4J40A

Crystal structure of the dual-domain ggdef-eal module of fimx from pseudomonas aeruginosa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
251
structure length
251
Chain Sequence
AAQRGDVIAILQQALETNSFRLLFQPVISLRGDSHENYEVLLRLLNPQGQEVPPAEFLHAAKEAGLAEKIDRWVILNSIKLLAEHRAKGHQTKLFVHLSSASLQDPGLLPWLGVALKAARLPPESLVFQISEADATSYLKQAKQLTQGLATLHCQAAISQFGCSLNPFNALKHLTVQFIKIDGSFVQDLNQVENQEILKGLIAELHEQQKLSIVPFVESASVLATLWQAGATYIQGYYLQGPSQAMDYDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords FimX
total genus 77
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4j40A00
3HV8A 3SY8A 5MKGA 5MKGB 4Y9PA 4AG0A 5MF5A 3U2EA 4FOUA 3TLQA 4F48A 3GFXA 4RNJA 3PJTA 4HU4A 4J40A 4HJFA 4FOKA 4F3HA 4LJ3A 4Y8EA 5M1TA 4FOJA 4Y9MA 3PJUA 3GG0A 4RNFA 4Q6JA 4RNIA 4Y9OA 3N3TA 4RNHA 2BASA 4KIEA 3PJWA 3PFMA 4HU3A 4AFYA 4ES4A 3KZPA 2R6OA 3GFYA 4Y9NA 3PJXA 3GFZA 3HV9A 3GG1A 4LYKA 3S83A 2W27A
chains in the Genus database with same CATH superfamily
2WSRA 1XCFA 3MDWA 3IJQA 1H0IA 2PRHA 5EBAA 4C6DA 4MIMA 3SN0A 3ARPA 1HL9A 3VGEA 4PFMA 4ENLA 1RJQA 4DJDC 1LQ0A 1E1FA 4AF0A 1O5RA 1RHCA 3O6YX 3QM3A 4UQDA 1T40A 3HG4A 3ENLA 2C14A 3K8LA 4HZ7A 3FHQA 5REQB 1IEWA 3ZR6A 2PCEA 4KEVA 1WAUA 4JQ2A 3LLFA 5KSWA 4M7SA 3M7SA 2Z6IA 3O6CA 1S2WA 3DFHA 3FAXA 4JZ5A 2RFGA 3HQPA 1KRCC 5A8PA 5C2CA 2DVUA 1OT2A 3LPFA 3VI2A 2QCGA 1E9IA 5JUVA 2VUNA 1N8WA 5HANA 3C52A 2ZX9A 1TTIA 1NDYA 5FOOA 1DIDA 2AAMA 3AXMA 3LPPA 4OE7A 4M80A 4BF5A 4QR6A 4TR9A 3CMFA 3BDKA 3L23A 1GVSA 4L4LA 1JCLA 5BRQA 3KBSA 4HN8A 2VYOA 3A64A 5G1TA 4E4FA 5HK4A 1UHVA 2Z7GA 3CU2A 2D22A 1PHQA 1EEPA 3LCHA 1SFLA 3A13A 2IXVA 2Y2WA 4HU4A 4NASA 4UFIA 3IVUA 3VD9A 1EOKA 1VFUA 3SR7A 3EXSA 5FEXA 3GIQA 1TMQA 2PZ0A 3CMGA 1C3FA 1A4MA 4LQ1A 3A21A 4HCLA 1FY6A 1X7FA 1JZ4A 3JZUA 1XLAA 4IP7A 2FPYA 2HVOA 3NCOA 1V08A 3W1UA 3BJSA 3TROA 4I6KA 1E56A 1OG6A 4QQUA 1JGMA 3EMZA 2V0TA 5EGRA 3UESA 1LBMA 3NXLA 3UCCA 1FCUA 4NAFA 2V69A 1KM0A 2PC8A 1AL7A 3TTQA 3RN6A 2I9UA 4LU0A 2F6UA 1FWRA 1DHKA 4DJEA 1TJ2A 3IIVA 1KW1A 2YCLA 1CGXA 1PHWA 3LMZA 3T08A 3GH4A 2JE8A 4F9DA 4LALA 2FLIA 2WW5A 4P61A 2VFEA 4PE8A 1SW7A 3TTYA 5HMFA 2BY1A 2XH2A 2IKIA 2CITA 3LHYA 1ICSA 1UKTA 1E3XA 2VXNA 4YTSA 4LB3A 3TN4A 4LCRA 3RPMA 4C6JA 2XH0A 3BARA 1OFBA 2JKAA 1NWUA 2V3DA 1TIWA 5K9XA 3WJXA 2Z2BA 3GHTA 3G5EA 1FCBA 2R1KA 4GX8A 5FF3A 1KR0A 1SMAA 1IEXA 4Q4SA 1V4YA 3FKKA 4LYKA 3W28A 1CLVA 1ZTVA 4AC1X 1SJAA 3B8VA 3WQGA 4ZZ9A 4NYYA 1SFJA 1SR0A 2HNEA 5AFDA 3O05A 1LCOA 1A5NC 3LN3A 3EWDA 5A95A 3W1NA 4ZGYA 1UWTA 4IQJA 4LUTA 1MZHA 2ZA2A 3I7RA 1CGVA 1VIZA 1KO0A 2DJXA 2W63A 1GEHA 3I3EA 1DHPA 3O0FA 3P80A 3MBFA 5MF5A 4B3LA 4J5NA 2PD5A 3PZTA 3PUDA 1M7OA 3ME3A 3ONCA 3H24A 1IHIA 1VR6A 4ZSTA 4K8EA 1GVFA 4J27A 3E2RA 5DBTA 1R9XA 5BWAA 4GISA 5BU6A 2QUUA 2YIHA 4O14A 4O1CA 4BQ5A 1E6QM 1S5NA 2D69A 1RJRA 3DIPA 1FWAC 4DZIA 4NNAA 5ECUA 1JZ7A 1K7FA 2D0FA 3GNDA 1XYAA 1FWBC 5IHRA 1UYQA 4A3QA 4CEUC 3PBGA 1UR3M 4DJFD 4XBJA 3O63A 2BZNA 4GNKB 3G8RA 5G2WA 3GTXA 1US0A 3MMWA 2CLEA 1XKYA 4FNRA 3RCYA 3B8DA 5LNSA 1D3GA 1Z69A 4DQWA 1FCQA 2D2OA 3UA3A 2GK1B 1IE7C 2CBUA 5T91A 1GEQA 2J7HA 4BHYA 5DRCA 3V1HA 1SSDA 1AD1A 3LHWA 3TN5A 2J75A 1I1WA 1MQRA 2JBMA 1J10A 1GPWA 5G1MA 4X0NA 1QO2A 1XFCA 2WCSA 3NURA 4QJ3B 2XSBA 1QU4A 4D1IA 1F3XA 3WDHA 2PAJA 2ZXQA 2WMGA 5CZSA 2PDXA 3K1GA 4PEEA 1F7BA 4IMEA 2WMIA 4CLMA 4G7FA 4CCZA 1W5PA 3BGAA 2P8CA 3M4HA 3VZXA 3CQ0A 3VKBA 4XBSA 4CCCA 4RE0A 2TRSA 2XIOA 1JAEA 3W7DA 5J04A 1NVMA 2D2JA 3OZOA 5XIAA 1DVJA 3BCDA 5D02A 3OLDA 1DBTA 4WK9A 1QI3A 5BCAA 1XYLA 1JZ3A 4FX7A 3AJXA 2RAGA 2QMJA 1UQZA 2OO6A 1JDAA 3WENA 2PZNA 3V0UA 4GYKA 4W86A 4JTGA 4PUEA 2H8ZA 4XX6A 1O7AA 3MV11 2CEQA 4XKYB 4AMCA 4GQQA 3T2PA 3TLLA 4AB4A 1QPKA 5FI8A 2E9LA 4DNHA 2NX1A 5E5CA 1UASA 4TOQA 4IP5A 2PWEA 4YL2A 4IGHA 1CDGA 3VZYA 2BV9A 5E9AA 2OB3A 4MZ8A 5EB8A 3TYCA 3CL6A 1JZ8A 4R5EA 4PCPA 3L21A 3FDKA 2G3FA 1S5VA 1BVNP 4DELA 1I2RA 4Z2JA 5JMUA 1W1ZA 3I7QA 1LBLA 1VFSA 2A3CA 4JTCA 3TJ4A 2D1ZA 4RXGA 1WO2A 5C9ZA 2J47A 2XWDA 3O8AA 1L8PA 1KA9F 3SCRA 1SMDA 3BMVA 3B0XA 2GQ9A 4GJJA 1UD2A 1I75A 4KCWA 5HPOA 4MOZA 2GGIA 4PUDA 4Q8WA 3RX3A 4LEFA 1DWAM 2X09A 1WXYA 4INFA 1U5VA 4DO4A 4N9BA 1QOXA 1FCVA 1OJXA 5I03A 2YDSA 1HZYA 5TNVA 5G4WA 4P8WA 1R85A 3EOSA 3QZ6A 3WLQA 2CHNA 4O54A 1TPFA 1R2RA 2PDJA 3RLVA 2OG9A 3PR2A 2O9PA 2V2HA 3W3OA 2IS7A 4YHEA 2V38A 4DHGA 5LGZA 4D2JA 1G4EA 4PB4A 2W66A 5EKYA 7XIMA 4IXHA 1PIGA 1YHTA 2C16A 1F4AA 3U9IA 3ZOAA 3CEPA 3LMYA 1AMKA 1XUZA 2CBJA 3FEMA 1KWGA 2BGNE 5CBIA 4NJGA 1P0NA 1BTMA 2VELA 5CSRA 4FLOA 2VZTA 4D9PA 2DFAA 3WJWA 4BI7A 3A47A 5BRPA 5LA1A 1Y7VA 4K8GA 3BAYA 1PTAA 3VGDA 2OX4A 1E6XM 2YYUA 2X1IA 2CHRA 1TCMA 4F48A 1V6WA 1BG9A 3PS7A 3C2VA 3PP7A 1R3QA 3LNPA 4OBRA 1UJQA 4AHOA 1XLEA 4N9CA 1KQYA 2IPFA 1EJSC 2I17A 1HP4A 1UOZA 2ZFAA 4KH2A 6ALDA 1E1CB 4A8IA 2E67A 2G4JA 2QIWA 4HHPA 5F2LA 5HWNA 1CXKA 5I3GA 3N13A 3UG3A 4X0VA 4DB7A 3Q45A 4DWSB 3MW7A 1R2SA 4GGHA 4JPGA 5LIKX 1S1RA 8TIMA 3VD4A 5HXMA 1WBHA 2E1WA 2EEXA 2G0WA 2OEJA 1FDZA 1SGJA 3AIVA 1RSCA 1P0KA 2P88A 4ZTXA 3LRMA 2E77A 5GNZA 1OT1A 2ISSA 2DH3A 3B40A 2WMHA 3PAJA 3ITCA 5AOUA 3GC5A 3S83A 1DXFA 1SQ7A 3WBYA 3BSMA 