3MJYA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-aminoorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
306
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 107
structure length 306
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mjyA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mjyA01
3G1AA 1OFDA 4NQ1A 3NAVA 1F73A 5AC8A 5F2IA 2X1TA 1ICPA 4LUIA 2B7QA 3N14A 3HGRA 5AOUA 2P1FA 2JKEA 1LOLA 4LV4A 1Q3NA 3P62A 3EWBX 4Z1CA 5K7JA 1BEUA 1PS9A 2QCDA 4LWWA 1WQ5A 3WK0A 2Y88A 5D2TA 3QM3A 4HNTA 4X2RA 2YCEA 1ZFJA 3N2MA 1QPQA 4AWTA 1W5OA 1TYGA 3MYOA 3MP5A 2G97A 4RZ6A 3L68A 4TU1A 2GJNA 1TIMA 2H6RA 2HMCA 4FXRA 3WFAA 1XCFA 4FNPA 2FTPA 3QRHA 3C2VA 1KFLA 3P61A 3BW2A 1HTIA 3PG9A 5C2XA 1DORA 4QNEA 4XTDA 1EUAA 3R2GA 3W70A 2A7NA 1B4KA 2ZZ7A 1AL8A 5H2ZA 2E6AA 4FNUA 5F2MA 2A21A 2QCNA 4A21A 2BSLA 1KFBA 3NPXA 3LI1A 3RMJA 2Z0IA 1QPOA 3PC0A 1AW5A 4I9AA 1T96A 4QJ1A 1TB3A 2OZ0A 3MHUA 3BW4A 1ZNNA 5G4EA 3M16A 3W85A 1OFQA 4XKYB 4FNQA 3UD6A 3W7DA 1R2TA 3BG5A 1F74A 3HB9A 3DFQA 4G1KA 3PY2A 4UTIA 3H53A 3W23A 3W2NA 4GC4A 1MO0A 3R8RA 3LOTA 1W31A 3DFTA 4JX6A 4O1AA 2C18A 3PWAA 1ME8A 3BLFA 2NV2A 5FF3A 3QPYA 1KLZA 2TSYA 1KTBA 1C29A 3LCXA 3P81A 3KHJA 1L2UA 1QOPA 4UR7A 5IM51 2C15A 2NX9A 3UZJA 1H63A 5AHLA 1EP2A 1OJXA 2HTMA 2C16A 3UQNA 4JGDA 1H7WA 4PEKA 1OG0A 4L4MA 3PG8A 5HINA 2Y7EA 1GYNA 5G5IA 3G3DA 4JY8A 3O15A 1J2WA 1PVNA 4NUWA 1WOBA 2A4AA 5KZDA 1LLZA 1TMHA 4UUIA 1FCUA 4DXVA 4L4LA 4ZL1A 2CLMA 5F4XA 4MPQA 3W7CA 2C19A 5LGZA 2X1UA 4QITA 2RFGA 3W1TA 3I6RA 3W7IA 3U6WA 5IBXA 2E77A 1FY6A 3NQFA 1EEPA 2VEKA 2QDGA 5HWJA 2B7OA 2H8XA 2Q3RA 1I2OA 4TO8A 3ATZA 4RZ4A 3IGUA 3C6CA 4WQ6A 3W1QA 1S5TA 3OBKA 1TPH1 1CW2A 2QAFA 3M9YA 1H7PA 3NEVA 1OK4A 4P61A 4JYFA 4IPJA 1DJQA 4HPXA 4N6FA 4XZ9A 1ZAJA 4MKNA 1LZOA 6TIMA 4JEQA 4O16A 3EB2A 4JR5A 2JGYA 4DO4A 1UASA 1KFCA 3L65A 5F4WA 3SI9A 3R89A 4WXZA 3P67A 3JS3A 4OWGA 4HKPA 5LNSA 5AC6A 4O0KA 2NWRA 1VS1A 1N7KA 1TRIA 3LTSA 1TO3A 4Z1BA 3P74A 1LROA 4NT0A 2DZSA 2WKJA 1OX4B 2NZLA 4AB4A 1OYBA 2CU0A 4O52A 3GAYA 2AQWA 2FIQA 2EHHA 5C54A 3F4NA 4A29A 4GBUA 3USBA 4TMCA 2R94A 1I2PA 3QW4B 2V2DA 3W2KA 1M6JA 2AAMA 3LBMA 1KM2A 4FNRA 1JVNA 4RZ5A 4WY0B 5KTLA 1A5SA 1NEYA 1TRDA 4RXGA 4IXXA 4B5NA 4ORMA 1SW3A 1JCYA 4FB7A 1UUOA 3MP3A 3W7QA 2ZZ4A 1G4EA 1Z48A 2E5BA 4NJHA 4FF7A 2UV8G 4MJZA 2TPSA 3FJLA 1YADA 2QCMA 3RF9A 1QDSA 4CCDA 3MI2A 1JUBA 1RQBA 1FDJA 1H7RA 4LVGA 3NA8A 4OV9A 2J9ZA 3KVLA 3FJ6A 4A22A 3I7RA 1IIGA 1AW2A 3EWXA 1IXQA 5DCEA 1TCDA 2Y89A 1MEIA 5F2GA 2A0NA 3E0IA 4GUFA 5I3FA 1KM5A 3PULA 2QUVA 3W7JA 5I3KA 3MP4A 1O60A 3ABOA 4NJIA 1PHQA 2ZA1A 2Y7DA 4YMZA 1X1OA 3UWVA 4M7TA 1H1ZA 5AHIA 2OT1A 1FUYA 2C14A 4GJ1A 1NF0A 3CU2A 3IIPA 4Z1AA 5CZJA 1EP1A 2W6RA 3W1XA 2X1SA 2Q8LA 1FDYA 1R2SA 5F2LA 3KRUA 3RU6A 4IX0A 3CWOX 2QDHA 1LYXA 1QO2A 4O8RA 1FX6A 4U28A 4K7VA 1I4NA 1TV7A 3LGEA 1K8YA 2ATSA 2NV1A 1JUKA 1W3TA 2DZPA 3QSRA 1KM3A 1Q6OA 4LV9A 1CX9A 3T78A 1SR9A 3KOFA 3LCWA 3RK8A 1W5NA 3FYOA 4O1DA 5L6UA 5K9CA 3LTPA 1CI1A 1RZMA 3PM6A 5LSMA 3TDFA 4UTJA 2ZQ0A 3GZ3A 1SZGA 2GQ8A 3NXFA 3HG5A 3LTYA 4GFSA 1V7YA 2D73A 4JDYA 1G7VA 2TYSA 3CT7A 3UZ5A 3HG4A 2QCDB 3N9RA 4WY0A 2ZDRA 5AC7A 2BX7A 1JRBA 1LBFA 1RVGA 4ADUA 1W5PA 1WXJA 3LBCA 5F4SA 3P8JA 5BMXA 3A23A 4FEZA 5A8GA 4JTTA 5DCBA 4ML9A 1O5KA 1PCWA 2J27A 5LNRA 5SWUA 2PRHA 4DEFA 1X7FA 1DQXA 3E49A 4NX0A 1WX0A 3L5MA 1X8FA 1KBJA 4O12A 3UWWA 5AYXA 2GQ9A 1SO3A 5HUPA 5FEZA 2JK2A 2TRSA 3TW7A 4U4MA 2GVJA 4R7JA 1T99A 5CZTA 5EBUA 3HGSA 3MBFA 2RHGA 1EPXA 1LBMA 1VGAA 5CGQA 4TX9A 3QMTA 2HS6A 5LHEA 2Y85A 4OBTA 1WV2A 4MY9A 1QR7A 4JX4A 4AEOA 3NM3A 1F5ZA 5AHEA 3TQVA 1TPUA 4NJKA 3RFAA 2ZTJA 4OQVA 1L6YA 2CZ5A 5CPMA 3B0UX 4N6EA 2YFNA 3WK2A 3W74A 3L67A 4K39A 5CPOA 5F1VA 4UTTC 1P4CA 3NQDA 1XBVA 1F6KA 4UIOA 5BW6A 1P1XA 3W86A 2A6NA 1FWSA 1OF6A 1VCFA 4DBEA 1SZFA 2WPBA 1ZAHA 4JD4A 1TTPA 1K02A 1LORA 5D09A 3TXZA 4OT7A 4UTWC 4UTUA 3ZWTA 3O6CA 2QCLA 3DHFA 5D02A 1MEHA 3HBLA 3TC6A 5DY2A 1GPWA 1M5WA 4LVAA 3O06A 3LV6A 1TSIA 4LVDA 4QSHA 3WJWA 2DZTA 4PC8A 2NWSA 3LI0A 1K3UA 5CZ0A 3ABRA 4ADTA 1BWKA 1BKSA 1W8SA 4FO4A 3ZFHA 1IXNA 3M0ZA 3W2LA 1IIHA 5D03A 1XBYA 1VHNA 4FX6M 1G6CA 2FDSA 2YX0A 4HN4A 3QQ0A 3S5ZA 3LRMA 3HG3A 5C55A 5EYWA 1T0OA 1KTNA 5T26A 4AVFA 2FPVA 1SFJA 2FJKA 3C0JA 5K2ZA 5BOOA 3W1MA 1L9WA 4TMBA 2PRMA 3LCFA 4C1KA 3CB8A 1QFEA 2CWNA 3PBUA 1GVQA 4IWWA 5TIMA 4DO5A 2J9XA 2EPHA 2PURA 4OHQA 5HJLA 3TV8A 3B0VC 4UTWA 1KFKA 5DBTA 3KX6A 3NQAA 3G8EA 3BO9A 3W6YA 3A5FA 4RLIA 1RV8A 4JTUA 4DF0A 4EIVA 1R47A 3G1HA 3DFSA 3QFEA 1ZALA 1KM4A 1JUEA 5MHBA 5D04C 2FPTA 3A22A 3GDLA 2ZZ1A 4KWVA 3DAQA 1XDLA 2DP3A 4IX2A 4CQAA 5FI8A 5AYZA 1FQ0A 2PE4A 3W76A 1VLIA 3SY5A 3NPUA 2DZUA 5FEXA 3DH7A 2Z6JA 3G1XA 3SSJA 1LOQA 4UFIA 1RD5A 4I7UA 2GUUA 1H61A 2V2HA 4O1BA 3CIWA 4JTEA 4CQ9A 3QEZA 2ZRZA 3S42A 4QIUA 3HIJA 2YW3A 1DVJA 1ML1A 4FXSA 3EXRA 3GYEA 2YYUA 1VRDA 3SIZA 1M7OA 3R5EA 3HF3A 2Y6ZA 3TSDA 3W2MA 1H1YA 2DJXA 4OU1A 3UWZA 2J9YA 2GVGA 1Z42A 3C8FA 1EA0A 3HGOA 2V5LA 3KAOA 2H8ZA 3LHUA 3PBYA 2A1YA 3TXVA 1OX5A 3LCHA 3S9YA 3EX3A 3P80A 3SGUA 2Y63A 3CTLA 3F1QA 2NX1A 2YR1A 