4J40A

Crystal structure of the dual-domain ggdef-eal module of fimx from pseudomonas aeruginosa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
251
structure length
251
Chain Sequence
AAQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords FimX
total genus 77
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4j40A00
4Y8EA 4RNHA 3U2EA 3GFZA 3PFMA 4HU3A 4Y9OA 4Y9PA 3PJUA 3GG0A 4Y9NA 4Y9MA 3S83A 3GFYA 3KZPA 3N3TA 4HJFA 5M1TA 4AG0A 4RNIA 4RNFA 3GFXA 3SY8A 2BASA 3TLQA 4FOKA 3GG1A 4Q6JA 4RNJA 4ES4A 4F3HA 4LJ3A 3PJTA 3HV8A 4F48A 4FOUA 2W27A 3HV9A 2R6OA 4KIEA 4FOJA 4HU4A 5MKGB 5MF5A 3PJXA 4LYKA 3PJWA 5MKGA 4AFYA 4J40A
chains in the Genus database with same CATH superfamily
1HKIA 1XIGA 4NSBA 3MO7A 4NJKA 3GTIA 3QV7A 3T09A 3DHDA 2W63A 1FDZA 4XZNX 3G3DA 1C92A 2XYLA 4PFMA 1TPUA 4S3FA 4QE4A 4M0XA 1EKOA 3PNUA 1UWAA 1CGTA 1HIZA 4WDUA 4LPCA 3A5FA 4I7UA 1XCFA 1VR6A 3G77A 1XDLA 1IT7A 3TROA 5JBDA 1XQLA 2NUYA 3UCDA 5FJUA 1CNVA 2XVLA 3LXBA 4GH3A 3NQBA 1VBUA 3BCDA 3NPWA 1OGSA 1JULA 1GVOA 3OQ8A 1DQWA 1K70A 3WDPP 1W3NA 2JALA 2DZAA 3CUHA 4PMYA 4TX9A 4NG3A 2FVKA 3JRKA 1XLJA 4GNJA 4E2BA 4AD5A 2GOKA 2B31A 3N2BA 4QFUA 1I4NA 2VP8A 3ARWA 2WNWA 4K36A 4HOXA 2XU2A 1HL2A 5U4NA 3VX0A 3NVTA 4R9XA 3PTMA 1TJ0A 3FSTA 2G4JA 3CQ0A 1V3LA 1HP4A 4ZVJA 2DW6A 1MVYA 3KCOA 1FWFC 2D20A 1VHCA 3KXQA 1H63A 3I65A 5K9DA 5D4YA 1H61A 1KQZA 2OWXA 3RM4A 1PWMA 1WX0A 2DVXA 3W1TA 3GC4A 4H8UA 3ES7A 5FIPA 1W56A 4H9YA 2FDMA 5CEWA 4I9JA 1H4PA 4IMFA 1TUFA 4KEUA 1XISA 4YNGA 1W9BM 1ZZMA 4GO8A 1QFEA 3V5CA 5A8GA 2EJAA 3GLCA 2OEMA 2XIOA 3SB0A 4NAEA 3UXLA 3ZT5A 5M3WA 1JUKA 1PXGA 3WJWA 4MYAA 2BB0A 3PSWA 4D8ZA 3WQGA 4GI6A 1ZFJA 3T07A 3LPOA 2RDWA 4EWJA 2Z7GA 4IMCA 5CLTA 1OGGA 3LCWA 4ICCX 1TR1A 3CLMA 1BYDA 4O10A 4X2RA 4JEJA 3DC0A 3OGSA 3KRUA 5HATA 1JZ7A 3GTXA 1E40A 3D6NA 3BE7A 3W1PA 3DENA 3T8QA 3GS6A 1E6PA 4DN1A 4TOQA 3SN1A 1E1CB 4PN2A 4PEEA 3RDKA 4O1EA 5MKGB 4ZO6A 2ZC8A 1OCQA 3SGUA 1Q8AA 2V5KA 5ENLA 1QUMA 1KRMA 3V4BA 1C93A 4XSMA 1LWJA 3B03A 2F84A 3IJ7A 4F66A 3KW3A 5IRPA 4DWDA 1TPWA 1DJYA 3WQVA 1UASA 2PD5A 2FH8A 4QXIA 1ML1A 2R94A 1RXOB 3HB9A 2FZ8A 2QUTA 3QN3A 2TYSA 1W2PA 1X1NA 3VNZA 3SGZA 1WDSA 3U2ZA 3IIPA 2V2CA 4PUJA 2KAUC 3GIPA 3BOFA 1YDNA 3W7GA 1C3FA 1MDRA 1UIPA 4NZJA 2PDPA 4FO4A 3AC0A 3KBVA 4PMNA 1R7OA 2W0UA 3DBNA 3A64A 1DTNA 1WKYA 2WM1A 5JXQA 4P8UA 5IOBA 2YBTA 3PJTA 1I2PA 2YL6A 4A3RA 3UF9A 5BROA 3EA3A 4RDWA 1BXBA 3MUZ1 3UZ5A 3ZLGA 4DJFD 2BVYA 3A12A 5C9WA 2A5HA 1ITCA 1QPQA 3U2CA 1GKPA 3VIIA 2NX1A 1X8CA 7PTDA 3G8RA 3DKLA 2OLSA 3EMQA 4QTGA 2GQ3A 3IIXA 4YLWA 3FVDA 1JPMA 3W7JA 2H8ZA 4B16A 3PBGA 4GY1A 4ILSA 5EL1A 3VCNA 4NX0A 4A35A 1E0WA 3QVQA 3QKZA 3LSBA 2Q3OA 4UMAA 4L5ZA 1J10A 1TELA 1P1MA 1GG0A 3NXLA 4R3UA 1DTUA 1F5ZA 1VCGA 1IR2A 2WMKA 4DLFA 3DFNA 5JH1A 2WKGA 2VELA 3N9KA 2GVYA 4LUSB 5CKSA 4GI9A 4ZE4A 3KVMA 1PZ0A 1GJWA 1ZCCA 3WLJA 4L6DA 3SCWA 4PUDA 1ZALA 1KCKA 4A05A 4H83A 1SYTA 3AMGA 4YWIA 4LYRA 4HNOA 1L6FA 2XZ7A 3TTEA 1JFHA 5MF5A 5HR7A 1VJSA 1SM9A 3CIVA 1MNZA 3WH9A 2EJ1A 3B9EA 4L1XA 1G4SA 1UWRA 5DFAA 3HQOA 3VO0A 4KIRA 3L0KA 3HU7A 3MWAA 3ATYA 3O15A 3VABA 4DO6A 4W87A 4MY9A 3RK8A 3WX7A 2DGAA 4WQ6A 4F8XA 3UWWA 1MW3A 1NDYA 5C2GA 5HJLA 4CVUA 4HU3A 3POCA 4ICMA 2G3MA 1B4KA 3ITVA 4UTKA 3WH5A 4AIOA 4LCQA 1E0TA 2P88A 4LH8A 4AD1A 1R8LA 2ZOXA 3WDIA 2W91A 1LBLA 4DM2A 1G4TA 3VM5A 4GINA 3CWOX 3SUSA 1MUWA 4YHGA 4JNYA 1S5WA 1ICSA 3VNKA 1WUEA 2J8GA 3IGUA 4I8YA 3NPXA 4GD0A 4RNIA 3HG3A 4AUBA 2BG5A 1B30A 3WEOA 3BICA 3UPBA 1QU4A 1TA3B 2Z6JA 1SMDA 3OLEA 5BCAA 4J3ZA 1M3UA 2O9RA 5HULA 4FNQA 1JI1A 4TUFA 3AMCA 3QKEA 2R1MA 1X6NA 2FPYA 1UPPA 2Y8UA 2V5LA 4H6EA 1S39A 3CIXA 4NP7A 5FESA 4CQCA 4TTUA 3BL3A 4WD0A 2D0FA 4HYRA 1G4PA 4FLOA 1YIXA 4DUWA 3G0UA 5FSEC 3E96A 3GBDA 1M41A 3CM4A 3STFA 5FL0A 1V0KA 1JPIA 3KEHA 4AB4A 5HQMA 4JHOA 4GUHA 1GEQA 1MFVA 4M82A 2RH9A 2ZUWA 1KQYA 3RNDA 3C61A 3I7QA 4AIUA 4F0HA 4HU4A 1XBVA 4LBUA 5LA2A 4H9VA 5C8BB 1GOXA 4J3XA 4Q3MA 4UOJA 3A13A 1MQQA 4I90A 4ACZA 1ZL1A 4WOQA 3UJSA 4EX4A 1I2NA 3OVGA 3UG4A 4RE4A 1UKTA 2DSWA 1QHPA 3MP4A 1LLZA 1WP6A 3HJEA 1TFVA 2FH6A 1ISZA 4S1FA 1GHRA 3O1NA 3WF2A 3OOQA 3WF3A 4N9BA 4ZXLA 4O18A 3W24A 4Z08A 4EXAA 1GVFA 3IRDA 4CNTA 1FXQA 4QX4A 3WNPA 4IP4A 4CKQA 1ZY9A 4DWSC 5CSSA 1RJQA 3EKZA 3OA3A 1BLIA 2YBUA 1NWRA 3LPPA 1XLFA 1E5JA 3ZJKA 3PZIA 4YYFA 1R9ZA 1XFBA 5DXYA 4QG6A 4Y8EA 4C6MA 1KXVA 1F07A 4AD0A 2WAGA 1HUVA 1SU5A 1PEZA 3A4AA 3IWPA 3HV8A 2WM0A 4L4MA 4B5NA 4AF0B 1W5QA 1WKEA 3USBA 1HKJA 3PJUA 1KXHA 4XO7A 1EZ2A 1CIUA 3D3AA 3ERPA 1B90A 4XD4A 2WCAA 5DX7A 3E2VA 1EIXA 2D0HA 3AS3A 2V3EA 2PLJA 2PWDA 2XINA 1QNPA 1XM3A 4XZ9A 5JBEA 3OQEA 2V0TA 2Z2BA 3PBYA 1AL8A 2ZXQA 2FHBA 5DCEA 3ZR4A 3WF1A 4GO9A 3SUTA 1K3UA 4QRNA 3VZYA 3T40A 2X1RA 1Z8AA 2TSYA 1T40A 3T2PA 1XYFA 3UGRA 3NGFA 3C3NA 1GG1A 1WDPA 3OLDA 4CNSA 4LAKA 2E40A 5M2FX 3IVUA 4LNYA 1WQ5A 1EF3A 1E15A 1XICA 1TV5A 1W3TA 4S2CA 3EDEA 1OWQA 5TIMA 1YTEA 2W67A 4ZR8A 3IIZA 2VDHA 4DJED 1L6YA 3TQKA 4REQB 2CWXA 1IZJA 5E70A 1J6OA 4KIEA 1DBTA 4AW7A 5D2YA 4DF1A 1J5SA 3Q94A 1YNPA 3AALA 2YDAA 4PMDA 3TWAA 3NZPA 1EGZA 3S5YA 1YW1A 3C4UA 