4J40A

Crystal structure of the dual-domain ggdef-eal module of fimx from pseudomonas aeruginosa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
251
structure length
251
Chain Sequence
AAQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 77
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4j40A00
3SY8A 3GG1A 4LYKA 3PJWA 5MKGB 3GFZA 3GFXA 4FOJA 4FOUA 4HU4A 4Y9OA 4ES4A 4Y9MA 4Y8EA 4Y9PA 4Y9NA 3TLQA 3PJXA 4F3HA 5M1TA 3S83A 4HU3A 4J40A 4RNIA 2BASA 4RNHA 5MKGA 2R6OA 3PJUA 4F48A 4RNJA 3U2EA 3KZPA 5MF5A 3PFMA 2W27A 4AG0A 4AFYA 3GFYA 4Q6JA 4KIEA 4LJ3A 4RNFA 3N3TA 3GG0A 4HJFA 3PJTA 3HV8A 4FOKA 3HV9A
chains in the Genus database with same CATH superfamily
1NU5A 3LN3A 3S5YA 3MSYA 3G1VA 5LA0A 4CD6A 5T26A 3ES7A 4GX9A 2VENA 3PG9A 5GJPA 4AZCB 1JCXA 1LBLA 4I7UA 4EANA 3BG3A 3C0JA 4TX8A 1H1NA 4Y2WA 1RD5A 1WZMA 1CIUA 1UG6A 3WLTA 3VX0A 4UTMA 2ZYFA 3OVGA 1NJJA 5C9ZA 4QDMA 4UQ9A 4UQBA 1H11A 3IIPA 4CD5A 3VD7A 2CIPA 1SM9A 4XD6A 1N55A 1CXHA 1TCDA 4V1YA 3T0TA 2G37A 1YE6A 5MHBA 3WLNA 1LG2A 3UQNA 3W71A 3BLFA 3WK0A 1CECA 3CGTA 3PPGA 3BQ6A 1EBHA 3H12A 2J74A 4U2YA 5CGQA 1OIFA 3G3DA 1AD4A 2V5CA 4ZQOA 4M51A 1JYNA 5IHRA 4AISA 4XO6A 3CQHA 2ISSA 5GPRA 3EEZA 1UR9A 3WBEA 4K8EA 2VFEA 3BMWA 1EYEA 4HZMA 4E2VA 3WD3A 2AL1A 3CQJA 3NSMA 4J2MA 2W91A 3BJTA 3WH9A 1WUFA 4G7FA 4U31A 3DBNA 3W7NA 3QR1A 3DKLA 4TMCA 3S6DA 2XIMA 1C8VA 4Q4RA 4A2SA 4H01A 1IEQA 4NZ3A 3PWGA 3L2MA 1JYVA 2UZ9A 3L21A 3ITLA 5BMXA 3QSTA 2PE4A 1KNWA 2YIHA 2CBVA 3GNNA 1XF0A 3DFPA 3H7VA 4I9JA 3VK5A 2RUSA 2NT0A 3W1LA 4AZ7A 4UXDA 4A8LA 5D2TA 4ATWA 3WH8A 1J9YA 1NEYA 4E8DA 3SCPA 3PB2A 4OUIA 3RO8A 1S2CA 2OXNA 4KWUA 1N82A 4NKCA 3PP7A 4JHZA 5H8MA 2VR5A 4NYYA 2Z7KA 2BY1A 3WL0A 1QPRA 2QHAA 1GT8A 5D8ZA 3LGEA 5FL1A 3L4TA 6ENLA 4GVIA 4Q8TA 3WF2A 1DJZA 2BASA 1ICSA 2D2JA 1UR2A 3T42A 4FLOA 4LAOA 2WHJA 1PUDA 4XG1A 5JH1A 2VXNA 3WFAA 1H7OA 2DVTA 3DX5A 2GVYA 5FJUA 5K9DA 4YIWA 3TFXA 4JN8A 5D04C 2KZHA 2Y5EA 3NL3A 4JIPA 1UD6A 4S3DA 1C93A 2OVLA 2X42A 4Q6JA 4LC8A 3TYAA 1VH7A 1JCTA 3IVUA 3P60A 4KWWA 3U5YA 2OOGA 1SJDA 3B97A 2UY4A 1QNVA 2VD9A 1FWDC 1JZ2A 5HQMA 1JG9A 1M03A 3T40A 2A7PA 5CJNA 2E68A 3LCHA 4GRSA 3KTCA 2OGYA 1TPDA 5DFAA 4EPBC 1EDTA 3WLIA 4TMBA 4FNRA 3Q37A 1OQFA 2PFHA 3PBGA 4O52A 4V28A 5BOOA 3AMKA 1LJYA 1ZGDA 1F4AA 1UKQA 2VELA 1IIGA 3T4CA 4NNCA 3SZ8A 4A6GA 2PU1A 3GM8A 4C6EA 4DO5A 1DIDA 2FH6A 1QOQA 5C6MA 2ZWYA 4LB4A 3CQIA 3DG3A 3JZUA 4I5XA 4ROPA 4E3VA 1MUMA 3SECA 4M29A 4PMJA 1HJQA 2PCEA 1XLKA 4RLIA 4E5TA 2TODA 2Y8UA 1CXKA 1ZBKA 4FALA 2HK1A 2Z24A 3VI2A 5BOFA 3WELA 4JHOA 3GS6A 4KW2A 1SFLA 1A5MC 1I2NA 1M01A 1GQJA 3EWZA 1JNDA 2RDUA 3ZR6A 4GIAA 3MPGA 1OGSA 1LT8A 2A6LA 3SI9A 2J75A 2A7NA 1HF6A 3L12A 2AGKA 3FAXA 3L4XA 4MTVA 2NV2A 5A5WA 1FWCC 1OFAA 1E0VA 5LKYA 1TTIA 1RP9A 3M0LA 2BSLA 1GHSA 1EZWA 1OFBA 3MKCA 3QM3A 1GQKA 4I7VA 4QJ5B 3LV6A 1UA7A 3F03K 5C55A 3DG7A 2E9LA 3THUA 3QGVA 3TJXA 4IXHA 3QW4B 1XLBA 2HS6A 3AIBA 2VEMA 1LOQA 2GQ9A 3TJ4A 1SO3A 5CLTA 3LCGA 1LL6A 2R1NA 1ZJIA 4OZOA 4QFUA 4R7JA 1MZHA 4XKYA 3NL6A 2P0OA 3DYOA 2CZVA 2ZZ1A 4PBFA 3EX2A 3HPZA 3CUFA 3HQ1A 4JR5A 5F1VA 3NSXA 3FIGA 3LXCA 4C7GA 1J01A 2PU0A 3QYSA 2GOKA 3WLJA 3W1UA 4AWTA 3W2UA 1UH4A 4XISA 2JIEA 4NASA 3R79A 3EWBX 1FX6A 5RUBA 1DWIM 4M5PA 5AHIA 3TW7A 1VC4A 3ZJ6A 4Z0JA 1KBKA 2PBGA 3ITXA 3EDKA 5FJPA 4ERGA 1DJGA 3W2MA 1X8CA 4IL0A 1D2KA 4JIQA 4RR4A 3S9IA 3CU2A 4G1NA 1YADA 3KRSA 1ITCA 2QMJA 3SCWA 1UIOA 4FEZA 1R8LA 1JXJA 2VVSA 3LI0A 5FSDC 4JZ5A 3SCUA 3N9RA 3BLKA 2IKJA 3URBA 3EKLA 3TA9A 5ECVA 3HMJG 2PDBA 4IP4A 1LWJA 4NAEA 4LS1A 3SN0A 1LBFA 4ZSTA 1O60A 1V6TA 1JJKA 1FHLA 1T99A 5FJOA 2XWEA 2ZX5A 3MYPA 3RJXA 1ZS2A 3L5AA 1K03A 4IMEA 1R9XA 3HQOA 3AIRA 1EHAA 3F5KA 3OTRA 3C0SA 1R9YA 2I7GA 1RSCA 3EX4A 1UWIA 5DMNA 3QQWA 2PDPA 2ZXAA 4F4RA 4DUVA 3AQUA 2YZ5A 3ARQA 3AYRA 4JEJA 3UWQA 4WVXA 4RDYA 3G0UA 1AZ2A 5G4EA 2WWCA 1FHDA 1ZU8A 4HJFA 3SUWA 3WJZA 1EPVA 1TRIA 1C29A 4JTCA 1V93A 3HN3A 4BK9A 3T08A 3S83A 3OG2A 3FEMA 1JDAA 4N9CA 4W8BA 2F7FA 2OMAA 1WAUA 1XIJA 3KCOA 3CHDA 2XYLA 2Q3RA 3EWDA 5CJ5A 1Q6LA 3QYQA 5C70A 1WDQA 2QCDA 1E9ZB 1HKMA 1FTXA 4YTRA 1VEPA 4RE3A 5E9XA 3W26A 3GHRA 1KBBA 4LRTA 1GKPA 4I5RA 3SGUA 1BVWA 1IZJA 2O55A 2YW3A 4AZCA 1EC7A 4DAIA 3WG6A 3KRBA 5I09A 4NNBA 1K8XA 1J0ZA 5C9WA 2V69A 4BJHA 1AK5A 1M3UA 3N34A 4WY0F 4NI3A 4A8NA 1IHIA 1NOFA 3LBCA 2QIIA 3HJEA 3ZLGA 2OEMA 1Q7MA 4IQJA 5JIWA 3QXBA 4HU0A 4IQEA 3C3NA 1RA0A 2ZICA 4JX4A 1XIHA 4NI8A 4HQVA 4R3UA 1Q63A 3BANA 3FYPA 3R4IA 2V3FA 3GHTA 1XP3A 3WLRA 3WMSA 3EX3A 2IXVA 4AD3A 2Z27A 3ARXA 3WD0A 2J7BA 4U10A 4XZNX 1I0DA 3MDWA 1XS2A 3JZEA 1M53A 5BXSA 1W37A 1VGAA 4FXFA 3HPFA 5DMMA 3P62A 3S5OA 4ZFCA 3LQGA 3B40A 5FJIA 4AVNA 4UMCA 4ZO7A 4BQ3A 3NXFA 1ALDA 4MMWA 8TIMA 1RALA 1W9UA 4GO9A 5D32A 1SZGA 1R7AA 1YHTA 3UETA 1G4TA 3L23A 1YDVA 2GVGA 3FDGA 2WQPA 2GSJA 1VP5A 4PSRA 5I3DA 2A79A 4L80A 3BDKA 3G0XA 2GVJA 1HVQA 4F3HA 2DZWA 5AN7A 5I6SA 3FJ4A 3ZZ1A 2VEFA 2CFFA 3V5FA 1TPVA 4AXKA 3VKKA 1SZRA 1QPKA 1ZBWA 4S3KA 3OZYA 4Y9MA 1IEWA 3CUZA 1UWRA 2OT1A 4NF7A 3MHFA 2W79A 3GC5A 5C9UA 5KZMA 4MWAA 4R7OA 4DPQA 3DN5A 4PFHA 4AUBA 4JQAA 1XJBA 