VA 1O94A 4XQ6A 4J9JA 3VKJA 1SW3A 1Z42A 4GUIA 4YCOA 3LHVA 3DGRA 2HS6A 1BKSA 1TV8A 4IOTA 4WOQA 2A5HA 3RLUA 1F74A 2X1SA 3BPWA 4Q32A 1EP1A 1KFKA 3NNTA 2W6RA 3F4NA 1EB3A 1OFBA 4JTIA 1SUXA 3QPZA 4LVFA 3PBVA 1RVGA 3K30A 2CU0A 3SW6A 4NNAA 3PBYA 1JJKA 3W1TA 4L4LA 3AJXA 1V7YA 3OVQA 3QMTA 2GQ9A 5CPLA 4FXSA 2WPBA 5LNUA 3UWYA 1NVMA 3PUOA 4ZQPA 3C2OA 4JYFA 5KTLA 1R47A 1TTIA 1KM1A 1W5MA 4NNBA 1P1XA 4N6FA 3UXAA 3ABRA 3LTYA 4UTWC 5IM51 4JTLA 4X22A 4D2JA 4HPXA 5E0KA 2ZZ5A 3FYPA 1FWRA 3CTLA 2P1FA 3UPBA 3HOJA 3PC0A 2NLIA 5DLCA 5LNVA 1PV8A 5LGZA 4R7JA 2AGKA 3KRSA 1R2TA 1MEIA 1YPFA 3PSWA 4O1DA 2P10A 1OK4A 3G3MA 3QZEA 1G7VA 1LOSA 3W7MA 5AN7A 3F4WA 1QFEA 2Y63A 3NVTA 3BW3A 3RFAA 4WOZA 4ADSA 1TPDA 2QUUA 2X1UA 3H53A 1FCQA 1GZGA 3P81A 4IMFA 3LBMA 5A8GA 3W07A 3NM3A 1GYLA 2DP3A 3T55A 5DBUA 1G67A 4A2RA 3FKKA 2Y85A 3M47A 5D33A 2CLKA 4KFNA 1W37A 2WSYA 3UZ5A 4M7SA 3W7GA 1CW2A 1TPVA 1HO1A 4I7UA 3S1XA 3RMJA 3BG3A 4AMAA 1RV8A 3A5FA 4IMGA 2ZRXA 4QNWA 4AAJA 3VI2A 4RZ6A 1Z41A 2PRMA 1I2QA 1JULA 4NJIA 4JY9A 3W84A 1WBHA 5BNKA 1PS9A 3S1VA 1FWTA 2DZXA 3SECA 4LOCA 2VOMA 3M1ZA 3W1QA 2JGYA 3Q2DA 5F4XA 5TIMA 1OX5A 1EWDA 2E77A 1IXNA 2CWNA 3W70A 4IPJA 4ADUA 2A7RA 1JCYA 1QWGA 2R94A 3D0CA 1K3UA 2BWGA 5FEPA 4ZQMA 3BW4A 4GE8A 3IIXA 4N6EA 4MPQA 3DFSA 5D38A 1K8XA 3ZS4A 5T26A 4ALDA 3QPYA 3SFKA 4PCFA 1JCLA 5F2MA 5HQEA 1LROA 4FX8A 1M7OA 5E1QA 4LVBA 1H7WA 4UTLA 4JTHA 4UTTA 1KFCA 1DL3A 3KVKA 3A9IA 3Q58A 1AMKA 4ML9A 2Z6IA 4DQWA 1FWNA 1CI1A 3LX9A 2NX3A 2ZA1A 2Z0IA 1OABA 1EIXA 3NQ8A 4YXGA 3B4UA 3LI0A 4FX6M 4WJEA 1GEQA 3QH2A 2J9XA 2DZUA 4JTTA 3VE9A 2XFWA 3C2EA 4O54A 5FF3A 3F03K 1EP2A 3G1AA 4HPJA 4IX0A 3P82A 4O10A 3L0KA 4R33A 3FKRA 1JUKA 2VFGA 2NXHA 4CCDA 2Y6ZA 4RV8A 4BK9A 1LRNA 2B7NA 4DF1A 2NUYA 3CQ0A 2H6RA 2WNQA 2PRLA 4O11A 5CPNA 4O52A 4ZQNA 2Q8LA 3T78A 3RU6A 2QUVA 1K7EA 4JY8A 2YPIA 2V82A 4EF9A 3B06A 4FX7A 3P8IA 4IMCA 1L2UA 3NEVA 2A21A 4FB7A 1WV2A 3BGJA 4ZQRA 1QPNA 3UQNA 1VYPX 3TSMA 3EB2A 4NJKA 4TU1A 1PE1A 4AF0A 5HULA 2NUWA 1LORA 2Y7DA 2VC6A 5K9XA 4UTTC 2V81A 4AHPA 5CPOA 5CPMA 5G1YA 3M5YA 1BWKA 3QSTA 2Y7EA 4AWTA 3W72A 5D2TA 2X2GA 5LGXA 1WYIA 3PBUA 2BXVA 1FQ0A 3L66A 4O1CA 2V5LA 2W0UA 4IMDA 1HFBA 3TA6A 5H2ZA 1WAUA 2J27A 3C8FA 1PHWA 2OT1A 4O0KA 3PG8A 4OE7A 4HT3A 1C9DA 4BWLC 1FY6A 3DFPA 4PL1A 4RR4A 3UY8A 2I1OA 3DKJA 4TR9A 3LV5A 1FUYA 2C19A 4KFPA 3BARA 3PWAA 1WOAA 1XDLA 4FNRA 3G1HA 3GDMA 2A4AA 3N34A 1G7UA 3CHVA 1K7XA 1W3NA 3KRZA 2R8WA 4NXKA 1D9EA 4JN6A 1XC4A 3O63A 2B7PA 1G4SA 1HL2A 1VCGA 4HSOA 3CB8A 3P60A 3NPVA 2B7OA 5KSWA 3B8DA 1GVFA 1IXOA 1O95A 1GQNA 3NL3A 4UFLA 4QQ3A 1KTBA 3B0VC 3PR2A 2WKJA 3P8JA 4MFDA 2CLMA 3MHGA 4UTHA 2CLHA 4N2YA 1F2JA 3HGJA 3QM3A 1TB3A 2H3DA 1OG0A 4UFJA 3HGOA 4MIMA 3WK0A 1S5WA 1WOBA 3W85A 1QPOA 1K02A 2YZRA 3QQ1A 4WY0F 5EA9A 3FOKA 2VXNA 2I14A 3SY5A 1XL9A 3EXTA 1TMHA 3S5OA 1A50A 2A7PA 3MUXA 4PEKA 1ICSA 1DORA 2ATMA 3EKZA 1O5KA 1H7OA 3O8AA 4A29A 5DCBA 3DH7A 3ZFHA 2ISSA 3TSDA 1D3HA 1TV7A 3I6RA 1AL8A 4RCXA 3NR0A 4OV9A 2ISVA 3G1DA 4FNPA 3NG3A 4Y9AA 5AYXA 3MYPA 3N14A 1YPIA 4O19A 4O1BA 2A85A 3N9RA 3CC1A 4IGHA 1GWJA 1NFBA 4JIQA 1WXJA 1N8FA 4LS0A 5HMSA 3NXFA 3GIYA 3N2MA 5FF4A 2E5DA 2PCQA 4NZJA 2QAPA 2E68A 5BMWA 3GX9A 1UBSA 4O53A 2P0OA 4PODA 5G1TA 4LVDA 1QCWA 5BMXA 4Q33A 4DBDA 3W7NA 4E2BA 4YL2A 1K8ZA 4UCGA 3CPRA 3H55A 4FIQA 3W2NA 1YXCA 2B4GA 4Z1DA 3EWZA 1VLWA 3STCA 3CEPA 2QCDA 3S42A 2YGYA 2FLIA 5CSSA 4X9SA 2EPHA 2ZZ2A 2EKCA 2NWRA 1KFEA 4OGZA 3KAOA 3UXDA 4OQVA 4KKXA 2CZEA 1UB3A 3O6CA 4AVFA 2QJIA 2ZRWA 1LBLA 3ELFA 4RKAA 4WZHA 3GDRA 1PVNA 3PY2A 2OX1A 2ZZ3A 4XWUA 2QCMA 4FO4A 4O28A 4O50A 4LWWA 1VLIA 3P5YA 5I3JA 1W3IA 2GQ8A 1ZALA 4YWIA 2V2DA 4KFOA 1V5XA 2XN2A 4MLRA 2WSQA 3W88A 4PH6A 1NSJA 2HTMA 1OJXA 1T8XA 2C3ZA 4I9AA 4P61A 1SQ7A 2HMCA 4JTEA 3W76A 2V2HA 1TRDA 5K3VA 3SZ8A 4AHQA 3LM7A 1M7PA 4JS3A 4O4WA 2WSRA 3UYCA 4MLJA 1JRBA 5LKYA 3C61A 2EF9A 4GRSA 2A6NA 3WFAA 1GYNA 3OA3A 3F1QA 5LNSA 1OVDA 1QR7A 2AQWA 3DAQA 3YPIA 5D32A 1W8SA 5L9FA 3P84A 2O7SA 1EUNA 4KWVA 3NPWA 4TIMA 3TJXA 2G97A 2DJXA 2FPYA 3HQ1A 1Q6QA 4LRTA 4IUOA 3ABQA 2FPVA 4ZQOA 1FDJA 4JX6A 3TFCA 3LLFA 3NQEA 1Z48A 3TW7A 3TAOA 3W1UA