3SW6A 4CU7A 3EXSA 1O1HA 4IIEA 3RAOA 1B3YA 1P6BA 3GXIA 1R3RA 4GKTA 3THQA 3QEZA 3VOIA 4FNPA 1TWZA 3S3GA 3MP3A 1A5NC 5JVLA 3LB0A 4Y9AA 4N9CA 5FA5A 4LB4A 2XM1A 2BP1A 2P50A 3GDMA 2FVMA 4ZQPA 3PZNA 3W02A 1I6NA 2XWEA 4AD4A 4U33A 5DMLA 2OT1A 4QQ3A 3WSUA 4H6RA 4WLCA 4Q4OA 2GGGA 2RGMA 4MNKA 5DXXA 3F4NA 2BGSA 1OD8A 4KEMA 3PZTA 5LZLA 3N25A 3U9IA 1WXYA 1XG3A 3L0GA 1UR9A 3LNPA 4LUYA 3S1VA 4PMUA 2JKAA 4G7FA 1S5MA 3LDVA 3CWNA 4RZBA 3FAWA 2J4GA 3GO2A 3QQ0A 2GDVA 2VZVA 3WK0A 4PEKA 4J4KA 4NUWA 1W54A 3VD3A 1J0JA 2ZCGA 4E2OA 4JICA 4XUGA 4RE0A 4Y2WA 1PCWA 4M7TA 3E2RA 3VMNA 2RUSA 2Q3RA 5AZ0A 4PUWA 1GGOA 4BR1A 3QHMA 1XDMA 3GVRA 3ZFHA 1ICPA 3NTYA 4Y9NA 2VEMA 3PBUA 4DIAA 4HNCA 5E09A 2Q01A 1CZ1A 4NNBA 1RVGA 3DCPA 1YQ2A 2V67A 1FHVA 3S9ZA 3CMFA 3GDKA 1MMFA 2UY4A 2WQDA 3QY8A 2PUZA 4LRSA 4QE1A 2EHHA 1BWKA 4HNVA 2VQTA 3QGVA 4HPGA 1OC7A 5E0CA 5I2UA 2WLZA 4GWEA 2ZZ7A 3RR1A 3CAWA 3UD6A 3LMYA 1E1CA 1UP2A 3M0MA 2QT3A 1H51A 1FHDA 2E09A 2ZX6A 3QMRA 3FIGA 1IGSA 2XFRA 2CKRA 2ZXAA 1GJPA 5A8PA 3PFRA 4ZCWA 1RK5A 2WO5A 2HK1A 1TREA 1FQ0A 3G1SA 2WZEA 4HZ8A 4ZOCA 3W1MA 2F6XA 3F4CA 1QPKA 4IIHA 3NAVA 2H9AA 1SO4A 2QZRA 2DUZA 5M03A 1XPGA 2JGQA 2PWUA 2O55A 1G94A 3GG0A 5H2ZA 4OWGA 3TR9A 2HJPA 3OLGA 5HWNA 4Q4RA 1YADA 2WVUA 3MCMA 1TB3A 3OO2A 2QCCA 3ABXA 1N2VA 1Y5WA 5LYRA 1RBOB 2J78A 3WQCA 5KZDA 4MNLA 3NL2A 3JU2A 1EBGA 3GZ3A 1N55A 3ZT6A 2PDLA 2QDHA 3ARUA 1ZNNA 1XX1A 1SJCA 2PDYA 1X1ZA 3CZGA 1U22A 1A0CA 1QR7A 2V82A 2A3HA 1XBZA 4TV6A 1IXQA 4DZ5A 3EZ4A 1VBGA 4LUTB 4PCNA 4N0RA 1TTJA 2X09A 1P0EA 2BXZA 1AD1A 4NYUA 4LY8A 5D33A 3W00A 5DBUA 2Y7EA 1DWIM 4XBJA 1H11A 1EP2A 5EMUA 1C9DA 4Z2HA 1V51A 4Q8WA 4M7SA 1R86A 5HQEA 4ZGYA 1VFFA 3S46A 1JCJA 4QISA 4AVFA 2DU2A 4MZ8A 3V3WA 4NASA 1X97A 4O0ZA 3E1F1 2OYMA 5T8GA 4UCFA 1CWYA 4A2RA 4UTMA 1W9VA 3HN3A 2HROA 1V02A 1BF2A 4GBDA 2DH2A 1ELSA 1Q85A 3B8WA 3M0JA 1JCYA 4MPKA 1O68A 4R88A 5GNYA 5ABFB 3NEVA 3KHJA 4DYKA 3WQ6A 2VRJA 4AZIA 3TYCA 3PM6A 4K6AA 2Y63A 4FEZA 1KGUA 3W88A 1Q6RA 2DP3A 1GOOA 2XVGA 4IZGA 3SN0A 2ON3A 4G8TA 4JQ4A 4K8HA 4DI9A 1ZBKA 2WCSA 1HP5A 2PDWA 5EB8A 1JEZA 5IDIA 1H41A 1KR1A 3ITYA 3KTSA 3SZ8A 4PMJA 4B5VA 2DDXA 3TVAA 3WFAA 1I1XA 3WUGA 4M56A 3PAJA 3NFUA 1TPC1 1BVZA 4OGZA 1PO9A 3ZVHA 1QO5A 2B81A 4DJDD 1JGIA 1QXLA 1YPIA 3NJ3A 5HMDA 2V30A 4ERAA 5CZSA 5K2ZA 4L4PA 4O1FA 4M6UA 4XZWA 4D8LA 4P8VA 3EB3A 4W7UA 2GL5A 3GHUA 5CC5A 1RBLA 1FWWA 4REQA 1GVSA 1Y5XA 4KH2A 3EXRA 4FLQA 3SAZA 1PKNA 1EWDA 1OGBA 2WNQA 1NP2A 3W2UA 5C54A 1EA0A 1B1YA 3VCCA 4QNWA 1UR3M 4IPIA 1ZCOA 1UUQA 1E4LA 1OBAA 3PNZA 2W9MA 2DIKA 3I4KA 3CZLA 3LV5A 4BI7A 2XN1A 5E93A 3TW7A 2VEIA 2QVNA 2PDFA 5D38A 1TMHA 3FYYA 3PPGA 4IH3A 1TTPA 3ALGA 1FVPA 1ISWA 2ZXBA 4R53A 2OOGA 3IAPA 1XG4A 4OT7A 5EGRA 4H8NA 2WJZA 2O4QA 3FFSA 2ZZ4A 1TZZA 4YPJA 1XLBA 1K8XA 1E43A 1DXIA 1UG6A 3TNOA 1W0MA 3CHVA 1HF6A 1X7FA 3TNBA 4F2BA 5A2AA 4JD4A 2HTMA 3VNLA 4F9DA 2WHKA 3R79A 3W87A 4IFKB 2Y5JA 3ABQA 3MW7A 2WBGA 2PDIA 1V3HA 5LIKX 1ENUA 1N8IA 4Q4QA 2YB1A 1W1VA 3LY0A 4CLMA 2PMQA 1VYSX 1I45A 3QW3A 3IUDA 5H8MA 4GYKA 1W2VA 1DWFM 3TK7A 3EKGA 3MP5A 1P48A 2QJGA 4CCCA 1XIBA 2E8YA 1HJUA 2J77A 3HF3A 2GUUA 3EPOA 2DT1A 1WNOA 2FZBA 4WSKA 1E3XA 4I7VA 1O95A 3SY5A 1WE5A 2PWHA 4KT2A 2IXVA 2DORA 3PG9A 1O5QA 3T4WA 3T81A 4JTLA 4HHMA 4ZOEA 3ZT7A 2XH2A 5EA9A 3VNJA 1BQGA 1DKWA 1XH0A 2OZ3A 3KCJA 3MBDA 5CPLA 2OZ8A 1GOIA 1X8FA 5ABGA 1WBHA 4MZYA 3TJIA 3LZ3A 2UZ9A 3DKJA 3SEPA 2R1PA 1YE6A 5XIMA 2W3ZA 3JR2A 3MVIA 4H19A 4IGSA 1V79A 3MQTA 3UR8A 3OP2A 2JIEA 3OG3A 3CMJA 3B8TA 4HA4A 1VPXA 4W5UA 4LYPA 1RP9A 1NDWA 3GB6A 5F1UA 1HL9A 1JZ8A 2WVTA 3M07A 3NQ6A 3E02A 3P8JA 4NILA 3TMLA 2E9LA 4UNLA 3WLRA 1EZWA 4AMCA 1ZB5A 4CNPA 2GQAA 1A50A 4ADUA 4JS3A 4UTFA 4NAEB 4FALA 2YR1A 3LHVA 2A7RA 3DG6A 1MW1A 2QMKA 1CBGA 4X0NA 1EJUC 1U1HA 1WAUA 6A3HA 1V6VA 3VZZA 3FKRA 2F8QA 3OGVA 4C1KA 3TSMA 1X96A 2Y5EA 2PURA 4UQEA 3L0NA 2XVKA 4YN5A 1GHSA 3ABZA 2WNNA 4DXXA 2W4XA 1R0MA 3LI0A 3PWGA 3ZLFA 1XLDA 1MXSA 4CQ8A 3GBEA 3TSDA 5J5RA 4WX2A 4IG2B 2CZDA 3O6DA 3UFYA 3QR0A 5A95A 1JZ6A 2J66A 1TV2A 2L5HA 4YHEA 3VOCA 3LRMA 1N8WA 5U7SA 2R6OA 2D0GA 4H9ZA 3PJXA 4DRSA 3VAVA 1EUNA 5AYXA 3LHZA 3S2CA 1OD0A 2ACSA 5CBIA 3L4ZA 4LUIA 4GQQA 4C60A 4KMQA 1UZ4A 2ZA1A 3UVAA 3HPZA 1DORA 1FHLA 4D9PA 3VYLA 4UB9A 2UY2A 3SJ3A 2BY2A 2YBVA 4P7RA 3WBWA 3ONCA 2WZIA 5C9RA 3B40A 1IV8A 2WZMA 3WQPA 4LF1A 3OYXA 1J0ZA 4TVCA 3QYQA 1UB3A 3F4DA 1TCMA 1SJDA 3MB9A 2PP3A 2J7CA 1L9WA 1S38A 2QCMA 1XLLA 4IG2A 3W86A 2ACUA 3UPMA 4HSOA 2X0SA 3ITGA 4ZL1A 4HZMA 1F76A 2Z26A 4AY8A 1HG3A 1JXKA 3H4WA 2I56A 4KFNA 1OT1A 3LUTA 4NZFA 1GQIA 2JQXA 3PTQA 3W1QA 3DHFA 3GX9A 3KBWA 4CGTA 5DQPA 4GX8A 2X05A 4BQ5A 2Y1HA 5LA0A 1XH2A 2FQIA 4GUGA 2I5IA 3U8GA 3N2XA 1WZAA 3NWRA 3VIJA 4AC1X 4O12A 4E6MA 4KS0A 3HMJG 4U28A 4YYCA 1RCQA 5I3FA 3TJ4A 3W0KA 4IUOA 5GQBA 1WO2A 1Q2RA 2P76A 1PIIA 3V1PA 3HA1A 8TIMA 1TE6A 2V6AA 3SCUA 3TU9A 3GE7A 3S47A 1E56A 2A6NA 2G5WA 2YCIX 1Z42A 1OVDA 3GD6A 3MMWA 3GRIA 4BQ2A 4CEXC 7TAAA 8XIAA 3H2CA 5KZEA 3UYIA 1IEVA 1OG6A 7REQB 1E4IA 1ZJHA 2HMCA 1JCXA 4D6IA 2WSYA 2AKMA 3VIKA 1SUXA 2FMNA 5GJNA 3W7KA 4WK9A 1FH8A 1DYSA 1FWBC 2YCKX 3CASA 