2WO5A 3LD5A 4W87A 4UTFA 1G01A 4MLJA 3MT1A 2FTWA 1W3HA 4TVCA 1MQRA 2BB0A 3WLQA 5AYXA 3K13A 4GY1A 4DPPA 1MEWA 3TYDA 3LZ5A 3IGXA 3GRIA 1DKWA 4U28A 2DY3A 4NZCA 3BOXA 3MCNA 2E6AA 1TSIA 3WDPP 1JCNA 3H4GA 1GONA 4FIRA 6XIMA 3TYCA 1XLJA 4Q4MA 5LA1A 4AIEA 1MEHA 4KRZA 3EXTA 4BS0A 4H9VA 4YXGA 3IUDA 2YB1A 2ZTJA 4MWAC 3QKZA 3A64A 3KOFA 1VFHA 1B57A 3USZA 2DUZA 1VJZA 1MWOA 3LCWA 3HF3A 2ZA1A 4GG9A 4IFOA 5CC5A 3OA3A 4QTGA 3UR8A 3I3BA 3P5YA 2WHMA 3CQ0A 3U57A 3L5MA 3U5UA 1ISVA 5F7UA 4JIIX 3O6YX 1A5BA 1Z69A 3DCPA 4KIEA 4MF4A 2CNCA 3NQDA 2WKGA 3VIOA 4E8CA 3OPSA 4RDWA 5KZ6A 4JOMA 4HHMA 4V2XA 4KESA 2NX9A 1AMKA 1J18A 2FGBA 4WJXA 3IK2A 1TZ7A 4LX4A 1GEHA 2BVWA 4DO6A 2PLMA 4OKDA 1WP6A 1WNOA 4IGMA 2I9EA 1FWBC 4QQUA 1EJSC 1XLLA 3UG8A 1E51A 4ICNA 4B15A 4D6JA 2NT1A 2YXXA 4UFIA 3IJ7A 5JUVA 1GUVA 3IGUA 4JAWA 2DIEA 1TPWA 4GVHA 3AXMA 3R8HA 4IH3A 3U8GA 3C8FA 1R5YA 2VGGA 3FDKA 3HM7A 4LYQA 2EF9A 3BOLA 4FLSA 3F2CA 1HGWA 2OX1A 1SO6A 1XLGA 3JU2A 4IUOA 1H09A 4BWLC 4HZ6A 4ZA0A 1CGYA 5T9CE 1UD4A 1ZAHA 1TE6A 3OW1A 1HJUA 4PA8A 3QY7A 4H9ZA 4CNOA 3P0XA 3NQEA 3SCVA 3W3OA 5HJLA 4Z2KA 3SUVA 1PBGA 3A5VA 3POHA 2YA2A 3DFOA 3T4WA 1TWDA 3VABA 4IPIA 3LSBA 3MI2A 3UA3A 1L9WA 3EB2A 5D2XA 1VCVA 2NQ9A 1P1XA 1XLEA 3GC4A 3L0GA 3M0ZA 5AYZA 1E70M 3PNZA 2FZDA 3PNUA 1IXPA 4NJJA 4CKQA 4H6EA 3N19B 3LBOA 1CXIA 1TIMA 2E0PA 1KTBA 3RMJA 3ZFHA 3LDVA 3OGSA 4K7VA 3A12A 2X1TA 2ZX8A 1K8ZA 1UB3A 1A3XA 4AD1A 4HBKA 1EL3A 1OJXA 3VU2A 4GFSA 2Z00A 1UWUA 3INPA 3KBMA 3UY7A 2GDVA 1OX6A 4GYPA 3A24A 1TELA 3KZSA 1J2WA 1LL4A 1MDLA 2PP0A 2QKFA 5FKYA 3TE9A 3AROA 3WDRA 5HPOA 3GKAA 1BWVA 2DSWA 2QJMA 3OJGA 2WC7A 4TOQA 1BF2A 3CV1A 3DC8A 1A5CA 4QSFA 3VIHA 1VBUA 1RLCL 2CEQA 1AJ2A 4JL1A 4PC8A 3UXIA 1D9EA 3CL6A 2ZZ4A 2X05A 4HNUA 1C3FA 1OFDA 3QTPA 1MYRA 1R3QA 3LM7A 2PWDA 1KLYA 1GOQA 3E6EA 5TD4A 3H2MA 1RCXB 3O6DA 3W1QA 1C7SA 1EKOA 4R33A 1UR0A 4LNCA 4HCHA 4L5ZA 4GABA 1W3KA 3KBWA 3W81A 5D4YA 3QR3A 3B9DA 3VX1A 1NP2A 3BAJA 3ZOAA 4QXIA 1Y5VA 1I1XA 4MZ1A 4R5EA 3H70A 5HMFA 4K2SA 1JZ6A 1B5TA 4GYPC 5A2AA 3IWPA 3N13A 5M5DA 2HXTA 2OGJA 3IIXA 1TQXA 4GIEA 3QEZA 2OZ3A 5I3GA 2HSAA 1Q7ZA 1TKKA 4MB1A 1XGZA 3ZJ7A 3E5BA 2VEPA 3BVJA 1F6YA 3GFXA 3A3WA 1UZDA 2TMDA 2FHBA 3PUEA 2GJXB 4HOWA 3WLLA 2F6XA 4BFAA 1DL3A 1ZHAA 4HJWA 1GW1A 4L9XA 4QISA 5HUOA 3H55A 1Q45A 4CD8A 4H6RA 4J3WA 2FVLA 2YLLA 1QCWA 2DT0A 3NGJA 4CD7A 2DT1A 3FV9A 1S2TA 2G4FA 5BRQA 3USBA 4I90A 4YPJA 4IXXA 4F0RA 1OADA 2BS9A 4AZHA 2Z2AA 5EBAA 3OZMA 3SADA 3GG1A 4GISA 2PDFA 3NQFA 1X1ZA 3WUGA 4J3ZA 3QV8A 2W27A 2GGIA 4BA0A 1RD6A 3B0XA 4JPGA 4US6A 4XD5A 5C2XA 4M80A 4UFLA 3P7YA 2YDAA 4N42A 4DLFA 4HHLA 1XI3A 2QULA 3AZRA 2B4GA 4XZMX 3L2IA 2C13A 4R53A 1SO4A 1CPUA 1PX8A 1DQUA 1U22A 2P10A 1XPYA 2CLPA 2I14A 1GJUA 1OY0A 1PDZA 4S1FA 3A21A 3UWZA 5M3WA 3C2VA 5IOBA 3SCSA 1H0IA 1HZYA 1KCLA 2NVCA 3HFYA 4PTDA 2NXIA 1TYGA 3NVDA 3AISA 3BMXA 1P48A 3GYEA 2RGMA 4HSHA 1W6TA 3OA5A 2QDEA 2HXUA 3NOYA 1FKXA 4ZO8A 4E3TA 3MI3A 1UASA 5D38A 4B3ZA 2OT0A 3TWBA 4MPQA 5I0DA 3DC0A 3NZQA 4L1XA 4KQNA 2J88A 1Q6GA 4HHPA 1VHCA 2C7FA 2WBKA 3I3DA 1HGYA 5H91A 3HQNA 1XD1A 4R9OA 1TJ1A 4JTIA 1YXCA 3TXZA 1KM3A 3FVDA 5EPDA 2XVPA 1GKQA 2FB2A 3VD5A 4J3TA 2ZX9A 2KX9A 1IGWA 4UZUA 3N4EA 4TVDA 4C1LA 3ITGA 5IRPA 2PP3A 2PWFA 4GZEA 3ANVA 2HS8A 1DXEA 2I5GA 3SAZA 2G3JA 3BSMA 2FZBA 4YU1A 3CH9A 2UY2A 1UP2A 3PC0A 3MU7A 2PDUA 2QCHA 3LCXA 4H8HA 2XSBA 1XYZA 4F40A 4EF8A 1PXGA 4IPNB 4DIAA 2ONEA 1VR6A 3LSCA 2C19A 3BSGA 2HE5A 5LIKX 2E09A 2ZZ5A 2FMNA 4FXSA 4C5ZA 3GWQA 5BYWA 3HJZA 4UR8A 4GOAA 4CCDA 4LS0A 1U33A 2BXYA 2E8YA 4UQDA 4PCFA 2NXHA 2Z1KA 3A47A 3MMWA 4H4IA 4X60A 1N2VA 3S6OA 1V5XA 3NPUA 4QJ4B 4C6DA 4WXZA 4YTQA 1K9DA 3REQB 2DSZA 3E0IA 1HKWA 4DNMA 4I8YA 4ONVA 4J9JA 1JXKA 3QQ1A 1NDYA 4DI8A 1YTKA 4MZ8A 1S5TA 4XVEA 4RZ6A 4DBSA 4XAPA 5A6MA 1SJBA 1NF0A 3AMCA 1IXNA 2V5JA 1GWJA 5HQEA 2XZ7A 3WF0A 3KM8A 2Z1XA 3GNPA 1NWSA 1S5VA 2E6DA 5K7JA 3IJDA 1OBAA 1LLOA 2CZEA 1LF1A 3W7IA 1CGXA 3S2JA 3IIVA 4ENLA 2C1GA 1H60A 1XD0A 3R13A 3RRXA 4D9PA 3QN3A 3HV9A 4X2RA 1BLIA 1GOKA 2GSHA 3LX9A 3S1XA 1VRDA 1YTDA 4K3ZA 4MOZA 5A94A 3RU6A 2YOCA 4RE4A 3R25A 1HO1A 1NARA 3U2ZA 4IJBA 1KCXA 3WEMA 1LZOA 6A3HA 3AUJA 4IGSA 1FWGC 3ECQA 3QMTA 4QSHA 5CGTA 1XKJA 4H9XA 4HOZA 3WBAA 2VCAA 2WMGA 2V8ZA 3WNPA 4JN6A 5KEZA 2YCKX 3QV6A 2ATMA 2GGGA 3DGRA 4XSMA 4W9TA 1E6QM 1LRTA 3TH6A 3ABOA 1EGMA 1I2PA 4C60A 4HPJA 3BPWA 3SIZA 3ZSSA 3PZUA 2AGTA 3SUUA 4WEVX 4AEFA 5JH2A 5FF2A 3W1NA 3DH7A 2GJRA 3F5JA 2CKRA 3T07A 1LP6A 5A6BD 4LVFA 1HVXA 2ZE0A 1EDQA 1PDYA 3NEVA 1VZWA 2XG9A 1OFQA 4GY7A 5EA9A 1M7JA 4J3XA 5EMMA 5LYRA 4H41A 4WKAA 3VDHA 4IMGA 3CK5A 3P93A 1US0A 3CNYA 1REQB 2GJPA 2TYSA 1TPFA 2EKCA 5FA5A 4KEMA 1YMYA 2INEA 3ARZA 3PBWA 2YDQA 1SVDA 1IR1A 1XH1A 3PFMA 4LANA 1JQXA 1XDJA 3CT7A 3MCMA 4RPQA 2AKZA 4L4PA 2XHYA 3KX6A 1VFMA 2VX7A 3V7PA 2NW0A 1WBHA 4FX7A 4R88A 4O13A 3PJUA 2C3ZA 2G3NA 2PS2A 3GXMA 3EZ4A 2G8ZA 4DXKA 3U0HA 1OX4B 1C91A 3PG8A 4GHRA 4P7NA 3LY0A 2NWRA 1E1FA 2GDQA 4N9DA 1KFBA 1UUQA 1ELSA 2GOUA 4NT0A 1S2VA 2HRWA 1BHGA 1T8XA 1PKMA 1WE5A 3QBUA 2JBMA 4ZE5A 3WQDA 4A3YA 4O1EA 4PUUA 2HPMA 2AQWA 3CWHA 1B3ZA 