4J40A

Crystal structure of the dual-domain ggdef-eal module of fimx from pseudomonas aeruginosa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
251
structure length
251
Chain Sequence
AAQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 77
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4j40A00
4F48A 3SY8A 3GFZA 4AFYA 4RNFA 4Y9NA 4RNIA 2W27A 4J40A 3HV8A 5M1TA 4FOJA 3GG1A 3PJXA 3S83A 3PJTA 4Y9OA 4HU3A 4FOKA 3HV9A 4ES4A 5MKGB 3GG0A 2R6OA 4RNHA 2BASA 3GFXA 3PJWA 4LYKA 4RNJA 4Y9PA 3TLQA 4Q6JA 5MKGA 5MF5A 4HJFA 3PFMA 4FOUA 4LJ3A 4HU4A 4KIEA 3N3TA 3U2EA 4Y9MA 4AG0A 3KZPA 4Y8EA 3PJUA 3GFYA 4F3HA
chains in the Genus database with same CATH superfamily
4M0XA 5C70A 3NL3A 1TRIA 1XDMA 1K8XA 2FZDA 4HOWA 4MNMA 4D8LA 3EOSA 4LCRA 4H3DA 2AOSA 3LCXA 1ZBWA 2D20A 1XLIA 5G4WA 3OJGA 1J0HA 3SSZA 2Q3OA 4DUVA 4F0HA 3MYOA 2ZA2A 2AAMA 3EWXA 3O63A 2FQIA 4LWWA 3KRBA 1WDSA 4LUTA 3AMLA 4NZJA 2AL2A 3STEA 1V6TA 2Y8UA 1DHKA 2NQJA 3PP7A 3AYRA 3WK1A 1XM3A 1UP2A 4QQUA 4KGJA 4ZFCA 2WV8A 4LUJA 4F9DA 3UY8A 3CUFA 3IIVA 1DXEA 4ZVJA 1P6BA 4PCSA 1OM0A 1AL7A 3T44A 3IIPA 3PZNA 3R79A 4R9OA 4PTWA 3LX9A 4HPGA 1LLOA 4LW7A 5CG7A 4KWVA 4I9AA 4W89A 3MKCA 1H41A 3RMJA 4EIVA 1CECA 5HMDA 1EH9A 4S3AA 2YL9A 5FESA 4IPJA 4UTTC 2YDSA 5U4NA 2NUYA 1FDYA 3EA1A 5XIMA 3KBWA 3K2GA 2VT0A 5I23A 4J40A 1X38A 4H9XA 3UERA 2QPUA 3H2AA 1RALA 1QO5A 4DPPA 1R85A 1RVGA 5BXPA 2PD5A 2XINA 3WUFA 1L6SA 1V7AA 1A5LC 1ADSA 3VVGA 5CQ1A 1GVSA 3CIWA 1NELA 4PMJA 2WMGA 4MAZA 8RUCA 5E0FA 3WQEA 1RV8A 2ZUMA 1UZDA 1BD0A 1MW3A 2BGQA 2QCCA 2GVLA 4XISA 1B90A 4XO7A 4XUYA 3TQKA 1K02A 2QUTA 2ZZ6A 2CPUA 4DXKA 1CB7B 3FAWA 1FCUA 2D2HA 1AODA 2QR6A 5CC3A 3CU2A 4A3RA 3WUEA 4QTGA 4U2ZA 3RX4A 3VIKA 4HZ7A 1CENA 3W1RA 1BPLB 1XG4A 4KGLA 3C3NA 3HM7A 2PDJA 4JBRA 3W6YA 3N6JA 2QUVA 3V75A 1A5NC 2HVMA 1VFTA 1P0NA 4RNFA 5KETA 3UPMA 1KM6A 1OCQA 4D6HA 1TVLA 4NNCA 4Q8QA 1YXDA 4M6QA 3W71A 3VDHA 3MSRA 4LBSA 2EKCA 1ONEA 1ZB5A 1UKTA 5D30A 4IIBA 5ECUA 1L6WA 3AXKA 1HKMA 1FFRA 1DIKA 3WLSA 4E3VA 1XIMA 4LS1A 4QEHA 1Q6LA 4J3SA 3DFYA 4C6JA 3SUSA 3UW6A 1VFOA 3TYDA 5T91A 4JKMA 4Y9MA 1W5OA 3AZSA 3N34A 2QVHA 1BXNA 3TZNA 1J0ZA 3N4AA 1UKSA 1TYGA 4LRTA 4LALA 1TELA 3VOCA 3TOYA 3QGAC 3VA8A 1QPOA 4L4PA 4KFPA 3FYYA 4CN1A 3SRDA 1PSCA 1S5WA 1P7TB 5A2BA 4M5PA 3EXSA 1XJBA 3MCOA 2A5HA 1ZHAA 2OLAA 1AQFA 3BOXA 3R6IA 4WUIA 1OK4A 3W7MA 3LCFA 2EHHA 3A5VA 3AICA 4XD6A 3M43A 3EGJA 4AD4A 1H1NA 4JN6A 5E0CA 2XM2A 1WKDA 3OZPA 1PBGA 3M46A 4EPEC 1BRLA 3NPUA 1KXTA 4PBGA 1K1DA 4CQDA 1PIGA 3PZGA 2VR2A 2CW6A 4ZQOA 1PKYA 4PB4A 1A0EA 3WNPA 1YW1A 3NXLA 1HVQA 3AS1A 2Q02A 2VOTA 2NZLA 5D04C 2XIIA 3MJMA 4Q4QA 2CHNA 3MDUA 2O4QA 2VRKA 5CGMA 3KM8A 2XM1A 4AEFA 1HGYA 1M65A 2X8RA 3NFUA 1GHSA 3ATYA 5LNUA 3W01A 1B3VA 1LTDA 3VDAA 1DTUA 4LAUA 3WF4A 2X2GA 4QJ5B 1N8IA 3RRXA 3DFPA 3GIQA 3MJYA 5FJUA 3LSBA 1YADA 3QY7A 1W9XA 3ZS4A 2ZDRA 2D0GA 3KBSA 3UT0A 3LM3A 3P62A 1GZGA 2Z1XA 3RG6A 3HG3A 2W4XA 1W17A 4G8TA 3INPA 5DXYA 2VWSA 5K3VA 1XSIA 4H19A 3MO7A 5CPSA 1H1ZA 1ADOA 1UMLA 1G69A 1JZ6A 4MNLA 4H7CA 4G5DA 4AC1X 4B5SA 3WBYA 1BVWA 1UUQA 1JYWA 2ZWZA 4MWAD 4DBUA 3W23A 3VXGA 3KP1A 4A3QA 3NZRA 4W88A 2VO5A 4Z08A 2YZ5A 2WQDA 5I03A 1L2UA 1RA5A 4R7JA 4KH2A 3NL6A 1FWTA 3GXNA 3M0ZA 3WMLA 2PODA 1V3LA 3WLOA 4RPPA 4DLMA 1GHRA 1JCNA 2CCRA 4YVPA 3UWVA 3FJ6A 1QVBA 1XUUA 2PFHA 3AWNA 3W2JA 1AJZA 2CWXA 2W5FA 5D9MA 3AXMA 3MV01 2YPIA 2C14A 4NIRA 2EG7A 5A6LA 4LS2A 4FXSA 4GA8A 1W3NA 6TIMA 4QXIA 3E0LA 1Y7VA 3REQB 3VKAA 1V3JA 4JFSA 3O3RA 1J12A 3B0UX 3M0LA 3QFWA 4KRUA 2Z24A 1NF7A 3GR4A 3QMTA 4TXEA 1XYZA 4H9VA 3KVMA 4C5ZA 2BFGA 4PFMA 3DFQA 3N9RA 2F61A 1C29A 1G4EA 2JIWA 2WPBA 1FQ0A 3W86A 2PZ0A 1E6ZA 1TJ1A 4H6QA 5F4SA 4INFA 4PMYA 3TXVA 2Y7GA 5CPLA 4DYKA 3HPAA 3S6OA 4JQ4A 4B5UA 1XL9A 1ICSA 4KEMA 2XVKA 2PWDA 4MWAA 2V5KA 4KEZA 4HBKA 1Z42A 1AW5A 5DELA 2J9ZA 3OVRA 1DIOA 3MUZ1 5EMMA 3A5FA 1GTHA 3GTHA 5A8NA 3KVKA 2OQLA 2NSXA 4IFKB 3SY1A 1H7OA 2IS7A 3SIZA 2J7CA 3SCRA 1EPXA 4AZHA 5FF0A 5BXTA 3BTNA 2DW7A 2PF8A 2HS8A 1JDDA 1DIDA 3IV8A 1IR1A 2BG5A 2Z7GA 2PGRA 5AVHA 1PX4A 3NGJA 4CGTA 4PULA 3QBUA 1IGSA 1O5QA 4N4PA 1N82A 3WNMA 3HV8A 4D6GA 3MC5A 3GG1A 1XYBA 3GAKA 3EEZA 3MHFA 4ZQCA 1KGWA 3BAIA 2WO5A 3F03K 4ZO6A 4QE4A 3HMCA 2R14A 1PB0A 4NZ1A 4IGMA 2VM8A 3SB0A 4NILA 3G77A 3SFKA 1UD2A 1HT6A 4RZBA 2NLYA 5HANA 4GI8A 5AHIA 4MB3A 4QAWA 4W8LA 4D1IA 2NX3A 5J8LA 1G9HA 1QPQA 2A7NA 2FPYA 4Q8UA 3TSBA 1Y8BA 1M9HA 1IT0A 4Q8NA 3S9ZA 1RQEA 2QW5A 1EDQA 1AW1A 4C7DA 3THUA 3TYEA 2PDXA 3VTRA 5EU9A 4O10A 1UBSA 5JUVA 2D0FA 3W27A 2BP1A 5EPDA 3MCNA 1Q7QA 1FFQA 2XFYA 5A8QA 3HPXA 3OIHA 5IOBA 1CXFA 1J11A 4GUFA 4Q8PA 2W67A 4AY1A 3WQ4A 3AZTA 2QCHA 1VJSA 4NP7A 1CZ1A 4E2DA 3R94A 4FO4A 1KD0A 1BYDA 5D9OA 5AZ1A 2WHMA 2A3BA 3PJUA 3PZQA 3ES7A 4ZE4A 2QV4A 3P6LA 5AZ0A 1UJQA 3BJSA 1IZCA 3URQA 3LCLA 1XF0A 1Z8AA 5IXEA 4KFNA 5G2IA 5M03A 1ZUAX 3VYLA 1LP6A 3K1GA 3IS4A 4WF7A 4K6AA 1GK8A 1UC5A 2CZ5A 1IXOA 4JX5A 4AZCA 3WD4A 1KM4A 1B30A 1KM1A 1ZL1A 3EX1A 2E8ZA 4J3UA 4GXPA 2FHFA 4L80A 4TUFA 2PSNA 1NP0A 1V0MA 1QWGA 1WYIA 1Z6KA 1POKA 1WKFA 1WCGA 4PUJA 3BG5A 1EJUC 3C56A 4GD0A 3T0BA 