1KTCA 1OX6A 5BW6A 2J9YA 3A4WA 4G1NA 1B31A 1JDCA 3WDHA 1J4EA 3A22A 4C6PA 5JIPA 3KWSA 4K8GA 4GGBA 3LM3A 4GA8A 1BKHA 3LCXA 4PYSA 1W6TA 3PF3A 4F0RA 4LY4A 5A6JA 4JQ1A 1MXDA 3M41A 3STCA 1IEWA 2DH3A 2OO0A 2CYGA 1PIFA 5HNNA 1WOBA 4KCWA 1KTBA 3LCLA 3TN6A 1KM6A 4V33A 1S1RA 1SO5A 3L21A 2XVNA 1TR9A 4BF7A 4PUKA 1UMYA 1DIKA 2ZYFA 2XN0A 3VFLA 2CLLA 1NWSA 5K9XA 4KRZA 3BV7A 1L0PA 3HPFA 4CN1A 1FWEC 2HCVA 4MLRA 2VR2A 3GYEA 1AQ0A 3S6OA 2EQDA 1V6YA 2QXWA 1VLWA 1PBGA 4Y9OA 4WSJA 1YBQA 4KGLA 1RCOB 3DDMA 5EU9A 2QCNA 3CUXA 3KE0A 4ML9A 3CYJA 4MDOA 2PLCA 2NVDA 4AY1A 3F4VA 2POZA 3NQAA 3ISIX 3WZ0E 4QS6A 3N9RA 1UD6A 3B8SA 2F61A 3QPEA 2ZFAA 1XS2A 2NQLA 3EEGA 2WHMA 3H24A 4AC7C 1LQ2A 5G1TA 1ADSA 1D2KA 1OF8A 3KRBA 3KOYA 1US2A 3WKZA 1V7AA 2VOTA 1NFBA 2ZWYA 1UP0A 5AC5A 3IJLA 1JI2A 3N18A 2PGRA 5FEPA 4M29A 4AHPA 3R8RA 3C0LA 4E3TA 2OKTA 3QPYA 4CD4A 4UR7A 3F2DA 4AISA 3RJXA 3I3DA 4PB5A 1W1B1 2VZOA 5DRCA 4MFEA 4HYWA 1PHQA 1WB0A 4I5RA 3VKDA 1EGVA 4H8HA 5AVHA 3G1YA 4NJIA 3EX2A 1P6CA 2IPGA 3L4TA 1TYGA 3EEZA 4PMXA 3HQ1A 4UXDA 4PBEA 2OFJA 1M7OA 4A3QA 1SZEA 1QJWA 3ARPA 1U5VA 1VCFA 3TTOA 2CHOA 1O5XA 2UY3A 1OJXA 4LTSA 3NZQA 3VCRA 3QJAA 5DELA 3M0XA 4PCSA 4EKJA 1QWGA 3DYPA 2GGEA 3QY6A 2PZ0A 3M43A 4LEQA 3PSVA 1HGWA 2FTPA 3AXHA 4QQUA 2OYKA 3NYZA 3RITA 2ONEA 3CAQA 2A7NA 5ABFA 3AS2A 2PLKA 4OV4A 1KR0A 2FGBA 3XISA 4LWWA 4GI8A 3RMJA 2DW7A 1QPRA 3TAKA 3QC3A 1XIIA 2NV2A 4A3UA 1PDZA 1F2JA 1JR1A 3NA8A 4PH6A 5FEZA 3KTCA 3PS7A 2GVGA 5HMSA 1H1YA 3GU1A 1UWUA 3WJYA 3A47A 4PUMA 3D3FA 3IVSA 1J96A 2UBPC 4Z1YA 2X41A 1TMQA 4G5DA 1BFNA 4J2PA 3B8IA 1MUMA 1BG9A 4EP8C 4PC8A 3WFZA 1JGMA 1BVWA 3FA5A 3U5UA 3MI6A 1W9PA 3WEZA 1LQ0A 2FB3A 4C6OA 3LPGA 5F4WA 3W73A 4D6JA 2OSYA 3FJNA 1AW1A 4QLLA 4AQLA 1QASA 2QEZA 1KKOA 4R7JA 5PTDA 5D03A 1Z7AA 3CXOA 4PRTA 1CGWA 4OQVA 3H21A 3BWWA 1HZYA 3O06A 4Q7BA 3SCOA 2ISFA 3O8AA 5FI8A 1TPVA 3B0YA 3URBA 1UH4A 2Z27A 3W71A 1LLOA 4FLSA 4IL0A 3TA6A 3V0TA 5C2XA 1TVLA 2ASHA 3BDKA 3VUSA 5AN7A 4B5TA 3R10A 1U5HA 4IX2A 4IICA 5FJRA 4DBWA 4H00A 4N9EA 3ZXWA 2CWNA 4CNUA 3NGJA 1QNRA 1TQJA 1OFOA 4GVGA 4KKXA 5JBFA 1MW0A 3UG3A 4HIBA 4TMBA 3WO8A 1M7XA 1PTGA 2IXUA 4RPPA 2Z1XA 4IPLA 3N4EA 4FXFA 2QPXA 1RHCA 2XN2A 1KRBC 1B9BA 1FTXA 3O7UA 3ZVIA 3GXFA 1O5KA 3L5AA 5KETA 4FXRA 3S2JA 4ZTXA 3HMCA 3GR7A 1NSJA 5FJJA 1LT8A 4F79A 3IANA 4BJHA 3D47A 1ZJAA 2VNCA 1BHGA 2BY3A 3R7MA 3B9NA 5EMKA 3U4AA 3WMCA 3N11A 1MWOA 4QAWA 3EPMA 2X7VA 1JG9A 3MV11 1WDWA 1A80A 1SW3A 1R47A 4NRRA 4K1WA 3CYVA 2OLHA 4JFSA 3SQSA 1TRIA 5DT7A 1KCLA 2XSAA 2XGZA 3B4UA 1PKMA 3SSZA 1ESWA 3LQLA 4F48A 1VP5A 4QLJA 5I06A 4JHZA 4NHVA 1GZGA 1I0BA 1HW6A 3EWYA 2FTYA 2V5CA 4BEQA 4MJ2A 2J8FA 1UZHA 1Z48A 4S2BA 2V2HA 3VD5A 1TPEA 5LNVA 4XWUA 1VENA 4J28A 2GOUA 3RYSA 2FZDA 3LM7A 1K6WA 2CIPA 4X9SA 5H91A 1WV2A 4GY7A 3WBEA 7TIMA 3W1XA 3UXAA 4LC8A 2W5FA 3QW4B 1FWDC 2F6UA 3C3UA 2BMBA 2W61A 3WBAA 1JDDA 1FFQA 4QSFA 3ZWSA 1H1NA 1E6QM 2WSKA 1OC6A 3QBUA 2W92A 3NURA 2VCBA 4L61A 1D8WA 5IDZA 1SW0A 1LOQA 3WLOA 5BWFA 4EPKA 2GSJA 5F2GA 1Q7QA 3DC8A 3S4TA 1VBRA 3CHDA 4MDPA 3ELFA 1W37A 3WJZA 2PU0A 3R94A 5L9FA 5DEZA 2OSXA 1US3A 3U2EA 2ISDA 3GFZA 4P61A 3CT2A 1TTIA 3W75A 2CLHA 3E38A 1BTMA 1B57A 3AXIA 1VFLA 3II1A 3LA4A 3O16A 1AUSL 1JQXA 2OTDA 5G1MA 3AXKA 4FOUA 3W6MA 1R2RA 2OG9A 4UMBA 3WLHA 3UJ2A 4Q4MA 4P8XA 4XISA 4MY1A 4FIRA 2DFAA 4CQAA 3VGDA 3EX1A 3T6CA 1TZ9A 3AUJA 1TX2A 6TAAA 3QSTA 4HMCA 4HU0A 2VFEA 3GQYA 4MTVA 3AHVA 4LF2A 2HV5A 1W1ZA 4GJIA 1XF0A 3FOKA 1QI2A 2HQAA 3G8EA 4QIUA 2CZEA 5FD0A 4DX3A 2WSRA 2KZHA 1E70M 3MUIA 4QG9A 1UWIA 2ICSA 1UHVA 2QCLA 4B15A 3THAA 3VILA 5CG0A 1E9LA 1QPOA 3TOYA 5HJYA 2Z29A 3ZQ9A 3GXDA 1OX4B 4JX6A 5AOUA 1J93A 9XIMA 5I6SA 3PBVA 1T8QA 4BY3A 5MHBA 4Q4KA 3ZM8A 3H70A 1F05A 2R91A 4FB7A 1YXDA 3HM7A 2VFGA 5FJPA 3FGCB 1RQHA 4V1YA 1FP9A 1UJQA 4JIEA 3ITLA 2B7PA 9XIAA 2VDIA 3E0IA 4UQAA 3WBXA 3GDTA 3TX9A 2DQXA 5H6HA 3V16A 3IGXA 1B5TA 1V08A 2X1TA 4K2SA 1E5NA 3BGJA 1HGYA 1ICQA 2YFNA 1J79A 3G0XA 1B3WA 2PDHA 3PWIA 3DYOA 4QROA 1KB3A 1UR0A 5LXEA 3PHAA 3DN5A 3T2QA 1UH2A 1K4GA 3PZUA 5DN1A 3WELA 3SO7A 3WMSA 3URAA 3LHWA 3GHSA 2XIBA 4NNAA 1NP0A 1TMLA 2OSWA 2EAWA 3A3XA 2XG9A 1J0HA 3N34A 3C0QA 4LAUA 1JPHA 2EGZA 1KNWA 5C5YA 1XBXA 4HK7A 2X7WA 1YPFA 3SQLA 1E0UA 4ADTA 5CJMA 3UXIA 1SR9A 1FH9A 3RILA 3RPTA 1MW2A 3MJMA 4AZ5A 3ZYZA 3VKKA 2OVLA 4MOZA 2OLAA 4ZZ9A 1VYPX 2IUZA 5A6TC 7A3HA 4NZCA 4H6QA 1H7RA 3CHCA 1TKKA 3NIYA 2YW3A 2ZX5A 2VEKA 4KW2A 2CZ5A 3WLPA 2VR5A 5CBJA 4RV3A 3SM0A 1EEPA 4JL1A 4J1OA 4YS1A 4C6IA 5A69A 2OT0A 4AZ7A 3QHNA 3Q58A 3Q65A 1YYAA 1NAL1 4E4FA 3VIMA 3QRHA 3DECA 2VRQA 4MLJA 2D3LA 3GVVA 1KBJA 3MA8A 4GGHA 2CERA 3F7JA 4LVFA 2TMDA 3POHA 5HUOA 4CEUC 4ML4A 3ITOA 1U30A 4NIRA 6REQB 2NT0A 2A6LA 5E1QA 4XZMX 1KM2A 4JN6A 4BF5A 1VJIA 1IXOA 4DO5A 5A6BA 2C6QA 3WH6A 1NH6A 1BAGA 2IPFA 3GXPA 3OBEA 3W1UA 4NRSA 3JW7A 1K03A 4CCDA 2CNCA 3LLDA 1J0KA 3ONBA 3K4AA 3WQWA 2CEQA 1R30A 4ZE5A 2NX9A 4C6DA 1HN1A 1M5WA 1GORA 1S5TA 1R46A 4GUJA 2I5QA 1XSJA 4IM4A 5GJMA 1GW1A 3DFQA 1OYBA 3CZEA 3AZSA 3MKVA 1LL7A 1A5KC 1OX4A 2HS8A 1JFXA 3VDGA 1BF6A 2ZADA 2AAMA 1K1DA 3CZKA 4KERA 1XYAA 3N73A 