4KWOA 4KQNA 4E3TA 1US3A 1KLYA 1MXGA 1EKOA 3RILA 4GZJA 2CCRA 1R87A 4HMCA 1ZU8A 4MWAE 4LT9A 4GVFA 3REQB 3QC0A 2VGFA 3MCNA 4B5WA 4K68A 5CG7A 1BGGA 3V36A 3DFYA 3TQVA 3WO8A 2Y63A 3C5QA 3VE7A 4JICA 2DT3A 5TD4A 4JFWA 4C6OA 1E4MM 4JTKA 1SW0A 3N15A 1E43A 3JS3A 5LA2A 3W26A 2C19A 3O16A 1RA0A 4ORMA 2AAAA 1WDDA 3I4EA 4DWSD 1XLGA 4Z2HA 4I9MA 5BRBA 3R1ZA 4J3XA 2EQDA 5K7JA 3CO8A 1MWOA 1QDSA 4FO4A 4GMEA 4A4AA 5A6LA 3GK0A 3SCQA 1W3IA 1PTDA 3CWNA 3HJEA 2XM2A 3W53A 1OBAA 5AHIA 1JI2A 1QCWA 3TN3A 1DTUA 1M65A 4HZMA 3TWAA 4AXNA 5I07A 3P82A 2GGHA 4NKCA 1LT7A 1YE6A 2B81A 3PZIA 1K1DA 2O92A 1E71M 3A4XA 4ZB0A 3BLIA 3BG3A 1ZJHA 3LSCA 4JFVA 3QV8A 4JFSA 5BNKA 1UP2A 1J12A 3AIWA 1LG2A 4S39A 3H7VA 4IIHA 1H5YA 2GJLA 2B4GA 2PDMA 4LX4A 2FGLA 1E0UA 2Y24A 1JIBA 5CSSA 6TIMA 3TA9A 1L6WA 4JTLA 3LXAA 2XIJA 4XIAA 4XD3A 3M46A 3EA3A 4FSAA 4QSHA 3V5CA 1IR1A 2VM8A 2GQAA 5K4ZA 2A21A 1X39A 4H7ZA 3Q94A 5DANA 3W7NA 2GJXA 4NT0A 3NGJA 1K03A 3N34A 3KLLA 4W5UA 4JN6A 5EY5A 3RHGA 2V3EA 1K9DA 3MMUA 3KAOA 1J0YA 4F4RA 3PZGA 1CTNA 1XC4A 3B0UX 3VIFA 2BY3A 2OWCA 1OIMA 1V0LA 1PX3A 3UXDA 1Z7AA 3QFWA 2BVWA 1SZGA 1CXIA 2IQTA 4PUJA 4Y7EA 1XG4A 1GOKA 4ZCWA 4H9UA 1R3WA 2DZBA 5HDRA 1DPMA 2OSYA 3WUBA 1WV2A 1JXJA 4HTYA 1JPHA 2WBKA 3W25A 2WHLA 4DJDA 4HZ8A 2WYSA 3PJUA 1I8JA 2UY3A 3AOFA 1JFHA 3B8WA 3S5YA 4IISA 1DJHA 3NO1A 4UCGA 5I00A 1P6BA 5DF0A 3LM7A 4BWLA 4W87A 3TNOA 1TUFA 3EKLA 4IFKB 4X60A 2ZZ7A 4DXKA 5AC5A 1UZDA 3IUDA 3LPGA 4JIHA 3ZR4A 2O7QA 4JTRA 1EF3A 1M68A 5LIYX 4JIRA 4I7UA 1FWJC 1K70A 4XZIA 4W88A 3BO9A 1Q6DA 4QROA 1E4IA 3WQFA 3E2VA 1QAPA 1WQ5A 1QPRA 2QCDB 2CLMA 1UKOA 3GR7A 4Q4MA 4JQ3A 2QCNA 4X9YA 1BSIA 2OOGA 4WD0A 3S2MA 5CZ0A 5PTDA 3MWCA 3LG3A 1QTWA 5E93A 4LUIA 4E38A 2Y5EA 1JNDA 2YCLB 4AVNA 2QDHA 4EIVA 1Q4WA 4AMAA 2A6LA 1YYAA 3KDOA 1XPGA 3T81A 3RK8A 3NQ8A 4FS9A 5IBXA 5M3WA 3NQGA 1XSJA 1ZS2A 1J5TA 1ZAJA 2E6YA 4GYJA 3THCA 2HK0A 1TFVA 3H55A 4F9JA 5DMMA 4US5A 4WKFA 3W85A 2EXOA 3L2IA 3QV9A 3U3HA 5IFTA 3TAOA 2CBIA 3PUGA 1B90A 4JNZA 2PF8A 1DWFM 2CZ5A 2Y7EA 1H7WA 2PWGA 4BQ4A 4EE9A 1ZCOA 3JW7A 3URAA 3GXIA 2YGYA 4GQ0A 3PZQA 1C9DA 2ZE3A 1DJQA 1GTEA 1UR8A 4GUIA 2J7BA 3OLEA 3VMPA 5AC4A 1A5KC 3N19B 3W88A 2BGQA 4O17A 3W7KA 5E6YA 2AQWA 4XO6A 2VDHA 4JHZA 1OGSA 4D71A 4EXAA 1DWIM 1RY0A 1KM2A 2UV8G 4IZGA 4NJKA 5DX7A 2HISA 4HPNA 1SZNA 3GXNA 3W6LA 1XH1A 2CKSA 1YLVA 1L8NA 4MPQA 3CK5A 4WIWA 4DXXA 4HCHA 4LBUA 5F2IA 2HTMA 4GQGA 4N42A 4OBSA 3W87A 2R8WA 3ECQA 2E1DA 3VNLA 2OTDA 3UETA 2NWRA 1CB2A 1L0PA 1PE1A 3OPSA 3Q37A 1W5MA 1DQUA 4EAYA 4CGTA 3I3BA 5A6JA 3AHTA 1M7PA 3F5JA 5CJNA 3W9ZA 1XRFA 4UUIA 1D7FA 4P7RA 3HV8A 5D03A 1EJVC 2E40A 2DZAA 2DSWA 3S2LA 4MPKA 3B03A 2O9TA 2GVLA 3O7UA 1KBJA 4H9ZA 1OVDA 3GXDA 3L4XA 3M16A 1W1IE 2VEPA 2PP0A 5LZLA 5F4WA 2CLKA 1J0JA 3AMKA 1C92A 3WJZA 4UTJA 4MY1A 3M0YA 3T42A 4JN7A 5FAGA 3VNDA 1DL3A 3W1LA 4G2DA 1FHVA 3L5MA 4EXQA 2WK2A 1S46A 2A7RA 1PKMA 3GUGA 1TCDA 1JZ5A 2WVVB 3A9BA 4C6FA 3U5YA 1W6TA 2H9AA 2FHBA 2FKPA 2VUYA 1JL8A 4JEQA 1OABA 4C6NA 3S1WA 2XUCA 3B9EA 1Q7ZA 3W2KA 4EPKA 1K8XA 1TWIA 2DQWA 7ODCA 3BOLA 4PGLA 1HO4A 1K4HA 2A3BA 4G8TA 2WSQA 2DZPA 2F2KA 2CLHA 4FALA 1JCMP 4XVDA 2TODA 1K6AA 1XQKA 4WY0B 2D20A 4O52A 9CGTA 3JRKA 1C29A 3T8LA 4GINA 1KRBC 3L2MA 1OX4B 1NJJA 3WH5A 3M43A 1YTEA 4H8NA 2V68A 1G69A 1JCNA 1HJSA 1XBXA 3DI0A 1BFNA 4YN5A 2Z1KA 3OJGA 1DJYA 3G1HA 4WEVX 4GFSA 2CU0A 4LAOA 1I0DA 5I24A 4M81A 2DUAA 3HFTA 4CD5A 1YADA 4IM4A 2YXXA 3SCNA 4DWSA 2Q71A 3LLDA 2HRWA 4W7UA 2HJPA 1FXQA 1VPYA 1X1OA 3ZJ8A 3FJ4A 3Q65A 3MMTA 2WM0A 4GYFA 2Y7DA 5F1VA 2BY0A 4EACA 3ZWSA 2H8XA 4GFIA 3WFAA 3W37A 1UWSA 3MCOA 5I5RA 1GNXA 4O10A 3ARRA 3WLRA 3QRHA 3E12A 3UR7A 3VCRA 1UD6A 1FP8A 3WDQA 4Q4PA 5EMKA 3VCNA 5C6MA 3U2ZA 2C71A 2YX0A 3P60A 3C2EA 1E9LA 4US5D 3IJ6A 2DORA 4ML4A 2ON3A 3OGVA 4RX0A 3NZRA 3APTA 4HOXA 5FF0A 1SSGA 4B5VA 4WY0A 3A3HA 3RMJA 2A79A 4G7EA 1Q6QA 4NX5A 4JD4A 3SGZA 4Q8MA 5FSEC 4O16A 4HGXA 3DZ1A 4B9ZA 5D8ZA 3KP0A 4V33A 4Y96A 1KWKA 3KBVA 3DC8A 5LGXA 4OBTA 3BMWA 5DMNA 4Q8OA 2FZMA 4ZQNA 4AHPA 2PRLA 3Q4DA 3VNYA 4L56A 3FSUA 4HK7A 5TQLA 2CNCA 2J79A 1IR2A 2JEQA 4TTGA 1AW2A 3N4FA 1NAL1 2ASHA 4GNJA 4DM1A 2PDKA 5HMSA 1WNOA 4XTDA 4B5NA 2OXNA 3ITLA 4F0SA 3KTXA 2OJPA 3LCXA 1Q2RA 4NJJA 3OQEA 3DG6A 4ZOBA 4E6MA 3V75A 3SFWA 4RE3A 1ODZA 1XPYA 4V1YA 1IF2A 4PODA 5IM51 2CLFA 2C15A 4O4VA 2Q8ZA 4QTGA 4Z1AA 4NJHA 1GOWA 3VIHA 2HNHA 1K9EA 2WMKA 4HU8A 3EA1A 3N2CA 3RPDA 5FEWA 4LCQA 4JGDA 1RPXA 4OZOA 1FA2A 5BU9A 4FHAA 2HQAA 2J9YA 4NVTA 4R7JA 1A49A 3QEZA 3GNNA 1QNSA 4DO5A 3VNKA 3P81A 3STEA 1TWZA 4DPPA 3VXGA 6CGTA 3U5UA 3MC5A 2HBVA 2ZWZA 4FAMA 1JYNA 2Y5JA 3A22A 4OOUA 3EB2A 1F76A 5EBUA 3PZ9A 4DLFA 3EPMA 1WA3A 5I0DA 1ZZMA 1UD5A 1YBQA 2PFHA 1EO7A 2VCBA 1D9EA 3GO2A 4GZEA 3O1NA 3WK2A 4ZQCA 4GYPC 4W93A 5AYZA 4PBEA 4XZ9A 1S5WA 4H9VA 4KFNA 2V8ZA 1TPUA 1UH3A 1YDYA 2REQA 4LAZA 4L6HA 4UMCA 2QGHA 3RU8X 4MNLA 4GZ7A 3IUIA 2B7QA 1E9ZB 4AXKA 2GQ8A 2ABAA 1ICPA 1ZGDA 5HQMA 2YB4A 4A35A 3RMEA 1FDJA 1XLKA 5DEZA 3II1A 4LVAA 3PBYA 2VFDA 3BG9A 3FFSA 1NY1A 1DJGA 3CHCA 3ZM8A 4K36A 1PVNA 3NDYA 2ACUA 4GCXA 1DEDA 3GG7A 4PCSA 3T44A 4BKNA 2X7WA 4CU6A 4IQEA 3CHDA 1Q6GA 3ANYA 2NXIA 2EJAA 