3A9IA 3PUDA 2NLIA 4JYDA 2VOMA 5EY5A 1RQEA 3O1NA 2PRLA 4LS2A 1GWJA 3M5ZA 2V5BA 1JJKA 2VFEA 2QF7A 2WO5A 1B4EA 1EX5A 1GYLA 1GT8A 1W54A 3IGSA 4AWSA 3DKLA 3O63A 3L0NA 3TJLA 2QJHA 4LY8A 1Z41A 1DKWA 3DZ1A 1TREA 5CG7A 3W7RA 4IQLA 1D3HA 1XDMA 1V5XA 4K8HA 1PE1A 1ME7A 1F7BA 3SECA 2J24A 4KFOA 3GDKA 4EF8A 1GQNA 4LU0A 4MFEA 1G7UA 5DCDA 2PCQA 2VFHA 2QUTA 3FS2A 3THAA 3QH2A 4CNNA 2QCCA 1JCJA 1KV8A 3G1YA 3EX6A 4YL2A 3G0SA 2DZXA 2X2GA 1VCGA 1VYPX 4S2BA 1OYAA 3G1VA 3UXAA 1LRQA 5KSWA 3N73A 3BLEA 1GTEA 2WSRA 4OE7A 4HSNA 1TPEA 3G8RA 4UMCA 3N34A 4H3DA 3TCEA 3W2UA 4NXSA 1W0MA 2ZRUA 1Q45A 1B9BA 4ZVJA 1PV8A 1FXQA 2JKPA 3GXPA 3BGGA 3BK0A 1OHLA 2ZA3A 4FX7A 3M47A 1FBAA 1KFJA 3QC3A 3TC7A 1OFRA 5I3JA 2G96A 2TMDA 5AYYA 4O14A 1TPDA 4UTKA 1H7XA 4HT3A 4I7WA 3INPA 1W3IA 5G1YA 3PB2A 3AJXA 1XM3A 2EAWA 2ZTKA 4O1CA 1WDWA 1VHCA 2VFFA 2Y62A 5HUOA 1F76A 3TMLA 1DQWA 3V75A 3W2JA 4FNTA 1OFEA 4RR4A 3KXQA 4QM1A 4ZQPA 3NO5A 3IIOA 5AFDA 3EWZA 3DXIA 3W1AA 2ZRXA 3A21A 1YXCA 3TQKA 3BGJA 3C52A 1LM1A 3DENA 2VENA 3N19B 4RK8A 3AO0A 5KMYA 1SPQA 1OK6A 5K9DA 3FLUA 1TPC1 5IBXC 3NR0A 4HNUA 3PVFA 4DBDA 4ZQCA 1NVMA 3LX9A 5TBOA 3O6YX 1LRTA 1RPXA 2CLKA 4WUIA 4Z1DA 2YYTA 5K4ZA 5CZSA 4A3UA 3LLFA 2NXHA 3L2IA 4FNSA 3CPRA 4QISA 4WD0A 5KINA 5E0KA 2ZZ2A 2ALDA 3O8AA 1HL2A 1HG3A 4UTTA 3NM1A 2NUXA 3YPIA 1MEWA 2ZFAA 4LVBA 3S1VA 2HS8A 1GJPA 2E09A 3GDMA 4LTSA 1TV5A 3M5XA 3S5NA 1OFAA 3ZR4A 2JKAA 4PL1A 1TPWA 2I1OA 2QCHA 4KFNA 3T4CA 4M19A 3IIVA 4R53A 3OEXA 1FDZA 2ATMA 3W73A 3V1PA 3WJZA 1JCMP 4O11A 3EEGA 1XC4A 4JTHA 1DBTA 1W56A 4M7SA 2X30A 1B3OA 1SO6A 2OMAA 3TSBA 6ALDA 5LKYA 1G69A 4JDBA 1W3NA 1ZY9A 2A5HA 1GTHA 3EWUA 3LLDA 3U2OA 1H51A 1YDNA 3R13A 4DELA 1MXSA 5K9XA 3HJZA 2DZWA 4AHPA 1AW1A 3QQ1A 4W9TA 2Q8ZA 3UWUA 2VXNA 4JTFA 1L6WA 4MZYA 1TJRA 2QR6A 3DGRA 2WOQA 3HQ1A 1SW0A 3T40A 1VZWA 1JR1A 3BG9A 1XL9A 3I68A 1F2JA 1YXDA 3PUOA 3MO7A 1B57A 1X1ZA 3PS7A 1OFBA 3O16A 2PC4A 4S2CA 3LXAA 3HGJA 4JN6A 2ZZ3A 3EXSA 4ZQRA 4CNOA 3TAKA 4O50A 1N55A 3ZWSA 1A53A 4AWUA 2EF9A 1HFBA 4WOZA 3UY7A 1TTQA 1YXYA 4A2SA 1R46A 2WNZA 5D2XA 2YGYA 4LRTA 1QOQA 2EGZA 1ADOA 3NQEA 2O7QA 1ZHAA 3TH6A 3H54A 3F4WA 4WZHA 2BZNA 3G18A 5D38A 1DOSA 2RKXA 3PAJA 4DF1A 1KBIA 3QZEA 1IF2A 2BWGA 4UMAA 1IXOA 1MZHA 1W37A 1K7XA 4O54A 4ZQNA 5DLCA 1KTCA 3DFNA 5L9FA 3G1FA 4XUGA 1GG1A 1FCQA 5TQLA 4NNAA 2GPTA 3UXDA 1XUZA 5FESA 1DJNA 1G67A 1R30A 4AF0A 5G2HA 1AMKA 3C56A 5C5YA 4DPPA 1VH7A 4GUIA 3ELFA 4E38A 4DF2A 2B4GA 2YXGA 2V81A 4NX5A 4AMAA 2Z1BA 4MFDA 3GKAA 1PHWA 4ALDA 1PIIA 3PF3A 3UYCA 1IGSA 3RLUA 2B0MA 5J5RA 1JQXA 3MJYA 5U7SA 3UNDA 4KFPA 3UPBA 2WNQA 4IMDA 4JS3A 4ICNA 1THFD 1YPIA 1ZCOA 4BFAA 4JTJA 1ONRA 3WJYA 1QCWA 4NJGA 1TPB1 4ZQMA 4M6PA 5D2VA 2W0UA 5G2IA 1JCLA 2ZRYA 2QJGA 3LB0A 4Y8FA 4UCGA 2XFWA 4LC8A 1VCVA 4O4WA 3BG3A 3MI3A 4IMGA 4KKXA 2V82A 1EUNA 3TKFA 5HR7A 3EKZA 2CLIA 4JY9A 4MY1A 1I8JA 3CEUA 5A5WA 4IMEA 4GUGA 1AK5A 2E5DA 3GNNA 4M5PA 3GXNA 3W1LA 2A7RA 5HR6A 3QMRA 4BI5A 4XTIA 3M5YA 5HMSA 1UJPA 3L0KA 4DQWA 1YDVA 4ZMGA 1W5QA 1H7OA 3SGZA 4Q4KA 1DL3A 2FFCA 3G24A 1GOXA 1WBJA 1G4PA 2XN1A 5E1QA 5BNKA 2CZEA 3QF0A 1S5VA 4O57A 3MBDA 3QMSA 4Z0JA 2A85A 3NDOA 1NF7A 5DELA 1FCBA 2F84A 3TFXA 1Y0EA 1A5AA 3GXTA 8TIMA 3VKJA 4PCFA 1YPFA 4NNBA 1D3GA 3FYPA 4EF9A 4JTGA 3NQ6A 3FFSA 3L5AA 2A2IA 3QJAA 4WY0F 2Y7FA 1K8XA 5FEPA 3W87A 2CLFA 3C2OA 3W7PA 1FCVA 4IUOA 3LM7A 3PUEA 3DKJA 3GAKA 3F03K 3W1NA 4N4QA 4R34A 2CLHA 4LUJA 1G4TA 1Q6LA 1UUMA 5AN7A 4O53A 2ISWA 3A24A 1YTKA 3T7VA 3LXCA 4IPIA 3O07A 2V0TA 4LVFA 1UBSA 4WX2A 3G1SA 3ABSA 3NYZA 3P5ZA 3G1DA 5FF7A 3NOEA 4E2DA 1I2NA 3IVSA 3NQ2A 3LHZA 3STEA 2BXVA 1GZGA 3GB6A 4ONVA 5DY3A 3LXBA 4S1FA 4N9DA 4O4VA 3ATYA 1GEQA 4LOCA 3S1UA 1K8ZA 2CZFA 5LNVA 3KRZA 3TK7A 4JYEA 5D05A 4O13A 4YCPA 1KFEA 2R8WA 2V30A 4LW7A 2P0OA 4GUHA 4IJBA 3TX9A 3VE9A 2NXGA 2I14A 3Q94A 5CPLA 1FWWA 2C13A 2LLEA 1HO4A 2Z2UA 1K7EA 1F05A 4CCCA 3NZ1A 3QSTA 1ALDA 3P84A 4MLJA 3W75A 3W7OA 4O18A 2WV8A 4MJMA 1JRCA 3VI2A 4JXCA 5LGXA 3KVKA 3PR2A 1SZNA 2OCZA 3L9CA 1P0KA 2VEPA 5AHNA 2ZCGA 4XKYA 1H60A 2C1HA 4JIQA 1EP3A 4K6AA 2QUUA 4GNJA 1LRNA 3SW6A 3UWQA 1ICSA 1UB3A 2C6QA 3C2FA 3MW7A 5C6MA 5G2WA 1VLWA 3NQGA 3TA6A 4K8EA 5LNUA 1EIXA 3CQ0A 1YTDA 4E2BA 2E6DA 5I3IA 1JCXA 1PCKA 1GVSA 4UNLA 2CFFA 3DI0A 2HSAA 4O0ZA 3W9ZA 3NZRA 3N2XA 3TNOA 1TV8A 4BI7A 1GVOA 2Q3OA 5FF4A 1GG0A 1XFBA 3WJSA 2QEZA 4AXKA 3DFOA 3GDTA 3STCA 3S5OA 5EKYA 5EPDA 1GVFA 2O7SA 3TU9A 1FWTA 4N4PA 3P8IA 1NAL1 5EL1A 1KM1A 4EOUA 4LRSA 3FEMA 3S6DA 3OHIA 1LOSA 1VYRA 2FPYA 3FIGA 4HSOA 1XUUA 3GK0A 4N2YA 1QPNA 2EKCA 1AL7A 2G5WA 2WJZA 4HNVA 1OYCA 4ORIA 2YSWA 3EX1A 1RQHA 2ZA2A 3L21A 4BR1A 1FWRA 3FKRA 2E6FA 1M7PA 3KRSA 4MY8A 2F7FA 4MLRA 3SZ8A 2QCEA 2A6LA 4MUZA 3WJXA 1LTDA 3CLMA 3E9AA 4QQ3A 4R33A 1EWDA 5HULA 3W7MA 3NQ7A 4O17A 4KWWA 3FA5A 4POCA 2RH9A 3IVTA 5D37A 4FX8A 5KITA 3BLIA 3RLVA 4JIPA 3IV3A 2DZVA 3OA3A 2CLOA 3NPWA 5EMUA 2VELA 4UC5A 4DO6A 1R2RA 3P82A 4UNKA 1H5YA 3TFCA 3G0XA 4J9JA 5BMWA 1YLVA 1ZJIA 3TMQA 4BK9A 4PH6A 3G22A 5LNWA 3M7WA 3C4UA 1A5CA 4RKAA 3EWYA 3GIYA 4UR8A 2V8ZA 1OF8A 4O15A 1P0NA 1QWGA 4XBKA 2E6YA 2NUWA 3GR7A 1D9EA 