6ALDA 2ZZ7A 5A6TC 2VX6A 5FOOA 4GQGA 3CO8A 3D3FA 3LS9A 1PKNA 3N14A 4GKLA 3H2OA 3AO0A 4UBPC 2BOEX 4GI9A 1VPQA 3M44A 1P6BA 4K1GA 3BO9A 3GXIA 1V0LA 3KS6A 4G9PA 4H1ZA 3TW6A 1MO0A 1MVYA 4XZHA 3BAIA 3WLPA 1X6NA 2VQUA 1QO5A 1QNPA 3R58A 4O1CA 1PS9A 2PDMA 8XIMA 3V1HA 3RAOA 2VMFA 2Z6IA 2I5QA 3SUSA 3M7SA 1BXCA 4OBTA 5CZ0A 3VNJA 1WO2A 2A2IA 3O05A 4Z2HA 4OVXA 2JKEA 1BFNA 3H21A 3W7GA 5FEZA 3TN5A 4HNTA 2GJXA 1IT8A 4C6QA 1B3VA 2VCBA 5U7SA 2I17A 1ZY9A 3LLXA 5CH9A 1TREA 2CBIA 4KCUA 1VS1A 1MRAA 1BG9A 4C1KA 1H4PA 3FX4A 1VYSX 2R1KA 4GKTA 1HT6A 3FYOA 6TAAA 3D3AA 1RVGA 2NQLA 3Q65A 5CC6A 4XK2A 2QF7A 1OABA 4XVDA 1TWWA 1SYTA 2CZFA 4LCRA 4XQ6A 1K8YA 3L68A 4HK7A 4WSJA 2VR2A 3WD2A 4HTYA 3WLMA 3MBFA 4DUOA 2YL5A 1WUEA 4QEHA 2EG8A 3GAYA 4CEUC 3C86A 1WXYA 3KVLA 4JYFA 3FA5A 5FEWA 2VEGA 3KTSA 5J8LA 3IV8A 3B8SA 4XAZA 1OFOA 3O6AA 1H0GA 2VFGA 4I6KA 2E25A 1VPYA 1FH9A 3UY8A 1F73A 5XINA 2EXOA 2WPBA 4O1BA 4D1JA 3VGHA 1QPQA 5F4XA 3WNKA 4IPJA 2OSXA 3GVQA 4MDOA 4C6CA 4HB7A 3O3RA 5M03A 3CLMA 4EXBA 3I4KA 1E6PA 3MY9A 3WBWA 1T5AA 1WZKA 2OG9A 3WUBA 1FWNA 2WNZA 3AMLA 4C6PA 2QLYA 1EGVA 5LNUA 3VKJA 4LBSA 1SZFA 2VDIA 1K8CA 3D0CA 1IT0A 1F4HA 3T0BA 5D2VA 3SGZA 4GPNA 3SRDA 2PWHA 3TSMA 2VVNA 2WJEA 4OTKA 5G4WA 1ZAIA 2PGWA 3PFRA 4GNKB 4J4KA 3ZO9A 1OC5A 3UJRA 3N4AA 3AS1A 4POCA 4I9MA 3HFTA 2G97A 2Q71A 2Z29A 4FR6A 1ZNNA 4PH6A 1F9CA 2D2GA 3LMYA 2QJHA 2WHLA 1QWKA 3BGAA 3AAMA 3N11A 2PURA 3GX9A 6CGTA 3FVMA 5I00A 1H62A 2JKAA 5I23A 3VE9A 3QMSA 1PX3A 4GINA 1FCUA 3WJWA 2Z1SA 4AMAA 4FSAA 4WD0A 4IICA 4TR9A 1MUWA 4PUDA 4GGBA 1FVPA 3NQAA 2BVYA 4AZBA 1YNYA 1CTNA 3MBDA 3W70A 1R30A 3UWUA 4H7VA 4M1BA 4B90A 2UBPC 1V3KA 3SY5A 1V3JA 4H9MA 4PMRA 1R46A 3WK1A 1EEXA 1ZBVA 4WY0B 3LPGA 3KP1A 4W84A 4AWSA 4OV4A 5C2GA 4MUZA 3V0SA 4QE4A 2GZXA 3P6LA 3VNLA 3TUUA 2XGIA 2YCJA 3GHUA 3PBMA 3THQA 1PPIA 3NZRA 2VC6A 3BCDA 3RM4A 1KV8A 3REQA 4IP7A 2EG6A 5AKQA 2V5BA 2Y6ZA 5AOUA 3A22A 1XX1A 3TQVA 4MJMA 1QRQA 4GE8A 6PTDA 1GVFA 1R3YA 2EPOA 2RDWA 2PWVA 4WGXA 3OIXA 1E6ZA 3R89A 4GO8A 1NOUA 4WK9A 3AXIA 1QASA 4FIQA 1FUYA 4KBXA 3CIXA 2DH3A 3NA8A 3L67A 2A85A 1AQ0A 4HA1A 3GDKA 3CUXA 4Y7EA 1TV8A 4DQWA 2DSKA 1UD5A 3EX1A 2YPIA 4B3KA 3WH7A 4WSHA 4A35A 1WKFA 4WSKA 1XKYA 3CPRA 4LAUA 3TEVA 3H2FA 3MUZ1 1VFLA 1PIFA 3ZR4A 2HWGA 1LWHA 5KZDA 3BAWA 3WMCA 2PDCA 4BI5A 2C1IA 1K7XA 1ZENA 1WDSA 1SR0A 5FIPA 4FOUA 3VZYA 2PLCA 3CV6A 3MUXA 3TNOA 1QW9A 4B5SA 1GQIA 3T81A 5CSRA 1R85A 3A3XA 4H8NA 1KR0A 4MDPA 3UG3A 3OLGA 2YX0A 2C0HA 3MUAA 3Q4DA 1EOKA 4PUWA 2DV0A 7ODCA 2FTPA 4ZOCA 4S3FA 5AB3A 4AQLA 3ZXWA 4QS5A 1QHZA 4ZR8A 4NZFA 3TTQA 2C6QA 4B4HA 2ZRXA 1E40A 1S2AA 1AW2A 4D6IA 3LERA 1O5QA 2NUWA 3Q2DA 5A8QA 3SFKA 1KC7A 1V7YA 4QDPA 4G5DA 4MKVA 1DVJA 1Q65A 5EYWA 2QCCA 3GVWA 2NZLA 1MZRA 1OCJA 1REQA 4P8XA 1EYWA 2PDGA 4XIMA 1E72M 3C52A 4QG6A 4Z2IA 4AWUA 2DJLA 2J9XA 3DXIA 4MUPA 1YXDA 3NZGA 2XIIA 4JKKA 3G2GA 1F07A 2O56A 4O8AA 4C6IA 4C6OA 2G4JA 4YCOA 3FSUA 4W88A 2PCQA 1E9YB 1GOMA 1MFVA 3AZSA 4K8HA 1JUEA 1W54A 2YLAA 4DYJA 1UKPA 5BZAA 3DFNA 4H7ZA 1GZ1A 1GOWA 1OX4A 4M8UA 3PY2A 1ZPTA 2VGFA 1FWRA 1YW1A 1ISZA 1CLKA 1YNQA 3KS5A 3QGAC 3WKZA 4FLQA 4NYUA 2PODA 5D30A 4JGDA 4HN4A 3E2QA 1DJNA 3BG9A 1CEOA 3WD4A 2Z0IA 1KGWA 5I03A 5BXTA 2F2HA 1TRDA 2I1OA 3DYPA 4ADSA 2V2DA 3IS4A 2GVEA 3DYMA 5LNRA 1US3A 1LQ2A 2A1YA 2PDKA 2CKSA 1PTAA 3TC7A 1XIGA 3W1MA 3SY8A 4BHYA 2UY5A 1A0CA 1FCQA 2OLHA 4HYWA 1S5NA 4MNJA 1R3VA 3WLOA 2EG7A 3UVAA 2HZGA 1H41A 3N4FA 1JF6A 3W9ZA 1W1YA 3TWAA 4YTSA 3G8RA 1KFLA 1S46A 2WM1A 5C5YA 3VNZA 2YCLB 4UFMA 3C6CA 1ZJHA 1H7NA 3P8JA 3W7EA 3SM0A 1OYBA 2W5FA 5G1MA 3CWOX 3VCNA 1TIWA 1U5HA 3LYEA 4HN8A 4IG2B 1R3TA 5ABEA 4ATLA 4LUYA 4Z2GA 3N17A 1IWAA 1JIBA 2JEPA 2IQTA 4Z42C 2O4MA 1GHRA 3CQKA 1KXVA 3E2RA 5DXXA 4Q7BA 1J11A 4CU7A 3O1NA 1KWGA 3BGJA 4O50A 2DZXA 2AAAA 1BPLB 1KO0A 1BSIA 5G4HC 2BOGX 2IUZA 4LCQA 4E4PA 1EJUC 1HG3A 4MY1A 4NUWA 5FEXA 4DEFA 1NP0A 1XYCA 1WCGA 1PZ3A 3LXAA 2V63A 5K9CA 3KBJA 4UNLA 3SY1A 2DIJA 3GHSA 2PDNA 4D6CA 4CU8A 4LBUA 2QZRA 4CVWA 1TPUA 4YS1A 3UWVA 1A5AA 4P7OA 5H2ZA 3OIHA 3B06A 1XCXA 3GG0A 1W1IE 4UR7A 1KFKA 4K39A 2EPNA 2V5DA 1VFTA 4V27A 4NZ4A 3DESA 3TDFA 3SUTA 3CEUA 3M1ZA 3M6DA 3HIJA 4US5A 3AYTA 1ZALA 4AIBA 1HJXA 2AMGA 2DZUA 5BWFA 5DX7A 4XUGA 3KE0A 4LB3A 3E74A 5CZKA 3P61A 4RCXA 1CW2A 3LA4A 2NX1A 1QNSA 4PMUA 4URIA 4HP5A 4A3RA 3SRFA 5GJNA 4EIVA 3UGRA 1E15A 1UMLA 4HIBA 1HJVA 4H8UA 4GY0A 1GZGA 4B5WA 2FDMA 3JW7A 4TXEA 3GXNA 4MWAE 5JXQA 3FGCB 3CPGA 3MVTA 1QBBA 3AICA 4AZIA 2FVMA 2PD9A 3LU2A 4G1KA 4GNJA 3W75A 1QNQA 3IUHA 4MFDA 2J7HA 1EJTC 1FCBA 5DANA 3MMUA 1QI4A 3LPPA 4I6VA 5M1TA 2WMKA 3NQ7A 2VO5A 1D7FA 2CC0A 3I4EA 1TA3B 2J6XA 1HXJA 3BARA 3L0NA 4Q4QA 4S3AA 4B5NA 1HUVA 1EIBA 4KEUA 4IT1A 1XINA 2DZAA 2J7EA 2QJNA 3HO8A 2XINA 3B9OA 1FBAA 3EMZA 2W3ZA 3D5HA 3EA2A 3GYCA 4W85A 3WQGA 1JDEA 5I3FA 1WB0A 2WC3A 3JRKA 4H9TA 1Q6OA 5M17A 3LLFA 5GNXA 3RGTA 5REQB 2OOFA 1OM0A 4I9TA 1V51A 1LQ0A 4AVFA 3QFEA 3H7RA 2WZEA 1PO9A 2AKMA 4D6GA 5E6YA 4RK8A 3NPXA 3M46A 4TU1A 4Q7NA 3PJXA 3EOOA 1EOMA 3QLLA 4GH1A 3VIJA 4HPHA 4W8LA 4M56A 1CGUA 1FDZA 1NDVA 4PTNA 1YPIA 3N2BA 1JPKA 2XH4A 5FAJA 4GJIA 