3MJYA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-aminoorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
306
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 107
structure length 306
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mjyA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mjyA01
2ZRWA 1ME9A 4ZQOA 4O14A 4AEOA 1VR6A 4MY8A 3GNDA 3NQ7A 1WQ5A 2ZA3A 3E49A 3GXTA 4UFHA 2DORA 4LUJA 3OA3A 1LZOA 1QO2A 2PURA 1GTHA 4Z0SA 4AHOA 5J5RA 6ALDA 5DCDA 2QJGA 1TMHA 3KVMA 3CEPA 1VYSX 3P7YA 4MVAA 3STCA 1R30A 3MHUA 4AWSA 1B9BA 3S5ZA 4CCEA 3W7EA 4AVFA 4AMAA 3W7DA 1G7UA 3C8FA 4ADUA 1FUYA 1ZAJA 1AMKA 2GJNA 2QJIA 1G4PA 4IPIA 2A7NA 2R91A 1GZGA 5C5YA 1EA0A 5K2ZA 4RXFA 1N55A 3Q2DA 4ORMA 3LTSA 4QNEA 1B4KA 5TBOA 3USBA 4FIRA 1WBJA 3DXIA 5FF7A 2CWNA 4GUHA 3NL3A 3P67A 1ML1A 1WBHA 4NQ1A 3W88A 4R33A 1TPWA 3N19B 1ICSA 3NZ1A 2V82A 1J5TA 2P0OA 2ZRVA 5D2YA 1VCFA 1LDCA 1WDWA 3NQEA 1ZY9A 2C18A 3PB2A 4UUIA 1RV8A 3SSJA 5FEXA 3KFTA 4JN6A 3ELFA 3E9AA 3QW3A 1KM3A 4NJGA 1M5WA 5AC6A 1VRDA 2ISVA 3R2GA 4CCDA 5BMXA 1SFLA 1ZNNA 5K4ZA 4LNYA 2WSQA 3PY2A 4M19A 1QPOA 4X3ZA 3TJXA 4N02A 2CU0A 3BG9A 2CFFA 3GK0A 3D0CA 5SWUA 2ZRZA 3LCGA 1GVFA 2FQIA 4UR7A 1KFEA 1SW7A 4MIMA 3DHFA 4LV4A 4E0CA 2TRSA 1KLZA 3NQAA 1IXQA 4HHPA 3ZFHA 5AC7A 1DV7A 2Y88A 1LROA 4HIBA 3SR7A 1FXQA 3OVQA 1TSIA 3O6CA 3MHGA 1YXCA 3WJWA 5K4XA 3DBPA 3KHJA 4WOZA 3CTLA 3BK0A 2Y7FA 3W9ZA 3UD6A 3W2LA 2GVGA 2E6FA 1NAL1 4R53A 3ZWSA 3W7QA 1FWWA 1HTIA 3UZJA 2X30A 4BI5A 4W9TA 3NL2A 2B7OA 1KLYA 1XFBA 4K8EA 1VZWA 3FEMA 4TR9A 4CQ8A 3W1MA 3G3DA 4K7VA 4CLMA 1DL3A 1H7PA 2C0AA 3S1UA 1W3NA 4AXKA 3B06A 2HSAA 5LHEA 3UZ5A 5HUPA 4IMEA 2YSWA 2Q8ZA 1Q6LA 4S1FA 4WOQA 3LCIA 3LCHA 1W56A 3NQFA 1I2RA 4N6FA 1ZJIA 3F1QA 3TROA 4PL1A 2G96A 1LYXA 3LCXA 4EWND 3N2XA 3DI1A 3WK3A 3CIXA 3UQNA 5AHMA 4IOTA 2QKFA 4IXHA 4MOZA 4JTIA 1W5QA 2C14A 3HGSA 3PC0A 4IMCA 3ZS4A 1EEPA 3P62A 4HSOA 4RKAA 1HO4A 4CNNA 2J27A 4JTGA 4MPQA 2YCEA 3DENA 4OE7A 3UPWA 5F2IA 2CW6A 4A2SA 2YXGA 2H3BA 4DO6A 3M41A 4UTWC 3W71A 3FS2A 1W54A 5F2LA 4I7UA 4Y6GA 2PCQA 1KM1A 1I2NA 4Z1AA 1YDOA 3SJ3A 2PRHA 4XQ6A 4IUOA 1P0KA 2P1FA 4NU7A 3O63A 2TPSA 4YL2A 3LI1A 2VC6A 3W84A 5LSMA 2A5HA 4IGHA 4S2CA 4ZQPA 5AYYA 1VCVA 4FNRA 1YYAA 3UY8A 1W1ZA 3BW3A 1OFAA 2QCFA 5H91A 2RHGA 3G3MA 5C55A 4QISA 1F05A 4U28A 3QRHA 4ZZ9A 3FYOA 2WQPA 4LC8A 1Q6OA 3DZ1A 1GVOA 1OJXA 3LCFA 3NO5A 1KFCA 1XKYA 4MYXA 3DI0A 1VYPX 2NZLA 3FJLA 2EKCA 1KBJA 2X1RA 2Z1BA 4LW7A 3ATZA 2V0TA 1K02A 5CPNA 1UUMA 4FXRA 4LUIA 5AHFA 4IXXA 1JR1A 3R5EA 1VHNA 4G1KA 4GWEA 3TE9A 1MEIA 2JKPA 2CZ5A 4NJHA 2I1OA 1ADOA 1UASA 4NNAA 1H1ZA 3VNDA 1SPQA 3L0GA 3L21A 2XN2A 4GBUA 5EY5A 1OYAA 4QAIA 3P61A 3B03A 4OHQA 4PC8A 1O5XA 5FI8A 2OX1A 5FF2A 3C0JA 1SW0A 3S1VA 3P81A 1WV2A 4WY0F 3UWWA 3QPYA 2B7QA 1OFDA 2KZHA 2B0MA 1JCMP 3LXAA 4YCPA 4N2YA 5HJLA 3W70A 3W3OA 1L6SA 1OFOA 3VE7A 1GOXA 4XKYB 2E77A 3KRUA 4K38A 1EX5A 1VHCA 1ICQA 2EHHA 5EPDA 3RMJA 2GVJA 1C29A 4BI7A 4TMCA 5KZEA 1A5CA 3LXBA 2C6QA 3L5MA 3L68A 4UTIA 3PWAA 3B8DA 1DJQA 1IF2A 5C54A 1L6YA 2WV8A 3MI6A 1YTKA 2Y7GA 2A2IA 4A29A 4P61A 1JQXA 1SZGA 3MHFA 2VELA 1A50A 1C8VA 3PS7A 1TJPA 3R12A 2ZZ4A 1O60A 3H53A 3LGEA 2GVLA 1TJRA 3O8AA 2QDHA 5K9DA 1MEWA 3PG8A 1OX6A 4IX0A 1PCWA 1QOPA 1QPNA 4O8RA 3L66A 1H50A 4UTTA 3KVLA 3AJXA 1RQBA 4S2BA 5FF0A 1OFPA 3IIXA 1SW3A 4RX0A 4N4QA 4O1BA 2LLEA 3IVSA 1XL9A 5I3GA 4UTHA 2CLFA 3KVJA 1HO1A 3T55A 1OHLA 5LNVA 4JX5A 1FY6A 2WO5A 2QCGA 3W2KA 3PSVA 3SFKA 1XC4A 4C1LA 1UCWA 5KITA 2DZVA 4XTIA 5E1QA 3CB8A 1F6KA 2VFEA 4O4WA 2C13A 3L0KA 5LGXA 3G18A 1G4TA 1JRCA 3TSDA 1W8SA 1UBSA 4Z1CA 3C2EA 5A5WA 5CZ0A 1SR9A 4LVDA 3CC1A 2G5WA 3BO9A 3LRLA 3BARA 4LS1A 5AOUA 3BG3A 5T26A 4ORIA 3M5VA 5DCEA 3U2OA 5LHFA 1J2WA 1S5TA 3PM6A 3UWQA 4KFNA 1TO3A 1K8YA 3W1TA 4IWWA 3IIVA 3TCEA 5D05A 1LOLA 3HPZA 3O07A 5LNWA 4Q4KA 3GDLA 4M7TA 1BKSA 5EMUA 2V30A 1GG0A 3M7WA 4IMFA 5A8GA 2J24A 4UFKA 1SZEA 1K7XA 2ATMA 4RCXA 2Z6JA 4TMBA 1E51A 2YR1A 1Z44A 2VEMA 3S6DA 3EXSA 3O06A 3TH6A 2Y61A 5K7JA 1B4EA 4H6KA 2ISWA 1KM5A 1DQXA 3NQ2A 4OT7A 3FYPA 3EWZA 1KM4A 3PUDA 4UTJA 3C2FA 3GAYA 5DBTA 3W7IA 