5HAOA 3TJIA 2RDXA 1EHAA 3H2FA 3W2MA 3QY6A 4W84A 1X7IA 4GVIA 1JYXA 3AI0A 3DHUA 1BWVA 3FV9A 4Y8FA 5CG0A 1F3EA 2NV2A 3CM4A 3IWPA 2OEKA 3QYQA 4XIMA 5MHBA 4LCSA 3W0KA 5E0KA 3AISA 1VRDA 1KFJA 3CASA 4TMBA 1TQJA 4E2DA 4G9PA 1CXHA 4ZO8A 1G5AA 3MSDA 1PWLA 3OGSA 3CAWA 2ZVRA 2ZZ2A 2BHYA 3BAKA 4QSFA 3GE7A 1L2QA 1XKJA 4OUEA 3M41A 1U2YA 4OECA 4LVGA 3TQKA 4GIYA 1M41A 3STPA 3P61A 3C56A 5CZJA 5HINA 3TFCA 2HCVA 4KPLA 1F05A 1J9YA 1ZL1A 3LENA 3D6NA 1HG3A 1VS1A 4HA1A 2OKTA 4AISA 4OOZA 3WLOA 3A23A 5FL1A 4CD4A 4IOTA 3NDZA 1H2JA 4D6CA 3OLGA 3PTKA 3ZVHA 5JIPA 4CUCA 1GQIA 1OQFA 3BTNA 2PODA 4LC6A 4N9DA 2BVDA 1P0BA 3OZMA 1V7YA 1AVAA 1D2KA 2XYLA 4XO7A 2OZTA 5DLCA 4Z2IA 1ZJAA 1WCGA 2YFNA 2WJFA 3U48A 2BXYA 2PUZA 2Y88A 4ROQA 1EUAA 3AU6A 2OKOA 3MUXA 4LOCA 4NAFB 1DXEA 1KM1A 4E8CA 1K8YA 4HK6A 1KBBA 1X97A 3HURA 2FH8A 2EPMX 2QQ6A 4WDWA 2OT0A 5EPDA 2UY2A 3ES8A 3SAZA 4AD1A 3M7WA 4KWWA 3CUGA 4W5ZA 1A3WA 3TONA 2INFA 3EYPA 4JBRA 4QCFA 3N29A 2HBXA 1EP2A 3DGBA 3M0XA 1VP5A 1NOUA 2D0GA 4Q4RA 4RUBA 3KVKA 5C71A 1F74A 3KTSA 3PZNA 2YLAA 1EXPA 4NF7A 3JVAA 4N6FA 5JXQA 2GVJA 3XINA 1QNOA 4XAZA 1E3ZA 4GQBA 4DBUA 1KBIA 1TTQA 3GH7A 3WQDA 4CKQA 1I45A 4JTTA 3P62A 4L5ZA 1SPQA 4ZTYA 4QIUA 1VRXA 2EPNA 3GKAA 3QKZA 4QJ4B 4AEEA 4GOAA 4DUOA 4R33A 3U2CA 2O56A 1LRQA 4ERIA 1KD0A 4JTSA 4QXIA 1M04A 1DWHM 1WKFA 1FWWA 1JVNA 1P6CA 5FIPA 3FY1A 4Y9OA 3VNJA 1K7EA 5FJJA 4LUTB 3WDRA 1P0DA 5CZKA 5HJXA 2BWGA 1VYSX 5DRIA 5A8OA 3QOKA 2QGYA 3A4JA 5D05A 1IZKA 4PB5A 1B4KA 1HFBA 3O0KA 1VCGA 4AVOA 3LHUA 2XM1A 2WSPA 4K1GA 1VEMA 3UFYA 5K4XA 2HPMA 1V7AA 4XQ6A 1VZWA 1ZJIA 3DUGA 1WDRA 4ICNA 5LNWA 4GUFA 1Q4NX 3SURA 3MZ2A 4K3ZA 1POKA 4TU1A 3SZ8A 1HJUA 4XAFA 1CXLA 3L4ZA 5G5IA 4PMZA 3WNKA 4QGCA 1LF1A 3QPZA 3CQHA 1B4EA 3FKRA 1TO3A 3MU7A 5AYIA 1ESWA 4FLQA 1XFBA 1PDYA 4O1AA 3PK7A 2VFHA 3WJSA 4QHRA 1B3ZA 3ZYZA 2Y62A 4IMDA 5CH9A 1OFQA 1O6IA 2ZDRA 1TVPA 3PWAA 2AGTA 1O5XA 4LF1A 2WWDA 3W07A 3SN4A 2ZC1A 1ISXA 3WELA 5J8LA 3UG4A 1YE4A 4XSMA 3KBNA 4L80A 4KF1A 2GPTA 5D9NA 3JR2A 1DOSA 1G01A 1JPMA 4TQTA 2IXUA 1JGIA 1WDSA 1FWGC 5GJNA 3LV5A 3W1QA 2XH4A 4XZLX 4FX6M 5G4EA 3FIGA 2G97A 4BWLC 3EMCA 1ZP3A 3FA5A 5TIMA 5EFFA 1PL9A 4B4HA 3B9OA 3L4WA 1M3UA 1RH9A 1ZPTA 5BXRA 4NI8A 2DT1A 3KE0A 3UR8A 2AL2B 4AZCA 3S6TA 3GB6A 2OGJA 4MKSA 2QW5A 2VC9A 4UOZA 2QNEA 2I5GA 4P2VA 4AEOA 3K1DA 4E8GA 3B3DA 4FOJA 4DYEA 5HMDA 1NWRA 4WDTA 2WLYA 4GLEA 4HHHA 1V3LA 1QW7A 2P5NA 1RV8A 3WQOA 4A21A 1AFSA 2QCEA 4MUZA 1EL3A 3HFYA 2WQPA 4XWUA 4B16A 1Y0EA 3CT2A 3PTQA 2JIWA 1K3UA 5FSDC 3KCOA 3GQYA 4EANA 5KMYA 2D73A 4AC7C 2GOUA 1FRBA 3BMXA 1Z89A 3AIBA 4O15A 4E0CA 3DI1A 1OY0A 3E96A 2Z4GA 5HNTA 2CESA 3T1GA 3LBMA 3AUOA 1PTGA 2ZX5A 2E4TA 3BSGA 5C2GA 4R9OA 2X0HA 2EPLX 3MP3A 3QMRA 4AD2A 1A5AA 4O1BA 3GZAA 5I3JA 4O53A 4A22A 3FJLA 1D8CA 3EOOA 3IRSA 4KCVA 1LRTA 2PTYA 3G8EA 1OX4A 3SUUA 2DH2A 1OSEA 5G4HC 4RLIA 1WBJA 4A3RA 3EBVA 3TVAA 3XISA 1XQLA 2DJLA 2YL5A 3NO3A 5K2ZA 3M1ZA 4XAGA 2ZX7A 3M0LA 3SCTA 3ZSTA 1W1YA 3SQLA 3UG8A 3AC0A 4UNKA 2XVPA 4KIEA 4PTXA 1FWDC 1EEXA 5M03A 1GQNA 3MDUA 1CPUA 2VWTA 1KFKA 3EX1A 3KHDA 3BPWA 3KVLA 2EJ1A 2ODOA 2W91A 3DXIA 3S47A 4AIUA 2IKGA 1QUMA 3CQJA 2W0UA 4I7VA 5HPCA 2PDIA 4RZ6A 3CAKA 4FNQA 4ZA0A 2YBUA 3MP4A 3LLXA 3AMLA 3E9AA 2GSEA 3P8JA 3CV6A 3TTOA 1JZ2A 5U7SA 5T26A 4IP4A 1TZ7A 3T4WA 4YTUA 1QNVA 1FP9A 3BV7A 4EWND 5B7YA 1S2UA 2Q8LA 4O28A 3NSMA 3NPWA 4X61A 4HT3A 5C55A 4C1KA 1BLIA 4UQAA 1OFRA 1ZNNA 1VGAA 4AY7A 4H19A 2NQJA 4J3TA 3EEZA 1QPQA 5DCBA 5D33A 1G7UA 4MJMA 2YYTA 3H7RA 1S5TA 3QPYA 1OB0A 3AUJA 2VTFA 5BW6A 4NSBA 4ZR8A 2I5IA 4U4MA 3TMLA 1ZUAX 3UBPC 1VJZA 2WLZA 1ADDA 2H6RA 1PSCA 3UZXA 3RCNA 2WJZA 4XVEA 3ARYA 5AYXA 4CN4A 4WUIA 1EBHA 3ABOA 1WZAA 3GBEA 3QMSA 1KR1A 4P5UA 4QNEA 1ME9A 4JY9A 1R0MA 4WR3A 3S46A 1OCJA 3DG7A 1AZ2A 4ZE5A 3CZ8A 3LRLA 2NX9A 1SUXA 1HVQA 3CTTA 3F5LA 4IIGA 4N4QA 3CUXA 3F4DA 2CW6A 1BYBA 3GC2A 4FIQA 3WMBA 4GUGA 1E9YB 3GRIA 3PUEA 4HSOA 1R3RA 4MNMA 3AYRA 4MZ1A 3QKEA 3QMTA 1Q6OA 1ZQ5A 1XLHA 4WGXA 2C7FA 3NWRA 2Y85A 3UGRA 1YX1A 4ATWA 5CGTA 3HPAA 5AVNA 2X1TA 3TKFA 2VC6A 2ZTJA 1EUNA 1V6UA 4U3CA 4ZE4A 2WNWA 3EXRA 4JFTA 4BQ2A 2EF9A 3LERA 4IICA 4UNIA 4DWDA 3KTCA 1J01A 3POHA 3OB8A 2OGYA 3IIPA 1W2PA 4H8HA 3MP5A 1T41A 4CVUA 1XGEA 3NZQA 1HIZA 2V5LA 5H8MA 3NQMA 2FHFA 4KWSA 1BKHA 4RCXA 4Z1BA 3H21A 1RCOB 1BF6A 4M56A 2QEZA 4R34A 1KKOA 4KT2A 2QYGA 5LIUX 1UIPA 3TR2A 4BA0A 1A47A 1G0CA 4H4IA 4HNLA 1W9XA 2P76A 1Q7QA 3V18A 3R12A 4Q8UA 2OLAA 3FJNA 1E0VA 4GXWA 1UCWA 3KOFA 2C1GA 1XYFA 4UFJA 3TDFA 3RLUA 4Z2KA 3MUIA 5C54A 4M82A 1QO5A 3LRKA 3WF3A 3IVSA 3FSTA 3UF9A 4RV3A 2GYIA 1ME8A 3LQLA 3PY2A 3IARA 2YL8A 1HO1A 3TYEA 2O7SA 4Y9AA 3GU2A 3FYOA 3TWBA 1U22A 3OVPA 3A24A 3AS0A 1LG1A 1EDQA 4CQBA 1XWYA 2Z1BA 3F2DA 4GGBA 1NELA 1WB0A 3QF0A 1ME7A 4RL3A 1NWTA 5E6ZA 1X6NA 2VNCA 4J3VA 1BYCA 2CC0A 3O3RA 3S3GA 1YDOA 5M5DA 3W27A 2VX4A 2WZMA 5A3HA 4NJIA 1N2VA 1NF0A 5CBJA 2JGQA 1K9TA 3B8IA 1LLOA 3QC3A 1E1EA 3CC1A 3BLFA 3EX2A 1AJ0A 1XYCA 4C6BA 2WNNA 3ITTA 3E0VA 2AL1A 2PTZA 3R13A 2QPUA 1W5QA 2V5JA 2ZUUA 3E49A 3MUZ1 3HQOA 1TMHA 3A4WA 2XGBA 3EXTA 3KL3A 4PL2A 4J2PA 3QW3A 3MS8A 5H2ZA 1BQGA 2VFIA 3OW1A 3NQFA 2FFIA 3ARQA 