3MJYA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-aminoorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
306
Chain Sequence
b'GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 107
structure length 306
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mjyA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mjyA01
2J6XA 2V81A 2XN2A 2O7SA 3S6DA 2CLHA 3H54A 3PUDA 3W1AA 4G1KA 2ZA2A 1G69A 3IRDA 1K7FA 3S1XA 2H3BA 2QAFA 3DHDA 3PBWA 4GRSA 3G1SA 1EX5A 1W37A 1SSDA 2ZRYA 2J9ZA 3O15A 4U4MA 5HWJA 4JTIA 4UNKA 3W1TA 5IBXA 2VFEA 3DXIA 4PTNA 2ZA3A 1R2RA 5DBTA 3S5ZA 4N6FA 3WJSA 3R5EA 3S5YA 4LW7A 3NOEA 1ME9A 3L65A 2VFFA 1ZHAA 3GDMA 2A6NA 5LSMA 3I7SA 4XKYB 4NJJA 2QDGA 3LRKA 3LXAA 3LRMA 3HG2A 4M6PA 3CM4A 2B7NA 4NQ1A 5BMWA 3MBDA 4WX2A 2I9EA 1LOQA 2P1FA 1WBJA 1TJPA 1JQVA 1I4NA 2E1DA 4LT9A 2Y62A 5HQEA 3KXQA 3BPWA 3O63A 2TMDA 1AW2A 5LNSA 3W6YA 1HTIA 2WO5A 5EMUA 3SZ8A 3EWUA 3A5VA 5CG7A 3TJLA 3EKZA 3NL6A 4I9AA 4KFPA 4RXFA 4NZJA 3TSMA 4AF0A 3W7PA 1HFBA 3LHVA 3PR2A 3GXTA 4PFMA 1NFBA 3O05A 3W1NA 3FYPA 4YCOA 4FHAA 1GVFA 3NPWA 2C16A 4Z0JA 2C0AA 5A5WA 3QM3A 1O5KA 2BSLA 4LOCA 3T7VA 4GBUA 2C1HA 3SFKA 5AN7A 3I7RA 3U6WA 3C56A 3I65A 3GNDA 2PC4A 1GJPA 1SZEA 4O15A 1KM6A 4N9BA 3KX6A 3HGOA 4ZMGA 4LUJA 2A7NA 1KBIA 2NLIA 4LV9A 1OFQA 4X2RA 3MP3A 5C6MA 2FIQA 4O1CA 4MFEA 2FB3A 5MHBA 4MLRA 5AHLA 3QW3A 1YXCA 1N7KA 5U4NA 1QO5A 2G95A 1UUMA 2ATMA 3NYZA 3NL2A 3OIXA 3W71A 4RR4A 3GDTA 2H8XA 3LHTA 3OVQA 5EBUA 1SZNA 1VH7A 3C61A 4UFJA 3AO0A 1YYAA 1GT8A 1LBFA 4MZ8A 4LTSA 3M5VA 3STFA 3TH6A 3KVLA 5AYZA 2B7QA 3O07A 1SO5A 2ZBTA 3VNDA 3EWWA 3HF3A 4RJEA 3CHVA 2DZSA 3O6DA 2X1SA 4LS0A 4RZ5A 4BK9A 4U28A 5KINA 3ELFA 3LRLA 3HQ1A 5LNVA 2AAMA 3EX6A 3TROA 3TSBA 4I7WA 1TQXA 2G96A 3PB0A 4N9DA 2I14A 4PC8A 1IXNA 4GUJA 1MXSA 1LBMA 4FNTA 5FF4A 5KZDA 3STGA 1M5WA 3EWXA 5D03A 1Q6RA 2V82A 2YZRA 3SIZA 5CGQA 2GQAA 1L6WA 1KLZA 2RH9A 2CU0A 3SGUA 3MHFA 4MYXA 2H8ZA 3TQ0A 2NUXA 2CLLA 4TU1A 1EUNA 3C4UA 1VYRA 4DELA 5FEWA 1X6UA 1VPXA 2FFCA 4MVAA 1IIHA 3LCFA 2X16A 4AHQA 1TIMA 3P67A 1EEPA 2CLEA 2CLOA 4JDYA 1TPVA 5TBOA 5I3FA 3MHUA 5FF2A 3IIZA 3DFNA 3B04A 1KA9F 4WY0A 4DO5A 4UFKA 1GTEA 3LXCA 2Z2UA 2G97A 5D02A 3M16A 1JCXA 3BG3A 1KBJA 3ZR4A 5C54A 2VENA 6ALDA 1ZAHA 3V75A 4MY1A 4MPQA 3L0NA 1BKSA 3NQMA 4ZQCA 4JX4A 3TIMA 3ABRA 3CLMA 3MI2A 3KFTA 3M9YA 2VFDA 4DQWA 3TUUA 4FX7A 3NXFA 2V9DA 4FNRA 3WK0A 1LDCA 4UIOA 3W72A 3G0SA 4O1BA 3NR0A 2A2IA 3FS2A 3IGUA 1Q3NA 4R53A 3USBA 1LROA 3VFLA 2QUUA 4O4VA 3ZWTA 4N4QA 4QISA 3UWUA 5HWNA 1XBYA 3YPIA 3BGJA 3P74A 3EX3A 5AC6A 4PODA 3PSWA 1LP6A 1DL3A 1VHCA 4XUGA 4JGDA 1H1ZA 1T96A 3RK8A 4PH6A 5F4SA 4TR9A 3DENA 5DN1A 4JEQA 2YGYA 5HR7A 2A6LA 1S5TA 1UJPA 5EL1A 4JXCA 2UV8G 1EB3A 4K8EA 4E38A 3NQEA 1F05A 3OVRA 2A21A 1A5CA 3W2KA 1O94A 1B4EA 5K9DA 1RD5A 1TCDA 3N9SA 4NJKA 3D0CA 3AJXA 2F84A 1MO0A 3GXPA 3NQAA 5K9XA 4GE8A 1UB3A 2A1YA 4ADUA 1EP2A 4XWUA 1VYSX 2QEZA 3BG5A 3TXZA 1DQWA 4WQ6A 5CZSA 1W5OA 3OG3A 1RQEA 2YW3A 4FNPA 4UTWC 1SO3A 1SO4A 2BZNA 1B57A 3UXDA 2Z6JA 3PULA 1JR1A 2ZRVA 3OBKA 4L4LA 3A9IA 2W6RA 4WY0F 4KKXA 1EWDA 1LORA 3FIGA 2FPVA 2EGZA 1XXXA 5AOUA 3C2OA 3TR2A 2J9XA 4O53A 3TA6A 3UY8A 3TJXA 1AK5A 3LI1A 3MMTA 3B0UX 1W5NA 1LOLA 1ICSA 1RV8A 3UNDA 2FQIA 3CIXA 1D3HA 4PA8A 4O28A 1H7XA 4JNMA 3DI1A 1MSSA 1D3GA 1K7XA 3LDVA 5AC7A 1QPRA 2GJLA 4YLWA 1KFKA 4HPXA 3UWWA 1TREA 1KTCA 4WOQA 1SW7A 1THFD 3MI3A 3FFSA 1IIGA 2E6FA 1G4SA 1SUXA 5D32A 1A5AA 4H6KA 5F4WA 3LCWA 5KITA 4O19A 1TMHA 3FEMA 3PUEA 4NUWA 4BFAA 3PG9A 1ZNNA 2CLFA 5F2IA 4HSNA 1XL9A 1QOPA 1G4EA 1AL8A 4O4WA 3LXBA 3M5ZA 1HO1A 1O95A 1Z44A 5AHMA 3HG4A 4FX8A 2Y70A 1FWTA 1H62A 4BWLC 3KVKA 5LZLA 3MJYA 3BW4A 4LVFA 1JQXA 3P80A 2C15A 4K7VA 4RK8A 3TFCA 3W2MA 3W1UA 5F2LA 1NF0A 1ZENA 1TYGA 3LLDA 3GKFA 4ONVA 2QKFA 4AH7A 2EPHA 1TPEA 5C5YA 1R2TA 5G2IA 2CZEA 4KWWA 1DV7A 3PBYA 4LVDA 4CCEA 4O18A 2GPTA 1TO3A 4Y96A 5HWMA 5J5DA 5D37A 5HMSA 3OA3A 3GIYA 1O5XA 4JD4A 4BWLA 1KFJA 2B7PA 2GOUA 2YPIA 1F73A 1OABA 2PCQA 4A2SA 3LX9A 3RF9A 3U2OA 4TO8A 5FF0A 1VCGA 5G1TA 3P5ZA 4N6EA 1JUKA 4ZVJA 1WOBA 4IQLA 4XKYA 3E96A 2YR1A 2VELA 4ALDA 4AWTA 2C19A 3E12A 3N73A 2PRHA 3EEGA 4AMAA 3BG9A 1F7BA 3IIPA 3HG5A 5IM51 3Q2DA 4ORIA 3UPWA 1XUZA 3I7QA 5G4EA 4FEZA 3V1PA 4NNBA 1VC4A 3CT7A 3CWNA 1MEWA 3GDLA 4H4IA 4IXHA 1HUVA 4JIQA 4LVBA 2QCGA 1QCWA 2V30A 3Q94A 2HMCA 2ZZ3A 2Y7EA 3P8IA 2ZRXA 1OJXA 4LU0A 3BARA 2FPYA 4MOZA 2OT0A 1P0NA 1TRIA 4MKNA 4HHPA 1W5QA 2F7FA 1PV8A 4ADSA 1R47A 2ZZ5A 1QR7A 3HBLA 2R94A 1K7EA 4O8RA 3TSDA 2C6QA 4QJ1A 3S5NA 3IEBA 2VFHA 5IBXC 4I7VA 3ABOA 2YDAA 3GX9A 5A8GA 2J27A 1YXDA 2ZYFA 4DPPA 1EP1A 5CZJA 1VJIA 5LGXA 1MEHA 4LUIA 1H63A 1QPQA 2ZZ1A 1YDNA 1ZY9A 3LCHA 5CPOA 5EKYA 1T99A 1IXQA 3WJWA 1VR6A 4WXZA 3W7JA 1L2UA 2HS6A 4NZFA 1A5BA 2AGKA 3HO8A 3L2IA 1C8VA 3OVPA 5TIMA 5BRBA 2DZWA 3MYOA 5F1VA 3GVGA 1LZOA 3W86A 2C14A 1EP3A 3IIXA 4FNQA 4LY8A 5CZ0A 4MJZA 3PSVA 3EX2A 2Z6IA 4IMEA 4OQVA 4MIMA 4H3DA 3THAA 3IVTA 1VQTA 4YXGA 1JCYA 4IX0A 5F2MA 1IGSA 2QAPA 2DZTA 2Y61A 2OX1A 5I3IA 2Q3RA 3W7DA 3W7LA 4EOUA 1KLYA 3MUXA 3LCXA 5AB3A 2FPTA 3BV4A 4N4PA 1AL7A 3W07A 3SW6A 