1SO3A 2QUTA 3N2MA 1NFBA 2WJZA 3W74A 3MBFA 2NWRA 3I7SA 3KVKA 2QCLA 5DY3A 1SO5A 2B7NA 4AHPA 1WXJA 2PE4A 3EX6A 4AF0A 1KA9F 3NOEA 1ZCOA 3SIZA 4E2DA 3O6DA 4QQ3A 2NX9A 4MY1A 2HTMA 1GJPA 3L67A 2J9YA 2XN0A 5IBXA 4JTLA 3U6WA 4HNUA 1TPC1 2GQ8A 2J88A 3WK1A 3HF3A 1XBVA 3W7GA 1JCJA 1P1XA 5D2VA 2ALDA 4RZ5A 7TIMA 2X16A 1FWNA 4D2JA 2FPTA 4N9BA 1IXNA 5L6UA 3T78A 2Y70A 3W7MA 4K39A 3QC3A 3C56A 2VKZG 4GUGA 1TRIA 1RZMA 1OX4B 3LRMA 1FCQA 2TYSA 2R8WA 2CLEA 1R46A 4CCCA 3EX1A 3QW4B 4U4MA 5EBUA 3DH7A 5CPLA 3DFOA 3WK2A 4DBDA 3N9RA 2OCZA 3TX9A 2X2GA 3EX4A 5LKYA 5KMYA 4JS3A 2D73A 3KOFA 4MLRA 4I9AA 4JR5A 2RFGA 4OWGA 5DCBA 4UTLA 3G1XA 3QF0A 3NPVA 3W1PA 3C3NA 1H5YA 1PCKA 5I3FA 4PH6A 1I2PA 2E09A 3QM3A 3UY7A 1SZFA 4JTKA 3K30A 4XZ9A 1CW2A 1OG0A 3LDVA 3OHIA 5HWJA 3TQVA 3OVPA 2YGYA 4HPXA 4JDBA 4O12A 3B04A 4H4IA 1VLIA 2ABAA 1A5AA 1JCYA 2QEZA 4UFIA 3VKJA 5HWNA 1SSGA 2NWSA 4FEZA 3NPXA 4PTNA 3GDKA 3L65A 2DP3A 4O28A 5BW6A 3O1NA 1GPWA 3HGJA 4FIQA 3V75A 3MP5A 2VFGA 3NQGA 1I45A 3BPWA 2OT1A 4NXSA 2WKJA 4GXMA 3UPBA 4HT3A 4WZHA 3M5ZA 1OX5A 2DU2A 1W3TA 4YCOA 1MXSA 2NLIA 1B57A 4PA8A 1PE1A 4DBEA 5HNRA 3GR8A 1G4SA 3M0ZA 3U8GA 1DQWA 3IGUA 3W76A 3LHTA 1QDSA 3W7JA 3W6YA 3C52A 2W0UA 3TFXA 2Y89A 3GDMA 1BWLA 8TIMA 3HGOA 4TIMA 1TV7A 1N8FA 3QYQA 1IXOA 2A21A 2E6AA 1W5OA 3CQ0A 1XUZA 3BG5A 3STGA 4UMBA 1KFJA 1XXXA 1TCDA 3BVJA 2E6DA 5CZTA 1K7FA 5MHBA 4OV9A 2PRLA 1F76A 3THQA 4ADSA 3MO7A 4UTUA 3S8HA 4NJKA 3TMLA 3HMJG 2ZRUA 3FKRA 1WA3A 1QFEA 2FB3A 1TPEA 2JKAA 4UFJA 3OVRA 4JY8A 3W1QA 5AYZA 2ZTKA 2A6NA 2DZTA 2JKEA 5D04C 4JNMA 3HO8A 3GIYA 4IMGA 4IMDA 3TSBA 2HS8A 1GVQA 3A22A 4FNTA 1DVJA 3S1XA 4JYEA 4AWUA 1ONRA 5F1VA 5D32A 4N4PA 4ZQRA 1UB3A 3W83A 1PHQA 3BLEA 3DU0A 5CPOA 2FLIA 4EF8A 1ZAHA 3QEZA 4O16A 5HINA 4Y90A 3ATYA 1Y0EA 4A21A 4RXGA 1JUEA 3CLMA 2DZXA 4O1CA 3GVGA 1D3GA 3TJLA 1F6PA 1DKWA 1LORA 2VXNA 1GT8A 3FFSA 4O50A 4ZVJA 1K03A 4A2RA 3W85A 2JBMA 3W2JA 1H63A 2C15A 2ZZ3A 3W7OA 4TX9A 4MLJA 4RV8A 3NQMA 4DO4A 1T0OA 4DO5A 5AB3A 3CIWA 1W31A 4BI6A 2CLOA 1OFBA 2E1DA 4CQAA 2NUYA 3LTPA 3NAVA 3TDFA 1TB3A 3PR2A 4DF2A 1DORA 3JRKA 1U5JA 1F2JA 4DF0A 2YYUA 1FDYA 4GUJA 2RKXA 1ME7A 1FWSA 2AGKA 3P80A 4HNTA 2XFWA 1LBFA 3C4UA 4I7VA 3FOKA 3LV6A 3HOJA 4PEKA 5D37A 4UTWA 3PUEA 4NZFA 3M9YA 5E0KA 2Q8LA 3RLUA 2B4GA 1J4EA 3B4UA 3FKKA 4HSNA 1LBMA 3CWNA 3TFCA 3EX3A 5KTLA 1DHPA 1EUNA 2EF9A 4UFMA 3NZRA 5G1YA 2UV8G 5KSWA 3STFA 2Q3OA 2CZFA 4JX4A 4K37A 2H6RA 3TQ0A 2A7RA 3UXDA 3NQ6A 1OF8A 1PS9A 3TU9A 2OJPA 3LHUA 2WPBA 1OABA 3LHZA 1PV8A 1KFKA 3TAOA 1RQEA 1TYGA 2QDGA 3DFSA 1H7WA 3JR2A 5FF4A 3B0UX 5FEWA 1TTPA 3FIGA 4AWTA 5K9XA 5HWMA 2WSRA 5D03A 2FJKA 1YXDA 4O19A 2NX1A 3LM7A 4WXYA 3W2MA 1JQVA 3S5NA 1K3UA 3ABQA 1AK5A 3PAJA 4MYAA 5HR6A 4ADTA 1VYRA 1GEQA 1Q45A 5TIMA 4E38A 5HMSA 3W1RA 1PIIA 1T8XA 3O6YX 1LTDA 3G8RA 3VI2A 3DHDA 4K7YA 2ZFAA 1JCXA 2ZZ5A 5FEPA 5G5IA 1O95A 1Z48A 1ALDA 4H3DA 2CLKA 1RVGA 1I8JA 1WOAA 1SO6A 3QSTA 4BWLC 1KTCA 1IIHA 3M43A 1OVDA 1TPH1 3MMTA 2V2DA 2Z6IA 3M47A 1V7YA 1HG3A 4HPJA 2X1UA 1SU5A 4O0ZA 2QAFA 5CZJA 1H62A 3TW7A 3BW2A 4UC5A 5ABTA 3GKAA 3PBWA 5D33A 5K9CA 4LVAA 4WY0B 1JUBA 2DZWA 5D30A 4GUIA 1XM3A 4L4LA 1P5BA 3W1XA 5LNUA 2ZCGA 1AW2A 2C16A 3TIMA 4Q33A 4KFPA 3NR0A 1XBXA 2YPIA 3G1HA 5FEZA 1VJIA 3G8EA 1KFLA 5I3IA 4GNJA 4P2VA 3C6CA 3C2RA 1L6WA 3PG9A 4FF7A 1PHWA 3E12A 4YLWA 3PUOA 3QH2A 2A4AA 4LVFA 4XBKA 3T7VA 1H7RA 5KINA 4LT9A 3KXQA 2NV1A 4NJJA 1VS1A 3RK8A 2RDWA 3NPUA 1GVSA 5U7SA 2A85A 1XDLA 3W7RA 3YPIA 3DFTA 1R2SA 1X8FA 4QJ1A 2Q3RA 4FB7A 3QJAA 2ZA1A 5I3KA 3GKFA 3EWBX 4O17A 1A53A 3MJYA 1TPUA 2EPHA 3EXTA 1I2QA 1ZFJA 2RDUA 1TIMA 2A6LA 2I14A 3M5YA 3IVTA 1TPVA 3W1UA 3QSRA 3HG4A 4WUIA 4ZQMA 4AB4A 2JGYA 3UNDA 4X22A 3W1NA 1M6JA 3E96A 3F4WA 4EOUA 5AFDA 1BEUA 4RR4A 4UCGA 2QCCA 1FCUA 1K8ZA 1ME8A 2A1YA 5DXYA 3NVTA 4JTTA 3BGGA 1S5WA 4FX6M 1KM0A 1TQXA 2OMAA 2OT0A 4JIQA 4MFEA 1XCFA 2BZNA 4DPQA 4LVGA 3V1PA 4IJBA 3LOTA 2Z0IA 2NXHA 5AHEA 3PULA 1XDMA 4EF9A 2F7FA 1HFBA 4KFOA 1R2TA 3W1AA 1GVRA 4M6PA 5H2ZA 1A5BA 1AL8A 3MP4A 2CLHA 4NNCA 1FXPA 1H61A 1SZNA 3MI3A 2J9ZA 2NXIA 3L5AA 2FTPA 3MUXA 4YMZA 4RZ4A 4Z08A 1EIXA 1THFD 