chains in the Genus database with same CATH superfamily
2QAFA 1DHPA 3GUGA 1K9DA 4NAFA 4I5RA 3MMDA 2ZXAA 3B8TA 3Q67A 4ZB5A 3RITA 3S2LA 3AISA 1AH4A 4Y2WA 1D7KA 3UWUA 3IK4A 2E9BA 2V68A 4GX9A 1Q63A 1E0WA 3FEMA 2RFGA 3VMNA 4C6KA 2PRHA 4O17A 3WNMA 1KB3A 1Q8AA 1ZJIA 4CN4A 3F4VA 3ATYA 2D69A 2E6FA 3GTHA 3S9ZA 1TCMA 4MVAA 3ITGA 2WZIA 4Q22A 1US3A 2AAMA 2BV9A 3LI1A 1EUAA 3RU8X 4K1GA 3FXYA 1O6IA 4CQDA 4EIVA 3NQ7A 3UPWA 2WK2A 4RXFA 3GYEA 1R5YA 2V5JA 2VFIA 2OZ3A 1YYAA 3DG7A 3OLDA 3HPAA 2FZ9A 2P3EA 3UJEA 3HMJG 2ISWA 3TN5A 3LPPA 1VFUA 4GHRA 1EQCA 1W1B1 1REQB 1UD4A 2CCRA 1UWAA 1J96A 4RW5A 1VKFA 2DZTA 4J5NA 4B90A 4ZR8A 3E5BA 4AC1X 3STEA 2XFRA 4JQ1A 4GNKB 3SO7A 3W2JA 2GGGA 2BHYA 6XIAA 2YDSA 5XIAA 2UY5A 4HNVA 3A22A 5LXEA 5E93A 2VC5A 3TN6A 4PUKA 2NQ5A 3EXRA 4GUFA 1O12A 1I4NA 2VENA 4DUWA 3EAUA 4UMBA 2ZRVA 1O68A 2EBNA 4LX4A 3FGCA 5FJUA 2FVLA 4AMCA 1NDYA 4OUIA 1ONXA 3UWVA 4X2RA 2V3GA 2PDNA 1QBBA 1LZOA 3VZZA 4NX0A 4DPQA 5KMYA 4PA8A 1IV8A 3B8UA 1CXIA 2C16A 1ONRA 4K38A 3CUHA 2ZBTA 1B5TA 4LC6A 2XIBA 4IGMA 1X96A 3GDLA 3TAKA 1NM9A 1A49A 4FNQA 5AB3A 3IJ6A 1RK5A 4LV9A 4MJ4A 2X0HA 4FNUA 1GQLA 3APYA 3MCOA 3NXLA 1IXPA 4GJIA 4WJXA 4QRNA 2PGWA 4PUNA 4DIAA 3I4KA 3W02A 3T2PA 1KFWA 1KXTA 3KVJA 4XB3A 3W71A 2R14A 2CYGA 4C65A 1VPXA 1NTHA 1H5YA 4IICA 2PURA 2YB4A 4GYPA 2CZDA 4TV5A 4YMZA 1QNOA 1UWRA 4U4MA 5BOFA 4NRRA 4GNJA 4BFAA 1E1EA 3RNDA 1GKRA 1C9WA 3CEUA 1TZ7A 1ZTVA 1M5WA 3T2QA 1K4GA 2UWFA 1VGAA 5E6ZA 3WQCA 3K8KA 1BSLA 1E6QM 4WUIA 5EB8A 1FHVA 5A8PA 2DZVA 4RX0A 5FAJA 4HGXA 4J28A 3UR7A 1ZJAA 3TTQA 3W9ZA 3OEXA 1EIBA 3QN3A 4LAUA 4GI6A 1XCWA 3IACA 4HIBA 4D6DA 3UD6A 5ABFA 1EO5A 5BRPA 1X38A 3AO0A 4LNCA 4KIEA 4A3QA 4BI7A 1HKWA 4WKAA 4XSMA 3N18A 2W27A 1FWSA 2QUTA 3THQA 5ECUA 5SWUA 1FWEC 2P53A 4H9UA 4JTFA 4AD4A 1EH9A 3K8LA 1Z44A 3WMLA 3T0TA 3DBPA 4GFSA 1DIKA 4GH1A 2J13A 1H63A 1ME7A 3O6YX 4S1FA 4JNYA 2QULA 4D8ZA 3ZR6A 3GG1A 3S2MA 2YL9A 2ZXQA 2ON3A 3KVMA 4IUGA 1Y0EA 3R6IA 3SN4A 3WLIA 1WUFA 2FMOA 3L5LA 4FI4A 5F7UA 3VNJA 1QI2A 4UTIA 4C6EA 4IIEA 3M44A 2Q8XA 3GAYA 4FZIA 3L67A 2PP3A 3LU2A 3SURA 4S3FA 4ATWA 3VUPA 4R53A 1JF6A 2QYGA 1FCBA 1VBRA 4OWGA 3WF3A 1UR4A 4LVGA 4ZQCA 5TAOA 1YNQA 4MFEA 3AU6A 1XFCA 1BTMA 4JQ4A 1J11A 4ILSA 4QS5A 3OBAA 4IT1A 3TSBA 2OSXA 1FVPA 3NL5A 2FZDA 2J79A 3W83A 1ZL1A 4WXZA 4HMEA 5LIWX 2E7FA 5DANA 2X1TA 3S1GA 4HHMA 1B31A 3FHAA 1RK6A 1UPPA 3T09A 5D02A 2D20A 3BL3A 2QMJA 4GABA 4Z0JA 5DQPA 2WO5A 5HQMA 4W84A 5FESA 2QCHA 3SFWA 1XLGA 3IPWA 1KTCA 2WM1A 2O9RA 3VM5A 2JFEX 3FFSA 1E9ZB 1EJTC 3DIPA 3GWQA 2BVWA 2HNHA 1SJDA 4F0LA 3ZM8A 4LY8A 1K8YA 2PWGA 4GYKA 4DLMA 3HPSA 5CGTA 4Q7IA 1XI3A 1W3LA 4GMEA 3LB0A 1UYQA 1XRTA 1H0IA 5A6KA 1R2SA 2VT0A 2ZZ6A 2CLEA 2D23A 3GTIA 3UWWA 4Q4KA 3FX4A 6ALDA 2OKOA 3OLIA 4AZ5A 4MWAE 3U2OA 4GJJA 3DN5A 3GFYA 2PZNA 5E70A 4AG0A 3C8NA 3UEQA 1AJ2A 3IJ8A 5C54A 1T5AA 1BG9A 4GC4A 1DWGM 2C1GA 4DAIA 5C0QA 2FZNA 2G3JA 4PC8A 3DFOA 3WNOA 4IQDA 3VGBA 1SZEA 3WD2A 2JBMA 5DMNA 4LS2A 4KERA 2FDMA 4GGBA 3Q4DA 4GNVA 3T0CA 4HZMA 1EJRC 4AZ6A 4WKHA 4D72A 2PDFA 1R87A 1EEXA 4BKNA 4W93A 3HPZA 1AW1A 3B05A 1KQYA 2R82A 1F5ZA 2RGMA 5LHEA 4AQLA 3SCTA 3T2OA 2Y61A 3EEZA 4NILA 1H1YA 5FF7A 4KIRA 1OX6A 3T07A 1T8QA 3TYDA 1AQFA 2Q3OA 1NELA 4K7YA 4I90A 4C6PA 3I65A 4HOZA 3UCDA 3TC7A 4Q6XA 1I0BA 1X1NA 2EEXA 5LIYX 3S1WA 2DU2A 2WHJA 1QHOA 3EWYA 2R9RA 5LIKX 3P93A 1YBQA 1RALA 3WCZA 1E55A 5DCEA 3W1XA 2WV8A 3QJAA 1PKNA 2ZUVA 2Z1XA 1VPYA 3M64A 4DJED 3D47A 4CVUA 5I03A 4G1KA 1ODUA 2E6DA 2WMHA 1Q3NA 2PP0A 1K9FA 1H4PA 4I8YA 4J2MA 4GXMA 4ZL1A 4R34A 3L4TA 2VEKA 4CD7A 1EC7A 1J0HA 3H2AA 1X6UA 1QDSA 4HHPA 3EXSA 3EOEA 4PCSA 