1VJIA 5DXYA 3W7NA 3W1UA 2BLEA 3BW3A 3NQMA 2WNNA 1VC4A 1DHPA 3FOKA 4N9EA 3L0GA 1H7NA 3W7GA 4NXKA 2GOUA 1K7FA 4GWEA 1KM6A 3B04A 2P10A 4Q33A 3S8HA 4IOTA 2WSYA 1G4SA 1SSGA 3B05A 3DI1A 1SO5A 2ZBTA 4RV8A 3S5YA 1C9DA 2Y61A 3PBWA 3W7KA 2QKFA 3DFPA 1XXXA 2I9EA 5G4WA 4EVZA 2FQIA 3O6DA 3Q37A 4K38A 1ICQA 2VC6A 1ME9A 3C3NA 1JQVA 2W79A 4X3ZA 3TIMA 5LHFA 4N9CA 4HNNA 3W7EA 3C2RA 2GJLA 3KFTA 4Z0SA 4BWLC 3TJXA 1OVDA 3NVTA 5CKSA 4UXDA 4GE8A 4WOQA 1I2QA 3CM4A 3D0CA 4MZ8A 3QYQA 3GNDA 5HNRA 3M43A 5ABTA 3R12A 4C1LA 2E1DA 3NL3A 3NL5A 3W7HA 1XI3A 4ZQOA 4OGZA 1TTJA 3M44A 3UY8A 1E51A 3M41A 2C3ZA 3CEPA 4YWIA 4LS1A 1DV7A 4DPQA 1FWNA 4IXHA 3S1XA 3W07A 3UPWA 3I65A 4A2RA 3P7YA 3IIZA 3G3MA 4UTLA 1OABA 3RNDA 1W1ZA 1EWEA 4LT9A 4K7YA 4NVTA 1VPXA 4MOZA 4QNWA 4X22A 5CSSA 3MYPA 4JTIA 2H90A 2Y7GA 3EX2A 4TR9A 3T44A 2B7NA 1HO1A 2A7PA 2KZHA 4MIMA 2R91A 3OG3A 4ZZ9A 1O95A 1QMLA 3TSMA 1ZAIA 4Y9AA 3VE7A 4PODA 1SSDA 1J4EA 3W72A 3TAOA 4UFLA 3KVJA 2C0AA 1PL9A 3GDRA 4NNCA 2QCGA 4HIBA 1JCNA 3HMJG 1ZENA 3M1ZA 2JBMA 4HHPA 2DU2A 4LNYA 4UTHA 1H50A 1A5BA 5I3HA 1QNVA 1K03A 3BARA 4BWLA 1I45A 1LDCA 4Q32A 1P5BA 3MWAA 1TPVA 5D30A 5H91A 5HQEA 1SW7A 1VQTA 4IMCA 3NPVA 3E02A 3C61A 2ISVA 4MVAA 3H55A 2DJLA 4JNMA 4AHQA 2BTMA 1OFOA 2G95A 2VFDA 3B06A 2FB2A 1TQXA 2YFOA 3LHVA 2QCFA 1SFLA 1RR2A 3NGJA 2J88A 4UFMA 5I3GA 4NZJA 3FKKA 4H4IA 4FIQA 3SR7A 3IVUA 1GVRA 1KV5A 1SU5A 4RXFA 2V2CA 3GVGA 3LCGA 2OX1A 3LDVA 3JRKA 3GKFA 3EKLA 3EXTA 2NXIA 4AF0B 1QAPA 3Q2DA 2ABBA 4UFKA 3TROA 3STGA 3QPZA 1YYAA 5KZEA 4EWND 1OX4A 1WAUA 2VFGA 4XWUA 1XKYA 2RDTA 2H3BA 4RJEA 1S5WA 3PB0A 4O10A 1Q6RA 1F6PA 3PBVA 3PSWA 1EB3A 4Y90A 1Z44A 3DU0A 1Q6QA 5KZMA 3IGXA 1KA9F 5K4XA 5D2YA 4UTMA 2DORA 1LCOA 3HO8A 3HPZA 3QW3A 1WBHA 2ISSA 4IGHA 1BWLA 2ZRVA 1A50A 5HWNA 4LC6A 4PFMA 3PSVA 4RX0A 1T8XA 3LHTA 3MHFA 4X9SA 5G1TA 1KLYA 2YZRA 1BTMA 3S0CA 1LLWA 3NQCA 1WA3A 2ZZ5A 1O94A 4CCEA 2J6XA 2FLIA 5GVJA 3LCIA 5AHFA 4CLMA 3S1WA 3K30A 5FF0A 4H6KA 1KW1A 3L5LA 2VKZG 3OVQA 2ZZ6A 4JX5A 2X1RA 3ZS4A 3W22A 1I2RA 1L6SA 4IMFA 4JTKA 3LRLA 4Y6GA 1TQJA 3ANYA 3BVJA 4BI6A 3HOJA 3MUXA 1H62A 4P2VA 1UCWA 5DN1A 2X16A 2VEIA 4NJJA 3G0UA 4WJEA 3E12A 1SQ7A 2V9DA 1J5TA 4PTNA 3OVPA 1QPRA 4Y96A 4K36A 4BF9A 4JICA 1FXPA 4YCOA 2CW6A 1TJPA 5FF2A 3DBPA 2GQAA 5D33A 3Q58A 4Z08A 4NU7A 1NSJA 3LHYA 5J5DA 4TIMA 4XQ6A 4AH7A 1YTEA 5E93A 5EA9A 3DHDA 3M6YA 4LS0A 4OV4A 4MYAA 1C8VA 4XBSA 3SJ3A 3NG3A 4UFJA 2B7PA 3LHWA 1QO5A 3KVMA 5AHMA 2XN2A 1SZEA 5FEWA 3EX4A 3BPWA 2NUYA 1S3HA 4N9BA 1O4UA 1X6UA 1U83A 4YLWA 4M6VA 3OVRA 4MZ1A 3W71A 1LP6A 5CPNA 3TR2A 2E68A 1HUVA 3M5VA 1W5MA 3A5VA 3IRDA 4GRSA 4K37A 3L66A 5D32A 1SUXA 2Z6IA 3JR2A 1LBLA 3CIXA 1IXPA 4D2JA 4AAJA 3VFLA 2ZRWA 2FB3A 4CNPA 2WSQA 2YPIA 5LZLA 1VR6A 3OIXA 4HPJA 1AG1O 2R14A 5CSRA 3B0PA 1MSSA 1KM0A 3W7LA 2CLLA 2YDAA 2YW4A 4RCXA 5D2WA 3WK3A 3LCLA 3NQVA 3P60A 3LRKA 4ADSA 3E96A 3NQ8A 1TPFA 2CLEA 3I7SA 4GXMA 3ABQA 5F1UA 3TW6A 2AGKA 3B8DA 2E5CA 1WYIA 4NZFA 4MYXA 5HWMA 3WK1A 2OT0A 3NL2A 4E0CA 4I7VA 1WOAA 3CC1A 1OFPA 3C2EA 3MHGA 3HPXA 4O19A 2RDWA 4AHOA 4QAIA 2Y70A 3HG2A 4JTSA 3CWNA 3VCRA 2VFIA 4N02A 1YDOA 3P5YA 4UMBA 3W84A 2XN0A 4PL2A 3GR8A 3LERA 4M6QA 4O28A 3W3OA 4UFHA 3U8GA 4JTLA 3STFA 2QJIA 3W88A 2H3DA 3GX9A 3N3MA 3TUUA 3TE9A 5BRBA 2VEMA 3MI6A 4YXGA 3W1PA 3GLCA 2RDUA 2ZYFA 3W1RA 3NNTA 3HPSA 5U4NA 2NX3A 5DXXA 3B4UA 2ABAA 5K3VA 3IIXA 1XBZA 2WQPA 3LV5A 5DBUA 4CQ8A 3SFKA 1VYSX 1JULA 3IEBA 7TIMA 3N9SA 5AB3A 4PA8A 1O5XA 3W83A 3TQ0A 2CZDA 1XBXA 1U5JA 3BV4A 3EWWA 2OJPA 3CHVA 3NL6A 1TTIA 1NFBA 2QAPA 3VNDA 4FHAA 3I7QA 3MMTA 3THQA 1N8FA 4GUJA 4WXYA 3O05A 3B03A 3T55A 1SO4A 3UWYA 2JGQA 1OX6A 4FIRA 2IQTA 2GVLA
chains in the Genus database with same CATH superfamily
1XLEA 1K9FA 1OFDA 1GQIA 1Q65A 2P3EA 1GVIA 3NAVA 1F73A 4F2UA 2X1TA 3QKEA 4JQ2A 2WHMA 1AJZA 3PTKA 3HGRA 4IL2A 1TKKA 2P1FA 3IPWA 4NP7A 4UOQA 1YBQB 1Q3NA 3KE0A 2WZHA 4FAMA 3SUVA 3WQ6A 1YX1A 3WLSA 1V6UA 3VFCA 4PMJA 1WQ5A 2ZXDA 1XIJA 9RUBA 3QM3A 4HNOA 4P8VA 2D3LA 2E8ZA 4AWTA 3CV7A 1P1MA 3IUDA 1POKA 4TU1A 3ZOAA 1JDDA 1R8LA 2OYLA 5RUBA 4PTXA 3PG9A 2PLCA 4QNEA 2J66A 2VO5A 3SAZA 4F4RA 1C90A 3QY8A 4GQRA 1QATA 1XD1A 1ZLPA 5H2ZA 4FNUA 3PPCA 3VTRA 1CB2A 1KFBA 1S1PA 3LI1A 1AW5A 3STPA 4J3VA 1XIHA 1TB3A 3BW4A 3KTCA 3EB3A 2CBUA 3KHDA 3UD6A 3EDEA 1YNPA 3IACA 1T7LA 1F74A 4G1KA 3PY2A 1KQYA 1X98A 1B3XA 2PGEA 4HU3A 3R8RA 3VC6A 4RNFA 3LOTA 4JX6A 1BVWA 1H3GA 2C18A 5M03A 1ME8A 3WDJA 2W61A 4J28A 1XGZA 5FF3A 4B5UA 1KLZA 3LPPA 3SADA 4HYRA 3W01A 2I5GA 4JAWA 1T8QA 4PE8A 4HHHA 4UR7A 2PI6A 5AHLA 1C93A 4E2OA 4L4MA 4C60A 5EMLA 4IIEA 5G5IA 4JY8A 4AD5A 1J2WA 4NUWA 2Z1SA 3ARZA 5KZDA 3MA8A 1FCUA 4DXVA 1O5RA 3GXMA 3ZT5A 4E8GA 3MUY1 3WH7A 5I06A 1NH6A 3V5OA 4MPQA 5C0QA 2R24A 2X1UA 4H9MA 4QITA 2RFGA 3PANA 3W7IA 2O9PA 4XZMX 3U6WA 2BVWA 1ISVA 3NQFA 2DW7A 4A3QA 4AIOA 1WB0A 5HDRA 2Q3RA 4GO9A 2ACQA 1GOWA 4IIGA 1R9XA 2W9MA 1KRCC 4TO8A 2VX4A 3IGUA 3C6CA 3W1QA 1BXBA 5FKYA 1CW2A 2QAFA 3HFYA 4M82A 3S9ZA 4CD8A 3OU8A 4XZ9A 3T9PA 5ABFA 4MKNA 1Q6EA 3EB2A 4XAYA 2V3FA 4CD4A 3KWSA 4KRUA 1PDZA 5F4WA 3R89A 3P67A 4E3TA 4E8DA 4M8UA 