3QR3A 1EQCA 2TODA 3VGDA 1GNXA 1NTHA 5E6ZA 2WNWA 3VK5A 4WDTA 2FH6A 2JEQA 5KSWA 1E6QM 1LOSA 3P8JA 4UIOA 4TV5A 1QPKA 4W7WA 3AS3A 3U5UA 1I60A 3PJTA 4O54A 5ABFA 2XFFA 3G1AA 1LT8A 3P7YA 4UFLA 4GFSA 5C54A 3N2MA 1MZRA 3K4AA 2P0OA 3WKZA 2ZXBA 3UCCA 1ICPA 2FZNA 3W0KA 4GYFA 1E72M 3T9PA 4H2HA 1M7JA 3OB8A 3BZJA 3A47A 7CGTA 3DECA 1GVYA 3TFXA 4BHYA 2PCEA 4TVDA 3U2OA 1XICA 3UP8A 2BOFX 4E8DA 3AMCA 3GIYA 3QZ6A 2I9EA 3SGZA 1VGAA 4X61A 4H8UA 3C4UA 4C6EA 1I2NA 3LMZA 4ZB2A 1YLVA 1EQPA 3AHXA 2B7QA 2XH4A 1RCOB 4FMVA 1RLCL 1QWKA 3JUGA 5G1TA 1NSJA 4IT1A 1EB3A 1HO1A 4JIRA 5FJRA 3AU2A 2AAAA 1BVZA 1DWHM 3S5SA 2QZRA 4RJEA 2C15A 2FPVA 4HU4A 4HSOA 4JNZA 4KCWA 3VD3A 3S6TA 4U5IA 3U3HA 3R0KA 2Y70A 2CYGA 3XISA 3KHDA 4GWEA 1WBHA 3BH4A 1K6AA 4LUTB 5DLCA 1OX4A 2AL2B 2VCCA 3VOFA 1QMLA 4EX4A 2OCZA 3L4XA 3VM7A 3NNTA 4Y9AA 3ARRA 3AMDA 5CBIA 1PZ1A 2E4TA 5E1QA 3DG6A 2KX9A 5F4XA 1OQFA 4HT3A 1XIIA 3SECA 3QSRA 3WQVA 1C8QA 1YX1A 1D3HA 9XIMA 3GG0A 3V18A 4CN6A 2BASA 1DBTA 2DZUA 4JR5A 2PF0A 5EMUA 5HR7A 1QATA 2XH7A 5AHMA 4FF7A 2HQAA 2A4AA 1E9LA 2FTYA 4DO7A 3ORWA 4DYEA 2VYOA 4OHQA 5CPTA 1JXJA 3OVQA 5E09A 3CQKA 1O95A 1WPCA 3UJ2A 1O4UA 2OT0A 2IQDA 4O28A 1JEZA 4MJZA 5M3WA 2RHGA 2QPSA 3TP4A 3CO8A 3HPFA 3EMQA 1EKOA 2H90A 2OB3A 3IV3A 1UUMA 4D2JA 3HB9A 3WJYA 3CASA 2V6AA 4U3AA 4AX7A 3DFHA 1DYSA 4MMWA 2QAFA 4QM1A 3TLLA 1OG0A 5LIYX 1HJQA 1VBGA 3A4AA 3H7VA 1ZLPA 3P81A 1RSCA 1CGVA 3PTQA 4B4HA 1BXCA 1XLFA 2VELA 3LPFA 3CAVA 3FA5A 4AZIA 3QR0A 1GQIA 1J0JA 2XTKA 2PAJA 3WMBA 5FF7A 3W7EA 4CQCA 2WNNA 1V0KA 3TKFA 2PWGA 3VIHA 3RJYA 2YL6A 3O6DA 2ZTKA 4H4IA 2PEVA 1EBGA 3BE7A 5AB3A 1J0KA 2W27A 3T55A 5LGXA 4FPSA 4BK9A 4N6FA 2Y6ZA 2HEJA 2RUSA 3VKKA 1ME9A 2EBNA 1BTCA 1T5AA 2QJHA 1AZ1A 4R85A 2QAPA 3CHFA 4BEUA 4KWUA 3TR9A 3UYIA 2QMKA 2AQVA 3DYOA 3KL5A 3GHRA 4QITA 5I79A 1KQZA 5CSYA 2ANUA 4HHPA 3F2BA 1AA1B 1LWIA 3R58A 2J66A 3F4WA 5F2MA 3EDJA 2OODA 3WNLA 2YCEA 1I6NA 1UOZA 4LNYA 1JPHA 1BYBA 4TMCA 1VPYA 1V03A 4MPKA 2WJEA 3RGTA 4LBUA 1HF6A 2C6QA 1ISYA 4F79A 5M2FX 3EXTA 1EJTC 4JIQA 1US0A 4C6KA 3HPZA 2WKLA 4Q4SA 1V0LA 3TW6A 3U8GA 3TX9A 4KERA 2KAUC 5LHFA 2VUYA 3L2MA 1BRLB 1ZBCA 2VC9A 4H6KA 1JR1A 4UTKA 3QMSA 2BNJA 3G0SA 1JZ3A 5AHNA 3RCYA 4FEZA 1H0GA 4QE5A 4NNBA 5AVNA 2ZXQA 3RN6A 1P43A 4GVGA 2FLIA 1VKFA 3GSMA 2I14A 1W2PA 1VHNA 5A8PA 2B7OA 3DI0A 1AQ0A 2JF6A 3AFBA 3OG3A 4XKYA 4Q22A 1EP2A 4JIHA 1X6LA 1UWSA 3TC7A 4HU3A 2X16A 1PL9A 1DQUA 3IJDA 1EIBA 4UNIA 5I78A 2RDWA 3GTNA 4HA4A 3SCVA 1JF6A 4Z42C 1H7XA 3LQGA 1QPNA 1VFHA 5EMJA 3M4HA 4I7UA 1UR1A 1AQHA 1UKPA 4HOXA 5CZ0A 4FXFA 2E68A 3PUEA 4IG2A 1LWHA 3BVJA 1FTXA 3SN0A 3UJFA 3TQ0A 4GH3A 1HKVA 3KEHA 3BMVA 1RP8A 2QJJA 5LXEA 3KS5A 3A3HA 3CMFA 3BG9A 3QFEA 3G1DA 1QI3A 2CESA 3II1A 3FFSA 4XAGA 4IP5A 3ANUA 3C5QA 1B3XA 3DKLA 5G1MA 1S2TA 4ZQNA 1CB2A 2GSJA 4MY8A 3GDLA 1YMYA 1F4HA 5C2GA 1YDNA 2OKOA 2Z1BA 3I3BA 2EJ1A 2VWTA 1ZTVA 5G1YA 1Z7AA 2VCAA 3G22A 3AYSA 2YA0A 2NQZA 4MM1A 4GISA 1XIHA 5FA5A 3TYCA 3L4UA 2O9TA 1TV8A 2W0UA 1D3CA 3BW2A 3NQAA 3LCGA 1D8CA 1CGYA 3MI6A 1F5ZA 3OVGA 3V4BA 4GQRA 4RLIA 2ACRA 3OLIA 2NX9A 3WCZA 1XI3A 3OO2A 3SCSA 4Z1DA 2FVMA 3WMSA 2YL8A 3GDBA 1X1ZA 3GHTA 2BY1A 1C3FA 2VEPA 5AYYA 3LLFA 4UQ9A 3CUHA 1J10A 4PRWA 4AVFA 6XIMA 1H7RA 1JAKA 3A13A 4DUXA 1XXXA 2YJQA 2DZBA 4QJ3B 4XKMA 4FIQA 5CCZA 3MWAA 4L6HA 1GOIA 3GR8A 3UWUA 3VOIA 1CXEA 1XCWA 2PCQA 2GJPA 1E6NA 5F7UA 3S1WA 3GW0A 2QJGA 2WC7A 3SRHA 4JFVA 4MWAB 1SO4A 1SO3A 1UZHA 2ZVRA 3CT2A 1PHQA 4XZ9A 3TDFA 1UR2A 2WHKA 4Z2HA 2W66A 4P2VA 5HNUA 2E09A 1B3OA 2C16A 1GYNA 1HXJA 2QCNA 1EOKA 2RJHA 2CEQA 1LOLA 4K38A 2PDWA 3AAMA 3BJTA 2XIQA 1SZFA 1C7SA 2ZYFA 3WLKX 4O8RA 4XSMA 1CI1A 4KESA 3ARSA 3HQPA 2PP0A 1E5NA 2TYSA 3VNDA 1KCKA 1RPKA 4V1XA 3PS7A 1R38A 1WDPA 3ZYZA 2GOUA 4UTFA 4MAVA 2ICSA 4AAJA 1XFCA 1UC4A 2OYLA 3W1TA 6ENLA 5D8WA 4KIEA 2NXGA 3IJ7A 2HSAA 1L9WA 3L4WA 5H91A 1R3RA 2VX6A 2JALA 3W84A 3E2SA 3WK3A 5I3HA 4Q33A 2G0WA 2CHRA 4FNSA 3Q65A 2J25A 1KFWA 1RK5A 4DXVA 1BKSA 3IAQA 2WB5A 1ZBKA 3A9IA 3ZZ1A 2V0TA 3VD5A 5LXXA 2ADAA 1AJ2A 4RCXA 3A22A 4O1EA 3TJXA 1Z32X 1ZSXA 4IZGA 3OHMB 4CQ9A 2D2GA 3AUJA 1AVAA 3NOEA 1TJPA 3QTGA 1NDZA 2ZZ4A 3M0HA 3E0VA 1TZ9A 2VKZG 3U57A 4IGNA 3L66A 2FJUB 3WQDA 4ZR8A 2GK1A 4Q8OA 3RLVA 1B4KA 3AWOA 3NEVA 1ZAIA 1UOKA 1CXHA 3IVSA 3BW4A 3DERA 5BOFA 4MY9A 2IQTA 1RLDA 3KX6A 3R12A 3LBOA 5ABTA 3KBVA 3F2CA 2A1YA 5ABEA 3CPUA 3M07A 4NQ1A 4REQA 3LV5A 3NUKA 3RO6A 1J5SA 1G4PA 1BWVA 2PD9A 1C8VA 3OHIA 2PE4A 3KL0A 2E0PA 4QP0A 4XSLA 3M64A 1A5CA 3UWZA 2NWRA 1FH9A 3TW7A 3TNBA 5BNKA 2JKEA 3GK0A 2G3MA 1T96A 5ECVA 2PB1A 3ZSTA 1CGXA 3BV4A 4RE3A 3SY8A 4AZCB 5JQ9A 4AVOA 1YPFA 1TPC1 2LLEA 3A3WA 5D32A 2RGLA 1G7UA 1PV8A 4IPIA 1W1TA 4QX4A 4TMBA 3QOKA 7XIMA 3UG5A 3V16A 2ZIDA 2E9BA 3LHUA 3L21A 1A49A 3I65A 4QS6A 2F6UA 1MEHA 3EKLA 5C55A 1UIOA 4EAMA 5JMUA 3EX2A 2GJRA 4XZNX 4RDWA 4Q6JA 2DZWA 3C0LA 1TTQA 3CAQA 4O4WA 2FFCA 1X96A 1OFDA 4IPPA 2ZUNA 3SRFA 4UFJA 3VCCA 1AH4A 3TC6A 4HKPA 5ABFB 1OADA 1OCNA 2FHCA 2QQ6A 1BG4A 1YYAA 4AW7A 3WDRA 4LT9A 1O6IA 3RAOA 1QUMA 1JDEA 4PN2A 3HU7A 1GTEA 5JVLA 3M47A 1UYQA 2GVEA 3EEGA 1XIGA 1JUEA 3QJAA 4DB7A 1DP0A 