4J40A

Crystal structure of the dual-domain ggdef-eal module of fimx from pseudomonas aeruginosa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
251
structure length
251
Chain Sequence
AAQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 77
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4j40A00
5M1TA 4ES4A 3GG0A 4FOKA 3SY8A 4HU4A 4RNIA 3U2EA 4J40A 5MF5A 3TLQA 3PJWA 4F3HA 4HU3A 4LYKA 4HJFA 4FOJA 4Y9PA 4Y8EA 4Y9NA 2W27A 4RNHA 4RNFA 3N3TA 2R6OA 4Q6JA 2BASA 4F48A 4Y9MA 4AFYA 3S83A 4KIEA 4FOUA 5MKGA 3PFMA 3PJXA 3GFXA 3PJTA 4AG0A 3GG1A 4Y9OA 3HV9A 4RNJA 3HV8A 3PJUA 4LJ3A 5MKGB 3GFZA 3GFYA 3KZPA
chains in the Genus database with same CATH superfamily
2NQZA 1XGDA 1WA3A 2RJGA 4J40A 4MB4A 1UR0A 4M56A 3HPSA 3SUTA 1PJ9A 1T6MA 5G2WA 3FJNA 4L65A 3SY5A 1GOWA 1J01A 1UWRA 2UY2A 4A8IA 4M0XA 1E9IA 2BWGA 2FJKA 3HOJA 3FCPA 5F1UA 3AWNA 2NQLA 3UPMA 5BOFA 3URNA 2XYLA 3WMSA 5FEXA 4JEJA 5H1WA 3E0VA 3VTRA 1REQA 1TV3A 4UQ9A 3V0UA 4XZWA 1F6PA 3OBKA 3V18A 1N2VA 3YPIA 1SFTA 4NNCA 1JEZA 4HZ7A 4PSPA 5AC6A 3OBEA 2FDSA 3DBPA 1E72M 4LV4A 1AODA 1WXYA 4B5TA 2O56A 5I03A 3KBJA 3WEMA 3SQMA 3DAQA 3QRHA 6TIMA 1R5YA 1HJUA 4WKFA 1PZ2A 4HPXA 1GZ1A 1KBIA 3UU0A 4JTAA 2OYKA 4EE9A 2GDVA 1V6YA 3LCWA 1RQEA 3M44A 5H6HA 3W26A 4H41A 3F4NA 3R8RA 3P8JA 1UH2A 1F3WA 3G0UA 1C29A 4I5RA 3PZOA 4G1KA 2WZHA 1V6WA 2PWGA 4AVNA 3B8VA 5HR7A 4Q8WA 1YQ2A 2GOUA 4CNSA 3TNBA 3TSBA 5KZMA 1KRBC 1LLZA 3NOYA 3TYUA 1BWLA 2ACQA 4OUEA 3GAYA 3B3DA 4FNTA 1TB3A 3A9IA 1JULA 1VFTA 1XG4A 3M5YA 2WVTA 2GUUA 4G8TA 1QT1A 1XIEA 1BG4A 9CGTA 4P8VA 3DZ1A 2XG9A 4DBSA 2CPUA 3W3OA 3NO3A 1J18A 2VGGA 3VKBA 3UWZA 3P67A 4GIAA 1PWMA 1UBPC 5KTLA 1XG3A 1Q2RA 4WDTA 2EPLX 3CHEA 1WKFA 1V8EA 4OGZA 3IVTA 5A2AA 4HSOA 3V4BA 2DUZA 1ONWA 4XAGA 1P4CA 4XVDA 2G3MA 3RX3A 3KOWA 1NU5A 1DIOA 5E5CA 2OXNA 3ANVA 3I7QA 3SFWA 5MF5A 1A3HA 4UFHA 4JY8A 4ZO6A 3AYTA 2X0SA 1BG9A 1QI0A 2JFEX 2FHFA 1KBJA 3N6QA 1GOQA 2G95A 2Y1HA 1EJ7L 1EA0A 1W54A 1R3WA 4P7QA 3GHUA 2R9RA 3LK6A 5I3JA 2PU0A 2QYGA 5DBUA 3S4TA 3TP4A 2VEKA 3Q65A 2YB1A 1SJAA 3F2BA 4NXKA 1YYAA 2ISDA 1EGZA 4Z2KA 2BXZA 2DH2A 3DHDA 1A5AA 3UCQA 4R9OA 4JHOA 1YKWA 1NDVA 1KKOA 4L1XA 2D2GA 3LHUA 2D20A 2GPTA 1LM1A 3A23A 2A6NA 4O11A 3OTRA 1PL9A 2Z1SA 3F4WA 1EA9C 3DBNA 3KWXA 4N4PA 4PCNA 6PTDA 5AHNA 2POTA 2AOSA 3GU9A 6ALDA 4HK7A 4FNRA 1NQ6A 3E5PA 4D6JA 4UFIA 2NXGA 4R7JA 2RKXA 3BXWA 4Q4QA 1O68A 1DV7A 1H41A 1VPXA 4PMDA 4AD4A 1HKWA 1JDFA 4BF9A 1Z3NA 1W9VA 3C0QA 1KLYA 1VRXA 1IEWA 4LS2A 1XRVA 2HK0A 1A5OC 2FGBA 1YE6A 4NY2A 4H8VA 1D7KA 1Q6LA 4K39A 1XDJA 5FF4A 2OQHA 5GPRA 3DFPA 4JIRA 3Q94A 1HT6A 4YVVA 1K1DA 4QIUA 3N9SA 3DX5A 3ES7A 1RJRA 3CT2A 3SUVA 4BA0A 3DFYA 3WUEA 2YBVA 3RAOA 4AW7A 1NTHA 3C3NA 4GQRA 3M0XA 5ECUA 1JRCA 2VJXA 3O7UA 3RRXA 4IX2A 3W7MA 3AMLA 1I8JA 2VEPA 4ZVJA 4GYJA 4KW2A 3MMUA 4WHBA 1UH4A 3AHTA 4S3JA 3KBSA 1CLVA 3A64A 2QUTA 4JHZA 2YOCA 3TN6A 3B97A 2QPUA 4ZTYA 3DFNA 4JFUA 4PODA 3RN6A 4K8HA 3N73A 3ZLHA 4GZ7A 4I8DA 1BEUA 1V3IA 1VP5A 1RV8A 5C5YA 1P6CA 3Q2DA 1NWSA 1BYAA 1KA9F 4ATWA 3SURA 1X1NA 1X96A 1GOMA 2ISVA 1KWGA 3BH4A 3B8TA 4RPQA 3VKJA 2ZUUA 2IQDA 1HL8A 2PDGA 1VYRA 1NF7A 1R2RA 3HJEA 5K4ZA 1HUVA 2OU4A 1M7JA 2HROA 5EY5A 4ADTA 3HG3A 1N8FA 3WN6A 1IIHA 3ES8A 3GNDA 4ATDA 3W38A 1TV2A 3W7OA 1OC7A 1Q4WA 4CEUC 4CCCA 4C6NA 1F6KA 3A9BA 4AU0A 2P5NA 3M07A 1UASA 4I9MA 3RHGA 3O63A 2PRHA 4QG9A 3W01A 3RX4A 1G94A 2I56A 2ZUVA 5IDIA 1JD9A 2C1GA 1A80A 2A3LA 4EAYA 4AZGA 3B06A 2C16A 3NTYA 2YA0A 1JI1A 3WUFA 2AQOA 4L1GA 4ADUA 3BW2A 3TK7A 1PTGA 4OKDA 2E6AA 3GNRA 3QMTA 3S42A 4UR7A 4EK7A 4UUIA 1FDJA 4PUJA 3TW6A 4HIBA 3CQHA 3PBWA 1PCKA 1FOBA 1DXEA 3W2UA 4P8XA 4LCRA 2VZSA 5H8MA 3W1MA 3RU8X 4JQAA 2WYSA 4BQ3A 1GKQA 1JZ8A 1UW9A 4PULA 4O16A 1B2YA 1KCLA 3PB2A 4XAYA 4ERAA 1CX9A 3DYPA 1J0KA 1EZ2A 2PBOA 3U9IA 1P0BA 2XHYA 4BF7A 5F2MA 1NDWA 4DJED 1QNOA 2ZC8A 1U22A 2PDBA 2EEXA 5LZLA 1R85A 4CCDA 2WCAA 1S1RA 2HK1A 3CV2A 4TMCA 3ARTA 1IXOA 4JFVA 3FXYA 4PMXA 1VHNA 1XCFA 2HXTA 3EOLA 1EEPA 3HPFA 3FFSA 2OEKA 4MWAD 4NHVA 2J74A 1J5SA 2E5CA 1W37A 4WY0B 1OCQA 2VWSA 3Q67A 5L9FA 1DWGM 2ZUTA 4IL0A 2PGEA 4W86A 4Z2LA 3UZXA 4M6VA 1XBZA 4DPQA 3KVKA 5CSSA 4A3YA 2HBVA 5A2CA 4R88A 1F3TA 3WKZA 2DFAA 2G8ZA 2ZZ3A 3BWWA 1R9YA 2AAMA 3MA8A 5EMMA 1HX0A 5DCEA 1CGTA 1OGGA 4LC8A 3WELA 1EHAA 3WJWA 2I5GA 3TYCA 4UZSA 5E0FA 4H9YA 1YXCA 4GH3A 1K8CA 1K9FA 2DZVA 2GGJA 4QQUA 5I3FA 4ZOCA 4M5PA 3N11A 3P0XA 1J2BA 4CQAA 1GZJA 2GGEA 2QW5A 1KQYA 1IXNA 2VX4A 3W81A 1XYLA 2F61A 3HJZA 3LSBA 3WDIA 3K8LA 3B9NA 4BQ5A 3U2OA 4J1OA 1O60A 1EJVC 2XPKA 1WDWA 2OODA 3QSTA 3VMNA 3NQ6A 3C2YA 1GWJA 4YPJA 4GBDA 3DESA 4FOJA 4C6LA 4QJ4B 4KF1A 1R2SA 1TTIA 2IKHA 4HTBA 2DUXA 5JVLA 1V51A 3P82A 1AH4A 1BSIA 4JNYA 4L9YA 4B15A 3IRSA 4JN6A 3RXZA 2DEPA 1OM0A 3GHRA 3VOHA 1ADSA 1BF2A 1CXKA 3DC0A 4JTIA 3LCGA 4N6EA 2QAFA 2XVPA 2EPMX 3NFUA 2OSXA 4RDZA 1HTIA 5D2XA 2IPFA 2PB1A 4REQB 4YWIA 2GK1B 1EF2A 3DFTA 4JX6A 1JFXA 3ZWTA 1TJRA 4PRTA 3QR0A 4GD0A 4GX9A 3KVLA 2PUZA 2BXVA 3MBDA 4J7RA 1KCZA 5G5IA 3LHVA 2F2KA 3WJZA 1LJYA 5C55A 2TAAA 1Q4NX 4IQEA 4AD2A 3W22A 4AYSA 3RLGA 1I2QA 2AL2B 4LQ1A 4IGHA 2CXGA 