1WKDA 4QROA 3WLKX 1RAKA 5I78A 2OSYA 4WY0A 3UXKA 3E96A 2W67A 3UG5A 4KKXA 1YIXA 4ZMGA 3QKEA 4U4MA 5F1UA 3K8LA 4UTWA 2PF0A 1KR1A 3HQPA 3S2MA 3EA1A 2E9BA 4D6FA 4HT3A 3W1PA 1DORA 3IJLA 1F6PA 1UBPC 1BEUA 5E93A 1J2BA 2J7CA 1Q5MA 1PTGA 2PDLA 4W7WA 3LG3A 3VD3A 5E09A 1H7PA 4LOCA 4RXGA 4Y96A 1SUXA 2WVTA 1UJPA 1S5MA 1XBYA 2DP3A 3NO5A 5CBIA 4QAIA 4N7QA 3EDEA 5EBUA 5T9BG 2PBOA 1Q6RA 2JQXA 1M41A 4GXPA 5CQ1A 4GJJA 1YEYA 5DELA 2TSYA 1N8FA 4ADUA 3TCEA 5JVLA 7TAAA 1OIMA 4PODA 3UJEA 2VX5A 1CWYA 1L6SA 4I7WA 1O95A 3L4VA 2C79A 1J6OA 3WQVA 5DY3A 2X0HA 1Y5XA 1K9EA 3C56A 2POZA 4FMVA 3ONCA 1DWGM 3OZPA 1TZ9A 4XV0A 4IMCA 1E0WA 1UQYA 1UH2A 2OX4A 3L5LA 3MS8A 3LUTA 5EKYA 2ZA2A 2VCCA 3GIQA 4QCEA 3U4FA 1D3HA 4JCMA 2OYKA 2PA6A 4R7WA 1WA3A 3WDJA 2O9OA 4DJDA 4IISA 3LQLA 5FL0A 3RO6A 1GZJA 1FWFC 2OJPA 3HU7A 1O4UA 3U3HA 2VZTA 1GVYA 1VD6A 1LG1A 2POTA 1TX2A 2UV8G 2YBTA 2VZUA 2PP1A 3I10A 4C6LA 3G3MA 2ISDA 3GH5A 3MQTA 1JDCA 2OEJA 1SW3A 3DI0A 2CITA 3WLHA 1G4EA 3K8MA 1NM9A 1R3WA 1ISYA 1QHOA 3R12A 5BOEA 4H00A 4HA4A 1FA2A 3VIIA 3S4TA 2PGEA 4G56A 3BTNA 4UTTA 2D0HA 4DF2A 4ATDA 3LHVA 5G2IA 5XIAA 2H9AB 1EO7A 3OB8A 1DE6A 1LQAA 2H3BA 1UOZA 4JIEA 3WDIA 4KFOA 3IRSA 4K7YA 3H2CA 5IDZA 1GYMA 1S1PA 5BW6A 1OWQA 4HNVA 1WDPA 4A05A 5CPLA 5HOSA 3H2EA 5BU9A 3M0HA 1BGGA 1XSJA 1P43A 4Z17A 1GG0A 4KMQA 1JQVA 3R0DA 4CN4A 1CLXA 2YXOA 3A6OA 4MKNA 2QUUA 4IFKA 5E70A 3MP4A 4Y9PA 3CUHA 4Y9NA 2FQIA 2HVNA 3TYEA 3MB9A 3BLOA 1E1CB 3IACA 1W9DM 1FKWA 3G1YA 2TAAA 1WPCA 3TCSA 1GQNA 3F4CA 1QK0A 3OLEA 2XJ7A 4UTTC 1AL8A 3O6CA 2YW4A 4DN1A 4ICMA 2E7FA 2V0TA 3DKJA 1IWBA 3TAKA 1LM1A 1Q7QA 2XISA 3GDLA 3W37A 2VQTA 1MUCA 4UR9A 1RA5A 4PN2A 3NM3A 4HHHA 1FWIC 4ZQMA 2B7NA 3WQ8A 1GCYA 1MW2A 3E2SA 2WK2A 2WSPA 5CCZA 3E0LA 2XSXA 3PBVA 2F38A 8CGTA 4IWWA 3ABSA 4A8RA 4F0SA 3Q45A 1ECQA 1F8IA 2C0AA 2GJLA 1W3IA 1X38A 4X9YA 3SJNA 1XLHA 3VDCA 1OYAA 2YCLA 3AXXA 2VFFA 1AJ0A 2ZVIA 2DU2A 3RPTA 1TCMA 5D02A 2Y2WA 1KM0A 4US5D 3UZYA 5AHFA 3B05A 2CLOA 3MWAA 1VLWA 1R6WA 4Y6GA 3VKAA 2IW0A 4MIMA 4IP5A 4ZEPA 1Z44A 5C54A 2VRQA 4E2DA 1O5XA 3CLWA 3QHOA 4IUGA 4HYRA 4JTSA 3VIGA 1QI0A 1KRCC 1DPMA 5LGZA 2ACUA 4E6MA 1EXBA 1W1TA 3AWOA 2XUCA 1KBJA 1OFPA 2V67A 2XIOA 1A50A 3F2BA 2WBGA 2F6UA 1W8GA 3DFHA 5FCZA 1TWIA 2ZADA 3WNMA 1U1HA 1LBMA 4Y8FA 3VMNA 2B81A 1R7OA 5U4NA 1HKJA 3CBWA 3GVGA 1Q85A 3O0KA 4EXQA 2KAUC 2X40A 3FLUA 3I6RA 3GIYA 4FPSA 2Y88A 4XBKA 5CGMA 2ZXBA 1NQ6A 3GG7A 4M7SA 4Q33A 2R9RA 3LNPA 2VEKA 1KM6A 1R2SA 4PTVA 3C2FA 1TJ0A 3H6OA 3MW7A 5FACA 3RJYA 5I07A 4Z0SA 5AC8A 4N9BA 2DSVA 7TIMA 5FSEC 3KLKA 3ZS4A 2BHUA 1NOWA 3ARUA 4D6EA 3F4DA 1JGIA 1T96A 3RG6A 4WRHA 1V3IA 4O4VA 4JFWA 4G6CA 1X6LA 1F76A 3MHUA 5FF3A 1PYMA 3UR2A 3WL1A 3B8TA 3KVMA 1CB7B 5E0CA 2LLEA 3FY1A 1OCQA 2EBNA 3NQ6A 3TTOA 3TJIA 3B9AA 1E6SM 2Z1BA 1PZ2A 4M1RA 4RJEA 4RKAA 1FFQA 4AMCA 1GOIA 3H4XA 5EMKA 2E77A 1EJRC 4S23A 4BQ2A 4IOTA 5AHLA 2BODX 3WQFA 3K46A 1A80A 4QDWA 3B9NA 2ZZ2A 2DQXA 1I60A 2Z4GA 1J12A 3STGA 1ONEA 1VBRA 4JTRA 3WQWA 3FGCA 1W2PA 2P5NA 4LF2A 3VXGA 1GYLA 3N9KA 1O7AA 4IMAA 3SB0A 3MO7A 2WQDA 3G0SA 3WBYA 1QNRA 1A5NC 1UW9A 1M7PA 3UXAA 2X1IA 1W1B1 1A4LA 4A8IA 4AD0A 3DENA 3TYUA 3R0KA 3QV7A 3ELFA 5A6JA 3EA3A 1TA3A 3N2OA 4CNSA 2WZHA 1HX0A 3UF9A 2W61A 1X96A 4NJIA 3HG5A 3LMZA 3GR8A 4C6JA 1J0JA 3IANA 1G4SA 2CWNA 2VDGA 1P1MA 3H24A 3BXWA 1IEXA 5EMJA 1Q66A 4BEUA 1MNSA 2OU4A 3O2LA 4CNTA 3LEPA 3T2OA 3WBXA 4U33A 4DRSA 4JTHA 3UBPC 3NJ3A 1J8VA 4JBRA 1BXNA 1ZRQA 3B8UA 4NNAA 2DIKA 1W3TA 2JALA 3MJMA 3VOJA 2BXZA 1Z89A 3IJIA 2ZRZA 4OWGA 1EWEA 1LOLA 3DDMA 2ZFAA 4QJ3B 4RXFA 4Z1AA 4RPPA 4GVGA 4LYKA 1MW0A 1ADSA 3RYSA 4WUIA 1E0XA 3GDBA 2QJJA 2J8GA 1O66A 4DELA 3WMLA 2JGQA 2RAGA 4RE0A 4AW7A 3GD6A 3BLDA 1G1YA 3DFYA 4DJDD 1UOKA 3GU9A 3H54A 3W83A 4ALDA 2VURA 3WENA 4LVAA 5C9XA 1EA0A 3VC6A 1Z3NA 1FDYA 3NZPA 3W6YA 1G4PA 1IEIA 3LCFA 3V5CA 3QOKA 4H9YA 2PDWA 2E5BA 1HKIA 2WNQA 1XR2A 2D20A 1JDDA 1A5KC 5FJTA 4IJCA 1C8YA 3EXRA 3RF9A 2D3NA 3N25A 1EP1A 1K7FA 1AODA 3KBVA 3IK4A 3NO1A 3PBYA 4DWDA 3BLPX 1X8FA 1RJPA 1H1ZA 4GZIA 5TIMA 3VDAA 3PK7A 4K6AA 1EF3A 3EOUA 3NWRA 3STPA 4E4UA 2P1FA 4W4QA 3KP0A 4ZOAA 1RP8A 4F9JA 1K02A 2IMRA 4MJ2A 1UKSA 1RJQA 5FF7A 1ZCCA 1L8NA 2ZUMA 3SBFA 1UZ4A 3TVAA 3KRUA 2J62A 3U2OA 3RLGA 1DEDA 3P82A 4EAMA 1RK5A 3S6TA 2ON3A 4QRNA 1ESWA 1MMFA 4P7LA 1SU5A 1UMYA 3K8KA 2V3EA 3PM6A 3VFCA 2YA0A 5AYYA 4QGCA 5J5RA 1UIPA 3N6HA 5DRCA 3UEQA 5H6HA 1ITUA 2NVAA 3WUEA 6REQB 4TVUA 3V5OA 1SR9A 1MXGA 7A3HA 3P3BA 4PMDA 4PB5A 4DY1A 3GZ3A 4AYGA 2D2HA 5DBUA 2QYGA 1I75A 2YSWA 3QFWA 4WIWA 3RCNA 2OWCA 3S1VA 3STCA 4JDBA 1EC9A 1TTPA 2EHHA 3SCOA 4WCJA 3XINA 1E5JA 2WOQA 4PMVA 3EOLA 2PRLA 2PRHA 1NDWA 1R0MA 4GVFA 3ID7A 3ARVA 3F4VA 3W29A 1ISXA 3KBNA 1F61A 2X8RA 2Y7EA 1HP5A 2C16A 4J27A 4LEQA 3M7WA 4FR1A 4JTAA 4DUWA 6TIMA 5CLWA 3A9BA 4W89A 1DTUA 1P0NA 1XISA 1FH8A 2BDQA 3BURA 1XLAA 2E67A 5C7HA 1QU4A 1HL8A 2C14A 1CLVA 4Q6XA 9XIMA 3WYZA 1UWAA 3ARWA 4XZLX 2BY3A 3GB6A 1QMLA 4J35A 3M0XA 1KTCA 1E1CA 3E5PA 3FJLA 1VCFA 3CAVA 2WANA 1GVOA 2J9ZA 2BLEA 3TR9A 2O7SA 2JIWA 3BCJA 3EAUA 5DO8A 2GJNA 3STFA 4BCEA 4HNOA 2QW5A 2B0MA 2ZUUA 3QW3A 3B03A 