4BWLA 2Z26A 4QQ3A 4UTIA 5GPRA 2A7PA 1OZQA 2V67A 1JUBA 3T8QA 1S2CA 3R8RA 9CGTA 4AUBA 2ISSA 4IP4A 3AIVA 5LSMA 3KAOA 2XJ7A 2I5IA 4ZE5A 4QR6A 3W1NA 3ZR4A 2ACUA 5D05A 4AU0A 1EJXC 4Q6XA 1G94A 4R3UA 1GVQA 5KINA 3ES8A 4JQAA 4C6BA 4UTWA 1TIWA 4H00A 5ABGA 3B8VA 3GM8A 3GHUA 2DT2A 1WUEA 4WGXA 1WA3A 5CC6A 4S2CA 3VGGA 1H5VA 1DTNA 4RR4A 4B3LA 2OOGA 5EFFA 2DH3A 5I06A 1VENA 4AH7A 1UZ1A 3SRKA 1PAMA 1KO0A 3KRZA 4Q4OA 1OF8A 2I17A 2DDXA 3UD6A 4B5VA 3W74A 3QGVA 2GGIA 4HK5A 3F4DA 3W2LA 1KR0A 1KXHA 2F84A 4D6IA 3IVUA 4L4MA 5IHSA 2I5QA 1W3HA 2CFFA 5IBXC 4HNLA 4GYKA 2ZC8A 3PPCA 4C1KA 1OX4B 4JFWA 5DO8A 3RF9A 2E7FA 1I75A 1TV7A 1DE6A 3P93A 4GGHA 4YLWA 4AXNA 4X9SA 4LF1A 1XD0A 3SY5A 1EZWA 4DJFD 3HGOA 4D6JA 3UXDA 4L9ZA 2IQ0A 4J3VA 4RDZA 3M0VA 3GG7A 2W92A 2PTWA 4GI4A 4K7VA 1XKYA 3FVMA 2JEPA 3GVVA 2V9DA 4N9BA 4GCXA 4CUCA 3PTKA 4C60A 2OZ0A 2PTYA 1F74A 3KOYA 1TVPA 3ZVIA 4I9MA 4BI7A 3KBMA 2ESCA 3U2CA 4O1BA 3LM7A 4ML9A 3OVPA 1OX6A 3QQ1A 3T7VA 3LD5A 2VJXA 5D8ZA 1KXVA 3AYVA 4H2CA 3KRSA 4ORIA 3DDMA 1W2VA 4TVUA 2XU2A 4MADA 4GXWA 1A5AA 5AYZA 4GYJA 5K4ZA 1W6TA 4WKFA 1O60A 3GXFA 1QHOA 1UR3M 3ECQA 3QH2A 3FHAA 2L5HA 5HXMA 2CLHA 3MVIA 1K77A 1M5WA 1V77A 4M29A 3BC9A 4JNMA 3R10A 5I5RA 2EO7A 3BANA 1M1BA 1TJRA 1UWRA 1WZMA 3WF3A 1XIEA 4LV4A 2XN1A 1TPB1 4UOJA 3T08A 3BDKA 5BRPA 3I4KA 5EB8A 4KRTA 3H4GA 3F5JA 1GWJA 1U22A 3MV11 3IGXA 1EJRC 4DF0A 2P10A 2WZHA 1JJKA 3A24A 1V6XA 2X1UA 1LBLA 2GDUA 2YCKX 4H1ZA 3WK2A 4EVZA 1V6UA 2QDHA 4H83A 5DFAA 4H6EA 1U5HA 3EWUA 4ATDA 3ZSSA 3C0JA 4J3ZA 1LL6A 3GU2A 4DX3A 3R25A 2PDNA 2VZOA 2J8FA 1QI2A 4XTDA 3CXOA 1MWOA 2ONEA 4BI5A 3KWXA 3VZXA 4HMEA 5KTLA 3NM3A 2C71A 1EPVA 2DP3A 5HQMA 4EF9A 2WQPA 4PFHA 4AHPA 1WOBA 4NG3A 2WNQA 3L4ZA 4HMNA 1QFEA 3WLQA 4Z1YA 1S2VA 2VDHA 4ZOCA 3V5FA 4AZBA 3EMZA 4HQVA 2CLOA 3RFAA 3NQGA 5HQEA 3LPPA 4WKAA 3JW7A 3VKCA 4R5EA 1G6CA 2HMCA 3IGHX 1W1A1 4XZBA 3S2NA 3WN6A 3WNOA 1GOOA 1KRAC 2QCGA 1MZHA 3WF0A 3OZOA 5IM51 1LL7A 4PCFA 1H7NA 4GZEA 3VZYA 3UNTA 2WCSA 3LEPA 3ZJ8A 3DBNA 5KZDA 4UFHA 1JCJA 3R11A 1JXKA 3LNPA 2PU1A 3S5ZA 3P0XA 5AN7A 2V82A 5CC7A 3W25A 2CHOA 3A4XA 3HPSA 4YMZA 2INEA 4D1JA 5A94A 3FKRA 2XIOA 3BARA 5I77A 2HV5A 2PDIA 2VZSA 2R1KA 1ZFJA 3QVQA 2R94A 1WB0A 3GDTA 3F4CA 2EG8A 3COTA 1A4LA 3FCPA 2D23A 3CHEA 3TOPA 4L1WA 2PUZA 4GOAA 1KM3A 4NVTA 2Y62A 4EWJA 1ZRQA 1OX5A 2QCLA 2D0HA 1BXBA 3PZTA 1W3LA 4N42A 1SJDA 3W22A 1O7AA 2D1ZA 1A5SA 1N55A 1GYMA 1AD1A 3PJWA 3WDQA 3EPMA 4O17A 3WDHA 4QDMA 5G4HC 4EPKA 3I3DA 3F4VA 4XKYB 4LEQA 3B4UA 2CLKA 1R9ZA 3VOGA 3AROA 4GZIA 1GGOA 3TK7A 4AYGA 2C1IA 4QCFA 2YBTA 1JCXA 2OT1A 1K7FA 4HK6A 4NNAA 4P8UA 3N14A 3VIIA 3OGRA 3B8DA 1UWUA 3HG5A 4C6DA 1FDZA 2VZTA 1XRVA 3CWOX 1E1EA 5BXRA 5CPNA 4NJHA 4N7QA 1FBAA 2ZFAA 3KP0A 5FIPA 3GH5A 3IVTA 3TNOA 3RK8A 1V3HA 4IG2B 1IQ8A 1NQ6A 3QYQA 4IMCA 3GHSA 1TKKA 2X1RA 2ZRVA 3L5AA 3NVDA 3PN8A 2PDHA 3KTCA 5FCZA 1FWJC 4JFTA 3AJXA 4PMRA 4X0NA 4RW3A 1QASA 3LHZA 1HJVA 5I3FA 1LCOA 3N9SA 3QQWA 1MVYA 3ELFA 1O1ZA 5A2CA 4CQAA 2P8CA 1DJHA 4ORMA 2J7HA 1GJPA 1PVNA 4GKLA 1I2OA 3WL0A 2W79A 4JTKA 4TU1A 2R1MA 4I9TA 4HHMA 4DI9A 1MEWA 2FZBA 1JD9A 1HL2A 1K8ZA 2WK2A 2QJIA 1EJWC 3W37A 4BWLC 2FKPA 1WKEA 1UD6A 5A6TC 3MT1A 3W70A 1QPRA 4YCPA 1CXLA 3M6YA 1HNYA 4XZHA 2BLEA 4LC8A 4OBTA 1F4AA 3PY2A 2FGBA 3EWCA 4N9DA 4HNUA 3MO4A 3ZLHA 3VDGA 2IKGA 3AIUA 3BLOA 2Y8VA 4O1DA 2YFNA 3CV7A 3CAWA 1KKOA 4HYVA 2ODOA 1M7PA 3AHZA 1H4PA 3DGBA 3KL3A 2Z25A 2ZC1A 4W7VA 1W32A 1ME8A 3FYOA 3MZNA 5DN1A 3SURA 2WVVA 2EPLX 1TB3A 4AF0A 4GC4A 1CGUA 3NQEA 4O19A 4TX6A 3VNYA 3U48A 5LA2A 4C6LA 2X40A 1I1WA 1W37A 1RQHA 3POHA 4NZCA 2V3FA 3JS3A 4GNKB 5I00A 4GC3A 4CD4A 1SMAA 3K4WA 4GCAA 1WOAA 5C8BB 3TUUA 1FWBC 1B3ZA 3V35A 4Q4PA 4YVXA 4LY8A 1MO0A 4NAEA 2X7WA 4E2BA 5J04A 3FSTA 1XIFA 3VFCA 3NQ6A 1U1UA 2UV8G 4L5ZA 1M01A 3V1HA 3IIZA 2YBUA 4FHAA 4MHBA 1Q6CA 1LL4A 4POCA 1KM0A 2XPKA 3M0JA 4H7VA 4H9TA 5A6JA 1MUWA 1T0OA 1VB9A 4IHCA 3H8AA 2CZFA 3ITGA 2J4GA 1XHGA 3VPLA 3IRDA 4ZSTA 2A0NA 2RAGA 1B9BA 1FVPA 1JRBA 4HK7A 1YXCA 2PLMA 1FWFC 1AMKA 4W87A 4JTCA 2OWXA 1ODUA 3WJXA 4GVHA 1Q3NA 4LRSA 1YDYA 3SQSA 1AMYA 4V15A 1RBAA 1U1JA 3QHMA 1NF0A 2WMFA 3VKBA 1L0PA 3WELA 3RPTA 1TE6A 4V27A 2YXXA 3MHUA 3I7SA 4M82A 3N2CA 4OKDA 3ZJ6A 2IW0A 3T2PA 6ALDA 1DJWA 2YW3A 1V3IA 4IIDA 3MUY1 1ITQA 4N6EA 4J35A 4I7WA 3S3GA 2DZXA 3PANA 3W24A 2J62A 3MVTA 3E2RA 3UU0A 3ITYA 1YIXA 1DIEA 1KBLA 1OC6A 5ABHA 3ABZA 1KTCA 1I8JA 4X0VA 3QV9A 4R9XA 2GK1B 1YXYA 4XO6A 3LXBA 3APTA 1LORA 2FVLA 2WLYA 2W9MA 1VCGA 2PBGA 2GWNA 3GDKA 4HNNA 2GGJA 3W53A 2OSYA 3GIPA 3B8IA 2D2JA 2PP1A 4DJFC 1J5TA 2VGIA 1O94A 3AIRA 4UTHA 4REQB 4JQ1A 2V2DA 2GQ3A 1SFJA 3PFRA 3RO8A 3VFLA 1Q6DA 4CQBA 2FB3A 2XGZA 4XV0A 1UHVA 1RAKA 3AHVA 3KCJA 1O1HA 3L4TA 4FLQA 1SMDA 3CZ8A 3VGEA 4W93A 3AO0A 3EPNA 4E8CA 4DLFA 3N2XA 1T8XA 1V51A 5C0QA 1YE4A 5DXXA 4DJDA 4MWAE 3AC0A 2OWCA 2VHLA 1RA0A 2JE8A 4UTMA 2J8GA 4CNNA 2AMXA 2WJZA 3UWEA 1GG1A 3QN3A 4Q8TA 1EYEA 3C0SA 4US5A 1OCBA 4ZQMA 2R6OA 4GVFA 3HBLA 1IIHA 5I0DA 3W00A 1K8CA 2OZTA 1ME7A 3KBJA 3K13A 4M24A 2ZZ1A 3IK2A 3KRUA 5AHLA 1CCWB 3TW9A 4PUKA 1M7OA 3I68A 2ZQ0A 3O06A 4ROQA 1CEOA 4PMUA 4S3GA 