3EWXA 2UY4A 3HPAA 3CHCA 4FS9A 3FAXA 1PWLA 4LT9A 4C60A 1XS2A 4HMCA 4LBSA 2VEFA 4C7FA 4UC5A 1TFVA 5F2GA 3IV8A 1GHRA 4XZMX 3QHOA 1H1YA 4JKKA 1US2A 3QTGA 3T8LA 1L8NA 3N04A 3QM3A 4Z1YA 1QU4A 3AMCA 3MY9A 3I10A 4WGHA 3W7CA 3R13A 2CZ5A 3CUGA 1QR7A 4U28A 5EMJA 1YEYA 2NSOA 3C5QA 3QXBA 3VUPA 3ATZA 3CYJA 1T99A 3VIFA 2DY3A 2BY2A 5LNVA 4TVUA 2YXOA 4DBEA 3MZNA 1A0DA 2TPSA 2ZRYA 3I65A 2CHRA 1VCVA 4O13A 1FWRA 2JKEA 3BAWA 1ZJIA 4N2YA 4QCFA 3VINA 3R1ZA 2OGJA 1RH9A 1X8CA 2V3DA 3KWSA 1WOBA 1AQFA 5DT7A 3CK5A 3NGJA 1XH0A 1U1UA 2J9ZA 4WOZA 4REQA 4TMBA 3APYA 2CW6A 1LT8A 4WSJA 2INZA 1BLIA 4M6PA 3QPZA 4DJEA 1UC4A 1DHPA 3DN5A 3GXTA 3UJFA 3C2FA 2W9MA 3UD6A 5H8PA 4FMVA 1EC8A 4HCHA 4W89A 3UFYA 2AL2A 1ZNNA 1PEZA 4GYFA 4MWAA 2CFFA 4N9DA 3GUGA 3H2AA 3TC3A 3SZ8A 2YBTA 4J27A 1EJXC 4YYFA 1UWUA 1QWKA 3E96A 4GBUA 2CZVA 2Y5SA 3PWGA 1TG7A 1VEOA 2YL8A 1TX0A 5G1MA 1Q8AA 4PFHA 1HP5A 3TH6A 4C1NA 3NZRA 3R43A 3RFAA 2IKJA 4XISA 5AHEA 3CUJA 5E93A 4JAWA 3TTEA 3N1AA 2QULA 3AZTA 1IE7C 1TUFA 2HVOA 5DELA 4PMVA 3RUBL 2WJDA 2Z25A 2RDUA 3MUZ1 3WD0A 4J3XA 2FZDA 2VDGA 1CXFA 3CWOX 1MVYA 4W88A 4OOZA 1FUYA 1ECQA 1R3RA 4MUPA 1TWWA 4NJJA 5CPMA 1E0UA 3LNPA 4ZSTA 4DB7A 3O0KA 4IP7A 3W82A 2UBPC 2FGLA 3UWQA 4BQ2A 3Q37A 1EEXA 1MQPA 2QCDB 4GCXA 3VKCA 1QMLA 2R82A 4KEZA 2YW3A 3RYSA 5BRBA 3TX9A 4WD0A 4CGTA 1VD6A 3P93A 3D0CA 1GG0A 3W7NA 3QVQA 1TVLA 3K5XA 2A7PA 3OVQA 4ZQPA 2DZUA 5C70A 3A12A 4F0HA 4OU1A 3KLKA 2DIKA 2A85A 4NIRA 3E3HA 5BU6A 3RITA 4TV5A 3DGBA 4GLEA 1F5ZA 4DF1A 4LNCA 4UOZA 3VOJA 1UWIA 3BCJA 3VDAA 1XDMA 3WF4A 4I7WA 3HA1A 3B9OA 3TLQA 2PD5A 3B03A 3KDNA 4TO8A 4DWSC 3TXZA 3S1VA 1R3VA 1S3TC 3C61A 2V2CA 3S0CA 3F5KA 1XYCA 2ONEA 2VRJA 5K9XA 4H9TA 1IV8A 1PX8A 2OMAA 1HO1A 1E0VA 5A8NA 3WF1A 1YADA 3AMGA 2WMHA 4GNJA 3BUVA 2F7FA 1FH8A 1KFLA 1TJPA 2X8RA 3GD6A 2R1PA 4FPSA 4B2DD 1JQXA 4JGDA 2GDQA 3LTYA 5AC4A 3DH7A 5EFFA 1GEQA 4L6OA 3WH9A 1W31A 2YXXA 4C6IA 1Q13A 2AGKA 2QCDA 2PC8A 3LRKA 4DZIA 2BOFX 3C56A 4O0QA 1L6SA 3U5UA 3WFLA 2ZQ0A 1BFNA 4HOWA 1DJHA 2DT3A 4GWEA 5DEZA 2VEIA 2NXHA 3W9ZA 1XSKA 4C6FA 3REQB 4Y6GA 1FXPA 1TVNA 2XN2A 2V2HA 1V08A 2PDLA 3PTDA 4DIAA 1POJA 4WVXA 3MKVA 2WKGA 3SCNA 4H8NA 4PUNA 3ITOA 3K8KA 1SPQA 3TYZA 3R11A 4X3ZA 5HMDA 1VYSX 1SFSA 5JU6A 4GC4A 3PM6A 4JN7A 2Z1KA 3RLUA 2WC7A 1KQZA 1UWQA 3DC8A 3RCNA 1ZJAA 1OK6A 1TPC1 5C71A 3GXNA 2GUYA 5CEWA 3EDDA 1UPPA 3VNLA 4CU8A 2NLYA 3QOKA 3EAUA 3SECA 5BW6A 3MDWA 1N55A 4B3ZA 2MNRA 3W72A 4WQ6A 3KFTA 2OJPA 5CC5A 2HNEA 2DJXA 5GJNA 1UC5A 1E1CB 4L9XA 1XCWA 5FF7A 5BU9A 2E1WA 4DXKA 2QXWA 3CUZA 3KS6A 1IYXA 2DP3A 2ZZ6A 1SQ7A 4QS6A 1LUCB 4A8NA 1LQAA 4D8ZA 3IGSA 2BV9A 3N25A 3WQGA 1V6XA 1R9ZA 4TVDA 4DLFA 2WKLA 5D03A 3EMQA 5EGRA 1HO4A 2QUUA 1AL8A 1OT1A 1ZZMA 5G2IA 1EWEA 2WV8A 3PVFA 1E5NA 3AIBA 3APTA 3N2TA 3G1VA 1R47A 2CCRA 1KV8A 1A4LA 3HMJG 3NQ7A 1XYBA 3C0SA 1TJ1A 3I68A 4A6GA 4K1GA 1XX1A 2JEPA 3SCUA 4JQ2A 4G7EA 2Y89A 3G1DA 1A3WA 4ROPA 3EOOA 2C3ZA 3QMSA 3REQA 3UY7A 1KFCA 1XFBA 1VGAA 5HPOA 2HNHA 1FCVA 2WAGA 4ATLA 1Q7QA 1EWDA 5E6ZA 3PZUA 3WY1A 1IT8A 4OE7A 2BODX 4V2XA 3PBGA 3AICA 2BVYA 4BEQA 4D72A 4FALA 1E0WA 2V5BA 2BB0A 5AC8A 3LX9A 1UKSA 3GH5A 2ZA1A 4DXVA 4Q8QA 3R0KA 1LG1A 1NQKA 5J04A 3W02A 4LAKA 4V33A 1AH0A 3T2OA 1UUOA 3CPUA 3DENA 1E1CA 3WIJA 3T4WA 1HNYA 2QCNA 4MB3A 2ZVRA 5LKYA 1LUCA 5ABEA 2XH2A 3DHUA 3LLDA 3UWEA 2VC9A 2QLYA 1W1B1 3EX4A 4JNMA 3WBAA 2W63A 2HEJA 4HA4A 3GDKA 3QW3A 3VOFA 4MY8A 4ZE5A 4M19A 1TKKA 3IGXA 3NA8A 1B3ZA 1KGUA 3N4AA 5DO8A 3BAXA 3CUXA 3R5EA 3WMCA 4ROQA 4P8WA 3VIMA 2WOQA 3BSHA 3VFCA 3V1HA 3WNMA 1DTNA 5AYXA 3OZMA 2BP1A 3BCDA 2P1FA 5BNKA 4AHQA 4NT0A 3S9ZA 3S2CA 1NH6A 2W91A 3O3RA 3I3EA 1MEIA 4B2DA 1CECA 4FNQA 3GH7A 3P60A 4BI5A 4Q8OA 2HBXA 5GNZA 4N6FA 5AKQA 1AG1O 4JTSA 4JQ1A 1BD0A 3PZ9A 3QJAA 3SSJA 1WKEA 1IR2A 3EX1A 3I7SA 2YA2A 3N15A 2XIIA 4EXQA 2GSEA 5I3IA 2ASHA 4NZ1A 4IUGA 5FESA 3OU8A 4GA8A 2A79A 1AD4A 3RM9A 3I6RA 1RVGA 1J0HA 3OQEA 4HNUA 4NKCA 3PTQA 3ITCA 4ERGA 4AIOA 3FA4A 2HWGA 2VMFA 4NJGA 4H9ZA 1E3ZA 1PDYA 2J9YA 1G1YA 3AALA 4NJHA 1N8IA 5E09A 3CV1A 1B30A 3VNYA 4JKLA 5M17A 4E2OA 2ZOXA 4DJDC 2X16A 5CPLA 2ZE0A 1EIXA 5DMYA 3C0JA 4US5A 1TELA 2V82A 4HPNA 2WC4A 4RE4A 5LNSA 3GRIA 4I8YA 4I9AA 4FXRA 3EDJA 3EKLA 5I00A 2O9RA 5CLTA 2WWDA 2JBMA 1XJBA 4WJ8A 3AOFA 3T6CA 4RK8A 4XO6A 4PMQA 3LA4A 1XPGA 5C9RA 1E9LA 5AC7A 1G4EA 2HS6A 1UR4A 3KXQA 1W5OA 1S2WA 3VNIA 5FJPA 5HMEA 5AHMA 1EX1A 2VXNA 4WLCA 3ZR6A 1F3XA 1DTUA 2XWDA 2D3NA 4JEQA 2QCMA 1TPH1 4NYYA 3CM4A 4LUSB 1JGIA 1KTBA 2DZWA 3W7LA 3UXDA 1ZU8A 2VFIA 1LRQA 4QJ1A 5REQB 4PB5A 4MY9A 3MSRA 2Y88A 5LIKX 3ZSSA 5K9DA 1I45A 4CVWA 2BG5A 3UBPC 3WFAA 1IGWA 1G5AA 1DXFA 2WMFA 2QVHA 3QW4B 4LEFA 4CQBA 4ACZB 4JY9A 2G97A 4N7QA 4ZZ9A 3RNDA 5HJLA 1Q85A 1R3YA 1XICA 3S2LA 2EG8A 2Y6ZA 5CH9A 4TUFA 2HVMA 3L2IA 4JTLA 3G8EA 4MTVA 4BF5A 2PA6A 4X9SA 1KCKA 3E38A 4MNJA 3TJXA 4AH7A 4ZFCA 1I2OA 2WQPA 1ME7A 2WNNA 2CNCA 4HA3A 4KRTA 1JIBA 3H55A 5A6JA 1JPDX 3AXMA 4YIWA 3UF9A 2PTXA 3TIMA 1FHLA 3MV01 1KRCC 3GDBA 5MKGB 3WO8A 4X2PA 4TIMA 3ABQA 2YSWA 4ENLA 3TJLA 1WX0A 1A50A 2XN1A 4IT1A 1DQWA 4Z2GA 1KBLA 2V0TA 3QV6A 5TD4A 4GVIA 3UZ5A 4KWVA 