3M0JA 4QFUA 5C9WA 2CZVA 2WMFA 3P74A 1RCQA 4GHRA 1OX4B 3K1GA 2JIEA 3GAYA 2ADAA 1J0KA 2OEJA 3VNLA 1T40A 1K4HA 1LT7A 2VX7A 1Y5WA 1M6JA 4RZ5A 2YCLA 4I9JA 1A5SA 1DXFA 1NEYA 4BY3A 4IXXA 2XIJA 3N25A 4B5SA 2X2YA 2VQTA 3ANVA 1RXOB 2PWVA 4FMVA 1BTCA 1M7XA 5HMDA 3CMJA 2NQ9A 2TPSA 1YADA 4ZO6A 1JD9A 3BURA 1DP0A 4L65A 1H7RA 3AAMA 4OV9A 2J9ZA 3KVLA 2FZDA 4IGMA 4HMCA 3WDPP 3FJ6A 1CIUA 2PDJA 3MJMA 1QI4A 2V68A 3I4KA 3T08A 1WZLA 3SURA 5GNXA 3E0IA 4GUFA 4Q4QA 1O60A 4RNIA 4QE4A 2Y7DA 4UBPC 5MKGA 3UWVA 5E9AA 4M7TA 2OT1A 1FUYA 4GJ1A 2E25A 2QF8A 5CZJA 1EP1A 1PZ3A 2X1SA 1FDYA 1CGWA 5CG0A 4FK9A 2EEXA 1FX6A 5HQLA 4K7VA 2WYSA 3VABA 1DHKA 2ATSA 1E6RA 3QTGA 1ZBVA 1OBAA 2BGSA 3T78A 4JN8A 5A6AA 3LCWA 3RX3A 4F0RA 1HW6A 4O1DA 5K9CA 4X60A 5H1WA 1HIZA 4I3GA 3NFUA 5T91A 4YVVA 3BH4A 2BGNE 4QX4A 1AQMA 3TDFA 3U4AA 2JIWA 1E43A 4OVXA 2I57A 3WNNA 3GZ3A 1KRAC 1W9XA 2UY3A 3U7VA 1R86A 1PXGA 2Q02A 3HZ3A 4JDYA 3UNTA 3UZ5A 2QCDB 3M0XA 4PEEA 3C8NA 1RVGA 5FL1A 2J7HA 2QW5A 2V6AA 3BXWA 6CGTA 3EBVA 4IG2A 4KPLA 5DCBA 3SN1A 2Z29A 3K5XA 3P3BA 1BSLA 2CLPA 4GVGA 2J27A 1DQXA 3LENA 3U5UA 3VCCA 3E49A 1XH2A 1F3TA 3L5MA 1X8FA 1KBJA 4O12A 1ZQ5A 2JK2A 3LNMA 3TYDA 3EPNA 3B9DA 5CZTA 1MQPA 3WF3A 1EPXA 1LBMA 3H22A 3KS5A 4MY9A 3UGVA 4AEOA 3NM3A 1ZU8A 4O0QA 4NJKA 1HZYA 4OQVA 1GKPA 5I02A 1VENA 5T9BG 2QUMA 4CQDA 2Z7GA 2FH6A 4KEMA 2IPWA 4G9PA 4K39A 4KS0A 2CBJA 3T6CA 3GUWA 1RD6A 1DIEA 2UBPC 1REQB 4UIOA 1GKQA 2XGZA 4DBEA 3NSNA 1K02A 5D09A 1CT5A 2PDWA 4UTWC 1IE7C 4AD3A 1LQAA 5E6ZA 3O6CA 5D02A 3DHFA 1H09A 3TC6A 1FHVA 5DY2A 3KL3A 3LV6A 4JL1A 4LF1A 1U5HA 1DIDA 4LVDA 1XLAA 1M3UA 4QSHA 1MUMA 4B3LA 3DUGA 4DRSA 3CLWA 3A64A 4NI3A 1W1A1 2DSWA 2BODX 4Q7IA 1VHNA 1CXHA 4FX6M 3WH6A 4HTBA 4BHYA 4ATWA 4E4FA 1E4NA 1KTNA 4AVFA 3CPUA 4GVHA 2FPVA 5K2ZA 5BOOA 2W62A 3HFTA 2PRMA 1W6TA 1XRFA 1W1TA 3LCFA 2VDGA 3GG0A 5J8LA 2PURA 1XH0A 1PO9A 5HA7A 4GYPA 3M0LA 5AECA 4XAGA 4PMZA 3U3HA 2YCLB 1FWIC 4XD4A 4GVIA 2YJQA 4JNYA 4DF0A 4EIVA 2C1GA 5ECUA 1KM4A 4B4FA 3GDLA 3PZTA 3J7HA 2F9RA 3W76A 1VLIA 1MUCA 5LIUX 3ABXA 3GTFA 1S3TC 3KP0A 4QG6A 1R0MA 2PGWA 3VNYA 3CIWA 3K2GA 4IFKA 4JTEA 2A3CA 1AUSL 5HOSA 3WSUA 1Q6CA 4NRSA 2XVLA 2GWGA 3EXRA 2YOCA 3HF3A 2Y6ZA 3RPTA 3UWZA 3RGTA 2GVGA 3C8FA 2GUBA 3HGOA 6XIAA 3WLKX 4ZENA 3PBYA 1HGYA 4IISA 2AQOA 3CTLA 3JZEA 2VC7A 3A9IA 5I6SA 2YL9A 3VD9A 3EWCA 5EY5A 1RQEA 1J6OA 3O1NA 2PRLA 1KBKA 1GWJA 3M5ZA 4YYCA 3R0DA 2J74A 1V8EA 3UERA 4S3KA 4HU0A 1EX5A 1W54A 3IGSA 3O63A 3L0NA 2FHFA 2D0HA 1Z41A 4UNIA 3T0CA 1DKWA 3H21A 4DZHA 3WUBA 3ME3A 4Q6JA 4Q8PA 2E1WA 1XLIA 2D1ZA 2O55A 3WQWA 4KFOA 2AQVA 2O56A 1ENUA 3OW1A 3VIGA 3MT1A 3THAA 1IT8A 4YL2A 3LA4A 4EKJA 3W81A 2PDUA 1VCGA 4GYPC 4LSBA 1OYAA 2Q6ZA 1KCXA 1LRQA 5KSWA 1WUFA 1Q63A 4IGNA 3WNOA 1VBRA 1ELSA 1TPEA 4GH3A 1XWYA 3SUWA 4H3DA 3TCEA 2WWCA 1W0MA 2ZRUA 2J7GA 4DJED 4ATLA 1B9BA 4C7FA 4H2HA 1H49A 3BAIA 1OHLA 2HE5A 2A3LA 2VWTA 1FBAA 1KFJA 2HCVA 4O8AA 1EZ2A 3GE7A 4KGLA 1T6MA 5I0DA 1QJWA 1RY8A 4I7WA 1W3IA 3PB2A 4O1CA 3CZGA 1WDWA 3OLIA 3IJQA 3JZUA 1PSCA 1ITCA 1OT2A 3V75A 1E5JA 1SR0A 3W00A 1L6FA 4PMNA 4K8GA 4GFIA 2GK1A 3C52A 1LM1A 2VENA 5HAOA 3GHUA 3AO0A 1A4LA 1OK6A 1PB0A 5E70A 3BDKA 1TPC1 4HNUA 1H11A 2XU2A 3KOWA 5TBOA 3BE7A 2CLKA 3QBUA 3SCVA 1XD0A 3KRBA 4A3UA 1BYBA 3NYDA 4OZOA 4FNSA 2O9OA 3VA8A 2ZZ2A 2ALDA 2WMIA 1HG3A 4H8UA 3E2SA 1M7JA 3NM1A 1MEWA 3S1VA 1H0GA 3H2AA 5HXMA 1HGWA 3ZR4A 2JKAA 3GWQA 2Y24A 2I1OA 1NDVA 1QNRA 4AFYA 2IMRA 2PTZA 2Z24A 4YTRA 3IIVA 1V02E 4R53A 4AU0A 1BRLA 1F8MA 1CXKA 3R58A 1JCMP 3N13A 3EEGA 4O11A 3DBNA 1J5SA 1IR2A 1B3OA 2OMAA 1G69A 1W3NA 2WCAA 1ZY9A 2A5HA 4LF2A 3LLDA 1H51A 1YDNA 4DELA 1GJWA 1AW1A 3QQ1A 3UCCA 3XIMA 4GI6A 4W9TA 4F2TA 2Q8ZA 3UWUA 4JTFA 3GH7A 1L6WA 3UYIA 4D71A 3F5KA 2WOQA 2IQ0A 4HGXA 3HQ1A 3T40A 1VZWA 2NLYA 1KD0A 4D6EA 1XL9A 3AMKA 1FOBA 3QV6A 2PC4A 2QGHA 4YJ5A 4CVWA 1US0A 4AC1X 3EZ4A 3HGJA 4AUBA 2FMOA 1K8CA 2Z2BA 2EPOA 1XIGA 4I5RA 3UY7A 1TTQA 1D7KA 1ZB5A 2WNZA 2DGAA 4LRTA 4CNSA 4MJ2A 3VOIA 4UQ9A 2OVLA 2O7QA 1CGYA 3THDA 3F4WA 6REQA 1V6XA 2BZNA 3KZPA 1P7TB 1TR1A 2RKXA 3GXFA 3CHDA 4DF1A 4Z2KA 3QZEA 3UXIA 2BWGA 4JKLA 4UMAA 4O54A 4GI4A 4ZQNA 5DLCA 3DFNA 3G1FA 5CPTA 1C7TA 1Q6GA 3URNA 3TA9A 4QR6A 3SCPA 5FESA 1R30A 2I56A 2QPXA 2VX5A 4A8NA 5C5YA 4GUIA 3ELFA 4AVOA 3R11A 2B4GA 2V81A 3VGFA 1JZ8A 4ALDA 1PIIA 1ONEA 1IGSA 4DNMA 2NSOA 6PTDA 3BTNA 5GPRA 5ABHA 3OZMA 4LCSA 2HWGA 3MJYA 2YIHA 3UNDA 4KFPA 4IMDA 3T0BA 4NZ3A 3OGSA 4L1WA 5C7HA 5EMYA 3GTXA 5A6TC 1ONWA 1ONRA 1PKYA 3WJYA 3ECQA 1TPB1 4ZQMA 4M6PA 1JDAA 3MCMA 4HVXA 2ZRYA 2FKPA 1Y7VA 3LB0A 4PUWA 1DJGA 2YLAA 1VCVA 4O4WA 1A5UA 1KFWA 3BG3A 4IMGA 1EUNA 3LPOA 3CEUA 5A5WA 4IMEA 3RO8A 4GUGA 1RUSA 3RU8X 3UG8A 3AICA 5HR6A 1Q7ZA 2J7EA 1E4LA 3WZ0E 1YDVA 1W5QA 4V28A 1G0CA 3NWRA 4FXFA 1GOXA 5E1QA 4LYRA 2QGYA 1WKEA 3KBSA 3BCJA 2CZEA 1J96A 4F0SA 4CNTA 3NDOA 4E3VA 3HQNA 3B9NA 1K4GA 1A5AA 1JDCA 1YPFA 3COTA 3VUPA 3CYVA 2D2JA 4MJ4A 2Q01A 4WY0F 1K8XA 3W87A 3TYUA 3PNZA 2CLFA 1NFGA 1FCVA 4DHGA 4IUOA 5JH1A 1NOWA 1VRXA 1KB3A 4KRTA 3MO4A 4GQ0A 4C6LA 2CLHA 4KCTA 3MU7A 3CUZA 1Q6LA 2DSUA 4O53A 2PCEA 4KEVA 3A24A 