3QMSA 5K2ZA 4UTIA 4PL1A 1NEYA 1NF7A 1XC4A 3W1MA 3RLUA 4CQ8A 3A22A 1A5SA 2Y7FA 1QO2A 4ZQMA 4ORMA 4XBKA 3W2LA 2QDHA 3M47A 3TXVA 3DKLA 2A4AA 4AVFA 3EX4A 3LI0A 3L67A 2EKCA 1TPWA 1XFBA 4CCDA 4HNNA 3CEUA 4O16A 4BI6A 3R2GA 4OHQA 2B7OA 4Z1AA 1H7OA 3HB9A 3L9CA 3NA8A 3W7RA 2VFIA 1M7PA 1RPXA 4JX6A 4FB7A 4HSOA 4N2YA 5BMXA 1GTHA 4M5PA 3HOJA 1F2JA 3G18A 3Q37A 3S1WA 3W1RA 2Y7GA 2CZDA 3NQGA 1CI1A 2QCHA 4PL2A 2NZLA 2A5HA 3PBVA 5DELA 4MFDA 1HO4A 4IMDA 1TTQA 1C29A 1FDZA 1FCUA 2ATSA 2Q3OA 3C2EA 2P10A 3UXAA 4O11A 3I68A 4QITA 3FYOA 1FUYA 3S0CA 3EXTA 2HSAA 3BW3A 3W1QA 3QSRA 3PF3A 3DHFA 1W0MA 2WOQA 4IOTA 1DJNA 4JICA 3W73A 4DF0A 3OHIA 3VE7A 2V0TA 1LRNA 3JR2A 2FDSA 4FF7A 4JTUA 1GOXA 5G4WA 4EF8A 1LM1A 3KRUA 1ADOA 3L66A 1H50A 1NSJA 5K7JA 1NVMA 5D38A 4O50A 2DJLA 4JYEA 1Z41A 1OF8A 3QEZA 2KZHA 1XBZA 3M0ZA 4IMFA 5HUOA 3G22A 5E93A 3IIOA 4C1KA 5G2WA 5BOOA 4AHPA 3NPXA 3LTSA 2B0MA 2WKJA 3KAOA 4Z1CA 2CLMA 3M5XA 3NNTA 3W9ZA 3QYQA 2A85A 2X2GA 1LBLA 4CNNA 1VCFA 1DORA 2GQ8A 1OYCA 3TFXA 5BNKA 3TK7A 1TRDA 4FNSA 3NQCA 2EAWA 2IQTA 2PURA 2JBMA 5CZTA 2XN0A 1YTEA 2TPSA 2QCCA 3L5AA 2BTMA 2GVGA 4NXSA 4OV9A 5K9CA 3TV8A 3WFAA 1ZALA 2BLEA 4FXSA 3TW6A 1YTDA 1VHNA 1G4TA 2RKXA 3NQVA 1SSGA 3UWVA 4IPJA 5LHEA 1VCVA 1H61A 1GWJA 3UWZA 1OYAA 2ZZ6A 2Y7DA 3RMJA 1TQJA 1YTKA 3T55A 4GWEA 3EKLA 3DFOA 1I45A 4YCPA 1GVRA 1WAUA 5KZMA 3CTLA 4NJHA 1PIIA 2RDWA 3Q58A 5L6UA 3S42A 4AWSA 4P2VA 1PE1A 4FIRA 4OU1A 3T40A 1K8YA 4XTIA 3LHZA 1FCBA 1QOQA 4EWND 1EIXA 3IVSA 2WSYA 5G1YA 1VZWA 5KTLA 4FX6M 1TV5A 3W7EA 1ONRA 1VYPX 3P81A 4UFIA 5ABTA 3TKFA 3CU2A 2CZFA 1JRBA 3M44A 2YYTA 1G7VA 1I8JA 3GAKA 5K4XA 3QRHA 1V7YA 3W76A 1E51A 1X8FA 3DAQA 4QSHA 3QMRA 4NNCA 2CLKA 1XI3A 4TMCA 3QPZA 1H7PA 3MO7A 4AWUA 1TJRA 2Q8ZA 1G67A 4R7JA 3G1HA 4RZ4A 3B0VC 5CPNA 5KSWA 1SW3A 4K36A 4MY9A 3VKJA 1S5VA 3W1LA 2NX3A 3P62A 2V8ZA 2QCFA 1FWSA 3WK1A 3PC0A 4B5NA 1QPNA 2XN1A 4JTJA 1LTDA 4S1FA 2JGYA 2YW4A 2C13A 1W1ZA 3CQ0A 4DBDA 4NJIA 1PL9A 5FF3A 4NU7A 1F76A 1R46A 4O14A 2TSYA 5AC8A 3T44A 2DU2A 2NWRA 3TQKA 1BTMA 2FJKA 3O6CA 5FEZA 1XUUA 5TQLA 3G0XA 1FXQA 4HPJA 1FWWA 3KRSA 1OK6A 3N3MA 3BO9A 3MYPA 3LV5A 3E0IA 1N55A 3TW7A 3ABQA 5D2WA 1AG1O 4JTSA 2B4GA 4UTTC 3G8EA 4LRSA 3W7IA 3C2FA 4QNEA 2WSRA 3UQNA 1TB3A 1H51A 3RNDA 4QIUA 1LLZA 3B0PA 5AFDA 1ZAJA 5T26A 5FF7A 3TAOA 5C55A 3MBFA 2VEMA 1OFBA 3HGJA 3QH2A 3NQ6A 3W7CA 2ZZ7A 4LC6A 3IGXA 3EXSA 4MZYA 4UCGA 1M7OA 1B3OA 1F5ZA 3RFAA 3IIVA 5CSSA 3RLVA 1TPB1 4JTHA 1Q45A 3G0UA 2ALDA 4UTMA 4XBSA 3UZJA 4UTJA 3NM3A 4UTTA 1N8FA 3W7NA 2BX7A 4GUIA 1OFAA 4UUIA 3L68A 3HG3A 2E6YA 2ISSA 4JYDA 4XZ9A 4YL2A 3UWQA 4JN6A 1FWRA 4JTGA 4LRTA 3BLEA 4Q32A 1P1XA 2I1OA 4HKPA 4M7TA 4D2JA 3TCEA 1KM3A 5EYWA 3W75A 2ZRUA 3VCRA 1KFBA 2OJPA 3W2NA 3NG3A 3N14A 4XTDA 1VS1A 4KFNA 3VI2A 4N02A 1GZGA 1W3TA 4UXDA 4LWWA 4HN4A 2A7RA 1ME7A 2VEIA 1EWEA 3CWOX 4GNJA 1LYXA 4M7SA 3W7GA 3CB8A 2J24A 1PCKA 2PRMA 1TTIA 3NVTA 1MEIA 4RX0A 1TPUA 3LHWA 3STEA 1LRQA 4CLMA 4LC8A 4Y8FA 2V2DA 3STCA 4O57A 1YXYA 2ISVA 1OYBA 3S9YA 1T8XA 1GQNA 5HNRA 2EF9A 1DVJA 1U83A 1WDWA 2PE4A 3G1YA 1VGAA 4L4MA 2ZTKA 2DZXA 4MYAA 3UD6A 3KOFA 1X1ZA 1G4PA 2NXIA 4FO4A 3EX1A 4DEFA 5J5RA 3QQ0A 4Z08A 2DP3A 4ZQOA 4E2BA 3M41A 3N2XA 4I7UA 3A21A 5AHEA 4NVTA 4BF9A 1FCQA 1KTNA 1YADA 1KFEA 1OFOA 4YWIA 1F74A 1XCFA 4CQAA 2JKPA 4IXXA 1TV7A 5EA9A 2FLIA 3GNNA 1OX6A 3OEXA 1KM4A 5AYXA 3LHUA 3PBUA 4UMBA 2E68A 3GAYA 4BI5A 3O16A 1YDVA 3C3NA 2RHGA 4Z0SA 2QJGA 2Y63A 1JJKA 2QR6A 1RZMA 3LHYA 5EY5A 3G24A 4K8HA 1QWGA 2CFFA 2GVLA 4JR5A 4IMGA 3TAKA 4HNUA 1YPIA 4K38A 4IPIA 2R91A 1B4KA 4UNLA 3DFTA 2ZA1A 3NM1A 4ZQNA 1TPFA 4NX5A 1PCWA 3C52A 3JRKA 3WK2A 1WX0A 3PG8A 2J9YA 4XQ6A 1GVQA 5LNUA 3PB2A 4X22A 4A21A 4O0KA 3B06A 5AHNA 2RDUA 3P8JA 4UFMA 4C1LA 1R2SA 3THQA 3HMJG 3ATYA 4O13A 3LTPA 5CSRA 2V2CA 5D05A 1DHPA 4PEKA 3BLFA 2J88A 5HJLA 3W7QA 3W74A 3G1VA 4GUHA 4MJMA 1W54A 2NV1A 4NXKA 1W5PA 3GK0A 2EHHA 4MLJA 3LV6A 2YCEA 2RFGA 2ISWA 3A23A 2HTMA 3WJZA 4QM1A 2CWNA 1P5BA 3NAVA 4IWWA 1KFLA 2E5DA 3S5OA 4K6AA 1PHWA 1GEQA 3DZ1A 2E5CA 2YFNA 4X3ZA 5SWUA 3NZRA 3GKAA 2ZRZA 1XKYA 4MZ1A 3BGGA 2QUTA 3PAJA 2O7QA 2E6DA 3W87A 1TV8A 1GG1A 3GR8A 5EPDA 2V5BA 3P84A 3P5YA 4O1DA 4BI7A 1I2NA 2Y88A 5DCEA 3EWYA 2Y6ZA 4E0CA 3LBMA 5D09A 3VE9A 2DORA 1OX5A 4GUGA 5HULA 4QNWA 3PUOA 2QCDB 4UMCA 1WXJA 2VEPA 2VOMA 5LKYA 4WZHA 1H7WA 2GVJA 3QMTA 1U5JA 1XM3A 1TSIA 1Z48A 3H53A 4RKAA 3R13A 1JULA 3C2VA 1X7FA 4E2DA 2YXGA 2R8WA 4LVAA 4TIMA 3QC3A 3EXRA 1BEUA 1UBSA 3G1FA 5FESA 3FOKA 4WUIA 4EVZA 2WV8A 3W7HA 1ICQA 3FJ6A 1EPXA 1O4UA 5E1QA 4ICNA 1SW0A 3TMQA 2C3ZA 1BWKA 4O1AA 3QFEA 4ZQPA 4WJEA 3CC1A 4JDBA 3DU0A 4IGHA 1GG0A 2P0OA 3LERA 3SGZA 1VLIA 3NPUA 4OE7A 1OFEA 1OX4B 2E5BA 3QF0A 1FX6A 1KM2A 3PY2A 1GYNA 1P0KA 5DXXA 2BXVA 2Z0IA 3GB6A 3NL3A 5F2GA 4EIVA 2H90A 3FKRA 3E49A 1FWNA 2ZZ2A 4M6VA 5F4XA 3W2UA 3W7OA 3HPZA 3NQ2A 1EUAA 4GXMA 4WXYA 2YX0A 4LS1A 5D04C 4ML9A 3FLUA 5DCDA 1UUOA 3LGEA 4K39A 2C18A 2H6RA 1GYLA 1WQ5A 1I2OA 1UASA 4Q4KA 4DF1A 4YMZA 1H1YA 3RU6A 4NT0A 3TU9A 3LCIA 3CEPA 3LCLA 2X30A 2ZZ4A 5KMYA 4UTUA 3B03A 3MP4A 1KV8A 3GR7A 3L5LA 4RXGA 5H91A 5L9FA 4HNVA 