4Y96A

Crystal structure of triosephosphate isomerase from gemmata obscuriglobus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
250
structure length
250
Chain Sequence
TRKKFVAGNWKMNTTLAEAKALGAAVAKGVTDDRVTVAVFPPYPWLTAVGEVLKGSPVALGAQDVSSEKKGAFTGEVSPAMLLETGCKYALIGHSERRHIIGESETFINHKVHTALEEGLSVVLCMGETLAERERGLQERVFQRQVYAACAGLTDEQFGRIVIAYEPVWAIGTGKVATPEQAQEAHAFVRSKLRLLYGDKIADSTPIVYGGSVTPDNTVGLMSQPDVDGALVGGASLKADSFLAIVKAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate Isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Gemmata obscuriglobus
total genus 93
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y96A00
5EYWA 2WNQA 3DXIA 4HNTA 4FNPA 1K8YA 3O6DA 3N34A 3HMJG 5KZMA 4JIPA 4Q33A 2DJLA 1ZFJA 5EPDA 3VE9A 1SFJA 5AHIA 1SW3A 4DPQA 5HWJA 2DZXA 5LHEA 1O5KA 5DY2A 1YTDA 4CCEA 5TBOA 2Y89A 3HB9A 3DBPA 4KWWA 3W2JA 2A4AA 1K7EA 1M7PA 2V9DA 1JCLA 4JTLA 3SW6A 3W2KA 4P2VA 4NJIA 4MPQA 4BI7A 1KM1A 4FX6M 4DF1A 3G22A 2EHHA 1LROA 2VEMA 3GB6A 3IGXA 5CKSA 4ICNA 2W6RA 1FWTA 3NO5A 1DORA 4ZVJA 3SI9A 1I2NA 5E1QA 1QFEA 3C2EA 3EEGA 1DQXA 2ZZ4A 1TPB1 3DKJA 3JR2A 3LHWA 3L65A 2JKPA 3BLEA 4FO4A 1EPXA 3THAA 1VZWA 4M6VA 3UPWA 4A29A 1QPOA 1ZHAA 2XN1A 3M1ZA 3HPZA 3CWNA 3N73A 3BPWA 4IXHA 2V30A 1V7YA 3LI0A 2NWSA 3W86A 4AXKA 4N9BA 3GKAA 2WOQA 1AG1O 3N9SA 4N6EA 2NXGA 3NQGA 2CU0A 4O19A 1UB3A 3IV3A 3KRUA 1DJQA 2R94A 3W84A 1JRBA 3P62A 4YLWA 4HN4A 5KMYA 4MJZA 4O1AA 4MFEA 4CNPA 1J5TA 3NQAA 1QPNA 2BLEA 3OVPA 5I3GA 1K7XA 4LUIA 5IBXC 1EP2A 3LCWA 1QNVA 2Q8ZA 2ZRVA 1H7PA 1XFBA 4ZQCA 3OEXA 1LRQA 1JCXA 4JTSA 2X1SA 5K2ZA 4OWGA 3NA8A 3KX6A 2R14A 4OQVA 4XWUA 4N2YA 1TREA 2C15A 3W6YA 4O52A 5CZ0A 3RFAA 3LCFA 3LHTA 5LGZA 2CLEA 1VHNA 2ZDRA 3Q37A 3W07A 5CSRA 3W22A 4IMDA 3TC7A 3IGSA 4O14A 1XBZA 4Y8FA 3DHFA 1LOQA 2UV8G 1TRIA 4Z1BA 2J9XA 3UXAA 3HIJA 4N02A 1OFQA 3WK0A 5EL1A 4CCDA 3MBDA 4YWIA 2QCMA 4ZQNA 3M43A 1TTQA 1LRTA 1F5ZA 3NQ6A 2QCHA 3G24A 4O1BA 3B8DA 2YPIA 3MO7A 2NZLA 3NQ7A 2ZZ3A 4MY1A 5E0KA 1LM1A 2H6RA 2NUXA 3THQA 1RR2A 3R2GA 2WNNA 2Y61A 4QQ3A 4IX0A 1OABA 4MZ8A 2CFFA 1BEUA 3FLUA 4NXSA 4LUJA 2VEPA 4PFMA 3FA5A 1WAUA 1TIMA 4K8HA 1YTKA 4FX8A 4MYXA 1B4KA 5HUOA 4MLRA 3B06A 2CLOA 4POCA 2CZEA 2W0UA 4OBTA 2WQPA 2QUUA 1CX9A 1H63A 5HJLA 1Y0EA 2DZUA 2YX0A 1OYCA 3NQ8A 4CQ9A 1ICPA 4M6PA 3NQVA 4HSNA 5F2LA 3MHFA 4M7SA 3IEBA 5MHBA 3NL5A 2QAFA 5HUPA 2ZTKA 3N2MA 5CPMA 5BW6A 2Q3RA 2X1TA 4AF0A 5CGQA 3LDVA 3WK1A 3VCRA 2FPYA 4XTDA 1HG3A 4DF2A 4JY8A 1WYIA 3QSRA 4LS2A 4HPXA 4M7TA 3U2OA 2TYSA 3PB0A 4MOZA 1QO2A 3O15A 3HPSA 1YXYA 5FEPA 4DO6A 3LXAA 1I45A 3TSDA 1FCBA 1G4TA 2CW6A 2NV1A 3UZJA 2FDSA 3ATZA 3MW7A 2WSQA 3QSTA 3EKZA 1QDSA 3C6CA 2W79A 4GXMA 3C8FA 1SSGA 4UC5A 1TPFA 3FYPA 3TX9A 1H7OA 3P60A 3A21A 3QFEA 5FI8A 1ME7A 2TSYA 4MKNA 3N14A 1H61A 4NJKA 3SSJA 5LNSA 5H2ZA 2ZCGA 4PEKA 5K4XA 4DXVA 2G95A 5HMSA 5AC6A 2Y88A 3P5YA 3SR7A 4LVAA 1VCFA 3TA6A 2CLFA 3NVTA 4NXKA 3ZWSA 3FJLA 5KTLA 2B7QA 2C18A 3P82A 5AYZA 4HIBA 3W76A 4K7VA 4IPJA 4Q4KA 3EX3A 4LC8A 1FDJA 3DKLA 3CC1A 3JS3A 2B7NA 2Y7FA 3LCXA 4YXGA 2WO5A 3KXQA 3Q94A 3PS7A 3G1XA 2PURA 2O7SA 3TXZA 5HWMA 2YZRA 3QF0A 1VRDA 3LHVA 4RK8A 2ZZ2A 3O1NA 3TROA 4CLMA 1LORA 2QKFA 1J2WA 3FFSA 3BVJA 4KFPA 1FXQA 4S1FA 1OX6A 3AJXA 1CW2A 2FFCA 3P8JA 1XL9A 5F2GA 1G4PA 7TIMA 2QJGA 1X1ZA 3TAOA 2V8ZA 3BG3A 1YADA 4BR1A 3O16A 3S9YA 2CLMA 4YCOA 5BNKA 3O8AA 3I7QA 4L4LA 1H51A 4E38A 2ZYFA 2ZZ5A 4FNSA 3GXPA 4UXDA 4UTHA 1PL9A 2X30A 1L6WA 3W7JA 1LZOA 4IOTA 3OVRA 1XDLA 3C2RA 4UNKA 1DQWA 1JULA 3S42A 3K30A 4LVGA 4O54A 3W7PA 5F1VA 4PH6A 4ZQMA 3Q58A 1TV5A 1EP1A 1K8ZA 5D2YA 1ZENA 3MP5A 4O1CA 1Z44A 3ANYA 3QQ0A 5DCDA 2ZRZA 5L6UA 1QPQA 1XUUA 4ZZ9A 3BV4A 5AFDA 1OFEA 3BW2A 2FPTA 3MYPA 4KKXA 2ISSA 3KVMA 4LC6A 4O4VA 3PG9A 1ICSA 2GQAA 4JX6A 3LXCA 2V2DA 4TU1A 1A50A 3P61A 4UFKA 3LB0A 4A22A 1G7UA 1BWKA 3MI6A 1G6CA 3MP4A 1UUMA 3VFLA 4LY8A 3HPXA 3NEVA 1K02A 3W1PA 2DP3A 3HG4A 2PRMA 4Y6GA 1LBMA 3PULA 3MP3A 3UWUA 1OF6A 3KOFA 1DV7A 4HHPA 1SW0A 2E6YA 2Y70A 4MIMA 4JYFA 3W2UA 3FIGA 1YYAA 3SZ8A 1G7VA 1OX4B 5KZDA 1F6PA 3C56A 1RV8A 3DI0A 2PC4A 3W83A 4IGHA 4LVBA 3F4NA 5I3KA 5G2WA 1GOXA 1SZNA 1GYLA 1N55A 2OJPA 1KFLA 1FWNA 4FIQA 2FTPA 4JYEA 2KZHA 1ZJIA 4KFNA 3W7HA 2ZFAA 4XTIA 1L6SA 1FCVA 1I4NA 4AB4A 1KLZA 4JIQA 3NG3A 4Z1AA 1GTHA 1BKSA 2GPTA 5D32A 5D33A 2YR1A 3BGGA 1TPWA 4DELA 5DCBA 1Q6RA 3SFKA 5LNRA 2DJXA 3IIVA 3DI1A 3I65A 3LRKA 1O60A 4HT3A 4TO8A 5FESA 4UTUA 5A5WA 1XBXA 2F84A 4GBUA 5CPNA 3NPVA 1CI1A 2JGYA 5EMUA 3OHIA 2A2IA 4LNYA 1TV8A 2GUUA 4M5PA 1YPFA 4GRSA 3L68A 3GR8A 4PC8A 2GVLA 4JR5A 1RVGA 4UTLA 3O6YX 5LZLA 1OFPA 1ALDA 4TMBA 2QCEA 3A5VA 1VGAA 3DENA 3LGEA 2NXIA 1OK4A 2E68A 5AHMA 4ZQPA 1WA3A 4ZQOA 1PHWA 4U28A 3PUDA 2VEIA 3LI1A 1KFEA 4LW7A 4AHQA 3M5ZA 4AEOA 3INPA 3W23A 1FBAA 5FEZA 2J27A 1VLIA 1W31A 4K8EA 3LRMA 4LS1A 2OT0A 3TUUA 4YMZA 2B4GA 1OHLA 1TSIA 4GUFA 3CT7A 1H7RA 2DZVA 1JUBA 4O53A 3E0IA 3W7QA 3NYZA 4O57A 4NJHA 3O63A 3PAJA 4UFLA 3UXDA 4UNLA 3MI3A 3EWUA 4RKAA 3HF3A 3KHJA 3BGJA 4ONVA 3T40A 4HNVA 2C16A 1R2SA 3M7WA 4XZ9A 3DFQA 3QJAA 4DF0A 1TPH1 3LCLA 4G1KA 2HS8A 1A5CA 2J9YA 1H60A 3W7DA 3UQNA 4IMEA 3KRZA 5G1YA 1MEIA 1B4EA 4Z1CA 