4W4QA 3BK0A 4FI4A 2DJLA 1P0DA 5AN7A 4I90A 2YCIX 5HMSA 1XLBA 4LY4A 3GVRA 3PBMA 4LUSA 3W2MA 1JCTA 3AROA 2H6RA 1FHVA 5REQA 1ZALA 2DIJA 1E4NA 2QCGA 2ZXAA 1A47A 1XKYA 5CJNA 4UTLA 3RCMA 2KZHA 4ZR8A 3GNOA 4DI8A 3N2BA 4H04A 4ACZA 1TV7A 4WX2A 1HJXA 4HYVA 1AJ0A 3SO7A 2Q3OA 1JCJA 2Z1WA 1B9BA 3IPWA 1E6ZA 2A0NA 4GHRA 1BTCA 4QSFA 2VRKA 3F03K 2Y7DA 1RQBA 3SJNA 2XIMA 3EKGA 4RKAA 4U3CA 1XIGA 1DJNA 2G3NA 1PKMA 4QR6A 2OYMA 2XGIA 3T4CA 3OJGA 1L8PA 3SN4A 2PEVA 4DWSD 2FTWA 1YBQB 3FJ4A 1WZKA 4JDBA 1FX6A 3MO7A 3W23A 2PSNA 2ZWZA 2BTMA 3CEUA 1U5VA 3H2CA 1QRQA 3W28A 3B9AA 3B40A 3IUIA 4KS0A 3LYEA 2JF6A 1NY1A 1XSJA 4LVGA 3UXAA 2VZUA 3N3TA 3GZ3A 3LRLA 4Q8TA 1NARA 1LQ2A 1TZZA 3FNDA 4KIEA 1B3XA 4HOZA 3QV8A 2ZDRA 3LBCA 4YVPA 3BG3A 1PS9A 5A2BA 4IOTA 2IPGA 4S3FA 3FGCB 2EJ1A 2W3ZA 2CLLA 3TWAA 2KAUC 3FVDA 2R1NA 4IPIA 1GYMA 1A5CA 1BXBA 3PBVA 3TNOA 4F8XA 2AKMA 4OBTA 1S2AA 2WZEA 4QJ3B 3M0VA 3CH9A 5CPNA 1UP0A 3WMLA 1OD0A 4J3TA 1W1A1 3MHUA 1TQJA 3L4ZA 4AC7C 3VIHA 2VR4A 1Q6OA 1AQHA 4LOCA 1JPKA 2P53A 2J13A 5B80A 3EWUA 3LPGA 3QC3A 1M65A 4D9PA 5FEPA 1MW0A 2Q8XA 2OZ3A 4L5ZA 1Q5MA 4AD0A 3IS4A 2EF9A 3TA6A 3MS8A 4M6QA 3QH2A 1OJXA 3GFXA 2TMDA 2O4MA 2NX9A 4E4PA 2DSVA 4JDYA 1J12A 2B0MA 2FZNA 3LBMA 4I7UA 4MB5A 4F40A 2XUCA 3AIVA 1WZLA 4Z1BA 1SZRA 4EAMA 3FX4A 2O9OA 5BXSA 4AEFA 4W9TA 3UPBA 5E9XA 1KFWA 2V69A 5HNTA 1YTDA 5EKYA 1T8XA 3S6DA 3VA8A 4MKVA 1ME9A 1DWHM 2JIWA 1XQLA 1J4EA 3W84A 1TQXA 5I6SA 4BZYA 1V03A 3GDMA 1ZS2A 3SCOA 3FGCA 3VZYA 4H7CA 2WCGA 4NZCA 5AB3A 2Y62A 7A3HA 1JF6A 4MF4A 1GNXA 2CLIA 1UR9A 2OX1A 3S3GA 1K4HA 4G56A 4F0RA 4AVFA 1PV8A 3Q45A 5XINA 2CLFA 4AHOA 3N2MA 1Q66A 1EXBA 4KCVA 3ZVIA 4DWDA 1A5KC 3S6TA 1IEVA 1F3EA 4W84A 1FDZA 2MANA 1FWFC 4K8GA 4PB3A 1AFSA 2QPXA 7CGTA 3GM8A 1H7XA 3UXIA 4FOKA 1GORA 4Y8FA 4DBWA 4ZTXA 5EPDA 5F1VA 4EANA 2RH9A 3W7DA 3BCFA 4EX4A 3HQOA 5LIUX 4HSHA 5BXRA 3WDRA 3URBA 2PI6A 2CHNA 1BAGA 3ABZA 2PZ0A 1TTJA 2FHCA 3EB3A 2DSKA 2W4XA 1W2PA 1JUEA 3K4WA 3M16A 2G96A 3KHDA 4HN4A 3CAWA 1C7TA 3QZAA 4RNFA 4WJEA 1UG6A 3JUGA 3G0XA 3THAA 4GVFA 4JTTA 3WLLA 3WQDA 5EBAA 1H5VA 4S23A 3T1GA 4ACYA 2X7VA 4JTGA 4WKAA 4LBRA 3GR7A 3NSMA 1CPUA 4MFDA 1XD0A 3EXRA 3O16A 3S2MA 1K7EA 4GE8A 4E8CA 1QHOA 2X40A 2RHGA 3NZPA 5I07A 1OFEA 2OWCA 2OKTA 2VI0A 1XF0A 1DP0A 3SJ3A 4LXFA 2GFTA 3NM1A 4NG3A 5ABHA 1TCDA 4AHPA 3EA2A 3SRFA 1MW3A 1LRTA 1YHTA 1UB3A 2NVDA 3H6OA 2BOGX 4MG4A 2TSYA 1EX5A 4Q7BA 4LSBA 3HQNA 3ARWA 4A4AA 2GOKA 2OVLA 4Z08A 2CC0A 2VD9A 4V15A 1RA0A 1WDPA 4UOQA 1J0JA 3IAPA 5C54A 1OK4A 2YR1A 3SY8A 2XIOA 3AQUA 1OFAA 4WIWA 4M3PA 4M29A 4MY1A 1ML1A 3V75A 3VMPA 2DT2A 1O7AA 3CASA 1QJWA 3L4XA 4RV3A 5HK4A 2CLMA 3O6CA 4LAZA 4ZQOA 4NAFA 1I0BA 4PCPA 3WLRA 2PDFA 4F66A 3VE7A 3DYOA 1DHKA 1TE1A 1TX2A 1E6NA 2GWNA 1VEMA 4ML9A 1R38A 3R8GA 1JZ5A 2INFA 2VNCA 4LNYA 4L6HA 1EBGA 4XQ6A 2WHLA 4O53A 5F4WA 1R6WA 3UG3A 3UETA 3VD3A 3PS7A 3L5AA 3NWRA 4A21A 1OY0A 4DJDD 1M1BA 3W7PA 4CNTA 2E6FA 2R1MA 3T7VA 1TRIA 1DIKA 2WMKA 2YL9A 4IGSA 3E02A 3E2RA 3OVRA 5CZ0A 2PU1A 2ZRVA 3PPGA 4UMAA 4TOQA 2QJNA 4MUZA 3HG2A 1UIPA 3ARVA 3O8AA 4JFSA 4HU8A 1J10A 2R24A 1FP9A 3VE9A 2Z2AA 1L6FA 5HXMA 5DCDA 3H4WA 3IEBA 2E0PA 4H9MA 1TJ0A 1ADOA 5DF0A 3DFQA 3W1PA 2X7WA 4AWSA 2ZZ7A 2D69A 5K7JA 1THFD 1Q6CA 4HYWA 4QNEA 2FPYA 3GKFA 3TV8A 2YDSA 2XFFA 1RBLA 2PP0A 3H4GA 3V5FA 2INEA 2AQWA 3TMLA 3M0MA 3HF3A 3TMQA 3MCNA 3ARPA 1W17A 1KB3A 2WMIB 4KWSA 1UHVA 1SO5A 2UZ9A 4GNVA 1GVRA 4JCMA 3RMEA 3GG1A 5HDRA 1AQMA 2FVLA 1XYZA 2C0AA 1H7WA 3MTWA 1K6AA 2Q8ZA 3KCJA 4URIA 3ZVHB 3VPLA 2WK2A 1C7SA 2XIJA 3RLHA 4XD3A 4WDWA 2IUZA 3IJ8A 5BYWA 3UT0A 2A3AA 3PBUA 1WDDA 2WMGA 1TMLA 1HIZA 3FYOA 3M7SA 1TZ7A 6ENLA 1X7IA 3FV9A 1ITXA 4UQCA 3B4UA 3O0FA 2GZXA 5T91A 1K8YA 5I02A 4IQDA 3NUKA 4LWWA 4GH1A 3EDEA 3ZT5A 3M5VA 2YFOA 4X0NA 2QR6A 3WQ5A 1UD8A 1XDLA 1NM9A 5CPQA 2Z6JA 3BURA 4QLJA 4CU6A 3FLUA 5HOSA 1XIDA 2ZZ1A 4UTWC 3UYIA 2HPIA 5C6MA 5IBXC 1M01A 2FDMA 4TX8A 3MYOA 4W8AA 4YTSA 3KZSA 1AZ2A 3HG5A 4N9EA 1HVQA 2G3IA 4O4WA 3SSZA 3NIYA 4J28A 1TJ2A 2V6AA 1H7OA 1DJXA 5HATA 2FZMA 3RM8A 3H8AA 5DMMA 3QPYA 3QGKC 4BR1A 3PSVA 1XXXA 1SFJA 1AL7A 1RK6A 3FKKA 4LUJA 1BVZA 1POKA 3SN1A 1F8IA 4DO7A 4XTDA 3QHNA 3KUMA 3ZM8A 1M03A 3OQ8A 3PZTA 3T55A 1L2QA 3LPFA 1TSIA 3IWPA 4O28A 4MIMA 3ZJ8A 2ACSA 1UWTA 2HDJA 3P8IA 5GQBA 3M0KA 4PYSA 1WDQA 4NX0A 2Z28A 3T09A 1XLMA 1GGOA 4HTYA 4V27A 3W27A 4YYCA 5SWUA 3ZVHA 3VCRA 4L80A 3N9KA 3PUGA 4EPDC 2Y0FA 1T41A 2E8YA 3M47A 3NCOA 3ZJ7A 4GJ1A 4RDWA 2ZVIA 4HK6A 1LRNA 5FJUA 1TR1A 4B9ZA 4GQ0A 1KRMA 2QIIA 5E0KA 1PIFA 3WD4A 2YL6A 2WNWA 3ABXA 2HISA 4HNNA 4L7ZA 2J7FA 4OZOA 4GKTA 1VLWA 4NASA 3UNTA 2NV9A 3ITVA 2JKAA 1IQ8A 4QSHA 3ZFHA 5K2ZA 2QQ6A 4KEVA 4QLKA 3NPUA 1L9WA 2QF7A 3KOXA 3SCSA 3WLMA 4HQVA 4GRSA 1ESWA 1XLEA 1DWFM 2ZBTA 1RLCL 2V2DA 4GYPC 3I4EA 2NXIA 2B4GA 3N3MA 3TE9A 3FEQA 3PB0A 1RSCA 3BZGA 2ZZ2A 3NL5A 3EWBX 2ZZ5A 4M6UA 5CQ1A 5C9XA 1S38A 3VU2A 3H2EA 1U5HA 4YXGA 4JBRA 4AZ7A 2C71A 4C5YA 1GW1A 3VFLA 3MI3A 4U33A 1AQ0A 3TW7A 1T7LA 2GVYA 3G1YA 1UPMB 2DSUA 1NSJA 3S5OA 4PEKA 1GQLA 2ADAA 1CENA 4NZFA 3P61A 4Q4PA 4AY8A 7PTDA 3P62A 3GC2A 1GQIA 2DT0A 2ALRA 4XAZA 3NNTA 3PK7A 