3EB2A 3S0CA 2A7PA 2G95A 2QCEA 4NUWA 3TC6A 3RLVA 4KWVA 3W7HA 4NJIA 1RR2A 2Y6ZA 2H90A 1LRNA 3UWUA 3IVUA 2A0NA 5HUOA 1H51A 3KAOA 4FHAA 4QM1A 1H1YA 4A22A 5EKYA 2PC4A 1EUAA 4Y96A 4JXCA 3QQ0A 6TIMA 5CSSA 3FJ6A 3LHVA 3INPA 5D2XA 5EL1A 3TAKA 5F4SA 1VPXA 4AH7A 3IRDA 1QPQA 1W0MA 1GWJA 3NM1A 1XBZA 4MUZA 1YDVA 4LC6A 4PFMA 1GYLA 3VFLA 2TMDA 2GJLA 1QR7A 4EIVA 3WJXA 1T96A 1JCNA 3HG5A 4OBTA 3PVFA 1O4UA 2V9DA 1R47A 1C9DA 2E6YA 3FA5A 1NF7A 4QNWA 4N9EA 2FIQA 2ZQ0A 3L0NA 4O1AA 1G67A 3JS3A 4UXDA 1NF0A 3HG3A 4JGDA 1MEHA 3L2IA 4ALDA 3NG3A 3IIOA 3IIZA 3S5OA 3M1ZA 2GUUA 4O1DA 2NUXA 1X1ZA 3UYCA 1OF6A 3MP3A 1I4NA 2O7QA 2WNQA 5AHNA 5BMWA 2QJHA 4AHQA 3EEGA 5AHIA 1X6UA 2FPYA 2CLMA 3GAKA 3E0IA 2PRMA 5TQLA 4WD0A 4DPPA 4ICNA 3C61A 1F7BA 4JDYA 1KW1A 3CEUA 4MY9A 4LVBA 1AL7A 4JICA 4PODA 1GYNA 3R13A 3GR7A 2QCMA 2EAWA 1JJKA 3H55A 2NUWA 3N73A 5DY2A 3RFAA 3P8JA 1ZENA 3GDRA 3STEA 1V5XA 5CPMA 2E5BA 4XKYA 2V5BA 4GUFA 4J9JA 4AAJA 1BWKA 4UR8A 3CU2A 3W2UA 1WX0A 5DELA 1K7EA 3N14A 4MZYA 3VE9A 3RF9A 5D02A 1TPDA 2ZRYA 2WNZA 2E68A 1H7XA 4WX2A 3LV5A 3GB6A 4MJZA 1TTIA 1A5SA 3TKFA 5EA9A 5G2WA 4OQVA 4LS2A 1FQ0A 4M6VA 3LERA 3SW6A 4BFAA 2YX0A 2QF7A 4DQWA 1IXPA 1LP6A 2Y85A 4JY9A 3W72A 4NXKA 2IQTA 4K36A 3QZEA 3UWYA 1I2OA 3G24A 4BK9A 2VEIA 5FESA 4FNPA 3BW4A 4Y9AA 2ZZ7A 3NQCA 1LOQA 3P60A 3Q37A 4GJ1A 4A3UA 3N3MA 1B3OA 2BX7A 3M6YA 3N34A 1ICPA 3I68A 4IPJA 1FWTA 3B0VC 5U4NA 4OGZA 1FCBA 4JTFA 5F2MA 3GDTA 3R89A 4FX7A 5I3JA 2CZDA 1YPFA 5I3HA 3I7QA 5D2WA 3G0SA 3LRKA 2VFIA 4JTEA 4M7SA 1QCWA 2GPTA 1F73A 1EB3A 4JX6A 1SO4A 5GVJA 3TA6A 1RD5A 1MSSA 2YFNA 1N7KA 4ZMGA 2E5DA 2YW3A 3QMSA 3THAA 2J6XA 1UUOA 4B5NA 2F84A 4CQ9A 1JRBA 3TK7A 1FWRA 4QIUA 2GOUA 4PCFA 4LRTA 2R94A 3W7KA 3GXNA 3HQ1A 4DF1A 2ISSA 5D2TA 4LS0A 2WNNA 2Y62A 1Z41A 3NPWA 3SZ8A 3IV3A 3OBKA 4I7WA 2AAMA 5IM51 4O11A 3HBLA 1F74A 4MFDA 3ANYA 1H7NA 4O0KA 3QQ1A 2QCHA 4WQ6A 4LY8A 4CNPA 4Z0JA 4DEFA 3R8RA 5G2HA 4TO8A 1QWGA 4MJMA 3BGJA 4O54A 2ZDRA 4NT0A 3OG3A 3WK0A 3HIJA 3OIXA 4NZJA 1VCGA 3MYOA 4ML9A 3QFEA 3C2VA 3IEBA 2BLEA 3UWVA 1PL9A 3TQKA 4M5PA 4JEQA 1O94A 3WFAA 4E2BA 3G1FA 3W86A 3GXPA 2H8XA 3A24A 5G4EA 3BV4A 2ZRXA 5CZSA 1TPB1 1UJPA 4FO4A 3TR2A 1TTQA 1OK6A 3P5YA 1LLZA 1G4EA 4RK8A 1QPRA 1R2RA 4JTJA 3NQ8A 3A23A 3IIPA 4O57A 1QNVA 4M6QA 2DZSA 1YPIA 3M16A 1SFJA 2QR6A 3TMQA 4Y8FA 1KM6A 3GZ3A 5AYXA 3LCLA 1QO5A 2BTMA 1LOSA 3QMTA 4MZ8A 2FDSA 3H54A 2V81A 4RZ6A 3BLFA 5BRBA 4RJEA 4Q32A 4OU1A 1OX4A 3LTYA 2ZA2A 3LCWA 1EP2A 4X2RA 2CZEA 3W2NA 1YTEA 4FNQA 3RNDA 2RH9A 2ATSA 3WJZA 1S3HA 2V8ZA 4UMAA 3MW7A 3LHWA 1ZHAA 4OV4A 1AW5A 3HJZA 3T4CA 1LM1A 5G2IA 2QUVA 2Y63A 4BF9A 4IX2A 1GTEA 4QITA 4JTUA 3ABSA 5BNKA 4R7JA 4HNVA 1G7VA 3P5ZA 2BSLA 2VEPA 4XUGA 1MZHA 2I9EA 3QMRA 4YWIA 4C1KA 2H8ZA 4JTHA 2QCNA 3DFNA 3DFPA 2QAPA 2DJXA 2QCDB 4RLIA 3MWAA 1WYIA 3HB9A 1OYBA 3GLCA 4FXSA 5E93A 4NNBA 3W87A 1KV8A 2WSYA 1W3IA 3LB0A 2W6RA 3I7RA 1GQNA 3G22A 1FX6A 5DN1A 4NX5A 3O05A 1YLVA 1K8XA 3EKLA 3HPXA 4NX0A 4DELA 2C19A 2TSYA 2CLLA 3CWOX 1OYCA 1VGAA 1EP1A 3A9IA 3E02A 4O53A 3M5XA 4ZQNA 4AF0B 3TC7A 5KZMA 5AC8A 4K6AA 1QMLA 1VH7A 3LBMA 4BWLA 3NM3A 5F4WA 1PVNA 3KRZA 4XWUA 1Q6RA 5LNSA 1KBIA 3A21A 3W1LA 1W37A 1T99A 3EX2A 3GYEA 4FNUA 3OEXA 1P4CA 1AG1O 1H7OA 3WJYA 3HPSA 3SI9A 4R34A 2V5LA 3T40A 3W22A 2ZTJA 1ZAIA 2VFFA 3BLIA 2NV2A 2VFHA 5G1TA 2ABBA 3NNTA 2ZBTA 5D09A 1MO0A 4POCA 1TPFA 2CLIA 4GE8A 3RU6A 2NXGA 1XBYA 3W73A 4LRSA 3GX9A 5CG7A 2B7PA 1CX9A 4HKPA 1CI1A 3NDOA 5AHLA 4IQLA 5HULA 1JULA 3O16A 4PL2A 2BXVA 5D38A 3G1YA 1FDJA 3W7PA 4KKXA 4Z1DA 3DFQA 3G1DA 5L9FA 3IGSA 4Z1BA 1VLWA 1KTBA 3O15A 5DXXA 4O4VA 4JD4A 4O18A 4O13A 3SY5A 3NL5A 3ZR4A 1LRTA 3W23A 3W75A 3NYZA 1G6CA 3DAQA 3ABRA 3S42A 1JCLA 4WXZA 5J5DA 2ZZ6A 3PSWA 4O52A 3TV8A 4HNNA 2FFCA 3I6RA 3P74A 2ZYFA 5BOOA 2GQ9A 4HN4A 3EWYA 4JYDA 2VENA 3HGRA 4GC4A 4ZQCA 1KM2A 1OK4A 3DKJA 3LI0A 4MKNA 3TSMA 4GFSA 2YFOA 1LBLA 3G0UA 1U83A 4UTMA 1G69A 1EPXA 2W79A 3SGUA 3NXFA 4UTTC 1GG1A 5CKSA 2HS6A 2X1TA 1IGSA 1SSDA 3EXRA 1W5PA 3LBCA 1M7OA 1TQJA 3TW6A 4EVZA 4JYFA 3PB0A 4N9DA 3G1AA 5AN7A 1Q6QA 2QUUA 3PBYA 3CHVA 2X1SA 2EGZA 4LV9A 3VCRA 5F4XA 3CM4A 