1ZP3A 4KKXA 4YN5A 1R8LA 3CH0A 1H51A 1VJZA 5LHEA 3U5YA 4L56A 3L67A 4YNGA 3O2LA 4MZ1A 1TREA 3K5XA 4PEEA 1CBGA 2Y5JA 3OA3A 4R53A 4D8ZA 2ZUTA 3GY1A 5JXQA 2ALRA 2E40A 3OZYA 4DO5A 3AIEA 3ZWSA 2HISA 2GGEA 3UFYA 2PDYA 3CZEA 4G7FA 1REQA 3V36A 4CD7A 1PYFA 1AK5A 3E6EA 4LUYA 3WUGA 1ISXA 2BXZA 3O6AA 1MUCA 1YE6A 2ZXDA 3BMWA 4UR8A 2C0HA 4ZSUA 1XRTA 7REQB 1ZZMA 3GVQA 2EQDA 5HATA 3ZM8A 3M6DA 1QAPA 2FDMA 2YCIX 3LCHA 1G4TA 3SCQA 3LRKA 3SBFA 1ITXA 3URNA 4GK8A 1QK2A 5D9PA 4ZEPA 3JZUA 4AZ6A 4UQEA 3S5NA 4WSJA 7A3HA 1TV5A 3H70A 1RY0A 3GLCA 2P0IA 3JVAA 1SVDA 2YGYA 1W31A 3W87A 4JTAA 3CM4A 2XSBA 1TZZA 2BHZA 3EBVA 3GYEA 4WDUA 3UR2A 4N02A 3HMJG 4NZ5A 3SW6A 3VGBA 4E38A 1XP3A 3EOEA 2W6RA 2RFGA 4NSBA 4QCEA 5FOOA 1FWDC 4H9UA 3EDFA 5HWJA 1EJ7L 3WFZA 3PZVA 4F8XA 2IUZA 3RNDA 2UY4A 2X1IA 2C13A 8A3HA 3OGVA 1B3WA 1XYMA 4I5UA 1VBUA 3FN9A 4NRRA 5K9CA 4FLOA 4IUGA 4CNPA 1KGUA 1KCLA 2A7RA 1W9PA 1SZEA 5B7YA 1DORA 4HSHA 3Q4DA 3SEPA 4UFMA 4ADSA 2PA6A 1HVXA 4EWND 3H4WA 5TQLA 1P1XA 3ANYA 4A3UA 4GY1A 3M9YA 2ZX8A 2GJNA 4MG4A 4XWUA 3WD3A 2VTFA 2D3NA 4UR9A 1TWIA 1OHLA 4M6UA 4NY2A 1TZ7A 3E5PA 3QHOA 2EG6A 2PRLA 4P7NA 3GVRA 2XSXA 3M5YA 1K8YA 3BJFA 4HJFA 3W2NA 4X9YA 3W38A 4KPLA 1WP6A 1HFBA 3MY9A 4ML4A 1NY1A 2QDEA 3PM6A 3LOTA 4LAKA 1QRQA 2DEPA 4O18A 3W7NA 3N11A 1EYWA 3VIOA 5F4WA 2J47A 2ISVA 1IXNA 1ZENA 3W2KA 6TAAA 4I3GA 1QBBA 2P76A 2VFIA 1TVNA 1Q6EA 1VJIA 4A6GA 4PA8A 1DJNA 3CPGA 4DYJA 4CU7A 3PC0A 4ZTYA 1BWKA 1FHVA 4AIEA 2WKGA 3WFLA 4GQ0A 1HL8A 4ADUA 4GXMA 4C7GA 2HCVA 4C6MA 5M17A 3PB2A 3U7BA 1YRRA 3WL1A 3DHDA 1NU5A 2YXGA 3RXZA 4DNHA 5HOSA 2OELA 3CL6A 1DQXA 5HAOA 2F6XA 1WXZA 4I90A 1TWWA 4DQWA 4UB9A 3DENA 4L6DA 4H7ZA 3TV8A 1G1YA 1KV5A 3DYPA 1BTMA 4FP1A 2YX0A 1Q65A 1JAEA 1HX0A 4O13A 3FEMA 3BZGA 3ARYA 2Y2WA 1JDAA 4HNOA 1E3ZA 1K3UA 1XUZA 1VFFA 3WDPP 4CCDA 2J7FA 1CDGA 3GXMA 3DFSA 4LYPA 3UA3A 1Q6FA 1OIFA 4UNLA 3AMKA 2OSXA 2QIWA 3NYDA 4QDPA 3NPVA 5E9AA 4QEEA 5MKGB 1W9UA 1F3EA 3AIBA 4LYRA 3WG6A 3LPGA 4OGZA 2O7QA 2TSYA 3H53A 4IQLA 1HJXA 3MW7A 3WYZA 3PBVA 1ZY9A 1NFPA 3C61A 4NJKA 4L9YA 1OYAA 3QW3A 3PJXA 2GGGA 2TRSA 2JF7A 4GO9A 2CC0A 3G6MA 5G2WA 1XISA 1VH7A 1YTKA 1KFEA 2PDLA 2ZRXA 1EEXA 4FX7A 4J2MA 4EK7A 1SZRA 4ZMGA 2PS2A 3A4JA 1TPH1 5FL1A 1I0DA 1E6PA 4LCSA 1XLLA 1P0BA 4U28A 5HJLA 3QSTA 1B54A 5ENLA 4XVEA 3QR1A 4Q4RA 3MUXA 3CAKA 4QLKA 4ZB0A 5HA7A 3SDOA 5H1WA 4IICA 1XH2A 1IWAA 4LGXA 4DWSD 4NJGA 4QLLA 1E73M 3EB2A 1UB3A 2ZTJA 4Q7IA 3C52A 1S3TC 1NDYA 1WZLA 4DAFA 4AG0A 3MKKA 3SCUA 2GPTA 2VZUA 3SCNA 5M1TA 3WQCA 1CXKA 3P5YA 3A6OA 4PCNA 3GD6A 3L4YA 2J27A 4IX2A 3E49A 4ZQPA 3VNIA 4D6CA 4GHRA 3QZEA 2QT3A 2WZTA 3UZ5A 3PFMA 2WSQA 2Q8LA 2OEMA 3H12A 3RM9A 2JBMA 4GH1A 2DQXA 4IJRA 1DWFM 3LTSA 1IZJA 3NDZA 3JU2A 3N2BA 4NJJA 1EUAA 2A3AA 2X0YA 4OOUA 4LAOA 3E5BA 2BZNA 1LQ0A 3IWPA 1FWHC 4OTKA 1UD3A 2DT0A 2DVTA 4ZXLA 2Y5EA 2DZSA 4EPBC 1TV3A 3A23A 4NYYA 1MNSA 5LKYA 4S23A 3NXFA 4UBPC 3LGEA 4HHLA 4CD6A 9XIAA 3IK4A 3IJLA 2R9RA 1IGWA 5DBUA 1RY8A 4BEQA 1R3SA 1BG9A 2WMHA 3R2GA 2WSPA 5I09A 4IIGA 2AQWA 1W3JA 2I5GA 2BOGX 4WQ6A 3NZGA 5LNVA 3P84A 3FAXA 2VVSA 3PUDA 1KM2A 4DWSA 3GNPA 2DQWA 4PYSA 1EC8A 3RU8X 3ITTA 3P2VA 1VRDA 4FSAA 4Z1BA 3T40A 3LHYA 4U4MA 1SQ7A 2FHBA 4AC7C 3VD7A 4PB3A 1IT7A 1MDLA 3TN3A 2CBUA 3OU8A 4ES4A 1HKJA 3USBA 4N2YA 5H2ZA 1BQCA 2WVVB 4NI8A 1F3WA 3T4WA 4YPJA 4CU6A 2J9YA 4AF0B 3PPGA 3EOLA 1XDLA 2R1PA 3TYAA 4CNUA 4UNKA 5A6AA 1UP0A 4C6PA 4ICNA 1I9CB 3LRMA 1F3TA 2EPMX 3TROA 8XIMA 1OJXA 5FJTA 4B9ZA 3FSUA 1ZJBA 3EDEA 4EKJA 3MP4A 1TV2A 1IEIA 4OFCA 4JTEA 4NAEB 4KT2A 1HUVA 3WLMA 5AYIA 4HPHA 4HMDA 3QXBA 3ZXWA 2Z28A 4I5RA 3LN3A 1O5KA 5C5YA 2O9PA 4V28A 5HPOA 2G37A 2WHJA 4XZLX 3B06A 4ZXOA 1CX9A 5AC8A 2D73A 4Q8MA 4HPXA 5E0KA 1SPQA 5B7ZA 1QCWA 3VOHA 9RUBA 5HBFA 1G01A 3IPWA 5D4YA 1KWGA 3GBEA 3VKDA 1N8WA 3S8HA 3W7DA 1KV8A 4QSFA 1R3VA 3YPIA 2OQYA 1FWIC 1M41A 4Y96A 1EC7A 1TX2A 1PZ0A 2E1WA 3HIJA 2V81A 4XIAA 4HYWA 4TR9A 3IACA 2XVPA 1OG6A 5CAKA 1TIMA 3TJIA 1IR2A 4AZ7A 4BF9A 3G5EA 5A6BD 1H11A 3KE0A 4GBUA 3TN4A 3ZR6A 2CZDA 1BSIA 2NV9A 1ITUA 2JIEA 4YYFA 3PUOA 4NX5A 4L6OA 1UR8A 5AFDA 3GFXA 3TH6A 5FEXA 3ISIX 4EF8A 1FWAC 1W1PA 1UR0A 4H04A 5TBOA 1J0IA 3CBWA 4S3JA 5C9RA 2XG9A 5I3IA 2OLHA 3BICA 3AS2A 1JRCA 4K37A 3T0TA 1HL9A 3UEQA 3EMCA 4M3PA 3LTPA 3K8MA 3T81A 1GVFA 2Y24A 4LAZA 1U83A 1VBHA 4HYRA 3N6HA 3TQPA 5IDIA 3W83A 4UQAA 1FH8A 4CKQA 4Y6GA 5FI8A 3CB3A 1XQKA 4P8XA 2DUZA 3WH8A 3OEXA 4DNMA 3GTIA 2OEKA 2A6LA 3S2MA 4PUEA 4QS5A 3LI1A 4FB7A 2GUUA 1XLCA 3SUTA 1Q6QA 3GXDA 4H9ZA 2ISFA 2DJLA 1MDRA 3NL5A 4M1BA 3I6TA 3WLRA 3PPFA 3QV7A 5EMLA 1ZQ5A 1DWAM 1QJWA 2A3CA 2FMNA 1C7TA 1CYGA 5EMYA 3LA4A 2QEZA 1TO3A 3QGKC 3HTWA 3GKFA 3UWWA 1KFKA 4PC8A 1TUXA 3XINA 3ABOA 8XIAA 1SFTA 3M5VA 1SSGA 1GZJA 1OFEA 2Y5SA 2ISWA 4ZOEA 1YEYA 3BGAA 2VMFA 5CZTA 3UXKA 3W7QA 2GQ9A 4AX6A 5K7JA 4UTUA 1HTIA 3VCNA 4B15A 3GR7A 4FK9A 3DUGA 1XLDA 1SW3A 1EDTA 1SR9A 1GOQA 3TONA 3W1MA 5LNRA 4J4KA 2EKGA 1M53A 1I2RA 4MGGA 4A3HA 1FXPA 2Z1VA 3L4VA 2O56A 2POTA 1U5JA 2G4FA 5PTDA 1SUXA 2P50A 4DWDA 4ACYA 3GC4A 3O0KA 2FB2A 4XQ6A 1IWBA 3WNNA 1VIZA 2V69A 1Z9AA 2QGYA 4LB3A 3G1SA 1TCMA 