1R30A 1I2PA 2WSQA 3P82A 2NV2A 2BWGA 3ZWSA 3NZ1A 2ZTJA 1RQHA 4BR1A 5K3VA 5LNRA 4O17A 1OHLA 2ZDRA 4ZZ9A 4AB4A 3P7YA 1GVOA 3IV3A 1QFEA 1XBVA 3B4UA 1MZHA 1D9EA 1W5MA 5LNWA 1SFJA 3DBPA 4AAJA 3W2JA 1I2RA 2NWSA 2VC6A 4UFLA 5D2VA 3L0GA 3QQ1A 2VEKA 3INPA 5I3GA 3G3MA 3LOTA 2E77A 4ZQRA 4NNAA 3FKKA 3O06A 4FIQA 3MP5A 3NPVA 3I6RA 3PS7A 1OG0A 3GZ3A 1B9BA 3NQ8A 3S1UA 1AW1A 1G7UA 4MUZA 3NQDA 3B05A 3UY7A 1J5TA 2GQ9A 3LBCA 4O0ZA 3TC7A 1ICPA 3W85A 3WJYA 4IJBA 1XDLA 3U8GA 1WV2A 1Z42A 3JS3A 3NQ7A 4JS3A 4UC5A 1F6PA 1YPFA 4JTFA 3TX9A 1SZGA 2NX9A 3H55A 3W7KA 3BLIA 3FJLA 3G8RA 3UPBA 4O10A 3QPYA 5CKSA 3GDRA 4JTLA 4CNPA 3TC6A 3NL5A 1W3NA 3LB0A 5K4ZA 3LM7A 3NQFA 4JIPA 1ML1A 3DH7A 3DFSA 2X1TA 1ZFJA 3R12A 5D2XA 1L6YA 1G6CA 5HUPA 3F4WA 1FY6A 1PVNA 2NX1A 1W31A 1KM5A 4Z1DA 2A7PA 1K8XA 5HINA 1Q6QA 2DZPA 3R89A 4IMCA 1OFPA 2JKEA 3LLFA 1H60A 2JKAA 4M19A 3TE9A 3C6CA 1OF6A 5I3HA 1QPOA 3HPSA 4EF9A 3QSTA 5FEPA 8TIMA 4JTTA 3DGRA 3NO5A 2E6AA 1CX9A 1RVGA 2CW6A 2Q8LA 4X9SA 2QF7A 4CQ9A 4FNUA 4AF0B 4FXRA 1FDYA 2GUUA 1VRDA 2NUYA 4RLIA 4DPQA 5CPLA 3HIJA 2H3DA 2YSWA 3W1XA 3TNOA 1P4CA 2DZVA 3NDOA 4N9EA 5E0KA 3A24A 2G5WA 1OVDA 1IXOA 3PWAA 1VLWA 4LV4A 1H7NA 3M43A 4UTKA 1FDJA 5CPMA 4RV8A 1QNVA 4JX5A 3HJZA 4TMBA 2W0UA 1K03A 1PHQA 1OFRA 1QDSA 2Y85A 1LOSA 1HG3A 3DKJA 4AEOA 3EB2A 4Y6GA 2DZUA 5D2YA 1TPDA 4UTLA 3GXNA 2NXHA 4J9JA 5KZEA 2ZCGA 5DBUA 3E02A 3G1DA 4W9TA 4R33A 3SSJA 2AQWA 3N19B 1AW5A 1JRCA 2VXNA 1SR9A 2QUVA 4MY8A 3B8DA 1JUBA 3C8FA 3ATZA 1WA3A 2ZQ0A 3W7MA 2D73A 5AHIA 2QCMA 3EWZA 3HPXA 2ZFAA 1A53A 3GDKA 1EA0A 3W23A 4TX9A 2TYSA 2GJNA 1XDMA 4Y90A 7TIMA 4KWVA 5C2XA 4JTKA 2A0NA 1GVSA 4IUOA 3N9RA 1SQ7A 4A3UA 4K37A 1I2QA 3TMLA 1YLVA 2V5LA 5G5IA 4DXVA 4UR8A 4GUFA 5BW6A 1S3HA 1K02A 3SI9A 3QJAA 1K8ZA 3DFPA 5FI8A 2V2HA 5I3KA 3W88A 1LLWA 1X1OA 1KM1A 3O8AA 2XFWA 3ABSA 1Q6OA 3NEVA 1KFCA 1KV5A 4UFHA 3SR7A 5H2ZA 4IX2A 4S2CA 1H7RA 3ANYA 4GJ1A 3KRZA 4GFSA 1SPQA 2CLIA 3T4CA 1FXPA 2WNZA 1T0OA 2WNQA 3A5FA 2FTPA 3G1XA 4PCFA 1ALDA 2QCEA 3F4NA 2X1UA 5D33A 3O6YX 1TPC1 4UTHA 3QW4B 1LRTA 3N34A 2PRLA 1W3IA 3MHGA 3ZS4A 1W8SA 3EWBX 1TTPA 4WY0B 5GVJA 2E09A 3P61A 1SU5A 5D30A 4ADTA 1WYIA 3FA5A 4UTWA 1GPWA 1Q6LA 4O54A 1LCOA 4WOZA 1SZFA 1L6SA 3QZEA 4LVGA 4A2RA 4O52A 5LHFA 1FQ0A 3R8RA 5DCBA 1RQBA 5LGZA 2NXGA 3WJXA 3W83A 2OMAA 4OWGA 5G2HA 4A22A 3IGSA 3MWAA 3SECA 3NGJA 4ZL1A 2OZ0A 2YYUA 4K7YA 1K3UA 4N9CA 3W84A 4OT7A 1DOSA 1JUEA 4JTEA 3S1VA 1DQXA 2WJZA 1OK4A 5HR6A 2QCNA 2QCDA 4P61A 4QQ3A 3PVFA 3SJ3A 4AXKA 3GLCA 3O1NA 3S8HA 1HL2A 4WD0A 4HIBA 1RR2A 1YDOA 1JCJA 5DY2A 1S5WA 1C9DA 5DXYA 1JCMP 1ME8A 2TRSA 1PS9A 4QAIA 4NJGA 3DI0A 1IXPA 3E9AA 3MW7A 3ZFHA 3M7WA 1F6KA 4JY9A 2ABAA 4A29A 4DF2A 4S2BA 6TIMA 4OBTA 3G1AA 1WBHA 1XBXA 2HS8A 3C0JA 3L0KA 1TPH1 2JGQA 2NUWA 4M6QA 4HNTA 4RZ6A 1OX4A 2RDTA 5F1UA 3MI6A 4OGZA 4UMAA 4CNOA 1O60A 1Y0EA 2ZRWA 2DJXA 1H5YA 3F1QA 3GYEA 4Z1BA 4GC4A 3KVMA 3W22A 2QJIA 2VKZG 2OCZA 3W3OA 3BVJA 1TTJA 1M6JA 4HT3A 5D2TA 5DLCA 2CZ5A 1SFLA 1J2WA 2R14A 1A50A 5AHFA 1ZAIA 5AYYA 3LCGA 1IF2A 5U7SA 3TQVA 1FCVA 3BW2A 4LS2A 3BK0A 4CCCA 3G3DA 1QMLA 4POCA 2WNNA 1WOAA 3W70A 3SY5A 1BWLA 3N2MA 4AHOA 3KVJA 4DO6A 1OFDA 4Q33A 3WK3A 2Z1BA 1KM0A 3KHJA 4Y9AA 4UR7A 1DBTA 3M6YA 1CW2A 4OV4A 2W79A 3W1PA 1JCNA 2X1RA 2Y89A 3DFQA 3M1ZA 1L9WA 3UWYA 4RCXA 4DO4A 1KTBA 1J4EA 3TDFA 1DJQA 1ZCOA 1JVNA 3LTYA 4O12A 3P60A 3PM6A 3CPRA 4NX0A 2QJHA 1AMKA 3IVUA 1UCWA 1FBAA 5FEXA 4R34A 1V5XA 2YFOA 1KW1A 1NAL1 2LLEA 3F03K 4KFOA 4DBEA 3UYCA 1DKWA 4JY8A 3L21A 3CIWA 3T78A 3HGRA 1ZJIA 2OT1A 3C2RA 3UZ5A 3HGSA 1W56A 2WPBA 4JYFA 3K30A 3M5YA 2WQPA 2FB2A 1JCLA 2QCLA 2VFGA 1QAPA 3L5MA 5DY3A 2ABBA 4LNYA 5I3JA 2JK2A 1SO6A
chains in the Genus database with same CATH superfamily
2V81A 2O7SA 2HISA 3W1AA 4G1KA 3IRDA 3WDIA 1YKWA 3BAKA 4PBEA 1TA3A 5D9OA 4NY2A 3S1XA 1WDRA 3BOXA 1W37A 2DH3A 1B54A 3GDBA 5IBXA 3MT1A 2VFEA 1ITXA 4C5ZA 4PTNA 4UB9A 4L9YA 4N6FA 3FDGA 4IQJA 3L65A 2GYIA 1NP2A 2V63A 4AISA 2FTYA 4DBSA 2Z29A 1M41A 4QJ5B 1S1PA 4FLQA 1UQZA 5FJJA 1UBPC 3LRKA 3LRMA 1VPQA 1D7FA 4M6PA 1E15A 5FKYA 4QDMA 4WX2A 2I9EA 3AXIA 1LOQA 1KC7A 1EC7A 8CGTA 2E1DA 2I17A 3UJ2A 4DXKA 5HQEA 3DYOA 5CG0A 5FSEC 1AW2A 3W6YA 4KERA 3AJ7A 4H00A 1P0BA 4EPDC 1J0IA 4MB3A 4KFPA 4MTVA 1M7XA 3D3FA 1JPMA 4B5XA 2JF6A 3O05A 1W32A 3W1NA 1S2UA 2WHJA 3FYPA 4EAMA 4FHAA 4E4PA 4Z0JA 2E9LA 1T40A 5F7UA 2C0AA 2OTDA 3QM3A 1OWQA 2X05A 4Q4PA 2BSLA 5LA2A 4M3PA 3I7RA 5EMYA 1O6IA 2PC4A 1SZEA 2OVLA 1KM6A 4N9BA 3KX6A 1KBIA 4KF1A 4DJDC 4ZSTA 2HDJA 1Q2SA 5I2UA 4O1CA 4PMNA 4Y9NA 4MLRA 2BVWA 5AHLA 3QW3A 5FD0A 1YXCA 2PWEA 5CQ1A 3B8WA 3OBEA 1QO5A 1B3WA 1FWDC 1UUMA 3NL2A 3KHDA 3W71A 3LHTA 1R85A 4KWOA 3OVQA 1SZNA 4PMYA 3UA3A 2REQB 3LS9A 1P1MA 1SZRA 1YYAA 1JZ6A 2BY1A 4LTSA 3TH6A 2XGBA 2X8RA 4L5ZA 1CECA 2DZAA 3EWWA 3HF3A 3AWNA 4LS0A 2PF0A 3IUHA 2E9MA 1XLAA 5KINA 1F9CA 1POJA 3ELFA 4Q3MA 3HQ1A 4C1NA 2J7HA 4QFUA 1UKPA 5C9RA 1BGGA 3KCJA 1LBMA 2R24A 4J2PA 5KZDA 3EWXA 4GYKA 2V82A 4H7CA 1I75A 1S2WA 1KRCC 1L6WA 4Y9MA 1KLZA 3SCUA 1J96A 3SGUA 3BLPX 1V3JA 4H19A 3SAZA 4JHMA 4Y8EA 3CZ8A 4DELA 3BAJA 2BVYA 2RAGA 