4O8RA 1UR9A 5AVHA 1EPXA 3L5AA 1XICA 3KUMA 4Q7IA 1TJ1A 1U5HA 4F79A 3MUCA 2NSOA 1V02E 3L4TA 1T0OA 3GNXA 4QCEA 3GFZA 3PB2A 1A3XA 1K8ZA 4MDOA 2CZDA 2VZSA 4P7QA 3W74A 4K39A 1W9VA 1TMLA 2XZ7A 3O6DA 2VD9A 3ID7A 3QH2A 3R43A 4MJ4A 3P5ZA 1FWFC 3N2MA 4I8YA 1TV7A 1GCYA 1F3TA 2XN1A 1MW2A 3VO0A 2ZE0A 2DZUA 4AD0A 3PNUA 3KXQA 3LX9A 3VE9A 2XVLA 2DZXA 9XIAA 3LNMA 2WC3A 3MUY1 1R7OA 4XK2A 1F5ZA 3QOMA 2FYMA 2ZCGA 5GJPA 2MUCA 3NQAA 4PMDA 3LCFA 3C2YA 2VX6A 1CYGA 4H9TA 4XAPA 3HM7A 1BWKA 3NQ2A 3G1SA 3WNNA 1B57A 3QPEA 3DU0A 2X1RA 3OP2A 1EA9C 7ENLA 4FNPA 2C0AA 5AYBA 2WXDM 1VAHA 3OYZA 2Y5SA 4DI9A 3I6TA 5HQLA 1W8SA 4D6DA 2ZXAA 4PTDA 3THUA 3UWYA 3GH5A 4OTKA 3SGGA 2BOEX 4KEMA 3QHMA 4YTRA 4GBDA 1XIBA 3IK2A 4PRTA 2E5DA 2KZHA 3G6LA 3ZLHA 1AH4A 2P8BA 4BR1A 1U33A 1VYPX 3WEMA 3BVJA 3TLQA 4DAFA 2GDUA 3G2GA 1RJPA 3AXKA 4JOMA 2Z2AA 3SO7A 2IQ0A 1EYWA 2Z2UA 1HJWA 3R8HA 4Y90A 1E5JA 4C6PA 3UXLA 1F6YA 1PZ3A 5MKGA 3MT1A 2J9ZA 2WSKA 1PKNA 3KOZA 4HJFA 4HNTA 1VH7A 1B3OA 4ML9A 4LVFA 1T99A 2X41A 1PCWA 3H2NA 4DUVA 2J7EA 4C6LA 1A0EA 5A6BA 4C90A 3A5FA 3HGOA 2IPGA 3APYA 4W8AA 1I6NA 2VZVA 4IQLA 4I5UA 3NTYA 1TE1A 4J3UA 2QCLA 4FMVA 2ZZ4A 5BXSA 1XSIA 2EGZA 2Z28A 1FWEC 3LGGA 5A8NA 4S3GA 1X98A 5J5DA 1EA0A 4BCEA 4LAKA 4FX8A 5HJLA 1PBGA 1T6MA 3N2XA 2F6KA 4RW3A 1L6SA 3G1AA 2DUXA 3WQ4A 4DBDA 2J8FA 4ZB5A 4XKYA 3WLTA 2ZBTA 1XRSA 4FR6A 4C91A 4ONVA 3UZ5A 1U83A 3GIYA 1CEOA 3LD5A 1XIEA 1POJA 2CIPA 3VOFA 2VEMA 4FXJA 4Q8PA 2BB0A 5CZTA 3MJYA 3RR4A 3U2OA 4XZBA 1H41A 1XINA 4JKMA 1GVIA 1PZ0A 1MNZA 3GW3A 1S39A 1SZEA 1XF0A 2GGGA 5JBDA 1WUEA 3WQ5A 1XXXA 3LBCA 5AN7A 1MI3A 4AX7A 3TUUA 4KEUA 1JYWA 1MQPA 3PUOA 4A6GA 3IVTA 3BLEA 4JTFA 1L9WA 3WNOA 3MCMA 4Q4OA 4GK8A 2JGYA 4HK5A 3W01A 3W6MA 1VEPA 4QLKA 3GXFA 2ZKMX 3WDIA 2ZUMA 4PMRA 1HW6A 5KZDA 1TV8A 3LCIA 3GDLA 1THFD 4F2TA 3K8MA 4ADUA 3DYMA 1TJ0A 2E3ZA 2GFTA 2YCKX 4MGGA 4QNWA 2X8RA 3PTMA 2HV5A 1ZY9A 1TYGA 3RO6A 1RCXB 3MHFA 4WJXA 2ZRXA 4HZ6A 1OZMA 3EDEA 3VZZA 1TV3A 1VENA 4U10A 1ZAIA 3TCSA 2AGKA 2DZTA 2H90A 1K8CA 3UXIA 5BROA 3HV9A 1EWEA 3PWGA 4H2HA 3LEPA 4HIBA 1UR4A 2EG8A 3WQPA 1BXBA 2IPJA 2IQDA 2PBOA 4OHQA 4RW5A 4LBRA 1ONRA 1WOAA 5JQ9A 4O1EA 2E7FA 2VQTA 4O50A 1BQCA 3DGRA 3L0KA 3CUIA 2DZVA 4O4WA 2NV9A 4QG9A 1VIWA 4ZOCA 1OD8A 1GPFA 4IL2A 3N3MA 3B9NA 4BI6A 1ICQA 2GLKA 1JEZA 2HS8A 1B9BA 2VR2A 3BOFA 3PC0A 1HJXA 4QLJA 4AH7A 3TXVA 3BE7A 3LCWA 1KXQA 3S5SA 4WF7A 1KCLA 2X0YA 2PLKA 5C0QA 4FF7A 2Y1HA 2NQ9A 1MFUA 5JH2A 1AQFA 1LOLA 4O8AA 3BL3A 1H0GA 3LI1A 4GY0A 4BI5A 1P7TB 3EDJA 4FB7A 2VWSA 1DP0A 3S2JA 2YKKA 3POCA 1JULA 3TP4A 1PJ9A 3BLLA 4NY2A 1EP1A 3TEVA 1ZBVA 1BD0A 3ZWTA 5HWJA 2NUXA 3UR5A 3W7HA 2HVMA 4JKLA 3DH7A 4R53A 1NFGA 2G50A 3VIGA 5HBFA 4TVCA 6TAAA 1Q63A 1SFTA 1XV8A 4H6EA 2J13A 2V2CA 1A50A 4K7YA 1PYMA 4WJEA 2VI0A 1HGYA 3UZWA 4BF9A 1PYFA 1HX0A 3QQ0A 3D46A 1FWNA 5I2UA 2CFFA 1ADSA 1QATA 2NVAA 2Y8UA 4AAJA 2YL9A 2XPKA 1J0ZA 1Z6KA 4O0ZA 3VX0A 2HE5A 4QDPA 3WBWA 4GNVA 1JAKA 3K13A 4LF2A 1YW1A 2WCGA 1LUCA 3PBVA 2J77A 1E73M 2CLOA 4L9ZA 3ZLGA 3G1RA 1FFQA 2ZRYA 3LTSA 4XB3A 5CGQA 4LY8A 3QV7A 3AZRA 3NEHA 1SFSA 3DBNA 1V51A 1W32A 2NUYA 2PBGA 2V30A 3G6MA 4FLSA 1TA3B 3ABSA 2FGBA 3VIOA 1W0MA 3KEHA 4J1OA 2VL4A 5TAOA 4I5RA 1C8QA 3DFSA 3NVTA 1UKQA 1G1YA 1DWJM 5CGMA 3PHAA 3W7QA 3N4EA 3CHVA 4XZMX 2C91A 5FJUA 4LJ3A 2QR6A 4IX2A 3SW6A 3KL5A 5CLWA 3NFUA 5HNNA 2X42A 4W85A 4LUYA 3MANA 1DV7A 3U4AA 1MMFA 2DVXA 3FCPA 3D0CA 1HL8A 1TJPA 1GKRA 2BDQA 1E0XA 1QHPA 5E09A 4NNBA 1PKLA 1W9DM 2VR5A 1XJBA 2FMOA 1LQ2A 4UNLA 2XN2A 1VCVA 3UXAA 2TYSA 2QDGA 6XIMA 4F0KA 5CC7A 4AWUA 1DJWA 3IJ7A 1GOMA 4YVPA 3WH9A 2OR2A 1DIKA 4HN4A 4LFYA 3W7GA 1RQBA 3VINA 3N18A 3UWQA 4JDBA 4ZBCA 3R8RA 2TSYA 2F61A 3W38A 1KFLA 1LUCB 4X3ZA 4YCPA 3FOKA 3HO8A 3A6OA 3PFRA 1W1PA 5DELA 4JHOA 3R6IA 1BF2A 2YDQA 2QJIA 5LNVA 3R10A 2G3JA 1OADA 2EO7A 3WK3A 4MYAA 1XYZA 2GSJA 4FNSA 1ECQA 2QXWA 4W7VA 3OG2A 2D3LA 3ZMRA 1WPCA 2VT0A 4X2RA 3AYTA 2YB1A 2ANUA 1ITUA 4EWJA 3MYPA 3AYVA 2OPJA 3CMJA 1Y5VA 3CZJA 4MVAA 1UMYA 3VIIA 3N9RA 3LA4A 3ARVA 3HMCA 3V16A 3A9IA 3VYLA 4LSBA 3CUFA 1A5LC 4HA4A 3VVGA 1TVNA 3OLIA 4C5ZA 3LHTA 1DJIA 3UEQA 4U5IA 2DIKA 3J7HA 3DESA 4JYEA 2GUBA 3EOLA 2WHMA 4UFKA 3FGCB 5I3DA 3NXFA 3SSZA 1TG7A 4ZB2A 3AO0A 3GHSA 2P10A 1JJKA 4YS1A 3C2FA 2FVKA 3BWWA 3WH7A 3U8GA 4J2MA 4XD6A 3C4UA 3BW3A 5F1UA 3KM8A 3VIMA 3CWHA 3CO4A 3LCGA 5CC3A 2RDWA 3DYPA 3RUBL 1FH9A 2FTYA 2Z25A 3ZT7A 3S5ZA 4AF0B 3VOJA 5BXPA 2EG7A 4Z1CA 4ZQOA 5DMYA 2W67A 4GPNA 4IQDA 4XG1A 3G1XA 4XD4A 2OCZA 2QCDA 4JCLA 4CQCA 4QJ1A 3BAWA 4H04A 4ZO6A 1TX0A 4JTUA 2F6XA 4QP0A 2NQLA 2QDEA 4M19A 1TUXA 1S3TC 3L4VA 1HL2A 2ZQ0A 1V93A 1B31A 1Q65A 4JDYA 1Q45A 3ICJA 3AMCA 3T0CA 4N2YA 4P8UA 4AY1A 2HEJA 3AROA 1GVYA 1MFVA 4B5UA 4TV6A 2FFCA 1QI2A 1HN1A 2PE4A 3V5FA 3OEXA 5AZ0A 3WUFA 1FUYA 4IIFA 2WPBA 3UWZA 1Q3NA 3H6OA 2V67A 3BLKA 4FPSA 1R2TA 4F3HA 1FXPA 2E5BA 1GVRA 2B7PA 4JIPA 2X1UA 1Q6LA 3U57A 4DZ5A 3MI2A 4Y9NA 3MA8A 4YYCA 4CN6A 2CBVA 2J8GA 3L66A 3BH4A 1EWDA 1F2JA 4V28A 1SM9A 4C6IA 1QBAA 4LNCA 3H4XA 4I9JA 5LNUA 2YBVA 4N4PA 3WEOA 5JBEA 3DEQA 1TVLA 4JNMA 4QEHA 4KETA 1LRNA 3QSTA 3K46A 3HGJA 2FH6A 4MJ2A 4YIWA 4C1NB 1V77A 3HPXA 3QXBA 