4MOZA 3C2RA 1E4MM 4EXBA 3E02A 1I1WA 2NX9A 1ZJHA 2G4JA 3N6JA 4NU7A 4MZ1A 4WVXA 3MYOA 1BAGA 1FXQA 4RDVA 2AL2A 6A3HA 1S1PA 3U2CA 1ZZMA 4BHYA 4GGHA 3KLLA 4L4OA 4MMWA 2PLJA 5AC8A 3GY1A 3LBOA 3CL6A 3CMGA 1NY1A 1XKYA 2OYMA 1QI3A 1SJBA 2EAWA 3ZO9A 2OWXA 1YDYA 3EWWA 5KEZA 4GIYA 2IKJA 3C0QA 4U2ZA 1UA3A 3OZMA 3MQTA 1BGAA 2QCDB 2GJNA 1E6ZA 3U5UA 1EJVC 3GHTA 3UCCA 2WC7A 3LCIA 3C86A 1JCMP 5A8NA 1BQCA 1XD0A 3ARRA 2DV0A 1EBHA 3T4WA 4OFCA 4RZ4A 3NGFA 2R6OA 4X2PA 2DVTA 3WH6A 4CNUA 4CCZA 4FLRA 2PGRA 4IP4A 2DZBA 4GXWA 1E9YB 3C52A 2BOFX 3KS6A 4GUHA 3THDA 1AFSA 1ZQ5A 4AWEA 3V75A 4QE5A 3E9AA 1NEYA 3WF4A 1MEWA 1KRBC 5JXQA 3EKLA 4A05A 3SGUA 4A35A 3WX7A 5D04C 4PFMA 1ME8A 3SN0A 1FBAA 4ZTYA 5K4ZA 1KXHA 2XM2A 3IVSA 7REQB 5CAHA 3N04A 1IT8A 4JX4A 3OHMB 3WBXA 1SZNA 1AD1A 2ACSA 4CQ9A 2OWWA 3R1ZA 3KLKA 3VIGA 5C2XA 2GJXA 1GVOA 4LPCA 3TCEA 1DPMA 3IGUA 4DZ5A 3ARPA 1O66A 1TIWA 3O0KA 4R88A 3PF3A 2E8ZA 4EPDC 1V51A 1LLZA 3QHNA 3DU0A 3MP3A 1XCFA 1XBXA 2PD5A 3R5EA 3BAXA 5BWAA 1GCYA 1S2WA 3WF0A 3I3DA 2DUZA 4XZIA 3HFYA 2DZPA 4C6LA 1U2YA 1XBVA 4Q3MA 1LOLA 3CIWA 1E72M 2ICSA 4DO7A 4ROPA 3IIVA 3HBLA 3TH6A 1GOWA 4GBUA 2PWEA 1BD0A 1CEOA 1SFLA 3P74A 1V3MA 4K2SA 1GJPA 3GFZA 3SUVA 3SR7A 4WK9A 1Q85A 1XIEA 3TDFA 4IP5A 3W2LA 4MM1A 2QDEA 3ARSA 4XZLX 3N4AA 1UMYA 1UCWA 2BVDA 3MPGA 5CC3A 4PN2A 1BXBA 3WO8A 1X1OA 1HVXA 3K46A 1UZ1A 1W5NA 5MHBA 3GUWA 5AHMA 5T9BG 5D03A 3SM0A 3MMTA 3TQ0A 3N1AA 3VNDA 3WFZA 3CV2A 1E0UA 1FHDA 3DFQA 1UWUA 3A47A 1Q6CA 1JPIA 2NW0A 1ENUA 1PEZA 3IEBA 1KM5A 1P4CA 5HNNA 1PIGA 2X09A 4L56A 1A5AA 3E96A 3WDRA 3WLLA 4N9EA 4KEVA 1W32A 2IMRA 3ONBA 1VFMA 2NVCA 1D8CA 1E4IA 1TJ1A 2VZOA 3NSNA 1WZKA 2RDUA 4P5UA 5D2XA 3FGCB 3G0XA 5C71A 1R9YA 1UKPA 2QVHA 3Q94A 1Z9AA 3LN3A 2BY3A 3M0YA 1GG1A 3F2CA 1J10A 1IIGA 3GS6A 2Z00A 3OZYA 5REQA 1TVPA 4QJ4B 1U30A 1KGUA 5CGQA 2OZTA 4CCEA 4DF2A 4OT7A 4W8BA 4DBUA 3GXTA 1VYRA 4LUSA 2NT1A 3PJXA 3S5YA 2A0NA 3KX6A 1LRQA 1XFBA 3H6OA 1A5SA 1ZU8A 1PIFA 2XU2A 5LNRA 3H7VA 1I6NA 3ZXWA 3B8WA 1PBGA 3NZGA 3W53A 4FF7A 2ZICA 2OZ0A 1VEMA 5GQBA 3WQEA 1B4KA 5HNRA 5DN1A 5F1VA 4F0RA 1ZP3A 3SDOA 8XIMA 5DMYA 3OHIA 1MDLA 5C8BB 3B03A 2BSLA 2J47A 1SO4A 4CNTA 5CZSA 3PULA 1UKQA 3AXKA 3W1NA 4GCAA 5CZ0A 2GGEA 4L6HA 1R46A 1RVKA 2G37A 1C91A 3G5EA 2POTA 5G1MA 4YYFA 1OY0A 1NJJA 3WNNA 2TRSA 1IGWA 4MJMA 4ASTA 3KL5A 3E5PA 2J24A 3T40A 3GR8A 3EWBX 5K2ZA 3BAIA 1CT5A 3IVTA 2DSWA 3TX9A 4LUIA 4QDWA 4UTJA 2E5CA 1RBOB 2J25A 4Q8WA 2YCLB 3BCJA 4DEFA 1PCWA 3H23A 3BSGA 4IIDA 3O1NA 3P80A 1RLCL 2D2JA 1J5SA 2XIIA 5H6HA 3W7DA 4D71A 1VFLA 3IIZA 3TCSA 1L6GA 4C6IA 1HKIA 4YCPA 1J0YA 1C90A 4BI6A 4CN6A 2HE8A 1KA9F 4D6FA 4AZHA 1RP8A 2XWEA 3M41A 1ITXA 5ABFB 4S38A 2ANUA 3LXAA 1P7TA 2XZ9A 2OQYA 1OFOA 1GYMA 4JKLA 5G4EA 5C2GA 3RJXA 3VKBA 1YTDA 4B5UA 4E38A 3WH7A 2DSZA 1FCVA 3GNDA 3DHFA 4WRHA 4MWAC 1VRDA 3GRIA 4YTSA 3DENA 3GNOA 3QOKA 4IMAA 1XH1A 1O5QA 3MDUA 3EWXA 2NWSA 4AD5A 2OGJA 3T42A 3CT7A 4O13A 4K68A 4L61A 4JDYA 3QLLA 1J9YA 2ZA3A 3RCMA 4X0NA 5CJMA 3UZXA 2X42A 4MAZA 4MAVA 5DY3A 3Q65A 4UNKA 1T96A 3QY8A 3RR4A 2GSHA 4OBSA 4MJ2A 1UD5A 3VDCA 4M6UA 2WVUA 5HUPA 3H2EA 5KZDA 4DF0A 1WNOA 1TV3A 3O6DA 4XK2A 1KBBA 3G3DA 3AWNA 1MXDA 1XG4A 2C71A 2BX7A 2HXUA 3W2UA 3D6NA 5F2GA 1B1YA 1ZBWA 3TFXA 1U5HA 2OCZA 3K4AA 1XDMA 1AQHA 1WO2A 1R7OA 1YDVA 3MUAA 2F61A 4D9PA 3WJZA 1GOOA 1C92A 3PM6A 1X7FA 3DHDA 1NDVA 4Y8FA 4QE1A 2GGHA 1DHKA 5A6LA 2XFFA 1WKEA 4Q4QA 3B4YA 4P8VA 2VC7A 1KTNA 2QCLA 3E74A 3IS4A 4M1RA 3DEQA 2ABAA 5AHNA 2Q8ZA 3TROA 3W75A 3JZUA 3WBWA 3S83A 2YX0A 4Z1CA 3GXPA 5J5DA 3UYIA 3A23A 1ISYA 1EDQA 2YCKX 4ONVA 3LHUA 4XZBA 1OX4A 1EC8A 3P7YA 4AB4A 2PLCA 5A6JA 3W4RA 1CWYA 4AZ7A 3FLUA 4NKCA 3AMDA 4TV6A 4H9VA 1MZRA 1Q6OA 4H6KA 1G0CA 2OQHA 1YTKA 3JU2A 1OGSA 3QR1A 4X61A 3VYLA 1B9BA 4CQ8A 2PWUA 2Q01A 3QC0A 2W3ZA 3U2EA 2WHMA 3GQYA 2WHLA 4QCFA 5I09A 4JTQA 2D2OA 3LRMA 2P5NA 3REQA 3WDPP 1VBGA 4AIBA 