1IIHA 2X16A 3RJYA 3TZNA 3WLQA 2QHAA 2WMHA 2CLEA 2HVOA 5BROA 5TBOA 3MHUA 2YOCA 4C6OA 3BC9A 3B04A 1KA9F 1EFZA 2DFAA 3LXCA 4RW3A 2G97A 5D02A 4OTKA 3MKVA 3M16A 1JCXA 4WKFA 3E0FA 3SB0A 4K1WA 3ZR4A 5BRPA 5C54A 4CU7A 4IJRA 3L0NA 3NQMA 1XQLA 4PRTA 2VFDA 3VIHA 3AXXA 4FX7A 3WK0A 4XIMA 2ASHA 3MSRA 1UHVA 3W72A 3U2CA 3WENA 4LCRA 1QNOA 4RNHA 1DE5A 2VTFA 2BY3A 3QVQA 4IQDA 4O4VA 3ZWTA 4FR6A 4RE4A 3UWUA 1P7TA 3YPIA 2KAUC 3HV9A 3MSDA 4PODA 4ACZA 4H8NA 1LP6A 4XUGA 3GTHA 4X0NA 3ZVIA 3CAWA 5DN1A 1S2AA 2UV8G 1K1DA 2ZUNA 3NQEA 1F05A 3ES8A 3OVRA 1VIWA 1B4EA 4DUOA 2J47A 4DNHA 2PDHA 2VVSA 4NJKA 1XRSA 4PGLA 4NYUA 4J3WA 5K9XA 1C7TA 1JG9A 2A1YA 4EWJA 1EP2A 4JFSA 3EOSA 3PWGA 1TG7A 3BG5A 2FZBA 4Y9PA 4WQ6A 5CZSA 4D6IA 4PMXA 4W5ZA 2FHCA 4F3HA 4BCEA 2Z6JA 4DJFD 3R0DA 3SO7A 2W6RA 4WY0F 4KKXA 4H9XA 2FPVA 2YDQA 2EGZA 1XXXA 3TR2A 1GUVA 3C2OA 3VGBA 4DY1A 1NWUA 3WN6A 4F0RA 1LJYA 2P8CA 5AC4A 4ECLA 4HQVA 2VNCA 3UNDA 1RV8A 4AZCB 1W6TA 3AIBA 3CIXA 4IG2A 1H7XA 1JPDX 2V5JA 3WZ0E 4ACYA 1D3GA 2O92A 1K7XA 4YLWA 3BE7A 1W1TA 3KW3A 3G6MA 3UWWA 1I1WA 3REQA 2QPXA 3ALFA 1IIGA 3VK5A 1SUXA 3VKBA 5D32A 3VKAA 4WEVX 5KITA 1XISA 4NUWA 1H4PA 1OGBA 3VMNA 1FKWA 1M7JA 3PJTA 3TN3A 1HL8A 1Z44A 3RMEA 4CEUC 1Q6EA 2VHLA 2IPWA 5CC6A 4LAZA 2G0WA 3UJFA 5AVHA 4RK8A 1VFHA 3C8NA 3W1UA 2QMJA 5F2LA 1ZENA 1TYGA 2D1ZA 3QOMA 2PTYA 2QKFA 3ABXA 4MDOA 4XV0A 3P0WA 1TPEA 1WDQA 1F3XA 5G2IA 2WQDA 2ZX8A 2OU4A 2GPTA 1TJ1A 5I02A 4IP4A 3OA3A 4PTVA 1DP0A 3BJFA 4AZ6A 5KEZA 1F73A 1OABA 3ZJ8A 2PCQA 3CASA 1Q7MA 4A2SA 3LQGA 4DIAA 3NSMA 4GBDA 3FSUA 1CBGA 1TWDA 1SMDA 3TN6A 1PBGA 1BLIA 5T9BG 4ZVJA 4HMCA 2VELA 2XVGA 3CQHA 4AWTA 2QPSA 1XLMA 1XICA 3UU0A 3E12A 4E4FA 1HJUA 1KXQA 2WM1A 3ITGA 1O66A 1X6LA 3DUGA 1XYAA 3WF1A 1TFVA 1K6WA 4GQBA 4GO9A 5G4EA 4DZHA 4NNBA 1MEWA 3FV9A 1Z89A 3UXIA 1RLDA 2D23A 4FMVA 4P8XA 1W1A1 1QHOA 3EMCA 2FPYA 3F2CA 3HJEA 2VGBA 3PPGA 1W5QA 2F7FA 3QR3A 1FWEC 1DJXA 4PUMA 2ZZ5A 1QR7A 1K7EA 2VUNA 3CS2A 2VDHA 1JFXA 3GUGA 3EDJA 3ABOA 4JN7A 2ZVIA 3ARPA 2J27A 4GVIA 5I09A 5LGXA 1MEHA 4LUIA 1H63A 3T2OA 1WKFA 9XIMA 2Y5EA 3O2LA 3NURA 2QUNA 3KZSA 1DXIA 1YDNA 1ZY9A 5EKYA 4EAYA 1B3VA 5CC7A 3VD4A 1K77A 1MXDA 2VX5A 4C91A 4L1XA 1VPYA 2XHYA 4E5TA 3VZYA 1A5BA 3NDYA 1C8VA 1AZ1A 3OVPA 1FP9A 3GD6A 4FOKA 5TIMA 3C0LA 4S3FA 2DZWA 3W86A 1HZYA 4AEFA 2C14A 3IIXA 4LY8A 4C6IA 4ERIA 2XFRA 1YNPA 2Z00A 4OQVA 4MIMA 3IJQA 4NZ1A 3T05A 3WX7A 4PTMA 4E3VA 4D6EA 3NO1A 4JKMA 1XLHA 2DZTA 2Y61A 2PB1A 2VX7A 2OO6A 3RM8A 4EOUA 2WC4A 3LCXA 2FPTA 3TTEA 1AL7A 2PWHA 1E0TA 4UTIA 2YCIX 3RLUA 2Y7FA 4R85A 4HCLA 4MKVA 1DTNA 4ORMA 3M47A 1JIBA 2QF8A 2FZNA 3NGFA 3EWCA 2PS2A 1XYCA 2A4AA 3EX4A 2O9TA 1XLBA 4YS1A 3VGGA 5CPTA 1UD3A 5MKGB 4BI6A 4C7DA 2B7OA 1WCGA 1H7OA 3WBWA 3W7RA 3VIJA 1R8LA 3AZTA 1H0GA 2JE8A 4GVGA 1RPXA 4M1BA 3AWOA 2PDMA 3OP2A 5BMXA 1U5VA 1XLKA 3G18A 5E5CA 3W6MA 2Y7GA 3BAYA 3TC3A 4IFOA 1CI1A 3SGGA 3UGVA 1BRLA 2Q71A 5LA1A 4PL2A 3VX1A 2HWGA 2NZLA 5FSDC 3PBVA 1HO4A 1KXHA 4BEUA 2ATSA 4QBXA 4TVUA 4GINA 3I68A 2GGJA 2OOFA 3W1QA 4U3CA 4IOTA 2WOQA 1J12A 2X1IA 2J7BA 4UOZA 4OZOA 3OHIA 4S3CA 2V0TA 5BXPA 2FDSA 4JTUA 2VI0A 1QNRA 3LENA 3KRUA 3FHQA 1ADOA 3L66A 1H50A 1CXFA 5TD4A 1OZMA 2WM0A 1S2TA 1GK8A 4XD6A 2KZHA 3KBNA 2YB1A 2Z7KA 5B80A 1WKEA 1IR2A 1XBZA 4A6GA 3S83A 3G22A 5E93A 4G1NA 4C1KA 3BJTA 3CUFA 2WKJA 3NNTA 1BVNP 1TR9A 1HKKA 3BLLA 4I9MA 1DORA 1OYCA 3GNOA 4EANA 3NQCA 5A8OA 4J28A 5CZTA 4GYPC 2YDRA 4MADA 1AZ2A 4DX3A 1YTEA 2QCCA 1UR2A 3L5AA 1BF6A 4OV9A 5K9CA 4FXSA 1WKYA 1SSGA 2Z1WA 3SCRA 3ICJA 5EFDA 1VCVA 1ZL1A 4LSBA 2Y7DA 4DLMA 2ZKMX 4JBRA 4FI4A 2PLKA 3M0KA 4F48A 3G5EA 2P3EA 4I9TA 1GVRA 3F5JA 5KZMA 2UY2A 4PUNA 1PIIA 2RDWA 2ODOA 4XTIA 3VC5A 4B5UA 4Q8VA 2HCVA 1SFTA 1Q6FA 1WE5A 3S6OA 2WSYA 1BHGA 4ZO6A 2ZADA 1VZWA 1HX0A 4FX6M 1SJBA 1VYPX 4UFIA 1KCZA 5A8QA 1XS2A 5ABTA 3EWDA 1JZ4A 1CLXA 2WMFA 4HNOA 3M44A 1G7VA 1K70A 4XSLA 1L6GA 4H2HA 3DAQA 3CV6A 4NNCA 1Q8AA 4H2CA 4TMCA 1H7PA 3VNLA 4AWUA 1TJRA 2AL2A 4GI9A 1B1YA 1MUWA 2QV4A 3WLSA 2ZX7A 3G1HA 4MNLA 3EB4A 3N15A 1JXKA 2ZX6A 5CPNA 5KSWA 2YZ5A 1UROA 4EE9A 3VNKA 4PMQA 1UMLA 5M5DA 3N11A 4Z42C 1W3HA 4L1GA 1UR4A 1JNEA 4F0HA 4E8CA 4AD4A 1J9YA 2C13A 3A3WA 3CQ0A 4NJIA 2G3MA 1PL9A 2QDEA 3MKKA 2WLZA 3UWEA 2PCEA 1F76A 4PUUA 2DU2A 4QG6A 2C0HA 1JNDA 5BCAA 1OQFA 1BTMA 3M0HA 3I4KA 3G0XA 4HPJA 2PDXA 4XD3A 3KRSA 2POZA 5BXSA 1HKWA 5D2WA 1R3QA 4JTSA 3B9DA 1EC8A 3CH9A 4QNEA 1U33A 2PFHA 2WSRA 4HA3A 4MKSA 5CBJA 1MRQA 3BSMA 1E5JA 5EFFA 1OFBA 3D47A 3QH2A 4IFKA 4JIRA 2EEXA 2FZDA 4MZYA 4UCGA 1QATA 3CV1A 3QOKA 4D8LA 1B3OA 4B5WA 3SN1A 5JH1A 3VC6A 2HBXA 1J10A 3VABA 3RLVA 3VVGA 3PUGA 4Q8MA 2FVMA 3R8GA 3EPMA 3L68A 4L56A 4JTGA 3WUGA 4GXPA 4LRTA 4D8ZA 1UKTA 2O9OA 1R87A 4LCQA 1R5YA 4DZIA 9XIAA 1U5HA 5I6SA 1RJQA 3KS6A 1GZGA 1W3TA 5TAOA 4LWWA 2A7RA 3GG7A 3CWOX 4GNJA 3ALGA 1RA0A 2R1KA 1PCKA 2ZUMA 3NVTA 4MPKA 3STEA 3OZPA 3GH4A 4YTRA 4D6DA 1E3ZA 4O57A 1OYBA 4H9UA 1T8XA 3DOPA 2EF9A 3PJXA 5HNRA 1AJZA 3AMDA 1QK2A 3KOZA 3WNNA 5CAHA 1VGAA 4AYSA 4MYAA 3N1AA 3WQ5A 4B91A 5J5RA 3QQ0A 4DWSA 2W66A 1PZ0A 4Z08A 3VD3A 4ZQOA 3A21A 1FCQA 4QLKA 1UA7A 4YJ5A 