4Z2IA 1ECEA 2V8ZA 3MYPA 2ZZ5A 4XD4A 2Y61A 2Z2UA 4MJ2A 1ODZA 1REQB 1TPDA 4HCHA 1J8VA 1XPYA 3PVFA 3FHQA 3STCA 1GT8A 3U0HA 4BY3A 4EACA 1KRMA 4S1FA 4XIMA 1R47A 1P6CA 1D7FA 2F7FA 3UR5A 4GY0A 2ZRZA 3THDA 3ARQA 2NXHA 2ABAA 1X97A 4MY1A 5CPMA 5AECA 3I4EA 2OYMA 1WX0A 1W8GA 1ZP4A 3KLLA 2VX7A 1U5VA 1F6PA 3CNYA 2BVTA 2G8ZA 5E5CA 1KB3A 3SUWA 3O16A 3CZLA 1IEXA 3CUXA 1FUYA 4H8NA 1FCQA 5FJOA 3ZO9A 1TJ0A 4J3XA 1IT8A 3PG8A 5FF4A 4JHMA 1E0VA 2YDQA 1W1B1 3R8HA 4B16A 1R3TA 2V30A 1BAGA 3P82A 4HJWA 3ITXA 1Q45A 1Q63A 1THFD 2P3ZA 4QG6A 4ACZA 2OFJA 1MW0A 4UTJA 4R88A 4FNPA 1XYFA 1I1XA 3CO4A 1A4MA 4C6CA 2ATSA 4YHEA 2E9LA 5E93A 4GI6A 4PSRA 4MVAA 3FX4A 2BY3A 3C2YA 5A8MA 1S38A 2PRMA 2V2HA 1S5VA 3LRLA 3W82A 1OT2A 1ENUA 3W81A 3EDDA 4G56A 4UMCA 3UZXA 1TCDA 4IQEA 3RILA 4DZIA 1Q6RA 5AKQA 4M56A 1A0DA 3TTEA 2WSRA 4YTUA 3UZZA 5CKSA 4MFEA 3BURA 3M7SA 1N7KA 3CTTA 1GQLA 3L5LA 1DWIM 3ATZA 3PAJA 4S38A 3P74A 4LPCA 3TA6A 1VRXA 3M41A 4DWSC 5AHEA 3WBWA 4ZTXA 4GUJA 1S39A 3IIOA 4U2YA 4GG9A 3DYMA 4MJ4A 4NKCA 4MFDA 1A0CA 2BV9A 4ECLA 1ISWA 4I9JA 3OBAA 4J9JA 4TO8A 3E74A 5IFTA 1SO5A 5C9XA 1PKNA 3VX1A 2DSZA 3DFNA 3WLIA 1BVNP 3GTFA 4DIAA 4EOUA 5I3KA 4D6DA 2PP3A 5HMSA 3NA8A 1EP1A 3UVIA 2XIMA 5JBDA 2D24A 4IMAA 1AZ2A 2VZVA 3CHCA 2FZ8A 1WE5A 5XINA 1JGMA 2C7FA 3VNMA 2GJLA 3NM1A 1OZMA 1OYBA 3QC3A 1GJUA 3BUVA 2D2OA 1LG2A 5JBEA 5FKYA 3S1GA 1P6WA 3L9CA 4M6VA 4E4PA 3GFYA 3AHYA 4Z1CA 1GVRA 4H9YA 4G2DA 3FJNA 3LYEA 4ALDA 4MF4A 3C2FA 3BL3A 2O92A 4Y9OA 3MS8A 1UWTA 2RDXA 3E0IA 5AY7A 1A3XA 1HN1A 4QSHA 1PE1A 2XUCA 4J3WA 1XC6A 3EKGA 3GAYA 1CLVA 1HJWA 5FL0A 2OXNA 2F6KA 2PGFA 3BLFA 1LBMA 3N3MA 1EGMA 2WOQA 4PL2A 1V4YA 3CHVA 1AW2A 3KDOA 1P0EA 2VDGA 4UOQA 4K8EA 7TAAA 4KWWA 3NAVA 5I7GA 2GWGA 2QIIA 2BOEX 2H3BA 3GNOA 4X3ZA 3CZJA 4DO4A 4IM4A 2REQA 2ZVIA 1C90A 1V0NA 4S3BA 2A79A 2CLFA 4P61A 4Z0SA 4AD3A 5FAGA 3H54A 4N9CA 3RMEA 4AIOA 5LIWX 4FLRA 1OC5A 1QW7A 1QNSA 5D2TA 4DZAA 3W29A 2QCFA 1N2VA 3SUVA 3DHPA 1ZAHA 4AHQA 2ZRYA 3ZWTA 2J7EA 2ZX7A 3MSDA 4PEKA 4HZ6A 2E9MA 1F9CA 2ZDSA 4JDYA 4KS0A 5K2ZA 7ODCA 2WKJA 1QOXA 3WENA 5DCEA 4O15A 5CBJA 4LVFA 2J6XA 5F2GA 5CSSA 1LT7A 4PMNA 1OFOA 2V3EA 4J27A 4M80A 4AWUA 2Q09A 2PDBA 2XYLA 4PMDA 3OODA 2PRHA 3M5ZA 3LLXA 1XRSA 4M81A 1FCVA 2Y85A 2ZZ2A 5G5IA 1E5JA 3BK0A 2X30A 5BYWA 3C0QA 4DZHA 3VCRA 2AKMA 1BF6A 3URAA 3W07A 1JNDA 4ZO9A 4RNHA 4ZGYA 7PTDA 2INFA 2Q3RA 4GIEA 4WSHA 2C0AA 5D33A 1J01A 3BOLA 1HP5A 3H55A 2G3NA 1F6KA 3WLHA 3S42A 1D7KA 1Z3NA 3M0YA 3WQOA 4FAMA 1K70A 3BLDA 3OBEA 4DUWA 4CLMA 2BGNE 1EF2A 1W1ZA 3V0TA 4G9PA 2QXWA 1W9VA 4HTBA 2XSAA 5BU6A 2PDKA 1B0IA 3T05A 4QE1A 1X1OA 5CG0A 3E38A 4GFIA 3OPSA 3EWZA 3OQEA 3ALGA 4PBEA 1OFAA 3TFCA 4JX6A 1C9WA 1UR4A 2C1HA 2QULA 1VCFA 2XWEA 2WC3A 3SFWA 3B04A 4B90A 3GE7A 1XINA 1KFJA 1XCFA 2ZWYA 3QLDA 3TVAA 2E5DA 1Q4NX 5AC6A 1VEPA 4AMCA 4O11A 3ERPA 5A95A 4H8VA 1JGIA 5HULA 3VD9A 1FWSA 3L2IA 3R43A 2QUNA 3ZT5A 1J6PA 4JTDA 1ONRA 5A5WA 4DXXA 5C9UA 4IIHA 2HRWA 2DSWA 3UA4A 1XCXA 3TWBA 4E0CA 1DKWA 5HK4A 3HF3A 4W5UA 4UFKA 4P7OA 3BCFA 1TJ2A 1XIJA 4ZA0A 1YPXA 5IRPA 4DWSB 5HINA 3BAWA 2GGHA 5DT5A 5F2LA 1N8FA 1XGEA 2ZRWA 4D8AA 3FK4A 3UWYA 3TU9A 4C91A 4JYDA 4KWOA 1I2QA 2W3ZA 5A6SA 2D69A 3GC2A 2OMAA 3MMDA 4KEVA 3WF1A 1BGAA 3V0SA 3BGGA 3RPDA 1JZ4A 1HO4A 1TV4A 1R0MA 3R1ZA 3T2OA 1E0TA 4AYSA 5CEWA 3EZ4A 4GZ7A 1XS2A 1KBIA 2ZKMX 2ZCGA 4PUUA 3EX6A 4ERIA 3PULA 4GJIA 4HZMA 3PR2A 1AD4A 3NVTA 4BJHA 5CZJA 3SCPA 3BGJA 1W5QA 3DOPA 4F2BA 2WZEA 1KLYA 3N2TA 5JU6A 3B9NA 3UYCA 3SGGA 2YA2A 4LU0A 5CAHA 4NI3A 2GVJA 1LDCA 1QTWA 2GJXA 2DZAA 3IARA 2PTDA 4WVXA 1ZU8A 4PRRA 2PDQA 4RDYA 3PHAA 4O12A 1MXSA 4QNWA 3KOWA 4AZ5A 2Y7FA 3UJRA 2CERA 1TMQA 3PZUA 3KCOA 4K2SA 4WZHA 3SJNA 1MRAA 4YTQA 1HJUA 4WXYA 4AB4A 1PCKA 4LVGA 3O15A 3GH7A 3D47A 3H2OA 5EBUA 2D22A 5GQBA 3VNKA 2X0SA 3NQ7A 4DN1A 3ITOA 1K9DA 5LIUX 5FJPA 4NXKA 2Z6JA 1JFXA 3G1HA 3H7UA 2VVNA 4RNIA 4TX8A 1CLXA 3BLPX 8CGTA 5DMYA 1I4NA 1O12A 2EPNA 1QNVA 1R7AA 4GYPA 3RPMA 2O0TA 4ZENA 1L6YA 2VGGA 1F6YA 1VLWA 4IX0A 5MHBA 2X41A 2OWWA 3GFZA 3AOFA 1E4NA 4AFYA 5EL1A 1W3TA 5D2YA 2NXIA 3ANVA 2WVUA 3R89A 3JRKA 4PMOA 3H4XA 3D6NA 4OECA 3I10A 5FSEC 2PZNA 1O5XA 6PTDA 2IPJA 4N9EA 3TLQA 3R4IA 1NAL1 1JIBA 1CXIA 3S1XA 5CPOA 3VIMA 4QRNA 2AGTA 1F07A 4W86A 1TWSA 4WGHA 3CWHA 3WZ0E 3C86A 5BOOA 2NV1A 3WEZA 5A3HA 3NGFA 3KCLA 2A6NA 2NVCA 1SW7A 3UVAA 2ZUWA 2J7BA 1A5BA 3S46A 4URIA 1WNOA 3G1XA 2VQUA 1TR1A 5DRCA 1EXBA 3T0DA 1QXLA 1R86A 1VF8A 1Y0EA 3QZAA 4IIEA 3WQWA 2NT0A 4KQNA 3E12A 1R87A 5HR6A 2YCJA 4B9YA 3LXCA 4UQDA 3W7JA 3RUBL 1BF2A 1FWEC 1PTAA 4E2OA 3FLUA 3STPA 5CLTA 2QUUA 4O0KA 5CBBA 5AOUA 3SQLA 3P60A 3CHDA 2VOMA 4FA3A 1MQQA 2E6DA 3G6LA 3TR2A 3W7HA 4YHGA 4UR7A 2B4GA 3MSGA 2I16A 4HA1A 1V3MA 3ZVHA 4RE2A 3QC0A 1EGZA 2IXUA 2I57A 3VGHA 2QDDA 1I45A 1WDQA 4RXFA 2G4JA 4Z2GA 4O57A 2VNCA 3MKVA 3IRSA 2DV0A 3BXWA 2CITA 1MXDA 3FKKA 1V08A 4Y9PA 1XLKA 3B9DA 2HK0A 5DANA 2I7GA 2E3ZA 4LBRA 4F0MA 1X98A 4D72A 1JYXA 3URBA 3BAYA 3D3AA 4C1LA 1RJPA 4ZOBA 4JN8A 4GQGA 1ZJAA 1UBPC 3K30A 4JAWA 2V63A 1V6YA 5E70A 5KZMA 3S47A 1TWDA 3PUGA 4CD8A 3WJWA 2DSUA 1B2YA 3ITCA 3WBEA 3WH7A 1EF3A 