3BJFA 1B3YA 2GFTA 2CLKA 4ML4A 2FPTA 1DJQA 5D8WA 5AZ0A 1JI1A 4RW5A 4L9ZA 4U5KA 4F0MA 2ZRWA 1VFSA 1V3LA 3NTYA 1TR1A 1OD0A 2DVUA 1VYRA 4YMZA 3JVAA 3W72A 3B9EA 3LBMA 2A5HA 5D9MA 2CXGA 1PB0A 4RDZA 4E0CA 1LWIA 4LT9A 4UTJA 3N2TA 3ZT7A 2UWFA 1G9HA 4PB4A 4MB5A 3VGEA 1K4HA 4UNKA 1C9DA 3MVIA 2P8CA 1PWMA 2BG5A 2ZDRA 3WNOA 2IS7A 5KTLA 1O6IA 4D1IA 1ZJBA 4HNNA 1QHPA 3V4BA 4A3HA 1US2A 1UCWA 3PZ9A 5LIUX 3MSDA 1DBTA 2AAMA 3IARA 3B0YA 2NLIA 1K7EA 4UTHA 1JAEA 3F1QA 3GR7A 3RRAA 1PVNA 3MP3A 2ADAA 4DJFA 3PZQA 1R2TA 1TTQA 1MXDA 4I3GA 2OWXA 1EX5A 1UR3M 2DT3A 5F2IA 5AHNA 2NQHA 3IVSA 4S2BA 4XWUA 1O12A 4LW7A 4PBGA 4PMNA 2P88A 4LS2A 1UP3A 3CL7A 1CNVA 3SR7A 4HTBA 3HGJA 2Y85A 2R91A 3WQOA 5CAKA 1ZB5A 4J3SA 3QPEA 4DM2A 1SGJA 3WMBA 4M6VA 3T9PA 3UR5A 3K4DA 4W5UA 2BP1A 3CHEA 2R82A 3SW6A 1P6CA 5FF0A 4DUXA 4WDTA 1PHQA 1B3XA 1G7VA 2OSWA 1RZMA 3N9SA 1LRQA 1Q6QA 2DQWA 5AZ1A 3IRDA 3WQ4A 1KM2A 4CNPA 1EUAA 3DHPA 3TX9A 1DE5A 4UC5A 2EEXA 4J2PA 3T7VA 2GVLA 4UOJA 4AHOA 1NWTA 4DJFC 1T0OA 2RDTA 2VWTA 3B3DA 4KETA 5DCBA 3RLUA 4JDYA 1V0MA 1YRRA 1H5VA 1BYBA 2QS8A 1DWJM 1BKSA 2ZRVA 1H1YA 2WKJA 5G1YA 1T8QA 3UW6A 4EXAA 2PWUA 3LTSA 3T55A 3P81A 4PMYA 3L4ZA 2E3ZA 3BLIA 4YLWA 3VAVA 5FF4A 1OHLA 2CESA 2PMQA 4PR4A 3S1UA 2E1DA 1S5WA 3TXVA 4N02A 1E4MM 2JF6A 2Y61A 3C61A 2CBUA 1P4CA 1XRFA 3M43A 4GC3A 2Z2BA 3T6CA 1E56A 3VIFA 3UPWA 1R3RA 3TTEA 1W3NA 3NCOA 4B5UA 3ZLHA 1AA1B 2BX7A 3EYPA 1OG6A 2VOTA 2IXUA 4CEXC 1J93A 4PUKA 3VNKA 2Q3OA 3OO2A 2YL6A 3W85A 3W76A 1MW3A 3CIWA 3H8AA 4AC1X 3TK7A 4KFPA 4S3JA 3G1SA 1JGMA 1D8WA 1BG4A 1AH3A 3NDOA 3NM1A 1PWLA 1IGSA 3UERA 4JNZA 2VC7A 1WOBA 1CENA 1LROA 1K77A 1MEIA 1SJCA 1WZAA 1UC4A 3BZJA 3BAXA 3KOXA 2HNEA 1TPB1 1HIZA 1VBHA 4QHRA 2HVOA 3AI0A 1JPMA 5HBFA 4J3UA 4B3LA 2WMFA 4MNMA 4W5ZA 2FJUB 3C8NA 1HJWA 2Z28A 1BYCA 3HPSA 3E0FA 1HTIA 3S5ZA 2P50A 5D05A 2UY3A 3RIKA 3ZQ9A 1XUUA 1FWJC 4OGZA 3TMLA 3TFCA 3AS0A 2XVLA 8A3HA 2E4TA 3HGRA 1B54A 1DJIA 1JYWA 4IMDA 4X2PA 1XFBA 3QZAA 2WMJA 2EQDA 5BNKA 2PPGA 3PSWA 5HMSA 3RNDA 1ZLPA 3C2RA 2X2YA 2J24A 2JK2A 3CO4A 4DNHA 2WPGA 4Z2JA 4K38A 4KRTA 3AIUA 1W1PA 2E1WA 4F2BA 2PDIA 2D0GA 4ZVJA 4AD2A 1UWSA 3WF3A 1TWSA 3FA4A 5CZJA 2ACSA 1W32A 3CXOA 4GUIA 5A1AA 3POCA 3ABXA 3B4YA 4OIFA 1WKEA 4M7TA 3PZGA 3FN9A 1EEPA 5CPMA 1XYAA 4ADTA 3STEA 2FVKA 1L6GA 3IJ8A 3UYCA 4BQ5A 1GEQA 1XG3A 1EZ2A 1EFZA 4Q32A 1J0IA 5I3KA 2QNEA 5D37A 5DRIA 4KCVA 4ZOBA 2QPUA 4UCGA 3R1ZA 2Y8VA 4K8GA 1PAMA 5TBOA 4MYXA 2WXDM 2PI6A 3OVRA 4RE2A 4HCLA 3R43A 5IBXA 3GSMA 3ITTA 2AQVA 1UD8A 1BTCA 4MB3A 1Q6EA 1E6NA 4BZYA 3LRKA 1B2YA 2VR4A 2W0UA 3FAWA 2C8NA 1PZ0A 3GTFA 3WDQA 2XIJA 1U5VA 2JFEX 1V8EA 2VZVA 3V1PA 2A7RA 3GK0A 3OOQA 1TV2A 1FWTA 7XIMA 1ODZA 2XIQA 5HWJA 2I9UA 3AXHA 3R0UA 4C1NB 3GIPA 2QIWA 4RW3A 5I77A 2A3EA 4A3UA 2IKGA 1HP4A 2DPEA 4XAFA 1DHPA 4M6PA 3G1XA 1IZKA 1G69A 2GK1B 3PJTA 4PMQA 4B16A 2ATSA 4JTTA 4AYSA 2NUXA 1KBIA 5F2LA 5CZTA 2Q8LA 2XFFA 1XGEA 5DMYA 4FX8A 3VPLA 3RCYA 1F3TA 3SO7A 4F8XA 1DQWA 2AMXA 3W7PA 3WDHA 3HG2A 4HMDA 4Q8VA 1XW8A 3G1DA 2YL8A 4FNQA 4NVTA 3W82A 4AX7A 7CGTA 1UHVA 3AHTA 1X1OA 1R86A 3HTWA 1MI3A 1GOOA 1J6PA 4RNJA 2WMIB 4M24A 4DJFD 3LHWA 4GMEA 4O15A 4MADA 1W1ZA 2CHOA 3RXZA 4AD4A 4S2CA 3E2VA 2JGYA 3TQKA 2ZIDA 2QPSA 3SQMA 1EJ7L 4EOUA 3NOEA 1XIIA 4RV8A 3H53A 4L9YA 2QCEA 4JN7A 4UMAA 3SCTA 4B2DD 1JUBA 3W1XA 2QGYA 4MZYA 2QF8A 2WSRA 3HG3A 1TV7A 4JS3A 3TSBA 3AJ7A 3U7VA 4ES4A 1JL8A 3J7HA 3G18A 1KTNA 2WLYA 3VGBA 4LAZA 3H22A 3V35A 3CC1A 1V6YA 3I7RA 3TAOA 1BTMA 3LK6A 5AVNA 4C91A 3G6MA 1JRBA 2IKHA 3GLCA 5I3JA 1SSDA 4UTLA 3T2QA 5HR7A 4JYEA 2X7WA 2NSXA 4A2RA 4M0XA 1XYMA 4HD5A 1Q6CA 4MG4A 3CHCA 2E8ZA 4B92A 3PZNA 3O16A 3MMDA 4NXSA 3B8WA 2G3FA 4H2CA 2JEQA 1RLDA 3BK0A 4AD5A 3FHQA 2XSAA 3L4UA 1K6AA 4BY3A 3W74A 4KCWA 4FF5A 4M3PA 2CU0A 3VIMA 1UBSA 2PD5A 5H1WA 4Q22A 4RV3A 3PULA 3W2KA 1JULA 1YNPA 4ZCWA 4ZO9A 4R85A 3OYXA 4QG8A 5IM51 4F66A 1M68A 4C6NA 5DY2A 1UYQA 2NQ5A 5LXXA 5A95A 3L9CA 1XLCA 4P8WA 3CHVA 2D3LA 4AAJA 2QDGA 3LTYA 1B3WA 4DBEA 3U7BA 1XLFA 3BGGA 3N2CA 2J8TA 5L6UA 1CYGA 2VGIA 3M5ZA 3CMJA 4OE7A 4UOZA 1EB3A 4ZQNA 3VDBA 3D47A 2V5KA 5C0QA 1W31A 3LENA 4DVOA 4CQAA 4FAMA 1I45A 4UQEA 3TOPA 3RM8A 3QR0A 1GYNA 1T6MA 5A6AA 3GFZA 4TUFA 2DDXA 2YCEA 1VIZA 1FQ0A 3DFQA 4CQBA 3QOMA 1RJRA 2QPXA 2GPTA 3AIQA 4JFUA 1SZEA 4K37A 5D2WA 1IE7C 2PDYA 2TPSA 2A3LA 1AD1A 1B9ZA 5JIPA 2A3CA 4E2OA 2DW6A 3BCFA 3TV8A 3GXTA 3VKCA 1GVQA 5FEPA 3W7QA 2RJGA 4PUJA 5I24A 3SN1A 4MB4A 3W25A 5D2YA 4LEFA 2FHFA 4JQ2A 1V6UA 2HPIA 1E4LA 4FF7A 4LUTB 1WOAA 3NPVA 1WQ5A 1P5BA 4GD0A 4TX9A 3GH4A 2FJKA 3F4NA 5C2CA 4YTUA 3QF0A 1P0DA 3T44A 2XWDA 4NRRA 3UYIA 4P7RA 3BAYA 2A21A 5HPCA 3PZOA 1X98A 3UWEA 2A3AA 2OZ8A 4JFSA 4MAZA 5CZSA 4ZQRA 3UP8A 3UR7A 1PZ1A 3R94A 4AWEA 1NIUA 2VI0A 1JD7A 4PE8A 1H51A 1HJSA 3E38A 1POKA 4RUBA 2VRJA 1NY1A 3UNTA 4Z08A 1P0BA 4MJ4A 2ZXDA 1B30A 1BGAA 3PTQA 2Y5SA 1JZ4A 1EP2A 2VYOA 4ZB0A 5CBBA 1YE4A 2Q02A 4IQDA 1KFEA 1V6XA 3EDJA 2G3IA 3MUY1 4LAKA 1YX1A 3B04A 4HA3A 4LVDA 5A6BA 3TKFA 4HYVA 4KERA 3BW2A 1FWHC 2BVTA 5A8MA 4F0KA 3N04A 2XVNA 1TMHA 3DG6A 5EMUA 4XAGA 3UJ2A 1XBVA 4QLJA 1SQ7A 1U2YA 3SRHA 3FSTA 