4CQAA 4B3ZA 3GNPA 3WLTA 3U9IA 2CWXA 1YEYA 2PWDA 4O0QA 1D2KA 2Y8UA 1MYRA 2RHGA 3TOYA 2J62A 1JJKA 4HMNA 3TQPA 1XYZA 1B5TA 4W84A 1CTNA 4JR5A 4IMGA 1H2JA 4K38A 2O4QA 3UJRA 2J79A 3LNMA 3W28A 1B4KA 3DFTA 3OODA 2ZA1A 1PCWA 4XQ6A 1JPHA 2C91A 1FP8A 4P8UA 3PB2A 4Z17A 4NZ3A 5AHNA 2IKIA 4UFMA 1E0VA 3ATYA 3HMJG 1V6XA 2V2CA 5D05A 1DHPA 2J88A 1TVNA 3MQTA 1PB0A 2VCCA 4GUHA 3WLIA 2NV1A 4NXKA 1W5PA 2EHHA 4B92A 3LV6A 3REQB 2ISFA 1TMQA 2HTMA 4QM1A 3NAVA 1DIDA 1LT8A 4K6AA 1PHWA 5C2GA 3DYPA 1DXFA 3GKAA 1M68A 1JDFA 4LYQA 1PPIA 1X39A 2O7QA 3N12A 1TV8A 2V5BA 3RPTA 2DZBA 4O1DA 3ZJ6A 1IWPA 1XSJA 2Y88A 3EWYA 1G5AA 2XVKA 2ZOXA 2GDUA 1OX5A 3I4EA 4CUCA 4LUSA 2WZHA 3IARA 1J0JA 5HMDA 1TSIA 3R13A 1JULA 3C2VA 3AXHA 3WBEA 2RUSA 4LVAA 4H7ZA 3APTA 3CMFA 1BEUA 3G1FA 3MO4A 1ISXA 4YTUA 5RUBA 2WV8A 1QW7A 4H8HA 3W25A 3QHOA 2ACUA 2C3ZA 4WJEA 2BHUA 3DU0A 4IGHA 3SBFA 2DSVA 3FCPA 3ZR5A 2J75A 4AX7A 2EPLX 4Z2HA 1OX4B 3RM4A 2PDFA 2GJXA 3QF0A 1FX6A 3H7UA 1GYNA 2IPJA 5DXXA 4TV5A 1EYEA 1VFMA 3NL3A 5F2GA 4EIVA 3CB3A 1A3HA 3FKRA 3U2EA 1R7OA 1FWNA 3URQA 3UZZA 2ONEA 2D2HA 1EUAA 4GXMA 4WXYA 2E40A 5A8NA 4S38A 4ES4A 4AD3A 3M0LA 2GUBA 4XAYA 1GYLA 1I2OA 3N25A 4Q4KA 4YMZA 5AECA 1IT0A 3N18A 1WPCA 5JIPA 3KBWA 1JXJA 3LCLA 3ITOA 2PSNA 2OYLA 4H6QA 3CZLA 2PD9A 3B03A 3UERA 3ZLGA 3GR7A 3L5LA 4RXGA 1FH9A 4GKTA 3ZT5A 2NV2A 1TIWA 2ZTJA 1DWAM 3NUKA 1BSLA 4NZ5A 3SRKA 1XBVA 3VD9A 2XZ9A 3W2JA 5M17A 2ZIDA 2VC6A 2VDIA 2HJPA 1EF3A 5D2VA 1B3ZA 3L0GA 3QQ1A 1BXNA 5CSYA 3UZWA 1VKFA 3INPA 4JIEA 3RHGA 1JPKA 2VT0A 4D9PA 4OOZA 4ZQRA 4HGXA 3FKKA 4YTQA 2ZXAA 2HRWA 5I7GA 5H6HA 1K9TA 3NQ8A 3AS3A 3AAMA 2W67A 3NQDA 3B05A 3IJ6A 3LBCA 3SEPA 5EGRA 1ICPA 3IAQA 1XYMA 3W85A 5HA7A 3WJYA 2XH7A 3CUJA 3U8GA 1Z42A 2QUMA 1F6PA 1YPFA 2PPGA 1AD4A 2NX9A 4DI9A 5HXMA 4S39A 3POHA 4PTXA 3RM9A 1EQCA 1OGSA 4DUWA 2JEPA 4NI3A 3TC6A 2I57A 4PB3A 3NL5A 4L6HA 1JD9A 1V0LA 3K8KA 4JIPA 3V0TA 3DH7A 3OQ8A 3R12A 5D2XA 3F2DA 3TWAA 3ZZ1A 3MMDA 1FY6A 1PVNA 1K8XA 4MWAD 3AIEA 2DZPA 2YL9A 2NVAA 4IMCA 4TUFA 2JKEA 3LLFA 2JKAA 4TTUA 3TE9A 3TTYA 1OF6A 4AVOA 4EPKA 3DX5A 2DT1A 3IWPA 1EZ2A 5FEPA 3WQ6A 3ONCA 2DGAA 4U31A 4B9ZA 1RVGA 1IWAA 4CQ9A 3FEQA 4AF0B 4FXRA 4Q4QA 1RBLA 2NUYA 4RLIA 4KS0A 3AS2A 1L0PA 4DN1A 2YSWA 4NRSA 5FJPA 1EJSC 3NDOA 4N9EA 2G5WA 2J7EA 3PWAA 1VLWA 1QNVA 2J4GA 2V5KA 4TMBA 2W0UA 1HKIA 1S2VA 1QNQA 3DKJA 5LIWX 4AEOA 3WQCA 4Y6GA 2DZUA 4NHVA 5D2YA 5C9ZA 3W6LA 3WDQA 3GXNA 3ZIZA 2ZCGA 1MMFA 3G1DA 4JKLA 3FN9A 4M81A 3FVMA 2J7DA 2WMIB 2OQYA 1KRBC 3HPXA 2ZFAA 4YVVA 4DYEA 4AIOA 2BHYA 2IQDA 1GVSA 1W2VA 3N9RA 1A47A 4J27A 4DM1A 5A6LA 2CBVA 3M0MA 4LAKA 1XLEA 5BW6A 3GM8A 1VEMA 3MC5A 3DFPA 3DG6A 1MXGA 1SJAA 3R79A 4E4UA 3WCZA 3ABSA 1Q6OA 3NEVA 1PTDA 3SR7A 4AZIA 3VZZA 1UOZA 1W9PA 1JCTA 1KQZA 3AXKA 2R1PA 3THDA 2PGWA 1T0OA 2FTPA 3LPFA 3G1XA 4HSHA 1ISWA 3K4WA 1ALDA 1UQYA 5D33A 4YVXA 4QE4A 4AXNA 3A4WA 4WGXA 3ZS4A 3EWBX 4WY0B 1XLGA 4PUWA 3DN5A 6XIMA 3UR2A 3B9NA 4ADTA 4ZOBA 3FA5A 1ITQA 1F3EA 5GNXA 1ZTVA 4QCFA 4CD8A 4L64A 3IJ9A 1UD5A 4IGMA 1EIBA 1XLLA 4A2RA 4O52A 3R8RA 5DCBA 1OINA 1SJDA 2W4XA 3IGSA 2PBGA 1D8CA 1NP0A 1GVIA 1JUEA 2PP1A 2R1MA 4AG0A 1Q66A 3OGVA 1ZBWA 4IPNB 2OYKA 4F9JA 2D0FA 2QCDA 3B9AA 3R0UA 4WD0A 1RR2A 3V0SA 4PCNA 5DY2A 4OVXA 5H8UA 1FFRA 1PS9A 1DWGM 3EDDA 1NJJA 3MW7A 3ARTA 4PRRA 5IDZA 4DF2A 1A3XA 3G1AA 1XBXA 1JPIA 1A5LC 3C0JA 3UG3A 1TPH1 2NUWA 3IK2A 2I5GA 3S3GA 1QPKA 1VFUA 4Q8QA 2IKHA 2P53A 3SJNA 4C7GA 4UMAA 1O60A 4ZO8A 4PYSA 2PLJA 3MSYA 1IEVA 1D3CA 3W22A 1E9YB 3GFXA 3AHXA 5CBBA 2J66A 4K1GA 4EPBC 2CHNA 3MCNA 2C79A 2NT1A 3IRSA 4HYRA 2R14A 2CETA 1UIPA 4LJ3A 5HPCA 4QROA 5JH2A 4CCCA 3KUMA 1V6WA 3N2MA 1EYWA 3QGAC 1CW2A 4OV4A 1XX1A 3GO2A 4OBRA 2PWUA 1KXVA 1VBHA 3M1ZA 1G9HA 2BY2A 3B97A 1HF6A 1KTBA 3FJNA 5D8ZA 5LIUX 3WH6A 2Z1XA 1JVNA 3PM6A 4NX0A 1AMKA 3IVUA 3QZ6A 1FBAA 2ACRA 1JF6A 1V5XA 2YFOA 2J7GA 2LLEA 4CNTA 1C8XA 4KQNA 3G2GA 4Q7IA 4AW7A 3UYCA 3HGRA 1ZJIA 2OT1A 3UZ5A 3HGSA 1GVEA 1YE4A 2WQPA 3M5YA 2FB2A 1TKKA 1Z6KA 1T41A 4LNYA 2BMBA 4DZ5A 1SO6A 1HJVA 2XN2A 2AQOA 3PUDA 1J0ZA 1TV4A 2C8NA 2OLAA 1K7FA 1PSCA 2IUZA 4JFVA 2H3BA 5JXQA 3G1SA 1EX5A 3T07A 1EH9A 1ENUA 3WMSA 1GQJA 1MFUA 4PSPA 2VGGA 4D72A 1SM9A 3UPMA 1R2RA 4KW2A 3OZOA 1KGXA 3BCJA 2PD5A 4FAMA 3V4BA 2VM8A 4P8WA 3BDKA 1XFCA 3I7SA 4XKYB 2BVTA 4NJJA 2WCSA 3NZQA 2VR4A 3HG2A 3CM4A 4UQAA 4UQCA 2QT3A 3MBDA 4LEFA 1V77A 2P1FA 3PPCA 4I8DA 4G8TA 1JQVA 1BFNA 3BURA 2WJEA 4GIEA 3KXQA 3KWXA 1HTIA 2WO5A 2D24A 4C90A 5CG7A 3NL6A 4I9AA 4AQLA 3PPFA 3VNIA 1V7AA 2DUZA 3P14A 3TSMA 3U5YA 3LHVA 3GXTA 1E5NA 1JAKA 4MNJA 1GVFA 4D8AA 3NPWA 4HOWA 4YTSA 5IHSA 3R0KA 4LOCA 2Z27A 3T7VA 1US2A 4GBUA 3XINA 4AEEA 4MAVA 4BF5A 1Q6DA 3RR4A 3TOPA 1RK6A 2VC5A 3HGOA 5AYBA 3L4ZA 2OX4A 1FHVA 3AI0A 3H4GA 5GNYA 1NH6A 3MDWA 2W91A 4NAEA 5E09A 4RNIA 4PMDA 2PDKA 3HTWA 4HHLA 3JUGA 1PO9A 1OIFA 4LB3A 3GDTA 3B4YA 1RPKA 4XAGA 2NQZA 4UFJA 4ATWA 1RD6A 5ABEA 1DJWA 3S1GA 4JTCA 4C5YA 3M5VA 4E2OA 3STFA 3MJMA 1M9HA 3SADA 3KVLA 1W9DM 2YA2A 3O07A 5DO8A 4HHMA 1UP0A 3OGSA 4ZODA 4ZE5A 3GTXA 2PLMA 4RZ5A 3GUWA 3NFUA 2B81A 5LNVA 1S46A 3EX6A 1TQXA 3QBUA 4CVUA 