5CSSA 2BSLA 3L5LA 1FWSA 1RQBA 3C2VA 2ZZ1A 4JTJA 2B0MA 1YXCA 2ATSA 4GJ1A 2CLKA 3W7MA 2NX3A 1KM5A 1AW2A 2VFFA 1OFBA 4RXFA 1ZAIA 4QAIA 2YFNA 2PRHA 3TQKA 5AC7A 2QJIA 1ONRA 5AN7A 5I3IA 3IRDA 5HNRA 3I68A 3ABSA 5LNWA 5HWNA 3TH6A 3M5VA 1XI3A 3LHZA 3DHDA 3HGJA 4JNMA 2H3BA 5D2WA 5D2XA 5HULA 3DAQA 3G0UA 1GT8A 1RQHA 1XBVA 3QZEA 1SSDA 3DFTA 4WQ6A 2V5LA 3W2MA 5KSWA 1I8JA 1KM2A 1T0OA 3M47A 2ATMA 2A21A 2Y6ZA 3TMQA 4N9EA 2YCEA 3DZ1A 4NU7A 4NNBA 2O7QA 3F03K 3NL6A 4NQ1A 1FUYA 3U8GA 4HNNA 2C14A 2EAWA 3G3MA 3W7GA 1X1OA 3LBMA 5HR7A 3W7CA 4LT9A 1DOSA 4LVFA 1YDVA 1JCJA 3P7YA 4NUWA 1W8SA 2G97A 2ALDA 3EX2A 1GEQA 1EUAA 3S1UA 3T44A 4NVTA 4X22A 1FWWA 2QDHA 2BX7A 4O15A 4HNUA 4MUZA 4CNNA 4UUIA 2C13A 3TXVA 4Z08A 1W37A 4GWEA 1JUEA 4BF9A 3BW3A 4JYDA 1KTBA 3B4UA 1GVRA 2ZRYA 3LLFA 2E77A 2OX1A 3IIZA 1XXXA 4H6KA 5C5YA 1L6YA 1TPEA 2VFHA 4JTGA 1G4EA 1WQ5A 1WOAA 3HJZA 3I7SA 1IXNA 1EEPA 4GC4A 1Q6QA 1FCUA 2VELA 1SU5A 3G18A 1GTEA 3V75A 3I7RA 1Q3NA 3SY5A 3NQ2A 3NL3A 4J9JA 3RMJA 3TJXA 2RDUA 2QF7A 3UWQA 4UFMA 3EWXA 4RJEA 4B5NA 4PA8A 4DEFA 3W1QA 3C0JA 3LX9A 2QUVA 4PTNA 5K4ZA 4KWVA 1KV5A 2OCZA 5F2IA 3S1XA 2E5BA 1X7FA 3H53A 4O12A 5G5IA 1XDMA 3MUXA 3TCEA 3ZS4A 1H7WA 3IIOA 1T96A 2VFDA 2Y7DA 2C0AA 3BK0A 3S5OA 5CPLA 3WJZA 4BI6A 3PSWA 3WJYA 3PM6A 3DFPA 5LGXA 3P84A 3CIXA 4N4QA 4DO4A 4OHQA 1IGSA 1JVNA 5DN1A 1NEYA 1W5OA 3GDMA 2TRSA 3GLCA 4MY9A 3W7EA 1D3GA 3FJ6A 3GYEA 2EGZA 1G69A 2V82A 1DBTA 1FQ0A 2IQTA 3TSMA 1U83A 4ADTA 1SO4A 1XCFA 3L21A 4UFHA 4AHOA 3LHUA 4ZL1A 3W9ZA 3W72A 3FEMA 3KRSA 3QW3A 1GVOA 5LSMA 3TIMA 2NLIA 4H4IA 2QDGA 2WPBA 4GNJA 3MHGA 4LU0A 4H3DA 1PHQA 1VLWA 3FKKA 3MJYA 4QM1A 1V5XA 3QC3A 3S0CA 2ZA3A 2FQIA 1XKYA 1ZAHA 5SWUA 4C1KA 4P61A 3OBKA 2VC6A 4AH7A 3W1MA 1H7XA 5FF2A 3VKJA 1LBLA 2JGQA 4M6QA 5DELA 3PVFA 5DXYA 1QR7A 4XBSA 4OV9A 4GFSA 4BWLA 1TMHA 2J6XA 3CU2A 1X6UA 4GUHA 1NF7A 3EWYA 2QCLA 3L5MA 3VI2A 3CM4A 2VKZG 1Z48A 2OT1A 3LCGA 3QW4B 4YL2A 3NQEA 1L9WA 2D73A 4RCXA 4UFJA 1A5AA 1ZAJA 4JTTA 4NT0A 5FF4A 3LTYA 1KV8A 2CLHA 2JBMA 3L0GA 2Q8LA 3QMTA 3NPUA 2GOUA 1SPQA 3QEZA 1W5MA 1F7BA 2DZTA 3T55A 3G8EA 3NPWA 3TAKA 5K3VA 3H54A 2FPVA 3HGSA 4JXCA 1KBIA 2C3ZA 4A3UA 2X1RA 3HQ1A 4QISA 4DPPA 3STEA 2A5HA 2QUTA 1LLZA 1KM0A 3CPRA 2OZ0A 4LVDA 5L9FA 3M44A 5D2TA 5F4WA 2QCDB 4FIRA 5EKYA 4R34A 2RH9A 4XUGA 1P0NA 3N3MA 4IX2A 4IUOA 3WFAA 4FEZA 3M41A 1GVFA 3O6CA 2CZDA 1OX4A 4HPJA 3P74A 4PL1A 4C1LA 3M5XA 3UNDA 5BMXA 4TMCA 2JKEA 4UTTA 3IVSA 2Y7EA 4O16A 3DFOA 4GUJA 1S5VA 1N7KA 1TPDA 3NM1A 1KM4A 1MEWA 1F73A 2Y63A 1KM3A 1LCOA 5F1UA 2BXVA 1YDNA 3NQCA 2B7PA 2FIQA 5LKYA 1IF2A 3STFA 4LOCA 2Z0IA 5HR6A 1TTJA 3GNDA 4QIUA 3FKRA 3W1RA 3QQ1A 2EKCA 3WJSA 1PVNA 3STCA 2TPSA 5BRBA 4Y96A 1ZNNA 2I9EA 3PUEA 2GJNA 4O17A 3G0XA 4OT7A 3LCIA 3T7VA 3L0KA 5FF7A 5D38A 3UD6A 5AHFA 1GJPA 3M5YA 1YXDA 3JRKA 4O0ZA 4O11A 1F74A 4JGDA 4AWUA 1P0KA 3TV8A 3PBYA 3QMSA 1SW7A 5I3FA 2HSAA 4TR9A 5LNUA 1OFRA 1HFBA 1UASA 5AC8A 4WXZA 2ZBTA 2DZWA 3NOEA 4IJBA 1XM3A 2H90A 3C61A 4MZ1A 2HTMA 1OFDA 1QMLA 4JTHA 2V0TA 1LOLA 3P67A 2QCNA 5LHFA 4DBDA 2JK2A 3G1VA 3TW6A 5A8GA 4RXGA 1J4EA 2NUYA 1FXPA 4N9DA 2YW4A 3HGRA 3PBVA 4E2DA 2JKAA 3EXTA 1R2TA 2J24A 4MLJA 4ADUA 1RD5A 1XUZA 3W75A 1P1XA 1DHPA 1VH7A 2ZRXA 3DGRA 1BWLA 1EP3A 3A23A 3PG8A 1EB3A 4PL2A 1C29A 1BTMA 4DBEA 1TO3A 1IXPA 4NZFA 2E6AA 3UY7A 4GUGA 1PV8A 2E5DA 4AWTA 4N6FA 2NX1A 1OX5A 1QCWA 1VYPX 3FOKA 4PCFA 2WSRA 3E9AA 3D0CA 1YPIA 4MY8A 4JDBA 1JR1A 1Q45A 3PWAA 4RZ6A 3O06A 2YW3A 4JD4A 2NWRA 3S6DA 2RDWA 1EWEA 1QAPA 4Y9AA 4ZQRA 3KAOA 1AL7A 4IPIA 3BG5A 3WK2A 3B0VC 3W7KA 4FXRA 3PBUA 2C1HA 2FB2A 5D04C 4DO5A 1ME9A 4TX9A 5FF0A 4AMAA 4WXYA 5AYYA 3ZFHA 4Z0JA 1IXQA 3O05A 4JICA 1WV2A 1MXSA 1QO5A 1F05A 5DBUA 3MHUA 5J5DA 3IIPA 3L0NA 4QSHA 1KTNA 4E0CA 2XN2A 5CG7A 1A53A 3CIWA 1MO0A 4EIVA 1M7OA 2I14A 2E6DA 5D37A 3ATYA 3FS2A 2ISWA 3ABRA 1VYRA 3FYOA 2XN0A 1PCWA 3G8RA 5U4NA 3I6RA 4JTFA 4UTKA 3UWZA 1NVMA 2WSYA 3EXRA 4MZYA 2V2CA 1HO1A 4CQ8A 1P4CA 4ADSA 1AMKA 4NNAA 1QWGA 1GYNA 1B9BA 3TMLA 4WY0B 3UWYA 3MI2A 4XBKA 1KBJA 3GIYA 1R30A 3S1VA 2Y7GA 1K8XA 4JS3A 5EY5A 3LHYA 4JX4A 1QPRA 4LRSA 1THFD 3RF9A 1KFKA 4RZ5A 3B0UX 5U7SA 4JDYA 1W5NA 3T4CA 2ZA1A 4K6AA 5K7JA 3EKLA 1SZFA 1IIGA 1NAL1 3CLMA 3PSVA 3ABQA 3WJXA 4ORMA 5D02A 1T8XA 3N2XA 2A0NA 3GR7A 3UPBA 1U5JA 5KINA 1ZCOA 3GDKA 3U6WA 3OIXA 3GAKA 2R8WA 1D9EA 1PIIA 1R2RA 1DVJA 1WXJA 3S5ZA 3DFNA 5AB3A 3G1AA 1ME8A 1WDWA 1ICQA 3NQFA 4BK9A 5DY3A 3LLDA 4JTUA 1TJPA 1P5BA 1I2RA 2E1DA 3MBFA 3NL2A 2GVGA 5CZJA 4EWND 1TTIA 4HSOA 3IGUA 3EXSA 4WJEA 4IQLA 3A5FA 3G1YA 4QJ1A 4S2BA 3W7NA 3HGOA 1B57A 1GWJA 1H62A 2AGKA 1I2PA 3GDLA 4S2CA 1FDYA 1H1YA 3NQMA 4HKPA 4A2SA 4FXSA 5G2HA 3GNNA 1W3IA 4YCPA 4IWWA 3V1PA 4NZJA 2A85A 3WJWA 4K7YA 1HTIA 2YDAA 3VNDA 5C2XA 3CEPA 3W1NA 4RLIA 1AW1A 3N19B 4NNCA 2NXHA 3E49A 3BARA 4JTIA 3S5YA 1TB3A 1HUVA 3DFSA 5C6MA 4UFIA 1F2JA 3GKFA 4LS0A 4UR7A 1C9DA 2QR6A 3S5NA 3TR2A 1N8FA 3W2NA 4NJGA 1GVQA 1LOSA 5EBUA 1F6KA 2E6FA 2VFEA 3RNDA 1TPVA 1TPUA 2Q3OA 1M5WA 1S5WA 4OU1A 1KLYA 1VR6A 1G67A 1R47A 4X9SA 4O50A 4KFOA 1RZMA 2WJZA 4R33A 1QOQA 4UMCA 3HG3A 2OMAA 4PODA 3B03A 3M16A 5DLCA 3STGA 1SZEA 5T26A 1W56A 4NX5A 1EWDA 