2QUMA 1VJIA 3VKJA 1P43A 1SW3A 3NDYA 4YCOA 3DGRA 4IF2A 3CMJA 3FYYA 4Q32A 1SMAA 2W6RA 1OFBA 4JTIA 1SUXA 4IPNB 1RVGA 3K30A 2Z7GA 4DUOA 4HCHA 2OFJA 3EB4A 1EZWA 3R8GA 3BXWA 3QY6A 4JL2A 2XSXA 1XIIA 4TVUA 4W89A 7PTDA 3PBGA 5CPLA 3TOPA 5A6MA 1WKFA 4XD6A 3R8HA 3UWYA 2QZRA 1NVMA 1V6VA 4ZQPA 5T91A 1TTIA 1V3HA 3M7SA 3UXAA 1UUQA 4UTWC 4CD6A 5E0KA 2ZZ5A 3I6TA 2I5IA 2ZC8A 1IEQA 2EG8A 2BVYA 5FAGA 2OVLA 5DLCA 3WQ5A 4V33A 4R7JA 1PDZA 4KETA 3RO6A 2W91A 4O1DA 3AXXA 2P10A 1OK4A 4ZXLA 1XLFA 3QZEA 1G7VA 3B9DA 4QCEA 3BW3A 5BXSA 3VM7A 1Q4WA 3F5JA 1LQAA 3WMCA 3WUFA 3TR9A 1W8GA 1GZGA 3P81A 1BHGA 4IMFA 3LBMA 2GDQA 3MA8A 3KZPA 1NH6A 1YBQB 4A2RA 3V7PA 1EOKA 4RUBA 2J8TA 3C5QA 1JXKA 2VX4A 3S1XA 3RMJA 1JI2A 4F8XA 4AMAA 3MCNA 3A5FA 3UJ2A 2G4FA 1W1A1 3GO2A 4MB5A 4M8UA 1Z41A 1IEIA 3TYUA 1N8IA 1D2KA 1JULA 4MWAD 2VO5A 3W84A 1PS9A 4EPBC 1JEZA 2UZ9A 2CXEA 4LOCA 2VOMA 3M1ZA 5F4XA 2NT0A 1DYSA 1IXNA 2AMXA 2IPJA 1FKWA 2AL2B 3W70A 1B3WA 2O9OA 4DLFA 2XGBA 3UA3A 3D0CA 3CS2A 3BW4A 5GNZA 4N6EA 3DFSA 1FH9A 1W9PA 3V18A 1DJWA 4KT2A 2EPMX 3O6AA 3BAJA 3HQNA 1F61A 1KFCA 3RRAA 4L1XA 3AIUA 2HVOA 4BCEA 5ECVA 2Z6IA 3ZMRA 4B5XA 2ZA1A 1WDQA 2Z0IA 4R85A 4AUBA 1JZ7A 1OABA 3MZNA 1EIXA 1PYFA 3RIKA 1M3UA 3EDKA 3QHMA 3DUGA 2XFWA 5LA0A 1XCXA 3F03K 3P82A 1WXYA 4YS1A 4CCDA 2Y6ZA 3AZTA 4NASA 4RV8A 5I7GA 3BURA 1UIOA 4DF1A 2V6AA 2Z1SA 4MDPA 1UR0A 8XIAA 4FXJA 1JXJA 1WDDA 5CPNA 1DWJM 2QUVA 4B9YA 3GH5A 4ACZA 2OGYA 3HA1A 5EMYA 4ATLA 3OW1A 3VOGA 3B06A 1L2UA 2PBOA 3NEVA 3IV8A 3BLLA 2ZX5A 4JIHA 4ZQRA 5FACA 5J04A 2FTWA 2HBXA 3NO1A 3RJYA 1TVNA 4H19A 4AF0A 2BGSA 3WELA 3ARUA 3UPMA 5HULA 2VC6A 1Q8JA 2V81A 1PJ9A 5CPOA 1MNZA 1BWKA 1PX3A 2P50A 4LCSA 4B5WA 1RBLA 1A5KC 2Y7EA 4AWTA 4OTKA 1R3RA 1FH7A 2GJXB 3RO8A 1R9XA 1WYIA 1Y5WA 1FQ0A 2VWSA 4R7OA 4O1CA 1JL8A 1HFBA 3TA6A 1IHIA 4AIUA 3WFLA 2VDGA 1RAKA 2R1LA 3SUTA 2Z28A 3UCQA 1FY6A 4PUJA 4RR4A 4PL1A 3SB0A 3DKJA 4TR9A 3THCA 4A8RA 4ES4A 1GK8A 3PWAA 4Z2JA 4M1BA 1UA7A 2XG9A 5IRPA 4JN6A 4J3SA 1HL2A 4HSOA 3CB8A 2J66A 3P60A 3DECA 3FJNA 2HK1A 2B7OA 1GVFA 3E1F1 1O95A 4UFLA 2Y5SA 3QPEA 4INFA 3B0VC 3P8JA 4QDMA 3KCLA 1WZAA 3MTWA 1AMYA 1TB3A 4G9PA 1I75A 2H3DA 2XTKA 3EOOA 4HJFA 3HGOA 4MIMA 4ERIA 1MDRA 1WOBA 1E6XM 4WY0F 3SY5A 1QNRA 4AIOA 1A50A 4LBRA 3MUXA 4XZHA 2F2HA 1DORA 4LGXA 2ATMA 3O8AA 1HJVA 4W86A 3HJEA 4AY8A 1ONWA 1TV7A 3DBNA 4GKTA 4RCXA 4OV9A 3RG6A 3G1DA 4L65A 4Y9AA 1PSCA 4O19A 1YPIA 4YIWA 3LUTA 2OX4A 2CC0A 2YJQA 1WXJA 4G2DA 3CZLA 3R0UA 3AS2A 1VFTA 3NXFA 2XPKA 1S5MA 3N2MA 4JAWA 4NZJA 2QAPA 2E68A 4HHLA 4O53A 2P0OA 4PODA 4LVDA 5BMXA 1TJ2A 4E2BA 2XJ7A 1K8ZA 5FL1A 3PPCA 3TWAA 4Q8QA 3W2NA 2Z27A 4S39A 2WSPA 3S42A 4FXFA 4UR9A 3WEZA 4IIBA 1VFOA 4J40A 1BVNP 4OQVA 1OC7A 2CZEA 1FKXA 1UB3A 1GVEA 1QW9A 2QJIA 1LBLA 1OT2A 2GYIA 3GDRA 2Z1KA 1PVNA 4ML4A 5I06A 5REQB 3HTWA 2IUZA 2WLZA 4FO4A 5CSYA 4HNCA 1VLIA 1W3IA 1UC4A 2GQ8A 3PPFA 4LUSB 4HPHA 1V5XA 2XN2A 1RJPA 4MLRA 2MANA 2WSQA 3UFYA 1NSJA 2DW6A 1OJXA 1EA9C 4I9AA 4BY3A 3BSMA 1SQ7A 1TRDA 3UYCA 4IGSA 1SJAA 4MLJA 1KC7A 4DBWA 4GD0A 3PK7A 3F1QA 5C9ZA 1VPQA 3L12A 3PTQA 4OJYA 3BCFA 3ZVHB 3DAQA 3YPIA 2FKPA 5L9FA 2QV5A 2O7SA 1WDPA 4DX3A 4KWVA 3ME3A 3VKDA 4RZBA 2AGTA 1BYCA 4L80A 6REQB 3AYRA 1RHCA 3HQ1A 3N6QA 3AUOA 3GBDA 4AY7A 3UJSA 4ZQOA 3G1RA 4DWSB 2QF8A 1YE6A 1B90A 2INZA 4AISA 1MQRA 1XXXA 4LC8A 2YBUA 2PDCA 4F40A 4FR1A 2EGZA 3ALFA 1J8VA 1OYCA 4RLIA 3BC9A 1U5VA 3TLQA 5A6BD 2QCEA 4C6JA 1JAKA 4JEJA 4IIFA 4W88A 4HNUA 2V9DA 3WLSA 3N3MA 4BF5A 1YKWA 1MW2A 1WPCA 3NQ6A 2WVVA 3GZAA 3IUIA 3M6DA 1KLZA 5BCAA 5E6YA 4PCTA 4GI9A 3DX5A 2QCNA 3WK1A 5JVLA 2E1DA 1L6FA 2ALRA 4P8WA 4JTKA 3LBCA 5D9MA 3OG3A 3W73A 5TBOA 2WZHA 1L8PA 5CZJA 5FOOA 2X40A 1ZP4A 1WB0A 4GQRA 1NF7A 3NZRA 4EF8A 2GJLA 2QDGA 5A8QA 1H2JA 2F38A 5CQ1A 4PE8A 3W22A 3CQJA 3VMPA 3NAVA 2GFTA 4A3HA 4LEFA 3M0VA 2ZYFA 1CXFA 2ATSA 3O05A 4H9YA 4PMRA 4UFHA 1N7KA 2I9UA 1B9ZA 