3VNZA 1XX1A 4C1LA 2UZ9A 2D3NA 1ZBCA 4CU8A 2FB2A 1QR7A 4WVXA 4AW7A 4HYVA 1EQPA 3WQCA 3NL3A 1Z42A 3OHMB 1HP5A 1B3XA 2BTMA 4DJDD 3U4FA 3H2EA 2WMIB 2CKRA 4Z2LA 4M6QA 1TPEA 3G24A 4AIEA 2SFPA 1F9CA 3OBEA 2VGIA 3M0VA 3PZVA 4EPBC 4AZBA 3UNTA 1M01A 4DIAA 1XHGA 3SGUA 3GHRA 1VHCA 3SY5A 2XIMA 3EZ4A 1NOWA 2OMAA 2ZXDA 4HPXA 5FJIA 3UW6A 3F4VA 4PMXA 3LCLA 3WUGA 2W4XA 3GDRA 3PBUA 4NAEA 3OO2A 4IIEA 3FYPA 3W72A 4JCMA 4S2CA 4PMUA 4O57A 2E9MA 1XYBA 2ZUVA 4HSHA 1AQMA 2YXOA 1HT6A 1FVPA 1KV8A 1BPLB 4MWAC 3THQA 5CCZA 5T8GA 1SZRA 1X8CA 5TBOA 3WMLA 2V5BA 4HMDA 3HB9A 4GIRA 4QG6A 4H9XA 1J4EA 1AODA 3AXHA 2YDAA 1J0HA 1BEUA 2J7GA 3TCEA 3CYVA 3R25A 4MG4A 3O9NA 3OGRA 4E8DA 5GNXA 1BVWA 1XW8A 3M64A 3WK0A 3R8GA 1W3HA 5CXPA 4BEUA 2CXEA 4UB9A 2QCHA 1I9CB 2Z29A 1XRVA 2WKLA 1V6TA 1RVKA 1Q7MA 4S3KA 1HGWA 2WNQA 3WNPA 4D6IA 3M5VA 1NOFA 3NG3A 3F2BA 3CL7A 4Q6JA 1UC4A 3WKZA 3VIJA 3QGVA 1GYNA 1HKJA 3UJRA 1UMLA 2WWCA 3GDMA 1P0EA 5KITA 1P7TA 3LU2A 3BLPX 3S2NA 3NSNA 3W7PA 1J11A 1IEVA 5FF4A 4PZVA 3W2JA 3QTPA 3DG3A 1H61A 4JL2A 4AZHA 1KCXA 5AYYA 1BYAA 2JK2A 1RP9A 5HATA 3NYZA 4JYFA 4M0XA 2W92A 1TWWA 3C0LA 5ABFB 2R1MA 4RE4A 1KM5A 2FDMA 4Y9MA 4HNUA 4AD5A 2ABBA 3ALFA 3DKJA 3DOPA 3FVDA 1Z9AA 2QVNA 2B0MA 3V5OA 4C5YA 2BXVA 1MDLA 3SY1A 2DT0A 2XVGA 3PPHA 4ILSA 1EZWA 2QCMA 3TZFA 4KFPA 4J3WA 1EDGA 4EPEC 5M1TA 5C2XA 2BVTA 1JQXA 3QGAC 1FKWA 1R7AA 3C6CA 7A3HA 5I3FA 3NQ7A 4ZOEA 3PB0A 4RDZA 2IPWA 3V3WA 1PV8A 2GVYA 4GD0A 2PDFA 3MSRA 5E0FA 4HMNA 3I10A 1AL8A 3TAKA 1W3NA 3E6EA 1U1UA 2QLYA 3W7MA 3GAYA 4S2BA 3ZQ9A 1H11A 2PDUA 1S1PA 1A5UA 2L5HA 4HNOA 4JS3A 3WD4A 1K02A 4MMWA 4LRTA 3AZTA 3CNYA 1VBRA 3H2AA 1FWSA 4Q3MA 2VVSA 1LLWA 1GOXA 2QIIA 1BKSA 2XTKA 5D2VA 4UFHA 4HB7A 3TIMA 2AMGA 2WVUA 5ABFA 5I09A 3HOJA 3IUHA 4WZHA 3W1AA 3F2CA 3EWUA 1W91A 3Q2DA 4JTIA 4GXPA 3TW9A 2XJ7A 5DN1A 5E1QA 1AQ0A 1UD3A 4IPPA 1J96A 5KEZA 2PLMA 1PAMA 2NVDA 4WSHA 4DRSA 2IUZA 2E6DA 2UY5A 3GXTA 1XRTA 4F0MA 1XCWA 3IGUA 3W7CA 5FJTA 1U30A 4MHBA 3DYOA 3NO5A 3WL1A 1E6SM 1QOPA 2J88A 1P6WA 2ZRWA 3DFQA 1EYEA 3E5BA 2YZRA 4H3DA 2VRKA 1W1VA 1QBBA 1FQ0A 4NX0A 1C7SA 2CZVA 4UIOA 3CIVA 4BZYA 4LXFA 3SRKA 5A6MA 3WLSA 4IUOA 4JFUA 4JIEA 1RK6A 4DEFA 3OA3A 1R47A 4ACZA 2P1FA 3TMQA 3QGKC 1JCTA 2YL6A 1B30A 3KX6A 3FLUA 2XIQA 3BOXA 3VM5A 1GJWA 4Q8NA 4WQ6A 2J62A 2CLIA 1GQKA 1JI1A 4DZAA 1EX1A 5ABGA 3IV3A 4S3BA 3PZOA 3TJLA 2QAPA 2R1NA 2QUTA 1E6PA 1UKPA 3STGA 4ERAA 4MB4A 3V4BA 1MXSA 4JIQA 2QPSA 4Z2GA 2GDQA 2Y7FA 4H9MA 3N1AA 1HUVA 1ZLPA 2PCQA 1OZQA 3QHOA 2GUYA 2YW4A 3PG9A 4LV9A 3GU1A 2DZWA 3H2OA 1JDCA 3S8HA 2FJKA 2XU2A 2D2GA 2YA0A 4N6EA 4S23A 1NARA 3QZEA 4M6PA 4NRSA 4B15A 1QPNA 4FZIA 2NX3A 2QJJA 3EDFA 1JF6A 3AHVA 3RX2A 4LH8A 3ZJKA 4D6EA 2Z0IA 2OVLA 3EKZA 4V1XA 3APGA 3QLDA 2PD9A 2NQZA 3E38A 1VFMA 5DO8A 1VJIA 2BLEA 2FPVA 3OVQA 3GIPA 4AWTA 1XG3A 3DN5A 1TA3A 2A1YA 4AIBA 5I06A 1R5YA 3P0XA 2NW0A 3PPCA 3NZGA 1ITQA 1QI4A 3MI3A 1X8FA 3PSVA 4AEFA 1E1CA 4MY8A 4WXYA 3FXYA 3E02A 1KQZA 1GORA 2PWDA 1UBSA 1MUCA 3C86A 4NP7A 4RPPA 5BOEA 1WOBA 1MXDA 1LLZA 3FJ6A 1VF8A 3WEZA 1JZ6A 2VC7A 4UTFA 4IJBA 2FTWA 2XISA 3RM4A 4F0LA 1VBUA 3ABXA 4AHQA 4RZBA 5BWFA 1J8VA 4KFOA 4PR4A 3U7BA 4MLRA 2Q09A 2Z1WA 3EMQA 1WDQA 1FBAA 4DJFC 1RBOB 7REQB 1J18A 3LM3A 3VPLA 3SI9A 2VDIA 1YNYA 2HPIA 3W1MA 2YFOA 3Q58A 5EMYA 3RPTA 4X9SA 4H01A 1V0KA 4M51A 1U1HA 4DJED 1AQHA 3UT0A 1F6KA 4JKKA 3RF9A 4AFYA 1BAGA 3W81A 2WQDA 5CC5A 4H8UA 1OFAA 3LV6A 4DXVA 2G3IA 5EMJA 3TC7A 2J8TA 2O4MA 4UTUA 3RR1A 3ITVA 1X1NA 4BF7A 1PZ1A 2VHLA 1UZ4A 1YTKA 1CB7B 8XIAA 4P7LA 3CT7A 5D09A 5XIMA 3TU9A 4YXGA 3LTYA 5B80A 1US2A 3UWVA 3CLMA 4LGXA 2A7PA 1W5OA 3R11A 4DI8A 4FXRA 3MMDA 2PEVA 4JY8A 1C93A 3QYSA 5E0CA 2BVYA 3SRDA 3EDDA 3YPIA 3S1XA 3VNMA 4ATDA 4TIMA 2V2DA 4BQ3A 1PZ2A 7TIMA 1J6OA 3TSBA 1SJCA 2E8YA 3ATYA 7TAAA 4L6DA 3P67A 3CQKA 1N7KA 4XKMA 3W2LA 1KCZA 1UD8A 3SQSA 4L65A 3UVAA 1JCJA 1V3HA 3M47A 3NJ3A 3VOGA 1EJXC 1KFBA 2W6RA 3B9AA 3EKGA 2QV4A 3NGFA 3OZYA 2WMFA 4K8HA 1VFHA 4GC4A 2FVMA 3C0JA 1ONXA 4AZ6A 2H3BA 1V79A 4DY1A 3ITOA 3UJSA 1X96A 3WH6A 2R14A 3WUEA 1BHGA 2PTWA 2W9MA 3NAVA 2FDSA 5I6SA 1ZP4A 3BUVA 3SCSA 4DPQA 1VD6A 3KP1A 1IEQA 4NZJA 4GI8A 3VD7A 4AU0A 1DYSA 3DCPA 1ZBWA 2G3MA 4AQLA 5IFPA 1JRCA 4GVGA 3ATZA 1GQJA 2ZVIA 3AJ7A 1QRQA 4QM1A 4GY1A 3MHGA 2UY4A 5D9OA 2WVTA 4GZIA 4Q7NA 1EFZA 2ADAA 5HQEA 1XLBA 3N04A 2NQHA 1FFRA 2GVGA 1KM6A 5LHEA 2QUVA 4V27A 1EBGA 4KRZA 3A3WA 3TOPA 4I8DA 1OYBA 3FHAA 1P43A 1UUOA 1NEYA 5LIWX 2HWGA 5LSMA 4A05A 1LWIA 2HXUA 3CV7A 1SJDA 3V0SA 3WNMA 3LYEA 2OLHA 1MRAA 3B9DA 2R6OA 2XN0A 5FJPA 1WXZA 1QNRA 3WLLA 1GHSA 1A5BA 4RDYA 1UW9A 1UWIA 1AA1B 1GJUA 1IIHA 1XSKA 3HG2A 3LK6A 3W76A 2QCFA 4MLJA 1EIXA 3CS2A 3CZEA 1WZKA 1FWIC 3RDKA 2J7DA 4TO8A 3DECA 1QT1A 3B4YA 4MNKA 4UMAA 4JHMA 3WQ8A 3PF3A 1CT5A 2A3EA 1F8MA 2VP8A 1FHDA 1R3VA 3IAQA 3QQ1A 3F03K 4YJ5A 5ABTA 2GZXA 3CPRA 1OFDA 5HUPA 2VVNA 1TWSA 1HTIA 5D9MA 2V5DA 3HBLA 4B90A 3L12A 4XBKA 2Y0FA 2D0HA 2C1IA 2BODX 3M9YA 4P8XA 2DP3A 2C13A 3HIJA 3HPSA 4NZ1A 3RJYA 1DIOA 1DJNA 3IJ9A 4UWMA 1C9WA 4NZ4A 3CLWA 2RGMA 2OZ3A 1QHZA 2C3ZA 1SU5A 2FZBA 3ZVIA 1TPH1 4W9TA 3GDTA 4H8VA 2WZHA 2PI6A 2FIQA 1K6WA 2XIIA 3T40A 