4L4MA 3ZR4A 3IIXA 3W85A 5IBXA 3LTSA 5F4XA 3GXNA 1JJKA 1D3HA 2GQ9A 1UJPA 4R7JA 2C19A 3PBWA 2Y62A 4LRTA 4MFDA 1TRDA 1FWRA 5D05A 1SO5A 3W71A 3L5AA 1OFOA 2J88A 3NZRA 3PC0A 3W1AA 1VHCA 1WBHA 3GVGA 3LCHA 2F7FA 1KA9F 3W1XA 1VCGA 1KFBA 1TV7A 5D2VA 2ISVA 2EF9A 2Z2UA 3G0SA 5DBTA 3M9YA 1HL2A 1ADOA 1O94A 1SO3A 1NF0A 1TQJA 4EF9A 3GZ3A 1JCYA 1GG0A 1Z41A 5C55A 5CZSA 3P5ZA 3TW7A 2P10A 3BG9A 3QPYA 1LP6A 3DU0A 4ML9A 2ZA2A 3HOJA 4WOQA 3E12A 4FNQA 3CTLA 4IXXA 5KITA 3G1DA 1PCKA 2RDTA 3W7LA 3TSBA 4Z1DA 4RX0A 3T78A 2ZTJA 3A24A 1W54A 3OA3A 2I1OA 3H55A 5G2IA 2PRLA 5J5RA 5FEWA 1W5QA 2H8XA 2X1UA 3UWVA 3UY8A 4WOZA 2YXGA 1WX0A 2FB3A 3LV5A 4XQ6A 5KZEA 4AHPA 5AHNA 2QCDA 3KVKA 3WK3A 3YPIA 3IVUA 3NXFA 2BZNA 2QCGA 3C3NA 3GX9A 4UMAA 2LLEA 1W5PA 1LDCA 1FDZA 2X2GA 3TC6A 5D30A 3PB2A 3EB2A 2A7PA 2AAMA 3AO0A 5G4WA 2GQ8A 1VC4A 1GVSA 3L9CA 3L66A 1AW5A 3TJLA 1F76A 2V81A 4UTIA 3A22A 1O5XA 2GVJA 2ABAA 1OYAA 1FY6A 4TIMA 4X3ZA 3OG3A 3F4WA 2NV2A 3P8IA 4CCCA 5TQLA 1KM6A 3O07A 3CEUA 2A7RA 3G1FA 1E51A 2V5BA 4BI5A 2B7OA 3W7RA 1JRCA 2VXNA 5G1TA 3B0PA 4A21A 5IM51 3LBCA 1UCWA 4N4PA 2ZRWA 1VPXA 3W73A 2WNZA 3W88A 2YSWA 1SZGA 5F2MA 3W1UA 1XC4A 1OF8A 1LYXA 4MYAA 3EWZA 3S1WA 1HO4A 1DKWA 4BFAA 3EX6A 1QOPA 4UCGA 4XKYA 1O4UA 2X16A 2CLLA 5EA9A 3CQ0A 2EPHA 3NZ1A 4R53A 4WX2A 1K3UA 1TTPA 4UTMA 5G4EA 4FNTA 1RPXA 4UTJA 1FX6A 6ALDA 2QJHA 3NNTA 2A6LA 1AL8A 5E93A 4EVZA 1Q6OA 4BWLC 4Q32A 2J9ZA 3LRLA 2G5WA 2H3DA 4M19A 3TE9A 4IMGA 4LWWA 3EWBX 3M6YA 3ELFA 4RV8A 3M0ZA 1OJXA 1EA0A 1TPC1 3TK7A 2ZRUA 1NSJA 4X2RA 1KFCA 4WUIA 2PCQA 4NX0A 4UIOA 4O28A 1UBSA 1VS1A 1GZGA 3R5EA 1W0MA 2CZ5A 4O4WA 2ZZ6A 1JUKA 2ZZ7A 3SGUA 1YTEA 1MZHA 1M6JA 1R46A 2C6QA 3KVLA 2VFIA 2QCCA 5LNVA 5K9XA 1KW1A 1OYBA 5BOOA 1LLWA 4ZMGA 2P0OA 2Z1BA 4FNRA 1UUOA 3MYOA 1ZALA 1IIHA 1MSSA 3LTPA 3CHVA 3MMTA 4JTEA 5BMWA 3QH2A 1A5SA 2VFGA 4I7WA 3NAVA 1JQVA 1TYGA 4LTSA 3LOTA 3SGZA 1ZY9A 4IMFA 4N9CA 5K9DA 3RLVA 6TIMA 4O0KA 1JCMP 3W3OA 2PE4A 3B04A 1H7NA 2V2HA 1EX5A 1S3HA 2WV8A 3TFCA 3C4UA 1DJNA 3KFTA 3SJ3A 3PR2A 4JX5A 4ALDA 4UTTC 5H91A 1WOBA 4ORIA 3BLIA 3QM3A 2BTMA 4GE8A 4UTWA 1H50A 3BW4A 3DH7A 3W70A 4K39A 1K7FA 4O13A 2RKXA 4O18A 3W74A 3GDRA 3Q2DA 3G3DA 3UWWA 1DL3A 1OVDA 1TJRA 4XKYB 1VJIA 3QRHA 5I3JA 3NM3A 5K9CA 1K03A 1Z42A 1W3NA 4WD0A 1GQNA 1SUXA 1SQ7A 4AF0B 4I7UA 4UTWC 4FHAA 2DZPA 3NGJA 1SO6A 4I9AA 4O8RA 5CZTA 5FEXA 4AAJA 1OFAA 2E5CA 1L2UA 3NPXA 5AHEA 4FX7A 3GXTA 5D03A 4JY9A 2YFOA 2H8ZA 2FLIA 4MJMA 5F4SA 1OK6A 1VQTA 4NJJA 4LV9A 3G1HA 1MEHA 2HMCA 3SECA 1G4SA 5C54A 3HBLA 2DORA 4WY0A 4A2RA 2QCFA 5I3HA 4JTKA 3TQ0A 3R13A 2XFWA 3ZWTA 4UMBA 4OE7A 1H5YA 5DCEA 4FNUA 1S5TA 3PF3A 3N9RA 4UR8A 4DQWA 3IVTA 4LV4A 2NUWA 1WBJA 3W1TA 1PE1A 3LV6A 1JCNA 3E96A 3KVJA 3L67A 1LTDA 3EX4A 1KFJA 3GAYA 4FB7A 5HQEA 2BWGA 2QAPA 1KTCA 1W1ZA 5FF3A 3R89A 4OV4A 1XBYA 3VE7A 3W1LA 3G1SA 4WY0F 1RQEA 5AYXA 1C8VA 4RZ4A 3TFXA 3TKFA 2RHGA 3SIZA 4AWSA 1I2OA 3HO8A 1TCDA 3UYCA 3A9IA 3BO9A 4QNEA 3F1QA 2WKJA 2AQWA 1PS9A 3LXBA 3LM7A 1FCQA 4K36A 5AHLA 3HG2A 4AVFA 3W87A 3USBA 3LERA 3OVQA 3W7OA 4O1DA 1SFLA 1X8FA 4GUIA 1GG1A 2FJKA 2YYTA 1EIXA 2Z6IA 3PUOA 2GJLA 5ABTA 1IXOA 4FF7A 2CLIA 4OGZA 3W7IA 4JEQA 3RK8A 1AK5A 2QEZA 3TNOA 3MWAA 1I2QA 2DZSA 5HINA 4MVAA 1O95A 4O10A 1OG0A 4Z0SA 1GPWA 1ML1A 3HG5A 4WZHA 1SR9A 3NR0A 4W9TA 2A6NA 1Q6LA 3BLFA 3E02A 4EF8A 4QNWA 5GVJA 1VYSX 4IMCA 2CZFA 3TDFA 1H1ZA 3R12A 3RU6A 3NQDA 2YGYA 1A5BA 2R91A 2YYUA 3GDTA 4CQAA 1JQXA 2Y85A 2TMDA 2ABBA 1EUNA 3CWOX 4EOUA 4CNOA 3CB8A 3GK0A 2A7NA 2Z6JA 3S8HA 3QPZA 5CPOA 5D09A 3QMRA 1LBFA 2RFGA 4RR4A 1T99A 2HS6A 2P1FA 3B05A 4Y90A 4K37A 3R8RA 3L2IA 3PY2A 3C2OA 8TIMA 4D2JA 1VCVA 3W2LA 2VEKA 5TIMA 2A1YA 4JN6A 1YDOA 2VOMA 3C2FA 4U4MA 3ABOA 1YLVA 2G96A 3TU9A 4K38A 3RLUA 3TQVA 1TQXA 2E09A 2CWNA 3EWWA 4E2BA 4I7VA 5DXXA 1B3OA 1W3TA 5AOUA 1NFBA 2ZQ0A 3EX1A 3UZ5A 3QYQA 3P81A 2DU2A 2VENA 1LRNA 4QITA 2NX9A 3C52A 3P80A 3NDOA
chains in the Genus database with same CATH superfamily
2HVNA 3OPSA 4NAFA 4H1ZA 1ISWA 2WQDA 3LENA 4ICMA 4AZHA 6CGTA 4Q33A 2PDCA 5HK4A 4EAYA 4LAUA 3PP7A 3VE9A 5AHIA 5HWJA 4BJHA 2OQYA 1YTDA 3PJXA 3DBPA 5A2AA 4F79A 1IT0A 3W2JA 1V0NA 1ZJBA 1M7PA 2EJAA 4LYQA 1KM1A 4DF1A 3IGXA 4W87A 5CKSA 1EF3A 4PMZA 3TYAA 1FWTA 3NO5A 1IQ8A 3SI9A 1XD0A 3DESA 2WWDA 1QVBA 4OIFA 3E2VA 1GCYA 2JKPA 1X98A 1CT5A 4LX4A 4PB4A 3VDGA 3VKCA 2PDLA 1QPOA 4GPNA 3H26A 1KR1A 2WW5A 4MAVA 1D8WA 2V30A 3R6IA 1MDLA 3OZPA 5H1WA 2E8ZA 2PTZA 3N9SA 4R88A 4CQDA 5H8PA 1NARA 5AKQA 2FZNA 2CU0A 1UB3A 1DJQA 4Z2JA 2PDGA 3R25A 1E56A 4KH2A 3AOFA 4MJZA 4O1AA 4DAIA 3FVDA 1E9ZB 3GZAA 2BLEA 3OVPA 5I3GA 4LUIA 1EP2A 1JDAA 2Q8ZA 4O1EA 1H7PA 4ACYA 1EJ7L 1S2VA 5IRPA 4MB3A 1LWHA 3UG3A 1CECA 3VCCA 1TREA 1EQCA 3W6YA 3SY1A 4O52A 3K5XA 3LCFA 4LB4A 1EH9A 4MDPA 3QPEA 4Q4QA 2ZDRA 3W07A 4KCWA 3AXXA 3W22A 2BODX 1NDWA 3ONBA 4L7ZA 4B5UA 1XBZA 1BRLB 1BYDA 3WNPA 1CDGA 2XVPA 3MMUA 2DIKA 2AL2A 3T2PA 3CUJA 3AUOA 4YPJA 4H9UA 3MBDA 1NWSA 4ZQNA 2OKOA 1E9IA 2ACSA 3M43A 4ZO8A 1TTQA 5E6ZA 3O9NA 2NSXA 1F5ZA 4C1NA 2QCHA 1E0WA 1Q13A 2YPIA 2NZLA 1IZCA 2H6RA 3OJGA 2NUXA 2PDNA 1W1YA 3H21A 1LJYA 1RR2A 3R2GA 4J4KA 2Y61A 4XG1A 1OABA 2NQHA 