3QPEA 2ZCGA 2FIQA 4JN8A 4NILA 3GVGA 2YBUA 3GU1A 5EB8A 1XGZA 1N8WA 3O6YX 1VFHA 4DYJA 3DIPA 4M1RA 4XUYA 3GKAA 4M8UA 1W1IE 2D3LA 3W24A 2CLEA 5CC3A 1OX6A 1JPMA 2NWRA 1QPKA 3QLLA 4H9XA 2PBGA 5KZDA 3UCCA 3CJPA 5I3KA 1K70A 1MUWA 3AS2A 3WQCA 1X6UA 3MUXA 1RZMA 4FNUA 1WBJA 4NZ4A 4N9CA 3VGGA 2BSLA 2OOFA 1TV5A 3PFMA 4LTSA 3OYXA 3GH4A 1Q45A 3GNXA 3EEGA 4FEZA 4WK9A 2GSHA 1A5NC 4F4RA 4L4MA 4M1BA 2V63A 1RY0A 1GVOA 4MYAA 1DJWA 1FWGC 3MANA 4XZLX 4AYGA 1K3UA 4MM1A 3N2XA 3GHTA 3AUOA 3NDYA 3TYEA 5I23A 1IZKA 4RCXA 1UD2A 3WF0A 2WLYA 4JICA 1PIIA 4DJFA 5HQEA 3NM3A 1KM1A 3L4VA 1V3HA 4GQBA 4ECLA 4GXPA 1S5VA 4JOMA 2GSJA 1ISVA 1MMFA 3S5ZA 2A6LA 4GJIA 4NI8A 4Y9OA 1SFLA 4U3AA 4A3RA 1QAPA 4GACA 1UR8A 2CBJA 5CPSA 1JCXA 5CSYA 3W6MA 3S2NA 2BDQA 1R0MA 4QDPA 1VB9A 3STCA 3MO4A 4HJWA 1H49A 1Z7AA 4A8LA 4BEUA 1AMKA 3KBWA 3W88A 4TR9A 3HQPA 1SVDA 4C6CA 4J3ZA 5BOOA 1YPFA 3LMYA 1VJIA 1ZCCA 2BY1A 2W5FA 4P7NA 4D6EA 1TPFA 1D3GA 2QS8A 2Y4SA 3F2CA 3PZGA 1LBMA 2HV5A 3CIVA 2YCJA 1NWTA 2RUSA 4L4PA 2XIBA 2EHHA 4JFWA 1XLCA 1XV8A 4XKYB 4IGMA 4IJCA 4C1KA 3HGOA 3PC0A 3ZR4A 1ZJHA 1W9DM 3NQVA 4PTXA 3KEHA 3PSWA 1DQXA 3AIRA 1B4KA 3OZYA 1JNDA 3VOCA 4TX9A 4PMOA 4HKPA 3A5VA 2VUYA 1OSEA 4QE1A 3ZT7A 1K9EA 3VX1A 3R0UA 2VELA 2ZXBA 4MAZA 1GG1A 1KD0A 1QTWA 5GVJA 1R3QA 1O4UA 1UD3A 1R3SA 5LXEA 4ICCX 3R12A 3CPRA 4POCA 1VJZA 3ABRA 1E70M 3MMDA 4LRTA 1DJQA 1QW9A 2OLSA 3SAZA 1FWSA 4OFCA 4K37A 1B0IA 2J7HA 2ZUSA 2J77A 3TWBA 4LBUA 3E9AA 1O6IA 3KRUA 1S46A 2GJPA 3INPA 4HOXA 4LB3A 3GQYA 4A2RA 1BWKA 3MT1A 3SR7A 1B3WA 2P0OA 2VVSA 3LTPA 1EGMA 1DL3A 4IIGA 2BS9A 4JTJA 4GJJA 1T5AA 3NVDA 3H7VA 4XK2A 5FIPA 1TV8A 3JZEA 4QBXA 4RXFA 1GKRA 2C18A 2NUYA 2P8CA 3SCRA 3NL3A 1TPB1 3ALFA 3BL3A 2Z26A 2CIPA 2CLOA 1V3LA 1OF8A 3AS3A 1QFEA 4A29A 7XIMA 5F7UA 2P3ZA 3OODA 2ZUWA 1EXPA 3S1XA 4S3BA 5C9WA 1ZHAA 2WWCA 4DXXA 4HNOA 1NDZA 2YW4A 1XLIA 3T8QA 2D0GA 1O1HA 3BDKA 3TEVA 1JZ2A 1PX3A 4LCQA 5C8BB 4G2DA 4HZ6A 1PAMA 4OBRA 3DUGA 1WCGA 4XG1A 4X61A 4DI9A 3M41A 1OZMA 5C0QA 3C6CA 5FSEC 3QFWA 4U5KA 1UD6A 5HQLA 2E5DA 4CN4A 2WMJA 2EKCA 3WBWA 5I06A 4EIVA 1V6VA 1TTPA 3WENA 2XINA 2YCEA 2ZXDA 4YWSA 3P3BA 4RJEA 2XH0A 3TVAA 4JKMA 3WSUA 2GVGA 3R0DA 3EX2A 3IIZA 4EOUA 3LY0A 1Q63A 4MMWA 4HYRA 4CQDA 3NL2A 3L66A 4PUMA 3O07A 1SYTA 4MKNA 4FSAA 4KFPA 5FF0A 1OIMA 2VFGA 3BQ6A 2PWVA 4G1NA 4AD5A 3W6LA 1XFCA 2NV2A 4PUUA 2J66A 3F4CA 1TVPA 2O9TA 1B4EA 4ICMA 1QBBA 2EQDA 1OGBA 3ECQA 1XISA 2QCFA 1ZY9A 1HJSA 3GVWA 3PN8A 1SO6A 1OFDA 2J27A 5D09A 4XX6A 4N4QA 1E43A 1VFUA 1J5TA 3JR2A 1LBLA 2YGYA 2OLAA 1W3NA 3P74A 3BQ5A 1QHPA 3LRMA 4O0ZA 3HMCA 3ARXA 2G50A 1O5QA 5D37A 4PL2A 1SZNA 2WSQA 5I5RA 5HANA 1DORA 2YCLB 1B9ZA 5EMKA 1I1WA 3M0JA 1D8WA 2FH8A 3DG6A 1OFBA 2PDCA 3IVUA 3R25A 4O14A 2A3CA 3EWZA 3F5LA 3WH6A 1S2UA 1A0CA 2X2YA 3TDFA 3KCOA 4HJFA 5CCZA 1J93A 1SJBA 3GTIA 4ERIA 2I9EA 4GUHA 2Z1VA 4HP5A 2QZRA 4IFRA 2OKOA 3E12A 4FR1A 1KM2A 3BOXA 2CXEA 4F0MA 2W67A 2VOTA 2PAJA 1EDQA 4GZEA 3TN5A 1YPIA 3GFZA 3AIQA 4W85A 1R7AA 5FOOA 2XGZA 3SCWA 5F4SA 3F2DA 2Z27A 3L65A 4JYDA 4O1AA 3WNLA 2W6RA 4AISA 4M7TA 4AC1X 3L5MA 3GG7A 5D32A 2XH4A 2OGYA 3E0IA 3WEZA 5AHIA 2Y2WA 5CG0A 3SDOA 1OYAA 4WF7A 2EGZA 1OYCA 2WO5A 4LYKA 1QNVA 3FJ6A 3S9IA 1PIGA 4TXEA 1ONRA 5G4HC 1T0OA 1X38A 2JF7A 2WHKA 7REQB 3E0WA 4IPLA 7ODCA 4Q4RA 5LNUA 4FNPA 2B7NA 3IGHX 2RDWA 3UWVA 5E70A 3AYVA 3MUY1 3VX0A 5EMYA 5A6MA 3KCLA 5C9UA 3CZJA 3PAJA 1GT8A 4HPGA 1VZWA 4Q8NA 1Y5XA 3H26A 3VNMA 1U83A 1M6JA 4LH8A 1JDEA 5T8GA 3WBYA 1CXLA 1U33A 2D22A 4Q4KA 5TIMA 2XH7A 3SGUA 4BI6A 2YCLA 4U4MA 5C2GA 2A3BA 2WNQA 4JYFA 4ZO8A 3TFXA 3IACA 4JTKA 3E5BA 4Q4OA 3NJ3A 2Y24A 3P81A 3EB2A 3OLIA 4NP7A 1HL9A 1KTCA 2GJNA 2VWTA 2ZWYA 1DWIM 3N14A 1OFOA 4UBPC 3EOSA 3USZA 3HM7A 4RZBA 4X22A 1PKNA 3MWAA 2HVNA 3VNDA 2OPJA 3MP5A 4HCLA 2G4FA 1SM9A 3E0FA 3LN3A 4LALA 1XBYA 2O55A 2GGHA 4WSHA 4MNLA 1SU5A 3S1UA 5IFPA 3NG3A 5LNRA 4AMAA 4ZA0A 4DVOA 2D2HA 2BFGA 3PR2A 1MFVA 1RPKA 4ZSUA 1IZJA 2QAPA 4DHGA 1VIZA 4A05A 4ZO9A 3LCLA 3U8GA 3A4WA 1KXHA 2R91A 1VFLA 1H7PA 1H5YA 2O92A 1X39A 4WEVX 4R9XA 4IMFA 3GXPA 2QMJA 3PWIA 1JDCA 1WB0A 3IJIA 7REQA 4LFYA 4ZOAA 3WNOA 4NAEA 4NXSA 2OT1A 1C8XA 3CQKA 2DZBA 3TOPA 5LA2A 1CXIA 2DV0A 4QFUA 4A3QA 3T08A 3EDFA 3B9DA 1M5WA 3PG9A 2ZDSA 4RPPA 3POCA 2H90A 3MPGA 4UOJA 3FXGA 2X1SA 4D6IA 3WJXA 3WFZA 3TQ0A 3ONCA 4E0CA 3OGRA 1E1FA 4PSRA 4Y96A 5XIAA 2J8TA 1VENA 1M53A 1K8ZA 1QOQA 2RJHA 1E6SM 2DIEA 1OX5A 4HNVA 3E6EA 1HKVA 4MLJA 4Y9NA 1TREA 3MI6A 1FWWA 3R8HA 1YNQA 7TIMA 2VGFA 3KRZA 1F9CA 1IXQA 5FJJA 4IFKA 3UJEA 4LYPA 1S2VA 1EBHA 4ILSA 4IMCA 3PPHA 1RJQA 1AZ1A 1B3YA 4C6OA 2FYMA 2E6DA 1V79A 1IT0A 3CZKA 1B3OA 4HGXA 4HA0A 4PUWA 1E6RA 4D1JA 3I4KA 4EPBC 2AGTA 3FOKA 4L1WA 4AF0B 4XD4A 3DGRA 3ABOA 2VFFA 2EPKX 1VCFA 1V02E 5JH1A 1IIGA 3H23A 3BICA 1W8SA 1A5UA 4OJYA 4PBEA 3IJQA 4CN1A 4HD5A 4UTWA 5CLWA 3W70A 3HPZA 4XVEA 4O8RA 1HZYA 4U2YA 1QK0A 1EDTA 3IRDA 1MO0A 3AHVA 1H2JA 1HKJA 3VGEA 2HE5A 3PJUA 4R33A 4ZL1A 1W1VA 3CZ8A 2V3EA 1EYWA 3W75A 3NSXA 3VDGA 5HJYA 4F0KA 3L4YA 3A3HA 1IHIA 2GDUA 2NT1A 1OIFA 3WCZA 1VEPA 3ME3A 2JK2A 3PP7A 3THUA 4DZ5A 1M7OA 2PWHA 1UD4A 2GWGA 3UGRA 