5REQA 3O9NA 3O07A 2V0TA 1UBSA 2DIKA 2WWDA 3PZMA 1QNPA 3NYZA 1V08A 4M6UA 3F4DA 5FF7A 3NOEA 4DJFA 3STEA 4D8AA 3KL5A 1UZ1A 5DY3A 1IZJA 2YL8A 2DZBA 1NOUA 3WEZA 4GH1A 2FYMA 3KRZA 1D8WA 4CD5A 4YCPA 3TONA 1W2PA 2EG6A 4E4UA 1XQKA 4RV3A 3TX9A 3Q94A 4D1IA 2CHOA 2LLEA 1HO4A 2Z2UA 4CCCA 3T2QA 2P0IA 5TD4A 4JPGA 3QSTA 1ALDA 3VI2A 3W38A 3ID7A 3VD7A 1VAHA 2VEPA 1WXZA 2YDRA 1H60A 3TR9A 2R1MA 2QUUA 4IQDA 4BQ4A 4DLFA 4F66A 1G5AA 3UJSA 1RVKA 1I1XA 4QDMA 4IP4A 3DDMA 2VNCA 5LNUA 1JGIA 3LYEA 3HMCA 1YTDA 3REQA 4E2BA 4UQBA 3R8GA 4F3HA 4UNLA 3DI0A 1ZCCA 2HSAA 4O0ZA 1VFUA 3N2XA 4HNCA 2BG5A 3MKCA 1GG0A 3T2PA 3OTRA 3BAKA 3GDTA 4L9YA 4QQUA 1P43A 3S5OA 5EKYA 3KUMA 3PP7A 3U48A 2VHLA 1BYCA 3P8IA 5EL1A 4EOUA 4LRSA 1UA7A 3H2CA 7REQB 1VYRA 2FPYA 3S47A 2BY3A 5CBBA 3WBYA 4N2YA 1TV2A 2OQLA 1AL7A 3GW3A 3GHSA 1XYFA 1NOFA 3WLQA 5CSUA 3VX1A 2YSWA 4WK9A 4QXIA 3K4DA 4W5ZA 2BOGX 3KRSA 1YIXA 3T8LA 3PZGA 2QCEA 3F2BA 4QJ5B 5AC5A 2A6LA 3CLMA 3LU2A 3JVAA 3E9AA 4R33A 5HULA 4NY2A 5EGRA 3NQ7A 4O17A 1B3WA 3P14A 2HBXA 1UD8A 1HJXA 2QIIA 2W4XA 3IVTA 5D37A 1O66A 2QXWA 2OGYA 2NQHA 1RJPA 4M80A 3C0QA 1FWDC 1W3KA 4X2PA 3EA3A 4PUJA 4C65A 2XWDA 1O5QA 1KXHA 1H5YA 5ENLA 5BMWA 1ADSA 4ILSA 1XG3A 1YLVA 3AU2A 3G22A 1XC6A 3C4UA 3FX4A 4RKAA 4AXNA 3VDCA 5ABEA 4H7CA 4PMRA 3CZKA 1YEYA 5DXYA 3W7NA 5B7YA 2HISA 3NQMA 2PAJA 1S2WA 3FOKA 2WAGA 4EK7A 1K7FA 4GWEA 4DWSC 1KM6A 4Q33A 2WSYA 1G4SA 3B05A 3R43A 2ZBTA 3KS6A 3WQ8A 4RV8A 2Y61A 3PBWA 1OGBA 3W7KA 2QKFA 2PLJA 1ICQA 2VC6A 3NO3A 4R9OA 1ESWA 4FXJA 2GJLA 2NVCA 1F4AA 4M3PA 3BLPX 3W02A 3KFTA 1R9ZA 4DJDD 1I2QA 2CEQA 3GZAA 5H8PA 1JZ6A 3CM4A 4MZ8A 4XZHA 3ZT7A 3H4XA 3VYLA 2OU4A 3GNDA 5HNRA 3SUSA 2BOEX 4C1LA 4L61A 4X0VA 3NL5A 3W7HA 4QGCA 4C6DA 1B30A 4JIHA 4YWIA 3VD5A 4DJDA 4US5D 2VGBA 2PWHA 3W07A 3K46A 1BPLB 4HOWA 3W4RA 3HA1A 4UTLA 4V27A 4K2SA 2HK0A 1JPIA 1VPXA 4MOZA 4QNWA 4X22A 3TYAA 2YL5A 3MYPA 1KRMA 2IXUA 3EX2A 4EP8C 2WXDM 3V35A 3OG3A 1O95A 3TSMA 1XFCA 1TZ9A 4RDYA 4CKQA 1J4EA 2VC5A 2D2HA 3ARQA 3TAOA 1WUEA 1JPDX 1A5OC 5CPQA 2HBVA 3MUAA 2G3IA 4AYSA 3GD6A 3GC5A 1ZENA 2DU2A 2RGLA 4N42A 5JIPA 1AQ0A 1W1YA 1QNVA 4ES4A 1W2VA 2PF0A 1LDCA 1SW7A 1RP8A 1M65A 1VQTA 4WDTA 1F3XA 4LBRA 3C61A 4JHMA 3L4UA 1FTXA 1OQFA 2YA2A 2DJLA 4JNMA 5HK4A 4F2BA 4LAKA 3PJWA 5JVLA 3BJTA 3N2BA 4S39A 2VRJA 2QCFA 3UZZA 2WQDA 1KO0A 2VT0A 1GVRA 1EJ7L 4J3TA 4GYJA 1Z6KA 2PWUA 2QDDA 5M17A 1R9YA 4DX3A 3NUKA 1EPVA 3EXTA 3VNZA 4AF0B 1QAPA 2GUYA 2D24A 2VRKA 1QVBA 1WAUA 2VFGA 3M0IA 4C6MA 3C0SA 3HV8A 4DLMA 1Q6RA 4JNZA 4Y90A 1Z44A 3OGRA 4BS0A 4H9VA 4I5UA 2V5DA 3LSBA 2A3AA 4CUCA 4I6KA 3MKVA 1PAMA 3UG5A 2G37A 4EPDC 3AIRA 3V3WA 3OQ8A 1FKWA 1ITQA 1OM0A 3MHFA 4HD5A 4U5IA 2GFTA 4FSAA 1PEZA 3PZUA 4Q4RA 3NQCA 1J2BA 4OTKA 4CCEA 1LF1A 2FH8A 5GVJA 4U5KA 1XLKA 4CLMA 5FF0A 4H6KA 1KW1A 3VNJA 3L5LA 2VKZG 4JX5A 2X1RA 2DH3A 3NDYA 3W22A 1I2RA 3T0AA 4LNCA 5FJUA 5DO8A 4DXKA 4LUTA 4YTTA 3MUXA 2O4QA 2VD8A 4P2VA 1UCWA 3DG6A 3SQSA 3E12A 4ZA0A 4XIMA 2EPKX 4FOKA 1EC9A 5ECVA 2GDQA 1FXPA 4I90A 1LWIA 3GTNA 2ZE3A 2OPJA 2JF7A 3OYZA 4AX7A 2VGGA 5A2CA 3KDNA 4OV4A 4MYAA 2WZEA 4DJFD 4S3JA 4MADA 2GGGA 1QO5A 3LHWA 5AHMA 1Y65A 1SZEA 1XKJA 2XFRA 3CUXA 3W0KA 1VPYA 4JTRA 4YLWA 4CN6A 3NZGA 1HUVA 2QJMA 4URIA 3IRDA 2GLKA 4WJ8A 5LIYX 4NZ1A 1LBLA 4Y9OA 1MXGA 4IL0A 2FB3A 4C6NA 3BC9A 5LZLA 1B1YA 4HPJA 3OIXA 5CSRA 2O92A 2ZX9A 3B0PA 2CLLA 2YW4A 5A69A 4Y9NA 5D2WA 1BRLB 1BGAA 1PIGA 4RNJA 1KWKA 4HBKA 3RXZA 2G8ZA 3E96A 3NQ8A 2EKGA 4BKNA 3I7SA 3K1DA 1PZ2A 3VM5A 3N6QA 2AGKA 3B8DA 4QS6A 1WYIA 2Y5JA 3R7MA 3WK1A 3T0DA 1WDQA 1UD6A 2ZOXA 4GXPA 3CC1A 2PDBA 3F5LA 3G6LA 2I9UA 2RDWA 4QAIA 2Y70A 1LG1A 4JTSA 4BF7A 1W1B1 4H83A 2GGJA 4N02A 5FSEC 4UMBA 3P5YA 4PMQA 3ENLA 3AS1A 3GR8A 3LERA 4O28A 3UJ2A 4UFHA 4I6VA 4JTLA 3WX7A 2XUCA 3STFA 1X8CA 2WHKA 4PGLA 4ZSUA 3KBVA 4ICMA 3GIPA 3TN4A 3N3MA 1A3WA 1XGDA 4S3DA 4Q8NA 4TVCA 3MI6A 2GK1B 3DN5A 2ZYFA 1LWJA 2Y2WA 3RCYA 3NNTA 4C5ZA 3HPSA 2NX3A 5DMMA 3N9KA 2ISFA 3E6EA 2V5CA 4D9PA 3SFKA 1JULA 2BP1A 4MDPA 1TVNA 1HP5A 2VC9A 4H6QA 4HQVA 2GJXB 2CPUA 2AL2B 1U5JA 3BV4A 5JXQA 3EWWA 2OJPA 2WCGA 3KBWA 4NL1A 4L6DA 2G41A 1WAWA 2PC8A 3MMTA 3THQA 3TW9A 4GUJA 3ERPA 3T55A 3UCQA 3SCNA 1SO4A 2YB1A 2JGQA 3R25A 1B31A 4DI8A 3S2MA 4YNGA 3AHXA 2OG9A 2GVLA 3R0KA 4H01A 2J7FA 3WLMA 5CEWA 4LUIA 2FJUB 2B7QA 4W88A 4IT1A 2YA0A 2JKEA 4L4OA 3P62A 2MANA 3EWBX 3UZXA 5K7JA 4LALA 1E4MM 2QCDA 1LQ2A 3WELA 3AS2A 3WK0A 5D2TA 2YLLA 1FWJC 2D20A 4HNTA 1TV3A 4GJJA 2YCEA 1W5OA 4Q4MA 1MDRA 4RW5A 4XISA 3MYOA 3MP5A 2G97A 2C7FA 3L68A 2GJNA 2H6RA 3TTQA 2DY3A 5AC4A 1Z9AA 4FXRA 3WFAA 4FNPA 2FTPA 3ARUA 3P61A 1IZKA 3V1HA 3R0UA 5C2XA 3BOLA 1XIEA 1DORA 2YCKX 1MFVA 1EUAA 4XTDA 1V0NA 1EL3A 1VFTA 3B97A 5AZ0A 3R2GA 3W70A 4XBJA 3WF4A 5G4HC 4TTGA 1RA0A 4U31A 1VFLA 2E6AA 2BVYA 5F2MA 2QCNA 3I3EA 1A0DA 2BSLA 2WB5A 2Z0IA 1JFHA 1QPOA 3A13A 1E9LA 2GQ3A 1T96A 4QJ1A 1IQ8A 4DIAA 1R38A 3L12A 1B3YA 7XIMA 1OFQA 4XKYB 5HNTA 2CYGA 4KESA 3WUFA 3SN4A 3W23A 3W2NA 4KF1A 1MO0A 2XFFA 1W31A 3DFTA 4O1AA 3WF0A 2NV2A 1GJUA 4Z42C 4LAOA 3TN6A 2I17A 3RR4A 3P81A 7ENLA 3KHJA 1L2UA 3MTWA 1QOPA 3UXLA 