3CEUA 3EYPA 3A3XA 3EWYA 1S46A 3MPGA 1V02A 4JS3A 4DVOA 4JD4A 4I8YA 4MNJA 1JPDX 4Y8EA 1RD6A 3D5HA 1W91A 1EHNA 2WZMA 4GQQA 4V33A 2NQLA 1XLJA 3D46A 3SAZA 2PDFA 1PZ2A 5BU9A 2I1OA 3WEOA 4O8AA 2HPIA 1MUMA 5TF0A 4J2PA 2GOKA 5MF5A 1JZ8A 1TWZA 2Z7KA 4GX8A 4HA0A 5C7VA 4KRZA 3RHGA 4JFUA 4DM1A 3TSDA 2IPWA 3G24A 4B3KA 3DAQA 1A5MC 4RK8A 3W7RA 3TN5A 4NXSA 2BHUA 4XZWA 1PXGA 3B9AA 4GX9A 4CCCA 1HIZA 3EA3A 3TYUA 1HP4A 3NSNA 2XN2A 1KA9F 3CC1A 3M0KA 5XIAA 5T26A 3GS6A 1TFVA 4ACZB 3R0DA 3AS0A 1Q8AA 3UPWA 4ONVA 4CVWA 2QKFA 4ASTA 3KWSA 2X1TA 3ABRA 4PUDA 5IBXA 1E3XA 3UCDA 2BXVA 2RDUA 2QHAA 2VEIA 4L65A 4F2UA 3FVDA 4LXFA 2MNRA 1VQTA 5G2HA 4DY1A 1MEIA 2H6RA 4ICMA 3CMGA 5RUBA 4I6VA 3QQ0A 4ERGA 1TA3B 3BWWA 1PEZA 4EXBA 2VCBA 3CTLA 3CQ0A 4F0SA 3W75A 2DIJA 4DF2A 2BGSA 5SWUA 1YNQA 4KCVA 1XLHA 1F76A 3MA8A 4C5YA 1QK0A 1KWKA 4YIWA 4E6MA 3BG3A 4JTHA 5D2WA 4JOMA 2J79A 2WWCA 1FP8A 1YTDA 2AQOA 4AXKA 2OZ8A 1GEQA 5CSRA 1CIUA 3KVJA 1G4SA 3RCNA 1K7EA 3RR4A 1L6GA 3ZLGA 1V8EA 2NSOA 4S39A 1IF2A 2DZPA 4ROPA 4RX0A 2W63A 4PTMA 5DMLA 1XKJA 3WUBA 4C6FA 1IV8A 4RE4A 3RU6A 4Z2LA 3G0UA 3VDBA 1FHDA 2OKTA 3PSVA 1YTEA 3TJLA 4AIUA 3VINA 1V5XA 4LF2A 3S2CA 4I5XA 1ONWA 3NQ8A 4W84A 1E1FA 2DZTA 3KHJA 1TQJA 3EWDA 1Z48A 1EC9A 3OP2A 4RL3A 1DJIA 4LV9A 1HKKA 4H9MA 1JZ5A 3OG2A 3NZPA 3WEMA 1D2KA 2WC4A 2NT1A 3WJZA 4LTSA 3B3DA 1GW9A 1LRTA 2VUNA 3CS2A 1CPUA 3GVGA 4Q8VA 1GYLA 1OK6A 4NUWA 3GTXA 3O8AA 3H2MA 5JIWA 2HPMA 5E6YA 3E9AA 1VD6A 3GNRA 1M3UA 2IKHA 2FDSA 2CBIA 4ZCWA 2DY3A 2WSYA 2WMJA 2YA1A 2BB0A 2E67A 2JKPA 2BS9A 4LFYA 1C91A 5A69A 5FACA 3E2QA 1JDFA 4D6FA 2PC4A 3TCSA 1SR0A 5HMEA 2BX7A 1XX1A 3F2DA 4LVDA 2G97A 3WBXA 1XLGA 1JPMA 2UY2A 3TEVA 2WLZA 3HOJA 4NJIA 2RKXA 4PMQA 1M68A 1US3A 3FDKA 1A5OC 4MPQA 4UWMA 1TUFA 5TAOA 2REQB 3G1RA 4GYPC 3TAKA 4DHGA 4QHRA 4WX2A 3S5YA 3OA5A 1MQPA 1HQTA 3G1VA 4UC5A 2UZ9A 3VIJA 2C79A 4BR1A 3QY6A 2ZX9A 4V2XA 2O7SA 3S0CA 3NO1A 4HTYA 1UA7A 1HJSA 2V5LA 2ACQA 3P8IA 1S5TA 2BODX 2V5JA 2ZRUA 3CMJA 1V3KA 3LG3A 1E9ZB 3LHTA 2NVDA 1GQJA 1Q5MA 4XD5A 4US6A 3LI0A 5CH9A 4ZL1A 4M51A 4UQBA 5DCBA 1XBYA 1CW2A 4NX0A 3ZR5A 2EPHA 4N4QA 1FWGC 1RBLA 4AWTA 1VYPX 3VMOA 4AEEA 3RITA 1MSSA 4RKAA 2W91A 3UR7A 4FX6M 1QDSA 3WLJA 2NQHA 2VC6A 3NR0A 4HMCA 5BWFA 2ZICA 3AUOA 1TE1A 1EJSC 4DAIA 4IOTA 4R27A 1ADDA 2YBVA 3STGA 1UKOA 2QNEA 2PURA 2QYGA 2BXYA 3EOUA 4BQ5A 3BV7A 1Q2RA 4OBSA 1FOBA 3VIFA 3CV1A 4I6KA 3NQBA 4HPJA 5B80A 1EWDA 1GOMA 1RJQA 2OEJA 2Y63A 1GKRA 4Q7NA 3DC8A 1E0XA 2O9RA 1D3GA 3V5CA 2XWDA 2HXTA 4PRTA 2ZX5A 4W9TA 1EA0A 3H2NA 3E1F1 3ZFHA 1OY0A 3AXHA 1EX5A 6CGTA 1DE5A 2YB1A 1CNVA 2ON3A 2ISDA 4U5KA 4YWIA 1WV2A 2VFDA 4WHBA 2AGKA 2V38A 3I7RA 3OIXA 2JFEX 1A53A 3B8SA 1XGDA 4GIYA 1BWLA 3T6CA 3L65A 4OQVA 2MUCA 3VABA 4C6OA 1QI5A 1XGZA 3S1UA 5EMKA 1DWJM 2W62A 1K6WA 4ATWA 1WUFA 4OVXA 2GUYA 4GACA 1UPPA 1XDJA 2HNHA 4CEXC 4IXXA 2WZIA 1T8QA 2OTDA 2WM1A 1IXQA 1T6MA 5BROA 1A3HA 3WH9A 1OCJA 3NIYA 4RV3A 4YWSA 1P0KA 4JL2A 3A4WA 2ZX6A 4JQ2A 1LQAA 3EKZA 4B2DD 2YYTA 1DPMA 2ZZ3A 4U10A 3VC5A 3BOFA 5C2CA 4JIPA 4RZ6A 2YCLB 4MDPA 5A1AA 4AEOA 4RZ5A 3SSJA 4QG8A 1BHGA 4OV9A 3CZGA 3NJ3A 1UWAA 1U33A 1VIWA 4I7VA 3MUIA 3G8EA 1H3GA 2V3GA 4IJCA 1GKQA 3Q94A 2DPEA 1E0WA 7REQA 3HQ1A 1SO6A 2QVNA 1TPFA 4F0KA 4PTXA 3UGRA 1E51A 3CEPA 4DBDA 2J24A 3E96A 2DSVA 2ZZ7A 4GI9A 4YXGA 5BMXA 5GNYA 1EDGA 3FGCA 1LLWA 1HG3A 3WQFA 5L6UA 1PO9A 1WXYA 4IF2A 4JTUA 5DQPA 1VPXA 1WKYA 4UTLA 1LQ2A 2OGJA 4O0ZA 3KW3A 1UUOA 1UIPA 2G3FA 2H8ZA 3U4AA 2FGZA 3PTMA 3ZJ7A 3UXIA 2GJXB 1TMLA 3W1QA 1VFUA 3Q37A 3B0XA 3GNDA 1HW6A 3TMQA 3CK5A 3ARPA 2HE8A 2E1DA 4IFRA 1JCMP 1QT1A 4A2SA 1BFNA 1CLKA 3FY1A 2R1NA 3W02A 1OSEA 4K68A 3CYJA 5HDRA 3LB0A 2J8TA 2Z29A 2X2YA 4B2DA 1O5RA 3S83A 5I3GA 3W7IA 1SFLA 5IFPA 1EJVC 1GPFA 1WAWA 3W6MA 4CNTA 4LX4A 3P61A 4RUBA 4WSKA 4CCZA 2HVOA 4ZO7A 1BSLA 1A3WA 3QV8A 4C65A 1WDWA 1J93A 4D71A 1FP9A 2P8BA 5IDZA 3LUTA 3LLDA 3VI2A 4FXJA 1SU5A 3QTPA 3QPYA 4U31A 3IJ8A 1YQ2A 2E5BA 4K1GA 4LC6A 4QIUA 3NPXA 2WXDM 3NCOA 4GUHA 1JNEA 1GJWA 1A5UA 3TYZA 2QCDA 3CL8A 1BQGA 2NUWA 5I07A 4UZUA 2PGEA 4GIRA 5JBFA 2ZUSA 4HN8A 1M03A 3RX2A 1RQBA 2G95A 1K4HA 3VZZA 1B57A 3LCIA 5HUPA 3LERA 5A8OA 1FH7A 1IZKA 3TN6A 2PWHA 1J9YA 4H41A 3QW4B 4G7EA 2VDIA 1GVEA 3UXAA 4NZFA 5BRBA 1ZCOA 2Z27A 2XGBA 2Q8XA 1J0YA 3FV9A 2HWGA 2EEXA 1J4EA 2J75A 3VU2A 3HURA 4DJFA 4GMEA 4FF5A 2B81A 3NO5A 1NH6A 3FA4A 1TPUA 3ARZA 1DL3A 1QW9A 3LCWA 4FLSA 1ECQA 3OW1A 5F1VA 4OOZA 3OYXA 3MMUA 3QLLA 4DELA 4KIRA 3WSUA 2JK2A 3KVLA 3ZVHB 5GNXA 4P7LA 1IXPA 4BS0A 5FEPA 4K1WA 4OUEA 4NF7A 2UY5A 3MI3A 4KWSA 5FSDC 5GJNA 2DSKA 4G1NA 4JTGA 2PDMA 4PMZA 4RE0A 3THQA 1CGWA 4MYXA 3WIJA 5HUOA 2VX4A 3MDWA 2PLJA 2Z0IA 3UZWA 3MHGA 5MKGA 1AFSA 2CWNA 3WQGA 2Q8ZA 3L12A 3NPWA 3PNUA 3MU7A 3OYZA 5D2VA 4JHZA 4KBXA 1GQNA 1D8WA 4LCQA 1E6SM 2J13A 3GX9A 3A9BA 3CV6A 4GUIA 7ENLA 4JCLA 1W5PA 3GBDA 2FJKA 2A2IA 3CGTA 3N1AA 5AHFA 2DIKA 3IAPA 2CZVA 4JTJA 4DZ5A 3DXIA 2CLEA 1LBFA 3W7CA 5CLWA 3DCPA 4M7TA 2OGYA 4IL0A 5BCAA 4AZGA 1OF6A 4AVNA 4MB4A 2C3ZA 4O1AA 5DCDA 3W1XA 4TTGA 1BKHA 1B31A 2Y8KA 2ZA1A 4J5NA 4NU7A 2A3EA 2EAWA 3GKAA 4F48A 1KBKA 2ZA3A 3NURA 