4ALDA 1W5PA 3NQGA 4W84A 1W17A 2NZLA 3R12A 3BOLA 3ANUA 3S9IA 1REQB 3G6MA 1O66A 4RNHA 1I8JA 4QG8A 4L9XA 4LALA 1KGXA 5C6MA 4JX4A 3GVWA 1JZ3A 1R3TA 4UTWA 3UWZA 3FNDA 4URIA 2VGGA 1XBYA 1TWWA 4F0SA 3HGRA 1Z3NA 1XV8A 3NL6A 4LBRA 4M1BA 4IQJA 3H2OA 4S3AA 2ZICA 3KDNA 3QPZA 4HPJA 4Y9MA 2CBUA 3T7VA 1KFLA 2Z7KA 2ZZ5A 2HPIA 3NM1A 5LIWX 4Q8PA 3STEA 1BKSA 4ZXOA 3A4JA 1B0IA 4KF1A 2CBVA 3BLDA 3VD7A 2GWNA 1UA3A 4XKMA 2V3GA 3G1FA 2EO7A 1KM4A 4B5XA 4J3UA 4US5D 3R1ZA 3XIMA 4R27A 1VYRA 1YHTA 2ZRUA 1FA2A 1XLMA 1NM9A 4AWSA 3CUJA 2VFIA 1RZMA 1I75A 1X98A 3LRKA 4DEFA 2FKPA 3PULA 4UFHA 1B3XA 4PTNA 1VF8A 3KRZA 1FXPA 2XFFA 5LA1A 1SSGA 1Q6OA 4DF0A 2QGYA 3E5BA 3O9NA 5CJ5A 3NOEA 2B0MA 3WDQA 4KETA 3WG6A 4EVZA 2CPUA 4JCMA 4Z0JA 3VKBA 2Y2WA 5HUPA 2V5JA 4JIRA 1Q2SA 3TQVA 3SCRA 5KSWA 1S3HA 1VEMA 4AF0A 2IQ0A 1TPH1 2FPTA 1A5BA 3V7PA 4DLMA 2C15A 1VZWA 1K9FA 2QR6A 5C0QA 2CLMA 4LEFA 4ZB0A 1EWEA 2C7FA 4GIRA 4AEEA 2V2DA 3FLUA 4JZ5A 4CCZA 3YPIA 3W7RA 4MADA 3HPAA 5CJNA 3SUWA 3CZJA 2V63A 4UQBA 1OFBA 1WXJA 4WEVX 1R85A 4LW7A 4QLKA 3Q45A 3RLGA 3VKJA 5LSMA 1KBBA 4PTXA 1MXGA 4XSLA 4JOMA 3BG9A 3EX4A 3SUVA 4HOWA 4EF9A 4XZBA 4ACYA 1F3TA 5CZKA 3WD4A 2Y85A 4FIQA 4V2XA 3RG6A 4ZB2A 3KAOA 3PPCA 1UZDA 2QW5A 2AQOA 1FWGC 3P0WA 3PUGA 3L66A 2QJHA 2A3AA 3UPWA 5KZ6A 1R9YA 4B5WA 3DFPA 3JUGA 3TN4A 3N3MA 2AKZA 1M7JA 5CLWA 3P81A 1E1FA 3EWXA 3AI0A 2JIWA 4U3CA 2WANA 5LHFA 1UD8A 3BLLA 1W91A 2OOFA 2XGIA 5I3DA 3G24A 5DCDA 5BMXA 1WYIA 3WK2A 1F61A 3KRSA 4UFIA 3NO3A 1MI3A 5A6KA 1OABA 1QWKA 4WVXA 1PKLA 4U4MA 1A0EA 4YWSA 1LUCB 4B9YA 3ARYA 1H0GA 2YCLA 2VTFA 1GT8A 3EMZA 5AC7A 2WYSA 1CLVA 2CETA 3TR2A 1QNVA 1QPNA 3PPHA 3WQDA 1FCUA 2DT3A 4GFIA 4RXFA 2HBVA 4XAGA 4PMQA 1VRDA 4E38A 3MMTA 1SW7A 3TTYA 1JCLA 1RLDA 1HJWA 3IJ8A 3UA4A 4CQ9A 2VQUA 5AC4A 2PGWA 2A85A 3AHZA 2G37A 2WMIA 5LIYX 2VEPA 2RHGA 2PCEA 4FF5A 3VGGA 4WY0B 4Z2JA 3CC1A 1AFSA 4LAMA 3R58A 3SCQA 1BRLB 1HKMA 4MWAC 3W7EA 3SQMA 2A3EA 3HZ3A 1QBBA 1VKFA 1IHIA 3CQHA 4XAYA 1AMKA 3B9AA 3WMLA 3LI1A 5BXRA 3RIKA 4OIFA 4C6EA 4AVOA 1MEWA 2AGTA 3AIVA 4K1GA 3VIFA 4WUIA 2XH7A 5DBTA 4QJ4B 3ARSA 3L4YA 2WMIB 1KBKA 4XB3A 5EBUA 1P4CA 2X1SA 5D2WA 3R43A 2HPMA 4ROQA 3BW2A 3UJEA 1ZGDA 1L6SA 1V77A 5A6AA 3EYPA 1WAWA 2OQLA 4AU0A 4M5PA 3QR3A 3C86A 4GCAA 3FYPA 1BSIA 3MDUA 1DWGM 1RSCA 3OVRA 4PFHA 1A47A 3GHTA 3TC7A 1T7LA 1PHWA 4I9AA 3GR4A 4QM1A 4H9XA 2ODOA 1LROA 1YDOA 2E28A 4O28A 2EKGA 3BSGA 3AYSA 3FSUA 3U3HA 4YTSA 4WJEA 1ODZA 3ARQA 3P14A 2G3IA 1UC5A 3M6DA 1XLIA 3BAWA 1XLEA 3W28A 4NQ1A 3WNLA 3OA5A 3O05A 2NXIA 4N42A 3BCFA 4W8BA 4C1NA 3MU7A 4ZO9A 1I0DA 4M81A 2ZTKA 4JNMA 4WDWA 1OQFA 4NKCA 2BOEX 1JCTA 1QTWA 1W3KA 4LOCA 4JX5A 4JR5A 5D05A 3KM8A 4I7WA 3RJYA 3L4XA 4XZLX 4AG0A 1H3GA 3OZOA 1NDVA 5ECVA 4J9JA 2WC3A 5D2XA 1YXCA 2VFHA 3WL0A 4YTRA 1HJXA 1S2CA 1W9DM 2P3ZA 1KWKA 3RRAA 1OFQA 4UOQA 3GDLA 4XVEA 4D1IA 4LT9A 2YA0A 2Z1KA 3W2LA 3O0FA 3OLIA 2ABBA 4HKPA 2VZTA 2YXGA 1RPKA 2HBXA 2NT1A 4QS5A 3APYA 3WENA 2OWWA 2PDCA 1HQTA 1XD1A 1K77A 3U0HA 1TTQA 4JTSA 4HNTA 2F38A 5HOSA 1M03A 3N3TA 3BAYA 3BVJA 4MUPA 1CXHA 2GWGA 4HA1A 4N7QA 3AXMA 4L9YA 5F2LA 2VC9A 1FCVA 4DAIA 1EJSC 4L1GA 5IHSA 1YLVA 5J04A 3KLLA 3G1HA 1YPXA 2XFWA 4WJXA 4AXNA 2FHCA 1W1A1 3MHGA 4C6NA 1WUFA 3SI9A 4YVXA 1FX6A 1HVXA 1B4EA 1QNQA 2W6RA 3T0BA 1T99A 4KEVA 3LSCA 1ZHAA 4E0CA 1LOLA 2WMJA 2ZRWA 3BQ6A 3UG8A 1ZRQA 3P67A 1IWAA 3JS3A 5REQA 1EHAA 2HXTA 2WSQA 4RNFA 3LPFA 4GC4A 2VURA 1XDJA 3F2BA 3OBAA 3AICA 3QOMA 3K8LA 4ORIA 2QMJA 4MB1A 4O19A 2Y5SA 3QFEA 4HSNA 4JTEA 1AH0A 2BBFA 3M0IA 2WZTA 4AYGA 3IARA 3SY1A 2ZIDA 3W70A 1GVIA 4PSPA 3IACA 3GUGA 4RUBA 4XAZA 3UWEA 2DVUA 3IGHX 1PDYA 2XZ9A 3VU2A 1POKA 1LRNA 1RPXA 1A53A 2ZVIA 1DWAM 5KZMA 3BAXA 3VVGA 5JQ9A 4S23A 3C8FA 4AZHA 2QUNA 3BLOA 3EB2A 2D2GA 1ZLPA 1CI1A 3GFXA 2FZNA 1D7KA 3UR2A 3QV8A 3CQJA 2UY5A 5C55A 4HK6A 2R1KA 3WQFA 3LTYA 4F0MA 1Q63A 3H2EA 3THUA 3R6IA 3BMXA 3QZ6A 1J2WA 2OZ0A 4IJBA 2FPVA 3P5YA 5B7YA 4HBKA 4NJJA 2NQ5A 3B8UA 2FMOA 4IIBA 3WLTA 4H7ZA 1E72M 2QCHA 1T0OA 3VDCA 4IFRA 1E1EA 1FWAC 3LD5A 4HZ6A 3I10A 4K7VA 3CTLA 3LCIA 3O0KA 1VQTA 5BXSA 4HTBA 5BRQA 3W1NA 3PBWA 1OFRA 3P61A 3BOXA 4I5UA 3EWDA 3N12A 3SRDA 1KM5A 4ES4A 4GXMA 1R7AA 2PB1A 5EBAA 4XZIA 3F2CA 5I02A 2WC7A 2A2IA 4ZODA 2YPIA 3UJFA 1K7FA 2H3DA 3C2VA 1ISXA 1MO0A 2FTWA 3TYAA 1EX5A 4AZCA 1PX8A 4OOZA 1JZ4A 3L2LA 3QFWA 1ZP3A 3ARZA 4LV4A 2FVLA 4CN4A 3M5ZA 1XYZA 3WH8A 3W83A 3CL6A 4AAJA 1QOQA 2PBOA 4E3VA 3K8MA 5CH9A 4WDXA 1J2BA 2VZUA 4PMOA 4XBSA 3AIUA 3H4XA 4GACA 1EO5A 4E8CA 3TW9A 1XINA 4GZJA 1L6GA 3TQPA 3UWUA 3AU6A 3LN3A 1QCWA 1P0BA 2V3DA 4MPQA 1GJUA 2QYGA 2P0IA 1U33A 1VLIA 1KFKA 4LNCA 5CGTA 3EDKA 3S2NA 2DZXA 3PANA 4LU0A 1MNSA 4H01A 5EFDA 1H5VA 2ZRVA 1IYXA 1PCKA 4TV5A 2WV8A 1NTHA 3SECA 3CNYA 1Y65A 1P0NA 5AECA 2VCAA 1M01A 4JTTA 3BTNA 4L4OA 3HBLA 3RU8X 5K9CA 3AUOA 5FF7A 1TSIA 4U5IA 2CLIA 1DE5A 3TN3A 2A1YA 3MUAA 1ONXA 5FAGA 4PGLA 1D3CA 4GMEA 3BGAA 5KITA 3AMLA 3P74A 4L7ZA 1EIBA 4KRTA 3KHDA 4A29A 1AQMA 2YFOA 1J5TA 1KV8A 4IPNB 4S38A 1DQUA 3LXAA 4PUUA 3T0TA 2EKCA 3VGFA 3V5FA 1GPFA 3ZIZA 3BG3A 2WVVA 3NDYA 4US6A 4DPPA 4OFCA 4LB3A 5EMJA 4LXFA 5XIAA 4GUIA 