3Q58A 3W7LA 1L9WA 3TXVA 5C2XA 4ZL1A 1AW1A 1W5MA 4L4MA 2VOMA 4FX8A 2JK2A 3C2OA 3NA8A 1H60A 3CT7A 1XI3A 1FCVA 3MI2A 1M7PA 3L5LA 5K3VA 3LX9A 3GNNA 3M44A 1QAPA 3G1SA 2YDAA 5LZLA 4K8HA 3I65A 3P8IA 4XBSA 1L2UA 4UFLA 2C3ZA 3W7NA 2YYTA 5HQEA 5LNRA 4N6EA 3SGZA 4UMCA 1JUKA 4LWWA 4DXVA 2P10A 2DZPA 4LOCA 2V2CA 1WOBA 2GQAA 1LCOA 2FB2A 2FPVA 1DOSA 3LLFA 1TV5A 1F5ZA 4WJEA 4JTSA 1LRQA 1KTNA 1KV5A 1X7FA 3CPRA 5CSRA 2Z2UA 5FF3A 1VQTA 1WAUA 3QPZA 3TXZA 1S5VA 2RDTA 5F1UA 3G1VA 5DBUA 4UNKA 2ZZ2A 1BTMA 1HUVA 1OFRA 2Y7EA 4GRSA 1D9EA 2O7SA 1OFQA 4ONVA 2YW4A 4O15A 1EWDA 3PF3A 1O5KA 5DLCA 3G0XA 2C1HA 2QCDA 1XUUA 3FLUA 1NEYA 4BR1A 1EWEA 1YADA 3N9SA 3IGXA 1TREA 3A5FA 3KX6A 3F03K 1KFBA 3PBUA 4XTDA 3MBDA 1DBTA 3ABOA 1TV8A 1FDZA 2G97A 2DJLA 1P0NA 1YDNA 3W7CA 1OFEA 2J9XA 2HMCA 1IIGA 2VEKA 1ZALA 3HG2A 3LHYA 3Q94A 1X1OA 3EWUA 3TUUA 3F4NA 3AO0A 2BWGA 3DKLA 2NX3A 3LXCA 4KWWA 3EKZA 2YZRA 1NVMA 1Q3NA 5IBXC 3T44A 1HL2A 1W5NA 1Z42A 5LGZA 2DZUA 3SECA 3B05A 1LLWA 1SQ7A 3A5VA 3MYPA 3KRSA 4WY0A 1NSJA 1VC4A 3WJSA 3NGJA 3EWWA 1TRDA 4CNOA 1JVNA 2XN1A 3PBVA 4UNLA 4O10A 5CGQA 4FNSA 2H3DA 3S1WA 2E5CA 2JGQA 5KZDA 3S9YA 3P84A 4NVTA 4TU1A 3L9CA 3NL6A 1YXYA 2Y7DA 2R14A 2AQWA 1DJNA 5C6MA 3ZWTA 3B0PA 3UWZA 4LU0A 3LLDA 4UTKA 3TNOA 1TTJA 1FBAA 3NEVA 3UXAA 3W07A 5G4WA 3NQDA 4X9SA 1RQHA 4UIOA 3NQVA 2VFDA 1RPXA 1QOQA 2ZZ1A 4LTSA 3S5YA 1SUXA 4JIPA 1EP3A 2V2HA 4QSHA 2WOQA 5EYWA 4YXGA 2OZ0A 5HR7A 1D3HA 3DGRA 1YTDA 4MZ1A 3P82A 4N9CA 3EWXA 5F2GA
chains in the Genus database with same CATH superfamily
5GQBA 5A6LA 3QV7A 4ZQOA 4O14A 2VZOA 1VPQA 1XSKA 3E49A 4LUJA 1KCKA 2P50A 1GTHA 2G3JA 1FKXA 5DCDA 2QJGA 4GZIA 4M6UA 4PGLA 5I77A 1VYSX 4JL1A 3MHUA 3S5ZA 3KLLA 1JL8A 3TVAA 1PZ3A 1FUYA 1I75A 1M04A 2DFAA 4AZCA 2FMOA 2R91A 1X96A 1EA0A 4W87A 1E9IA 1QI4A 2VEGA 4QNEA 1B2YA 4UOJA 4Q8UA 4FIRA 5FF7A 2CWNA 4GUHA 2FZ9A 1ML1A 4NQ1A 4JBRA 1X8CA 1TPWA 1ICSA 3NZ1A 3QR1A 1B3XA 1J5TA 2P0OA 2ALRA 1VCFA 1LDCA 3NQEA 3N13A 3EOOA 1WKDA 2VGGA 3CASA 5FAGA 4IIHA 5FEXA 4J5NA 2QYGA 3M6DA 1YW1A 3KFTA 3E2RA 4FLRA 4OKDA 2J79A 3FW6A 4IGSA 3UVAA 1VRDA 1EO7A 4ZOBA 5BMXA 4QROA 4XZNX 5CJ5A 3ZJ7A 1GEHA 3GK0A 2CFFA 3BOXA 1H2JA 1QPKA 5IXEA 3I4EA 4A3QA 1SW7A 4LV4A 2O4MA 2FVKA 3NQAA 1XFCA 4QG8A 3WKZA 5HMDA 1BXNA 4GY1A 2GSEA 2OYLA 2AOSA 3SM0A 3FCPA 2R1MA 3MHGA 3BV7A 2W63A 3KHJA 2P88A 3O9NA 4ACYA 1V08A 1EFZA 1YNPA 2BY2A 3RM8A 4GQQA 2GVGA 2R1KA 1FWWA 1VF8A 1OGSA 4HK5A 2P5NA 3AS2A 1VZWA 3W1MA 1X7IA 1E3ZA 3S1UA 1W3NA 4AXKA 1UR4A 1JDAA 2Q02A 5IDZA 2YSWA 4PTXA 4HMDA 1BF6A 3CTTA 4WOQA 4GC3A 3LCIA 4O1EA 2FDMA 1PKNA 1LG1A 4TV5A 4DUWA 3ZYZA 3LCXA 1LYXA 1EDQA 3BICA 2Z1SA 3H2FA 3AS1A 5M17A 3UQNA 1UZ4A 3S3GA 4J3XA 2QKFA 2WJEA 3ZXWA 2VL4A 3GNPA 2VX5A 4DJEC 2DQXA 3SURA 3GBEA 3UNTA 3KLKA 3S9ZA 4P8XA 4F2TA 2BXYA 4JTGA 4MPQA 4HOWA 2ZUVA 2YCEA 5LA2A 4DLMA 3MSYA 4REQB 2WSKA 1TZ7A 1W54A 3S47A 1GUVA 5T91A 3RITA 7ODCA 5IFTA 1G9HA 4IUOA 1NWUA 2P76A 5M03A 3FX4A 3O63A 2OPJA 2JE8A 4GMEA 1IWPA 1BF2A 1H5VA 2XM2A 4IGHA 4S2CA 1NOUA 5AYYA 1E6ZA 1VCVA 1WDRA 4U28A 2VGFA 1XLGA 4E8CA 1Q6OA 2QIWA 3BWWA 3NO5A 1KFCA 1DXEA 5XIMA 1KRBC 2NZLA 3FJLA 3KP0A 4LW7A 3ATZA 4HNLA 1XRTA 5CPNA 3KEHA 3UZWA 5AHFA 1M01A 5DO8A 5I2UA 4YTRA 3R5EA 4PTDA 4GWEA 1MEIA 2CZ5A 3TN4A 3WUGA 3RCMA 1H1ZA 3VNDA 3WFLA 3L0GA 2VI0A 3BTNA 1OYAA 3OLEA 3P61A 2I16A 2Z1WA 4J3SA 4OHQA 4DWSC 1XYBA 3VCCA 3GTIA 3NDYA 3P81A 1WV2A 2DIJA 2OO6A 3MV01 4Q4RA 4WLCA 2KZHA 1JCMP 3J7HA 3WBXA 1JDCA 4PTVA 3W70A 3AXIA 1OFOA 1XRSA 4QLJA 4XKYB 2E77A 3JW7A 1UROA 3P0WA 1ICQA 5EPDA 1GONA 4BI7A 4TMCA 4J1OA 3L68A 4UTIA 1P0BA 3PWAA 1IF2A 5D9NA 4LUTB 3GVRA 1YTKA 1ZJAA 4ATWA 1UZ1A 3LNMA 2CHNA 4MGGA 1N8IA 1KR0A 4XKMA 2ZUTA 1CLKA 4G6CA 3MHFA 1C8VA 2PWHA 1O60A 2PP3A 2GGHA 4F0MA 1TJRA 2QDHA 4W88A 1ITXA 4IX0A 3K4WA 5I7GA 4S2BA 3RLHA 3EDJA 3ORWA 4YTUA 4MNJA 2X0YA 2LLEA 2W62A 3IVSA 5I3GA 2CLFA 3MSRA 5CH9A 3BDKA 2GGIA 2Q8XA 1XISA 3T0BA 1GNXA 2QCGA 4A3HA 3W2KA 2HJPA 4XTIA 3L0KA 3LGDA 2ZXDA 1JRCA 4Z1CA 5XIAA 5A5WA 2JFEX 5CZ0A 3GG8A 4LAOA 2OSXA 9CGTA 2D69A 2OEKA 9RUBA 4B92A 5AOUA 1J5SA 3BG3A 2HVMA 2P8BA 4ORIA 3B9EA 1QNSA 