5CBBA 1AG1O 3LPOA 3T2OA 1ISWA 1A3HA 1V6XA 4EK7A 1H51A 3BW4A 2GSHA 2PGWA 3TN6A 1KM4A 1WKDA 2NXHA 2PP1A 3GNOA 1Q6EA 3A12A 3TXZA 3IAPA 3QN3A 4TX8A 1TIMA 1XIHA 2PLJA 1XR2A 4LAUA 4HPHA 1E0WA 3KVJA 1M5WA 2PDGA 2DQXA 3M0ZA 1GW1A 2VCAA 4NIRA 1CGWA 4NQ1A 3GG8A 5JH1A 5D9PA 2HDJA 1P1XA 4KRUA 2R94A 2BHZA 4GQRA 3W82A 3AICA 4H2CA 4JNYA 1JYVA 4Q8VA 3BAXA 1YPIA 2NLYA 4GRSA 3R7MA 2Y7GA 3NL2A 4ACZB 3PAOA 4B2DA 3JU2A 3ONBA 3ITGA 1QNQA 1S3HA 2EPHA 4D8LA 2ZRZA 1UR0A 2J9XA 3UWWA 3G0UA 1B5TA 1RD6A 3L5LA 4A2SA 2YPIA 3SEPA 3C2OA 4IPIA 5CPMA 1GKPA 1OWQA 1V5XA 1W1TA 3P74A 4AD4A 3QLLA 1MEIA 4R9XA 2Q02A 2VOTA 2VURA 3DERA 3IK4A 1PIFA 4TVDA 5CAKA 2OEMA 4LS0A 3B05A 1KRMA 2QAFA 2WVVA 5EMMA 4GHRA 2OSXA 1PXGA 4U2YA 3FYYA 2ZX6A 4OV9A 4RNJA 1W9BM 2OSWA 3P7YA 1O1ZA 3GC4A 4OIFA 1ALDA 3WCZA 4B91A 4OJYA 1OHLA 4TX9A 1FWHC 2HK1A 3HPFA 3WLHA 1XP3A 4WKAA 5REQA 5EMUA 2D24A 3KCLA 3VKAA 4GO9A 1CGYA 5BZAA 2P3EA 4OWGA 3WD2A 4K1WA 4F8XA 3VDBA 1LL7A 2Z27A 4RK8A 1BSLA 2EBNA 1A5MC 1TRIA 2G41A 3RFAA 3T07A 3GVGA 3FA3A 3KWSA 1I4NA 3LXBA 1UOKA 1M53A 3MWAA 2ACRA 3EX4A 1VBJA 4PRWA 2ZUWA 4UQ9A 3T6CA 4E2VA 3N25A 4MWAD 4RNHA 1P5BA 3PANA 3ABQA 3W6YA 3L7RA 3VOIA 1WAWA 1OINA 1XGDA 3UU0A 1O1HA 3IJ8A 4NYUA 3P84A 2DU2A 3GS6A 3DFPA 4L9YA 2DW6A 3TA6A 1OG0A 3R94A 5H91A 3DHPA 2YCJA 2YW3A 3T7VA 4IPNB 3UG5A 2Q3RA 1BXNA 3CPGA 3GVQA 3R0UA 4KGLA 4RDVA 4PUNA 2A2IA 3VUSA 3GVWA 1T8XA 3W23A 1QASA 1GG0A 1OGGA 4AYSA 1IT8A 2FZDA 3AALA 3WBAA 1CGUA 3O07A 1GQLA 3FNDA 3BK0A 2B31A 4FIRA 3M0HA 3M0IA 3FK4A 1WZMA 2WBGA 5ENLA 2J7CA 1B1YA 4FK9A 1CXFA 3IS4A 3QZAA 4MDPA 3SJNA 4Q4KA 4JL1A 3HQ1A 1M6JA 2XFWA 4C7GA 1TR9A 4UTMA 4KW2A 1TPC1 1B3WA 2FJUB 1ZB5A 4G7EB 3U0HA 4J4KA 2QKFA 2FZ9A 2QF8A 1FWTA 4AUBA 3KFTA 2W5FA 3S5OA 3VAVA 2J66A 4C6QA 4UR7A 1EC9A 1QWKA 3W00A 4IWWA 1XLMA 1KFEA 4LYRA 4FR1A 4LTSA 4EPDC 1LORA 3T4CA 2WHJA 3W1PA 1VJSA 1PIIA 4POCA 1J6PA 3ARSA 3VD5A 3WLIA 2B7OA 4X2PA 5F2GA 4L1GA 1BTCA 2BMBA 4YU1A 3ARTA 2WO5A 1YDNA 4GH3A 4GI6A 3GU9A 1LJYA 3GFXA 1JPDX 4GX9A 1PO9A 4DNMA 2VO5A 2I16A 2J27A 4AX6A 3INPA 3HZ3A 1CWYA 3CQIA 1VQTA 4XSLA 5M17A 4LBSA 5DXXA 3TC6A 4TUFA 3R4IA 1JG9A 2EKGA 5GJMA 3KBJA 4IFRA 3DHFA 1OK4A 1F6PA 5CJMA 1B0IA 2DVTA 2NVCA 2W61A 3KZPA 3S9ZA 1T7LA 4MFEA 1R30A 2ZUSA 2INEA 2DIEA 1ZAHA 3MV01 2ISDA 3G1FA 5C7VA 4HTBA 2VEIA 2WNZA 1BGAA 4U31A 1ELSA 4IL0A 3WL0A 2HVNA 1V03A 3VGBA 4ZOAA 1OCQA 1D3HA 5CPLA 5FESA 3AS1A 3BXWA 4NXKA 1J0KA 3EWWA 1UP3A 1UZHA 2BS9A 6ENLA 5I7GA 2I9EA 1GYLA 1YEYA 2POZA 5EL1A 3URBA 4C7FA 2BOFX 4ECLA 4IGSA 3WQVA 2J4GA 3GVRA 3VMOA 3BC9A 1W3JA 1TJRA 3W2UA 1JR1A 1ONEA 1G4TA 1FX6A 1UWQA 1VFFA 3D47A 3N9SA 4I9AA 4N0RA 4BFAA 3N9KA 3VKKA 4U3AA 3RM8A 3SADA 3FGCA 3T9PA 4K2SA 4A8RA 3RIKA 5KZEA 2DGAA 3NR0A 4E4UA 1S2TA 4IIDA 4HNVA 3VGGA 2DT2A 1UR1A 1AJZA 1OYAA 7REQA 5DY3A 2GOKA 1XGZA 4MSSA 3HGRA 3WF0A 4GYPA 1EJWC 3DFOA 3WN6A 1FKXA 3MYOA 3OHIA 4HKPA 1H49A 5AECA 2E25A 3PJXA 3NQCA 4UFLA 1EZ2A 1A5OC 2ZXBA 3A3XA 1I2QA 1YNQA 1REQA 2A3HA 1FH7A 4Z08A 4LANA 1LROA 2PDWA 2Q6ZA 3R2GA 2BFGA 4UQEA 1QJWA 1GVEA 1AW5A 1K4GA 1JRBA 3VOCA 1ZCCA 4AIOA 2Z6JA 1UUMA 4PA8A 3H53A 3JZEA 1JDDA 4UCFA 4JAWA 3NM1A 2INZA 2Z1SA 4KIRA 3UPBA 5C9RA 1W17A 2QT3A 2Z26A 3KL0A 5XINA 4CNSA 1JFXA 6PTDA 1E4NA 5HJYA 4UTTA 1MW3A 4IPJA 3LZ3A 1GONA 2Y8VA 2Z24A 1ONWA 2P3ZA 3NDOA 3W7RA 4UMBA 4CEXC 1AJ2A 3SDOA 4FXSA 4G56A 4RNIA 1ZHAA 4B4FA 1XIDA 4PTMA 3QVQA 4PMQA 2JF7A 5C7HA 4IFKA 5KTLA 2NT0A 4UTTC 1EPVA 4B5XA 2ZICA 3PSWA 4TMCA 3HTWA 1KLZA 1LOQA 3AZSA 4PCTA 4WX2A 3WDPP 3BAIA 2EPOA 2PA6A 5A1AA 2WAGA 5AY7A 1OEPA 1RR2A 5AC8A 5MKGB 3ZT6A 3WQ6A 4S3JA 1V02A 4Q7BA 3WQWA 2AL2A 2J6XA 3EPOA 4EVZA 1EH9A 5I77A 1V0NA 4IJCA 2YLLA 4JTQA 1MUMA 1DJXA 2X7VA 2CLPA 1F3WA 1OC7A 2X30A 3LXCA 3T2QA 1V3KA 5SWUA 4M5PA 5FF7A 3ERPA 3ISIX 1H1NA 3ARXA 2OO0A 2JF6A 3VUPA 2NWSA 3RNDA 3ITYA 1M03A 1FHUA 3WIJA 1GZGA 4R7WA 3NSXA 3ITXA 3UCQA 3OYXA 3KRBA 4D8AA 5TF0A 3IJIA 1UC5A 3VOHA 1IEIA 1CLXA 2A85A 2WZTA 4W89A 1QW8A 1NIUA 3N6QA 1EF2A 4ERGA 1GK8A 5LHFA 4GXMA 1RZMA 3U6WA 4EX4A 1B54A 4G1NA 3BQ6A 2A4AA 1SZFA 2OYMA 4MYXA 2G95A 2GK1A 3W83A 1P1MA 4QITA 2WSYA 3GXPA 1NFBA 2WANA 1KBKA 2J24A 2R1LA 2Y6ZA 4MKVA 2XZ9A 2NXGA 2QUMA 1QMLA 4HCDA 3BCJA 4PCFA 1GGOA 1IGSA 3B0PA 1GJPA 4KGJA 2ESCA 2J74A 5CPOA 2GQ3A 3ANUA 3ZFHA 2PDYA 1BYDA 4DYKA 1RAKA 4OGZA 2FTPA 1KTNA 3AIEA 4U33A 1JUEA 2XGZA 4JTJA 3S42A 2ONEA 2IKHA 4M29A 1H7OA 4DUWA 1KRAC 4JTDA 3O15A 2I57A 4RJEA 1EJRC 3LDVA 3SQMA 4A29A 1M9HA 4MAVA 3BZGA 2A7NA 4L7ZA 2X2YA 1HKVA 2RHGA 3GFYA 2PC4A 1EJ7L 1SJBA 3T09A 4CQDA 3GNPA 2GDVA 3LI0A 4WDXA 2QVHA 3CAVA 1YPXA 4GJIA 8XIMA 1XI3A 4LRSA 1QFEA 2VD8A 1HJVA 2AKMA 1TZ9A 4RXFA 5D30A 1SR9A 1PUDA 3VGFA 2F7FA 4B5TA 3B97A 3GTNA 1E6ZA 4YVVA 3AMGA 4D6JA 4WDUA 2XVKA 1AK5A 2H9AB 3KZSA 5IDIA 4PUWA 3U2EA 2AOSA 4UFMA 3CV1A 4IT1A 1L2UA 5GVJA 2J78A 4AY8A 4UQBA 2C6QA 3CH0A 3WDJA 2QUNA 4GH1A 3EWCA 2O4QA 3EWYA 3NL6A 5LYRA 1OF8A 2JQXA 1YKWA 3VGHA 1TRDA 2YCIX 3QHNA 4KCTA 3G1DA 5KINA 4S3DA 5DT7A 1ZSXA 2JKPA 4KEZA 3P5YA 4QE5A 1P48A 1T96A 1T8QA 3BANA 4I9TA 1W9UA 3D3AA 1UPMB 3NVDA 1XH2A 2RDUA 3L65A 3AQUA 3URNA 2RJHA 3MZNA 3OBKA 1EP3A 3G77A 1QI0A 1IIGA 3GYCA 