4E2VA 2GDVA 1PYMA 3KDNA 2HJPA 3TYBA 1E0UA 1P4CA 2GSHA 4HGXA 4CEUC 3W4RA 2ZE3A 3LHWA 3UGVA 4AD5A 3B97A 4LEFA 3WY1A 3TA9A 3KTSA 3L23A 3R0UA 1RUSA 2J88A 1MFUA 1YHTA 3QPEA 4GVIA 1RVKA 1LUCA 1JL8A 1JI1A 4Q4MA 1MFVA 4O14A 1CGTA 2YIHA 3EB3A 2FGLA 1H50A 1JVNA 4MYAA 1Z69A 1RD5A 2FTPA 4R7WA 2YFOA 3CUJA 4GY7A 3OZMA 2NV2A 3KUMA 1UD4A 3V1PA 3W7PA 1MYRA 3RDKA 4MUPA 3VNJA 5BW6A 5FJJA 3MANA 3O0FA 5DMNA 2HS6A 3PWGA 2PDUA 1R6WA 4PB5A 4JKLA 3JZEA 4JEQA 3TTOA 1OFRA 1UCWA 3H26A 2RGMA 1KFLA 1Q13A 2DJXA 2WMIA 5HMFA 3AISA 1G0CA 2PWEA 2J7GA 2EJAA 3W1PA 1AH0A 4HHHA 1SJBA 2XVNA 4K3ZA 4OBRA 1DHPA 3DG7A 3K8KA 3WH5A 3HGJA 4Z2JA 3RM4A 4B5XA 3LXAA 2XISA 1NOWA 2E6FA 2PWVA 3D3FA 1QOPA 3LZ5A 3UG4A 4Z17A 4B92A 4BQ2A 2EGZA 1I0BA 4C6IA 2OX4A 4JL1A 4KW2A 1EBHA 4O53A 1X8CA 1PUDA 1OINA 5I3DA 4KFOA 1NFGA 2GLKA 4BZYA 3E02A 3VMNA 4BKNA 1EIXA 3FJLA 2V5CA 3WMCA 2CLLA 4DEFA 2P5NA 2BY2A 3NDYA 2Y7EA 1DJXA 3VILA 4HCLA 4Z2KA 3NQCA 1F3XA 3WDIA 4S3EA 1B3YA 1R2SA 1NFBA 3GNXA 1E71M 4JHOA 3XIMA 3B03A 1RCQA 2PU0A 3AIQA 1S2AA 4GNVA 4F40A 2OPJA 5HNTA 4FOUA 2E6AA 1OD0A 3FXYA 3NTYA 1K9EA 3FXGA 3T2QA 3N04A 6REQA 1AUSL 4JQ3A 3N25A 4UCGA 3RYSA 3L2LA 3HFYA 3F5KA 1VP5A 3N18A 1A47A 4WJ8A 4IP7A 1FX6A 4IQDA 3C8NA 4LYQA 1JQVA 3FOKA 4L1XA 3DC0A 5D37A 3G2GA 4LUIA 3F7JA 3UJSA 1MNZA 4HZ8A 4YTTA 3A64A 1E9YB 3VGFA 4WY0A 2YDRA 5KMYA 2YKKA 3OBKA 3GYCA 2FTWA 3ZIZA 4AD0A 4MWAC 3VIGA 2SFPA 4AD2A 4Y8FA 1P48A 4PUMA 4UZSA 3MI2A 4FI4A 3GG8A 4IJBA 3W6LA 1W54A 3SN1A 4DO6A 3FYPA 1SJCA 2WHLA 2Y4SA 3WD2A 1KC7A 4UUIA 4PR4A 1M6JA 1XLAA 1XLMA 3C8FA 3G1FA 1EO7A 1UH2A 1VC4A 1OB0A 4U3CA 1OEPA 4ENLA 5BWAA 2C1GA 3RRAA 4A8NA 2UY3A 5JH1A 2ZUVA 3PBYA 3OLEA 2WANA 4PUNA 4IQJA 1H61A 3GW3A 3ZMRA 2XIBA 2ZADA 1PKMA 4WXZA 3M0IA 1EO5A 4OWGA 4FOJA 1WZKA 3MMWA 5AYXA 2HK1A 2JGYA 4O0QA 1KW1A 1OD8A 3STFA 3SGUA 1YNYA 3NG3A 1K7XA 2XFWA 4L7ZA 3N3TA 3KOZA 3THCA 4TOQA 2G96A 2FH8A 3ITLA 3LGGA 4TX9A 5HJYA 3A12A 1ZJHA 1ITCA 5LA0A 4PTNA 2VEFA 3BLIA 1J6OA 2PBOA 2BBFA 3KZSA 1MI3A 3P80A 2AKZA 3BMXA 3HJEA 3ARVA 1XWYA 3CZKA 4DF1A 3C2VA 4G6CA 3T8LA 1TTIA 1K4GA 3CQIA 1X6UA 1ONXA 2VQTA 3EAUA 4GGBA 3IUDA 4X22A 3GU9A 4HCDA 1XV8A 4HNCA 2F38A 4F4RA 4XBKA 3CIXA 3QV6A 3FNDA 3WO8A 1FWRA 4FXRA 1TPWA 3SO7A 1F2JA 4A21A 5EA9A 4ICCX 3TTQA 3S6DA 1S2WA 2CXEA 1KCXA 2I56A 5KZEA 1L2QA 1FY6A 5I3JA 6A3HA 2WWDA 1NM9A 1IWPA 1WZAA 1AQMA 5D38A 2VC5A 3N15A 4JTLA 1G67A 1R9YA 1ZBVA 3SN4A 5AC4A 1DWGM 3LZ3A 3L68A 1IHIA 1LYXA 3SCWA 2OOFA 1DXIA 3U2EA 3FW6A 2F2KA 1RBOB 2HZGA 3O9NA 2DH2A 1OFQA 1Z89A 3CYVA 4Y9NA 1ISZA 1OT1A 2QLYA 3V5OA 3MCMA 5REQA 2VL4A 4JDBA 3NZQA 3ARUA 4X63A 4JKKA 1E4IA 1T7LA 1TTPA 1ZPTA 3DI1A 2XVLA 3RX3A 2DZVA 5I2UA 4A22A 1L8PA 2BTMA 4MZ8A 5LZLA 3UR8A 4MJMA 4QLJA 1HKIA 4O50A 1OGBA 3WFAA 3HV9A 3DG3A 4KMQA 3LQLA 3L0NA 4E5TA 1PDZA 3EB4A 2UWFA 1T40A 3S2LA 2Z1KA 3BCDA 4XB3A 1VEMA 1OIMA 3BO9A 1ZNNA 1XG3A 1YKWA 4JTQA 5E9XA 3FDGA 3U9IA 2HDJA 1WDRA 4FZIA 4MZYA 1X1NA 3DH7A 1JQXA 2ALDA 5FEWA 2DUXA 2YSWA 3TWAA 3WH6A 4B4FA 1POJA 1FWWA 2CLPA 1LJYA 4DPQA 4TIMA 2XIJA 2OX1A 4Q4KA 1ESWA 2DGAA 3HGSA 2OJPA 3AYTA 4LANA 5LIXX 4IPNB 1ZS2A 3FGCB 2JKAA 4OZOA 3FEQA 1DJGA 4B5NA 1PZ3A 3Q2DA 1SGJA 4K7YA 4HU8A 1RR2A 5FJIA 2VEGA 4M7SA 1XH1A 5F1UA 3PZIA 5GJPA 3WLTA 5BRQA 2HTMA 3O07A 5EBAA 3VD4A 5CZKA 1VBJA 3N17A 2VEKA 2W61A 4GKTA 1C9DA 2VFFA 5EYWA 2IPFA 2HNEA 1QOQA 3CB8A 1PS9A 1KLZA 3KXQA 5HNRA 3ZQ9A 2FVKA 4FIRA 1DVJA 3VIPA 3P3BA 5KITA 3N6QA 4WLCA 3E3HA 1UA3A 4FS9A 1X6NA 2Y88A 4HNTA 5CGTA 2D3LA 3U7VA 1Q4WA 3IGSA 2OU4A 1Q6OA 4H8HA 1JCYA 4MTVA 3V7PA 4EP8C 1OWQA 3ABXA 4UMBA 1UJPA 1V7YA 3LY0A 1H62A 3DX5A 1U30A 5DT7A 2QV5A 1UZ4A 2IXVA 3W85A 3NWRA 3GUWA 5EKYA 4B5TA 1UPMB 1E70M 5JH2A 2XVGA 3SZ8A 1RPXA 3UXLA 1B5TA 1KFBA 3UBPC 3W7LA 4JNYA 3MP3A 3CPRA 1JUKA 3H2FA 1KFCA 3M5XA 1EX1A 3ZOAA 3U2ZA 1QNQA 3K4DA 3UQNA 2V68A 3THAA 3UWQA 1EGVA 3BSGA 1TMHA 1IYXA 2ACSA 3PNZA 3W7OA 2YLLA 1XH0A 2FFIA 2QCDB 4ZOAA 2CKRA 3ARXA 3QY8A 3DBPA 2HVNA 4XZMX 3TC3A 2P53A 3NDOA 1J18A 3PSWA 2VI0A 2VP8A 4DRSA 4LVAA 3RM8A 4W8BA 3B05A 1RXOB 2CKSA 5GJMA 2QMJA 2Y0FA 1RP9A 4WK9A 4XK2A 5IHRA 4GNJA 4K36A 1HGWA 1B1YA 5CSUA 2QF8A 4G7EB 5C9ZA 4WEVX 3PG9A 5KEZA 3F4NA 3W3OA 1XR2A 4MKSA 2C91A 1BGGA 1R2TA 3B4YA 3CLWA 2V3DA 1DEDA 5J5DA 4S2BA 1V93A 3IUHA 3CUGA 4HB7A 1AL8A 4AWEA 4O52A 4W4QA 5FD0A 1PTDA 4B91A 1W8SA 2G41A 1E4MM 1UP3A 2H8XA 5I6SA 3T4CA 2YYUA 5D03A 3N4EA 2VX5A 1YPIA 1S1RA 3SJ3A 5LGZA 3VAVA 3QEZA 1H60A 3VE7A 1YNPA 4O1CA 2CXGA 2OO0A 5HPCA 6XIAA 2CBJA 4NYUA 1PIFA 4IMFA 1NWUA 1GOKA 1XBXA 2TAAA 3G8RA 1P1MA 4NAFA 2WW5A 1LRQA 3G3DA 4YJ5A 3CUIA 1QBAA 1C8XA 1OFBA 4ADTA 4PE8A 1JYVA 4Y7EA 2QPXA 2GQAA 1ZAJA 1XRFA 3K8LA 5TNVA 4A2RA 1GPWA 1VFLA 3BLEA 1KBBA 1E4LA 4YTSA 4B3ZA 2DORA 4OE7A 3KS6A 1E43A 4G1KA 1UH3A 2H9AA 4BCEA 3DEQA 3HN3A 2XH2A 1QW8A 2QJNA 4FNQA 4PODA 2VGFA 1YBQA 4K8HA 4GE8A 1UD5A 2XDFA 1JYNA 5CJNA 4DM2A 2BVDA 1XSJA 2RH9A 3R8GA 4LQ1A 3VO0A 5FF3A 4JICA 3IANA 1NVMA 3MB9A 2G3JA 3AIWA 3C6CA 1KGXA 2XN0A 3N19B 1I2PA 1J2BA 1XYAA 1VLIA 4WRHA 1RZMA 3VM5A 3QYSA 1SYTA 1LUCB 4X2PA 3ABQA 2YDAA 2GFTA 3BLLA 3NL2A 4W8AA 1NOUA 3AXIA 1F05A 2YXOA 