1FWEC 1IWBA 4RNIA 1L0PA 1YLVA 3SIMA 2Y7GA 2I5IA 3P5YA 1OCBA 2RDTA 1JYVA 3ABSA 5FJTA 1VFOA 4INFA 3TZNA 3D5HA 3TZFA 5KZ6A 4S39A 4N0RA 2BLEA 4H2HA 3WH5A 4HHLA 3OHIA 3WH8A 2P76A 4K1WA 1GVIA 3B4YA 4HU3A 3W07A 1BRLB 3M1ZA 3S8HA 4CD6A 2J8FA 1S5NA 4JNZA 1EC9A 1TCMA 2OZ0A 3GXMA 3M6DA 4AF0A 5BOEA 3S9YA 3FA5A 3MU7A 1WZAA 4BJHA 1RR2A 4LJ3A 2GQ3A 1K7XA 4E8GA 3T40A 5LIWX 4K2SA 3V0TA 3TR2A 4Y2WA 4CU7A 3WLTA 2XJ7A 1ZPTA 3WQOA 1XGEA 2I1OA 2OWWA 1X7FA 4MAVA 4PTDA 4RNJA 3R79A 4KWWA 4WRHA 2FMNA 1ZQ5A 1WP6A 3UG4A 3CLWA 3VCNA 3AJ7A 1RCXB 3UVAA 3EPOA 4RE2A 2C7FA 4Z2IA 2VYOA 1OZQA 4US6A 1WPCA 4PCTA 4R85A 5BXTA 2YPIA 1TZ9A 3T0TA 1K7FA 1PYMA 1Z6KA 4PRRA 4OHQA 2Q02A 3N12A 4XB3A 4AZHA 1G4TA 5AYIA 4JYEA 1V5XA 1HVXA 1K6WA 1TWIA 3GR8A 2YL5A 4KFNA 3NOEA 3L23A 3CWNA 5CPOA 3UVIA 5I3HA 2DZTA 2GVJA 3LEPA 4RV8A 2FGZA 1K77A 4FR6A 4UFJA 4S1FA 3DG7A 9RUBA 4Z1DA 1V0LA 3IJLA 3GTFA 3TXVA 3FJLA 1PX4A 5L6UA 2ABAA 3W87A 4NZ3A 2YLLA 3THCA 3J7HA 4H6QA 2DQWA 4HT3A 5B7YA 3L5LA 3K8MA 4RW5A 1YPXA 3WLNA 1BRLA 1JG9A 3N13A 3BGAA 4OWGA 2BMBA 1A3XA 3PZNA 4MGGA 2G37A 3IK2A 5JMUA 1XH1A 4W8BA 1JUKA 4EKJA 3RR4A 2ZIDA 2E6YA 4LRSA 2X0YA 4E2BA 3MYPA 1D7FA 4NRRA 1DJYA 1XH2A 4DYKA 3OG2A 4CD4A 3M0LA 3NZ1A 1ZBWA 2CWXA 2ZADA 4GOAA 1LTDA 3RPTA 3S5NA 4KH2A 4ONVA 8XIMA 4DO6A 2E77A 2ZA2A 3KL5A 2Y61A 3WDHA 1UWAA 4G6CA 1CGYA 2GL5A 5EU9A 4TV6A 4C6BA 1UZ1A 4MJ4A 3M0IA 4H8UA 4Q8UA 1S5TA 1TIMA 4J2MA 4D1IA 3IJ9A 4IWWA 2VX7A 1GTHA 2E5BA 3PJXA 4NUWA 4E6MA 2XM2A 1ENUA 2H8ZA 1Z8AA 3G77A 1UZDA 2DUAA 2VFEA 4M81A 8CGTA 6XIAA 3UJRA 3SBFA 2DVTA 3NO5A 4ORIA 4UB9A 1VFSA 5G1YA 5M2FX 4S3EA 1UZHA 5C7HA 4R53A 1UROA 3HB9A 3M43A 3VABA 2VGIA 4GFSA 1DJZA 3GBEA 1K9DA 1D2KA 4CKQA 1OC5A 4MKSA 2A7NA 3SEPA 4C6PA 3CBWA 3EXSA 3QTPA 2VQTA 4Z0SA 3VIIA 4F3HA 3WYZA 1LT7A 1UD5A 3STFA 1QHZA 3GXDA 2C6QA 3OB8A 3ZLFA 4NL1A 2J79A 1F05A 4UTMA 1RBOB 4QP0A 4ES4A 1S1PA 3LTSA 4H9VA 1CLKA 2VENA 3K13A 4BWLA 4JXCA 1V93A 1IF2A 3OLDA 2NT0A 2VEMA 4GI9A 5EMLA 1NOWA 1BF6A 3U48A 2Y85A 5HBFA 2WQDA 1FWCC 3KW3A 2ZE3A 3Q58A 5D2TA 2E9BA 1P6BA 3AYRA 2WPGA 3EX6A 1RD5A 3N19B 2J88A 1XYMA 4PN2A 5EMUA 3CIXA 1XIJA 3GTXA 2NQ9A 5E6YA 1XLGA 1TMHA 4UNLA 4XZIA 4MSSA 1M68A 4NJKA 1ZTVA 1GW9A 3MHFA 2EPHA 3FN9A 2CBIA 2VD8A 3IJ7A 1DWAM 2I14A 2ZYFA 1W5QA 3ERPA 4K36A 1X1OA 4DZHA 3AHZA 4PMUA 3TJIA 2PMQA 2Y7FA 5HAOA 1JI2A 1D3CA 4DYEA 4P2VA 4P7LA 2QJMA 3F4DA 1WXJA 1WAWA 4GZIA 2E40A 2RGLA 3WX7A 3DU0A 5AHLA 1G01A 3KOZA 1G7UA 3A22A 4RDVA 2VCBA 2VX6A 1JXKA 3WEOA 1JDAA 2PDUA 1EJWC 1RQHA 3PBYA 1U1JA 4UTKA 3N4EA 4R7OA 2OEJA 2OOGA 6A3HA 4GQGA 2I16A 1L6YA 3H2FA 4E38A 1SW0A 2OQYA 3W4RA 1QO5A 3UP8A 1J6OA 3P7YA 4J3UA 3B8IA 3TCEA 1O5KA 2WKJA 3GDRA 4QS5A 4AZCA 1X1ZA 1KFJA 3WQFA 3HURA 2QCEA 3UWYA 4BCEA 3M0HA 4MPKA 1E3XA 4PL1A 3GC5A 4WOQA 5A8QA 3CEPA 4C6EA 1OCNA 1LL7A 3MQTA 4HK5A 1TPWA 4NZJA 1H7NA 5A1AA 1VHCA 2NUXA 3RM4A 3FS2A 4Q4SA 3LHTA 4MWAB 2E9MA 3W7RA 1G4PA 4ZQMA 3JZUA 3LM3A 1FVPA 2VUNA 2Q71A 2VHLA 1FWAC 2VEGA 5T9CE 1MFUA 3AYSA 2X1TA 4PEEA 1XLDA 3UZJA 1W8GA 4LS0A 2BASA 2P88A 3KHJA 4W5ZA 1HGWA 3WF3A 2TRSA 4EF8A 2CYGA 1BGAA 5FJOA 4CQ9A 2Y5JA 4GO8A 4C1NB 3IJDA 3U7VA 5LHFA 1QNRA 1U1HA 3GB6A 4Z17A 3PG8A 2W0UA 5DX7A 2BVWA 3FY1A 2XTKA 3G24A 1I2PA 1Z9AA 5D05A 5I3DA 1CYGA 3JU2A 1DKWA 2O7QA 3JS3A 1JPIA 1YNPA 3EWYA 1G6CA 1AH3A 2PTZA 1WNOA 1MRQA 5I3GA 4IXHA 2GGGA 3M5ZA 3DYMA 4JIIX 1E4IA 3CL8A 3MVTA 4GVHA 1CT5A 3VOGA 3F1QA 2CWNA 4W5UA 1NAL1 3QF0A 3A4XA 1GVEA 1XLJA 4WDXA 2WNZA 1RA5A 4LVFA 2D2OA 2GUBA 1SR9A 3VILA 3QZEA 2NVAA 4FXFA 1EGVA 3M64A 1FCQA 1TR9A 1HGYA 4CNNA 5TNVA 3TYBA 3VAVA 2EXOA 5FA5A 5BRPA 3T42A 5TQLA 1E6XM 1QW7A 1E4MM 2PDKA 4HZMA 4D6GA 3B0VC 2BGNE 1FH9A 5F2LA 1ICQA 8A3HA 1TPVA 4IJBA 1P6WA 1BYDA 1YDVA 1HG3A 1W3KA 2YCKX 3ARYA 2CLPA 3CU2A 1AW5A 4C6DA 3FHAA 4XKMA 4J2PA 4A3UA 4UTTA 3C86A 2B7PA 2W61A 4DAIA 4RW3A 3PULA 1DE6A 3K46A 2VL4A 4NYUA 3A13A 1VCGA 3VCCA 4J9JA 4KCTA 3EMZA 1I0DA 3USBA 1W32A 1WAUA 2ZUMA 4GO9A 4OECA 3O2LA 4U5IA 2DORA 1DE5A 3LSCA 4IMAA 1CDGA 4PCSA 5A6BD 4I7VA 1KM5A 3TOYA 1GYLA 1FWTA 1JZ7A 2JQXA 5CSUA 3GFYA 4LVDA 4K7VA 1GVSA 1HFBA 5FF3A 1PZ1A 2V81A 4IISA 2VDIA 3OHMB 2IMRA 3V5CA 2Z00A 1H4PA 4O54A 1G9HA 2ZRWA 3APGA 2ESCA 2Y70A 2Z1XA 1RJPA 1MZRA 2QUNA 3HQ1A 4JQ4A 2ZA3A 3LERA 3WL0A 1US0A 3DEQA 1HKMA 1NFBA 1SSGA 4LPCA 2I5QA 1RCOB 1XC4A 4GI8A 3DECA 2F6XA 3TTQA 2O0TA 2PP3A 3EPMA 4NX5A 4HPJA 3H2MA 1VAHA 2DZSA 3H7RA 3DFSA 3LM7A 1E9ZB 4AZ5A 1CCWB 3BJTA 3PUOA 2ZTJA 3W73A 2V5KA 3ORWA 1ZAIA 5E9AA 3K4DA 3W76A 3LV6A 5I7GA 1HL2A 5K9CA 3QSRA 2CKRA 3CAVA 5DXXA 3M4HA 2PC4A 2ZUNA 4IP4A 4O17A 2A21A 3TFCA 1CGWA 1YX1A 4AFYA 5DLCA 2NQHA 3M7WA 2XFWA 3U57A 4JD4A 5EA9A 2W66A 1H60A 1MEWA 1KM3A 2QUVA 3LQLA 4UCGA 4GISA 3E2QA 2PRLA 4E4UA 1E4LA 1MZHA 1ICPA 2J4GA 2W27A 4YTQA 4AY1A 2PODA 4QE5A 1YXDA 1F76A 1I75A 3BAYA 4DAFA 1FCBA 1OGSA 4AZIA 1LCOA 3DHFA 1JYXA 1XLFA 4MLRA 3HGSA 1TPDA 3U2EA 1X6NA 3VI2A 1P48A 3NPVA 2Z7GA 1VH7A 5IFTA 1MNSA 4Q6JA 1MW2A 4B92A 5C7VA 4Q7NA 4R5EA 3TROA 1OG0A 1C92A 4MNMA 4AG0A 1FHDA 4KCWA 1QO2A 3B9EA 1Y8BA 1SO3A 3UJSA 2B7QA 4NI3A 3CZGA 4G7EB 2ZX9A 3CMGA 2X0HA 1T40A 1JAEA 