5IM51 2NX9A 2HTMA 5HINA 3G3DA 3BAXA 2XVPA 4AW7A 1LLZA 4UUIA 1PTAA 2ZXQA 4L4LA 5HQMA 2CLMA 4Q4OA 1Q6FA 4F9DA 1TWSA 4OUIA 1QWKA 2J8GA 2VR4A 5F4XA 4Q8QA 3W1TA 3I6RA 3N4EA 4R5EA 2E77A 4JIIX 2OEKA 5HNUA 1FY6A 2QDGA 2H8XA 1I75A 4AZCA 3ATZA 4WQ6A 5A8OA 3WMCA 1JFXA 3LLXA 3CV2A 4D6HA 1OK4A 1Y5VA 4JYFA 3GG7A 4DBSA 1DJQA 1HL8A 4N6FA 3U7BA 3LPFA 4JEQA 1I0DA 4JR5A 1FKXA 1UASA 3APYA 2F6KA 4HK5A 4WXZA 5C9XA 1CLKA 3JS3A 5AC6A 4O0KA 4QROA 1HX0A 1IHIA 3ARWA 2OLHA 2VOTA 4AG0A 1TRIA 5GNZA 2Y8KA 4IFKB 4HMNA 1P0DA 2E3ZA 2PP3A 1ODUA 2WKJA 2X42A 3SCUA 3CHEA 2IKGA 2NZLA 3GR4A 1OYBA 1UD2A 3ARSA 2CU0A 3O3RA 3TTYA 2AQWA 2FIQA 2EHHA 5C54A 2DQWA 5BU6A 3K8MA 3USBA 2VMFA 2R94A 1I2PA 2V2DA 3LBMA 1O1HA 3LEPA 1AJ2A 3OQEA 2OWCA 3EYPA 1QI2A 2P5NA 4KEUA 5GJMA 3VOHA 4PRRA 1U2YA 4MJZA 3FJLA 3BZGA 2XGBA 3VO0A 1FDJA 3L4XA 1BG4A 1JIBA 3NA8A 4H8NA 1GPFA 2NQ5A 1YKWA 4J27A 4X63A 1V02A 2X40A 1IXQA 3T2OA 2OFJA 3QXBA 2E9LA 2Y4SA 2A0NA 3WLJA 1AD1A 3PULA 4DJFC 1EF2A 2QUVA 1KXQA 3W7JA 3MP4A 5A2AA 3SCRA 2F6XA 4C91A 2WZTA 2QV5A 4YMZA 4U2ZA 4MB4A 1H1ZA 4OFCA 3LK6A 5CC3A 2C14A 3O7UA 4AQLA 2W6RA 4U3CA 2Q8LA 1R2SA 4IX0A 4C6PA 4EXAA 2QDHA 1LYXA 4XKMA 3MY9A 3WEMA 4YN5A 3B8WA 4O8RA 4U28A 3LGEA 1W3TA 1YW1A 3WQCA 2DVTA 4LV9A 1VBHA 1SR9A 2ICSA 1B54A 1W5NA 4BJHA 4UR9A 1MUWA 4FI4A 3LTPA 4AIUA 1CI1A 4D72A 2EJAA 2PLKA 1AD4A 2ZQ0A 1SZGA 1ZJBA 3FGCB 3U4FA 1V7YA 4LAMA 2D73A 1G7VA 3CT7A 3ES8A 2IUZA 1EGMA 3GH5A 3SO7A 4ZR8A 2ZDRA 3H70A 1UD3A 2C0HA 3CH0A 3GC2A 5F4SA 4V1XA 4LAZA 5BMXA 3RITA 1HKMA 4FEZA 3CUGA 5A8GA 2NQLA 3G2GA 3CAKA 3U2EA 1SJCA 3EKGA 1VP5A 1PCWA 5SWUA 2PRHA 1DWHM 1X7FA 2FZMA 2X7WA 1XR2A 4NX0A 1KCLA 3UWWA 1DIOA 1BYDA 5HUPA 3F4VA 1IWAA 3TW7A 4U4MA 1Q2SA 2GVJA 2RHGA 3DYOA 4PCNA 1FWBC 2JE8A 1EJRC 3TQVA 1TPUA 1L6YA 3EAUA 5DANA 3UXKA 2R1NA 4WKFA 1JZ3A 2YFNA 3WK2A 4MKVA 1E0WA 1FWEC 2ACSA 1AH0A 5CPOA 1UP2A 3L67A 5F1VA 4DM1A 4UTTC 2PDKA 4XD3A 1TWIA 1XBVA 1F6KA 1P1XA 2A6NA 3VILA 2QLYA 2DT1A 1WZMA 1Q2RA 2W92A 3TXZA 2CCRA 1WZAA 4IIBA 2BVTA 2INEA 2W27A 1VFOA 2QCLA 4D6GA 3H4GA 5FJJA 1E6SM 3SCWA 4G6CA 2XIOA 3M0KA 1Q7QA 3RIKA 1TSIA 3TLLA 2DZTA 4KIEA 5D8ZA 2NWSA 3LI0A 3E1F1 5CZ0A 3ABRA 1BWKA 1W8SA 3QKZA 1IIHA 1XBYA 1E1EA 3WLRA 3AIEA 3ZZ1A 1DJZA 4HN4A 3V5CA 5CAHA 2J62A 3OP2A 3N04A 4H6RA 3S5ZA 1B90A 5LA2A 1SFJA 3C0JA 3PTQA 1L9WA 4TMBA 2Y1HA 1WKFA 4QBXA 3GG1A 4QE1A 1GVQA 2QVNA 2XWEA 4DO5A 2EPHA 3TV8A 1KFKA 3BICA 1WE5A 4ZO8A 1CGXA 3OYXA 3D46A 3BO9A 1HF6A 3A5FA 4PUKA 4JTUA 3ZLFA 4AZGA 3T8QA 5MHBA 1SFTA 5D04C 3A22A 1XQLA 3DAQA 1XDLA 2DP3A 1XLGA 4IX2A 4CQAA 3GIQA 4ATDA 1FQ0A 2PE4A 3W26A 3DH7A 3G1XA 3SSJA 2IPFA 2JEPA 3M0MA 1E40A 4Q4PA 4ZB5A 2FZBA 2AOSA 1V0LA 3CZJA 4I7UA 1WXYA 1TMQA 3K4WA 3AZRA 1SMAA 3AMLA 1H61A 2ZDSA 4TV6A 3N3TA 1U1JA 3U2CA 1QW8A 2RJHA 1DE5A 1E9YB 3WQVA 2GWNA 2B31A 2YW3A 3N6JA 4TV5A 3CO4A 3L4ZA 3POCA 1VFFA 4FXSA 3SIZA 1VRDA 3VUSA 3AI0A 3R5EA 4LH8A 5CCZA 1H1YA 2J9YA 3RPMA 3FSUA 1XLLA 1Z42A 1EA0A 1TV4A 1J8VA 3OGVA 5CZKA 2YCIX 2CERA 2H8ZA 3LHUA 4ZE4A 2QIWA 2FTWA 4A8RA 2A1YA 1EOMA 1OX5A 3LCHA 3SCSA 3SGUA 2NX1A 5FIPA 3PUDA 1GGOA 4LS2A 1JPMA 1XW8A 1TJ0A 4AIEA 3I10A 1JJKA 4G7EA 4J3SA 3FY1A 4J35A 1RHCA 2Z7KA 4PN2A 1AQHA 3EDFA 3GVVA 4HA4A 3N18A 5CG7A 3UVAA 1V5XA 1PE1A 1ME7A 4MAVA 3DFYA 3IK4A 3GDKA 1FH7A 4EF8A 4DWDA 3GXDA 3NCOA 1GQNA 4UB9A 2J7CA 2PCQA 1KCKA 4CNNA 3SN0A 3G1YA 3H2OA 2GSJA 2WVVB 2PS2A 3SCOA 1XYCA 4S2BA 3AYTA 3UXAA 1FRBA 3A4WA 1KBBA 2WSRA 4GVFA 4MNLA 4MSSA 1V93A 2DUAA 4UMCA 3CL7A 3UESA 3W2UA 3A47A 4NXSA 1A5KC 5HJYA 2HVOA 3EDJA 1EXPA 1UW9A 1FXQA 3VPLA 2JKPA 3GXPA 3BK0A 4C6FA 2ZA3A 1JDEA 3P93A 1KRBC 4OIFA 2IPJA 1ISWA 1OFRA 1JZ2A 4F0MA 1KXTA 3WDQA 1VEMA 4ZGYA 1TPDA 3ICJA 1OG6A 5CH9A 3INPA 3RO6A 2DPEA 1WKDA 3AJXA 4JFTA 2ZTKA 2Y62A 1F76A 2HJPA 1DQWA 3SY1A 3W2JA 1OFEA 1PX3A 4QM1A 5DMNA 3NO5A 3IIOA 2KX9A 1L8NA 3KLLA 3W1AA 2G3MA 1YE4A 4XAFA 3TQKA 3CUJA 4AY1A 3BGJA 1XYBA 4INFA 5F7UA 1GQLA 2QV4A 3NR0A 4AZIA 3PVFA 4MKSA 3PJTA 4PMDA 1NVMA 4HJWA 3E5PA 1F6YA 1HJUA 2Z1WA 3O6YX 1PKLA 1JD7A 2YBVA 4Z1DA 1C7SA 5K4ZA 3CUHA 1HNYA 1WDDA 3LLFA 4C6KA 3L2IA 3CPRA 2AMGA 4JHZA 4XVDA 4UTTA 2P8CA 4J40A 3CS2A 3YPIA 3WMSA 4LVBA 2H9AB 4F0LA 1GJPA 1HJSA 5A6BD 3GDMA 2ONEA 1VEPA 1OADA 3VIPA 1OFAA 3A4XA 1XLMA 4PL1A 1TPWA 5E0FA 3II1A 3MSGA 2GYIA 4KFNA 5AKQA 4M19A 3KLKA 5AYBA 1ZJAA 2FHBA 1JF5A 2XVGA 4PTDA 5IDIA 1DBTA 1FWAC 1W56A 2X30A 3TSBA 5C70A 2IKHA 6ALDA 4JDBA 2YXXA 5A6KA 1FWFC 1GTHA 5K9XA 2ZKMX 3HJZA 4AHPA 3HJEA 2QVHA 4GZ7A 4B3KA 1U22A 2VXNA 3AS3A 4LUYA 1TJRA 1PTGA 1X1NA 2H9AA 1BF2A 2XSAA 2XZ9A 4XZIA 3HTWA 2XYLA 1GOIA 1JR1A 3ZJ7A 1LL6A 2JEQA 3BAJA 4MNKA 1XH1A 3I68A 1F2JA 1YXDA 5DFAA 1RJQA 1X1ZA 4QS5A 3O16A 4S2CA 3LXAA 3QLDA 2ZZ3A 3W27A 4CNOA 3TAKA 4O50A 2WSKA 2XJ7A 1A53A 2EF9A 1HFBA 3FA4A 3UR7A 3OHMB 4WOZA 4WF7A 4GIRA 1R46A 1KQZA 2DVXA 4W84A 1ADOA 1ZHAA 4DUOA 3CIVA 4L9XA 1DOSA 1W9DM 4W7VA 3A4JA 4GIYA 1DWJM 1OY0A 2XTKA 2Z00A 3E38A 3MUZ1 1K7XA 2E9MA 1IZCA 1OIMA 2GPTA 1RBAA 2CXEA 1XUZA 3N6HA 4MG4A 1G67A 3AYVA 3SIMA 1E6PA 1QNQA 4O1FA 1F4HA 1M9HA 4DPPA 1UQYA 1VH7A 4F79A 4E38A 4AMAA 2Z1BA 4MWAD 4MFDA 