3LNMA 4BA0A 3NVDA 3BAJA 3TXVA 2BOGX 1EJRC 4BK9A 4B91A 2WJDA 3SRFA 2EG7A 2CITA 1Q5MA 1FKXA 3LHUA 3P0XA 4DJEA 1CLXA 1XLAA 3GC5A 5A6BD 1XRFA 1O5RA 2DEPA 5JMUA 3NSNA 5I0DA 3ZS4A 2H8XA 1J9YA 4PBFA 4GRSA 1MFUA 1JZ5A 3MMDA 1PWLA 2AAAA 1VB9A 1PV8A 3I6EA 5HPCA 5CBBA 2BNJA 2O92A 4NVTA 2PRMA 3AWNA 4ECLA 3MCNA 2E5DA 1V3JA 3W7MA 2XFYA 1AJ0A 3H7UA 3QXBA 3NPVA 4UIOA 2C71A 2X2GA 1A3HA 5HAOA 1JRBA 3A23A 1OCBA 1WKFA 5IM51 4RZ4A 4GJ1A 3UXKA 3GUWA 7REQA 3G1DA 4LQ1A 3CV6A 4H41A 4HNUA 1AH4A 3N4AA 2W27A 3M0VA 5CSYA 1EX1A 3KLKA 1XXXA 2WCGA 4US5A 3AFBA 3CWHA 4GZEA 3RR4A 1REQA 1JAKA 1LRTA 3VKCA 4MHBA 4O50A 3OGRA 4FX7A 4MNJA 3R8HA 3IVTA 1Q8JA 4R5EA 1R3YA 1YDVA 4ATLA 4ADSA 2C91A 4IPJA 1XL9A 5AYBA 5FF2A 3W25A 1KC7A 2NQZA 4CQDA 3UXDA 1XC4A 2XWDA 1F4HA 2OJPA 5T91A 5LNWA 1EOKA 1OB0A 3RCMA 3BK0A 2XIJA 1DJQA 1IIGA 3O6AA 1Q6QA 5I5RA 1KFCA 5FKYA 3ANYA 2PEVA 4GLEA 1EPVA 1EP1A 4LVGA 4JBRA 5ABEA 3K46A 4HU8A 2Z1WA 4NYYA 3M5XA 3K4WA 1J6PA 2DZBA 2INFA 3E6EA 5FF4A 3QLLA 1H1ZA 1UROA 1SFTA 3PP7A 1C9WA 5AKQA 3NR0A 3M7WA 1ONRA 3QC0A 1GZJA 4LVBA 3E0FA 4C7DA 2Y62A 3VZXA 1LL4A 4C7GA 2E0PA 3S1UA 2O9PA 4LVDA 1Q3NA 1QT1A 5IHRA 1VS1A 2NXGA 5AC8A 2PODA 3P62A 5RUBA 3OG2A 2E7FA 5G2WA 3KL5A 2FJKA 3GU2A 3CQIA 4S3BA 3P93A 2CFFA 4MKVA 4DJDA 3QTGA 4WZHA 2Z1BA 3KTXA 2GJNA 5BRBA 2OWCA 4W8LA 3M1ZA 3ZSTA 1P1XA 1XLHA 3UP8A 2A21A 1OHLA 3QMSA 1IF2A 2C16A 6REQA 2A3LA 3PZVA 6PTDA 3W23A 1HT6A 4BHYA 3EOSA 3C2FA 2YX0A 3R0KA 3W81A 1VFOA 1V3KA 4G6CA 2CW6A 3VDBA 3NYDA 3T42A 3GTNA 3KUMA 5F7UA 1KA9F 2I16A 4Z42C 1B3VA 1ZSXA 2GSHA 2OGJA 5G2IA 3EOOA 4IXHA 2ZUMA 3GFYA 7XIMA 4HJFA 1KD0A 3OZPA 1Q4NX 4U3AA 1CXFA 1PSCA 1V3MA 1XIMA 4A2SA 1XGZA 1J12A 4MJZA 4V27A 4HSHA 2PWGA 3LEPA 5I3KA 4C6BA 4I3GA 1R5YA 4G7EA 4HCDA 5BXPA 2EEXA 2OEKA 1DJXA 2PC8A 4PTDA 3RUBL 1XYLA 2QDGA 4HA0A 3DFYA 3P80A 1X39A 1XIFA 3M7SA 3WEMA 3NL3A 5AZ1A 3DZ1A 3E5PA 5TD4A 1QOPA 4U5KA 2J47A 3PZOA 4EPBC 2HRWA 3OIHA 3QZAA 4M6PA 3UR7A 2HDJA 4W4QA 3B97A 3OPSA 5AYYA 4YXGA 1VJZA 3N2CA 1ZS2A 1KFWA 4C6FA 4B92A 4C5YA 3FJ4A 3TMQA 4FR6A 4DWSD 2QCDB 4OECA 5G4WA 4JKMA 5CPQA 2J24A 1Z9AA 3DI1A 4JFWA 1W1TA 5CPNA 1RUSA 3LYEA 3E0VA 1O12A 4JKKA 1FWSA 2WPGA 1T5AA 1K7XA 4MWAA 2G3JA 5M5DA 4UFLA 4JDBA 2GSEA 2ZX9A 3EWCA 4MWAB 2BGQA 4JTQA 5C7HA 3LGDA 3H8AA 4ZQMA 1V6WA 2PP0A 1IXPA 1DEDA 1LG1A 1QI4A 1EC9A 2Y88A 4GQ0A 1NOFA 4Z1BA 1VIZA 3SN4A 1DE6A 4F2TA 2BY0A 3E74A 2J9ZA 3KX6A 1TPB1 4WGHA 1W1YA 4WKAA 3GU9A 2VC5A 3WF4A 1GW9A 2GPTA 4W88A 3CGTA 4QDMA 4CU8A 8RUCA 3BLPX 2VX7A 4FOKA 4QDWA 1BQCA 1XI3A 1BSLA 1UUMA 4JTUA 4GE8A 2PGEA 3W01A 1XC6A 3DHPA 4MNMA 3W37A 3HTWA 3GH5A 3R5EA 4YTQA 5KEZA 3VNMA 4MSSA 3RPMA 2OPJA 2GYIA 3DFOA 4B2DA 3QMTA 4BQ4A 1JD9A 5XINA 1LBFA 4G7EB 2Q8ZA 3R0DA 4DXKA 5BOOA 2VUNA 2ZZ3A 5HDRA 3RM8A 1M04A 1WKDA 1FCBA 4O57A 4OKDA 2C79A 3UWQA 2J7EA 4WOZA 3UWVA 2WMGA 3CAVA 3NZRA 3QQWA 4K38A 1FBAA 1NU5A 3QZEA 4J3TA 5BXTA 4D72A 1GEHA 1XIDA 3IK4A 1O94A 3QQ1A 3UBPC 4TVDA 5E0FA 1BYAA 5HWJA 1R3QA 3SIMA 5IXEA 1TRDA 4FS9A 1W9UA 1UWQA 3N2MA 1Y7VA 2ZZ1A 1T6MA 2ZUSA 5K7JA 1JF5A 3O6CA 4UNKA 3E2SA 3MVTA 3CL8A 5HBFA 1KWGA 4IUGA 3P2VA 2E1WA 3MBFA 3M47A 8CGTA 1LYXA 5KTLA 4LS1A 2VUYA 1K4HA 4IFOA 1NF0A 4IMDA 4AFYA 2VRKA 4X61A 1W5MA 3SCVA 1A5AA 1DIOA 4EANA 2YCJA 1G69A 5BRPA 3SSJA 3RX2A 1UR2A 1GVEA 3SRKA 2GJXA 1TQXA 4UQDA 5EMLA 1UUOA 2J88A 4C6JA 4GIEA 5D8WA 3M16A 3VMPA 3C2EA 3TWBA 3N29A 3OODA 2YW4A 3I3BA 3TIMA 1EB3A 4FXSA 2D69A 3WD1A 2BVWA 2EPNA 3RPDA 1V6XA 4G9PA 3K5XA 1ITXA 3N17A 3M44A 4PTWA 2XPKA 4Z1CA 3TDFA 1OIMA 4UNIA 3GR8A 4GZIA 4O0QA 3DFTA 4HMDA 4RL3A 2NQ9A 1KRAC 1QOXA 2RKXA 1PYFA 2ISSA 1MUCA 2PDKA 1XP3A 3REQA 3D0CA 1YX1A 1TIWA 4P2VA 3K4DA 3KDOA 2VC7A 1A5MC 5L6UA 3GYCA 1DWJM 4Q8OA 5DMNA 1P6WA 4YMZA 1TV4A 1NOWA 1UCWA 4JNZA 1WXZA 3V1HA 2QPSA 5CSUA 1TUXA 1KFJA 5C7VA 5GJPA 4B3ZA 2PDBA 2BXVA 3W6LA 4ZQCA 1VEPA 3N1AA 4RZ6A 2CZFA 2QAPA 4UZSA 3W7QA 4C90A 4IIFA 2VOMA 3W2MA 3IJ9A 2X16A 1Z32X 1TG7A 1ZJBA 3BCJA 1Q13A 1AW5A 4CNOA 2O4MA 4OE7A 4P7QA 1MZHA 2JKPA 1R38A 2WHLA 1NFPA 3VUPA 3F5KA 3NSXA 3VXGA 5MKGA 1BG4A 3PFMA 2E4TA 4OBSA 1DP0A 2ACQA 3MSYA 3ICJA 1YRRA 4UC5A 1O6IA 3G18A 2Y24A 5H8UA 4DJFA 2PTYA 2DY3A 4NJHA 2XGBA 3UQNA 5AVNA 3TFCA 1CLKA 4DO4A 3OBKA 5LKYA 3FY1A 3BH4A 4HHLA 3VA8A 1OADA 5CZTA 2A3CA 2O9TA 4E5TA 3V0SA 1QMLA 2AGKA 2C3ZA 1VPQA 2VXNA 4YVVA 1XIEA 4PUNA 1DV7A 3GDBA 5I79A 2BWGA 3UERA 3PC0A 4PCFA 1PB0A 2ZXDA 3OHIA 4HD5A 2J7FA 1A4LA 1BGGA 1DJGA 3VE9A 1DJHA 5HINA 2ZRXA 2I1OA 4R85A 1OEPA 4M6QA 4QSHA 1OX5A 1QW7A 3BMWA 1S5NA 1XCXA 2JF6A 1EJXC 2O0TA 1JAEA 4C65A 3EDFA 3W7CA 4XZHA 3O63A 2PSNA 3UVIA 5JH2A 4JY9A 1RD6A 2RFGA 5E9XA 4IP7A 1R87A 3WUBA 1GYLA 2QJIA 2CLOA 2KX9A 1GVYA 3HGJA 5G4HC 3CIWA 1GNXA 4OHQA 4LVAA 4AWTA 3WUEA 1N8FA 3LTSA 4FF7A 1XQKA 4IHCA 2HVNA 3MTWA 3I4EA 4MJ4A 4HCLA 1XWYA 3EWZA 3FX4A 3VNIA 4RDYA 3KOZA 4DUVA 3WIJA 4RLIA 4GH1A 4AXKA 3HOJA 1UD5A 4NT0A 3BURA 3R0UA 2X42A 4HN8A 3TSBA 3PB0A 5C71A 2R24A 5CXPA 1ZBVA 2WLYA 1QHZA 4GZ7A 5FACA 1CYGA 3MI3A 4NZ1A 3AS0A 2GDUA 2UWFA 3VGHA 4DJDC 4O4WA 3VMOA 3C0SA 3WDJA 3AHTA 2P3EA 1XCWA 1KFBA 5GVJA 1XYMA 3WK3A 1HKKA 2INEA 1D3GA 1D8CA 