2YDRA 3M0IA 3G1RA 1S5MA 4DBSA 4IWWA 3H23A 1SJDA 3IIVA 3TCEA 5D05A 1HKIA 3HPZA 3O07A 5LNWA 3CAVA 3K1GA 1BKSA 4DHGA 3M7WA 4KESA 1SZEA 2ATMA 1E51A 1P7TB 2F2HA 4U3AA 1P43A 5EMKA 2OLSA 2DSVA 3DG6A 1A0EA 1W32A 3OG2A 1YNQA 2DDXA 3NQ2A 3EWZA 1KM4A 3KE0A 5PTDA 1E6QM 3C2FA 4DRSA 1SO3A 2QUTA 1NH6A 1UZDA 5H8MA 1XKJA 4PUKA 1UKSA 2QZRA 3QGAC 5DY3A 4DUVA 2Z2AA 4PN2A 3GTXA 2O55A 1B5TA 1WNOA 3TONA 3EX6A 3CJPA 4DO7A 1KA9F 3UZYA 3WMCA 3NOEA 1X6LA 1ZCOA 2VC5A 2HTMA 5BOEA 3UR5A 3U6WA 2J88A 1X97A 3WDIA 3WK1A 3VGGA 1E5JA 3ZR6A 1PEZA 3KTSA 1P1XA 3A47A 2WC7A 1OWQA 2Z00A 7TIMA 1FWNA 2XG9A 3DOPA 1GOOA 1J0HA 1IXNA 1RA5A 5L6UA 1UH4A 4QDWA 3ZT5A 2GOKA 2PS2A 1C8QA 1DIKA 3LRMA 4BQ3A 1FCQA 1HJVA 2R8WA 5G4HC 1XICA 4H9MA 1DHKA 2VO5A 3GVQA 5EBUA 5CJMA 4XD3A 3OP2A 3VDCA 2WLZA 2JALA 2OCZA 2GUYA 2X2GA 4G2DA 2OKTA 4JS3A 4LANA 4RV3A 3MSGA 2XHYA 4PSRA 4MDOA 1WZMA 4OWGA 3EZ4A 3NPVA 1FRBA 1BRLA 2J62A 1I2PA 2FJUB 2QPXA 3UY7A 1SZFA 1XRVA 1V0LA 1UPPA 3AALA 1I0BA 1GVIA 1CW2A 2HBVA 4HPXA 3TN3A 4O12A 1A5AA 2VC7A 3CV6A 4FEZA 4C6IA 3V75A 4I5XA 4GXWA 5M5DA 3NQGA 1I45A 4HTYA 1CIUA 2OQHA 3BPWA 3KBWA 5JXQA 1GQJA 1B0IA 2F2KA 2OT1A 3LQLA 1K6AA 4NAEA 4GXMA 4M80A 4Y8EA 1P0DA 3URAA 4YCOA 1MXSA 2PD5A 3QPEA 1OCNA 4PUDA 3DYOA 3KCOA 2NLIA 2J4GA 5HANA 4DBEA 5HNRA 1C92A 4D6EA 3U8GA 1DQWA 3PJWA 1OSEA 3IJ6A 4XIMA 4IQEA 4LCSA 3ALGA 4Y2WA 3VOCA 8TIMA 1TV7A 2PDPA 2E6AA 3CQ0A 3CQJA 4QE5A 4W7VA 3RO6A 3EWCA 1WZKA 3BVJA 2E6DA 3RR1A 5CZTA 4D71A 1K7FA 5BXTA 3B8TA 4NJKA 3GG0A 4H04A 3R11A 1QFEA 1OT2A 1TJ1A 1TPEA 2JKAA 3OVRA 3LPPA 1K6WA 3CAQA 3GD6A 2A6NA 2DZTA 2VWTA 4JNMA 4CCZA 5BCAA 2XZ9A 4HB7A 3P6LA 3UETA 1DVJA 4JYEA 3SUTA 5F1VA 5D32A 4ZQRA 3H2NA 4MHBA 3QEZA 1E1FA 4R9XA 3JZUA 4Y90A 3WDJA 1Y0EA 3V18A 3AOFA 2DZXA 1D3GA 4XIAA 1KWKA 1DKWA 2VXNA 1GT8A 4O50A 3IGHX 3PJXA 4ZVJA 4A2RA 2E25A 4HOXA 2OYMA 2ZZ3A 5CG0A 3VPLA 1KQZA 3SFWA 3N15A 4C6JA 3CIWA 4BI6A 3PZOA 3WLPA 2NUYA 1XGDA 1A4MA 3JRKA 1V6XA 1V4YA 3GHSA 1FDYA 2PAJA 4QBXA 2JQXA 2WC4A 1A5KC 2FGBA 2XFWA 1BTCA 5LIUX 4G8TA 5D37A 4UTWA 4WKFA 2VP8A 4ZODA 3GU2A 4HSNA 2YIHA 3CWNA 5KTLA 3UPMA 4HSHA 3QLLA 4S3DA 3WF0A 2Q3OA 4R9OA 4E2OA 3NQ6A 1DJIA 1R9ZA 1W3LA 3TU9A 3LHUA 1OABA 1PV8A 3B9AA 5KEZA 1TYGA 1JFXA 3VGFA 1GW9A 3B0UX 1KXVA 4LUYA 1UC5A 2D2JA 1US0A 3ZVIA 5K9XA 5HWMA 3KW3A 3T2PA 4O19A 5DFAA 2WKGA 4KGLA 2NX1A 4GQBA 5D9PA 1JQVA 1UWSA 1UKPA 3GS6A 3B8SA 3FJ4A 4QX4A 5HMSA 2KX9A 1N2VA 1CXKA 1AJ2A 3ITVA 2Y0FA 3G8RA 1V6TA 3DHDA 3CQKA 3QYSA 2H9AB 3IJ9A 1OGGA 1KGUA 5FEPA 4NAFA 5LA0A 4H3DA 1RVGA 4BEUA 1UD6A 4BWLC 3U57A 1KTCA 1LL7A 1XLBA 5HQLA 4Q3MA 4OTKA 4RL3A 4GA8A 4B5UA 2FHCA 1O1HA 4AZ6A 2OWCA 3M64A 1H62A 4LNCA 2HVNA 4C6OA 3PNUA 5ABTA 4J3VA 5K9CA 1JUBA 1PYFA 4BY3A 3ANVA 3V1HA 2XIIA 3PAOA 3CH0A 5DMYA 3W1XA 4PCSA 2ZCGA 3L4TA 4IP7A 3TIMA 4Q33A 4KFPA 1XBXA 3LM3A 5A2BA 2XFRA 4CD8A 1BG9A 4S3CA 1KFLA 3PWIA 4GNJA 1W1B1 1L6WA 3VGDA 5CC7A 4YLWA 3QH2A 3T7VA 3C5QA 1EYWA 3EMZA 3MC5A 1Q2RA 1WUEA 4X61A 2PDCA 1FFQA 5U7SA 1W9UA 3DFTA 1R2SA 4RNJA 2HNEA 4H8UA 4D6GA 4QS5A 1A53A 5I24A 4LAZA 2KAUC 4D6HA 3EXTA 2PEVA 3LK6A 5HMFA 2QMJA 4DZAA 1LG2A 2A6LA 4RPQA 2CETA 2FZMA 1W1IE 1IT7A 1Z3NA 2DT1A 4H9TA 3CWHA 4LFYA 3HG4A 1TV4A 3UNDA 1CCWB 3E96A 4AZCB 2EG6A 2TODA 2WANA 4H6EA 1BEUA 1ISVA 3PTMA 1POKA 3VNIA 1Q6DA 1ME8A 4ICCX 1P6WA 2QPUA 3D6NA 1IV8A 4FX6M 3TEVA 1KM0A 1EGVA 3D3AA 3OO2A 3QHOA 1AJ0A 2DZBA 3BZJA 3V1PA 3LOTA 4MTVA 1J6PA 1W6TA 2NXHA 3VO0A 3PULA 1XDMA 3ALFA 4KFOA 1TJ2A 1GVRA 3P93A 3N2OA 1A5BA 1H09A 1WDQA 4NYUA 2VDGA 1SZNA 1S5NA 2J9ZA 2FTPA 4RZ4A 4R5EA 4Z08A 5A2AA 2W9MA 2G95A 1V02A 1VFUA 3ARUA 1MUMA 5C9XA 2EXOA 4KWVA 1IEXA 3T1GA 1RR2A 3IUHA 3GNOA 3IVUA 4KT2A 3RRAA 3AHVA 2J7CA 4QM1A 3K5XA 3CMGA 2XGIA 4NP7A 5DRIA 4AZGA 5EL1A 3TAKA 1VPXA 3V36A 1EJ7L 3IRDA 4D1IA 4L7ZA 2Z1KA 4MB1A 4MUZA 4LC6A 2EKGA 2GJLA 2J13A 2G0WA 1J2BA 1JCNA 3FNDA 3HG5A 4UNIA 2DSZA 2OLAA 4FAMA 2E6YA 4EPEC 2DGAA 2WNWA 2ZQ0A 4O1AA 1G67A 1SJCA 3JS3A 1XLDA 4JGDA 3L2IA 1H49A 3M1ZA 3HQNA 2GUUA 1X1ZA 4LB4A 3MP3A 1GKQA 4NZ4A 5AHNA 2QJHA 2FPYA 3W81A 2WMIB 4DPPA 3C61A 2PDMA 1KW1A 3IUDA 3AICA 4YPJA 1T8QA 3CEUA 5ABEA 