4XZLX 2BMBA 3DESA 4E6MA 1E1CA 3PF3A 3UYCA 2HPMA 4AZHA 3ZT6A 4KCUA 4G1NA 2B0MA 3K8KA 3FCPA 1MRQA 2GJXA 3UPBA 1W9VA 1J0YA 2WZIA 1THFD 1TG7A 1QCWA 4LAUA 4H19A 2HZGA 3URAA 2MNRA 4LEQA 3O0FA 2V5KA 3MI3A 5JBEA 4RE4A 2V82A 4UZUA 2ZXBA 3TKFA 3EKZA 4MY1A 2VZSA 1AK5A 1JYVA 3NDZA 3GXNA 4FF5A 4MB3A 3QMRA 4BI5A 3P0XA 2PDIA 2FFCA 1UR8A 3IRSA 3E2VA 4QCFA 2UZ9A 4Z2IA 1G4PA 2AKZA 2XN1A 5IOBA 5XIAA 3QF0A 4EE9A 3IJ9A 4HPNA 4AYGA 2A85A 1NF7A 5DELA 1BSIA 2F84A 3FK4A 3WQPA 3PJUA 4IGSA 4QG9A 4PCFA 1CWYA 4NNBA 1D3GA 3RR1A 2X41A 4EF9A 2W5FA 4JTGA 3L4YA 4FZIA 2XSBA 2J7DA 1O12A 3L5AA 2A2IA 2QJNA 3QJAA 1LG2A 5LXEA 3U5YA 1H1NA 5FEPA 5A8NA 3C2OA 4MF4A 3PUEA 2OO6A 3WNPA 5E9XA 2EPLX 1MI3A 5IFTA 3L4WA 3CAQA 2ISWA 2VVSA 2CITA 4BZYA 3LXCA 3TJ4A 4IPIA 4LVFA 4GACA 2SFPA 3ABSA 6TAAA 2ZC8A 3P5ZA 4H6EA 1XSJA 3GU1A 1RCOB 1FP8A 5A3HA 3QFWA 3K8LA 3GB6A 3LXBA 4DUWA 4B5WA 1UHVA 1RJRA 3AMGA 1EEXA 3APGA 4TTUA 4JYEA 5D05A 1KKRA 4O13A 3GU9A 2V30A 1A0CA 3AFBA 4GUHA 3VE9A 2NXGA 4JFUA 1S2UA 5CPLA 1XPYA 4GIEA 3QLLA 3VD3A 4LCRA 3KTSA 3NZ1A 4N0RA 4MLJA 2PDYA 3W75A 2J25A 3W7OA 4O18A 4JXCA 3KVKA 3PR2A 2OCZA 1P0KA 2C1HA 3SEPA 1N82A 2PD9A 2VEGA 5G2WA 3NQGA 1EIXA 3UGRA 5AVNA 4JHOA 1PCKA 2CFFA 1C9WA 3PZQA 3VMNA 1UC5A 4MHBA 3RX4A 1ZUAX 5A8QA 4BI7A 5A2BA 2BFGA 2Q3OA 5FF4A 2G4FA 1QW9A 4WDXA 4JTQA 2FGLA 3CL8A 4QCEA 3STCA 5JUVA 1J0IA 3TU9A 1FWTA 1QASA 4N4PA 1NAL1 1AMYA 2CHRA 3FAWA 3S6DA 3GK0A 1YHTA 2EKCA 1CXIA 2G5WA 5BRQA 2XM2A 5I23A 3RYSA 4QDWA 2QYGA 3APTA 3GDBA 4BR1A 4QLJA 2E6FA 4NKCA 1M7PA 1EGVA 2CKRA 1EBHA 4MY8A 1VB9A 2VQUA 3KOYA 2VZOA 3THCA 3ARVA 3MMUA 4XZBA 2F38A 2PF8A 4Q3MA 2RH9A 1P7TA 4HPGA 4FX8A 3QC0A 3OA3A 2CLOA 3NPWA 3GO2A 4HU4A 4DJEC 4UC5A 1BLIA 3ZVIA 4DO6A 1R2RA 4YYFA 3S9IA 4J9JA 5FJRA 3TMQA 4BK9A 1Q66A 3WYZA 3G77A 3GIYA 1XSIA 4J3WA 3QV9A 4MMWA 1QWGA 2PWGA 5FD0A 2NUWA 4Y2WA 2V3GA 3GSMA 3IJ8A 2I7GA 3BW3A 1DHPA 1JAKA 2HQAA 1H7NA 4NXKA 5E5CA 4W87A 3B04A 4IOTA 2FZ9A 3GW0A 2NVDA 1E0VA 2I9EA 5G4WA 1ME9A 3C3NA 3RM4A 4EPEC 3ZXWA 4X3ZA 4CGTA 1DJYA 5LHFA 4N9CA 2G3FA 4XAZA 3RJYA 5C2CA 3TJXA 5CKSA 3ARTA 4WOQA 5J04A 3D0CA 1VF8A 3V7PA 3QYQA 5ABTA 4GD0A 4DBUA 2DUZA 1XI3A 5BXPA 1TTJA 2NVAA 3M44A 3UY8A 4UQDA 3M41A 1YPXA 4LUSB 3Q4DA 6XIMA 3L2LA 4LCQA 1JAEA 4LBUA 4DPQA 1FWNA 4IXHA 2BDQA 3UPWA 3CBWA 3PZIA 1JPKA 4IQJA 3IIZA 1TUFA 3ITGA 2DT2A 3NO1A 1OABA 1W1ZA 4IZGA 4LT9A 3V0SA 1IEIA 2F61A 1EKOA 2FVMA 2Y7GA 4C6IA 4TR9A 1ONXA 3T44A 2B7NA 2KZHA 4MIMA 2R91A 4ZCWA 2J8TA 1ZAIA 1BFNA 3W28A 1QOXA 1VBUA 2PFHA 4UFLA 3UA4A 2O0TA 2ESCA 4I9TA 1PL9A 4OUEA 3PWGA 5C71A 1PWLA 2WSPA 4NNCA 2QCGA 3D3FA 2WC7A 4MB5A 3ZYZA 2P8BA 3AMDA 4NZCA 2OSWA 4BEQA 5I3HA 1GZJA 1UIPA 4BWLA 4HA0A 3SBFA 1Z8AA 5D30A 5H91A 3QOMA 5HQEA 4ZOBA 3FJ4A 3NPVA 3I6EA 4NAFA 1GKRA 4JQAA 5BYWA 2DIJA 3H55A 2VZVA 2PZ0A 1OD0A 3KBMA 2YFOA 3VD4A 1RR2A 4CEUC 2D2GA 3H24A 5I3GA 4HMDA 4H4IA 4FIQA 1XJBA 4RDZA 3FYYA 1SU5A 2OX1A 1UR3M 3VMOA 2YCJA 3TROA 3STGA 2PDCA 3LD5A 3QPZA 1YYAA 1EO5A 1W1VA 1OX4A 1M03A 4EWND 4XWUA 3H7RA 3WN6A 4MNJA 1HJQA 5JQ9A 2I5QA 1FVPA 4B9ZA 5IFPA 4W8LA 3PB0A 4O10A 2QQ6A 3BMWA 1EB3A 4HHMA 5IHSA 1Q6QA 3IGXA 4GO8A 1KA9F 5K4XA 1J0ZA 5D2YA 1L2QA 2NQZA 2YZ5A 2DORA 4QEHA 1HXJA 1CBGA 3I4EA 1KWGA 1BWLA 2ZRVA 5HWNA 4P7RA 4LC6A 4PFMA 3C0LA 4WHBA 4RX0A 1T8XA 2AL1A 4WLCA 4ROPA 3E74A 2VZUA 3VKAA 1KLYA 1BTMA 4H9TA 4M81A 1B5TA 3CGTA 4V33A 2A79A 3VKBA 2FLIA 3TYCA 3LCIA 1E6XM 5C9ZA 3CV6A 2WLZA 2X0SA 1VD6A 3K30A 3E0LA 3AHVA 2HEJA 1ZP3A 2ZZ6A 3S1GA 3GM8A 1HQTA 3ANYA 3BVJA 1E73M 3TC3A 5HBFA 3H6OA 3VIKA 2VEIA 4R3UA 3WQ5A 1JYNA 3BOXA 4L1XA 3EWDA 1QPRA 4Y96A 4K36A 4BF9A 1QI0A 4JICA 4YCOA 1NP0A 1TJPA 2VWSA 4Z08A 3ZR6A 3URQA 1PJ9A 1NSJA 3LHYA 4TIMA 3L7RA 4XQ6A 2OO0A 1YTEA 4B3ZA 2CXGA 3DHDA 3JUGA 1I60A 1P6BA 4LS0A 4AZCB 2XINA 3VNMA 3SJ3A 4AZ6A 4UFJA 1BWVA 5C9UA 5HJXA 4GY1A 2JALA 5FEWA 3EX4A 3BPWA 1AVAA 1R3SA 3NJ3A 3PAOA 1NQKA 2E4TA 4M6VA 4MZ1A 4L5ZA 2PTWA 3KCLA 3M5VA 4GYKA 1W5MA 3A5VA 4K37A 5D32A 2Z6IA 4XIAA 1A5MC 3JR2A 2Z1KA 1K70A 1IXPA 4AAJA 3BZJA 3UR5A 4QAWA 2PDHA 1YE6A 4FLOA 3RLHA 3ZIZA 1VR6A 1F61A 2PDXA 1AG1O 2R14A 1UWRA 1DWAM 5JBFA 3WLIA 3NSMA 3WLNA 1DTUA 5CGMA 4E4PA 3CNYA 4RNHA 1QU4A 1L6GA 1HKJA 2CLEA 4B90A 1TJ2A 5EBAA 3WLLA 2ZIDA 4U2YA 2X0YA 3TW6A 1XYAA 5LA1A 4JCLA 4LB3A 2E5CA 4LYPA 4GGHA 2OWXA 4S3CA 2OT0A 1TX2A 5CLTA 4E0CA 3MPGA 5HPCA 2O9RA 3MHGA 2BB0A 2VEFA 3PHAA 1JGMA 4GKLA 3CWNA 3WLOA 1OC6A 2VFIA 5FJTA 3W84A 5FAGA 1MNZA 3GNPA 3ZR5A 3VIMA 2GJPA 1V79A 3MUIA 3GHRA 3VGBA 4XO7A 2H3DA 3GX9A 4WSKA 3AHZA 4PBGA 3TUUA 5BRBA 3TTOA 4D8LA 3CPGA 1Q5MA 1WO2A 1PZ1A 1OZMA 5U4NA 3Q45A 3B4UA 5B7ZA 3N4FA 4S23A 1XBZA 2WQPA 4NYYA 5BWAA 5DBUA 2GDVA 1VYSX 3FSTA 1R7AA 1UR2A 5AB3A 2D69A 4PA8A 5TF0A 2Z25A 5ABGA 4M56A 5D9OA 6A3HA 3MV11 1Z69A 3NL6A 4OBRA 4V1YA 4ZO9A 3LZ3A 4MWAA 3B03A 3AIQA 4H7VA 3BV7A 2D3NA 3HU7A 2X7VA 3UWYA 4A3YA 3SDOA 4KMQA 1NDYA 4G7EB 3AXXA 2IQTA 3QHOA 1FA2A 2OQYA 3WDIA 2VI0A 4NQ1A 4ERGA 1OD8A 2OOFA 5AC8A 1ICPA 1A80A 3IAPA 1GOOA 1BKHA 4LV4A 3ITXA 5HMEA 2Z1VA 4PRTA 3WQFA 3W6LA 1BEUA 4GA8A 4Y7EA 4AWEA 1IEWA 3IGHX 2Y88A 5AYIA 3GU2A 