2ZUTA 1FDYA 4QNEA 4O8AA 1GQLA 2VWTA 5REQB 5A6LA 1TPFA 4MB3A 3URNA 3H4GA 1V02E 4MB4A 4QR6A 2VM8A 1S2TA 4FX6M 2AOSA 3GKAA 3MHUA 3KP1A 1M1BA 2RJGA 5I00A 2WSPA 1EFZA 1XRVA 4DJEC 5M1TA 2D73A 2HNHA 1ZP4A 2E68A 4AX7A 3BZJA 4O11A 1NY1A 4D6HA 4ZO8A 1ECEA 2G0WA 4LBSA 2J7HA 1FWNA 3W76A 4J7RA 4MIMA 1PE1A 4HHHA 2W79A 3GAYA 5TF0A 4H7CA 3TE9A 2GVEA 4L6OA 1P0DA 2DZVA 1A5UA 4D8AA 7ODCA 2ESCA 9RUBA 3HFYA 3W2JA 4RDVA 1NQKA 2OODA 3GTFA 2H6RA 1EQPA 4O54A 4WR3A 2AL2B 3VOHA 4B5SA 1YDYA 4LV9A 5DO8A 4K37A 2ABAA 1XFCA 1GQKA 2EPLX 1CXEA 3UCCA 4DPQA 2Z1VA 2J75A 4DELA 2B7QA 2XIIA 3B4YA 3K2GA 3KVLA 3P6LA 3N13A 2Z28A 2GJLA 4L56A 4ZBCA 4KWOA 4JHMA 4X0VA 1UR4A 1F8IA 4C5ZA 4H9TA 1YTKA 3NQMA 4DBSA 4UUIA 3EAUA 1EF2A 2BSLA 1RV8A 3CB8A 4DYJA 3PG8A 3G5EA 2A3BA 1TWIA 3BW4A 1G7UA 4FX8A 4TTGA 1BGAA 3E9AA 1JYNA 4Z2LA 4Z2KA 1PVNA 4MYXA 3NQ8A 4NU7A 4AZ6A 1EXPA 4YIWA 1W1IE 3WYZA 4D6DA 1LF1A 1LWHA 2QAFA 4K3ZA 4K7YA 2NW0A 1E6ZA 2QV4A 3VNDA 4DXVA 1BPLB 3EDJA 1HL8A 4UTJA 4I9MA 1AG1O 3BGGA 2E9MA 4ZOAA 1CGVA 3UESA 1X7IA 3MMUA 5B7ZA 5G5IA 1XRTA 3CPGA 1H7PA 3DU0A 2QJMA 3TH6A 2YL5A 1U2YA 4RK8A 5CAKA 4IMGA 3ANVA 1R2SA 3WJSA 2V3FA 4JTDA 4JQ3A 5HQLA 4F0KA 3UNTA 2FZ9A 5D8ZA 7ENLA 3PJWA 4JTJA 3B9OA 4GYPC 4JPGA 2V8ZA 1PYMA 3E3HA 4U10A 3CQKA 4DY1A 1C8VA 1ZJIA 3W84A 3GNDA 4H2CA 4DJFC 1XKJA 3HPXA 3TYBA 4X3ZA 4A3HA 3SCSA 2YL9A 2YL8A 2BGNE 4S3CA 2NUXA 3RX4A 2DZSA 1UPMB 3ZR5A 1E3ZA 3HGSA 1E0XA 4HOZA 1OFPA 2TODA 1EXBA 3EMCA 1IIHA 1ZAIA 3A21A 5AHEA 4QAIA 4DZAA 3NPUA 3PR2A 1LRQA 1RQEA 4KWVA 4O52A 5D02A 3FYOA 2PRHA 4AEOA 1ITUA 3H26A 3WL1A 3N9SA 4PBGA 2FHFA 1NVMA 3ZZ1A 1S2UA 2PCQA 4W93A 3ZJ8A 3LXCA 2EXOA 3AOFA 2DSUA 1AZ2A 1M53A 1AL7A 2YLAA 4KEZA 1KXQA 1UYQA 1JIBA 1JDEA 4UTLA 1U1UA 4RR4A 4GQRA 4ICNA 1PX4A 4G56A 1H09A 3O3RA 3KBSA 4LYQA 1YKWA 4LC6A 1PS9A 3OU8A 3TZFA 4AZCB 4EPDC 3S83A 2E6FA 4XTIA 3BANA 4NZ5A 3PUDA 2OX1A 2OYLA 5D04C 3QGAC 3QM3A 4AZBA 1EEXA 2PI6A 4NZ4A 1U5JA 1F8MA 1DL3A 2CC0A 4Z17A 4Y7EA 4UTTA 2OEJA 3OVQA 3C6CA 1KLYA 4LUJA 2PA6A 3TA9A 3VI2A 5CZ0A 4UTUA 1R3VA 3AZTA 2QPUA 3LX9A 3XINA 1H50A 2OB3A 3LV6A 3W26A 2ZZ6A 1B2YA 2PDNA 2QLYA 1Y0EA 1UKOA 4O8RA 3CH9A 4S3JA 3IK2A 2D1ZA 4Q8NA 2OELA 2OQYA 4L1WA 3BQ5A 4GHRA 2BODX 1ZENA 2D2JA 2Q8LA 2E1DA 4FP1A 1EQCA 1N82A 3IV3A 3SR7A 3GH4A 3ABOA 3RHGA 4AD2A 3W38A 1HNYA 2OMAA 4FHAA 4IMAA 4KESA 4AVNA 4AYSA 5CC3A 6XIMA 1CGXA 1UJPA 3K1DA 1G7VA 4KCUA 1XHGA 2E3ZA 3O07A 2RJHA 3MS8A 2VENA 2ZE3A 3GK0A 5A3HA 3GNRA 4B5UA 1TPDA 3S5OA 4LRTA 2UV8G 2YCLB 5K3VA 2HZGA 2XSXA 2VZSA 4HZ7A 3GNNA 2B4GA 2A79A 1GUVA 4GNKB 3VD4A 4AHOA 3DHUA 3SFWA 3WLIA 4LUSA 5EPDA 3NG3A 4J5NA 1MRAA 1JYXA 5DY2A 2FYMA 3W27A 2BXYA 2QDEA 3C5QA 1GCYA 1KGWA 2P8CA 4ZO7A 5J5DA 4YTTA 4IQEA 5BZAA 3QOKA 4R7OA 4IIDA 1LBMA 1SZFA 2E6DA 2PLMA 2CESA 3SJNA 3BSMA 3W22A 4GFSA 4KWUA 5A1AA 2IMRA 1A4MA 3R11A 4NAFB 3W53A 5A8NA 5I3HA 3NUKA 4XTDA 2C0HA 2QIWA 3GNPA 3EA1A 3FV9A 1MEHA 1TO3A 2PF8A 1E6SM 1X6LA 4UOZA 4C6KA 4X2PA 3T05A 5B80A 2RAGA 2YXOA 4LSBA 1X6UA 5IBXC 2P8BA 4P8WA 1RH9A 1E0VA 4IMEA 5HXMA 2PC4A 3LTPA 6ENLA 2C1GA 3VTRA 5DMYA 1LL6A 1YNQA 3A24A 3UZYA 3BW3A 2RDTA 1E9IA 5F2IA 1BWVA 5DMMA 2XM2A 2PP1A 3S9YA 2PTWA 4RDZA 3E49A 2VO5A 4ZENA 3RCNA 1VFSA 4DUXA 2C0AA 4I8DA 2YIHA 3CHEA 1MRQA 4N6EA 4HT3A 1SO6A 3LMZA 5CAHA 3KFTA 2WB5A 4P5UA 4PB4A 1RAKA 5HNTA 1H7XA 3UT0A 5I77A 1UWSA 3L2IA 2XIQA 1BWLA 1G67A 1BYCA 3TYUA 2WXDM 3NM3A 3KBMA 3ABSA 5C70A 2FB2A 1JQVA 2PFHA 3GVQA 4EPEC 4Z1AA 1OYAA 3MYOA 4C91A 3TJLA 4D6EA 2O56A 2YJQA 2IKIA 4L80A 4FR1A 3MWCA 2DSKA 4GQGA 1SFJA 4J27A 4RJEA 1NDZA 1R9XA 3LRLA 5CSRA 1HFBA 4NNCA 1UOZA 4Q6XA 2NV9A 3KOXA 3BUVA 1LJYA 5CCZA 4FNRA 2QUUA 3CO4A 3S6TA 3LCFA 3M4HA 4CD6A 1TCDA 1H7NA 5DLCA 4EE9A 4XVDA 2NLIA 4A3YA 5IFTA 2QJJA 4XIAA 5AHNA 3G1VA 2QCFA 2GQ8A 5EYWA 1J0YA 3RM9A 4N4QA 5A2BA 2VEFA 2ADAA 3AS1A 2IKGA 2QUMA 3LENA 3RCYA 1AW2A 3GKFA 3M5YA 2CXEA 3TLQA 2HS6A 4LCRA 3K8KA 5D32A 3T0CA 3PUEA 1D3HA 4W86A 2VGIA 3AIEA 3BSHA 3W2NA 4Q8TA 5H1WA 5CGMA 3P8IA 2AQWA 4XKYA 3TJXA 2YZRA 4C6QA 3D5HA 2Z2AA 4WY0F 1S1PA 5FJIA 3C2YA 3EKLA 1TX0A 2ZX8A 3AHXA 2I9UA 1AMYA 4IGNA 2X40A 4YU1A 3R13A 3H2AA 2Y8VA 3M0YA 5EFFA 4FNUA 4TX6A 1B3ZA 1Q4WA 3B8VA 5AY7A 4KPLA 3MZ2A 3WDRA 4RKAA 3HIJA 1I2QA 4ZEPA 4Z2IA 3TKFA 1TJ2A 3CZ8A 4PRRA 4KCVA 4O1BA 3C0JA 1RY8A 2CXGA 1I60A 2DJLA 1OG0A 4JTAA 2EPOA 2DT0A 4XO6A 3TN5A 1Q6GA 4H9UA 1VIWA 1GOMA 4C6LA 4ONVA 1RA5A 1ZTVA 4HQVA 2Z24A 3AMDA 1CTNA 3JZUA 4PCPA 4PTMA 2F9RA 3N2TA 1TZ7A 4LUTA 1XPYA 3THCA 1VFUA 1KLZA 4HMNA 3OYZA 4GNVA 2WNZA 1PX3A 4EAYA 2ZRYA 2TRSA 1PUDA 1F4AA 1RCXB 1WA3A 3BJTA 2PDGA 2Y0FA 3TXZA 3UJRA 2ATMA 1ZAJA 2DZWA 1M68A 4MY8A 4PMRA 1THFD 3U5YA 4OJYA 1BD0A 1XLKA 2Z0IA 1D7FA 1EDGA 5HMFA 1EJVC 1LOSA 3PZ9A 5BWAA 1RP8A 3U2OA 3THDA 1SZNA 2BHYA 1OFEA 2YYTA 1XUZA 2ATSA 4L65A 4MG4A 4MWAD 1CGUA 4JY8A 1ME7A 4QBXA 2X0HA 4O1DA 4L64A 3VOFA 3AO0A 1P0KA 3W82A 3B05A 4V28A 4I9TA 1WZKA 1AQFA 2FFIA 2WVVB 5AYZA 3CUIA 1AJZA 3ENLA 2E5CA 3CLWA 1LDCA 1A49A 3ZSSA 1CPUA 3G2GA 3BPWA 5TQLA 4KGJA 5D30A 2P5NA 4AHQA 3WJXA 4WSHA 4Q7NA 4L6HA 2BHZA 1IGWA 2V68A 3T55A 1A0DA 1MYRA 1W5OA 4PZVA 3AYRA 4LS2A 