4PODA 4ATDA 1Q6GA 1XIGA 1YIXA 3KL3A 3H55A 5DY2A 3RFAA 1WXZA 1DXIA 1PTDA 1PWMA 1V5XA 3GDRA 5HA7A 5CPMA 2PBGA 4CEXC 4GX9A 2DUZA 3OIHA 4AISA 4J9JA 2HVOA 2XJ7A 5M1TA 1W8GA 4UR8A 4KPLA 1WX0A 3WD4A 5CGTA 4MZYA 3RF9A 5D02A 5EMJA 4GIYA 4UB9A 4WX2A 1T6MA 3LV5A 1TTIA 5HBFA 4OQVA 4LS2A 1FQ0A 4M6VA 4O8AA 4Z2KA 4JIHA 1XC6A 4IFRA 3WMBA 1DJZA 4GIEA 1ZPTA 2IQTA 4FLQA 4K36A 2UY4A 1UBPC 2WAGA 3O7UA 3QZEA 1XH0A 5FESA 3BW4A 1FTXA 2OOGA 4DYEA 2J8TA 1JD7A 3Q37A 3VZXA 3EGJA 4MDPA 4A3UA 1ADDA 4X9YA 3CMJA 2FHBA 2WBKA 1JEZA 1V3KA 1DYSA 5U4NA 2QNEA 4MF4A 4JTFA 2EEXA 1UD4A 3R89A 4HQVA 4FX7A 1LT7A 1YPFA 1MW2A 5D2WA 2VFIA 4M7SA 1QCWA 3IJ7A 3RDKA 3LPGA 2YFNA 2OELA 4ZMGA 2E5DA 4CQBA 1C90A 4N7QA 3UG4A 1UP2A 1JAKA 3OBAA 4PCFA 2RAGA 3RO8A 3V0UA 4ZB2A 4U5KA 3HQ1A 4DF1A 5D2TA 1MXGA 1Z41A 3IV3A 4V33A 1IZKA 4I7WA 3WUFA 2Y5EA 4GISA 1JPIA 1RXOB 4PB4A 4F2UA 3QQ1A 2PLKA 4HJWA 1F61A 4GZJA 1F8MA 4JNYA 3OU8A 3GXIA 1BVWA 4MJMA 1FHUA 4JOMA 3VCNA 2ZDRA 4NT0A 4ZO7A 3WK0A 2O56A 2BOFX 3MYOA 3IRSA 3QFEA 5HJYA 4L1WA 2BLEA 4HTBA 2BY0A 3AZTA 4F4RA 4PMVA 1XG4A 4KCUA 2D0HA 2ZRXA 5CZSA 1TPB1 4EXQA 1OK6A 2ZE3A 3QY8A 1GGOA 2DIKA 4RK8A 3NUKA 1EBHA 1NFPA 3QOKA 3WMLA 3NQ8A 4O57A 7REQA 2W3ZA 3VD5A 1SFJA 2QR6A 2ZVIA 4HHLA 1E15A 4ERIA 5AZ1A 4DJEA 4DJFC 1XGZA 4Y8FA 2ON3A 3P0XA 1BKHA 3RR4A 3QMTA 2WMFA 4RZ6A 4CGTA 2ZUWA 4EWJA 1MXDA 2GJXB 4M29A 3LCWA 1HVQA 4PTMA 1OIFA 3VDHA 1VBHA 2CZEA 4C90A 2RH9A 3WJZA 4KCTA 4UMAA 3MW7A 1ZRQA 4GOAA 3HJZA 1KQYA 1NWTA 2YDSA 3VNKA 1ISZA 3ABSA 1IE7C 4R7JA 3OHMB 3AXHA 3EA1A 2PZNA 1GOMA 4JTHA 1EJVC 2HPIA 7XIMA 1O12A 1TKKA 4DWDA 2E9LA 2R6OA 3SCWA 1M65A 2QAPA 2QCDB 3WQCA 3MWAA 1QTWA 3SRFA 3CV2A 1OYBA 3KBSA 4NNBA 2OU4A 3EDFA 1AH3A 4X0VA 2PWEA 3THDA 1FX6A 4NX5A 4NX0A 1K70A 1JYVA 2PTXA 4MWAD 4I6VA 3VAVA 2AAAA 3TC7A 3WQ6A 4K6AA 1VH7A 4FS9A 1Q6RA 3VD7A 1TWSA 3NZGA 5DQPA 3AIQA 1UA7A 3R79A 3A21A 2WWCA 1T99A 4GJJA 3ITGA 4FNUA 1U1UA 1ZSXA 1P4CA 1H7OA 1V3IA 4JQ2A 2VR2A 4OUEA 4R34A 4CD4A 4S39A 2REQB 3BLIA 4RE2A 5G1TA 4LSBA 2BNJA 3WNNA 1TVLA 1TPFA 2V5JA 3STPA 2CLIA 4DVOA 2NXGA 1J01A 3MKCA 5J8LA 3W73A 3WQOA 1JPMA 3HV8A 2OVLA 2CESA 2RDXA 1RBOB 2QMKA 4KGJA 4OECA 4XZIA 3EPOA 3W7PA 4L80A 3II1A 3S83A 3DFQA 3O15A 4D9PA 3ZR4A 3GU1A 3LENA 3NYZA 1JCLA 4L61A 4DM1A 5FSDC 1VBUA 4ZTXA 5J5DA 3PSWA 2PLJA 3ES8A 3HV9A 3TV8A 1ZP3A 4TX6A 2FFCA 1EGZA 5BZAA 2PDWA 1BRLB 1E4NA 2ZYFA 3UERA 1PKYA 4HN4A 3RCYA 3DKJA 3LI0A 3IUIA 4GFSA 2YFOA 2EPKX 4Q6XA 4JFUA 4UTMA 2I17A 1G69A 3SGUA 4UTTC 3AS3A 1IGSA 2PTZA 3WLHA 3EXRA 3ZJKA 1M7OA 4PCNA 3UJ2A 1FWHC 4JCLA 3B9DA 3VFCA 3KTXA 3G1AA 5AN7A 2QUUA 1DTNA 3PBYA 4ROQA 5F4XA 3GFYA 3CM4A 2VCAA 4OOZA 1L9WA 2QVNA 1XIJA 1VPYA 1KD0A 4NAEB 1TX2A 1MDRA 2UWFA 1O7AA 5K3VA 2F61A 4XVDA 3LX9A 2MANA 3GNNA 3M44A 2YDAA 5AYIA 2CBIA 4K8HA 3JUGA 1L2UA 4UFLA 1JNDA 2YYTA 5LNRA 5HQEA 1MW0A 2PWFA 2FKPA 4Q4MA 3UA4A 2V2CA 4RUBA 1XF0A 2GGJA 2FB2A 4UTFA 3ZSSA 3I4KA 3VA8A 4YN5A 3LNPA 4J40A 2J75A 1WAUA 4E4UA 3TXZA 1RBLA 2RDTA 3G1VA 3RU8X 2ZZ2A 3M0XA 4GRSA 3QV8A 4UOZA 2YW4A 5B80A 4NG3A 3IJIA 3SCQA 2VX7A 3B8IA 4BF5A 1UD8A 4PBEA 2C1HA 2VR4A 4US5A 2BVTA 1K1DA 2VX6A 1YADA 1GYMA 3IK4A 4NIRA 3LMYA 1ODUA 5I6SA 4G7EA 3F03K 2GDUA 1DBTA 3ABOA 3LPOA 3H2CA 3RRXA 1P0NA 3F4VA 5FL0A 1OFEA 4F9JA 1W9VA 1I1WA 3PZNA 1TG7A 4Z2HA 3OYXA 3LHYA 5D4YA 3VINA 4AYGA 2BWGA 3DKLA 4JQ3A 1HNYA 6PTDA 1DJWA 2G4JA 2XGBA 3UJEA 4KEMA 1Q65A 5IBXC 3T44A 1MUCA 3CH9A 2PU1A 1R9XA 4IG2B 4AQLA 1LLWA 3WJSA 1MQRA 2NSXA 2YCLA 1UJQA 2XSXA 3F2CA 1KCLA 2H3DA 5GJMA 3S9YA 2I56A 4HA0A 4NVTA 3BCFA 3AAMA 3NL6A 3QY7A 2YA2A 3UWZA 3CT2A 2PWUA 4U2YA 4UTKA 1MI3A 3TNOA 4H9VA 3NQDA 4X9SA 1RQHA 3E2SA 3H8AA 4AVNA 1PPIA 5AVNA 3NQVA 3S9IA 3LN3A 4DXXA 1RPXA 4M81A 3PNZA 5DRCA 4W5ZA 1G1YA 1YE4A 4QSHA 4YXGA 1YTDA 1ZS2A 4UBPC 1CBGA 4IH3A 5BOFA 1OC5A 5CAHA 4N9CA 5F2GA 2ZRWA 1ME9A 1KBLA 2W67A 4AEOA 3GNDA 1WQ5A 2ZA3A 5FL1A 4XZLX 3BAKA 2BOGX 4HNCA 3KVMA 3CEPA 3FA4A 2WZTA 1R30A 1F4AA 4B2DD 3GG1A 2OGJA 4AVFA 2V3GA 3W7DA 1QRQA 1ZAJA 2QJIA 3MPGA 4HGXA 3UWEA 5AKQA 1GZGA 1UR0A 2EG8A 1Y5WA 1KCXA 3H21A 4W89A 5FJJA 3USBA 4P7OA 3C0LA 4ZGYA 3DECA 4EACA 3NL3A 