4OUIA 5DANA 4OBSA 3TA9A 3W53A 2J7EA 1EUAA 4DN1A 1W3TA 4GCAA 3BAIA 4DNMA 3CZLA 2OO6A 3TQPA 5HWNA 5KSWA 1GQJA 2WHJA 5MHBA 3K4AA 5GJPA 2VKZG 4WUIA 2OSYA 4GG9A 1CBGA 2C14A 4GX8A 1A0EA 2JGYA 2PCEA 4V1XA 3GVQA 2NX1A 4AUBA 5RUBA 2C1IA 3EWDA 4AQLA 3NZGA 3WDQA 3SIZA 3NDOA 2PDXA 1QXLA 3BOLA 4FLQA 3IVSA 1OFQA 4S2BA 1ZBCA 4TTGA 3FKRA 1ISYA 2ACRA 1GJWA 3BJFA 2FTPA 5C2XA 1QPOA 4O1FA 1GVFA 2UY3A 4IMDA 2NSXA 2D0HA 1KFEA 5CKSA 4UTFA 4LUTB 3GZAA 3IGUA 3S6OA 3T0DA 1RD6A 3IJ6A 4PH6A 3BW3A 1B57A 4NVTA 2I57A 3PZVA 1X6LA 2D1ZA 3LI0A 2D24A 4MDOA 1ECEA 4K3ZA 4GMEA 4AIEA 3H21A 3MUIA 4TX6A 4DZAA 1HJQA 1XRFA 2DQXA 5C2CA 1OWQA 1PZ0A 2PPGA 4UTIA 1U30A 2BOEX 2WXDM 3CB3A 4QNWA 1J0ZA 1KGXA 2DH3A 3UNDA 4IL2A 1TTQA 1EL3A 3UZYA 3F7JA 1VQTA 2J7BA 4PRWA 2WSPA 3H4XA 3ANYA 5A6BA 1F07A 1MUCA 4FAMA 2Q8LA 4ZXLA 1QATA 3LXAA 4QQ3A 4NSBA 4RZ4A 3PZIA 1DJIA 2AKZA 1I60A 2QMKA 2DW7A 3GAKA 3T07A 1KWKA 1HN1A 3UQNA 2F84A 5D4YA 4HNTA 1WKYA 4RUBA 1C3FA 2XM1A 2ZX8A 3LHYA 4AD3A 2AAAA 2VQUA 1G67A 1ZENA 3H7UA 4PA8A 3TW9A 3F4VA 3U7BA 2DU2A 3SB0A 4IHCA 1WOAA 4RXGA 2VFHA 1GOXA 2UWFA 2FZBA 2X30A 3ZIZA 2R8WA 1EP1A 1XRTA 4KKXA 1AJZA 3M0ZA 3MC5A 1KBBA 3BLFA 1Y5WA 5A6SA 4LUTA 1R3TA 2C15A 4CQ8A 3IV3A 3ZQ9A 3GVVA 2HXUA 2Q6ZA 3IAQA 4QJ5B 4O18A 4B90A 1IWAA 1K02A 3GG0A 3A4AA 4UTUA 3LV5A 3WUGA 4JTQA 3NVTA 5EYWA 1T96A 4PTWA 2PRMA 2AL1A 3VM7A 5HINA 3R6IA 4QE4A 3WLKX 1JF5A 3ZJKA 5HWMA 1F4AA 1OFRA 4GXWA 1PPIA 1RVKA 1WE5A 4NRSA 4A8RA 2HJPA 3WK0A 3LGDA 4GUGA 9XIAA 2CERA 1SUXA 4JTRA 4Z1CA 1OINA 2CKSA 3GTHA 3TAOA 1X97A 1HW6A 4DF2A 3GR4A 1KLZA 4S38A 2QJGA 3PPCA 3AS1A 1RP8A 3B04A 2VVNA 1FWDC 2PWEA 5AZ0A 1QI2A 1R46A 4MHBA 1KCXA 3H2NA 1S5WA 4LANA 3H22A 3S46A 5JBFA 2O4QA 3E49A 4WGXA 1HJVA 5D04C 3WQ4A 4UTHA 1FRBA 4O12A 3ICJA 3VDCA 3WBEA 3HIJA 1S39A 1J0IA 5E0CA 2C1HA 5H91A 4QG6A 1UJQA 1VYPX 2QCHA 3MBFA 2GJRA 3N4FA 1VKFA 3WK2A 2X1UA 4KEMA 1AJ2A 2AMGA 3MP4A 4U31A 1GEHA 4P61A 4O4VA 2YYTA 4D2JA 2CHOA 1BQCA 1BSLA 4HN8A 3CQJA 1BQGA 1ZSXA 2NQJA 4FP1A 4UTJA 2PTYA 2ZXQA 2Q01A 4O1DA 2NW0A 2X05A 1KFBA 1QVBA 1UJPA 2J62A 2XIQA 4O52A 1PHWA 3CMJA 1PE1A 3G6LA 2G0WA 2HZGA 4IPJA 3UA4A 5CBJA 1TPEA 4H8HA 4F2TA 2GQAA 1F6YA 5DXYA 1H62A 3VKAA 4GY7A 2Y8UA 2Z6IA 3D47A 3COTA 4FHAA 1R7OA 1FWIC 4Y9PA 2PDNA 3ITTA 1UUMA 2YZRA 4NNBA 5A3HA 2V3GA 2JIEA 3W71A 4XUGA 4DY1A 1Q6RA 1SJDA 3K1DA 3ARRA 1QI5A 1A5SA 2FVMA 4QCEA 3BC9A 4HB7A 3AJXA 4FXSA 1W9UA 1VF8A 1EFZA 3RGTA 5AC5A 3V0SA 3B8SA 4GI6A 2XDFA 3WH7A 3WLJA 1EB3A 4AZBA 2XVLA 4YLWA 4I9JA 2LLEA 2XN0A 3KP1A 3NO1A 2OCZA 2EAWA 3BLPX 3MMTA 4WSKA 2FZ9A 3UG5A 7TAAA 3UCDA 3BV4A 3STPA 1E6PA 1L2UA 1OHLA 1XRSA 1OFPA 3TQKA 3U2ZA 4AAJA 8TIMA 4AWUA 4IICA 1XYFA 1F74A 1JL8A 1QK2A 3QZ6A 2OEMA 4AY7A 5KMYA 1O5RA 4UQBA 3ITXA 1QPQA 4XV0A 1KC7A 2XSAA 3OG3A 1XHGA 3WLHA 3KOYA 1OYBA 2PWUA 3UA3A 5HNNA 4DUXA 2BVTA 1RXOB 3IUHA 3AS0A 5K4XA 2WANA 3CTLA 2ANUA 4RDYA 1XLKA 1WO2A 5EBUA 1IGSA 1WKDA 1UIOA 4L9ZA 4UFKA 2HMCA 3AU6A 5M1TA 3SCQA 2VX5A 1W5PA 4S2CA 5CJ5A 3P80A 3GIPA 4XTIA 3T05A 3BANA 2V68A 3GDLA 1IXPA 4MVAA 5CZSA 4GPNA 3NR0A 2BGSA 2FTYA 4V1YA 4ZBCA 4IQJA 3CQ0A 4A3HA 2J8GA 2ISWA 1EJUC 3T44A 3AXXA 4PE8A 2OT0A 4LW7A 4BKNA 4H83A 5D8ZA 1KKRA 2XU2A 4B16A 4O50A 2R1KA 1EQCA 4C6QA 1KR1A 5G1TA 5AFDA 3HG4A 4PUEA 2SFPA 4LAMA 4DM2A 3UW6A 3SQLA 1OABA 4CCEA 2VR5A 1UKOA 1QNPA 3TN3A 1ZP3A 1YDNA 4DEFA 4QAWA 4H7ZA 4ZO7A 1W3IA 4JTCA 4DLMA 1GCYA 4L4OA 4P7RA 3KBNA 3FHQA 4IPNB 5IRPA 3BLLA 3EWWA 1E73M 4B5NA 4A22A 5AZ1A 1JYNA 2QGYA 3WJSA 4XSLA 5JXQA 3G5EA 2HCVA 4LV9A 4UQAA 1ZP4A 5HUOA 1CZ1A 1XM3A 4S3DA 3DDMA 3NDZA 3UZZA 4CCZA 3S5SA 4D6HA 2P50A 1WUFA 2P8BA 4MYXA 1QUMA 2WZTA 1OG6A 4QISA 5FAGA 1LLWA 2E25A 1BYCA 3GTNA 5ABFB 3UYCA 2YDQA 3HPXA 1LL6A 2A3HA 3BARA 2OX4A 3PWAA 1W3LA 4LUIA 1ODUA 2E8ZA 4U2ZA 1LWHA 3SRKA 1AD1A 4K6AA 1I2RA 4H19A 4IM4A 4UR8A 1QWGA 3R58A 1H7RA 3KOFA 3WZ0E 3SGZA 1Y5VA 2R6OA 4WR3A 2X09A 2FKPA 3S83A 3UY8A 3MCOA 4FX7A 5J5RA 3GWQA 4WJXA 2QCLA 2QIWA 1M7PA 2CESA 3LPOA 5TAOA 1E6QM 3R2GA 4GYKA 1BKSA 3DI1A 3BG9A 3RMJA 4YN5A 4E8DA 4GVGA 4B9YA 3OLGA 3D46A 3NYDA 3OBAA 2F2HA 5BMXA 4RE3A 3A6OA 1V6UA 3R7MA 1QCWA 1PTAA 2VT0A 1WYIA 3AIWA 1SMDA 3W2LA 4ML4A 3A3XA 3R89A 1XINA 2PLJA 3MVIA 1EPXA 1EHNA 4K68A 1XIHA 1GOKA 4DUOA 5ABTA 1TA3B 1FFQA 2NUWA 3H53A 3I7RA 3CLMA 1V0KA 3WDJA 3C2OA 4GUFA 2VCAA 2DZAA 3UZWA 5D9MA 4C7GA 3CV7A 3BW4A 1LOSA 2W92A 3TYDA 3JRKA 5HULA 2ATSA 3AMKA 1EQPA 1RUSA 1XP3A 4W7VA 4AEOA 4M7SA 1PB0A 5ABFA 1MEHA 4CNOA 5LIYX 5LXXA 3QY6A 1K9TA 4DWSB 4LYQA 3RU6A 4JS3A 5LHEA 4C6MA 4PMRA 2WJEA 1EDGA 2ZTKA 5E1QA 1WDSA 5HWJA 3L7RA 4FNSA 3SN0A 2IS7A 2VM8A 5A94A 1GPFA 1I9CB 1CXHA 3ELFA 3N9RA 4DPPA 3QOMA 2C13A 3LPPA 5CG7A 5CSRA 2WLZA 3VGBA 1ADDA 1JCYA 1QI4A 4KETA 3ZR5A 3I3DA 1W9PA 3MWCA 1EO7A 3A47A 1ISZA 3KS5A 3DKJA 4Q8VA 3WG6A 2QJIA 4XZ9A 4WY0A 3WQWA 2DVUA 3LXBA 3O6AA 3TTSA 3KBVA 5AYBA 1H11A 3SUSA 2E9LA 2QEZA 3FA3A 3K1GA 1VPYA 4DRSA 3E2SA 4WDUA 4YTUA 3SUWA 1MXDA 2VTFA 3LCHA 4HCDA 1TYGA 4PTNA 1VBUA 1JCLA 3HGJA 3G3DA 1RLDA 3T2PA 3WD3A 4J4KA 1GQNA 2F38A 3L67A 1XLLA 2D73A 4O1CA 4NAFB 3KBMA 3C3UA 2V9DA 4AWEA 3T0CA 3URAA 5A6TC 1TA3A 