1BXBA 4ZE4A 3TP4A 1BYAA 4I6KA 5J04A 1Q6RA 2YZRA 1E55A 4TV6A 5HMFA 3MHFA 4MYXA 3WF4A 2CLLA 3C4UA 2Q01A 2WZEA 1US0A 5FEWA 3QV7A 1VPXA 2OG9A 5FJOA 3WMLA 3LCFA 1V3IA 1TIMA 4HP5A 3BQ6A 3WFZA 3AYVA 3TTOA 1GOOA 2CLOA 1TPVA 3CL8A 5I3FA 2POTA 5FF2A 1YX1A 3DFNA 2Z2UA 3CJPA 2GK1B 1H1NA 3EB3A 3V75A 5CJ5A 1PKLA 4MPQA 2GLKA 4B4FA 2PBOA 3E2SA 3KFTA 3PN8A 3NXFA 3H7VA 2P0IA 3HURA 3PTDA 1LDCA 4UIOA 2ZC1A 4O1BA 1DJZA 1Q3NA 4H9TA 5ABGA 3T0CA 3USBA 1LROA 1R3VA 1JI2A 5DRIA 4QISA 4G6CA 3ARUA 1P48A 3EX3A 5AC6A 4C6CA 3QYSA 3EOLA 3PSWA 1NWTA 4ZO7A 4PH6A 2A3LA 5BOEA 4J3TA 1SFSA 1BYBA 4E38A 2QPUA 1O94A 3EPNA 4GY1A 1V6UA 3FDKA 5I3DA 1I60A 4EXQA 3WMBA 3HFYA 1YQ2A 3B3DA 1GHSA 4ZOCA 3U5UA 4I9JA 2FH8A 4IF2A 1TX0A 4ADUA 1WO2A 1VYSX 3VKDA 3TXZA 3AALA 1DQWA 3GTFA 1U1JA 3OG3A 4CD6A 1DPMA 1LLOA 1RQEA 2YW3A 4UTWC 1SO3A 1JR1A 4L4LA 3OBKA 1E6ZA 3A9IA 1Q7QA 3FGCB 1JYWA 1EWDA 2CPUA 4JTAA 3GG8A 5AOUA 1FWCC 3VO0A 4JQ3A 4HNCA 3UY8A 2VD8A 1AK5A 3LI1A 2ZVRA 2J8FA 2A3EA 3B0UX 1W5NA 2FVLA 2OZ8A 1O1ZA 4Q8WA 4I3GA 1NTHA 2AL1A 4JNMA 5BWAA 1MSSA 4LAMA 5A8PA 3HQPA 1QPRA 2GJLA 1CZ1A 1UH3A 2ZE0A 4ZXLA 1TREA 1LL6A 1FH8A 3DGBA 5JBDA 9RUBA 4H04A 1G4SA 1A5AA 2BBFA 5CJNA 4KT2A 4ZR8A 2D3NA 3BJSA 3LCWA 1HW6A 3N13A 4MNMA 1TMHA 2YL6A 3TYCA 4QLLA 1ZNNA 4X9YA 2CLFA 4HSNA 4O4WA 1O95A 2OOGA 1JZ7A 2FZ8A 3I3EA 1U1UA 2GWNA 1RY0A 1MVYA 4MWAE 5CC3A 3MJYA 3W0KA 1JQXA 3K13A 5CEWA 3SUUA 3TYDA 1K9EA 2DIEA 4W7UA 1ZJHA 4XAPA 1W17A 3H24A 5C5YA 3SY8A 3GZAA 1R2TA 4KWWA 4AZGA 4CCEA 2PDWA 3ARQA 4Y96A 1TO3A 5HWMA 3CUZA 4GPNA 2HK0A 3GIYA 3MVIA 4BJHA 4NIRA 4GKLA 3CHCA 4LX4A 1ZLPA 3P93A 3U2OA 4TO8A 5FF0A 1PZ2A 1OEPA 2D2OA 1YIXA 1WOBA 3E96A 2Y5JA 3RILA 2CKSA 2YR1A 3BCDA 4KCWA 5HNNA 4WJ8A 4HTBA 2OELA 2YCLB 1CDGA 3CAVA 1HP4A 4AMAA 3BG9A 2HZGA 4A8NA 4ORIA 3UPWA 3T2QA 1XUZA 2CYGA 1FKXA 3GBDA 4IIFA 5H1WA 4KGJA 3HQNA 4G2DA 3N4FA 3EBVA 1LF1A 4IXHA 3VOCA 4CEXC 3S2NA 4JIQA 1M1BA 1EPVA 6REQB 3S9IA 4WR3A 1QCWA 5T91A 3OOQA 2V30A 4QX4A 4HTYA 2ZZ3A 2Y7EA 1CPUA 5G1MA 4QXIA 1VJZA 1US3A 1PUDA 4JCMA 4DO7A 4MF4A 1R47A 4MG4A 4LF1A 3HBLA 4U3AA 4DAIA 1UD2A 1HJWA 2C6QA 4QJ1A 1W1VA 3IEBA 4UQBA 3EGJA 3AU6A 2YDAA 5IRPA 2R82A 2IW0A 1YXDA 2Z4GA 1VJIA 4V28A 1QPQA 2ZZ1A 4UWMA 3LCHA 4XZMX 1GKQA 4Q8NA 1L2UA 3MSGA 1PX8A 2HS6A 3GVQA 1GOWA 5BRBA 2HE5A 2REQA 2A3AA 4S3JA 4EPEC 4MJZA 1HXJA 3PSVA 3EX2A 2Z6IA 1OCJA 3GIPA 2VX6A 2V3GA 2F9RA 3IVTA 3WDRA 3UNTA 3MUCA 1JCYA 1WZAA 4IX0A 2VCBA 5F2MA 1DWIM 2BODX 2QAPA 1J6PA 2OX1A 1KLYA 3MUXA 5CPSA 5AB3A 3ANUA 3SW6A 3VIOA 4PL1A 5EMJA 1XC4A 4XUYA 5JQ9A 4CQ8A 3A22A 2XFYA 1A5SA 3NDZA 4IMAA 4V27A 4MM1A 4XBKA 1W9VA 3W2LA 4TTGA 3OLDA 3KM8A 5AKQA 3L67A 3VINA 2EKCA 1TUXA 3HMCA 4J3SA 4HNNA 2XISA 1NQ6A 3N9KA 3V3WA 3R2GA 4OHQA 1EBHA 1XYFA 4U5KA 4Z1AA 2OEMA 3VCCA 1X6NA 2IMRA 1CT5A 3OYXA 3T0BA 4DLFA 4D1JA 3M0IA 1GTHA 4XB3A 3HOJA 1F2JA 2IKJA 3Q37A 3S1WA 4GG9A 3K2GA 3QKZA 3AMLA 2A5HA 2OKOA 4MFDA 5TNVA 3VD5A 1EO5A 1TTQA 1FCUA 2P10A 1SJCA 4QEHA 3UXAA 3S0CA 3BW3A 3QSRA 5A3HA 3DHFA 1W0MA 4LUTB 1ZSXA 2W9MA 3W73A 1ZUAX 4QP0A 4ROQA 3IACA 4DF0A 3VE7A 4H8VA 1LRNA 2BGNE 4FF7A 1IEWA 6CGTA 1E4NA 2BXZA 3WH8A 3FXGA 3VXGA 5K7JA 1VBUA 4O50A 3WBXA 2DJLA 3IPWA 5I78A 1CB7B 4H6RA 2D0GA 1EJUC 1KRAC 3M0ZA 4IMFA 2XZ7A 3WLPA 1EDGA 3IIOA 5AC5A 1M3UA 5G2WA 3NPXA 5EB8A 2NQJA 1NM9A 3QY8A 4Z1CA 2MANA 3M5XA 4PUJA 4W8BA 1VCFA 4CQDA 2UY4A 1TRDA 2WAGA 4UQDA 4AZ7A 2EAWA 2PURA 2JBMA 2WBKA 4UOQA 1AD1A 3SSZA 4CU6A 2XN0A 2Y8KA 2TPSA 4TVDA 3W24A 2BTMA 2GVGA 2P76A 3A12A 3SCNA 2DQXA 3RAOA 1R3TA 1KBKA 2BLEA 3TW6A 1QASA 1HKMA 2FZMA 1BKHA 3NQVA 4IPJA 1Q7ZA 5LHEA 4GIAA 1H61A 1GWJA 1OYAA 3N6QA 2ZZ6A 1TQJA 1TMLA 1BVZA 1EOKA 1HJQA 4IQEA 4YCPA 5CC5A 4NJHA 3S42A 2O56A 3QLDA 1PE1A 1K8YA 1W8GA 1I9CB 1Y7VA 4JIIX 1TWIA 4GNVA 3NSXA 4GQ0A 1EIXA 3OLEA 2V67A 4RDZA 3IVSA 4L6OA 1TV5A 1E73M 3H2FA 3P0XA 2YIHA 2VD9A 4L4OA 1IZCA 3V16A 3WLHA 3BZJA 3KZPA 3QRHA 1E9ZB 1E51A 4Y7EA 4QSHA 4GIYA 4Q22A 1CGYA 1MW3A 2UY3A 4DUXA 2WB5A 4AUBA 3UR5A 2Q8ZA 4RZ4A 5CSUA 2DIKA 2XWEA 3CL7A 1SW3A 3W1LA 4PSRA 2V8ZA 3R4IA 1Q2RA 2QCFA 3NOYA 3ABZA 2WANA 3W81A 3QTPA 4JTJA 1E3XA 2CBUA 3P2VA 4ZOAA 2JQXA 2YW4A 2GGIA 4C6JA 1W1ZA 4DBDA 2VZUA 2OGJA 1B3XA 3RUBL 2TSYA 4AMCA 2XVPA 4MWAC 2J7CA 1OZQA 4AU0A 3PZOA 1KB3A 2TAAA 1XUUA 4U2ZA 2G3FA 1QXLA 3LV5A 3E0IA 5BZAA 4CQCA 2XVNA 1KBLA 3CPUA 4KBXA 3DFYA 4F0SA 3OVGA 1WP6A 1BWVA 3C2FA 1YHTA 1XJBA 3KE0A 2OLHA 4HZ7A 5AFDA 1ZAJA 2R1LA 5T26A 5FF7A 2VUYA 3VDAA 5TF0A 4KWUA 5A6MA 1V4YA 3NQ6A 2PDCA 2ZZ7A 3EXSA 3MUAA 2RDXA 4FLSA 5DMNA 1WZKA 1TPB1 2WWDA 4GH1A 3Q67A 4KRZA 1Q45A 3G0UA 3BOFA 2XGIA 5I07A 1OCQA 3UZJA 4UTJA 4RNJA 2BX7A 1OFAA 3VU2A 4UUIA 2AKMA 2E6YA 4YL2A 4JYDA 4XZ9A 3PTKA 4JN6A 1FWRA 2KX9A 1VFTA 3GXIA 2B31A 1KCLA 3GFZA 1EEXA 2CITA 4Q32A 1P1XA 2I1OA 4D2JA 3IUIA 3UZXA 3TCEA 1QOXA 1BQCA 4F0LA 3VKKA 2OJPA 1ELSA 3LGGA 3VI2A 4JHZA 1XRTA 3GWQA 4UXDA 1UIOA 1TZ9A 2YXXA 3EAUA 4HN4A 1ME7A 1J0KA 2VEIA 4A8LA 2FTWA 4PMJA 4M7SA 3W7GA 1E0XA 1RJPA 3CB8A 3WD1A 2XH4A 2PRMA 2X0SA 1Q8JA 1TTIA 3PZVA 4UZUA 3KBMA 3STCA 4J4KA 1XGZA 1YXYA 2CEQA 4AFYA 3CO4A 1IHIA 3S9YA 1GQNA 4S3GA 