3P67A 1WBHA 4R33A 3GTNA 2YL5A 3HFYA 1LLOA 5C2CA 5D2YA 5TNVA 3PB2A 4UUIA 3VIGA 4K1WA 2R82A 4JN6A 4I90A 3ITYA 4KCWA 1KM3A 5AC6A 1M5WA 3R2GA 1QWKA 4ZA0A 1UR2A 1PDZA 3HM7A 5ECUA 4LNYA 1XV8A 5JVLA 2PDXA 3B8WA 2WMJA 3NJ3A 3N12A 4JTDA 1TIWA 4WJ8A 3GM8A 3UT0A 1E6SM 1XYAA 2YXOA 3QLDA 4H6RA 2VGBA 3D0CA 5SWUA 2ZRZA 3LCGA 4XV0A 3JU2A 4BQ2A 3VIMA 2FQIA 3UVIA 1SZRA 3TWBA 2TRSA 1KLZA 1R8LA 2BVDA 3ZFHA 1LROA 6CGTA 2OWXA 4ZBCA 3OVQA 1TSIA 3O6CA 7A3HA 1EXBA 1IHIA 3G6LA 1A0DA 2ZX8A 3CTLA 3SO7A 2Y7FA 3CUJA 3GTFA 3ZWSA 4JFVA 4R3UA 3W7QA 1Y5XA 3UZJA 1B3YA 3SN4A 2UY3A 1KLYA 1XFBA 3M0LA 2CBUA 3FEMA 4CQ8A 2PDBA 4J28A 5EBAA 4D8LA 1H7PA 1TMQA 5T8GA 2WCAA 2C0AA 1VFTA 3B06A 4AIEA 4JIEA 5HUPA 1QK0A 4IMEA 2ZE0A 4QJ5B 4JN8A 1ZBKA 2J66A 4XVEA 5A1AA 5RUBA 3N6JA 3L4WA 3GXFA 3KP1A 8CGTA 4N6FA 4DNMA 3E0VA 3MCNA 4KMQA 3LY0A 3WK3A 3CIXA 5AHMA 1S2AA 2NT1A 1TFVA 1W5QA 3ZLHA 5ABHA 3RCNA 2C14A 3QKZA 3PC0A 5CBBA 3ZS4A 4OJYA 1UMLA 1EEPA 1NWSA 4HSOA 1UC4A 5A95A 2V6AA 3FAXA 4CVUA 2J27A 3GH5A 2Z26A 2YA1A 2X40A 1BFNA 2YOCA 4OE7A 2P53A 1R0MA 3AYSA 4CUCA 4QJ4B 2VCBA 1LQ0A 4A2SA 2YXGA 4DO6A 1KRMA 4OZOA 3FS2A 3GE7A 5D8WA 1H41A 3BE7A 1Q63A 1R3TA 1WAWA 4I7UA 4Y6GA 2PTDA 3A4WA 1I2NA 5C71A 2PRHA 2P1FA 2DH3A 4CQCA 4FXJA 1XX1A 4HU0A 4LYQA 2VC6A 4UZSA 2A5HA 3VU2A 4KQNA 3QXBA 3MA8A 3UY8A 1W1ZA 1C8YA 2TAAA 4A3RA 2QCFA 4D6JA 5C55A 5CLTA 1F05A 3QRHA 5AY7A 3NVDA 3BZGA 4Y9OA 2WQPA 1OJXA 2J8FA 1QVBA 3PJTA 1KBJA 2OZ3A 2Z1BA 4H83A 3UR2A 2FVMA 1W17A 4DAIA 4PMRA 1QHOA 3VOFA 4IXXA 4DI9A 4TX8A 1JR1A 4UOQA 3DG7A 3TE9A 4IMAA 4WKAA 4NJHA 2I1OA 1ISYA 3RPMA 2FVLA 2XN2A 4GXPA 3E5BA 1BXCA 1O68A 3PFRA 1O5XA 2JF6A 2WLYA 5FI8A 3QGVA 3C0JA 3OB8A 4NRRA 3S1VA 3CYVA 2XVKA 3MVIA 3UR7A 2WHLA 2HV5A 3ZZ1A 1OFDA 3LYEA 3VGBA 3LXAA 3TP4A 4YCPA 3VIKA 4N2YA 3F2BA 4H2CA 2WVTA 3F5KA 4I5RA 1E9ZB 3VE7A 3QVQA 9XIMA 1GZ1A 4K38A 1LUCA 1EX5A 4PRTA 3EPMA 2GVJA 2YL6A 3L12A 4NI3A 3LXBA 1DJQA 3NZQA 2MUCA 1L6YA 2WV8A 4H8HA 4L65A 3B9NA 3I3BA 4GK8A 4A29A 1LWJA 5C9WA 4GY0A 3PS7A 1M3UA 2ZZ4A 3H53A 4XAFA 3W28A 4QQUA 1E1CA 3L66A 1TMLA 4HHHA 1MVYA 1JDEA 3AJXA 1RQBA 5FF0A 1SW3A 1H1NA 4RX0A 4N4QA 2E67A 2NVDA 2V3FA 2O9RA 2PCEA 3KVJA 5LNVA 1FY6A 1SMDA 3RHGA 2Z1XA 3ZQ9A 3PSVA 4KF1A 3SFKA 1UCWA 4XZBA 2DZVA 3S5SA 2QHAA 3CB8A 2D24A 5B7YA 1F6KA 4O4WA 2C13A 3MUCA 3G18A 1XCWA 3CO4A 4KEVA 5B7ZA 3C2EA 3SCVA 3BMWA 4LVDA 3CC1A 3LRLA 5BROA 2ZXAA 2NW0A 4R85A 2ZC1A 1C91A 5LHFA 4DJDD 1XIDA 3K46A 1YMYA 3PM6A 3MDWA 3UWQA 2X0HA 1TO3A 4S3EA 5BXRA 1EL3A 1LOLA 1Q8JA 4Q8VA 3GDLA 5EMUA 2NSOA 3MQTA 2J24A 3KHDA 3RGTA 3P14A 3GH4A 1ZU8A 2Z6JA 4TMBA 1CTNA 1Z9AA 2YR1A 3M7SA 3WQVA 2Z28A 4J3ZA 2AKZA 1YE6A 4H6KA 1OB0A 2YL9A 1KM5A 4GGBA 4OT7A 4AEEA 1MQQA 1HJSA 3GAYA 3I6EA 5DBTA 1XLFA 3FSTA 1GVYA 3DHUA 1GOIA 2VZVA 3ZJ6A 4HD5A 3OBEA 2NWRA 3KVKA 3EKGA 3TYUA 2QCLA 1NARA 2A3CA 2J47A 3NOYA 4HZ6A 2ICSA 4C6DA 4XAYA 3AUOA 2AQOA 1WXJA 1U5VA 2PE4A 1UWUA 3UCCA 4ZCWA 4AF0A 1L2QA 4C6KA 3S2NA 2CZVA 4E2DA 1W1VA 3O6DA 4ATLA 2CKRA 3KM8A 2YB4A 4GHRA 3VK5A 2J9YA 2XN0A 4RDWA 1XLHA 3WBYA 1TPC1 3N04A 2GQ8A 4Q8NA 5TAOA 3HF3A 4AZBA 1XQKA 5D2VA 7REQB 2DV0A 1C8XA 1RUSA 3WH6A 4AD4A 3HU7A 3NDZA 2ZX6A 3DHPA 4D2JA 4D8ZA 2QGYA 2ZUMA 3T78A 2Y70A 1E4IA 2BS9A 3W7MA 4K39A 1EEXA 2VKZG 4GUGA 1TRIA 1BGAA 1DJYA 1JGIA 3H6OA 2GVYA 3EDDA 4DWSD 2CLEA 1U30A 3BQ5A 1RJRA 4U4MA 4X2PA 3UYIA 4HPNA 3AROA 3WK2A 1QI3A 4DBDA 2OSYA 3R43A 3TYAA 5LKYA 3KWSA 1UZHA 5CC5A 3VIJA 3KOFA 4MB3A 4D6DA 4PB5A 3N17A 1PX3A 4LPCA 2RFGA 4UTLA 2SFPA 1QXLA 1FFRA 3CS2A 1LL4A 3U4FA 3E0LA 3HQOA 5I3FA 2BY1A 4PH6A 1V51A 2E09A 4JTKA 1POJA 3LDVA 4GZ7A 1BVNP 3GC5A 3OHIA 3NYDA 3VZZA 6ENLA 1HJQA 2A3HA 4YHGA 4FR1A 3B04A 1PTGA 4MWAC 1JCYA 1R5YA 2QEZA 1DWAM 4GFIA 1Q13A 1SSGA 1W9BM 3L65A 5BW6A 3WBEA 1GPWA 3MP5A 1IGWA 2R24A 3AMLA 3ARVA 4GNVA 4PTWA 1Q6CA 4DUOA 1HGYA 5KZ6A 3WLKX 3UPBA 4HT3A 2CNCA 3L2MA 4M8UA 1W3TA 2GDVA 3MTWA 4PA8A 1EO5A 4GJIA 1H0IA 3LHTA 5CPTA 2W0UA 3TFXA 1BWLA 4TIMA 1IXOA 2A21A 1W5OA 3BG5A 1EJSC 3AZRA 4UMBA 5LXXA 3GU9A 5BXSA 2C1IA 4ZOEA 4OV9A 1F76A 1QATA 1A0CA 5T9BG 2C0HA 3HMJG 3FKRA 1WA3A 3F5JA 3GYCA 1GKPA 2FB3A 1CYGA 