4JNZA 2HK0A 4NXSA 1PX4A 5HAOA 1U30A 1BGAA 1WAUA 3TJ4A 4D8ZA 1X39A 1YTKA 5EMJA 2O92A 3T05A 1T40A 1B4KA 3WQCA 2CLOA 3GU2A 3RX4A 4ERIA 1EEXA 3NIYA 3DIPA 4DLMA 2Z1XA 1Y0EA 2YX0A 1OYCA 4H6EA 4CQ9A 2WSKA 3SUSA 5F2LA 4L6DA 4DYEA 4M7SA 3IEBA 2QXWA 3NL5A 2QAFA 3G6LA 5BWFA 3VCRA 3W28A 2FPYA 4DF2A 3L12A 1WYIA 3QSRA 4HPXA 4M7TA 3U2OA 3PB0A 1AUSL 3RR4A 1EX1A 1QO2A 3HPSA 4JKMA 1OGSA 1VEPA 1FCBA 1G4TA 2CW6A 2NV1A 3TCSA 1R9YA 2W79A 1MW2A 5B7YA 2WVUA 4C65A 4UC5A 5FA5A 3TX9A 1H7OA 3P60A 2FZDA 3EOLA 4AU0A 3SSJA 5FAJA 5K4XA 4DXVA 5CQ1A 1VCFA 4MNKA 4NXKA 1V4YA 1RCXB 3CK5A 1RAKA 2Z26A 1KWKA 2HBXA 2C18A 4GVIA 3W76A 2CHOA 4IPLA 1BXBA 3ONCA 4K7VA 4IPJA 1C7TA 4V28A 5EB8A 3JS3A 1KB3A 4YXGA 4LXFA 3H6OA 2YA0A 3PS7A 3NQBA 2IKJA 3ITVA 2O7SA 3JW7A 3TXZA 4JIRA 3W25A 3POHA 5LA1A 7CGTA 2VO5A 3WDQA 4RK8A 3O1NA 3TROA 1LORA 2VDGA 1YPXA 3M0HA 4FSAA 3FFSA 5HOSA 4S1FA 1OX6A 2A3BA 3CQJA 1CW2A 3UJ2A 4IT1A 4U2YA 5F2GA 2FVMA 2V8ZA 1YADA 3S9YA 2NW0A 1KFWA 5BNKA 1NWTA 4PUUA 2WHMA 2OZ8A 1GEHA 2ZYFA 2ZZ5A 4UXDA 5GJPA 2QQ6A 3CUZA 1A0DA 3L4UA 4FF5A 4UNKA 1DQWA 1E70M 3S42A 4HZ8A 4J3ZA 5F1VA 4ZQMA 4CU7A 1TV5A 1VF8A 1K8ZA 1ZENA 2Z2BA 3MP5A 1DYSA 1Z44A 2ZRZA 2XUCA 1QPQA 2DW6A 3GTNA 4ZZ9A 2OQHA 3U9IA 3B9EA 3MYPA 3KL0A 2ISSA 2VX5A 3KVMA 2GQAA 3QOMA 4TU1A 1XS2A 3P61A 3MI6A 4JCMA 3G77A 2CBUA 1QHOA 1UUMA 1JZ6A 3H7VA 5FCZA 4LY8A 4D71A 3HPXA 4I5XA 1K02A 2PRMA 2OVLA 1BYAA 3PULA 3UWUA 1PIGA 1OF6A 3UJEA 3PPCA 1DV7A 1A0EA 1M01A 4MIMA 1RP8A 1UH2A 1WKFA 3H2EA 3SZ8A 1G7VA 1MW3A 3AU2A 1N2VA 5KZDA 1EF2A 4HTBA 1RV8A 4KCVA 4LVBA 3FJNA 5I3KA 2WM0A 2V69A 1GOXA 1GYLA 1N55A 2OJPA 2PWEA 4JQAA 4JYEA 2RGMA 4KFNA 5BYWA 1I1WA 2XIBA 1B0IA 4JIQA 1S2WA 1EC7A 3W4RA 2WSPA 5D33A 3L2LA 3M0VA 1TPWA 1RA5A 1WDQA 4GGBA 5DCBA 1Q6RA 1WCGA 2CZVA 4TO8A 3RO6A 5BRQA 2DH3A 1OEPA 1HZYA 1E6QM 1V3JA 3OHIA 1C7SA 1EJSC 3C0SA 3V0UA 3B4YA 4GRSA 3GR8A 2GVLA 4G5DA 4UTLA 3O6YX 2DEPA 3LPPA 2GK1B 4P7NA 2NT0A 1VGAA 3LGEA 4JFUA 2NXIA 1OK4A 5C7HA 3CZKA 1XSKA 3QC0A 4H9MA 2XM2A 3F4DA 4ZQOA 2Q02A 1XLDA 1V93A 4LW7A 3ECQA 4F8XA 2BY1A 5CGTA 5H6HA 2NQJA 1P6CA 3VC5A 3IWPA 1FBAA 3MS8A 2OSYA 3KZPA 1W31A 1EGMA 4LS1A 2OT0A 3SO7A 3TUUA 4FLOA 2YCLA 3E0IA 1Q5MA 3O63A 4TXEA 4UFLA 4UNLA 1IEVA 3KUMA 4RKAA 3BGJA 1W17A 4QDPA 2IPWA 1N8IA 1RK6A 3M7WA 3RM8A 4OECA 4BQ5A 2QIIA 3LCLA 2HS8A 1R3SA 1Q85A 2J9YA 3W7DA 4A8NA 4LANA 2FDMA 3NSMA 4E6MA 5G1YA 3TW9A 2OLSA 3H2OA 4Z1CA 1H41A 5CSSA 3L5LA 1FWSA 4WSHA 4XZMX 2WNWA 3VMNA 1GOKA 4L1GA 3RCMA 5BU6A 1V02E 4RXFA 1E72M 1B3WA 3GE7A 3GFZA 3SCVA 4QAIA 4ZOCA 3WBXA 2BMBA 2PRHA 3TQKA 4UQDA 1ONRA 3OLIA 5JMUA 1WDSA 3M0JA 3ABSA 1Z7AA 5D2XA 3HGJA 2IMRA 1UW9A 3VM5A 3DAQA 4XZHA 3G0UA 4JTRA 1JDEA 1RQHA 3DFTA 1HKIA 2V5LA 1EO7A 2CCRA 3M47A 3TNBA 1HKWA 2ATMA 3UBPC 2Y6ZA 3ERPA 4N9EA 3TMQA 4NU7A 4NNBA 1REQB 2O7QA 3WO8A 4F0MA 3JVAA 1DEDA 3R58A 4HNNA 3E38A 2NQ5A 3MZ2A 3VD5A 5JVLA 3G3MA 1UD5A 3VNMA 3W7GA 5MKGA 4PEEA 3V3WA 5HR7A 2QW5A 4LCQA 3QXBA 4LVFA 3W53A 2DVTA 4EXAA 3EA2A 4NUWA 2OLHA 2D0HA 3N4EA 1ZJHA 3PN8A 3T44A 2PZ0A 3IJ7A 4PSPA 1KBBA 4HNUA 4CNNA 1W2VA 4GNKB 1OINA 4NZ5A 1W37A 4GWEA 1JUEA 4BF9A 4JYDA 1KTBA 3ZR5A 5JBEA 2DQXA 2QV4A 4MNMA 3C2YA 2E77A 1PKYA 2OX1A 1XXXA 1AZ2A 5C5YA 1JPMA 1HGWA 1BVNP 3PANA 2VFHA 1N82A 4GIEA 4J3TA 1WQ5A 3HJZA 2JQXA 1J5SA 2EBNA 3IJ9A 2VELA 4PMDA 1E43A 1SU5A 1GTEA 2OPJA 1Q3NA 3SY5A 3NQ2A 3NL3A 3WUBA 1E9LA 1Q6DA 4DJDD 2WZIA 1KD0A 3RMJA 3H23A 2OGJA 3EWXA 3KRBA 5EBAA 1KR0A 1JF6A 7ODCA 1SM9A 5K4ZA 5C9UA 3CPGA 2E5BA 1X7FA 5G5IA 3SADA 3TCEA 3ARQA 4HK7A 1OSEA 2O9RA 3WJZA 2FH8A 3LPOA 3WJYA 2ZXBA 1TZ9A 4Q8NA 3GDMA 2PFHA 2BY0A 2C8NA 2EGZA 1G69A 1DBTA 2IQTA 4D72A 2VJXA 2W62A 4UFHA 1D7FA 3BOLA 4QJ5B 5CCZA 1XIGA 4ZENA 4ZL1A 4NYUA 4RUBA 3QW3A 4N7QA 1YX1A 3MQTA 5FJOA 3TIMA 4TVUA 2PU1A 3LY0A 3MHGA 4LU0A 2YLAA 2OZTA 3GW0A 4FOUA 3QGVA 3VIKA 3GG1A 1V5XA 3QC3A 2ZA3A 1R3TA 1EDGA 4O1FA 1XKYA 3GU9A 3N1AA 2CBJA 1W3JA 4Q7BA 1AJ0A 1JYXA 4MJ2A 3PVFA 4OV9A 2BOEX 1HP5A 1QNSA 4KGLA 3CU2A 1X6UA 2G3IA 3UZYA 1J0ZA 1FH9A 3VI2A 1DP0A 1Z48A 4H9VA 4GYPA 3QW4B 4QRNA 1AD4A 4YL2A 1LT7A 2PODA 3NQEA 1L9WA 2D73A 1A5AA 1ZAJA 4JTTA 4NT0A 3LTYA 1HNYA 3AROA 1KO0A 4F0KA 2GOUA 4IMAA 1IWBA 3LNMA 3T55A 4JL1A 3HGSA 4DM1A 1O5QA 2JEQA 4QDWA 1KBIA 4A3UA 3VOJA 3SIMA 4DPPA 2PWUA 3AU6A 3STEA 4YVXA 4NSBA 4S39A 1E40A 1XD1A 5D2TA 4FIRA 2PLJA 4GVHA 2NLYA 2WVSA 4QG8A 4PUEA 3HFYA 3OP2A 1M68A 4FEZA 1ADSA 1Z32X 2CZDA 1OX4A 3VUSA 2CYGA 4PL1A 2GJPA 3DHPA 2VQTA 5BMXA 1FHUA 1C90A 2CBVA 1ZSXA 3K1DA 3KBJA 4G7EA 1J79A 2Y7EA 3H4WA 4G7FA 1TPDA 2ODOA 4GNVA 2D0GA 2D2HA 4CQCA 2BXVA 3NQCA 4EKJA 3AIVA 5LKYA 3PTMA 1IF2A 4J3UA 3STFA 1I0BA 1OQFA 5HR6A 1TTJA 2V3GA 4QIUA 3W1RA 3UG8A 2IQ0A 3TYCA 4JKKA 3F2BA 4HSHA 3ZM8A 1W6TA 3STCA 2DSZA 3QY7A 2I9EA 4S3EA 4YHGA 3G0XA 3MUAA 3LCIA 3BQ5A 3AQUA 3UD6A 1YXDA 1NOFA 3AZSA 4O11A 3EDFA 2D20A 4JGDA 4I9MA 4RDZA 3PBYA 3ITLA 3KW3A 3LPFA 4H6RA 4HPGA 3PZNA 4WXZA 8RUCA 3T0CA 2XWDA 2ZBTA 4H8UA 4HMCA 4J3VA 2DZWA 2XVLA 3NOEA 4IJBA 2PP0A 4MZ1A 2VVSA 3ARUA 2HTMA 3EKGA 4DWDA 3BAYA 4R9XA 1EJXC 1QMLA 2XWEA 1LOLA 3P67A 1AFSA 2J7BA 3KOWA 5LA2A 3GDBA 5A8GA 1J4EA 2NUYA 2YW4A 4QXIA 3OBEA 2CHNA 