4JOMA 1O5XA 2TYSA 3PWGA 4H8HA 5CG0A 1EGMA 1J01A 1LLOA 3L2IA 5CPQA 1ZS2A 2WCSA 2GUUA 1QOQA 4L9YA 3QBUA 4LAMA 4IIHA 4JGDA 5I3KA 4ERGA 4PBFA 1RY8A 1C8XA 1GW1A 3ZSTA 4XSLA 4IG2A 1TSIA 1KV5A 4EPEC 4MB1A 5D09A 3PB0A 4V15A 5HANA 2Y5JA 1BG4A 1EEPA 4WDWA 2ZKMX 3NYZA 5DCDA 3GTNA 3VXGA 5B7YA 3KBSA 3VNLA 1OD8A 2YBVA 1YRRA 2QEZA 1QTWA 4M19A 3H2OA 3V36A 2BMBA 3LZ5A 1UWTA 2WCAA 1L2QA 1V8EA 3VZYA 3FY1A 3G24A 1ECQA 4BJHA 3A5VA 1KWGA 2EG7A 2D2GA 3WJSA 3OYZA 5HPCA 4IQEA 4K6AA 4KCWA 2VEIA 5JBFA 3K1DA 1K7FA 4WY0B 1H49A 1A5OC 3TYCA 2GWGA 2J7GA 3SBFA 1IR1A 1JQXA 1PKLA 2ZE3A 2WYSA 3AC0A 2DSUA 4N9BA 4O8AA 4GC3A 4NY2A 3LS9A 1G6CA 3CPGA 4Q8VA 4Q4PA 3UGVA 3FHQA 4KBXA 4TMBA 1R8LA 4UQBA 1JCJA 1R3QA 2ZWZA 4H3DA 5F2IA 3EEGA 2FH8A 3UT0A 1QO5A 1X98A 2FFIA 2DVXA 3LD5A 4JEQA 4F66A 3RCNA 2PDPA 5BRQA 5HNUA 1GTEA 5K9DA 4FOJA 1LDCA 5MKGA 2Q02A 4KWUA 3W25A 1SR0A 3KRBA 2VEFA 4K1WA 1F6YA 4ZE4A 3ITXA 2ZXBA 1FWIC 4HSNA 1KQZA 1XIJA 1VHCA 2WNWA 3VX1A 3QQ0A 3A4WA 2OMAA 2ZUTA 3NCOA 4H8VA 3AU2A 1P6WA 4DO4A 1QAPA 4B2DD 1R86A 1Q6RA 2HSAA 4A6GA 5HWJA 1TA3A 1XGDA 3AHZA 3WUBA 4PEEA 3S5SA 5ABHA 5BXTA 2X7VA 4GYPC 3ID7A 2OEKA 1O5RA 1RD6A 1LBFA 1W56A 5AC4A 4ZVJA 1W31A 3UGRA 4PRRA 3UBPC 2J7DA 3BG9A 1ALDA 2WW5A 3OP2A 2ZZ1A 1MMFA 3MWAA 4F3HA 4O15A 2UBPC 3QV6A 1LWIA 3EMZA 4W85A 3LCGA 1RJQA 4DRSA 1XPYA 4LU0A 4QR6A 3CTTA 1MFUA 2C0HA 1YPXA 3KTXA 4BS0A 4NZ1A 1GPWA 2QT3A 2XDFA 3WZ0E 2YL6A 5DT5A 1XYAA 2ZRZA 3CHFA 3MP5A 2O4QA 3APGA 1AZ1A 4XAZA 1BQGA 1Z69A 4JN7A 1VFFA 4D6GA 2ZRYA 4ZEPA 3R2GA 3SIZA 3V0SA 3C0JA 3NQDA 2ZUSA 1UH2A 2VM8A 4GA8A 2ZDRA 5JH1A 3LPOA 4UOJA 4ZOEA 3VNYA 2YIHA 3M0KA 4JHOA 3S6TA 1HJUA 3GXIA 4KGLA 4KEUA 2HJPA 3RN6A 2VZSA 1AW5A 2E5BA 3RLHA 3VTRA 1BWLA 2C91A 4WQ6A 3PZOA 4KF1A 3LTSA 1XLIA 3QMRA 2UV8G 2VGBA 3VUSA 3EOUA 4UCFA 4L64A 4YN5A 3A3XA 4QLKA 3CO8A 4NJHA 1TQJA 3NOEA 3S9YA 5C9XA 2LLEA 4DYJA 1ITUA 2BHZA 3MZ2A 2QLYA 5EL1A 4O0ZA 5CLWA 4S3AA 1ZLPA 2XM1A 1QK2A 3GTXA 1IEWA 2FVMA 2YDAA 1EXBA 3CWOX 3GZ3A 4GY7A 4RNJA 3QY7A 5LSMA 2XFYA 3OBEA 4RW3A 4OBRA 1Q5MA 3CL8A 4E4PA 3E2RA 1CGXA 1OEPA 3GHRA 4JICA 4E8CA 5C70A 2GPTA 3KE0A 4UQ9A 5CC6A 3SRFA 4H7ZA 2BGQA 2IS7A 5KZ6A 4NIRA 2PAJA 2QJHA 3TJLA 4GYFA 5GJPA 1MRAA 4UR7A 3HGRA 3P61A 2F7FA 4EXAA 1TZZA 1HX0A 2QR6A 3NQAA 4HMNA 3INPA 4JQAA 3BLKA 1P6BA 1NARA 1CXHA 1NIUA 3M0MA 3IJDA 4ACZB 1I8JA 3ITLA 3TTSA 2CBIA 3WENA 3IV3A 3KP0A 5J5RA 2VEMA 2CLLA 3EB3A 3B8IA 3KOZA 3I68A 4C6OA 1KCZA 3GAKA 3S6OA 4AF0B 2CHOA 2PDLA 1I1XA 2A3EA 3A3WA 3RR1A 1DQXA 4LUJA 2EQDA 1A5LC 1XICA 2W79A 4JQ2A 1XLKA 2VGGA 4UNLA 4V28A 5AZ0A 1TPUA 2XH0A 1J79A 2NLYA 2A3CA 5I0DA 4UFMA 4U28A 2DT3A 3SAZA 5I79A 4UB9A 3WJWA 5C55A 3BLOA 5GNYA 1GQJA 2Y8VA 4I8DA 2V0TA 4BF7A 1OIMA 1LLWA 4JR5A 4LUYA 1TKKA 4JYDA 1UJPA 2INEA 1HJWA 4AVNA 5CBBA 3N2CA 5G4HC 1LL6A 3S5NA 3W26A 4MDOA 5DRIA 1RA0A 4BQ5A 4E2VA 1HUVA 7XIMA 4RPQA 3M07A 4XZMX 1ZCOA 1E0VA 2FIQA 1GT8A 3HQPA 3CH0A 3CAVA 5AFDA 4AX6A 4A8IA 4KS0A 3G0UA 4NZ3A 2Q3RA 3OGVA 2VCCA 1XBZA 1NDWA 4B5NA 1AJZA 3VZXA 4ZXOA 3VINA 3E38A 3O2LA 1M04A 2O9TA 4IIGA 3WNKA 4ORMA 2PDHA 3WQFA 1DKWA 2RH9A 2EPLX 3SY8A 4DAFA 3MMUA 4LS1A 3VCNA 3O06A 1AL7A 1DXFA 2VDHA 4RL3A 3VGEA 2ZDSA 3VFLA 3AIEA 1A3XA 4XVDA 3KHJA 3CZEA 1OD0A 1Z6KA 5A6TC 2C18A 3ZJ7A 1Y5VA 2VR4A 2NUXA 1MXSA 1EPXA 1KM6A 2CW6A 5ABGA 1T41A 4UTWA 2WJDA 1QMLA 1T99A 1DWFM 4RE2A 5AYYA 2PDUA 4IP7A 4EVZA 1TX0A 4WDUA 3G8RA 2I5QA 4QJ3B 2P0IA 3R12A 4ICMA 2WANA 1V4YA 3T8QA 3AROA 1CGYA 1TG7A 2FGZA 4IL0A 3ES8A 3R89A 2O0TA 4ZO8A 4Z08A 4LUTA 1V6UA 4MZYA 4CD4A 1UHVA 3PJWA 4M6VA 4UQDA 1DV7A 1UOZA 4JFVA 3ZJKA 1GGOA 3W7PA 4FHAA 1IQ8A 2JKEA 4GVIA 2J74A 5FEXA 4AFYA 1LF1A 1F4HA 1QW8A 4XAGA 3AI0A 4PRWA 5LHFA 1KWKA 2BODX 2O7QA 1CLKA 4N42A 2DIEA 3H7UA 3GDKA 3M9YA 4MZ8A 3NSMA 2V2CA 5BW6A 3KVLA 2DZSA 3U6WA 1NWUA 3KWSA 3QYQA 2VVSA 1VJZA 2NQZA 3HIJA 1K03A 5KITA 3TJIA 1A53A 4J3XA 1X7IA 3W23A 5HJXA 4XIAA 