3L2MA 1U83A 2PE4A 2VZOA 1J18A 3WO8A 4L4MA 2ZTKA 2DZXA 3FNDA 1G4PA 2NXIA 4DEFA 3EX1A 4FF5A 1RK5A 2CXGA 4O8AA 2YBVA 4NVTA 4P7OA 3UR7A 1BAGA 1CEOA 1YADA 3OLGA 3Q65A 4YWIA 2PEVA 1JYNA 1OX6A 2XGZA 1J2BA 1JF5A 2D3LA 2FDMA 1ITCA 3RIKA 3S9ZA 3QHNA 1IEQA 1CGVA 5REQB 4XO6A 3C3NA 2GQ3A 2PP3A 2FMOA 3I3DA 2QR6A 3PJUA 2WWCA 3VIFA 3KP1A 3BQ5A 1YPIA 1R38A 4JIHA 4LANA 3A4JA 3E5PA 1GPFA 2Y4SA 3CLWA 2QNEA 1YE6A 4IM4A 3D6NA 3D3AA 3CMGA 4JQ1A 3KL5A 4ZQNA 3C52A 3WK2A 4DJEA 4IH3A 3LK6A 3QC0A 5MKGA 3LPPA 4A21A 4E8GA 4O0KA 3B06A 3P8JA 4RZBA 1R2SA 3FJ4A 4QGCA 2XIIA 4IICA 1GGOA 1SYTA 4PEKA 2HQAA 3W7QA 1QW8A 3GU9A 3W74A 3G1VA 2YKKA 3DC8A 1X8CA 1A49A 2OQLA 3GK0A 2V5DA 2YCEA 3R11A 4ZB5A 4KRTA 4GZ7A 3UZYA 1GOQA 3SCPA 3ERPA 1Z9AA 2YFNA 1C9WA 3NZRA 4JOMA 2ZRZA 2NV9A 4ZB2A 3QXBA 1GG1A 2OSWA 1U1HA 3NXLA 2ISDA 4BI7A 5A6BA 1I2NA 4E0CA 2Y6ZA 3O3RA 3THUA 1V51A 4CGTA 5MF5A 1LG2A 2OO0A 4HZ8A 5HULA 2XIMA 4QNWA 1UC5A 4UMCA 1JYXA 1V02E 2E3ZA 1ZQ5A 4WZHA 3QMTA 1OD0A 1XM3A 1DIEA 1X7FA 3PP7A 2YXGA 1EXPA 3CWHA 4TIMA 3EXRA 1F07A 3WD4A 6PTDA 5PTDA 3FOKA 4WUIA 3K4AA 3FJ6A 5E1QA 1QVBA 1P0DA 1XRFA 1QT1A 4W8AA 3UVIA 4DYJA 4JDBA 2P0OA 4US5A 2WYSA 3SGZA 1H11A 3AMGA 2QULA 3T81A 2BOEX 3WNKA 1P0KA 2BXVA 3WH7A 2X0HA 4Z1YA 1REQB 2YL5A 3VOFA 2NVDA 3LUTA 2IPFA 2A3CA 3HPZA 3NQ2A 5XIAA 5D04C 1XLJA 3W82A 3TYAA 4F2UA 1WQ5A 1UASA 3VIMA 2NLYA 5EMKA 4WSKA 2J74A 3LCIA 3AZSA 1R3YA 3CEPA 4ICCX 3VD7A 5KMYA 1XRVA 2CIPA 2WXDM 3MP4A 2DVUA 4ZEPA 4ZTXA 5L9FA 2VO5A 2JF7A 3OJGA 3ZQ9A 1R30A 4QG8A 2Y1HA 3P82A 4NF7A 1JZ5A 3ZWSA 4OBSA 2INEA 4MDPA 3P7YA 3PZTA 3W37A 1D9EA 3G1RA 1SFJA 3DBPA 1VIZA 2NWSA 3WH9A 3AISA 5I03A 4PB4A 4GVHA 1RA5A 2CBIA 3AHVA 3EDEA 1CYGA 4FIQA 3MP5A 3U57A 3VKCA 3PS7A 1KGWA 2GOKA 2XPKA 3S1UA 4MUZA 4W88A 1MI3A 3H26A 3KOYA 3OZYA 1J5TA 1XQKA 4O0ZA 5HNTA 3RPDA 4IJBA 1W2PA 1UZDA 2UY5A 1XIIA 4JS3A 5I00A 3KL3A 3WD2A 3TX9A 1XR2A 3H55A 3PHAA 3W7KA 4EKJA 4DJDA 1LL4A 2WNWA 5JU6A 4XK2A 3BLIA 3FJLA 2JALA 1TE6A 4CNPA 1LQ0A 2G4JA 3LM7A 3NQFA 2PGRA 3DFSA 3GH5A 3PZUA 1L6YA 5JBEA 5HK4A 1KM5A 3WQ8A 1GW1A 2ZX9A 1HL9A 1OFPA 2PGEA 4BS0A 1DXEA 3BAXA 3M6DA 4KGLA 3HPSA 4K8GA 5HJYA 3O0KA 3W01A 1Q65A 4JTTA 4AY1A 5ABFB 3WYZA 1KWGA 3AMCA 4ERGA 1CX9A 2CW6A 2Q8LA 4X9SA 3UF9A 3C2YA 1ISYA 1GORA 2Z26A 4GK8A 3CNYA 1AJ2A 2DH2A 3HIJA 2DSKA 1V3MA 3MDUA 2DZVA 3I3BA 1ZRQA 5A2CA 1OVDA 4LV4A 1QI3A 5BWFA 3M43A 1LL7A 4RV8A 1SGJA 3WQGA 4WDTA 3TW9A 2Y85A 5CXPA 1LOSA 1MNSA 3KLLA 4RE0A 3EB2A 5I79A 1TPDA 3JU2A 2BXYA 4J9JA 5DBUA 3WLOA 4W9TA 4R33A 3M0JA 2AQWA 3SSJA 3VM7A 5A6SA 3N19B 2PWVA 1JRCA 4V1YA 2HVNA 5A1AA 1SR9A 3DESA 1M03A 2F2HA 3FX4A 5IHRA 1DWFM 3HA1A 3RYSA 3N29A 3BMVA 2D73A 4YU1A 2QCMA 4M51A 5DANA 3SUWA 2VGFA 2YLLA 1A53A 1QI0A 3WKZA 2XVLA 2GJNA 1XDMA 1UMYA 2PZNA 4KWVA 4QG9A 4D6FA 2WW5A 4JTKA 3RRXA 4IUOA 2GJPA 4A3UA 4K37A 3TMLA 1KWKA 4DXVA 4OJYA 4HYVA 4NYYA 1P0EA 2VZVA 4R88A 1JFHA 4ZENA 1S3HA 3SI9A 4UCFA 3QJAA 1V6VA 2BFGA 4V15A 3WH5A 5I77A 4JFWA 5FI8A 3F7JA 1KXTA 2V2HA 4FOUA 4GZEA 5I3KA 1WB0A 1F4HA 1KFCA 3EMZA 1CXIA 4BY3A 4GLEA 1W1IE 4IX2A 4S2CA 3ANYA 1XLFA 4GJ1A 1Z32X 2CLIA 2WNZA 2FGZA 4F0MA 3A5FA 1UZ4A 2QVNA 2VQUA 1UKSA 2PP0A 3VILA 2QCEA 2VRKA 3OHMB 3O6YX 4F0KA 1QI5A 4UTHA 1L8NA 2PRLA 1W3IA 1OGGA 2XFFA 1W8SA 3N2OA 1A4LA 5GVJA 1E6RA 2E09A 4R5EA 1TUFA 3CBWA 1SU5A 5FJTA 2UZ9A 1GPWA 1HJXA 1K4HA 1Q6LA 1WDPA 5GJNA 3U4AA 2E4TA 5LIKX 3VUPA 3WBYA 4M0XA 3GU1A 3AOFA 2E25A 3B0XA 3BOLA 1ECQA 4FR1A 5KETA 1VD6A 3IUDA 1CB2A 1RQBA 3N4AA 2NXGA 1XLDA 3GC4A 2OMAA 4OWGA 4A22A 1W91A 2E67A 1XV8A 3MWAA 4BKNA 1ISVA 3NGJA 2OZ0A 2YYUA 1EJVC 4B3KA 4N9CA 3W84A 1DOSA 4KEUA 1OK4A 5HR6A 4M82A 3DG3A 1X97A 4YHGA 3IANA 4AXKA 3EMQA 6XIAA 1UJQA 3S8HA 1W1B1 1HL2A 4HIBA 1XIEA 3LN3A 2GVYA 1M04A 4GJJA 1OB0A 2TRSA 4QAIA 2Q09A 3B8IA 2CC0A 3RN6A 3W27A 3TCSA 2P50A 3E2QA 4S2BA 3IJ8A 4OBTA 1R0MA 1WBHA 4Q8OA 3L0KA 4P7RA 3T4WA 1ZGDA 2VL4A 2JGQA 4REQB 1GQKA 3A3XA 4M6QA 4HNTA 1H5VA 4C65A 2VDGA 2Y5SA 1OX4A 4OGZA 1LT7A 4CNOA 1Y0EA 2YCKX 2DJXA 4Z1BA 3KVMA 2QJIA 2QQ6A 3II1A 3RRAA 4PUEA 1AH4A 4INFA 3RCNA 1YW1A 4H83A 3ZYZA 4HCDA 3ES7A 5D2TA 1S39A 3ZLHA 1A50A 5JMUA 4MWAB 4RDWA 5U7SA 4I5UA 1V02A 1OC7A 2WZTA 2PTZA 3TQVA 1FCVA 1KQYA 2X40A 3BK0A 2AMXA 2W27A 1QMLA 4POCA 1WOAA 3SY5A 4DO6A 1OFDA 3WK3A 4XZHA 3V36A 1MW0A 4J2MA 3ITTA 3W1PA 4NILA 4GHRA 3UWYA 1L9WA 4DO4A 1OC5A 1ZB5A 1J4EA 3TDFA 1OM0A 1A5OC 2J25A 3LTYA 3EOUA 4O12A 3P60A 3CPRA 4JTDA 1UZHA 3VA8A 2X7VA 1FWHC 3ZVHB 2BB0A 2R6OA 1RAKA 1NAL1 3F03K 2VEGA 4CNUA 2NSOA 1W56A 4HJWA 4JQ2A 2PWGA 2QCLA 1BSIA 3MUIA 4H8UA 5DY3A 4WRHA 5T9CE 5I3JA 5DT7A 3S6DA 5FIPA 2I7GA 1UKQA 2ZA2A 1G69A 5E6YA 4GO8A 4HPGA 1XSKA 3N3TA 1O5QA 4JQAA 1FH7A 3CZKA 3KDOA 2QAFA 2WVVB 3DHDA 2Y24A 1SSDA 1CIUA 3ARXA 2ZRYA 4GACA 1UZ1A 3O15A 4U4MA 5HWJA 1K9DA 3W1TA 3CGTA 4ZCWA 1VEPA 3DXIA 1VFFA 4LPCA 3BTNA 1XHGA 2VC7A 5EMMA 1WKDA 5DBTA 3S5ZA 3FA3A 5FACA 2ZDSA 1UH2A 2DV0A 2V6AA 1ESWA 4QSFA 1Q4WA 5LSMA 4B9YA 2QLYA 3M7SA 4ERAA 2PDLA 3QY7A 3LXAA 2WJFA 5ENLA 1F3TA 4QS5A 2B7NA 1HP5A 4JQ4A 1IEXA 1XH2A 4HPNA 3AHYA 1I6NA 1WBJA 4AIBA 1TJPA 1I4NA 3GVWA 4GNKB 2G3IA 