1YPFA 4CGTA 5DCDA 5LIYX 4G2DA 4JQ3A 5LSMA 2GUBA 3G1AA 1VBGA 1O1ZA 4G8TA 4LYRA 4JTLA 4LQ1A 1V7AA 4AZGA 4KFNA 1ONRA 3NVTA 1QI5A 1NAL1 3GNRA 2G0WA 1QBAA 1ZL1A 3VINA 3KL3A 3RX2A 3U6WA 3N29A 4S38A 4M6QA 2ZKMX 4LNYA 4NJHA 3IAPA 3KL5A 3B0VC 3A3HA 3PUOA 4QAWA 1SFTA 2WNWA 3N15A 2FZ8A 1ICQA 4FP1A 1IXOA 1P7TB 1J0YA 3W4RA 3CZLA 3KXQA 3CH0A 3LHTA 1EO5A 4C5YA 4A3QA 1UP0A 3S0CA 1AH4A 4XZIA 2Y63A 2HDJA 1QFEA 2E5DA 1W91A 1UR4A 3WH6A 4HU8A 3P74A 2QCGA 3RK8A 4Q4OA 3T05A 4O11A 3TR2A 3NR0A 1XSIA 4ZTXA 3N1AA 4YYCA 4EK7A 4GIYA 2OLSA 3OBEA 4YL2A 3GTNA 1P6WA 5K4ZA 1OFRA 3G77A 4DAFA 4V15A 4ZFMA 3KOYA 1ONXA 7ENLA 4GH3A 4QLLA 1KKOA 3NQMA 4KWOA 3GVVA 3VDGA 1KRAC 3DGBA 4DYKA 1SFSA 3GXFA 3T09A 2J79A 4L4OA 4C1NA 3Q94A 3OLIA 1V02A 3C0LA 1Z48A 2ZRUA 3NXLA 3VM5A 2ODOA 1VFOA 3UFYA 3B8DA 3V16A 2WAGA 3QC3A 2GK1A 4J3VA 1A53A 4YHGA 2ZUNA 4MLRA 3W7HA 3WEZA 1IWPA 1A4MA 3TN3A 5L9FA 4D71A 1ITXA 3LXBA 1ZFJA 1JRCA 5IHSA 5CC3A 1XH2A 4UTKA 1AUSL 2PDHA 4F0HA 3WF4A 4UNIA 2BGSA 2YYTA 4PULA 3TLQA 3UWWA 4QJ1A 4X0VA 4PRRA 4NRSA 1E43A 1V77A 3F4WA 5AHEA 4O16A 3VZZA 4BF5A 3KOZA 1OC7A 3EKGA 2W4XA 3WNNA 1JCLA 2D22A 3JUGA 3WQ6A 2WMIA 3WD1A 3QMRA 4FLRA 4DZHA 3RR4A 2CZDA 4ORMA 1TJPA 4CCEA 2QDDA 3OGRA 4NZ5A 3IVTA 3A13A 2L5HA 3W7MA 4A22A 4AZ5A 3H26A 1Z42A 4TV5A 3LPOA 3N6QA 3GO2A 1XIBA 3SN4A 4Y9AA 4AG0A 3IJ9A 3MYOA 4LGXA 1R87A 3AOFA 4JTQA 2RH9A 1B1YA 2H90A 2WJDA 3BV4A 5CPQA 1FDJA 2CBJA 3MDUA 1LTDA 2V9DA 4AC7C 1YDNA 7PTDA 2XM1A 1Q3NA 3CYJA 4PSPA 5CG7A 3MHGA 1XH0A 3ZMRA 1H50A 5SWUA 3W6MA 1ECEA 1LLZA 1SO5A 1JAKA 5HDRA 2WM0A 3KCLA 2YXGA 3K4WA 3CASA 2D2OA 1R3SA 2J7FA 4MWAB 3QY8A 2WCGA 3QRHA 2HISA 1Z9AA 3SRKA 1C8QA 4WZHA 2FKPA 3ZSTA 1JPHA 4XUYA 4ZTYA 3DERA 3R8GA 2ZE3A 5DLCA 4GA8A 1MDRA 3APYA 2V38A 3KWSA 1MRQA 2XN2A 4AB4A 4LRSA 4GUJA 3HGOA 4GC4A 5HXMA 5BU6A 3NL5A 4AHPA 1W5NA 3WIJA 1SW7A 4O0QA 5I2UA 2J25A 3AHXA 5KETA 4REQB 5D9OA 3W7LA 3RITA 3AHVA 3BH4A 4UFHA 9CGTA 4D8LA 3LHZA 3APTA 1QAPA 3W01A 2H3DA 4AZ6A 4DI9A 3ZLFA 3PWAA 1KFWA 3ZWTA 4AY1A 4PTWA 1O5RA 4K1WA 1J5TA 4ECLA 1XHGA 3L4WA 3CTTA 3HBLA 3XISA 4CQDA 2CXEA 2GQAA 2CHRA 1A3WA 3IJQA 3QTGA 3VOFA 4PUNA 5EY5A 4HMNA 4DZ5A 4KWVA 2DT2A 4FNPA 3NL2A 2P53A 2P0IA 3EWXA 4W8AA 2DH2A 3ZVHB 2Z7GA 2X2GA 5CC7A 5CBJA 1L8PA 4YTTA 3KFTA 2YDSA 1H63A 3T8LA 5JU6A 1NVMA 5AHMA 2FIQA 3L66A 3QGKC 1V6WA 1I0BA 1BXBA 1VHNA 1F8MA 4EAYA 4UFKA 1KM4A 1QOPA 2R1PA 4C6MA 3CEPA 3MP5A 3ABQA 3MUIA 1GTHA 3OBKA 1JZ3A 3MZNA 5CPNA 1XUZA 1KXHA 1AW1A 1DIKA 4DXXA 1DV7A 3RLVA 3EWWA 4LUTA 5ENLA 5A2CA 1SMDA 1OX5A 1S2WA 2V5LA 3WH5A 2OKTA 4X3ZA 5DF0A 3N2MA 2IKIA 2Y7GA 2VP8A 3TJLA 3CAKA 4KPLA 3C0QA 2INFA 5B80A 2V81A 1V03A 4L56A 4NQ1A 3VIKA 3AZTA 3R10A 2V2CA 3S46A 4OBRA 2PDJA 3EEGA 2HROA 3ISIX 1KQZA 3CPUA 2OYLA 3AU6A 4JX6A 3N73A 1CGWA 2D69A 1H7WA 1R2RA 1Q6DA 1ITQA 4LH8A 4CUCA 1FY6A 2EKGA 3I6EA 5KITA 1OVDA 1PCKA 3DOPA 3EOEA 4IPPA 3ENLA 1J10A 3KEHA 5KMYA 3O8AA 1NQKA 1YBQB 1CXLA 1TZZA 1I2RA 5G2HA 2YFOA 1FHVA 5HNTA 5CG0A 5E0KA 4N9EA 1EDGA 2GGJA 8XIAA 3JR2A 2NUYA 1GOXA 4WOZA 2BHYA 2VRKA 1KRBC 2VFIA 1OK6A 3M6YA 1OG0A 2Z26A 3LCIA 3DECA 1BD0A 4X0NA 2FGZA 2VL4A 4OOUA 2DZPA 5HMEA 1JF5A 2HQAA 3EDFA 3QPZA 1PTDA 1W56A 3HURA 3GBEA 3WQEA 1JYXA 5FD0A 1GVSA 3TU9A 1W5PA 3MUCA 4MPKA 5CSUA 4EWJA 1H7XA 4D72A 3AU2A 3S2LA 2DFAA 1JCJA 3THCA 3GC2A 3O63A 3RCMA 4EVZA 1R9ZA 2VHLA 1C90A 4IPLA 2YBUA 3WX7A 4GYKA 4PEKA 2D73A 1XV8A 1HQTA 2HK0A 3I68A 1PCWA 2FHCA 5BRBA 4NZ1A 3WCZA 3VNMA 2OLAA 4PCSA 2WVSA 1TVLA 3PTMA 1ZP4A 3PUDA 1K9TA 2CZ5A 2YGYA 1GNXA 4P8VA 4MFEA 3I7QA 1P7TA 2FGLA 3BV7A 4MSSA 3IV3A 1U83A 5BWAA 2XH0A 3ITVA 4GBUA 4NU7A 4ORIA 2XVKA 3VO0A 1EWDA 3A4WA 3DZ1A 4HA0A 3E49A 1YYAA 2HBVA 1TG7A 3BW3A 1YTEA 4LVGA 3AWNA 4O14A 3IIZA 3VUSA 3A23A 3PAOA 4EKJA 1KFJA 1S2UA 3U2EA 4PMOA 4V1XA 1K9FA 3GFYA 1U30A 1ZCOA 1PL9A 1B31A 2OO6A 4PUEA 3PS7A 3W24A 3FFSA 2Y5JA 3O15A 3GTIA 3GR4A 3TMQA 1QVBA 3CUIA 3GTXA 3TOYA 4Q8QA 1TX0A 3HOJA 4UUIA 2P3EA 3UWYA 2DGAA 2ZBTA 1SPQA 1FWWA 2OO0A 3RDKA 5T91A 8RUCA 1ADOA 4PGLA 3EX6A 3URQA 3TC3A 5ECUA 1VB9A 2BFGA 2QAFA 1UWQA 3GXDA 3I3EA 4YVVA 5A8OA 3W1TA 4IX0A 2DUAA 3AMDA 1ZTVA 2ZC1A 2D24A 4L65A 2V82A 1V3HA 4IM4A 3CWNA 1KW1A 1G0CA 2VT0A 1T40A 4N4QA 2Y1HA 2WMHA 1AQMA 1I9CB 4OECA 1O68A 1OZMA 4JNMA 4ML9A 1M1BA 2GGEA 1J4EA 3DUGA 4E38A 4LVBA 3NAVA 1WYIA 2VM8A 4YNGA 4FB7A 4JHMA 3MO4A 2EPMX 1S38A 1OEPA 1POJA 3GXPA 2IPFA 2C71A 3PR2A 4KEVA 3EGJA 2QCMA 2FLIA 3TTYA 5MF5A 1F2JA 1O94A 1E73M 2J47A 4LJ3A 2GUUA 5C71A 4DHGA 1YDOA 2F6KA 1E4IA 1EF2A 3OP2A 5CPOA 2Z1VA 5KSWA 4BF7A 4Y9OA 3PUGA 3AJXA 4LAMA 3DI1A 4AX6A 4UB9A 1HL9A 1ONWA 4GQBA 3CV2A 2XIBA 4PEEA 1TUXA 3E1F1 1EIXA 3R7MA 3TSDA 4NJKA 4FNSA 4FXJA 2J66A 3U4AA 1B4KA 2GSEA 4E8GA 3S9YA 1WDWA 3MTWA 3EB3A 4YVXA 3R6IA 1QATA 4IIBA 2CPUA 4QE5A 3GU1A 3P80A 2FFCA 4WHBA 3K4AA 1U1JA 2XDFA 2FPVA 4PMZA 4PL2A 3WF1A 1RPKA 1KCKA 1GJPA 1XLMA 2ANUA 1E6XM 2GWNA 3W53A 4LUJA 1AH0A 2A4AA 1RXOB 4YHEA 1XPGA 4QQ3A 2DZVA 5LZLA 1C9WA 4KRUA 4OJYA 2V3DA 3KOWA 3LGDA 3BLLA 1E3ZA 3HB9A 3W7CA 1RHCA 4Q8NA 5I7GA 4GNVA 1D7KA 4IF2A 3HV8A 5GVJA 4XBJA 1JPIA 3MI6A 3VOIA 4NSBA 2QCFA 4REQA 3OVQA 