2G3JA 1X39A 5XIMA 4R7WA 2QDEA 3N2MA 1QPQA 3OLGA 3UEQA 2J47A 1TYGA 4RZ6A 2P53A 1HJWA 2POTA 2HMCA 1PPIA 1XRVA 1XCFA 1CECA 3POHA 1YMYA 3QRHA 3C2VA 1KFLA 4J2PA 1MXDA 2PTDA 3UVIA 3FV9A 3QN3A 1HTIA 3LPGA 1FH8A 1FHLA 1PZ0A 1W32A 1B4KA 1A4MA 3WFLA 2V63A 2ZUWA 1O7AA 1R87A 4DWSD 2YXOA 2QMJA 1V3MA 3RMJA 3PC0A 4UZSA 2E7FA 3WF1A 2OZ0A 3N12A 3MHUA 3KOZA 4D6JA 4XK2A 1XLFA 3BOFA 4H7ZA 2ZUNA 4WSJA 3W85A 2VURA 1XIBA 3W7DA 3CQKA 3BG5A 1EJVC 3HB9A 4C6BA 5A6SA 3H53A 1DIKA 4GC4A 3AUOA 3XINA 2BOFX 3PWAA 5EB8A 1CXEA 3BLFA 2TSYA 2TODA 2WMJA 1KTBA 5EMJA 5LIKX 3AHTA 3VAVA 4C1NB 4S3BA 1H63A 1B2YA 1FH9A 1EP2A 2C16A 3UQNA 4JGDA 1H7WA 4PEKA 2PODA 4EAYA 2Y7EA 1GYNA 1R85A 3O15A 5HNNA 1PVNA 1WOBA 4MDOA 2FZ8A 2NT0A 3VGEA 5H8MA 1QXLA 3BCDA 4R85A 4AD2A 3MSRA 5EFFA 1QHZA 4GY7A 4ZL1A 4HA3A 1RA5A 3UG4A 1VBJA 2IS7A 2BHZA 1MZRA 1D7FA 3W7CA 2C19A 5DT5A 5LGZA 4UTFA 3FHAA 1TFVA 5JMUA 4BQ3A 2B7OA 1I2OA 1D2KA 4RZ4A 1ITXA 3PK7A 1S5TA 1AZ1A 3OBKA 4CQCA 2E67A 3NEVA 1EOKA 1C3FA 2BY2A 3AS0A 4LXFA 1LZOA 4O16A 1WCGA 3VOGA 1R3TA 1S2AA 2JGYA 1QT1A 3L65A 4OWGA 2RDXA 4HKPA 3CMFA 2DSVA 2MUCA 2HRWA 2NWRA 3N17A 3ZQ9A 1POJA 1XLBA 3TWBA 1N7KA 5GQBA 3LTSA 3WENA 4GQGA 1UA3A 5AZ1A 3RRAA 1UUQA 4GMEA 4L6OA 1KGXA 5EU9A 4NT0A 2DZSA 1EC8A 1GEHA 2PTYA 3OIHA 4AB4A 1M68A 4O52A 3SUUA 1OEPA 3VIIA 2XVKA 3F4NA 3S2NA 4A29A 4GBUA 1MW0A 1TELA 2PBGA 2EXOA 4TMCA 4XV0A 1AH4A 3W2KA 4QP0A 2PWFA 1JVNA 1TRDA 4W89A 4ORMA 4NG3A 1SW3A 4FB7A 1UOKA 5CJNA 2ZZ4A 1G4EA 1Z48A 2E5BA 2WHJA 2UV8G 3SQLA 1QDSA 3MI2A 1JUBA 4KWSA 3B8UA 2RAGA 3ITTA 4J5NA 2HE8A 2PDMA 4A22A 2WVUA 1IIGA 1AW2A 3ORWA 4PCTA 1TCDA 1MEIA 5F2GA 3O6AA 1SM9A 1UROA 4F0KA 5I3FA 1KM5A 3DX5A 1XLCA 4I8DA 1W9BM 1EJWC 1RLDA 4NAEA 1IEVA 1QTWA 1R6WA 3OPSA 4XG1A 1X1OA 1CCWB 3WG6A 5AHIA 1XRTA 1CGTA 3CU2A 3IIPA 4G5DA 4Z1AA 4WGXA 1UP3A 3W1XA 4ZFCA 1CLVA 2VP8A 3KRUA 4GBDA 3RU6A 3B8VA 4JTAA 3P6LA 4WRHA 1NWTA 2JQXA 4L6HA 1TV7A 3V18A 1K8YA 2NV1A 2ZWYA 1S38A 2J78A 1Q6OA 1XGEA 4CQBA 4DZ5A 1CX9A 3HURA 3CZLA 3KOFA 3RK8A 4JL2A 1R3YA 3FYOA 5M3WA 3PM6A 5LSMA 1JZ5A 4UTJA 2E9BA 4RZBA 2GQ8A 3NXFA 3HG5A 3O2LA 1EX1A 3E2QA 1J0HA 3H26A 2ZX8A 1E9ZB 1K9DA 1HVQA 3N9RA 3GVQA 5AC7A 2BX7A 3E2RA 3T0TA 1JRBA 2Z4GA 1ZP4A 4GQQA 4ADUA 1W5PA 2PP1A 1EQPA 3ZO9A 3SRKA 2XHYA 3B8TA 3H12A 3A23A 3EMQA 4GABA 2QT3A 5C2GA 3AALA 1V51A 3MB9A 4ML9A 2DV0A 4KH2A 1SJAA 3RX2A 2GGEA 5LNRA 1LL7A 1B0IA 4KCWA 3A6OA 3TN3A 1A3XA 3W6MA 5CXPA 3WD1A 1WX0A 1YDYA 1R7OA 5FJOA 5FEZA 2TRSA 1NU5A 4W85A 2BXYA 3RM8A 4R7JA 3FVDA 3HGSA 1OCBA 4LYQA 3WH5A 1V6YA 3QMTA 2WK2A 5LHEA 2Y85A 3SB0A 4DB7A 4OBTA 3URBA 1QR7A 1D8CA 4JX4A 2XIBA 1F5ZA 5DMYA 3RFAA 2ZTJA 4PMYA 1GOMA 5CPMA 4N6EA 3RCNA 2D0FA 1UH2A 4CCZA 2VCBA 3AQUA 3NQDA 4IP7A 4ENLA 3EEZA 4J3UA 1FWSA 1OF6A 3UU0A 1VCFA 3GVWA 4IIFA 3UA3A 1TTPA 1LORA 1QNOA 4KQNA 4XO6A 4D6DA 2XZ7A 4PMUA 4UTUA 1YNYA 3OB8A 1MEHA 1Q4WA 3ITVA 2OSXA 3HBLA 2P88A 1GPWA 1M5WA 1X7IA 4ZTYA 1JCTA 1V3JA 4PC8A 3OLEA 2EPMX 4ADTA 4KWUA 1PUDA 3W2LA 1XLDA 3WNKA 3WQOA 4EXBA 2FDSA 2X05A 3VOFA 2BGQA 2XVNA 3ONCA 3WUEA 2WVTA 5C55A 5EYWA 1UMLA 1T0OA 5T26A 3W1MA 4P8XA 3R8HA 3GG8A 3CB8A 4C1KA 1QFEA 2CWNA 2HXUA 4S3GA 4Y8EA 3AU6A 2DQXA 4IWWA 3GH4A 4JTCA 4YU1A 1XIFA 1RBLA 3B8SA 4LUTB 1OGSA 4OHQA 5HJLA 3S2CA 1U1UA 3AZTA 1W9PA 2P3ZA 1EDGA 3KX6A 3G8EA 3W6YA 3QPEA 1RV8A 8XIAA 5A94A 5DQPA 1R47A 3G1HA 3DFSA 3QFEA 4E8CA 3TEVA 1JUEA 4Z2JA 2YA1A 3RLGA 2FDMA 3VX0A 3MANA 5AYZA 3SRHA 3NPUA 2Z6JA 2WLYA 1LOQA 4PMVA 1S2VA 2CWXA 2V2HA 3IUIA 2VRQA 1XLHA 2ZRZA 3S42A 3WQ4A 3HIJA 1DVJA 1SYTA 1PWMA 3V4BA 2XGIA 1M7OA 1M41A 1JNDA 2DJXA 2WANA 4OU1A 4ROQA 2INFA 2XH7A 1BYAA 3UF9A 2PLMA 1DQUA 2Z2AA 4HCDA 4UOZA 4S3EA 3CUFA 3S9YA 3EPMA 3EX3A 3P80A 1GW9A 3L4VA 1PX4A 1BF6A 2NLIA 4NI8A 2X09A 3B9OA 1SMDA 4MAZA 5H6HA 2V5BA 3MSYA 2QF7A 1DXEA 2WO5A 1B4EA 1GT8A 4AWSA 4XX6A 3DKLA 4PTVA 4ZB0A 1HL9A 1FWCC 1XYZA 3DZ1A 1TREA 2QPUA 4IQLA 1D3HA 4GX9A 3VOJA 4K8HA 3VZZA 1NWUA 1F7BA 3MZ2A 3DEQA 3LMYA 2XIIA 1XISA 4LU0A 2HVMA 4HOXA 3FS2A 2QUTA 4CU8A 3QH2A 2HDJA 2QCCA 1JCJA 1HJVA 1JDFA 3A3XA 3B40A 2DZXA 5A6BA 4I5XA 2X2GA 3O0KA 1CEOA 3IARA 4YTQA 1VYPX 5LYRA 5IDZA 3G1VA 4TXEA 3B9EA 4Y9PA 5D9PA 3EOOA 3BLEA 1GTEA 5PTDA 4OE7A 3FHQA 3AIVA 3N34A 3Q67A 4D6CA 2GZXA 7CGTA 1Q45A 2WHLA 4PUNA 1Q13A 4FOUA 2D23A 4FX7A 3QGVA 3QC3A 2WKGA 2TAAA 5I3JA 2G96A 2TMDA 4O1EA 2AL2A 4O14A 1W1PA 3M7SA 2VTFA 3H2NA 3NOYA 1H7XA 4HT3A 5G1YA 4BEUA 3ZVHA 4U33A 1VHCA 2VFFA 5REQB 3TMLA 3A9BA 3GTIA 4FNTA 4RR4A 3KXQA 1MNSA 4IFOA 1O1ZA 3BGAA 3DXIA 3Q65A 2ZRXA 3A21A 1YXCA 2UY2A 4V15A 4RK8A 3R94A 3L4TA 5FL0A 1JL8A 4OECA 5IBXC 3OJGA 4OJYA 3T07A 1DWFM 3P2VA 1GZ1A 1UPMB 2BBFA 4ZQCA 3LM3A 4Q4SA 3LX9A 1UWIA 1RPXA 4FLSA 2XG9A 3CQJA 4QG8A 4DN1A 1GCYA 4QISA 4WD0A 3V0UA 1Z7AA 2VL4A 4ICCX 4IP5A 3GXIA 3ALGA 2ZFAA 2R1KA 3WLTA 2HS8A 2GSHA 1MRAA 2VCAA 2ZVIA 1BQGA 1TV5A 3M5XA 3S5NA 1ZSXA 5LA0A 2QCHA 1UH3A 2BY0A 2EQDA 4DXXA 3T4CA 2BASA 1QW7A 2OKOA 3AISA 3SY8A 2OWWA 2ATMA 3LS9A 1DPMA 3V1PA 3WJZA 4A8LA 2PU0A 4MNMA 4M7SA 4HSHA 5LKYA 2FGZA 3EWUA 3U2OA 4B5TA 1EJXC 3R13A 1M1BA 1MXSA 1I1WA 1FFQA 3UJRA 2IXVA 1V0MA 3TWAA