3DXIA 1GVYA 1Z7AA 2CXGA 1GW9A 3SGZA 3TYZA 5IHRA 4YHGA 4CLMA 3OYXA 4JBRA 3KXQA 1ISXA 3PNZA 5HWMA 2OLSA 3AALA 1J5TA 3R0KA 2XN1A 3KM8A 4QAWA 2VQTA 4PMQA 4JNZA 3ITTA 3CUIA 4A4AA 1UJQA 5EMJA 4CNPA 4XZNX 3QGAC 1Y65A 2YR1A 3KBJA 1U1JA 4Y6GA 4ATDA 5JUVA 4C90A 1QO2A 2ZUNA 2A2IA 2WM0A 3B0UX 3KS5A 1IT0A 5EFDA 2P8BA 5FSDC 1S1RA 2YFOA 1IR2A 1IF2A 3L5MA 3QV9A 1XD1A 1Q7MA 2YA2A 5ABEA 2QPUA 4NYYA 3IANA 4IGNA 3CZKA 3QR0A 4WX2A 4AHOA 1GEHA 3NYDA 2Z1BA 1G4PA 4EOUA 3U0HA 5FJJA 4N4PA 5IFTA 3TU9A 1YADA 6PTDA 5HWNA 1OF8A 2L5HA 2ZE0A 3G2GA 4WLCA 1OF6A 3NVDA 5D8ZA 2E9MA 2EJAA 3HMCA 4I7WA 2XVPA 2KX9A 4AZCA 1VZWA 2AL1A 3BV7A 1HO4A 1ZAJA 4I5UA 4YTRA 3TW9A 2GVGA 3MI6A 1EF2A 4P2VA 4MGGA 3W29A 4KGJA 3CL7A 4HU3A 5GPRA 3GTFA 5BYWA 3CV6A 3U48A 1TE6A 3AIWA 5C9RA 2G3MA 2YA1A 1J18A 4V2XA 3ANUA 3LCLA 2SFPA 4D6CA 3TQKA 1YQ2A 5FJPA 3LNPA 1NOUA 3GVRA 4FOUA 5I07A 2F9RA 1XSKA 3H4WA 2F2KA 3XIMA 2VHLA 2QDHA 1GJUA 1F8MA 4H8UA 2R24A 5FJRA 5M2FX 3DZ1A 5AYBA 4Z1BA 4GLEA 4JKMA 3W3OA 4JTUA 2AQVA 2GSEA 4NVTA 2FYMA 3EOSA 3AIVA 1QWKA 1JCXA 3HURA 2Y7FA 1PZ1A 4PTWA 1AK5A 4OOZA 3VPLA 3G22A 1DBTA 3I7RA 2EPOA 4IG2B 4NNCA 1U1UA 1T6MA 3I7QA 1BGGA 2ZX9A 1HG3A 1OWQA 5JBDA 1S46A 2FHCA 1UUOA 2NXIA 3HQOA 3W87A 1LCOA 5AZ1A 1YE4A 3CXOA 5HJLA 2E6YA 1V3JA 3W1AA 2JGQA 1IIHA 4PSPA 3AS0A 2WBGA 4PTXA 3GVQA 4C60A 1PX4A 3CIXA 3ITVA 5H8UA 3LSCA 1EFZA 1JFHA 1DJZA 1TQXA 2E9LA 1PDYA 2WAGA 1LOQA 3W1MA 4U10A 1JYWA 3ONCA 1KBKA 1M65A 3LPFA 2G5WA 1E6SM 3VC5A 3VGGA 1XYZA 1A47A 5EY5A 4I9JA 3QQWA 4Q4SA 1ZPTA 1H50A 4BQ3A 1S3HA 2JKAA 1WX0A 4GACA 4LEQA 3UG5A 2PI6A 1JD9A 3FSUA 2V63A 9RUBA 2CLFA 4EWND 2WMIA 1QOPA 2VX6A 4M6PA 1C29A 3F5KA 4AD1A 1WDSA 3DYMA 1CBGA 4WKFA 2ALDA 4B15A 5D8WA 1YDNA 1H5VA 3T6CA 2FJUB 3ARZA 1O7AA 4Q8TA 4WHBA 4LAKA 2BNJA 5MKGB 2YYUA 4F9JA 3RK8A 1W5OA 3BLEA 3S1UA 3G8EA 4CU8A 1L6WA 2IKGA 2NSOA 3L2LA 4QJ1A 4LH8A 3UZYA 4QITA 2CFFA 3NQ2A 4O1AA 2GVJA 3L9CA 4UFIA 5I3GA 3QF0A 1SFJA 5CKSA 3TLLA 1RD5A 5E5CA 5HNTA 2OJPA 4MNLA 4C6CA 2PSNA 1P48A 1TA3B 1SPQA 4JFTA 2W92A 1BLIA 1OFRA 3OJGA 3ZT7A 4XBKA 1VFHA 3OU8A 3MUY1 3P14A 1HF6A 5F1UA 3VD9A 4DWSC 3BGAA 4W5ZA 5AC5A 3NM1A 4CUCA 4WGHA 3RPTA 1XLMA 3WMBA 3DFNA 2OO6A 1FTXA 1UOKA 4GO9A 1H1ZA 2GWNA 4F0SA 1LM1A 1VD6A 4PUEA 4FLQA 2CZ5A 1IWBA 3V0UA 5IDZA 3APTA 4UXDA 5I3FA 4AZBA 2VELA 3PAOA 1BF2A 5H91A 3SCNA 3CBWA 3PTDA 3A4AA 2IKIA 3EOLA 4CKQA 1NOFA 3CZGA 3VKCA 4GIEA 4UQAA 3NQFA 1B3ZA 3VDAA 1E0XA 1XS2A 3QV8A 4YHEA 3JS3A 3M5XA 1C7TA 1IGSA 2OYLA 3GNRA 1ML1A 4FLSA 3VIMA 3E6EA 4K8HA 1OFQA 1UBPC 1EP3A 1KBJA 3NO3A 4H9TA 5DXYA 3W0KA 3UNDA 3NQBA 3HFTA 4C7GA 4O1FA 4NHVA 1R3VA 1JDCA 3LV6A 4UWMA 1OBAA 4XZ9A 3S2JA 5FJTA 4LSBA 1UP3A 1GVIA 4CQAA 1A5UA 3LRKA 2A7NA 3N2XA 2X7WA 4Q4OA 3U5YA 4F0MA 3BVJA 4FIRA 3SQMA 2HPIA 1GOIA 4FR6A 3HG2A 3IK2A 1KFJA 1TRIA 4W9TA 3M5ZA 1BVZA 3GNXA 5BOEA 1V6TA 3PTMA 3CV1A 4O4VA 1A3HA 2I9EA 2IPWA 2PFHA 4ZE5A 2HZGA 1BYAA 3M0ZA 3FYOA 4RDYA 4HBKA 1YTEA 2P76A 2RJGA 1O94A 4LANA 3A4XA 3KOWA 1Z42A 3EPNA 1TZ9A 4DJDD 4H04A 4HK6A 2VI0A 3KBWA 4HD5A 1CTNA 3RLUA 3BPWA 4P7RA 3OZPA 4IZGA 3UVIA 5EMKA 2REQA 3E2SA 3QPZA 4LVFA 4AEEA 5IXEA 2XWDA 4ZO9A 3MSDA 3SW6A 1Z8AA 4ZA0A 3NIYA 4L4LA 3QLDA 3GBEA 3B0YA 5BROA 4PCPA 2ZUMA 3V0TA 2VUYA 3QMTA 2OB3A 2WPBA 1V77A 2VRJA 1UG6A 4EK7A 5CH9A 2D24A 3PUOA 5DMMA 4G6CA 2XZ7A 3BSHA 1HL8A 5KTLA 3IJQA 3URNA 1W5MA 4NNBA 2MUCA 4JTLA 4IPPA 4HPXA 4AY1A 3IAQA 3CTLA 5I2UA 2P1FA 3UPBA 3L4XA 3PC0A 1CGTA 5LNVA 1X97A 5LGZA 3WLMA 3PSWA 1B2YA 3F4WA 1QFEA 2E8YA 3NVTA 2RGLA 1FWBC 4ADSA 5TNVA 4F9DA 1UC5A 3NM3A 3N6HA 3OODA 7A3HA 4HP5A 3I6EA 5DBUA 1G67A 3DHUA 2A3AA 3FKKA 3TYEA 2CETA 2CLKA 4KFNA 3VIIA 3W7GA 4F4RA 3PJUA 4ICCX 2J7FA 1HO1A 1MQQA 2WMGA 1JPDX 3N25A 3BG3A 3RUBL 1O1HA 4B9ZA 4LFYA 1Y8BA 4IMGA 4J4KA 3VGHA 2GJPA 2ZRXA 4QNWA 5TF0A 1MQPA 2WJFA 4QLLA 1J0KA 2PRMA 1I2QA 1ZBVA 1WBHA 3PZUA 3RCYA 1FWTA 3B8VA 2DZXA 4H2CA 