4GQ0A 5ABGA 1W5OA 1DWFM 1SFJA 4WF7A 4H04A 3CM4A 1W5MA 2P76A 4DBDA 3EWUA 4O1FA 4PFMA 3G5EA 3HPXA 3VGFA 4I8DA 3DEQA 3P8IA 5HNUA 1JR1A 1B3OA 2XZ9A 1Q6FA 3BG5A 4PMXA 3LLDA 4QCFA 1XRTA 1GTEA 1NF7A 3EWYA 3E02A 1W8SA 4LTSA 3ZM8A 3ORWA 1XL9A 3W1RA 1VYPX 4OFCA 3AMGA 5A8NA 4IHCA 4H9UA 4Z1YA 2IQ0A 3LGGA 1XIFA 4EE9A 1OD8A 3NQCA 2X30A 4NILA 1YLVA 1QPOA 4FOJA 3FKKA 1HKVA 4LFYA 1BAGA 3I65A 3ZVHA 1E3XA 4BWLA 5HNRA 1KRMA 2ABBA 1JFXA 1UKOA 3VKBA 1E0UA 5J04A 1IEVA 3SFWA 4U5IA 1K3UA 1QW8A 5I3HA 5MKGB 3G1HA 2WSYA 1RCQA 3TTSA 2QDHA 4BQ4A 1R47A 1W9XA 3S5SA 4A21A 3SGGA 2O9TA 1E71M 1B0IA 1ZZMA 2B31A 3AIVA 4ZXOA 3WJXA 1DIEA 4WDUA 3GY1A 3ZIZA 3ARRA 4O28A 1VIWA 3W6LA 2HBXA 3IIOA 3W38A 1UD3A 2BOFX 3A5FA 2BZNA 5LIXX 4DZIA 4C7FA 3TZNA 2YA1A 5DCEA 3T2PA 1GJWA 2CLMA 4LALA 5D9PA 2GWGA 2XM2A 3LHUA 1Q2SA 3LTPA 4GZJA 5D9NA 3PF3A 3LI1A 3HG4A 3RUBL 4FNTA 3GW3A 3TLLA 1DJYA 3AFBA 1YKWA 2I56A 1RQBA 4AFYA 3EWCA 1V0NA 5LNWA 2J13A 5PTDA 2X16A 1NH6A 2H8XA 1TO3A 1VF8A 3UZZA 3B8VA 1XQLA 2Q8ZA 3VM7A 3T1GA 3OQ8A 4IIEA 4LY4A 1RBOB 3KTXA 4GZ7A 4KGLA 1VRXA 5HAOA 3O7UA 3PAJA 2ABAA 3F7JA 1H49A 2PUZA 2W9MA 1YBQA 4D6DA 4FX6M 4M82A 1PIGA 1I4NA 4JD4A 4W7VA 2DJXA 2EGZA 4MNLA 2VC5A 3KAOA 1BVZA 3DHUA 2BHZA 3FHAA 1X7FA 3IUIA 1I2QA 1K70A 2D0FA 4L6DA 5A3HA 3ITYA 3GW0A 3V36A 3CS2A 3G1FA 3KRZA 1Y5WA 4QR6A 4R27A 9RUBA 4OT7A 1EQCA 1NWRA 3VCCA 1JD9A 1QXLA 3SCRA 4YN5A 3CAQA 4KF1A 2E6FA 1VPXA 3PVFA 4N4PA 3S1GA 1A5OC 4FO4A 1IIHA 1RK6A 3B4UA 4UTIA 5KINA 2WSQA 4DWSB 2OQHA 4HKPA 4EP8C 1QUMA 2NQZA 3B8IA 2AOSA 1EJVC 1KKRA 3KHDA 3SSJA 1EBGA 1EHNA 3F2DA 4GI8A 2ALDA 4C6KA 1X97A 2CLHA 1L6WA 3FK4A 1DHKA 3TZFA 1Q4NX 4DX3A 3GG8A 3ERPA 3TP4A 2E5CA 4ACYA 4AIUA 4ZB5A 2FTYA 1UROA 4AXNA 1F5ZA 4H2HA 1EJXC 3ZJ8A 4C7DA 3UD6A 2X1RA 3PWIA 2V3GA 1TV5A 4PCPA 3GTHA 1J79A 2ZOXA 2PLJA 2WB5A 2EO7A 2PTDA 4KS0A 4WJ8A 5G5IA 2XGBA 1CXEA 2F84A 3BLEA 3VCRA 2DUXA 3MKKA 5ABFB 2FPYA 1PV8A 5T8GA 2F8QA 5HK4A 5FI8A 2ZWZA 1GQLA 1FWEC 2WLZA 3A9IA 2W6RA 1L6YA 1KFCA 1AFSA 3MMTA 5ABTA 2YKKA 3ME3A 1EPXA 2HCVA 1EC8A 3IGHX 2XH7A 2OQYA 3GU2A 3S1WA 4XD3A 4H19A 4JY9A 1GW9A 5CAHA 3XIMA 4O19A 3NGFA 4D8AA 3OZOA 2WVUA 3SDOA 3SCQA 1HL2A 2ACRA 4X61A 4NZJA 4WKFA 2I5IA 4LPCA 1TMLA 2G5WA 2E6YA 3AYVA 1KLZA 1Z8AA 3G8EA 4C6BA 2ICSA 4NJGA 4C65A 1AMYA 2WJFA 1W2VA 3K1DA 3MKVA 3QPYA 4WLCA 1X6UA 3MSRA 1PJ9A 3KZPA 4MWAD 1LOSA 2X1UA 1XCFA 4KH2A 3A4XA 5AFDA 1UZ1A 4FHAA 3YPIA 4B9YA 1A5SA 4HZ7A 4L64A 4EPKA 2AQOA 4UQCA 1QTWA 4XSLA 3T8QA 5LHFA 2XU2A 5CXPA 2IPJA 2VC9A 2XTKA 5CKSA 1Q8AA 5AVHA 1FP9A 4PBEA 2E28A 3RILA 1FWAC 1T41A 5JBDA 1XC6A 4Q8OA 4OUEA 3DFSA 3QC0A 3CZ8A 3BUVA 3UXLA 1UR8A 3NYZA 3TNBA 2MNRA 1FFRA 2NLYA 4GK8A 1GPFA 5CJMA 3V18A 1X7IA 1GORA 1RCOB 4EF9A 3FJ6A 1UWTA 4QX4A 2EJ1A 3M4HA 1YDYA 2Q6ZA 4MVAA 2YYUA 1XLDA 3VGGA 4AY7A 1VBJA 4MGGA 3S47A 4WR3A 2HEJA 1E0TA 4O57A 2ACQA 3EBVA 2OYMA 3V75A 1OB0A 3ANUA 2FZNA 3NZ1A 3D6NA 4R9XA 3VILA 5DT7A 5HWMA 3M0VA 3EPMA 1Y8BA 4P8UA 1XBXA 2W62A 2VKZG 4DYEA 2R94A 5F2GA 1VFFA 3E0WA 3WQCA 2WZTA 3Q67A 3WUFA 4FI4A 4IFRA 2NV9A 3VVGA 4N6FA 1KQYA 4JIRA 4ZO6A 5EFFA 3CUGA 4CD4A 3M07A 2FH8A 4HSNA 5LHEA 2P3ZA 2DEPA 2BY0A 1F3XA 2WC4A 3ZYZA 4QNWA 4I9AA 3DHFA 3IAQA 2B7PA 4YVPA 9XIAA 4MKSA 5C8BB 4JTGA 4P7QA 4CN6A 3U48A 1UZHA 1RBAA 4R34A 2XPKA 3W2NA 3IGSA 1OZQA 3ZT5A 1NFBA 3DBPA 2PLKA 1BF6A 2E40A 2VEIA 4F48A 3EPNA 3CZJA 1E9LA 4AEOA 4M19A 1DQXA 2D1ZA 1V08A 1XBZA 1NDZA 3DHDA 1JUKA 4HSOA 4DZAA 1DYSA 3M0MA 1FCVA 3KUMA 4UTWC 1ICPA 2OCZA 5A6KA 1I1WA 3WY1A 2Y0FA 2NSOA 2J6VA 4IIHA 4U2ZA 3KDNA 3KLLA 4J28A 1C8XA 1HNYA 1CI1A 4MM1A 2Z6JA 3BW4A 3ZWSA 4GUHA 4B5TA 1S1RA 4O10A 2JE8A 4FA3A 4TX6A 4PCNA 5LIWX 2ZZ6A 2J8FA 2SFPA 5MKGA 3VE7A 3UCDA 1TB3A 2QXWA 4L4LA 2V68A 4WDWA 4AVOA 2V2HA 2RGLA 3W7JA 1N8IA 1Y7VA 5D03A 2QAPA 4OU1A 2YCIX 1VJIA 3EMCA 4GI4A 2QR6A 2X7VA 4LUIA 3CMFA 3ALGA 3UZWA 1WX0A 3CUJA 1ENUA 3K30A 4S3GA 2ZVRA 4EPDC 1F74A 3T0DA 1H5YA 3ARPA 4ASTA 1PKLA 3PTDA 1WKYA 3W2JA 2PTYA 1KA9F 1RH9A 2O9RA 4XAYA 1W3JA 4CVUA 2E9MA 4V33A 3VOHA 4CN1A 3U2CA 1ME9A 3PBUA 4WDXA 4IIDA 4DJDC 2A0NA 4PB3A 2YB4A 1F05A 2HVMA 4OHQA 3VYLA 2QQ6A 3UZJA 1TV3A 4JQ4A 2HV5A 5A8GA 1J0KA 1JPDX 5AY7A 4NX0A 3D46A 3H2AA 3FYYA 4HK5A 3S3GA 4QS6A 3TYZA 5DMLA 2J77A 5GQBA 1OSEA 3WJYA 4C6FA 1MSSA 2Y24A 3DIPA 5DBTA 1JCMP 2PDQA 2ZUSA 4LUSB 1EUNA 2VJXA 4JFVA 3URNA 1H61A 3CIVA 5JMUA 3QLDA 4J40A 1QJWA 3VGDA 3CV7A 5HANA 5E5CA 1W1VA 5GNZA 1OCBA 3UZXA 3R8RA 3TIMA 3NQVA 5BCAA 4Y8EA 5A2BA 2H6RA 3LZ3A 1BKHA 3P14A 5H8PA 1J0HA 1KGXA 2Q09A 2BXVA 3VTRA 4MY8A 5K3VA 3PSVA 2J7DA 4RX0A 1UR1A 3ES8A 3L2LA 5DN1A 4CCZA 1XDMA 5D33A 1M7XA 4IG2A 3L4YA 1Q2RA 3NG3A 3NDZA 4N0RA 3ANYA 1FXQA 3BSHA 4TIMA 1L6FA 3THDA 4DWSA 2ZZ3A 3O0FA 1XCWA 5JQ9A 2RHGA 3KDOA 1QI2A 2O0TA 4O17A 4YJ5A 3R2GA 3LPFA 3W84A 2C18A 4H7CA 1G67A 4AEEA 2WKLA 3UGVA 4LYPA 5F4SA 1D3GA 2FMOA 5AC4A 2EJAA 4ZB2A 4B4FA 1GPWA 4AY8A 3M0KA 3L7RA 5BRPA 1UPMB 1OYCA 1PE1A 5HATA 1Z6KA 4IQLA 1OFEA 2QMKA 3RX4A 2R24A 3ARSA 4KEZA 3T0AA 2G95A 3DAQA 1KXTA 4BKNA 2YZRA 3GBDA 4AF0B 3OU8A 3FNDA 4FXRA 4P2VA 3C5QA 4GQQA 4MHBA 5ABFA 1D3CA 1XWYA 4LY8A 3RR1A 1NSJA 1ZP3A 4GJ1A 