4MLJA 3ITCA 4ADUA 1XUZA 1DHPA 1MFUA 3A23A 1DXEA 1XIDA 3VD4A 1TO3A 1IXPA 4NZFA 3ZLFA 2BHZA 5H8MA 4GUGA 2E5DA 4AWTA 4N6FA 1QCWA 4CNSA 3D0CA 4MY8A 4JDBA 1JR1A 1B30A 1AQFA 3BAKA 3S6DA 4OKDA 1UUQA 1QAPA 3GVWA 4Y9AA 3CPUA 3KAOA 1Y7VA 3BG5A 2REQB 5BXPA 4CN4A 2WMHA 3UT0A 4IP7A 1F4AA 3THUA 2C1HA 5D04C 4DO5A 1ME9A 4BHYA 3Q4DA 4REQA 4WXYA 4KEZA 2EQDA 4JBRA 3R4IA 1MVYA 4B91A 1U22A 3ZFHA 1IXQA 3AHVA 1CXKA 2A3CA 1WV2A 1IZJA 1QO5A 3WCZA 3WNLA 1FFRA 5DBUA 2OFJA 5J5DA 3IIPA 2GSEA 2YCKX 5CG7A 1A53A 5CZKA 4IM4A 2VWTA 4IGMA 3M0IA 2ISWA 5M03A 3V36A 3LU2A 2PDHA 1NVMA 3J7HA 4CQ8A 3IUHA 2FYMA 4F2UA 1AMKA 4CD6A 1JXJA 3MKCA 4PBEA 2Y0FA 1HN1A 4Q4MA 3FW6A 4RZBA 4XBKA 1VFMA 3S1VA 3EMQA 1S5MA 5CPSA 4JS3A 3LSBA 4QDMA 4UCFA 1SZRA 3BLKA 4ERGA 1THFD 1WKDA 1YQ2A 4JDYA 2HISA 3T4CA 2NV9A 4K6AA 3OA5A 2WMJA 4ENLA 1J2BA 1NAL1 2Y1HA 3CLMA 3PSVA 3VMOA 1PSCA 4AZ5A 3ABQA 3WJXA 5D02A 4AZCA 5DO8A 1T8XA 3N2XA 3VNYA 3GR7A 4I6VA 1BLIA 3RRXA 4GXWA 5KINA 3ZT7A 4MF4A 2EPOA 3B0YA 3PWGA 4TX8A 3BJSA 3RHGA 1R86A 1TR9A 4W89A 1WXJA 1WDWA 4H00A 4C7DA 3NQFA 3QZ6A 1P5BA 3NL2A 4IPNB 1TTIA 3LQLA 4HSOA 5C9XA 4IQLA 3A5FA 2HZGA 4QJ1A 3W7NA 1RLCL 3KBSA 3MZNA 1FFQA 2G41A 5DMNA 3WQ8A 4A2SA 3VOFA 5G2HA 1C8YA 1M9HA 1VPYA 4LYRA 2A85A 4RNIA 5HJXA 1YE6A 2JIWA 1RY0A 3L4YA 4S3KA 1MZRA 3VNDA 5C2XA 1TVLA 1S2TA 4NNCA 3OHMB 3E49A 2Y8UA 3DFSA 3NCOA 3OYZA 4PUKA 4A3RA 3GXFA 3FXYA 4UR7A 2QR6A 3TR2A 4NJGA 3PZTA 4V33A 5I78A 1F6KA 2E6FA 3TZNA 2VFEA 3RNDA 4HZ6A 1TPVA 1TPUA 1POJA 1EOKA 4OU1A 1KLYA 4QHRA 4UQCA 2R1LA 4X9SA 5CJNA 2PWVA 4O50A 3OG2A 5FKYA 3LGGA 2OMAA 5JIPA 3RJXA 1U5VA 3S5SA 1M65A 4L4MA 3F7JA 2ONEA 3C3UA 3IIXA 3O0KA 3T2QA 1JJKA 3GXNA 2WAGA 2QJJA 3S2CA 2VGGA 4IIGA 4LRTA 3AUJA 4W86A 1FWFC 5D05A 1Y5WA 1SO5A 1HT6A 3L5AA 1I60A 1VHCA 4JKLA 3L2MA 5DMMA 2XFRA 4C7GA 2UY3A 2F9RA 2Y5EA 3A3HA 3KWXA 2BASA 1JZ3A 2QPXA 1NF0A 1TQJA 4EF9A 2FKPA 3GZ3A 5C55A 3AS2A 2WANA 4CQBA 3HOJA 1C8XA 1DIDA 3PTKA 4AVOA 3E12A 1BKHA 3G1DA 2RDTA 2VQUA 1Q6EA 3TSBA 4Z1DA 3QR0A 1EOMA 1LWJA 3VOIA 2ZTJA 4W8AA 1OCQA 1HVXA 4WCJA 2DY3A 3B8WA 2I1OA 5G2IA 3GHUA 4W93A 2PRLA 5J5RA 3R0UA 3SUVA 3FSTA 5FEWA 2EG8A 3A3XA 2UY2A 1WX0A 3VD7A 1VBGA 1W1VA 3OVGA 5AHNA 2QCDA 3KVKA 2IS7A 3WDRA 2I5QA 2VZOA 3AXKA 2VOTA 4QLKA 2GGHA 1YRRA 1FDZA 2W63A 4LNCA 4UOJA 4WJ8A 2AAMA 3MUIA 4LAZA 1UR2A 3TWBA 3L9CA 4UBPC 4BS0A 2V81A 4AC7C 2E25A 3FSUA 1FY6A 4X3ZA 1XP3A 4H83A 3BSMA 2XSBA 1KM6A 1CXHA 3O07A 4A3QA 1E51A 2V5BA 4BI5A 2VXNA 4B92A 1XSJA 2BG5A 2ZRWA 1VPXA 4XAZA 5GPRA 3CASA 5A3HA 4YVVA 4DNHA 5A2CA 4XBJA 5F2MA 2KX9A 1UROA 3EWZA 3EPNA 5FJUA 3UJFA 1E1CB 3R0DA 5ABGA 2CLLA 5EA9A 3NZ1A 1K3UA 2PDPA 5G4EA 1JI2A 4XZBA 1DJWA 1IEXA 5C71A 5AYIA 3AMGA 1PO9A 5I2UA 2A6LA 4QJ3B 1AL8A 4QE1A 4GCXA 1NDVA 3TN6A 4EVZA 1Q6OA 3GC5A 3ME3A 4N42A 2J9ZA 4W8LA 2G5WA 1ISZA 1GNXA 4IMGA 1M1BA 3M6YA 3ELFA 3MKVA 1EA0A 3OGRA 4OUEA 4P8UA 1KFCA 2DT2A 4YTQA 4H9TA 4UIOA 4ZEPA 5CLWA 4O28A 2W92A 1DE6A 4F40A 1VS1A 1GZGA 3TZFA 4G2DA 5H8UA 3AXIA 2D69A 1JUKA 2ZZ7A 3SQLA 3SGUA 1ODUA 2R1NA 1MZHA 1Q6FA 3KVLA 1OYBA 4ZMGA 5I5RA 1UUOA 4GZIA 1X38A 3BLPX 1KBKA 5BMWA 1A5SA 2J77A 2VFGA 3SGZA 6TIMA 3ANVA 4B4FA 3W3OA 3H24A 3Q65A 1H7NA 1EX5A 1B3VA 1VIZA 3C4UA 4WR3A 2V63A 5E0CA 3MT1A 1EGZA 3DYMA 1US0A 4ORIA 3VPLA 4QG6A 3RITA 3DH7A 4O13A 1FWDC 3FJ4A 1E6SM 1QHZA 3GDRA 4LQ1A 1KXVA 3EOSA 3UWWA 1OVDA 5D4YA 4EXQA 4XKYB 1VJIA 1M7XA 3NM3A 5K9CA 1Z42A 3MMDA 1GQNA 4AF0B 1J0IA 3WDIA 4TOQA 4FHAA 2DZPA 4WKFA 2E1WA 4WVXA 1L2UA 3NPXA 4QGCA 3B8VA 2D1ZA 2C79A 1MFVA 1JAEA 4NJJA 3G1HA 1FWIC 1MEHA 4EPEC 3VAVA 4Q4RA 1HF6A 2DORA 2E67A 3B3DA 1UZ1A 2QCFA 4E5TA 3TQ0A 4JTKA 3ZWTA 4OE7A 1LQ2A 2PSNA 1BVWA 3CHEA 4XZWA 3PF3A 1OGGA 4ICCX 3AMLA 3GXMA 2J7GA 4LV4A 3IVTA 4L9YA 1XYLA 3PWIA 1PE1A 4DHGA 5CAHA 3BZGA 1TELA 2QPSA 3L67A 4US5A 5CLTA 4PZVA 1MMFA 1KFJA 2VNCA 4LFYA 4FB7A 1R3VA 2QAPA 3AIBA 2OO6A 4E4PA 3VKBA 3NDZA 1KCLA 4AG0A 1R87A 4HTYA 4OV4A 4PBFA 3R1ZA 1XYAA 2J8TA 1ZTVA 3H2MA 3VE7A 4HCHA 5AYXA 3TKFA 4AIEA 3ITXA 3HO8A 3A13A 1G9HA 4QNEA 2WKJA 1QJWA 1G1YA 4M81A 2ZXDA 1UP3A 2G50A 3LXBA 3LM7A 1GJWA 3LERA 1PKNA 1SFLA 1Q4WA 1VKFA 3CAWA 2FJKA 1EIXA 3H7UA 4BQ4A 4AD5A 1TJ1A 2GZXA 5HQLA 2VGFA 3WUFA 3N6JA 1NQ6A 1I2QA 2DZSA 5HINA 3WQ4A 3WUEA 4O10A 1GPWA 2WLZA 3K4DA 2X0HA 1SR9A 4W9TA 3CUXA 3IACA 2A6NA 1WB0A 1Q6LA 4Y7EA 3BLFA 1POKA 3P93A 4QQUA 4GIAA 5GVJA 3NZQA 1B3YA 2YGYA 3NYDA 1A5BA 3E2RA 4MG4A 4ZO9A 3EB4A 2ABBA 4QJ4B 1EUNA 5ABFB 3EPOA 3CB8A 1DJGA 3NO3A 5ECVA 4AY1A 3B9OA 1SFTA 2V3EA 3G6MA 5DT5A 2DSVA 1BAGA 1KCXA 4Y90A 4A6GA 3PY2A 3C2OA 3ALGA 4Z17A 4CCZA 3ENLA 5TIMA 3CHCA 2A1YA 4JN6A 4GINA 1BYCA 1YDOA 3C2FA 3ABOA 2G96A 3TU9A 1CIUA 3DBNA 4K38A 4P8VA 3RLUA 2CETA 3OQ8A 4ZR8A 4E2BA 1MDRA 3GFYA 3G2GA 4B3LA 5HNNA 4XZIA 1UKPA 5AOUA 3HQNA 5FJRA 3QYQA 1XIHA 1TV3A 5EYWA 4DWSD 2WNQA 2VT0A 4FNPA 1K8YA 4GK8A 3O6DA 3N34A 3HMJG 1BWVA 2DJLA 5CH9A 1SFJA 4Q6XA 3THCA 4H8HA 2Y8KA 2Q09A 1NDZA 3FHQA 4UOZA 3T42A 4Z42C 4CCEA 4HU3A 4GX8A 4GX9A 2V9DA 1IEQA 3W2KA 4P2VA 3WQEA 1RJQA 2I5IA 3G22A 2EHHA 2VEMA 1DORA 4B15A 1I2NA 5E1QA 3W37A 1QFEA 3EEGA 3UVIA 1DQXA 2ZZ4A 6XIMA 2P53A 3WLQA 3LHWA 1GQJA 4FO4A 3VKKA 