1FH8A 1A5CA 4ZFMA 3UCDA 4Y9PA 2BGSA 1YNPA 5CPNA 5AHMA 4WJ8A 4QLLA 3WYZA 4LY4A 1H7RA 1A5SA 3LBOA 3BGJA 5EU9A 4REQB 4GC3A 2X2GA 3EOEA 2ZDSA 2CWXA 4Z42C 3E0IA 3KVMA 1OFEA 4PSPA 5A2AA 3OODA 3SUVA 3AXXA 1XLFA 4HYRA 3LHZA 2ZADA 4UTLA 4HYWA 4QRNA 1UKSA 4UZSA 2CYGA 1YXYA 2ZRVA 3DFNA 3UYCA 1JUKA 3E5PA 2E09A 3WF2A 2ZUTA 1FDYA 3HN3A 1UWRA 1F4HA 1R9YA 2ZZ5A 1EJTC 1GZ1A 4GI4A 2G3NA 3Q67A 2PU0A 3AMDA 3MHUA 3AHYA 4A8LA 4NZCA 3MY9A 1KGXA 3M6YA 5JBFA 4PH6A 1NQ6A 4M24A 1XH0A 2WKGA 4ASTA 1GVOA 4UXDA 3SECA 2BG5A 4S3EA 3TFXA 3CZLA 4QJ5B 2PU1A 1Q8JA 1UH2A 3TYDA 3WK1A 3VD3A 1DE5A 3NQDA 2YA1A 4KMQA 4O11A 3GM8A 2ZZ6A 3P0WA 1LL4A 3VMNA 2VFFA 1MW0A 3R5EA 1EC8A 1WP6A 1X6LA 1RVGA 4DAIA 4R7OA 3ZO9A 2E68A 3O2LA 4LAMA 4L6OA 4WOQA 3W7EA 1A0DA 4GUJA 2ALRA 1JPKA 5AC6A 4Q6XA 3MSGA 3PBMA 1ML1A 1Q5MA 3HU7A 3CIXA 3EWZA 4HBKA 3HGSA 3GR4A 1JNEA 1RBLA 4GIAA 3MKKA 3VKDA 1AH0A 3IIOA 4EP8C 4NZFA 4WRHA 2Z7KA 2Y4SA 1WKYA 4WLCA 2B7NA 3PN8A 1J93A 4OUIA 2UWFA 4LUJA 5D2TA 3CYJA 2PSNA 8CGTA 4F66A 3NIYA 2X0SA 3KHJA 3IV8A 3OG3A 3HG5A 3FW6A 2VMFA 3E0LA 2PWUA 2WC4A 3E1F1 4NZ5A 3EOUA 3C2RA 4JQAA 3USZA 5A6BD 3WLNA 4FF5A 3OIXA 4WKHA 4B92A 4YMZA 3VIPA 5CSUA 1UPPA 3WBEA 1XLIA 3PZUA 4RZ4A 5GNYA 2V3GA 3GW0A 3CXOA 3BJFA 3KOYA 2DDXA 3FXGA 3T0AA 2PF0A 4BJHA 3QY8A 1YXDA 2D23A 1XIFA 1NDWA 1ZBKA 1C7TA 1CX9A 4J28A 3AHZA 1RALA 4WGHA 2DUZA 5CLTA 1W3KA 3F5KA 1HJQA 2QPXA 2YR1A 4F2UA 2XSXA 4RE2A 1G6CA 3CL8A 3CUJA 3PM6A 2VX7A 4Q32A 4Z17A 3H23A 5I02A 4UOJA 2VRJA 4HP5A 2OWXA 1Z8AA 2OU4A 1GUVA 3I4KA 4FLRA 2WZIA 2ZUNA 3FX4A 2P0IA 2Y8KA 4IUGA 2VX5A 2DZSA 2GJXB 4RDWA 5D2WA 3CB3A 1HKKA 1S38A 4XV0A 2VKZG 4L4OA 4QQ3A 4R3UA 1KTBA 1F07A 1N55A 5FKYA 2ISFA 3ZS4A 3UD6A 7PTDA 5I3IA 1B2YA 3QY7A 4ZQMA 1OC6A 4W8BA 3UZZA 3AWNA 3LHVA 1UB3A 4M3PA 2ZA1A 1MRQA 4GJ1A 1O94A 1WXJA 3IGHX 3UGVA 2QHAA 1RBAA 1VEOA 2EPKX 1CENA 1Q2SA 1GVQA 1PX4A 1GOOA 3SJ3A 1UG6A 3O6AA 1KC7A 5A2CA 2RH9A 2A5HA 1N82A 4FOUA 1ISVA 1O5QA 1CZ1A 1ISZA 1PPIA 3KCJA 4IF2A 1MDRA 1SO4A 2I5QA 3UWEA 4YCOA 1R3SA 3URQA 2PWFA 4NNCA 4PRRA 1KTCA 1GHRA 3S9YA 1XD0A 1TTJA 1WUFA 3ZVHB 4U2ZA 4AZ7A 1JD7A 3GG0A 2OODA 4JYDA 3UPMA 1OF6A 3WSUA 4D8ZA 4IGMA 3KOXA 1XIJA 4Q8TA 4TXEA 5KZ6A 4O1DA 4B2DD 1Q8AA 1EC7A 4HA0A 3W22A 3WY1A 3B0VC 3BG5A 4CQ9A 1E5NA 4GI9A 4TX6A 1W3TA 4IMFA 3NYDA 4FXFA 4IMGA 4ADSA 3L0NA 1I2OA 2G96A 5DFAA 1XS2A 5BOOA 2GWNA 1GYMA 1DKWA 2R91A 3HJZA 5HR6A 3CAQA 2MANA 2ZC8A 1TSIA 3H8AA 1BWLA 4OT7A 3B8SA 3HA1A 3D5HA 3HQNA 3BURA 4US6A 1B3VA 3E2SA 2XWEA 3VDGA 3F4CA 3USBA 3QR1A 1UZ1A 3WMCA 1H09A 3EB4A 3CTLA 2FPTA 4LWWA 1CNVA 1TB3A 2WCAA 4J35A 3QSRA 3UVIA 3UY7A 1J0IA 1OM0A 4EAMA 4DX3A 3FN9A 4XISA 4Y8EA 3LZ5A 3AIRA 4PUKA 3EB3A 4QFUA 5CC6A 4XZNX 3TW6A 2WM1A 3JUGA 2FQIA 4OKDA 2YBTA 3W75A 1CIUA 3H70A 2NQ5A 3BSHA 5F2MA 4W7WA 1XC6A 5D37A 4XAYA 1O60A 3S1GA 1MEHA 3VA8A 2WMJA 4MFDA 4XZHA 4EF9A 1U1JA 3EA2A 3LB0A 1XBVA 3IGSA 1RD5A 5L9FA 1VFTA 3OA5A 1I1XA 2O55A 3KRSA 3GDBA 3SN1A 4A3UA 2I7GA 2E6FA 1ADOA 1LYXA 3AU2A 3N2BA 1O5KA 3G1YA 1IXQA 3RCMA 1WE5A 2VGBA 4MB5A 4HVXA 1H7XA 1UROA 5G2HA 1LQAA 4GUHA 3TH6A 1EIBA 4KERA 2R9RA 1EHNA 1X1ZA 5D4YA 1XL9A 4PUUA 5F7UA 4S3FA 2CLLA 4KS0A 5AHLA 4I6VA 3N17A 1RY8A 3ELFA 3OOQA 1AW1A 5AB3A 5E9XA 1MNSA 4CCDA 1R86A 3C8FA 1TQXA 2VEKA 4QX4A 5IBXC 1PDZA 1YXCA 3FA4A 2FB3A 2IW0A 3LUTA 2A0NA 2DSKA 1Q66A 3RRXA 3ABRA 2YA2A 4AZ5A 2P53A 4C6EA 1O4UA 3SUSA 5FCZA 4H6KA 4I5XA 4EXBA 3P2VA 4O0QA 4IMCA 4DJFA 4HOZA 1OFOA 1JPIA 4H83A 3V7PA 3K4AA 2VEGA 3SUWA 4DO6A 3EAUA 3N14A 4LS1A 1O68A 4ICMA 1XIIA 4M6UA 4Y2WA 3WD3A 4CN1A 2PPGA 4CNNA 3P8IA 3GLCA 4OFCA 4BEQA 2HMCA 3S2CA 4AD3A 1H60A 4H6RA 2DW7A 1F73A 1YQ2A 3TTEA 5HA7A 1OCNA 3WJYA 3SCVA 1GG1A 3AWOA 1XBYA 2QJGA 1VPQA 3ZR5A 2QF7A 4DJEC 4QDWA 4P7OA 1YBQB 2HSAA 1GTHA 1UBPC 3M5ZA 2V6AA 3U7VA 1SO6A 2TAAA 3QR3A 5DMLA 4JXCA 3QQWA 2F84A 3NPVA 4K37A 1HXJA 4L9XA 4J7RA 1YDVA 3N2OA 1EGVA 3GNRA 5IDZA 2CWNA 3ALGA 3UERA 3OIHA 4RR4A 4ZQRA 1TX2A 3CHEA 3NZPA 4LUSB 3UJEA 2C79A 1VPXA 3WF1A 2XIBA 1Y65A 3PNZA 2DY3A 1WX0A 4LVDA 4Q8QA 3RITA 3TSMA 4GCAA 1MUWA 2GGEA 3H4GA 3DDMA 3NQBA 1OK6A 3RX4A 1NH6A 2FMNA 4PMNA 2E5CA 1XLJA 5AZ1A 4Y6GA 2I1OA 3VILA 1V3JA 3MO4A 3GTIA 2ZA3A 2BBFA 2KAUC 2QJMA 3LSBA 4DBEA 3GZ3A 1PS9A 3I65A 4IJRA 2PDHA 1R3TA 5CJ5A 4JQ1A 1MYRA 1A0CA 1PX8A 3TQ0A 3COTA 1H1ZA 5D8WA 1C91A 1R8LA 1KV5A 3CV2A 3NOYA 4FA3A 5LXEA 3RJXA 3MVIA 4OVXA 3F1QA 1L6GA 1LT8A 3RM9A 4JX6A 1I0BA 1XDJA 4MF4A 3ZT5A 1I2PA 1V6YA 1H3GA 4E4PA 3VIKA 4CVWA 4DO7A 3TOYA 4QAIA 3CWOX 1E4LA 3GTFA 4REQA 2OELA 4OU1A 3V0TA 1S2CA 5C70A 2ZZ3A 1YRRA 2TMDA 3LTPA 1TKKA 3W7IA 1C90A 1KGUA 4PL1A 3FDGA 3SUTA 1IGWA 2WJEA 1NP0A 4YWSA 6XIAA 5M2FX 4EKJA 3G3DA 4GE8A 3CB8A 2W62A 1E0TA 4I7WA 1VFLA 3KS5A 4I3GA 4A2RA 4JX5A 2A3LA 4K6AA 1E70M 1LBFA 2OZ0A 2V9DA 3IJDA 2V63A 1J5SA 4OQVA 2ZX8A 3NNTA 5BYWA 4C6CA 3TR9A 2VFGA 1TV4A 3BCFA 3NQ6A 4E2BA 4NXSA 3GUWA 1A4LA 3UQNA 2GWGA 1W1B1 3UYIA 1G67A 3WLJA 3EX6A 3ORWA 1QHOA 4NU7A 4YVXA 1IZCA 1ISYA 1IXPA 1OYCA 3KWXA 3IRDA 5I3HA 1RQEA 4D6GA 1MVYA 2CETA 3QFEA 1UIOA 4HQVA 4CD7A 3T0DA 3T0BA 3GKFA 3HG3A 3VFLA 4D6FA 2YXGA 3K4WA 4KWUA 1RPKA 4UTIA 3ZJ7A 1EDTA 1HKIA 1W1A1 1UA3A 1YTDA 