3TC6A 2R1NA 4X60A 2GK1B 2I5GA 2QIIA 1FY6A 1WDRA 1IXNA 3CEUA 1AH3A 2YXXA 2ZDSA 2BASA 2A4AA 1TIMA 2ISWA 1HKWA 3L5MA 1DXFA 4R7WA 5EMMA 2I7GA 3WF0A 4YL2A 5I3GA 4K8EA 1PAMA 1K9DA 4M3PA 1YNYA 4OZOA 3FA4A 4FZIA 2W66A 4XD6A 3TTSA 3HQPA 4XUYA 4DBEA 4E2VA 2G3FA 1TE1A 1VC4A 2O9OA 3EWUA 3HFTA 4HK5A 4QE5A 3APTA 2WC4A 3MT1A 2WWDA 1UQZA 1BEUA 2Y6ZA 4EACA 4KBXA 1I1WA 2F2KA 1DIDA 1GQJA 3T0AA 4HTYA 3FVMA 3SFKA 1OFAA 1CB2A 3MKKA 3SY8A 2Y7GA 2YLLA 3JZEA 1KCZA 4GUFA 4PB3A 1FP8A 2G4FA 1CXIA 4JYEA 2DIEA 4TU1A 3FN9A 3M6YA 3PVFA 1EL3A 5HANA 1F6KA 2F2HA 4O0KA 3VDAA 3UEQA 2PWVA 3M46A 2CHNA 2WQPA 4HCHA 3VGEA 3TYZA 2A7PA 1FCQA 4O1CA 1PZ3A 4I6KA 1JPDX 3HG4A 1EGMA 1F3XA 5I23A 3G1AA 1SQ7A 3INPA 4PE8A 2IS7A 3VM7A 3GH7A 1TV3A 1S46A 1CGYA 2CHRA 1A3XA 1KM3A 2JK2A 3HG5A 1E6XM 1OK6A 1XH1A 4IGMA 2ISVA 1W9XA 5H8PA 1K9TA 5TAOA 3QYSA 4Y96A 1N7KA 5G4EA 2V5DA 2PS2A 1Q6FA 1S2VA 1K7EA 1VFMA 2BY1A 3FXGA 4OBTA 1UR8A 5CC7A 1XW8A 5A8OA 3FEMA 3LGGA 4DWSA 4O17A 2MANA 4R33A 4F40A 2JKEA 4N4PA 2ACRA 2AMXA 1ZUAX 1G01A 2V69A 3P82A 1H7OA 3WY1A 3STPA 3S8HA 4A6GA 1ZPTA 4YJ5A 2HNEA 3NSMA 2O7SA 4R34A 2HSAA 4EWND 3V35A 3MJYA 5I07A 3VINA 3M64A 3NNTA 5K4XA 3PUOA 1EO7A 3VD9A 2DZUA 2J25A 4XAFA 3CPUA 2XJ7A 5CPOA 5T9BG 1UOKA 3TFXA 3E0WA 5D2TA 4EXBA 1FDJA 3C56A 3H2MA 1QK2A 4Q7IA 2R9RA 1YBQB 2QGHA 1V03A 3ZVHB 5LIXX 2XVPA 4WRHA 2C1IA 1NELA 2QCGA 1ODUA 3H6OA 3W7LA 3W72A 4JQ2A 2GJPA 3IPWA 1KTNA 1LG2A 1GTEA 1I2OA 3DIPA 2GQ9A 4XKYB 3W9ZA 1XSKA 3H12A 3BLEA 5LNSA 1T8XA 1UMLA 5BYWA 4JTCA 1ECQA 3RXZA 2WKJA 1EC8A 1K6AA 2ZX7A 4J3WA 5T9CE 3LU2A 3EX3A 5FAJA 3VGBA 4JFUA 4JIPA 3EX6A 3R2GA 3V36A 2D2OA 1L6WA 4PULA 3NL5A 1OSEA 4WCJA 4WHBA 5DT5A 3WQ8A 1EDQA 5A8QA 1FWCC 4RPQA 5A6SA 3OZYA 3PB2A 2WK2A 2WJEA 3G1RA 3LERA 3W7IA 2P0OA 2PWFA 3L12A 2QCEA 4FNTA 4GOAA 3CAKA 2Y89A 4F9JA 2Y61A 2PPGA 4NZ3A 2PTDA 3T8LA 3DGRA 4PUEA 2OU4A 4S3DA 2E9BA 1H7WA 1IEIA 4ACZB 3GG1A 3A3WA 1QI5A 1C7SA 1MZRA 3MC5A 3EOUA 5BOEA 4AIEA 3AIBA 4J3SA 3KOFA 1EA9C 2MNRA 2VMFA 2EPHA 1Z89A 4KFOA 4Y90A 3BARA 2WJFA 5CG7A 2WBKA 5HK4A 3G6LA 2PU1A 4GG9A 4GPNA 1L2UA 3U6WA 1BXCA 1CW2A 3WLMA 4RZ5A 3F5JA 4MJMA 4F0LA 1JL8A 2NUWA 1G4EA 3N6HA 1E9ZB 3CO8A 1TV8A 4FAMA 3WCZA 3T78A 3S5SA 1GOKA 3LCGA 2IPJA 1JZ2A 1LP6A 3W07A 1O1ZA 5D9NA 2YSWA 4QEEA 2NSXA 3HG2A 5FEXA 3AJXA 4GIYA 3M5VA 4WF7A 2PDJA 4OTKA 4HB7A 5JIWA 3WD2A 4Q4PA 3FS2A 5GPRA 4CD5A 2EG6A 1IZCA 2NVCA 4GBUA 2D23A 2QKFA 2ZC1A 4Q6JA 1R2TA 3TUUA 3HO8A 2GVJA 2NX3A 2BS9A 3GHRA 1POJA 3Q2DA 4QGCA 3B04A 3GDRA 2J6VA 3IAQA 3W7HA 4EF8A 3V5OA 5AHLA 3IEBA 2VL4A 3AAMA 4RNJA 4N2YA 2P1FA 3EB4A 3REQB 2XTKA 5TBOA 1BXNA 1K9EA 2QDDA 4HPNA 4C1NB 2Y70A 3FAXA 2R1LA 3R25A 3QY7A 1E71M 5I3IA 5HR6A 2XDFA 3DH7A 3AROA 3RF9A 1W3IA 1JDAA 1F7BA 1FWJC 4FSAA 3BAKA 1UIOA 1JRCA 4JTKA 1EC7A 2PTXA 1L8PA 3B8DA 3D46A 3IJ6A 2O7QA 2ZKMX 5I3JA 2ALRA 1C7TA 5ABHA 1A5OC 3MYPA 4MUZA 5JUVA 3AISA 3DXIA 2GJXB 3TCEA 2VKZG 1I9CB 5ABTA 4WKFA 1EDTA 1GONA 2R8WA 4DQWA 1A5CA 4WIWA 1KM1A 4JQAA 1QAPA 4UR8A 1SR0A 1R6WA 4FLRA 3WH7A 3UNDA 2X1UA 1WZLA 2OCZA 1KBLA 2WWCA 4W5ZA 3UU0A 2J9XA 3BJSA 4XAPA 4UTHA 4RXGA 4OUIA 4HJWA 1Q6DA 3MO4A 4UWMA 2Y7DA 3NZ1A 3QSRA 1ITQA 3SIZA 2Y8KA 1G9HA 4IF2A 1YMYA 1XUUA 3BJFA 3TYDA 3NO5A 1J8VA 3W7DA 1ONWA 3NQDA 1EYWA 2VT0A 3LG3A 1WBJA 1EYEA 4L9ZA 2J13A 3B9DA 1RK6A 3CU2A 3KOWA 2BFGA 3S0CA 1KFEA 3OIXA 3WD3A 1E6NA 2EPMX 1GVRA 2C18A 4DZHA 4TXEA 4FXJA 3A4XA 5HMEA 5AHMA 1V4YA 3DX5A 4CN6A 4JL2A 1OZMA 3B06A 3ITCA 3ZMRA 1H5YA 2GDQA 1CENA 1GYMA 1AD4A 4H8VA 4CUCA 3DI0A 1DHKA 4CNNA 3KBNA 3Q4DA 1VFHA 5A2CA 3HGOA 2NV1A 1ZBCA 4H4IA 1Y8BA 3VIHA 1JF6A 3CV7A 3I6RA 1IQ8A 2CBJA 4BWLC 4H2HA 2NVAA 2JGYA 1VRXA 1F9CA 2GVLA 3AIRA 4INFA 1DJNA 1Q66A 1R3WA 5D37A 4GABA 4DF2A 1Y5VA 4NXKA 2FJUB 2WW5A 3ZLHA 3K1GA 2X30A 1EOMA 3CL7A 1CDGA 4IWWA 1FFRA 4O53A 4AZGA 1UC4A 1SFLA 3DG7A 4XX6A 4IISA 4NI8A 4YVPA 3MUY1 3IIVA 4M24A 4W7VA 2J7BA 4JYDA 1F3WA 2ZA3A 4MB5A 2IPWA 1D9EA 3P7YA 3FKKA 2NWRA 4S3GA 2BX7A 1R3SA 3TW6A 4TQTA 1C8QA 1Q6LA 4ZQNA 3LBMA 3PPFA 1JXJA 1OK4A 1XJBA 3OW1A 3VFCA 1S2AA 3MUXA 4EIVA 1CCWB 4DAFA 3KS5A 4MWAE 3S5NA 2WOQA 1J18A 3B3DA 4D71A 2WZHA 4BQ3A 1W5NA 3UW6A 5LHEA 4J35A 1MEIA 3DFSA 3QV9A 3ITXA 1NWTA 3TCSA 2TAAA 4Y6GA 2XSBA 2PDUA 4XD5A 3T44A 3NQCA 4JIIX 2Z1SA 1V0LA 3N2OA 2PTZA 4I6VA 1RALA 5GNXA 4ZMGA 2RDXA 3P60A 2PE4A 2E67A 4TMCA 1IEQA 3SGGA 3TOPA 4DVOA 4DM1A 3CMGA 4GQBA 2I17A 3M0KA 1TJPA 4GYJA 3H2FA 4HN4A 4N6FA 4KQNA 4OU1A 4ZFMA 3PTKA 4YCPA 4WJ8A 1ZU8A 3L67A 4JFTA 3UG5A 3AQUA 2Y7FA 3WD0A 4IPPA 3GC2A 1K8YA 3KCLA 1KXTA 4UFKA 1Z44A 3G1XA 1QW8A 3OTRA 1ME9A 3GXTA 3GG8A 1VPYA 4IXXA 1HJSA 3AIWA 1W3LA 3S2LA 5KMYA 5IFPA 1ADDA 4A8LA 4NL1A 1FOBA 3W4RA 4AX6A 2F6KA 1RVKA 5LNUA 1H60A 4EK7A 3CB3A 3EOEA 3HQNA 5CPTA 3SCNA 3CH0A 1FRBA 3P3BA 1AZ1A 4GYPA 5BMWA 4L4LA 4A21A 2G96A 4BS0A 3OEXA 3CV2A 3FDKA 2P10A 4GXWA 3ARXA 2BLEA 4F3HA 3IGSA 3Q37A 1W3HA 1HJQA 4OBRA 1FWRA 2VWSA 1RA0A 3ZO9A 3SADA 5F4XA 2ANUA 3BG5A 2J79A 3L4WA 4QEHA 3NXFA 1T41A 4D6CA 4AEFA 4CD7A 4E8DA 2VJXA 1XYBA 3AZRA 1UKPA 3MDWA 3KL3A 1XLGA 4OOUA 3SURA 4Q8QA 3KL0A 2POTA 1SMAA 1F3EA 3DESA 1YXYA 5EKYA 3MHFA 3LS9A 