4QNEA 4UOZA 4WDXA 4C7FA 2OVLA 2H3DA 2B31A 2VENA 4M6PA 3NYZA 5CC5A 5LA1A 4GUGA 3HG4A 3WDJA 2RJGA 3AALA 3WQ6A 1R3QA 4NT0A 3E2VA 3J7HA 2VFEA 1SFSA 1OGGA 3IEBA 1U2YA 5DBTA 1XYLA 3TCEA 2EF9A 2A85A 3I6RA 4Q32A 2WMIB 4P7QA 2Z00A 2GVYA 3DGRA 5K4XA 5H8PA 3TZFA 4PCTA 3O6YX 4EXAA 5DY3A 2J78A 3VE9A 3C2OA 3KTXA 3BQ5A 1VR6A 3M0MA 4FR1A 2O9OA 3WF2A 1E56A 3VUPA 2F9RA 1MMFA 1JULA 3BW3A 4WKHA 4TTUA 2ZBTA 2X0HA 2NQ5A 2VGBA 1KR1A 4O4VA 1OFPA 2Q6ZA 2X7VA 4IMGA 1W3KA 4BF7A 3B0PA 4LUSA 1LROA 1QU4A 2GYIA 3GXPA 2V5DA 3RJXA 3DN5A 1PTGA 1DJQA 2GL5A 1C8YA 3ME3A 2WVTA 4MDOA 4R34A 4F2TA 5BMWA 1TPVA 4J7RA 4UMAA 1BEUA 4FX8A 1JI2A 2CNCA 1K03A 1V02E 3W7KA 3BPWA 3VC6A 4DBSA 4M8UA 4C1NA 3VX0A 6REQB 4L64A 4FR6A 4YU1A 3CQHA 5HNNA 3SADA 2POZA 4MNKA 4IMEA 4OIFA 1JZ7A 2YOCA 2YW4A 1W56A 1D9EA 2WPGA 1VYRA 4O16A 5HWMA 4TVCA 1X7FA 3QKZA 3M44A 1GUVA 4XZIA 5J5RA 1TQXA 1YDVA 4J28A 5A2AA 3APGA 1UASA 1FKXA 4YTRA 4WY0B 2VR5A 2DW6A 3S9YA 1EFZA 2VXNA 2IKJA 4QJ1A 3MUAA 1EA9C 3D0CA 1P0DA 1VS1A 4JTRA 5G4EA 2J6VA 4L9XA 4AISA 4XBJA 2GSEA 4M19A 2OZ3A 1Z44A 3KZPA 2O55A 4JCMA 1XIBA 1XBVA 3PF3A 4QISA 4FALA 1EL3A 1V6WA 3ITVA 5H8UA 1SJAA 2VFHA 1FWNA 4RZ4A 1MW1A 4WCJA 4AY8A 1B9ZA 3UY7A 2R1LA 1YDOA 3PBUA 3W2UA 4C6QA 2TPSA 1WAUA 2R82A 4FNUA 4ZZ9A 3LK6A 1NEYA 5A6KA 4XUGA 3UESA 3ARTA 3PPHA 1X39A 2IPGA 4LAMA 1WXJA 1W5NA 3UCQA 4ZFMA 4WR3A 4H01A 3HO8A 3MZ2A 1S2UA 1FWCC 2BVWA 1LM1A 4AWSA 3V3WA 2E25A 2HBVA 2HBXA 5JIPA 4TV6A 4JTTA 1BLIA 1L8NA 1RK6A 1VEOA 1ZCCA 3POCA 4LSBA 2PI6A 4L1GA 4MIMA 5D9NA 3RLUA 3PBMA 3BLKA 3QF0A 1JCTA 4R7OA 1OGSA 2CIPA 4MB5A 5M5DA 4DJED 1XD1A 2Y1HA 3KFTA 4XAPA 3T09A 3GNNA 3CV2A 1W0MA 3AQUA 4PTVA 3T42A 2WMKA 1Y5WA 5CJMA 1JPKA 2Z2AA 2CETA 3W26A 3OQ8A 1Q7ZA 1LOQA 1Q2SA 3BAKA 4W5ZA 3HGRA 3C2RA 3SI9A 4JIIX 2AMGA 4HU0A 2WBGA 3FS2A 1OC7A 1LG1A 4A05A 4XD3A 1PDYA 1H63A 4N0RA 1H1YA 3RLHA 1J79A 4PUWA 4HA3A 2A21A 2GQ8A 3H24A 2VC7A 4IFOA 3WK0A 1F73A 4GLEA 4S3KA 4ILSA 2Z1WA 5DMMA 4GQBA 1E40A 2PMQA 1H49A 2E6YA 1QI0A 3ONBA 5D09A 4P5UA 3TXZA 3P5ZA 3W88A 1TTJA 3H23A 1O66A 2XFRA 2Y89A 1NIUA 2X42A 3HZ3A 4RW5A 4S3FA 5EY5A 3VMPA 5A6BA 2V5BA 4MKVA 4YL2A 3MMTA 5T9BG 1VCVA 3GXTA 4V1YA 2QF7A 3GXIA 3EX4A 4KEUA 3V0UA 2CBVA 4U33A 1Y5XA 1GOWA 4W85A 3A21A 3O7UA 1RH9A 4PGLA 4BA0A 1G7VA 1H5YA 1K9FA 3APYA 2PWFA 4IMDA 4CVUA 4YCOA 4PMVA 4ZQRA 2WAGA 4GZJA 3OOQA 1Q7MA 4JYFA 5REQB 3EWWA 4DJEA 4IGHA 1NDWA 1TR9A 3NQMA 2C19A 3DU0A 4D9PA 3EPOA 2YR1A 3LENA 5LNSA 1MXGA 2J9XA 3S5OA 1H0IA 1U1HA 3GWQA 3LGDA 1GORA 3T0AA 4QDWA 3CIVA 3MSYA 1CWYA 4A8RA 5DY2A 3Q67A 1DV7A 3NOYA 3OLDA 2PGWA 5AC7A 1W1VA 4PH6A 3GDRA 2OYKA 4LNCA 3HFTA 1LWJA 3CWNA 3MQTA 4KCUA 3ID7A 4KF1A 5CZSA 8TIMA 4IL2A 3PB0A 4JIEA 2ZE0A 4GINA 3TTSA 3GQYA 3MTWA 2XH0A 3CJPA 3EOOA 4Q3MA 1MW2A 2XZ7A 2WJFA 1E1CA 3IGUA 3LTYA 5LYRA 1R3YA 2G50A 1PHWA 3LV6A 4UTWC 4WJXA 4GJ1A 2Z4GA 3RCMA 2INZA 3UG3A 3ABSA 4MLRA 1LLZA 7TIMA 1FHUA 3G3MA 5AC5A 3RIKA 3EDKA 3B40A 3GO2A 4AMAA 3B0VC 2Z6IA 3B8WA 2IMRA 4GABA 1XSKA 1PPIA 1FCBA 1KKRA 3LPOA 3GVWA 3N4FA 3AHTA 3C3UA 5FF2A 3ICJA 4DUOA 2ZXAA 3W9ZA 1C92A 5D2XA 1UQZA 4O1FA 3ZLFA 3MWCA 1DJZA 2Q01A 3L5MA 4OT7A 3PZOA 5H8MA 1F8MA 5DX7A 2JQXA 2BSLA 4RDVA 1W5MA 1GONA 3M7WA 3GZAA 4MUZA 4A35A 4S3DA 2YZRA 1E55A 4OV4A 2YB4A 4PTDA 1FXQA 3FJ4A 1SM9A 3VKJA 1SZNA 1UMYA 4BFAA 4YYCA 2HXUA 4UCFA 1R9XA 4J3TA 4E4UA 1TA3A 3DIPA 1HKWA 2TMDA 5K9DA 4EE9A 1VFMA 4LOCA 1NP2A 3ZJKA 4LJ3A 2CLIA 1LF1A 4P8VA 3VOJA 1GG0A 4TQTA 1R7OA 4GPNA 1NWSA 1O68A 2QS8A 3FIGA 2PDGA 4IPLA 3LBCA 2PTZA 1WQ5A 3AI0A 3L0KA 2VR4A 2CLMA 4Q7BA 4MOZA 2A3HA 2JGQA 2V2CA 5D02A 3Q45A 4DJDD 3NO3A 4BI6A 1EOMA 3IIXA 4DI8A 1OABA 1CT5A 3TSMA 2WSKA 3WJSA 1DOSA 4IUOA 4US5D 2VD9A 4NZ3A 3R5EA 2I9UA 1EWEA 3PZ9A 4MLJA 1QI4A 2DT1A 1TSIA 4CCEA 2BHYA 1IEVA 2GZXA 3LDVA 4K8GA 1W3IA 3RLGA 3P67A 1PWMA 1SW0A 2WNZA 3CT7A 3DZ1A 4BQ3A 5H6HA 2A3LA 4F0RA 3TQVA 4Z0JA 3SCTA 2EPOA 3F1QA 2GVGA 2XZ9A 3L7RA 5HQLA 2QCEA 2AL1A 1X7IA 4Y2WA 4AD1A 1BYCA 2R24A 3T07A 3TAOA 4CNSA 4JY8A 1Q8JA 2WCAA 4LH8A 4E4FA 4JXCA 5C71A 4CD5A 2BMBA 1VHCA 3O05A 3SM0A 2BY0A 3ONCA 1VYSX 3OGSA 3BCJA 4NL1A 3DHFA 3N73A 3MP5A 5CGQA 5DF0A 1QNOA 4S3CA 3DHUA 2NLIA 4PBFA 4XX6A 1H2JA 3BSMA 5I24A 3TIMA 4AY7A 2J77A 4OU1A 3OLGA 1IEWA 3W1UA 4IH3A 1IIGA 3NSMA 3DKJA 3UZJA 5K9XA 1T41A 3VDCA 4A3YA 1XLEA 2CU0A 1ELSA 1R5YA 3PBWA 4UXDA 3FA3A 4F66A 4JEJA 3CL7A 2OSWA 4P7RA 2PDPA 2PLCA 3BSHA 3M0XA 3M1ZA 1QR7A 2EXOA 1A80A 2KZHA 2F2HA 1DQWA 1F61A 4M1RA 3TTYA 3GUGA 3GRIA 2FYMA 3P0WA 4WDWA 3WX7A 4NAFB 1UWIA 3TMLA 1Q66A 3AZRA 2DVUA 1NOFA 2WCGA 1K9TA 4C6NA 4BQ4A 3UZYA 2OO6A 3W76A 2X1SA 2Y7DA 3U4FA 5LNWA 2FZMA 4WOQA 3R7MA 1MRQA 2EPKX 3S1VA 1NQKA 3LHVA 1VFSA 2NW0A 1W9BM 1P7TA 3UNDA 3WQPA 3K1DA 4F9JA 2DIEA 1NJJA 1AH3A 2H9AB 1FKWA 5DEZA 1V6VA 2Z2BA 5AYBA 1S1PA 4XAFA 1TX0A 3VNZA 1XPGA 1ICQA 2E77A 3B8UA 4QG9A 1RHCA 4JN7A 1YBQB 1KM5A 4CNOA 4WOZA 3NSXA 1Q6GA 4LVBA 2OQHA 3EWBX 3M16A 4JX4A 3IJIA 2QJMA 4A29A 1W1IE 4FNTA 4X2RA 2E8YA 2P88A 2QCMA 3Q58A 4WD0A 3QHNA 4R33A 2PPGA 2Z1SA 3B8TA 1XBZA 5FAJA 3MBDA 2NQ9A 3HG2A 5TIMA 4AQLA 1T99A 3QMRA 2B7PA 2XGIA 1EHAA 1OYCA 2FPTA 4QGCA