1LWJA 4CQAA 4WHBA 1LP6A 5FL0A 3I6RA 1E6NA 4KWVA 4D1JA 1PWMA 3ARUA 1UUQA 1AUSL 1B9ZA 3GWQA 2GJPA 5C9XA 3L4YA 3KLKA 3NEVA 5CAHA 4BY3A 3NOEA 1V6VA 2VDGA 1XM3A 5AKQA 1P4CA 1UR2A 4GY7A 1TELA 1L6FA 2Y70A 3TW7A 1XBZA 3BW2A 2BASA 2XINA 1Q6CA 2JFEX 4ZQPA 3NUKA 1FHLA 5FEZA 3VFCA 3H54A 4UOQA 1PCKA 1G4SA 3CIWA 2HS6A 2XHYA 2ZWYA 4ALDA 1NWSA 4S38A 3C61A 3E74A 4B3KA 1WYIA 3QW4B 4S3CA 1V3MA 4PCNA 1HVXA 1H63A 3S1VA 4TV5A 2F2HA 3TZNA 5A6AA 3TYAA 1EX5A 2QZRA 2NV1A 3EWXA 3H7UA 3KOWA 5C9UA 1Y5XA 4UC5A 1M7XA 1IT0A 3M0MA 4HJWA 3SCUA 4XZWA 1QNPA 5LNRA 3CHFA 1IZJA 4JTEA 3M5XA 4ZEPA 1QK0A 5D04C 1AD4A 3IEBA 4ZXOA 4JIIX 2KX9A 3WFLA 3G18A 3N12A 3W7LA 4CNPA 1BVZA 3BAJA 5LKYA 1J2WA 1EGMA 3BV4A 4RZ5A 5I78A 2YCEA 1W56A 1ITXA 5HR7A 1NP2A 5K9DA 5DBUA 4W4QA 3S1UA 3WD0A 3RGTA 2CPUA 2AMXA 3H12A 2E8ZA 1IWPA 1C8YA 1BXCA 4PBFA 4WCJA 4KESA 4L61A 4JEJA 1SVDA 3SB0A 3TYUA 1E72M 1DORA 3W4RA 3K2GA 1AZ1A 3C0QA 3CZKA 1AMYA 2FGZA 4ZENA 2WZEA 1UP0A 1Y5WA 2V5KA 1SW3A 2ZZ1A 3ZIZA 4K7VA 1MQQA 3OU8A 2PTXA 4M1BA 4AZCB 1OD0A 1H7PA 1JDEA 2NZLA 3MPGA 3BGGA 5GQBA 5D38A 3H4WA 1UH4A 1JD9A 4YNGA 1MSSA 1KGWA 4WSKA 2PDBA 3CGTA 2CHOA 3A4AA 5DCDA 4L4MA 4NUWA 4IIBA 1W9PA 3W1XA 1O66A 3DBPA 3SRFA 4J9JA 1LDCA 4B5SA 3CJPA 1M1BA 2O0TA 2DSVA 4KCUA 2R82A 5H8UA 3M6DA 4HOWA 4FOKA 4IHCA 3RLGA 6A3HA 2GUUA 3MI6A 3VC6A 2O9RA 5HNUA 1DJZA 4PULA 4UTWA 1TV2A 4UZUA 3NA8A 1LOSA 3F7JA 3AXIA 3S6DA 2WJDA 2J6VA 4EOUA 4ZVJA 5BOFA 4C7DA 3OVGA 2OOFA 5KZMA 3I7SA 1OCBA 5A8QA 1GKQA 1JQVA 2YJQA 3OTRA 1UWUA 4UTKA 5A2BA 2DIJA 5FEPA 4PMJA 5I79A 4M1RA 4QE1A 5CEWA 4YWIA 3W7JA 3EWBX 3K30A 3FEQA 3STFA 4AWSA 3EDKA 1IQ8A 3K8KA 3SBFA 5HNRA 2V82A 3VK5A 3QJAA 1GZJA 1C8VA 4DYJA 3VTRA 4L64A 3N11A 3HMJG 1GT8A 5AC7A 3KRUA 5EMLA 4O19A 4UR9A 1W5NA 1CGTA 1SYTA 2DV0A 4QISA 2Y89A 4C6KA 2GVEA 4UR8A 5A5WA 4MZYA 3G0SA 2QS8A 9XIMA 4DLMA 1W8GA 2HXTA 2G8ZA 3F4WA 4XUYA 3QV6A 4KKXA 2PGRA 1G9HA 3W29A 4GACA 5H8PA 4Q33A 1H5VA 1N8FA 1KBLA 4B9YA 1V0MA 3VDCA 4NI3A 1KXVA 1TREA 5J5RA 1HNYA 4PFHA 3AFBA 4CNTA 5E70A 3W02A 1S5MA 4DBSA 2Z1VA 2VZOA 5D2YA 3TK7A 3TTSA 1XLLA 1KFCA 3GBDA 2Z1XA 4PMVA 4JR5A 4AVFA 1NM9A 1YMYA 3N6JA 5AHEA 4HSNA 2C8NA 3DENA 3I6EA 4LYQA 4PTWA 2VCCA 1EB3A 3M5YA 4R85A 3PBWA 3R0KA 5I23A 3P6LA 1JCXA 4MB3A 1JF5A 3M0KA 3AYSA 1OGBA 3R89A 3VNIA 4JQ4A 4ADTA 1KCKA 1QXLA 5D32A 2IMRA 4FI4A 4ICCX 3OBAA 2XVNA 1XD1A 5HOSA 1HF6A 3AS2A 3S0CA 4PYSA 3NM3A 4J3SA 4X63A 3W1RA 1RK5A 5LIXX 3S9IA 1K77A 4PBGA 3WG6A 4QE4A 3GG1A 1G4PA 3GY1A 1KXHA 2FZ8A 4IG2A 4IMAA 2BXZA 5FACA 3TQPA 4QG8A 3LQGA 2PDCA 4NG3A 1SO3A 3UZJA 4E2OA 2CERA 2FVLA 1PEZA 2WHKA 4XUGA 3KDNA 1RCQA 4URIA 2WKJA 5DT5A 5FD0A 1KM3A 3DHDA 2WV8A 4LEQA 1VB9A 1NSJA 1SO5A 2Z00A 3G22A 2H3DA 2G5WA 5A8MA 4N02A 1R38A 3E3HA 2FHCA 1A53A 1ENUA 3DKLA 4DF2A 1UD4A 3NPUA 3THAA 2XH7A 4RV8A 1TR1A 1LWHA 4F0RA 3ARWA 3R79A 4ZFCA 5IRPA 4EF8A 3T78A 3PTDA 2VJXA 4HD5A 5A6SA 2F9RA 5DXYA 1YPFA 4C6MA 2A6NA 4TVUA 2RKXA 3WFZA 1KKRA 2EHHA 4YHGA 3FVMA 4MWAB 3VDAA 3MBDA 2BX7A 3RG6A 1OFPA 3W24A 1ECEA 3S4TA 4S1FA 4L4PA 3SRHA 3NL5A 4LNYA 4XD5A 5D2XA 3PPGA 2RJGA 2WPGA 3PJTA 4M8UA 2QV5A 5IOBA 1QW9A 4CD6A 4MJZA 3C3UA 4NZ3A 1IV8A 2VR4A 1KB3A 2QCCA 5DY2A 3GVVA 4M6VA 3IACA 4IG2B 3R58A 4ZMGA 1Q6FA 3F4NA 2XFRA 1Y8BA 5A6TC 4FNTA 4ATLA 5ABHA 3CUHA 2OYKA 1ODUA 2PRMA 4WY0F 1RLCL 3VDHA 1DQXA 4N7QA 3VX1A 4ZSUA 4H7VA 4IX0A 2E28A 2OFJA 1K7XA 1W54A 2OT1A 1J79A 3CPUA 1MZRA 4JTHA 1DIEA 4HPJA 1MW1A 2NUWA 4GO8A 5T9CE 5C9WA 1L6YA 5HUOA 3FAWA 1RQHA 1NQKA 1U5JA 3PWIA 1ZFJA 2HROA 3SIMA 5A8GA 2ZYFA 3KS6A 1FWCC 3NPXA 3RYSA 2BY2A 4Z0JA 3GTHA 4RKAA 4GKLA 3L4UA 1XIGA 4G1KA 4A3YA 3ZJ6A 1DQWA 3ZZ1A 1TPB1 1TE6A 4NL1A 5B7ZA 2E6AA 2A3AA 1H62A 1XDMA 2YDRA 3PFMA 1YIXA 3T55A 2W27A 1JDFA 4DZHA 3GSMA 1NF7A 2AQOA 1KNWA 4AG0A 2VGGA 4Q22A 4L1WA 4Z0SA 3SIZA 4IPLA 1IWAA 4JTAA 1JUBA 1F8IA 8A3HA 4TTUA 3UA4A 5BXTA 1G94A 2ATSA 2ZRUA 2JEPA 6REQA 1W3LA 2XGIA 1RLDA 4HNNA 3G1VA 2PGFA 5C8BB 3TV8A 2ATMA 1BRLB 3HPZA 5I3KA 3THDA 3MKCA 2ICSA 5FJOA 3HF3A 2PDLA 1LL6A 4LYPA 4HHLA 2PS2A 8RUCA 1D8WA 4G6CA 1TWDA 1NFPA 5H1WA 3KRZA 3P93A 1GWJA 2GJNA 4DBWA 3DAQA 1UQYA 4DF1A 2ALDA 2C1HA 2C0HA 2RDTA 2REQB 4CNUA 3L67A 4A8NA 4B3ZA 3SSJA 3WQEA 4GG9A 3QBUA 1VKFA 2XDFA 4NRRA 3VABA 2DSUA 3C3NA 1VHNA 4WOZA 1QI5A 5A69A 4C60A 1HKWA 2AKZA 4D6HA 3I3DA 2E9BA 4BK9A 1EO5A 3D3FA 4NHVA 1G7VA 1ZJBA 5ECVA 3UZYA 2PDQA 4O1FA 1JXKA 3N6HA 4ES4A 2BP1A 4ZO7A 3GHUA 2IKJA 4A3HA 1E15A 5A6KA 3GX9A 3TX9A 4PTVA 2PDPA 3TC3A 1M7JA 4LB4A 2W79A 4PUMA 1OX6A 3K5XA 4MM1A 2DPEA 4D72A 3AAMA 7CGTA 2ISVA 3MUAA 3VU2A 5KETA 4DWSC 6REQB 4MTVA 5LA0A 2JIEA 5JU6A 1F61A 1BRLA 4UTHA 1H50A 3B4UA 3G3MA 4FEZA 4PMYA 3CUZA 5JVLA 1PB0A 4AWEA 1JCYA 3BLDA 1DTNA 5G2IA 3WF4A 4DVOA 1NTHA 1VBGA 3V35A 1VBHA 4GBUA 2OQLA 5HMEA 3SM0A 2PMQA 5JIWA 3TNBA 1VFOA 2YOCA 4JX4A 2NLIA 1EJUC 1AH3A 4QS5A 3WH8A 2JALA 3SCOA 2F8QA 1RP8A 2HZGA 3P3BA 1NDVA 1RUSA 1VLWA 2BSLA 4GABA 3IIXA 5CQ1A 2D2HA 1XLCA 3CBWA 4Z1DA 4ACYA 3SY8A 2JKEA 4XTIA 4MAZA 1UA7A 3GYEA 3DC0A 4F40A 4HMEA 1LTDA 1QK2A 2QMKA 4CNOA 2QDDA 2PP3A 1LM1A 3CH9A 3K4DA 2ISWA 4NILA 2X05A 1TPWA 3T0TA 4C1NA 5T9BG 3RU6A 3NQVA 4HPGA 3WLPA 5FF2A 4LC8A