2XSAA 3THAA 4M6VA 2ACRA 1ZHAA 3O3RA 1O6IA 5LIUX 3CWNA 3N73A 3BPWA 1V7YA 1DJIA 1VAHA 2WMGA 4N9BA 6ENLA 4N6EA 2NXGA 1OCJA 1YEYA 1GQKA 4MTVA 3IV3A 3KRUA 3LN3A 2R94A 3SCSA 3UF9A 3P62A 4YLWA 1JCTA 3CUFA 1V3HA 3ARZA 3IJQA 4MFEA 4CNPA 1J5TA 1WPCA 4OOZA 1GQIA 1QPNA 1QNVA 4KWSA 4GYFA 3RU8X 1RCQA 1XFBA 1TFVA 4LF1A 4LYPA 1RBAA 1AA1B 1MXDA 3OEXA 4LEQA 1LRQA 4NAFB 2X1SA 2Z7KA 4OWGA 1W32A 1PZ3A 3KX6A 3NA8A 3RPMA 4IQEA 2J75A 3WLPA 3RFAA 1A5NC 3RR1A 2XIJA 1MWOA 2XPKA 5CSRA 4Y8FA 4B90A 5IXEA 4PUDA 4A35A 5HJYA 1UWUA 2J9XA 1EPVA 4N02A 4PMVA 3BH4A 1OFQA 3LZ5A 3QBUA 4CCDA 2BV9A 1ECQA 1ZS2A 4FOJA 2ASHA 3POCA 4ZOAA 4DI9A 4Q8PA 3NQ6A 4Q8WA 3MCNA 3G24A 3MO7A 4C6IA 3VVGA 4MY1A 1E9YB 1MNZA 4EAMA 2XH2A 1V6XA 2F2KA 4QQ3A 5KZ6A 2CFFA 4LUJA 2VEPA 4NKCA 2ANUA 5EMLA 1UJQA 2V68A 4K8HA 2ZICA 4MYXA 1I75A 1XIIA 3KM8A 3QFWA 3NQ8A 2DH2A 4IUGA 3MHFA 5MHBA 5J8LA 3WQGA 4C91A 3N2MA 5CPMA 1UOZA 5M17A 4EE9A 3E74A 4LS2A 1Y5XA 1W1IE 3O15A 5FEPA 5FIPA 3V4BA 1XLLA 4IZGA 1JPHA 4CD5A 4PUNA 2WSQA 3QSTA 3WQWA 6TAAA 2CXEA 4QSFA 2TAAA 3WUGA 1W9UA 3A21A 2QVHA 3W01A 2TSYA 4MKNA 4HZMA 4NJKA 4UOQA 1AODA 5MF5A 4PEKA 2WLYA 1NOUA 1E71M 1OADA 4LVAA 2CLFA 1B3XA 3ZWSA 4U2ZA 2O9TA 3OZYA 4BY3A 5AYZA 2FZMA 3WEOA 2PF0A 1HL9A 3DKLA 2B7NA 2Y7FA 4FPSA 1JPDX 1ENUA 3Q94A 4QX4A 3OGSA 3G1XA 2PURA 1B31A 3I4KA 3B9NA 1AMYA 3H2CA 4A4AA 3QF0A 2ZZ2A 2O4QA 1J2WA 4HA4A 1FXQA 3BZJA 4MADA 1ZL1A 4E8CA 5A6AA 3P8JA 3CMGA 2PGEA 3IARA 4BR1A 3TAOA 3O16A 1KGUA 3GH7A 3EDEA 2ZUVA 4ZODA 3AYVA 3O8AA 3UESA 3UXIA 2PD5A 4L4LA 2A3LA 4QAWA 3MCOA 1TE6A 1OC7A 3NSNA 2F38A 4UTHA 3BCJA 4F0SA 3W7JA 3OVRA 1US2A 8XIAA 4JTCA 3SCRA 1TZ7A 2P0IA 1E3ZA 2C7FA 3REQA 5D2YA 3AXMA 1BSIA 2QV5A 3ABZA 5DCDA 1XGEA 4MUPA 4BQ2A 5FSDC 5JIWA 2VDHA 3USZA 1XLAA 1OFEA 3BW2A 3EBVA 2ZX7A 2C71A 4LC6A 3CO8A 5HMEA 3B8SA 4JX6A 4MPKA 1M7JA 1G7UA 3TP4A 3DC0A 1V3KA 2VCCA 1DIKA 3MP4A 4M51A 3VFLA 2E9BA 1RXOB 2DP3A 4Y6GA 1LBMA 3FA3A 3KP0A 1D3CA 4Z2KA 4FR6A 3KOFA 3EWDA 3KDNA 4IG2A 3AIEA 3BURA 5JH2A 4JQ3A 4AUBA 2QULA 3FIGA 3ORWA 1YBQB 1GOWA 3C5QA 1F6PA 3C56A 3PPHA 1UIPA 2AAAA 4NG3A 3WNKA 4DI8A 3ZYZA 1WO2A 3F4NA 1K77A 1SZNA 6PTDA 4IQJA 2P8BA 4FIQA 3VOGA 2KZHA 1ZJIA 4IP4A 2ZFAA 1L6SA 2PDWA 3VOHA 1WP6A 1ZCCA 4W7WA 4EANA 4AB4A 1HJXA 3FGCB 4ZTYA 4W5UA 1GTHA 3EDDA 1OB0A 5D32A 2YR1A 4MWAB 1H5VA 4D8LA 4IPPA 1JD7A 2BVWA 2P8CA 3IIVA 3RILA 4HQVA 3LRKA 3CAQA 5A5WA 1XBXA 2F84A 3A4AA 4YYFA 2XH0A 1CI1A 1KKRA 2VC5A 3T09A 3F5KA 2GUUA 3NJ3A 3FDKA 4HK6A 1KRCC 2AMXA 4PC8A 4JR5A 4GY0A 4TMBA 4ZFCA 1JDCA 1QK0A 3SRDA 3DENA 4GZJA 4WDXA 3WNNA 1NWUA 3KE0A 4LY4A 3UZXA 1GOOA 1WA3A 4WDWA 2AQVA 5FACA 1KFEA 2GGIA 2J74A 2OQLA 1XGZA 4OTKA 3INPA 2PDKA 4PCTA 3B8IA 3VCNA 3K8MA 1XHGA 4XSLA 4YMZA 1R9ZA 3AIQA 2Z7GA 1H7RA 1A5KC 2OODA 4NJHA 2F6XA 3PAJA 3UXDA 2PLMA 4GZEA 1MNSA 3EWUA 4QG9A 3T40A 2DQWA 1JGMA 1XQKA 4B5TA 3VIMA 4XZ9A 2X7WA 4DF0A 3RN6A 1A5CA 3GXIA 3WL0A 5PTDA 3QZAA 1UKQA 1JL8A 1S1RA 1MEIA 1XPGA 4XKMA 1IWPA 1RBLA 4F2BA 1NWRA 2PDIA 4DRSA 2ATSA 2E9LA 3W7MA 1UOKA 1AW2A 3BAXA 2VFFA 1OFBA 2X8RA 1EYWA 1ZAIA 4IJRA 1OC6A 3ARYA 3N2BA 3GIPA 3IRDA 3TN4A 2EPMX 1JD9A 5LNWA 3AI0A 1U1UA 4JNMA 5D2WA 2H3BA 2PA6A 2ZX6A 1BRLA 2QPUA 1XBVA 1R3QA 3TN5A 4IIEA 3W2MA 1V7AA 3MV01 3UPMA 3DZ1A 1HVQA 1XLHA 1R0MA 4HOWA 3ARSA 3BLLA 3NL6A 1XLIA 2BVDA 3U8GA 1QK2A 2EAWA 2G4FA 3HQOA 4K8GA 1X1OA 3ARVA 1FHVA 3LBMA 4GG9A 2FHCA 1JNDA 1XGDA 3U3HA 2I7GA 3U57A 4GYKA 1HGYA 4GYJA 2YCLB 2WYSA 1S2AA 1W8SA 4IF2A 2ALDA 4DJFD 4W85A 1UWRA 1EUAA 4P7LA 3UU0A 4J27A 3IK2A 2J7EA 2I57A 3W26A 3AYRA 1E6NA 4Z08A 5BOFA 3LG3A 1BXNA 4MJ4A 3SRFA 1GVRA 1CBGA 4ZXOA 2HNEA 2ZRYA 4QS6A 3LLFA 3VTRA 2ESCA 1PZ0A 1L6YA 3CV2A 4RW5A 4ZA0A 5E9XA 4YVPA 4H9ZA 3RPTA 1CWYA 4MSSA 1UD6A 2GSHA 4IFOA 3AS0A 4GC4A 4HYWA 3V75A 3M0KA 4YTTA 4AVNA 1QBBA 3WQPA 2ICSA 4RDYA 3TJXA 3AMCA 3UWQA 5DT7A 4XVDA 4MAZA 4RJEA 3BLOA 4PA8A 4DEFA 7REQA 2J7HA 1W3HA 4C6BA 4WF7A 2QUVA 1CEOA 2OCZA 3S1XA 4DBUA 4O12A 4P7RA 4ML4A 1KCKA 3S6OA 1T96A 1P43A 2VFDA 2Y7DA 2C0AA 4PTXA 3WLNA 4KERA 4GO8A 4KS0A 3URNA 3RPDA 5LGXA 3EOOA 3P84A 3CBWA 4DO4A 1NEYA 1W5OA 3GBDA 1D3GA 3HM7A 3VDCA 1U83A 1UQZA 1P6BA 1XLKA 1ISYA 1XCFA 2ISFA 2PC8A 3LHUA 4JHMA 1DJHA 3P14A 3W72A 3L4TA 3FEMA 3QV8A 5LA0A 5HA7A 2YDRA 2MNRA 3RO8A 4Y9MA 2GDQA 1PHQA 4QR6A 3TQPA 4QCFA 1V8EA 4WDUA 1TR1A 2QGHA 4AH7A 1QHPA 1E15A 2OO0A 2W67A 5FF2A 1LBLA 2BHYA 2JGQA 4M6QA 1NU5A 1OCBA 5DXYA 1J12A 1J0KA 4XBSA 1TMQA 2J8FA 4BWLA 3GH4A 4GUHA 1NF7A 3EWYA 4XB3A 4JFWA 3CM4A 2WM1A 1DXIA 4MGGA 4WSJA 3GY1A 1VFHA 4PMNA 2DVXA 3BL3A 1KWGA 3RDKA 3PTDA 2CLHA 3QGAC 3I3BA 3AXHA 3NPUA 4H04A 4L9ZA 4CN1A 4KEUA 1F7BA 3NPWA 4TVCA 2G8ZA 2YJQA 1GYMA 4JXCA 1XICA 4JHOA 3KLKA 2X1RA 4MDOA 3HQ1A 1BD0A 5BOEA 2GVYA 2I5GA 5FL0A 2WZMA 3FYYA 3SRHA 1GZ1A 3QY6A 2Z00A 3CPRA 2OZ0A 3F5LA 5L9FA 3M44A 3M0LA 3VGDA 1BXCA 4JHZA 5EKYA 4GVGA 4YN5A 2RH9A 4D1JA 3WQOA 1P0NA 5CBIA 4IX2A 4IUOA 3WFAA 1GVFA 1PEZA 1QW8A 4Q8OA 5KEZA 4AIUA 2UY4A 5LIXX 3P74A 4F48A 4YJ5A 4C1LA 2DGAA 4U5KA 2L5HA 3UNDA 4UTTA 2YDQA 8XIMA 1J11A 3IVSA 3A47A 3ARTA 5CSUA 4XK2A 5IOBA 1N7KA 4V27A 1MEWA 4GISA 1H4PA 1KM3A 4LOCA 4F66A 5CC3A 5A6TC 3B97A 6XIAA 1ITXA 