4LT9A 2OLSA 3MVTA 2Y62A 2ZC8A 3GVVA 3SDOA 3OIHA 3O63A 2TMDA 2NQ5A 1RSCA 5LNSA 1EGVA 3T0DA 4HK5A 3SZ8A 3EWUA 3WLKX 1EKOA 1GCYA 1P6WA 3TJLA 4XAZA 3ARRA 3R6IA 2J13A 4RXFA 5XINA 4P7LA 1E9LA 4AF0A 1HFBA 4YCOA 2D2GA 2C16A 4L65A 5A8MA 1OY0A 1H0IA 7REQB 4J3UA 2C1HA 5AN7A 4A3YA 3C56A 3I65A 4MNKA 3GNDA 4WIWA 1GJPA 4WDWA 1KD0A 2J8TA 4ZMGA 4LUJA 4XVEA 3E2VA 4JCLA 1ADSA 2A7NA 4LV9A 3MP3A 3F4VA 4P5UA 4QE1A 2JIWA 1TVPA 4R9OA 4Q4RA 1N7KA 3E0WA 1ZBCA 4GY0A 1OBAA 3AROA 4ZTYA 3HN3A 2G95A 5DT5A 1C92A 2ATMA 4GQRA 4KWSA 3OIXA 5EMLA 2WCAA 3HPAA 2CZVA 1VH7A 1GT8A 1LBFA 2WMIA 4K3ZA 4MZ8A 3ZSTA 1E70M 3UT0A 2DT3A 1CCWB 5AYZA 4DBUA 2AGTA 2GWGA 2ZBTA 3SQMA 1VFOA 4RJEA 4GXWA 2DZSA 3CHVA 3O6DA 1A80A 4IIEA 2X1SA 4Q6XA 1EHAA 2ACSA 4U28A 4KH2A 4WSJA 3ID7A 1XIGA 2AAMA 2VURA 3B0YA 3EKGA 3UJSA 3OPSA 4N9DA 3PB0A 1FWGC 5C2CA 1MXSA 4GY7A 3RX3A 1LQ2A 3STGA 1AJ0A 5D03A 3SIZA 2XUCA 4FLOA 5CGQA 2GQAA 2Q02A 3QY6A 2CU0A 3E0VA 4YTTA 3TQ0A 4TU1A 5DRCA 5BXRA 6A3HA 1Q6CA 3WLMA 1S5MA 1VYRA 1A4MA 3BLKA 1X6UA 2FFCA 4Z2KA 4MVAA 2XJ7A 4OECA 2J8GA 3P67A 2ZWZA 4Z2JA 3ISIX 1EEPA 1XDJA 2FGBA 4JDYA 5HQMA 2EBNA 3IIZA 4YYFA 4WY0A 4XSMA 4DO5A 1GTEA 4GYPA 1VENA 2PC8A 3BG3A 6ALDA 3LPGA 1ZAHA 4MGGA 4MY1A 4TX8A 4G7FA 4JX4A 3ABRA 3CLMA 1V8EA 4DQWA 2V9DA 4J40A 4FNRA 1C8YA 4FS9A 4AZHA 4YIWA 3G0SA 3CAQA 5BOFA 3N6HA 2VP8A 2A2IA 4OIFA 1Y5XA 3VFLA 5KZ6A 2QUUA 3VMOA 4OKDA 4N4QA 5C9XA 1DWHM 1XBYA 3BGJA 3P74A 3VMPA 4RV3A 1VHCA 3KBSA 3VYLA 4I6VA 1T96A 3AC0A 1TZZA 1FWAC 5F4SA 1RH9A 4S3AA 4HU4A 1E0WA 4B3LA 2YGYA 2A6LA 1S5TA 5EL1A 4JXCA 1S1RA 1N82A 2EQDA 5LIYX 1EB3A 3AIWA 4H1ZA 3WLRA 1EJWC 2A21A 1A5CA 3W2KA 4DWSD 5K9DA 4KIRA 1UPMB 2ZUWA 1RD5A 1XINA 1W3LA 4IUGA 1UPPA 3N9SA 5BU9A 3H2EA 2XINA 3D0CA 2F84A 3OBAA 2WMJA 1MO0A 1A5MC 4B5VA 3NQAA 4GE8A 3GXFA 4CQBA 4L7ZA 1TJ2A 3U7VA 2QEZA 4YVPA 3KLKA 4R7OA 4AIEA 1HVQA 1X38A 4FNPA 1NDZA 1MDLA 1SO4A 4HJFA 4IT1A 3PULA 2GZXA 3B9EA 1UP3A 3FIGA 1LORA 3BZGA 3MCMA 4F2BA 2WLYA 3CHEA 4O53A 3TA6A 3OQEA 4HZMA 3VZXA 4V1XA 3FVDA 4GIRA 3MMUA 1XD0A 1D8WA 1ICSA 1LOLA 2VWSA 4GYJA 3ZO9A 4PA8A 3FSTA 4O28A 4GQQA 5AC7A 2FVKA 1GQIA 4HPXA 4PULA 3LM3A 1KTCA 1PZ3A 4ZOEA 4P7QA 1SW7A 3MI3A 5D9NA 2AQVA 3G77A 1BG9A 2E6FA 2VYOA 3GXDA 3WQEA 3R43A 4XIAA 4HA1A 4H6KA 4M8UA 3FEMA 4NKCA 3WQVA 4BFAA 3PG9A 5F2IA 1F61A 1XL9A 2ANUA 1QOPA 1ONXA 3M5ZA 2VVNA 3HG4A 3SUSA 4FX8A 3ZXWA 1ZP3A 3LZ5A 3R25A 3SN0A 4BWLC 3BW4A 4LVFA 2ESCA 1JD7A 7ENLA 3P80A 2EG8A 4K7VA 4W89A 3TFCA 3W2MA 3DHPA 5E0CA 1NF0A 1R3WA 3LLDA 1P6CA 3AXMA 3AYRA 3GKFA 3C5QA 2WC3A 4E8DA 4M56A 3VM5A 2EPHA 3M07A 2I5QA 1PX3A 3TTSA 3PAOA 3VNYA 3GE7A 2CZEA 1B31A 1DV7A 4LVDA 3L23A 1F8MA 3BICA 5D37A 5HMSA 3W29A 2CHRA 4JD4A 4BWLA 4E2VA 2B7PA 4Q6JA 3R1ZA 2G4FA 1MW2A 4GX9A 4XX6A 3LX9A 3RF9A 4NASA 4PBGA 2J77A 2PU0A 5G1TA 2DY3A 4V2XA 3P5ZA 1JUKA 4IQLA 4XKYA 3WNLA 1VFLA 1VBJA 1PXGA 3EEGA 1TR1A 3HG5A 5IM51 1NOFA 4B2DA 1LQAA 1QBAA 4FEZA 3DYMA 1PKNA 4HHHA 1VC4A 4KEMA 1XIJA 2BOFX 2XSAA 4H4IA 2CLPA 1ISZA 1HUVA 4FXFA 4GZIA 4LVBA 2HMCA 3P8IA 4LU0A 1QW9A 3LYEA 3P3BA 3BARA 1P6BA 1P0NA 4JFTA 1DIOA 1TRIA 4HHPA 2VX4A 1PV8A 3URAA 3ZT7A 3GVRA 4J3ZA 4H6EA 4KETA 3ZR6A 4O8RA 1H49A 4GABA 4PR4A 3TSDA 1RCQA 4HNLA 4IL0A 2VFHA 1E1EA 5IBXC 1FWFC 3GX9A 3AUOA 2ZYFA 2D69A 3T2PA 4Q4OA 5JBFA 4V33A 5CPOA 1T99A 3MKCA 3K8MA 1TX2A 1VR6A 1QUMA 3W7JA 3A4XA 7A3HA 3UW6A 1CXEA 4UBPC 3AQUA 4L1WA 3MYOA 5C9UA 5F1VA 3GVGA 1LZOA 4AZBA 1YBQB 3VGHA 5CZ0A 1XD1A 3V0UA 3BCFA 2ZUUA 2Z1KA 4NZ4A 3E74A 2F6KA 4IMEA 3THAA 4H3DA 3T09A 3T0AA 3LQLA 1ZU8A 4A8RA 1IGSA 5I3IA 5AYIA 2Q3RA 3PBGA 3W7LA 2J7FA 4BZYA 2Z1VA 4N4PA 4U10A 1N8IA 3QMSA 5K2ZA 3C86A 4ZO9A 1NEYA 2ZUTA 3U3HA 4QDPA 1JZ3A 4LGXA 4ZQMA 3CHDA 2QDHA 4Q8PA 3DKLA 3QGVA 1MQPA 2DT2A 3LI0A 1R3SA 3WG6A 1U22A 1TPWA 4ZA0A 4O16A 3QV6A 1OT1A 3XIMA 3B8TA 3L9CA 3NA8A 4FLRA 1M7PA 1PYMA 5B7YA 2XSXA 1B3YA 1EHNA 1F8IA 4HSOA 4N2YA 4GA8A 5ABHA 1KFWA 2GK1A 1UD4A 4B4HA 2QCHA 4LYRA 3SM0A 3AFBA 1C29A 1FDZA 3C2EA 2BY0A 4W93A 2DDXA 3WFLA 3HPFA 1DJIA 2HSAA 3PF3A 3MMWA 3MV11 1CWYA 1HQTA 4JTRA 5A2BA 1A3WA 4WVXA 1XCWA 2E0PA 2G37A 1GVYA 1XG3A 1BVWA 4EF8A 2ON3A 3OW1A 1UWUA 1NSJA 3VGFA 1NVMA 5E9AA 4JYEA 2WSKA 1OF8A 3QEZA 8RUCA 5A94A 1E71M 1JGMA 2VZTA 1MQQA 1TWWA 2W5FA 3AU2A 4F8XA 2BHZA 2PLCA 5BOOA 1WNOA 3LTSA 3UETA 4R9XA 3BWWA 3UR8A 4QS6A 2CLMA 2I5IA 2ADAA 3N6JA 1E1CB 3QFWA 2A85A 3W9ZA 2X2GA 1LBLA 3FHAA 3D46A 4AD2A 4CNSA 5D4YA 3QV8A 5BNKA 3TK7A 4C6KA 4FNSA 1XLCA 3VDBA 2HPIA 4A4AA 3Q4DA 3SQSA 1E1FA 1JDDA 3MZNA 4US6A 4C6BA 1V6TA 3WFAA 4GFIA 1ZALA 1DTUA 2F38A 1YTDA 1VHNA 3FGCA 1G4TA 2RKXA 3JW7A 3UWVA 1B90A 1GYMA 3UWZA 3V35A 3RMJA 3TJIA 1YTKA 4GWEA 4FZIA 2DEPA 3DHUA 3EKLA 4ZFCA 4LEQA 1WAUA 5JIWA 3EZ4A 1XGEA 4FIRA 1C91A 2QDDA 3L4VA 4HB7A 1XKJA 1FCBA 3SCVA 5LYRA 5E6ZA 4N42A 2GGHA 4IISA 5G1YA 2ZWYA 5KTLA 2XG9A 4TOQA 3W7EA 1R7AA 5M1TA 4J3VA 3CU2A 2CZFA 1JRBA 2YYTA 1V0NA 4GZJA 3LEPA 1I8JA 1Q85A 4PE8A 3I6EA 5K4XA 3W76A 1RVKA 3K8LA 3VNMA 4QQUA 4ZGYA 2CLKA 3QPZA 4WGHA 2WZMA 3SN4A 1G67A 1EQPA 1A0DA 4R7JA 4G7EB 1BGAA 3BL3A 3VX0A 5LXXA 4PMUA 4KCTA 3VKJA 4GISA 2E8YA 3ECQA 1WDDA