1X98A 1OT2A 3AU2A 1UR2A 5AOUA 3PUDA 3A3WA 2OZTA 1KXVA 5CZKA 4QRNA 4IIBA 1CB7B 4H3DA 1XUUA 3UESA 2VGBA 1AW2A 4HMDA 5CJMA 2DPEA 1Z32X 1ONEA 3A4JA 4DWSA 3FAWA 5CZTA 4N42A 3FW6A 3LCFA 3M0YA 1JVNA 2VC5A 2ABBA 4ASTA 1V77A 1ZJBA 2OWXA 3ALGA 1FDYA 4TU1A 4W93A 4S3GA 3SFKA 4UFMA 2QGHA 2VZTA 4UNIA 5A8GA 2YA1A 4XAFA 4E5TA 1NIUA 2Z2UA 4AEEA 2GK1A 4CD7A 3ANUA 1KXTA 1JD7A 2P3EA 3RO8A 4GQQA 1J79A 4J3WA 2QV4A 3OO2A 1A53A 1LL4A 1L6WA 4A2SA 3LENA 3LD5A 3WLPA 3L4TA 1UYQA 3V5OA 1KW1A 3ITYA 3AMDA 2XVKA 4KT2A 4O10A 1TO3A 2A5HA 3N34A 4XBSA 4F9DA 4QITA 5HQMA 5C9ZA 1BHGA 1S5MA 3ZJ6A 2WCSA 4PBFA 4DBDA 4HU4A 1I2NA 2IPWA 2QNEA 1YMYA 1NFGA 3MZ2A 3CPGA 3QBUA 4QAIA 3FYYA 1UR3M 4KBXA 3NAVA 1UR1A 4MADA 1GTEA 2OR2A 4MJZA 4IFOA 5G4WA 1FKWA 2ZRZA 3KZPA 3Q4DA 3MCMA 4BI7A 3OOQA 4QLLA 4C1LA 4ALDA 1CLXA 3POHA 2XSBA 2GVLA 3NEHA 3EYPA 3BOFA 3C0LA 1BXCA 1NOUA 3CHFA 4DELA 3B05A 1GHSA 3G1HA 1Q6GA 1A49A 1GZGA 2DVXA 2CLHA 3EGJA 4FK9A 2E4TA 4RL3A 1CTNA 5AVNA 3STEA 4GIYA 1RALA 1VLIA 5EL1A 3VNKA 4JCLA 2ICSA 4G7FA 3NURA 5T9BG 1PVNA 3BTNA 1ISXA 2VCCA 3C8FA 4NU7A 5D33A 4M82A 4AX6A 2J9XA 1IZCA 1KV5A 1N7KA 3N6HA 4F48A 1MDRA 3W7IA 3BG5A 3AI0A 1MSSA 1VS1A 3C8NA 1GUVA 4YMZA 4OQVA 4PBGA 1JCNA 4IMGA 3HV8A 4FIRA 3BSGA 1R2TA 3GSMA 1QPNA 1TE6A 2J47A 3VD7A 5FCZA 3WK3A 1VBGA 2G41A 4XD6A 4Z0JA 5I2UA 2Y5EA 1SMAA 3GYEA 1GJUA 1XL9A 3VGHA 1CGUA 3L2LA 4XBKA 3T0BA 4YJ5A 1QBAA 1ZBVA 4KCUA 5JBDA 4ORMA 5HJXA 2D2JA 5ENLA 1QDSA 3CC1A 3VIJA 3MUCA 1CGVA 1BPLB 3QFEA 1G4SA 3SCTA 3MB9A 4M24A 2GQ8A 2XFYA 3CYVA 4CEXC 2UV8G 3N18A 4MB1A 2WVSA 1E55A 4H4IA 4LX4A 2ZRUA 4IQLA 3MSYA 3GYCA 1RCQA 4CD5A 3VIKA 3OIXA 2A1YA 3HFYA 3UR7A 3GO2A 3HBLA 3VNJA 4L64A 4P8UA 3A5FA 2C0HA 3G6MA 4AZ6A 4R27A 3T2QA 1KGWA 4LAUA 2BHUA 4MNKA 4QX4A 4CLMA 1W56A 1UA7A 1Q7MA 3VKDA 3W29A 1LF1A 3W1QA 3W0KA 1FFRA 2ODOA 3VD9A 2WJFA 2Z7KA 1UP3A 4GI4A 4KEUA 2WHMA 3U3HA 5DRCA 1CB2A 1V3KA 1KM0A 1HP4A 1AVAA 1BVNP 4PR4A 1K03A 1Z48A 2PDJA 1ZRQA 5CAHA 4W8LA 4PC8A 1XW8A 3QY8A 4I6VA 3NQBA 2VDHA 1TV4A 4GNKB 2G3FA 3W7EA 4C6KA 2ZKMX 1V3MA 3E2VA 1BWVA 4D71A 3W1TA 2XVGA 4H1ZA 1Y0EA 4UMCA 3L4UA 1GYNA 4MZ1A 1NFPA 5D9NA 4CVUA 1QW8A 1MYRA 3AXKA 3HO8A 2Z2BA 4L6DA 2HTMA 5DMNA 3QMRA 1RP9A 1J11A 4US5D 5CC6A 3QGVA 4ADSA 3NQ2A 3R94A 3C2VA 3U2CA 1W2VA 2QJHA 2WSYA 2IQ0A 2PURA 3CHDA 2UY5A 4O1EA 2X41A 4EWND 2PWDA 1W9BM 3WUBA 3UR5A 3EPNA 4AVOA 3NQDA 2QPSA 3TN4A 3I3BA 1HKIA 2XISA 4GFIA 5AHFA 5BMWA 3WNKA 5JBEA 4H6RA 2WVUA 1TRDA 4B3LA 3TC7A 3OGVA 4CUCA 3CTTA 4FF7A 4DJDA 4ZODA 2YX0A 2A7RA 2PWFA 4HA1A 3GY1A 1C9DA 5HNRA 1KTNA 3W1UA 5M5DA 4JTFA 3HZ3A 3WLOA 2PGFA 4GINA 3TYAA 3P2VA 3IANA 2YLAA 3GU2A 3EOEA 3QKZA 3AZSA 3KTCA 3EA3A 4KQNA 4GGBA 3FVMA 1Q2SA 1DXIA 4FB7A 3P14A 1UA3A 4R34A 4D8LA 1FKXA 5IM51 4GC3A 1PSCA 4HVXA 3W00A 4XIMA 4LF2A 4F9JA 3HN3A 2IKIA 1JZ6A 4AXNA 2OZ8A 2VO5A 3BLDA 4FLOA 1F4HA 4R3UA 2EG6A 4B5SA 1UQZA 3CIWA 1UQYA 4MJ2A 3CUIA 1R9XA 4AXKA 1FTXA 4HPHA 2CETA 4Y9AA 2BZNA 1C90A 1LLOA 4WXYA 3EMCA 3NXLA 3P0WA 4OV4A 2PDHA 4JZ5A 1FQ0A 1N82A 1CI1A 1VFMA 3WQVA 1PTDA 2PDMA 1IEXA 1ODZA 2PDPA 3VUSA 1H09A 4TTUA 5FD0A 3W7KA 4QROA 1E0TA 3ENLA 3OA3A 1F2JA 7ENLA 1PBGA 3PZMA 2OB3A 3GC4A 3OP2A 4J3VA 1M9HA 4Y8EA 1EO5A 1WXZA 4BQ4A 4IX0A 1I1XA 4E4FA 3OEXA 2G3JA 2Y63A 2GYIA 3W86A 2QV5A 1V02A 1QI3A 4G5DA 4JL1A 5DBTA 3L0KA 2PDQA 1Z42A 4XAPA 4LCSA 6REQB 4IF2A 1DVJA 1LDCA 2PLMA 3UR8A 4FA3A 1JPHA 3THDA 5LA1A 4L4LA 4QTGA 3KM8A 1JUBA 4JIPA 4BS0A 5I0DA 3BLEA 3B8WA 3QKEA 1AW1A 3RDKA 1RPXA 1FP8A 5FJRA 4KWOA 3DI0A 3RJXA 1O94A 4BY3A 3STGA 5I09A 4X0VA 5A95A 1B5TA 5FSDC 4B5WA 3CMFA 3EXTA 3QLDA 1J0YA 1NOFA 1US3A 3NQ8A 2OTDA 4JFTA 3RCYA 3N17A 1ME8A 1U2YA 2VURA 3W1XA 2OQLA 3VK5A 1NELA 2POZA 2WSRA 3ZZ1A 4L61A 3LZ5A 4H2CA 3LCXA 1LBFA 3KE0A 3VZXA 1T8QA 2BNJA 2YKKA 5FEWA 1OX4B 2B7OA 1XBXA 2V5LA 4Z42C 1NJJA 2IXVA 1OD8A 2ZX7A 3PJWA 2BY0A 3V16A 3SGGA 2EKGA 2VRQA 1NVMA 2F8QA 1GKPA 3AXIA 4X60A 3AXHA 3QYSA 3E0LA 5I24A 2A4AA 1KRAC 3QC0A 3BAJA 5FAJA 3UGVA 1R8LA 2NZLA 2FZ8A 2WVVB 2KX9A 3NPWA 2RAGA 1I6NA 1MWOA 3SI9A 1VRDA 2VOMA 3LNMA 3VGDA 2YDRA 2O9PA 4IUOA 2H9AB 6REQA 4XSMA 4KRUA 1VBHA 4A35A 3GNPA 4KERA 3BJSA 3AFBA 2PDYA 1EJSC 1W3JA 4C5ZA 3RIKA 3SY1A 1Z41A 4RX0A 2CLKA 4ZCWA 4LF1A 3ZSTA 4DQWA 4WXZA 1A5MC 4CD8A 2G5WA 5CGMA 1W1YA 4OV9A 1LYXA 1FWBC 2BVDA 2WJZA 4DX3A 3ATYA 2EO7A 1FXQA 2PCQA 1WV2A 3N2CA 4LVBA 5HNUA 4UMBA 3TONA 1H51A 3HV9A 3IIPA 1FA2A 4M51A 4TQTA 4LUYA 3QEZA 1OX4A 5TBOA 3GE7A 3HU7A 3NEVA 4UCFA 4O8AA 4XD5A 2YB4A 4I5UA 1TUXA 4D6CA 5DY3A 4DJFC 4MWAE 4HMNA 2NWSA 2JKPA 1XI3A 4EF9A 4X9YA 2GLKA 2FPVA 4DUWA 3V3WA 4Y7EA 4X2RA 3U6WA 2E7FA 5JUVA 1W9XA 1UKTA 1DQUA 3D3FA 1HKKA 3PHAA 2WVVA 1W6TA 2G4JA 4JIHA 3VXGA 3FK4A 1KM4A 3LQGA 4NF7A 3OPSA 5D38A 4LC6A 4MZ8A 3MUAA 3FDGA 4IPPA 5DMLA 4QG8A 1U5JA 2Q3RA 4F2BA 1I4NA 4QDMA 1VPQA 2TODA 1SZGA 3TU9A 2H9AA 3RPMA 4OVXA 5IXEA 1SW3A 4FF5A 1NP2A 1DOSA 3QHMA 2J75A 4GIEA 1HQTA 5GNYA 1O12A 1CGXA 5LGXA 1YIXA 4YNGA 3ZYZA 4B5UA 1GONA 3B0PA 5IHRA 1KXQA 1SR0A 2GVEA 2V67A 5D2YA 1K8XA 5H2ZA 1P0NA 3VYLA 4PMJA 4ZGYA 3M46A 3ZMRA 1EOKA 2R94A 1C8VA 4KMQA 2NVCA 3QGAC 4HBKA 2QDGA 1UKQA 1YTKA 