3K4WA 3SECA 3W1QA 1QK0A 1CB7B 2PTWA 2PBGA 3KOXA 3RHGA 2E77A 2CWNA 1S39A 1BF6A 3CQIA 3EMQA 3RM9A 3BICA 1C7SA 2A7RA 2OU4A 1VBUA 3IIXA 5D38A 1K8XA 3SCQA 5T26A 3AOFA 3ZLFA 2PTZA 5HQEA 1LROA 4FX8A 1M7OA 4JTHA 2FVKA 2HVNA 2CPUA 4YTQA 1DL3A 2YCLA 3Q58A 4LUTB 4DQWA 4DUXA 2CIPA 4GBDA 4J2PA 2XH7A 4URIA 3B4UA 4BQ2A 4FX6M 4WJEA 3VIKA 2OOGA 2VMFA 3QH2A 2J9XA 2DZUA 3VE9A 3C2EA 3AS1A 4O54A 4PUDA 4IX0A 4R33A 1JUKA 3NJ3A 1Z32X 1N8WA 2CHRA 2H6RA 2YDRA 2PRLA 1UROA 4ZQNA 1JDEA 4AYSA 3BOXA 3OO2A 3RU6A 5I3DA 2YPIA 1ESWA 4M51A 1W9BM 1OCBA 4IMCA 1QXLA 3GR4A 2A21A 4JIEA 4FB7A 1WV2A 3ITCA 3O0FA 3UZZA 3AMLA 3BGJA 1HKMA 1QPNA 2V3FA 4GKLA 3TSMA 4NJKA 4TU1A 3LA4A 3ZR5A 4FLOA 2CBVA 4MKSA 5G1YA 3E3HA 3M46A 2E0PA 4QHRA 2IXUA 3P2VA 5D2TA 5LGXA 4I6KA 1U1HA 2BXVA 3L66A 1KD0A 1V02A 2V5LA 3WUEA 2W0UA 4XD3A 1E15A 1DJHA 4KRTA 3CZJA 5H2ZA 1WAUA 2OELA 4F79A 4J3UA 1PZ3A 1PHWA 1MUCA 3G6MA 3SCWA 4OE7A 4HT3A 1C9DA 4BWLC 3DFPA 3LV5A 1OSEA 2GDUA 3T1GA 1FUYA 3VA8A 2C19A 2XSBA 3E0WA 3ORWA 5H8MA 2A4AA 1KKRA 3CHVA 3KRZA 3N12A 4K8GA 5HAOA 3O63A 1VCGA 4UQCA 5HJYA 1I9CB 3OLEA 3ARXA 3ITYA 2PWFA 4L5ZA 2WKJA 5GNXA 4H9XA 2CLHA 4N2YA 1LT8A 5DF0A 3HGJA 3QM3A 3T81A 5A69A 4TTUA 3N4FA 3N3TA 4AZCB 4QX4A 4UFJA 1MFVA 1DWAM 3WK0A 1S5WA 2I17A 1UIPA 5HMEA 3K5XA 1QPOA 3GXFA 1K02A 3QQ1A 2JEPA 2DUAA 3EXTA 1J0JA 3S5OA 4YVVA 1ZBKA 3KWXA 1ICSA 3EA1A 1WE5A 3IUDA 1XGEA 1O5KA 1V3LA 4LBSA 4A29A 5AKQA 4C5YA 4GH3A 2ISSA 2X0YA 1TV2A 1XP3A 3I6RA 3FA3A 1PXGA 5C9UA 1P0DA 1UR9A 1V6YA 4HA4A 3NG3A 5AYXA 2IQ0A 2Y2WA 3BTNA 4EKJA 3CC1A 1GWJA 1K70A 1TVLA 4RDZA 2DEPA 5LIUX 1DJGA 4LS0A 1R9ZA 1ISWA 1TMQA 1UBSA 3DYOA 5XINA 2PLMA 4DBDA 2CHNA 1XLEA 4WF7A 2I57A 4FIQA 2B4GA 3WH8A 3WLQA 3EWZA 4U33A 1NQKA 2FLIA 1QJWA 2ZZ2A 2EKCA 3UXDA 3MMWA 5DEZA 1Q7ZA 3R25A 4HNLA 3O6CA 1EGVA 4RKAA 1J12A 5GJMA 3UU0A 4RPPA 1F3WA 2QCMA 2QGYA 4NYUA 4O50A 2QQ6A 4LWWA 1EJWC 1XGZA 1QOXA 3FNDA 3EBVA 3K2GA 1RCOB 5GJNA 3KCOA 4YPJA 3W88A 1T40A 4I9MA 2VNCA 5HXMA 1J6OA 2V2HA 1R0MA 2IW0A 3MKCA 3SZ8A 4O4WA 4U5KA 2CZVA 4IPLA 1EYWA 1YW1A 4BZYA 3C61A 2D0HA 3AJ7A 1GYNA 3B8SA 3CLWA 4XBJA 1EPVA 1QR7A 2ASHA 2AQWA 4BQ4A 1W8SA 3P84A 5LA1A 3MV11 1EUNA 1DJYA 5HK4A 4TIMA 3TJXA 3QZAA 1MI3A 3B0XA 2G97A 2DJXA 2FPYA 2VGFA 4QJ5B 3BDKA 3ABQA 2WMIB 1PUDA 5EMLA 2FPVA 4GX8A 3EMCA 3LENA 3WLJA 1RH9A 2PDWA 4PRTA 2PWHA 3BH4A 1J0IA 1FWJC 1XG3A 4S3BA 8RUCA 1TR9A 2W67A 3PUEA 3ZLHA 3ARVA 4PB5A 4DJFA 2YA0A 3H2NA 3TOYA 1FP8A 2NQ9A 1W0MA 1X6NA 2CESA 1LG1A 5A5WA 2X16A 2WJEA 4CU6A 3NURA 3CYVA 5CSRA 1TV5A 4GY0A 5CC7A 4AZGA 3V3WA 3W1LA 4J3WA 1H3GA 1WDRA 3IUHA 5AVNA 4V1YA 2D1ZA 3GG8A 4RJEA 1CGUA 1GKQA 2ACUA 1NOWA 2ZX8A 1PPIA 3N73A 3STPA 1N2VA 1TPEA 5A2BA 4C6QA 4NG3A 3WF1A 2IXVA 3EX4A 2DSKA 1VC4A 3WQPA 1RJRA 4AD3A 1TTPA 4N0RA 4AIEA 1CB2A 4G56A 4E8DA 2PDGA 1OGGA 1CDGA 1WKYA 1O1ZA 5HUOA 4FAMA 1KM3A 4B3LA 2RAGA 4IJBA 4NI3A 4DY1A 3OG2A 2F84A 4OBTA 3SCVA 1TMLA 4PUMA 1JVNA 1OQFA 1YIXA 3MJYA 1VEPA 3W6YA 3UJFA 3RX2A 3VNIA 5I78A 5FF2A 2WMKA 1LUCA 5HBFA 4YVPA 3LLXA 3R11A 5JH2A 3LXCA 4X63A 5GVJA 4Y9NA 3GH7A 3L2MA 4HNOA 1W9DM 2DIJA 4NSBA 3QV7A 1MSSA 3N9SA 4A22A 4DXKA 1HGYA 4XO7A 4XTDA 3FJ6A 1EYEA 1NQ6A 4LBUA 2QHAA 2YBTA 5DY2A 2X05A 2OSWA 3SJNA 3R94A 3IGSA 3MS8A 4ZGYA 3O7UA 3EYPA 5CBJA 3KTSA 5AYIA 1OFPA 2GDVA 1XC6A 3FIGA 1E73M 3GXDA 2RDTA 2OYKA 1XUZA 1TJRA 1XINA 5BOOA 4UTKA 3T7VA 2NXGA 4HKPA 3F2BA 4S2BA 1Y5XA 2VKZG 3ZIZA 1UP2A 1QU4A 3IAPA 4PFHA 4Z1AA 3LOTA 3ATZA 3PPHA 1BPLB 4N02A 3I3EA 3VFCA 1R38A 5G5IA 1TREA 2Y8KA 2ZUUA 3FN9A 1JZ2A 4GZEA 4GYJA 4FXRA 4RE0A 4MHBA 1VIZA 2BZNA 3WH9A 4HA3A 4UNIA 3LHTA 5EYWA 3UXKA 5AC7A 4NP7A 2H3BA 2I16A 1JYXA 3FEQA 2YDQA 3QTGA 1TR1A 2D2HA 1BYDA 1BFNA 2O92A 4ZO7A 1OM0A 1LRTA 3EPMA 3H24A 3DKLA 3NUKA 2DZAA 2OO0A 3GG7A 1I2OA 1JDAA 2DT0A 3PZ9A 3GDTA 4MKNA 1SZGA 4WDTA 4F48A 2C1HA 4XVEA 3WH5A 1JQVA 2REQB 5C9WA 2PA6A 1H62A 2VX5A 1XX1A 1FWCC 