3FKRA 4QLLA 1WDPA 3QQ1A 1O66A 4H9XA 4LB3A 2JF7A 2TPSA 1GOIA 4I9TA 3PUEA 4OT7A 3TLQA 3MY9A 2ACUA 5FF7A 1I6NA 4I3GA 3MMWA 3MSRA 4ZFMA 4DZHA 1U5HA 3CZGA 1P0KA 1W9DM 4DB7A 1EC8A 4V2XA 5I3FA 3MPGA 3I3DA 4DLFA 4U31A 4Q3MA 1UASA 2RDXA 4Z1YA 3DERA 1FA2A 5EGRA 5GNZA 5DMLA 1M3UA 1H49A 4PTMA 1GK8A 1UG6A 5LIKX 4IL0A 5T91A 3C61A 1SMDA 1V3LA 3QY8A 3AJ7A 2GK1A 4JTHA 3KOXA 3L4WA 2YBVA 2QCNA 1K70A 2ZXAA 4GI6A 2JK2A 5HNTA 3G1VA 4D6JA 4RXGA 2J79A 5XIAA 1O1HA 3HGRA 4GKLA 4E2DA 3W6LA 3EXTA 4UWMA 3ZSSA 1R2TA 4QFUA 3VZXA 1RD5A 4TQTA 2PTDA 1UPPA 3T08A 1XRTA 1BWLA 1EP3A 4KCUA 1VFUA 2FJUB 4IJCA 1C29A 3QR3A 4DBEA 2X7VA 2GL5A 1DWIM 2NX1A 3S1GA 4X0NA 4PCFA 2WSRA 2O9PA 1MYRA 4DBWA 4JTDA 1NELA 1A5UA 2RDWA 1MQRA 3ITGA 2WJDA 4ZQRA 3L7RA 1AL7A 2IXUA 3B0VC 2EPKX 5DRIA 4FXRA 2FVKA 1FHLA 2B81A 4Y2WA 3S3GA 4GQQA 2E3ZA 3DFHA 4AMAA 2G37A 3VNIA 3K2GA 4LALA 3LQGA 3O05A 1XYMA 4PRTA 1JGIA 4GJIA 1F05A 5CBJA 2VMFA 2ZIDA 3UG5A 3L0NA 1KTNA 4HOXA 3B8UA 2XN2A 1DIOA 4CVUA 3CIWA 1XWYA 4DIAA 1MO0A 1ONWA 1W2PA 4EIVA 4A3HA 2E6DA 3WFLA 5CC5A 2XSXA 1U1HA 4C6OA 3ABRA 3T0DA 2I16A 2BVYA 3FYOA 1XW8A 1PCWA 3I6RA 4UTKA 1FTXA 3UWZA 4DAFA 5A95A 3MANA 4MZYA 3UR2A 1Z8AA 4Z2IA 1Q66A 3M46A 2Y24A 1GYNA 3F4CA 3ZJ8A 1Y8BA 3I6EA 1TJ2A 3RCYA 1UWIA 4J3XA 2Y7GA 3T4WA 3A6OA 2X2YA 1QPRA 1QU4A 3OB8A 5A6BA 3E0WA 3L4XA 4EACA 4GFIA 2F6UA 3IAPA 1W5NA 2GGGA 2ZA1A 1Q7ZA 4S3AA 1DQUA 3EKLA 2Z28A 1CTNA 1XISA 5M1TA 2GJRA 3I3EA 2YCIX 2A0NA 2FFIA 2XU2A 3UPBA 2OTDA 4HGXA 3S2JA 1ZCOA 2CKSA 5C0QA 3QHNA 3OIXA 3L4VA 4B2DA 1R2RA 3KTSA 3WG6A 4K1GA 2Q01A 2HPIA 3K1GA 2VRQA 1TJPA 1V0LA 5CZJA 5EU9A 4WJEA 3TTOA 2D23A 5A8QA 5FSEC 1B57A 2AGKA 3WLLA 1QATA 3HURA 4HKPA 4FXSA 2VHLA 1ZGDA 3WENA 1CXIA 3Q67A 5DMYA 4IWWA 4PB5A 2VZVA 4F3HA 3WJWA 4K7YA 4B9ZA 5EMKA 3B0XA 3CEPA 3N19B 2PP3A 3KHDA 1DHKA 2NXHA 4JTIA 1XQLA 1EDQA 1TB3A 1QRQA 1K6AA 3GU1A 1DPMA 3H12A 1C9DA 3S5NA 1N8FA 4RE0A 3W2NA 3K4WA 1GVQA 1LOSA 3WNOA 5E9AA 3ARPA 1XR2A 2Q3OA 1K6WA 3HA1A 3QHMA 1MI3A 1P0BA 1S5WA 1VR6A 1G67A 5GJNA 4M1RA 1RD6A 4R33A 2WJZA 1QOQA 3B03A 2PGFA 1HJVA 5DLCA 1M03A 1SFSA 2QVNA 5A2BA 4RNJA 1SZEA 1GUVA 3T1GA 3TN3A 1JFXA 1XCXA 4W8BA 2GQ9A 5E09A 1GORA 2C19A 1YNQA 2Y62A 4MFDA 1E5JA 5CJ5A 1FWRA 3M0YA 2A3EA 1C91A 3N12A 3W71A 3NZPA 4HMEA 3PC0A 1WBHA 3GVGA 3LCHA 3W1XA 4Y9PA 2ISVA 5DBTA 4ZB2A 1HL2A 1SO3A 1BF6A 4E8GA 2DZBA 4E3TA 3KEHA 2BVTA 3B9DA 4RW3A 1ZP3A 1LP6A 4C60A 4ML9A 1KBLA 2ZC1A 3CAVA 4GO9A 3SRKA 1QI0A 1XIJA 4FNQA 4IXXA 5KITA 3LMYA 2EEXA 2BGNE 1PCKA 1GGOA 2DT0A 5HATA 2I9UA 4E2OA 3AMDA 4GHRA 3QKZA 1UC4A 3GNXA 3OA3A 3R94A 1US3A 2JIEA 1PB0A 2WHJA 2OYKA 1CXLA 2H8XA 3UWVA 3UY8A 4WOZA 3CH0A 2DV0A 3VMPA 2YXGA 4HP5A 1JXKA 1A80A 1TE1A 3WK3A 4CGTA 2VX7A 3OZOA 1XYFA 3EDKA 2QCGA 1PYFA 1MRQA 3ZJ6A 4J1OA 4UMAA 3KBWA 2WHLA 4I8DA 1W5PA 3QN3A 1D8CA 4PMOA 4ROPA 2IXVA 3BOXA 4UQEA 1Z69A 3EB2A 4C6EA 3AO0A 2HWGA 2OEJA 3TJLA 4JL2A 1OYAA 3OG3A 3UA4A 2NV2A 5TQLA 4W88A 5BXSA 3CEUA 3DDMA 2B7OA 2IW0A 1JRCA 3WMLA 4A21A 4NILA 1LLOA 1UCWA 2VM8A 3CO4A 3L23A 3PTQA 4X63A 3W73A 3U4AA 1HXJA 1A5MC 2YSWA 3W1UA 1OY0A 4MYAA 4XIAA 2PDUA 1DKWA 2BY2A 3EX6A 1O4UA 3CQ0A 4QBXA 4RPPA 3WEMA 4R53A 1TTPA 4UTMA 4UTJA 4JFSA 4PCNA 3N04A 1B90A 1CGXA 5ECUA 3UZZA 2H3DA 4M19A 1SJDA 4LWWA 2IPGA 3UWEA 1ZBKA 3O0FA 3KCJA 3TK7A 1NSJA 1LF1A 1WZMA 4NX0A 2FGZA 3E2SA 4HNCA 1OG6A 1EJVC 1PUDA 1PKMA 1IE7C 1WAWA 4K1WA 4ZE4A 3WEZA 1I0DA 3D3FA 3CAKA 1J9YA 2VURA 1OIMA 4PUMA 1A3WA 1R46A 3T6CA 5K9XA 1KW1A 5BOOA 1PAMA 5D8ZA 2P0OA 4M6UA 1ZALA 3MC5A 4XSMA 3LTPA 4AXNA 4JTEA 4I6KA 1TYGA 4IMFA 5BXTA 3RLVA 1JCMP 3ZQ9A 2FGLA 2REQA 2V2HA 1DJNA 3KFTA 3SJ3A 3WLOA 4JX5A 4ALDA 1WOBA 3QM3A 2BTMA 5BROA 4GY1A 1PZ2A 3W38A 3U5UA 2YL9A 5IDZA 3PZUA 4XD5A 1F3WA 3Q2DA 4R9OA 1J0JA 4YTSA 3SUUA 2IKIA 3G3DA 3M4HA 2H9AB 2V3FA 2WZTA 4WKHA 3QRHA 1BQCA 3QV7A 1CXEA 3MSGA 2QUMA 4J5NA 1K03A 2EO7A 3D46A 4WD0A 2JFEX 2PTXA 2R1KA 3MB9A 4HBKA 1CCWB 1SO6A 4I9AA 1XIEA 2PD9A 5CZTA 1EO5A 4O0QA 2E5CA 3RJYA 4FX7A 1FKWA 1P0EA 2H8ZA 3H2FA 3IPWA 1L8NA 2NT1A 1VQTA 3SFWA 3VZZA 2Z1KA 1BYBA 1ZBWA 1G4SA 1LL4A 2ZC8A 1DWJM 4JIEA 4LCSA 1RPKA 3S46A 4UMBA 1OD8A 4IFKA 4HA0A 4HU4A 4H7CA 4MWAD 5LYRA 1A0CA 4JQ2A 2E0PA 5ENLA 1F3EA 1RHCA 4GOAA 4NAEB 1TWWA 2DVUA 3MCMA 3FEQA 4PBGA 1BFNA 1JCNA 2E40A 4AWEA 3WDHA 4AD1A 3KVJA 4V15A 2P76A 3GAYA 1L2QA 5E6YA 5HQEA 2BWGA 5LIWX 4AD4A 3H4GA 3UCCA 1KTCA 1UH3A 3ZVHB 1CENA 1TA3B 4QCEA 2DFAA 4CD7A 1XBYA 3VIPA 3G1SA 1LUCB 3URQA 4WY0F 1RQEA 1C8VA 4OVXA 3KCOA 2RHGA 1M41A 4PRWA 3BO9A 3LMZA 3F1QA 3N4AA 3SCOA 4KWOA 1PS9A 2CITA 4DY1A 4Q8MA 1UR3M 4RL3A 4ROQA 1MUMA 4RE4A 2D24A 1SMAA 3PZGA 1FCQA 4K36A 3HG2A 3OVQA 2Y4SA 3W7OA 2HRWA 1JYNA 4GUIA 3SSZA 1BVZA 3ALFA 4XUYA 1XG4A 3DEQA 1XRSA 9XIMA 2DSKA 3CQKA 4FALA 5ABTA 1ELSA 1XLFA 4FF7A 1HJUA 2OLAA 3OBAA 3NUKA 3HFTA 2ZX9A 4J35A 3MWAA 4M24A 3N3TA 4JIHA 4Z0SA 1TG7A 2OR2A 1WE5A 2J8GA 1G01A 1IEWA 4KGJA 1M53A 4CNUA 3WNMA 1J6OA 1KCZA 3RCNA 3BWWA 2CZFA 1H1ZA 3R12A 3FDGA 3NQDA 1P7TB 1WUFA 1B2YA 2Z1VA 3GDTA 4CQAA 1JQXA 3CWOX 4MMWA 4CNOA 1XYZA 3GK0A 2Z6JA 2YIHA 4IISA 1L0PA 4OUIA 2HS6A 4IHCA 8TIMA 1V0KA 2G4JA 4WK9A 2PBOA 2YB4A 3PZQA 1BG9A 3CUHA 