3BZJA 1RK5A 1TPUA 2P10A 1P43A 1WUEA 2HSAA 3QY7A 2XVNA 4B91A 1F7BA 4DO4A 1IR1A 3M6YA 5H8UA 5M3WA 4MPQA 2JEQA 1EOMA 3HFTA 5AYZA 2R14A 1HXJA 2NX3A 1PDZA 3KRBA 4AIUA 3PJTA 5DY2A 3MHGA 2WM1A 3PTMA 4FLRA 1Q8JA 1C93A 2B31A 4K8EA 4K38A 1JZ4A 4YL2A 4IH3A 3LDVA 4B3KA 2FPTA 1QOXA 3G18A 1ALDA 3LZ3A 4QGCA 3L0NA 5MKGA 3N2OA 3H24A 2CITA 3UXLA 4EXBA 3LS9A 4QM1A 5CPTA 3I6TA 2TYSA 1XYAA 3IARA 4PMYA 3QV9A 3CL7A 3GHSA 2PF8A 2I7GA 2BHYA 3GDTA 1A5BA 3ITLA 1FHUA 1YDYA 4MZYA 2PZNA 3KP0A 2HQAA 4FXJA 4O57A 4F79A 2Y8VA 1M41A 3W1LA 5D8WA 4EP8C 5DRIA 3RR1A 4XWUA 4UIOA 5HUPA 2Z24A 2YXGA 1LG2A 4EWJA 3WD2A 4HHHA 1FY6A 4Q32A 3AWOA 4FX8A 2GGIA 4ZOEA 4H6EA 3NSNA 5DQPA 3RO6A 3WJYA 3BLIA 3WD1A 3WLSA 1TWZA 4NAEB 1CW2A 3G1FA 4AD1A 4AX7A 3E1F1 4PGLA 3RG6A 1H61A 4JIEA 5J5DA 1B54A 1GVYA 5PTDA 4PUKA 2OO0A 2FB3A 2WBGA 1C91A 4PTVA 5LYRA 3LHWA 5G4EA 2VZOA 2OLHA 1YBQA 4UQEA 1ZUAX 5AVHA 3LCIA 3MW7A 4UQDA 1SSDA 3B8UA 2PE4A 2C91A 1PHQA 2J7CA 4KPLA 4C91A 4IIFA 1PYFA 2GJLA 2H3BA 4GK8A 5FL0A 2HPMA 3MJYA 2XGBA 2XZ7A 3QR1A 1W5NA 3KRSA 1Z89A 1MDLA 3GNNA 3KL3A 1UKPA 4F2UA 4IFKB 2DSZA 3IUDA 3QR3A 2OYLA 4GABA 3TUUA 4FOUA 1H1NA 4J35A 2ZC1A 1WQ5A 2Z29A 4UNKA 2MUCA 2YZ5A 4S3CA 1H0GA 1VFFA 3C4UA 3SUUA 1PKLA 3W85A 3W2KA 4KRZA 3EB4A 4BHYA 1K4GA 1O5XA 4I3GA 4B5XA 1E1EA 1UZ4A 5A6KA 2VC6A 3G2GA 2ALDA 3TC6A 3LBOA 1JYWA 1HJWA 1W0MA 3KTXA 4LGXA 3UR2A 4HHMA 2E67A 3W83A 2YFNA 3ARUA 4GZJA 2WPBA 3KDOA 3T0AA 4EPKA 4EVZA 3MI2A 4UZUA 4CNPA 3G3MA 1GJPA 6CGTA 2BBFA 5FJIA 3CUFA 1CWYA 1ELSA 5JIPA 3TR9A 1XLAA 3K2GA 3CAQA 3VO0A 4GXMA 3LUTA 3VD5A 5EFDA 3C52A 3PUEA 3DCPA 5D9PA 1EH9A 4ZB2A 1BTMA 4N9BA 1RY8A 2W79A 1H1ZA 3VOIA 1DPMA 3CAKA 2FFCA 3TAKA 5BROA 1G0CA 3WQEA 3BPWA 4ZEPA 1DIDA 2ISFA 4UR9A 3ZS4A 1GQKA 1QNSA 2DZPA 2OSWA 1EUNA 4IIHA 3GW3A 3MDUA 1TIWA 3IK4A 1V3JA 2PP1A 4PB4A 3CUHA 3L2MA 3JW7A 4ZQCA 5KZEA 2FFIA 4C7DA 2C8NA 3U4AA 1KM6A 1CXEA 3KVJA 1DIEA 1PKYA 1S2CA 4Q7IA 4QDWA 2WZMA 4GY0A 3EA1A 4LS1A 4YU1A 2C79A 3PAOA 1V7AA 2J6VA 4CN6A 1C8YA 3CS2A 3VGFA 4XBJA 1MNZA 4I5XA 1H3GA 2XFRA 4L56A 3WNPA 4E3VA 1MQQA 2PTDA 4Z2HA 3W1AA 1JR1A 3W1RA 3LGEA 3RK8A 1O1ZA 5ABGA 2VR2A 5IBXA 1OF6A 2Z0IA 3VMOA 1F61A 4I9TA 3MV11 3MJMA 3UG8A 5HPCA 1OB0A 5D2VA 1G69A 3GG8A 3ONBA 5LIXX 4J5NA 4Q3MA 3CNYA 1AUSL 3W2JA 1ZFJA 1Q6DA 4K7YA 1ZCOA 4PMNA 1W1TA 4CNUA 1TWDA 1KBKA 4PCFA 1EF3A 2HRWA 1FWHC 1XSIA 4HNLA 1MRAA 4PMZA 1C9WA 5LSMA 5A8OA 3LGGA 4C6JA 4IG2B 2PGRA 4OOUA 3WQ6A 4B5VA 2D23A 2CZFA 2E3ZA 3AZRA 4AIBA 4OT7A 3OIHA 3VZZA 3MSGA 1OQFA 3PY2A 1EZWA 3PTKA 4DM1A 3W7HA 3UERA 3AIEA 1P1XA 3H54A 3ARZA 2CU0A 5FKYA 3D6NA 1EIBA 1VBRA 3WK1A 1O66A 3CGTA 1AK5A 2WBKA 5CZJA 5G2HA 5B7ZA 3SQSA 2Y7EA 3OW1A 1O95A 4DF0A 3TLLA 3G1AA 4Q4MA 4O19A 2BX7A 1JDDA 1E5JA 4X63A 4JR5A 1XIMA 1LQ0A 5F2IA 2QJJA 4IZGA 2E09A 4ZOBA 3AC0A 1P0KA 1LROA 4GYPA 2IXUA 2FHBA 2PLCA 4FO4A 5IHSA 4RE0A 2NV1A 4GY1A 2D0FA 2J6XA 3JVAA 2BXYA 4C90A 3VIOA 4QHRA 1DEDA 2QCCA 3BSMA 3VDHA 2H8XA 3ZOAA 5BWFA 4JL2A 4H00A 4YTRA 2X1IA 4M80A 1SJCA 4ICNA 3NQFA 4JIQA 3N29A 4IMEA 1MXSA 1UH3A 1UOKA 2QF8A 5JIWA 2QUMA 2RDXA 1EYEA 4MDPA 5I78A 3WLQA 2XWEA 2OFJA 5DFAA 4YVXA 4HU0A 3V7PA 4Z2JA 1YTEA 4JQ3A 3NPXA 2JE8A 1J2WA 4W87A 1LZOA 3ISIX 3URQA 1W91A 3SCPA 4G9PA 3WQPA 1ZLPA 3B0XA 1GPWA 4AMCA 4IG2A 4O15A 2IW0A 2ZX6A 4LEQA 1M3UA 2V30A 5T26A 1P1MA 3G1XA 3VIPA 1EC7A 2DT1A 4DJFD 3EDKA 1P5BA 3ZXWA 2RGMA 4LYRA 4KGJA 5A6LA 1D3HA 4IJRA 4AB4A 1B31A 4F0LA 1LWIA 3VDBA 1EJTC 1Z69A 2PD9A 5HA7A 4MFEA 3DFOA 2IPJA 1JRBA 3F5JA 1SZEA 5AYYA 5HMFA 3RX2A 2L5HA 3EX3A 3W2NA 3NGFA 1CEOA 4Q33A 3FDKA 1EP2A 4P5UA 1D8CA 3BMXA 2CBVA 1YDOA 3OLEA 3IIXA 2GQ9A 2V5DA 4MJMA 2WMIA 4YHGA 3EZ4A 4KGLA 1XR2A 4H9UA 3KX6A 2J7DA 4IP5A 3WBXA 3U0HA 4W7UA 2DSWA 4NZ5A 3IIOA 2PDWA 1QNQA 3GBDA 1J6PA 4JTEA 3MP3A 3CXOA 4NJIA 1KR0A 2JGQA 3OYZA 2VFDA 5A8PA 2EPOA 1ZL1A 1WBHA 3UXKA 4KFOA 4JPGA 3SCVA 1W1PA 3O9NA 3MSDA 1X8FA 3M5XA 1LOLA 1UCWA 3GLCA 4R7WA 4UFLA 3W37A 5BRQA 1VBJA 3ARSA 3VIGA 2E1DA 1UOZA 2J25A 3LHZA 1RBAA 2PDIA 2WSKA 4GIRA 3D3AA 3L12A 3T9PA 3NXFA 4JTUA 4HSNA 1UP2A 3PF3A 2V3FA 2CEQA 5FL1A 3S1GA 3VVGA 3V1PA 5CBIA 2PFHA 3VKKA 2FB2A 2IKGA 4Q8MA 4HMEA 4BK9A 2I17A 3DERA 2QKFA 1LWJA 3QQ1A 3SRHA 3KL0A 1QPRA 1PCWA 4ZXOA 1SZFA 1BGGA 4E2VA 3W6YA 3U5YA 3EKZA 1Z44A 4AZCB 1ZAJA 1BKHA 3AHXA 3BMVA 5I79A 1IEQA 1FCUA 3KVMA 3CO4A 1VR6A 3C2EA 2WC3A 1ZAHA 1UBSA 1NEYA 1UUQA 3ZLGA 1JQVA 3O1NA 1J9YA 3EOUA 3CV6A 1W3HA 2YDAA 3HTWA 3VM5A 2QDDA 3LG3A 2R1LA 5BXPA 5FI8A 1S2TA 5FEZA 3H12A 4H6KA 4XZNX 3XISA 1XC6A 3O06A 4S3AA 3BMWA 2WB5A 3OZPA 5U4NA 1JZ3A 3ZT6A 5CGTA 3B8DA 4UWMA 5HR6A 4PUDA 1F73A 3OVGA 1F8MA 3NL6A 3NQAA 2P0IA 3ZO9A 3UWUA 3AIUA 4NQ1A 1MW1A 5CBBA 1BYBA 4PZVA 1OCJA 3O15A 1B3VA 4UXDA 2DZXA 3THQA 2CBUA 1NDYA 3CZEA 1TMQA 5M03A 2E28A 5DN1A 5A5WA 1XIBA 2B81A 3LOTA 3PNZA 5GNXA 3TTYA 2PGWA 3S5YA 5IDZA 3PFRA 3LMZA 1M7XA 3PZQA 3T78A 4OTKA 2J78A 3DKLA 4LB4A 5F4XA 2HE8A 3W7GA 1V0NA 3T81A 3RJYA 3TQVA 2DW6A 2QT3A 4XZHA 3U4FA 3A24A 3RLVA 1FWJC 1MXGA 1H63A 1LORA 1WDRA 5A6AA 4EPEC 1E15A 3G1RA 1H0IA 2FLIA 3OGSA 1UWSA 5GJMA 1XWYA 4D8AA 1P7TB 3BGJA 5KETA 3I6EA 3NQMA 2V38A