3ZT5A 4FNTA 1GTHA 4KWOA 1D3GA 2FHFA 9CGTA 1IXQA 3DI0A 1JF5A 1OC6A 3NGJA 1ZHAA 4WD0A 1JUEA 4S2CA 4M7TA 1WP6A 2PC8A 3ARYA 3IVUA 1UP0A 4GISA 4UTUA 1W9UA 4PMYA 4KRUA 5D4YA 1MUMA 1EDGA 1DE5A 3WJXA 4FOKA 5LIXX 4KCUA 4HYVA 5LA2A 3WLTA 2NX1A 1PWLA 4ZB2A 1Q2RA 4NQ1A 1S2TA 3WD4A 3MSGA 1R3WA 4MY9A 4L4PA 1XH2A 2QPSA 4ZOAA 1YXYA 4LW7A 4JHMA 5HR6A 1JAEA 1J4EA 7TAAA 5A8MA 1H0GA 1C3FA 2VQUA 4NXSA 4PMJA 2HK0A 4F0HA 3H2FA 4HMDA 4UC5A 1B30A 5L6UA 3W1PA 1GHSA 3SN1A 5BU6A 3EKGA 4EAYA 3OA5A 1M1BA 4DO6A 2HPMA 3AYVA 3SJ3A 3NFUA 1XIHA 3S0CA 1B4EA 3MT1A 4C7FA 2NQLA 2XVLA 2OKTA 1H7RA 1ZJBA 4MKVA 8A3HA 3TN4A 3G0SA 3NZPA 2OG9A 4E6MA 3MHUA 3BLPX 4UTFA 3THUA 4LT9A 4RNFA 2CZFA 3U57A 2CLIA 4HHHA 4P7NA 2I7GA 2WHKA 1LWJA 2Y62A 3HGSA 5AHLA 3W2KA 3ZVHA 3W7QA 1SR9A 4B4FA 2VJXA 4WIWA 4QLJA 2VGIA 1FWDC 4XBSA 3ZJ8A 1CX9A 6REQA 1PCKA 1QPKA 4HN4A 1XIMA 4D6HA 3P67A 3MVTA 3HN3A 3VILA 4AWSA 4DWSA 4KWSA 3RX3A 4C7DA 3H8AA 7CGTA 4DM2A 4J3TA 1XYLA 1MNSA 4MY1A 3V5OA 4DNHA 1S2UA 3OVPA 3W7OA 2VZUA 1Q13A 3QEZA 3W7EA 1OFAA 1DJXA 1JPKA 3OB8A 1E9LA 4WSKA 2OQLA 3SCSA 2VD8A 3JRKA 2OLHA 3SCPA 4M6QA 3I7SA 2PDQA 3WD3A 3SRDA 2Y4SA 3F7JA 4C1KA 2INFA 5CG7A 3TQVA 1HTIA 2O55A 1DVJA 1BVWA 4WCJA 2J62A 4M5PA 3URAA 4CNNA 3QC3A 2WMJA 3ZSSA 2D22A 4HTYA 1EF3A 3QFWA 4TX8A 2POZA 3WF2A 3W01A 4H7VA 4NT0A 2J4GA 3LLDA 3SUUA 3BUVA 1HJQA 1Q4NX 3ZWTA 2Z1VA 2QV4A 5A3HA 6ENLA 3HZ3A 3LEPA 3W2MA 4TO8A 3ABZA 2B7QA 1TFVA 2RJHA 3AZSA 4US5A 3NZQA 1ISZA 2Y0FA 4JIPA 1TPWA 4D6EA 3B9AA 3HPXA 2HDJA 3GVVA 4H00A 1FOBA 1V0KA 1WQ5A 4WGXA 2HWGA 4F2UA 4W8AA 4UBPC 2G50A 1MEHA 4QNEA 4CD5A 3RYSA 3B0PA 1GZJA 1CCWB 1U33A 3C0LA 3XISA 2PDYA 2W4XA 7TIMA 1ODZA 1LJYA 1ADOA 2VUNA 4ACYA 4BI5A 2WCGA 2EPKX 1F9CA 3LYEA 5FEWA 5C7VA 2IPGA 5AOUA 3M6YA 2J7HA 2DT2A 3AXMA 1IEVA 1OGBA 4NRSA 4A3UA 3G1XA 3TK7A 4G7EA 1AW2A 4NJJA 3PZTA 3HM7A 4MUZA 2FTPA 3MY9A 4PMVA 3UZJA 2GVYA 3C2YA 4E0CA 4Z17A 2FQIA 2FZBA 2WBKA 2DJLA 3A13A 2YB1A 3N4EA 4ZBCA 3W7HA 4PMNA 3W7RA 2FFCA 1EJXC 2PTXA 4KCVA 2PLKA 1W54A 4IM4A 3SGGA 5D2WA 3L7RA 2Y5EA 4MY8A 4ROQA 3BK0A 5E09A 2FMNA 3UESA 4NJGA 4MNKA 2B81A 3WN6A 3GE7A 4XD4A 2YLAA 3PG9A 2PB1A 1QI0A 2PGEA 1GQKA 2Z29A 3EX2A 1HXJA 4CN1A 3WG6A 2E3ZA 3EPOA 3CNYA 1GZ1A 5FEZA 4DZIA 3CAWA 3HG4A 1X8FA 3GNPA 4WY0A 3K1GA 3GU1A 3TQPA 3NQMA 3VIFA 5LNWA 2RDXA 3UXLA 2DQXA 4S3JA 2J78A 2J9YA 2ZWYA 1P0BA 2QJJA 3AXHA 3O07A 3S5ZA 1S5TA 1AH0A 1ZSXA 3C2VA 3L23A 4H6EA 2VR5A 1ZFJA 3MHFA 5KINA 5E9XA 3UA4A 3M7WA 1XLCA 4GVHA 1GVQA 1FX6A 4JYEA 4JTSA 2KAUC 5D2YA 3DG3A 5LZLA 1E1FA 2V5DA 4E4FA 3LM3A 3RM4A 2ZADA 1XJBA 1DJNA 1TIMA 1U83A 2JIEA 2FB3A 3EDFA 1TWSA 3WIJA 4HU0A 4HJWA 1XBYA 5HR7A 1CLXA 1DXEA 3A12A 2PU0A 4MG4A 4A8LA 1FHLA 4OUEA 4MUPA 1L6YA 1TE1A 4DWDA 3A9BA 1F8IA 2C13A 3FDKA 3W24A 1N55A 5CGMA 3G1YA 2J77A 1CXKA 4HYWA 4H2HA 3PANA 4D8AA 4DELA 3NA8A 5G2HA 4OIFA 1XUUA 1V79A 1BYBA 3URQA 6TIMA 1U5JA 3B97A 1OCNA 4GFIA 3WL1A 1QT1A 1M03A 1XIGA 4KPLA 3UVAA 2QIWA 1XSIA 3R58A 2W63A 2WSKA 2E28A 2J9ZA 3ICJA 2Z1WA 3LCXA 1B57A 1M9HA 3S3GA 4E8GA 2CBJA 4Q4RA 1OINA 5DELA 2VZTA 4KESA 2RHGA 1VCFA 3IJ9A 1UQYA 4LY4A 4YWSA 3GK0A 3R0DA 2ZCGA 3PAJA 3TYBA 3WK2A 4UR8A 3NPXA 4YVXA 3NWRA 1DTUA 5C2CA 1PAMA 4W8LA 3TN3A 2CNCA 3W7JA 1NWTA 4LF1A 2DT1A 4W7WA 5DO8A 4GUGA 2OT0A 4QG8A 3IIOA 3KCJA 3QW4B 3H70A 1CLVA 1GVSA 2JK2A 4AXKA 1RPXA 2X1RA 1E4LA 5ABTA 1IWAA 4JCMA 4C6MA 4AC7C 2VCBA 1S2AA 1WA3A 4HYRA 1B3YA 2QPXA 1GORA 1HJSA 3F4CA 2FZMA 2ISFA 3NL2A 1VCVA 3BLDA 2WWCA 5G4WA 4BEQA 2HRWA 3MO7A 3NQVA 4GIRA 2VRKA 3UNTA 1SFTA 1ZB5A 1D7FA 5I77A 4C6NA 5AC6A 3H54A 1V3KA 3UR8A 5FJOA 4EAMA 1M01A 2AQOA 2X1IA 3GIPA 2XIOA 3W7KA 4R3UA 4GVFA 1TPFA 3K8MA 1KFLA 4RE3A 4XV0A 2QCFA 3M16A 4E2DA 1NFGA 1E9IA 3BJTA 3L4YA 4AZIA 3AHYA 2XVKA 4DJEC 1ME9A 3L4WA 2V5BA 4H4IA 1LUCB 1YLVA 4IFKB 2C1IA 3KL3A 3PZIA 4NL1A 2Z7KA 2ABBA 1VH7A 3EWUA 3AICA 1OFDA 2HBVA 4X0VA 2YYTA 3BGGA 1I2PA