4QHRA 5CPSA 4F4RA 2I57A 1G1YA 4S3KA 4P7NA 1EBHA 1FKWA 2CLEA 1E4MM 1EPXA 2Q09A 3WNNA 2PDMA 5E6ZA 3GXMA 3BV4A 3HJZA 1F73A 2C19A 2ZDRA 2DV0A 3LK6A 2PAJA 3NDZA 4DWSB 2QV5A 3GW0A 2ALDA 3HPSA 4JTIA 1KV5A 2INZA 1XSIA 2C8NA 4PODA 4W8AA 3APGA 3IV8A 3HV9A 1XGEA 3STGA 1RLCL 3RMEA 4KWSA 1EUAA 2VR4A 6XIAA 2OGYA 3F5LA 5A6MA 4GISA 2XH0A 4E4PA 3FDGA 4WY0A 5FEWA 2CLFA 3OZMA 4CQBA 1AJ2A 4ZQRA 4H7VA 4H1ZA 3PTDA 1IR1A 3PBMA 2REQB 8XIMA 1AODA 5DRIA 1MSSA 2VVNA 1HTIA 3CHFA 3N6JA 5IBXA 1JUEA 3E2QA 1GOQA 1QDSA 1XR2A 2FDSA 3U7VA 3IJQA 1Q45A 5I7GA 3WK1A 3WQEA 4JGDA 2E25A 3FK4A 1O60A 3DERA 3EA2A 1LQAA 2ZVRA 3RLVA 3MY9A 1GVQA 4LX4A 1JYWA 1EH9A 2GGJA 3GTHA 2JBMA 2VYOA 2X2YA 2X0YA 1W32A 1LUCA 5FJTA 3WLSA 4LAOA 4GKLA 2WMHA 3WQ4A 2NQHA 4WGXA 1AK5A 2VFDA 3ALFA 3I3EA 2AL2A 1GTHA 3N6QA 3AYTA 4J3VA 5DCBA 3N04A 3MZNA 3TYEA 4TVUA 4A4AA 2VCCA 3QR1A 1P5BA 1LM1A 3SRHA 5AHIA 4XIMA 3MPGA 2Z00A 4BI6A 1V7YA 1VBHA 1RQBA 1WOAA 3C2OA 1W1PA 1UQYA 5JU6A 4DB7A 3RO8A 2BHUA 2HVMA 3LBCA 2BZNA 3FW6A 3MKCA 3L4UA 4O14A 1TV7A 2D2HA 3TTQA 1IE7C 4W9TA 3AYVA 4AY7A 3I7RA 2E6YA 3RGTA 3F4WA 3EWBX 1CXLA 5CPMA 3UYCA 3KP0A 4IL2A 2HE5A 3EOLA 3CBWA 1ISVA 4K39A 1FH7A 4KRUA 3ABRA 5FL1A 5T26A 1RY0A 5K4ZA 4IP5A 2WPBA 5J8LA 1S2WA 2VI0A 2X8RA 4HP5A 4GVHA 1VBJA 2R82A 1E73M 2ZUUA 3WNKA 1PKYA 3ME3A 1UD2A 1QW9A 6TIMA 1E6RA 3CK5A 4M6VA 3ORWA 1FWTA 2J7GA 1Q6EA 4GVIA 3NQ7A 3G0SA 3W1AA 3BC9A 2GLKA 4A8NA 3AHYA 3LQGA 4XQ6A 4X9YA 4ZSUA 8A3HA 2AMGA 4F2UA 3CUGA 3ZJ7A 1BTCA 1IZKA 3LZ5A 2PDQA 1EHNA 3GZAA 4FI4A 3ES8A 4LAZA 4N9DA 2QHAA 1NOUA 4JDYA 3ITTA 4QJ5B 2ZUNA 4B90A 1Z6KA 3VPLA 4MKNA 1IEXA 4C7FA 1WPCA 2B7OA 2PRLA 2GFTA 3GSMA 2JF7A 3FGCA 3U57A 1U1JA 4Q22A 2J6XA 4W7WA 3MSGA 1OM0A 3UCQA 1TWDA 1H0IA 1HJVA 4RE3A 1JVNA 2FGZA 2ZBTA 5BU6A 1JNDA 3IIOA 4LJ3A 2PF0A 1DJIA 4IGHA 2DSVA 3M9YA 2OQHA 3CEPA 1AA1B 2YGYA 1YEYA 3K30A 4CU6A 4G2DA 3N4FA 1GQNA 2DSZA 1HO4A 3DYMA 3WFLA 3NQ2A 4GX9A 4ZB5A 1DOSA 3SDOA 4B2DD 1UKSA 4PL1A 1ALDA 1L8NA 5F4SA 4GI4A 4E8GA 1EP3A 1CEOA 5HPOA 2SFPA 4X63A 3UY7A 5AFDA 2EBNA 1UWTA 1KBIA 3NQVA 1IWBA 1XIJA 1Q7ZA 3QF0A 2OX4A 1V0MA 2V5BA 2GZXA 3DAQA 3T4CA 1KM0A 1SSDA 1P7TA 1XLCA 2YZ5A 1W8SA 2REQA 4U2ZA 3CTTA 3P84A 3W85A 3WQOA 4BZYA 3QTPA 3NCOA 1MQRA 1LLWA 2V38A 4DYEA 2YKKA 3A5VA 3RRXA 1A5LC 1RBAA 1UKQA 3EGJA 1EJ7L 5I24A 4ASTA 4I5XA 2I9EA 1FUYA 3W29A 4UMCA 2GGIA 1V93A 4TX8A 4UQ9A 4HVXA 1QVBA 3A6OA 4M19A 2IKJA 2VD8A 1E51A 5D09A 3IRSA 1V8EA 2DZTA 3W7OA 4M51A 4DNMA 4IOTA 1OCJA 1XKYA 5GNZA 1K02A 1PZ1A 3SCPA 4A22A 2CZVA 3AMKA 1NARA 1LTDA 4S39A 1SFSA 3V0UA 4UQCA 3URQA 1RR2A 1QI3A 4MM1A 1W31A 1G6CA 4H04A 3GIYA 3ZR6A 1EJWC 3UGVA 3GNXA 4JIQA 1DPMA 2VX5A 3UY8A 4GYFA 3FA3A 3E12A 2JEPA 4TIMA 1U83A 3GM8A 3CUZA 3UZXA 4LFYA 4HPXA 4E2DA 3L4VA 4LYKA 4FK9A 3TLLA 3V75A 5LXXA 4ERGA 1FWHC 3S6DA 3MSRA 2HEJA 1KO0A 3W3OA 5CC6A 2Z6IA 3SCTA 4NX5A 3QHOA 4M8UA 1QK0A 2BTMA 4XG1A 4W85A 4BKNA 2ZA2A 3K13A 4G1KA 5LGZA 3ZOAA 1VAHA 4MFDA 3RLUA 1M6JA 3QH2A 4K68A 1NIUA 5HWMA 2FGLA 5C9ZA 2XUCA 3AIQA 2DUAA 1C8XA 2QJNA 4IFKA 4HNNA 2YYUA 4LS0A 3AXXA 3VC5A 3FJ6A 3WUFA 3GNOA 1PTDA 3WNOA 3GY1A 3Q67A 3M0ZA 3VIPA 3ATZA 3PAOA 2VGBA 1RD5A 4HMEA 3UR5A 4B9ZA 1SO3A 4CVWA 5A8MA 1QNSA 2EG8A 2J7DA 1AVAA 3G22A 3R4IA 5I03A 1B54A 5FCZA 1JD7A 4BFAA 1JCMP 4S3EA 1VFTA 1C90A 3BAIA 3SBFA 1K8CA 2QCDA 1GOWA 1XD0A 1B9ZA 2JFEX 1VH7A 3DFHA 2TPSA 4M80A 3WLNA 4AH7A 4MF4A 4RW5A 1FWIC 2DQWA 3RX3A 1M9HA 2H90A 5AHFA 4IIGA 1B3OA 3WQ5A 4JTGA 4LGXA 3T0DA 1V6UA 4JFVA 3MI2A 3OHMB 3T2OA 3L23A 4H9MA 4KCTA 1DVJA 2H9AB 2AQVA 3KZSA 1GKQA 4YCOA 4DO7A 3HURA 4ATWA 3TEVA 5I78A 3NQEA 1JUBA 3LBOA 5D9MA 1NQ6A 3NQFA 1W8GA 4IX0A 3H54A 2YCEA 2CBIA 3ARTA 4DZIA 3EDDA 1VCVA 2Z25A 3L9CA 5KINA 4BWLA 3M0LA 2HWGA 2QVHA 4ZQOA 1MQPA 1ME8A 5G2HA 4DHGA 2WVSA 4RE2A 4FA3A 4UFJA 1KW1A 3A9BA 1US0A 2QQ6A 4D2JA 3RO6A 4RV8A 1GYNA 4NF7A 4CCEA 3CPRA 4J2MA 4DBDA 1A3WA 4Q4SA 3WN6A 3ARRA 2Y4SA 3L65A 4FOJA 2PGFA 3NEHA 5M17A 3I7SA 3VE7A 4EOUA 3S5ZA 1QO2A 1OF6A 1OFDA 2B7NA 1J0IA 1E55A 2PDXA 3DOPA 5AC6A 4U2YA 5AYIA 1OINA 5D9OA 4BI5A 2CU0A 1P7TB 2NLYA 1F6PA 1CT5A 3TAOA 4QP0A 3LOTA 2XIMA 1WDQA 3B0PA 4JTRA 3C8NA 4ZFCA 5E0KA 3DG3A 3MANA 5C2CA 3F1QA 1OC5A 4GK8A 3VK5A 1F6YA 4FNSA 4MMWA 3T1GA 4LANA 3VOGA 4GIAA 3W1LA 1UA7A 4YTUA 3MV01 4P7OA 5ECUA 4MAZA 3FJLA 4Q33A 4D1JA 2QF7A 7CGTA 1SGJA 5E6YA 1UD3A 1NFGA 3VNYA 2ZZ2A 4Z2GA 1OCNA 2HE8A 1WDDA 1UBSA 5EY5A 2E6AA 1BRLA 4JKLA 1QI0A 1GK8A 3QGKC 2WKLA 2YA2A 4FMVA 4UFMA 4IQLA 2HK0A 1OIFA 5E9AA 2D24A 3N19B 2H3BA 1O4UA 4IJCA 5I09A 2YDQA 4O16A 2D3NA 2VDGA 4W89A 3NDOA 1C8YA 2GJRA 1S3TC 1JNEA 4GXPA 3KVKA 4PL2A 5DF0A 1DJWA 3DGBA 3RN6A 4BEUA 4UTTC 5CZJA 4AD3A 4B4HA 4UR9A 2IKHA 4ZSTA 2RGLA 2QULA 4C6CA 3COTA 1HX0A 1V6TA 2CLKA 3TZNA 4WXYA 3M0HA 2IW0A 5BOFA 2CKSA 1IWPA 4HYVA 3NZGA 1UW9A 1GKRA 1XRSA 2JE8A 3MSDA 3H53A 3O6YX 4JN7A 1ISYA 4Y9PA 4PMZA 4QCEA 5F1VA 2WHJA 2X1IA 2FIQA 2Z2UA 3MCOA 4JIHA 3EPNA 3CUFA 4JCLA 4Z1DA 1K8ZA 1IT0A 1JJKA 2GUYA 4PRWA 4D6FA 2FLIA 1WCGA 5FJOA 3H55A 4ZOBA 3S1XA 5TNVA 4MGGA 3LLFA 4E4UA 5F2MA 3KBJA 2AL1A 3ECQA 2NWSA 4MVAA 1UZ1A 2C14A 2VX4A 4EXQA 4NY2A 1SZGA 1XIHA