3P0WA 5JXQA 4LSBA 2X41A 3TQVA 3P6LA 2E09A 2VC9A 4S3DA 3ID7A 4R7OA 1FP8A 1ZBCA 3WN6A 5REQB 3A3WA 3N9KA 1FP9A 5DXXA 1NFBA 2ZQ0A 3EX1A 4AZ6A 5RUBA 4XO6A 3P81A 2DU2A 1EKOA 3UR7A 4QITA 5CSYA 2WKGA 3SCTA 2G3JA 3P80A 4D6GA 5CC7A 1TWSA 2GJXB 4DZAA 2V38A 3A4XA 1UR4A 4JIPA 5EPDA 8A3HA 1EJRC 4DPQA 2DZXA 1UIOA 5LHEA 4US6A 1O5KA 4LH8A 4BQ3A 3QLLA 1JZ5A 2Y89A 3HB9A 3M0MA 2YBUA 2HE5A 1JZ8A 1K7EA 1ODZA 2VGIA 4JTLA 3SW6A 1NJJA 4FX6M 1R7AA 4HYRA 1NY1A 3V5CA 1LROA 1RY8A 3GB6A 1XV8A 1XC6A 4ICNA 2W6RA 4ZSUA 4DJFC 1QPKA 5AZ1A 4A05A 5HNUA 1UP2A 2C1GA 4BA0A 3DKJA 3JR2A 4BCEA 4CU6A 3BLEA 3JZUA 2VR2A 4DM2A 1Y5VA 2XVNA 3D47A 3KBVA 3MV11 1CLVA 3SUWA 4CKQA 2XN1A 3HPZA 4YWSA 4PFHA 1FOBA 4DWSB 1OT2A 1XRVA 3W86A 3GKAA 3WH8A 4OFCA 3NQGA 3EYPA 1QWKA 1VP5A 2BBFA 4AZGA 3W84A 4L1XA 3SQSA 5KMYA 4U3AA 4A8RA 2HPMA 1K7XA 5IBXC 3T2OA 3LCWA 1MUWA 3V18A 2E7FA 4ZQCA 1R6WA 3VINA 1JCXA 2FHBA 3OYXA 2D2OA 6REQB 1CGWA 2ISDA 1WXZA 2WCSA 2WZEA 2W66A 1D2KA 1S2UA 4OQVA 5HDRA 2C15A 1XF0A 3SBFA 5CZ0A 5DANA 2D2JA 3CJPA 5I7GA 3VD9A 3VK5A 1VHNA 9RUBA 3SN1A 2PDYA 5XINA 3OODA 4LUTB 4IMDA 3BMXA 3IJDA 3UERA 3U7BA 4O14A 1J0HA 1LOQA 5JU6A 1LWIA 1TRIA 1E1EA 1BF2A 2W5FA 3LD5A 3R11A 1ITUA 3VGBA 1LT8A 2WMIB 5CPQA 2HVMA 3WK0A 5EL1A 4EWJA 2OG9A 1GW9A 3ZVIA 3PZVA 4HNLA 3GUGA 1E0VA 4O1BA 4CEUC 3K46A 1JFHA 4ZB5A 3GR4A 3THQA 2YA2A 2X05A 3N6HA 2BY3A 2WNNA 2F2HA 1B5TA 4UNIA 4B5XA 1IT8A 1GONA 1BEUA 3FLUA 2GGEA 3FA5A 3GNOA 3CIVA 1TIMA 3TEVA 2HQAA 3NWRA 4CN6A 1UZ4A 5HUOA 4MLRA 3B06A 3VABA 4POCA 2CZEA 1EHNA 4OBTA 3WDPP 2QUUA 2IUZA 3V0TA 3CGTA 2XFFA 3NTYA 1KRBC 3PZIA 5ABEA 2DZUA 1ICPA 4M6PA 3NQVA 3WF1A 3A4JA 3M0XA 1EFZA 1RUSA 3VGGA 5FJTA 5HUPA 2JEPA 2ZTKA 4IP5A 4KBXA 4KRUA 4GKTA 3DHUA 2BFGA 2X1TA 4AF0A 5BW6A 2VD8A 4C6NA 1HG3A 1VD6A 4Q4OA 2BXZA 5AZ0A 1S38A 2NQZA 1UR9A 2GWNA 4HJFA 1ZU8A 1CGVA 3TSDA 2B31A 4J2MA 1ZP4A 2FDSA 1KRAC 1QDSA 3A12A 3GRIA 1TPFA 2OWXA 3QFEA 5FI8A 3N14A 2WB5A 3WIJA 2VRJA 4U3CA 2G95A 3L4ZA 5AC6A 4S3CA 3P5YA 4B3ZA 1LQ0A 3TA6A 3FJLA 4X61A 5KTLA 2B7QA 3AS3A 4HIBA 2ACQA 5DFAA 4Q4KA 1FDJA 3CC1A 2HEJA 2DUZA 1V08A 4KEVA 3LCXA 2WO5A 1LQAA 1EJWC 3WLKX 1O5RA 5E0FA 1XJBA 3VDHA 3A9BA 2CEQA 3LHVA 1A3HA 4B16A 4CLMA 1PDZA 3TOPA 2QKFA 4TX6A 1E0XA 3BVJA 4KFPA 4AD0A 1QW9A 2UBPC 1F6YA 2WHKA 2DT3A 4AMCA 5CAKA 3EMCA 3OTRA 1U33A 2FFCA 1XL9A 3DFYA 3PPFA 5T9CE 1G4PA 2PTWA 7TIMA 2QJGA 3BG3A 2CLMA 5M3WA 4YCOA 1NOWA 1UWSA 2ZUNA 4MKSA 2J47A 1QUMA 5HANA 4QLJA 2YKKA 1H51A 4E38A 4FNSA 3PPGA 3GXPA 1CLKA 1LZOA 4IOTA 3SCPA 1JULA 4HYVA 4TTGA 3K30A 3W7PA 1VIWA 3HTWA 2QS8A 1C8QA 2E9MA 3ANYA 5L6UA 1XUUA 3BCDA 2FPTA 3GG7A 1ITCA 4KKXA 3PG9A 3VO0A 4JN8A 3SCWA 1OZMA 2V2DA 5AY7A 4FP1A 4QE4A 1BWKA 3CV6A 1HP4A 1G6CA 2OOFA 2R6OA 3NSXA 2POTA 3W1PA 3GC2A 1DWHM 3WZ0E 3MP3A 5ABFA 3EGJA 3U7VA 2QZRA 2PI6A 1AQMA 4HHPA 3W2UA 4GBDA 3TYZA 4Q4PA 5CGMA 2PAJA 4OZOA 4HB7A 3S83A 2CHRA 3AHYA 4XD3A 5AC4A 4E8DA 2UY5A 5G2WA 1M04A 2FZ9A 3ZO9A 2A3AA 2FTPA 1JYWA 3M6DA 3TA9A 5FJPA 3V0SA 1FCVA 3FAXA 3GNPA 3NEHA 3U5YA 1HKJA 1KLZA 4Q8VA 3S9ZA 3RIKA 4LUSA 2Z4GA 1BKSA 3PJTA 1HKMA 5TNVA 3MWCA 3KLLA 3CUGA 4DELA 1NQKA 3FA4A 5LNRA 3DI1A 1J01A 4UTUA 4GBUA 1FH8A 1ADDA 2FHFA 5CPNA 3NPVA 2JGYA 4FXFA 4RNFA 3SM0A 1H0IA 2A2IA 2WKLA 1TV8A 2YOCA 4M5PA 1Q6CA 3RGTA 1YPFA 4DXXA 3T8LA 1UR0A 4LAOA 1RVGA 3WY1A 2AMGA 1OFPA 2WPGA 3KDOA 4WGHA 3VUPA 1QI5A 5IDIA 4UQ9A 4B5WA 3BE7A 2E68A 4ZQPA 3E5BA 5A8NA 3HPFA 1PHWA 4U28A 4GJJA 3LI1A 2BGQA 4AD2A 4AHQA 3M5ZA 3GTFA 4DN1A 4AEOA 4DBSA 4K8EA 1Q2RA 4L9XA 1OHLA 1TSIA 2AOSA 4GUFA 4O53A 1G5AA 3NYZA 4GIRA 4F4RA 3MI3A 1W3LA 4NP7A 3UW6A 3LSCA 3HF3A 4ONVA 4R5EA 2C16A 3GUWA 2EXOA 1R2SA 2PDJA 1UR8A 2PEVA 1TPH1 4G1KA 4UTFA 1H60A 4OBRA 3UQNA 2RUSA 3KRZA 4EK7A 1B4EA 3N11A 1O12A 4CNTA 2QDDA 2BSLA 1L8PA 2J66A 3C2VA 2DIJA 2ZZ1A 2B0MA 4MHBA 1YXCA 2GUYA 4GJ1A 3WLIA 1CB2A 2NX3A 3AYTA 5CJMA 5HXMA 4NZ3A 1UMLA 1WZAA 2QJIA 2R82A 5AN7A 5I3IA 1CNVA 3I68A 5HWNA 3M5VA 3LHZA 3DHDA 3QVQA 4B5SA 4NI8A 2MUCA 5HULA 4DUVA 1XPYA 1GT8A 3WLMA 4JOMA 2F61A 1SSDA 2POZA 2Q6ZA 4JEJA 5KSWA 4I5UA 5AYBA 1EBGA 3SJNA 3GH5A 2XIQA 1C3FA 3ZZ1A 3S47A 4URIA 3TVAA 3T07A 1AH0A 3GQYA 4H8NA 3CZEA 2ADAA 1V6YA 3W7CA 4LT9A 4XX6A 1YDVA 1JCJA 3ARRA 2PLKA 1H2JA 1CB7B 1U1JA 2G97A 2VZTA 1L6GA 1GEQA 4IIFA 3E0LA 1EGVA 2E4TA 3S1UA 2XVKA 4NVTA 1DTNA 1IGWA 3I6TA 4X22A 2QDHA 3WLJA 2BX7A 1E5NA 4O15A 3V5OA 3GIQA 3BXWA 4JQ1A 4LEFA 1OM0A 4MKVA 3C0QA 3B4UA 1SJBA 1N8WA 2J6VA 4BEUA 1V79A 3WH6A 3IIZA 1I1XA 4H6KA 4P7QA 2VZSA 2PGWA 2DSUA 3H7RA 1R3YA 2YL5A 4PYSA 3CL7A 1FCUA 2ZX5A 5XIMA 4W7VA 3I7RA 4BF7A 3DYOA 2X40A 4GD0A 4J9JA 4K2SA 3WFZA 2RDUA 2QF7A 1R3WA 1H0GA 1NP0A 2FVLA 3MJMA 3LBOA 3W1QA 3C0JA 1XH0A 3LX9A 4PTNA 1KV5A 5F2IA 1ONXA 1VEOA 1XDMA 3MUXA 1H7WA 3WQFA 4GQRA 4KRTA 3A64A 3VGFA 5BU9A 5A8OA 1K1DA 3BK0A 1XLMA 3S5OA 2SFPA 3PM6A 4H19A 4N4QA 3CIXA 4WKAA 5DN1A 3VDAA 2PPGA 3OGVA 3GYEA 1VJZA 4U10A 3RM4A 2V82A 4ZOEA 5C7VA 2XYLA 1IZKA 1SO4A 3W00A 5C2CA 5I23A 5C8BB 3KRSA 3GM8A 4E3VA 2NLIA 4H4IA 1JI1A 2QDGA 2WPBA 2YDSA 3RLHA 1Z89A 4H3DA 1V03A 1VLWA 4K68A 3RXZA 3FKKA 3MJYA 2XGZA 1LL7A 3LS9A 4HNOA 3APGA 3UJRA 5C9WA 2FQIA 3CHFA 5SWUA 4P61A