1UD2A 4DWSC 5I5RA 1V6VA 1E4NA 4B5XA 1WZLA 4L7ZA 4RZ5A 2VNCA 4EPEC 4NAFB 5B7ZA 2QJIA 1V02E 2QUNA 4WQ6A 3N2XA 4NY2A 1S3HA 2VGBA 4H8VA 4ZBCA 3O06A 2OFJA 3MV01 5AC6A 4A29A 4JCLA 1K6WA 1HFBA 2INZA 5AC7A 3WFLA 4BF9A 4QIUA 3V0TA 3QZ6A 4TTUA 1IXQA 2BGQA 2YR1A 2ZUVA 4JTKA 4ZZ9A 3VNIA 2B7QA 4Y90A 2I16A 4CNUA 1H7RA 2R1MA 1A49A 1F3WA 1V0KA 3EMQA 2C15A 5XIMA 1N8WA 2HJPA 3R5EA 1XIDA 3W73A 1TVNA 3GDRA 2F61A 4UOQA 3LCLA 3SJ3A 4U3CA 1H2JA 4GCAA 2CWXA 3ONBA 3GNOA 1LT7A 2W66A 2WHKA 4GYJA 2QUMA 2ISWA 2PF8A 1DJXA 1LCOA 1VEOA 5I79A 1QI3A 3VD4A 3ZR5A 2VFHA 1NELA 3AYSA 2MUCA 1BWLA 4WOQA 1WV2A 2QVNA 4NXKA 1WXJA 1R38A 1OT2A 2CCRA 2P8BA 5REQA 4DXVA 2XGZA 4GIRA 4JNYA 1QT1A 1UH3A 4HPGA 1RV8A 2RFGA 4DF1A 2PB1A 5D09A 2IQDA 1JNEA 4B5VA 3JS3A 3V3WA 3SQLA 1NFGA 5HR6A 2ZQ0A 1BRLB 1RQHA 2ZRYA 3CT2A 3IPWA 3GZAA 4ZQCA 4UMBA 3MANA 1W17A 4GWEA 4U3AA 2OB3A 3UA4A 3OLDA 1M5WA 3P2VA 4HNCA 3QY6A 4NIRA 4INFA 3R11A 1QPNA 3PN8A 5TF0A 5JBEA 4MAVA 5DQPA 3OVPA 4AH7A 3LNMA 2YBVA 3GNXA 5E1QA 4M81A 2WVVB 3WO8A 2IPGA 1VFUA 4RL3A 3ALFA 1XQKA 4F9DA 2WWDA 3TN6A 2HNHA 4LV4A 4HK6A 1G6CA 3UU0A 2WJZA 1UC5A 5BMWA 4DBUA 1PX4A 4Z1BA 3UCCA 3FA3A 1KGUA 1KBLA 1XSKA 2PEVA 3M64A 1M04A 1CZ1A 3M9YA 2VTFA 2VUYA 3W07A 4GACA 3PZIA 3KHJA 1EGZA 5FJJA 4NX5A 1FOBA 3ARYA 3BC9A 4JICA 4MJZA 1B90A 5G2WA 2HTMA 5AC5A 5FAGA 3M5XA 4QP0A 1M6JA 3CZGA 1E1EA 1EXPA 3C3UA 3VMPA 3APGA 5HMDA 4TV6A 3KBSA 2PZ0A 1KXQA 3N12A 3RHGA 1A0DA 4O54A 1HN1A 4GLEA 4BEQA 4KCTA 4LSBA 2G41A 1VCGA 2XN1A 4FZIA 1CB2A 3GAKA 1D8CA 1QW7A 1OT1A 3LB0A 5F4WA 1YPXA 3G22A 2BGNE 3NO3A 5DEZA 2BMBA 2PTXA 2NWSA 2FB3A 1JEZA 4GUGA 4QBXA 1ISWA 4B91A 3NQ8A 4K68A 4ICCX 4BR1A 1FRBA 3P67A 1IF2A 3W02A 1IV8A 4Z1DA 4JL2A 1P0KA 2X0SA 4HGXA 2X41A 3NQBA 4DLMA 2RJHA 2X09A 3W88A 1XIEA 1BQGA 5FESA 3FKRA 1XLIA 2PGFA 1V4YA 2FFIA 4Q8WA 2REQB 5IFPA 1EJWC 2VDHA 3B0PA 4DO7A 3IEBA 2PWGA 1W9PA 4JY8A 4ZGYA 3GVRA 4PYSA 2OTDA 4LF1A 1DJWA 3VFLA 1Q8JA 4NL1A 3T78A 4Q3MA 2H9AA 1BWKA 2XH2A 4DBWA 5E9AA 2OPJA 1DJHA 1M9HA 1BQCA 1Z7AA 1DXIA 4CNNA 1DXFA 1GG1A 1LLWA 4UWMA 4JTFA 5K4XA 1ME8A 4W93A 3UCQA 1NFPA 4HCDA 2XFRA 1UKTA 2PC4A 2QUTA 3GUGA 3AHZA 1RUSA 4A4AA 1I6NA 3ICJA 2AL2B 4HVXA 4F79A 1W9VA 2XN0A 4WKHA 3N3MA 4P61A 3WK3A 3N6JA 4O18A 3KWXA 2CHNA 3UNDA 4Q4KA 4RNFA 1GGOA 1U5JA 2F2KA 2QEZA 1IT7A 4AIOA 5HUPA 2F9RA 2Y70A 5EB8A 4DWSD 1W9BM 5TAOA 2BNJA 4YWIA 2ISVA 1TJRA 1ZBCA 4LUSA 4IZGA 4BI7A 5A8PA 1UJQA 3THAA 1OINA 4DM1A 3RX3A 1RR2A 4S3BA 3TONA 1ZJAA 2QCNA 3FEQA 4NP7A 4LBRA 4GXWA 2O9PA 2I57A 5ABHA 1LDCA 3H7UA 3BOFA 3WK2A 3OHIA 2GL5A 3C2EA 3TQPA 3QZEA 5IFTA 2PRMA 2YDRA 3OG3A 1KWKA 2DVXA 3B0UX 3P0WA 2Y89A 1KB3A 2WV8A 1RVKA 1OF8A 1SMAA 5HULA 3URAA 3LRMA 2OELA 4LC6A 2GYIA 4UCFA 3UG4A 1TUFA 4GX8A 5CSSA 4IFKB 4GI6A 5BXPA 4CCCA 3QSRA 3QHMA 3SSZA 3RLHA 5A6LA 1CCWB 4HNLA 1J96A 4XZWA 3VUPA 4LWWA 5E6ZA 4Q7IA 3Q58A 3FW6A 5HWNA 3GDTA 2O7QA 1ZUAX 4KIRA 2Z25A 3OBAA 4L1GA 2Y4SA 5HJYA 1W0MA 2HMCA 1U1UA 2OZ0A 2C91A 3NQ2A 3PTKA 4XTIA 4Q4SA 3M41A 4B2DA 2BTMA 4L6HA 3CZKA 1DWHM 2Z1WA 1M7OA 4YWSA 3W23A 3ZT6A 4CQCA 1XGDA 1XG4A 4DJEA 3WJSA 3WSUA 3P5ZA 3LV5A 4O53A 4L61A 2D23A 3RFAA 4AF0A 4IGNA 3RN6A 4TTGA 2EPLX 2PWEA 5EMLA 1K4GA 3W00A 1GKRA 5EFDA 2YJQA 2ZX6A 2QVHA 4F2TA 5CEWA 1HKKA 4LCSA 2J7GA 4MY9A 3SURA 2WNNA 1IQ8A 4HPNA 4JXCA 3BE7A 4ROQA 3H2NA 2EPKX 3WZ0E 4UIOA 4ZXLA 1LUCB 2B7OA 2R6OA 3M0YA 2A3HA 3QQ0A 4XBSA 4NAFA 4IX2A 1THFD 1TFVA 1B9BA 2A3BA 2VD8A 2DSUA 1TPC1 1XFCA 3HPAA 4QNEA 2JF7A 3HMCA 2ZDSA 4F0LA 4N6EA 2GQ8A 1VENA 3PZMA 4GCXA 2DZSA 5I3IA 3COTA 4JYDA 5C9RA 4MNKA 4ZSUA 1TPH1 4DJEC 2VWSA 1RPXA 2XFYA 1FWSA 3VC5A 1DOSA 1CGTA 2VZSA 4N2YA 4EACA 3PPHA 2Z2UA 3CL8A 3UJFA 3VA8A 1UA3A 3MV11 2X1SA 3N18A 4DB7A 5FJRA 2NXGA 2PZNA 4CU6A 2FDSA 4HU3A 4PTMA 4NHVA 2Y7DA 2VOMA 3GDMA 4K36A 1RY8A 1PIIA 2GQ3A 3AC0A 2R1LA 3E9AA 4D2JA 1J5SA 1WXZA 2OWWA 1TWZA 3OHMB 2Y62A 4JQ1A 1WDDA 3O07A 3BMVA 1QR7A 1K1DA 1KCZA 1Q4WA 3K5XA 3WQPA 3UESA 6XIAA 5EU9A 3SIMA 4J5NA 2QT3A 3SCNA 1FH7A 4EX4A 3LM3A 2A6NA 1AQFA 3CYVA 3TN4A 1ME7A 3UXDA 1BYDA 2MANA 4RZ4A 3ATZA 5AECA 1VEMA 1EX1A 3CZEA 1DTNA 4O1DA 1BRLA 1Y0EA 2OZTA 4PTXA 2W92A 5AYIA 2CLFA 1SSGA 3BJSA 2FYMA 2QJGA 5M2FX 5TNVA 4FS9A 4ACZB 4ZENA 3VKDA 4QE1A 1ADDA 3VIPA 3C4UA 1O1HA 1XYBA 5EMYA 1TJ2A 1WAWA 2WVVA 4G7EB 4FOKA 5K9XA 4XD4A 1GVIA 1KD0A 3LOTA 1T7LA 4D8ZA 4PCTA 4LXFA 5HQLA 7REQB 4Q4PA 4EWND 1MFUA 3W7RA 3NYDA 4QLKA 3PPCA 1AW5A 2YL9A 1AG1O 2BV9A 2BWGA 4GGHA 1XICA 3AS3A 4IMFA 5J5DA 3NURA 1BYAA 2H8ZA 3PZVA 3PPFA 1OGBA 3RU8X 1KM1A 3GQYA 4XKMA 1RY0A 5A6SA 3W7OA 1SJAA 2YFNA 1UUOA 4JFTA 2ALRA 3AS2A 4AHQA 1YQ2A 4Q8MA 1XDLA 3CMGA 2PGRA 1MQQA 2CETA 2EAWA 3FOKA 3BICA 3LRLA 4IGHA 3PB0A 1ZSXA 1TPEA 4ZQPA 5BXRA 4PZVA 4JX5A 4JEQA 1JFHA 4UZSA 2NQJA 1AVAA 1XIMA 5CPSA 1PKYA 1JDFA 3I6TA 3GE7A 1TR9A 1W5QA 1Z32X 2CLEA 4JKMA 3AALA 1LL7A 4H3DA 5I06A 1AL7A 5B7YA 1RQEA 3MSGA 3KVJA 3QJAA 1A0EA 1SW0A 4HU4A 4RZBA 4JTEA 4ERAA 2HE8A 1LORA 3DFTA 1S39A 3KL0A 1B4EA 1O5KA 3OYZA 3GKFA 4O4WA 4S39A 3TC6A 2QCLA 3VMOA 3AHYA 4QEEA 1E9IA 1PYFA 6REQA 3OGVA 2X0YA 2WYSA 3QH2A 3UPBA 2BVDA 3GH7A 3M47A 1ML1A 5AYBA 4CLMA