1J8VA 3TYBA 4LYRA 3LA4A 3GH7A 2JKEA 3HO8A 2E3ZA 3GR4A 1IEWA 4IMDA 2HS8A 1GVQA 3A22A 4FNTA 1E73M 3OGSA 4CU8A 1WE5A 3VIPA 5E5CA 4RDYA 1UB3A 3U5YA 1PHQA 1HP4A 1XIEA 4EF8A 3PZUA 4LCRA 4O16A 1XJBA 4A21A 5FJOA 3CLMA 3W02A 1F6PA 2VVNA 3VILA 5C7VA 3FFSA 3T8LA 3W24A 3MT1A 2C15A 1J12A 4V27A 2IQ0A 4DO5A 2PDIA 4QHRA 3GNRA 1KB3A 2CLOA 1OFBA 2GUBA 1XDJA 3NAVA 4HBKA 3TDFA 4TUFA 1JPKA 3O0FA 1DORA 4TVUA 4DF0A 4IPLA 4GUJA 5DMNA 2POZA 3WQDA 4FA3A 4U2ZA 4H2HA 3PZVA 4I7VA 3LV6A 3DESA 3EA2A 1XLLA 5AVHA 4NZFA 1J4EA 3FKKA 1LBMA 1DHPA 2EF9A 1XP3A 4UFMA 2PDGA 4GVHA 2W4XA 3U5UA 4CNUA 5G1YA 2UV8G 3STFA 2H6RA 1TZ9A 1PBGA 2GGGA 3TR9A 2RUSA 1OF8A 1U2YA 3AIBA 2W66A 5EMMA 2RJGA 3TAOA 2QDGA 4I6KA 3JR2A 5A6JA 4AZHA 1TTPA 3O6AA 5D03A 3ZR5A 3ZMRA 3LM7A 3WDPP 3W2MA 2C8NA 1K3UA 2GZXA 5HR6A 4C6FA 4ML4A 1VYRA 4GLEA 5TIMA 4E38A 2YXXA 5A6BD 2ZDSA 1T8XA 2WVSA 2VQTA 5FKYA 3RN6A 4A8NA 3IAQA 2J25A 2VUYA 2ZZ5A 1YKWA 1AQFA 5DEZA 1O95A 2OZTA 4PMDA 1Z48A 1DWGM 1ESWA 2CLKA 5IFPA 1I8JA 3W53A 2A3LA 3LGGA 4GD0A 2RGMA 1OVDA 2W91A 2V2DA 1WDSA 2PODA 3L4XA 3ZLGA 1HG3A 1SU5A 3BQ6A 2PDYA 4MKVA 4UC5A 1FWBC 2EPMX 5H8PA 1BLIA 1L6FA 3GKAA 4LVAA 4XISA 3DYPA 5D30A 3TYDA 4DN1A 3QZAA 2YCLB 4Q4PA 4ACZA 1Q4NX 3TNBA 5LNUA 5CC3A 1AW2A 1JYWA 1JF5A 3A4AA 4MAVA 5DF0A 5LIWX 1VJIA 2Z25A 3G8EA 4EE9A 4P2VA 2NQ5A 3C6CA 3C2RA 4CU6A 4FF7A 3CZLA 2A4AA 4GKTA 4LT9A 1JZ2A 1FP9A 3NPUA 3RM4A 2A85A 3ZSTA 4S3AA 1X8FA 4QJ1A 3WMSA 2Q3RA 3GKFA 1NQ6A 1OM0A 3ZM8A 1GOKA 4UQ9A 2EPHA 3WQEA 2OFJA 5DT5A 4Q7BA 2J7BA 1LF1A 5HATA 2I14A 1TELA 3W1UA 1PZ2A 4MPKA 4WUIA 4AB4A 1JF6A 2QW5A 4V15A 3F4WA 4EOUA 4LEFA 1VFHA 5AFDA 4NHVA 4RR4A 1WO2A 5I02A 4UCGA 2QCCA 1OC7A 3NURA 4QJ3B 1J0JA 4AX6A 3WF1A 3DG3A 5DXYA 3AIRA 1XIMA 2Y2WA 1E4MM 1TQXA 3T09A 2QQ6A 5A8MA 2QT3A 1SMAA 1E43A 2WJDA 2EPLX 4EF9A 2QV4A 3MO4A 3QHMA 3R0DA 1ZB5A 3W1AA 5A6SA 1AL8A 5DT7A 4EAYA 2CLHA 3S6OA 3SBFA 2Q6ZA 2NXIA 3MUXA 1W1YA 2G8ZA 2QCEA 3TC6A 5CPQA 5A8NA 3R25A 3RMEA 4NJIA 4R27A 2VYOA 2FTYA 1K4GA 4S3BA 1BHGA 2Y6ZA 2CYGA 3MMWA 5HUOA 1BYCA 4GYPA 3VGHA 1CENA 4A22A 2ESCA 3W01A 4LJ3A 1RHCA 4WDWA 2PC4A 1EUAA 4Y96A 2CCRA 3R8HA 5D2XA 3INPA 1V79A 4WDUA 1SFTA 1QPQA 1W0MA 3RJYA 3SIMA 1K9EA 5GNYA 3VFLA 1GYLA 2PTYA 1NOWA 3RILA 1T96A 4TTUA 4E6MA 2G50A 6A3HA 3FEQA 3PTQA 1B3WA 4HZ8A 4QNWA 1UMYA 3VNZA 2FIQA 2FZ8A 4CD5A 3CV7A 1GZJA 3AISA 3HG3A 2NQJA 1VEOA 1V0KA 3NG3A 3IIOA 2A79A 4ZE4A 1OCJA 1MWOA 3V7PA 2NUXA 1S2VA 3UYCA 3VZYA 2PDFA 2O7QA 5BXPA 2NT0A 2WNQA 3EOUA 1VKFA 4AHQA 3OQ8A 1JD9A 3TA9A 1X6UA 4IHCA 2QXWA 1YHTA 2CLMA 2DT0A 3E0IA 4JDYA 4G9PA 1HQTA 2FH6A 4MY9A 5G1MA 4JICA 1WB0A 1K9TA 2BOEX 2QCMA 1S39A 2I9UA 2E0PA 2BBFA 2NUWA 3N73A 1BYDA 4GH3A 2Z27A 3FY1A 5HK4A 3T42A 2E5BA 1BSIA 4CD7A 2OOFA 1H11A 1E0VA 4H8NA 1UR1A 2DIEA 3CU2A 4NZ1A 3WD1A 2WHKA 2ZOXA 3VKAA 3TYZA 2DY3A 1YEYA 1TPDA 2ZRYA 2WNZA 3PZMA 1UD5A 1H7XA 4PMQA 3N18A 4PULA 4MJZA 1A5SA 1FKWA 5FJPA 3LERA 4BFAA 3AMGA 4MJ4A 4GZEA 4DQWA 2DSWA 3GC2A 3LEPA 3K8MA 1ITUA 2D2OA 1XG3A 1A47A 2XH2A 4CVWA 2ZZ7A 1O66A 3NQCA 3JVAA 3P60A 1XIBA 3CZGA 1DE5A 2R1LA 1B3OA 4GBDA 2OSWA 3N34A 3I68A 2J77A 4PEEA 1TUFA 2XVLA 4LX4A 1J0ZA 4OGZA 3QN3A 3OZPA 5F2MA 3N4AA 3AHYA 5DANA 3BLDA 1NQKA 1U22A 4JTEA 1EB3A 4JX6A 3WN6A 2IXVA 4M3PA 5EGRA 3MU7A 1SO4A 4B3KA 4IL0A 2YW3A 5LIYX 1CZ1A 2F84A 4CQ9A 1UIPA 1EQPA 4HK6A 3TK7A 4LRTA 3W7KA 3CUGA 3Q4DA 3OBKA 4QFUA 4O11A 4MFDA 3VDGA 1R3WA 1LUCB 3ANYA 3N1AA 4D1JA 4PRWA 4WQ6A 4JQ4A 4Z0JA 3R8RA 1QWGA 4S38A 4BHYA 3BGJA 3GRIA 5JQ9A 4QLLA 2ACSA 1H0GA 3AWOA 3C2VA 2ZUUA 2PF8A 3UWVA 1PWLA 2XFYA 4M5PA 2WVVA 3WFAA 1E1CB 3UCQA 3OLGA 4E2BA 4Q6JA 3G1FA 3W86A 2IS7A 4N0RA 3WQPA 1QNPA 3A24A 5IHRA 5G4EA 3DFYA 4AYSA 4HU3A 4C6LA 1RP8A 2PDLA 1XW8A 1QPRA 1R2RA 2QS8A 2VZUA 2PF0A 3ECQA 3A23A 3F4CA 1QNVA 1JZ7A 2WJFA 3K8LA 2CEQA 2DZSA 3GZ3A 5AYXA 2WVUA 3PP7A 2FDSA 2V3EA 3H54A 1L8NA 2WMIA 3A13A 1AODA 1XYCA 3MCMA 4DJDC 1OX4A 2ZA2A 1CXFA 1EP2A 3W2NA 3WFZA 1WP6A 3IWPA 2PLMA 3RNDA 2IUZA 3M0VA 1EX1A 2V69A 2HROA 1ZHAA 2XIJA 1ECEA 1AW5A 2CC0A 1A5UA 1A5NC 1A3XA 4L1XA 3VD4A 2QUVA 2Y63A 2WMGA 2XVPA 4KRTA 5BNKA 1YQ2A 4HNVA 4ERGA 2IKGA 2VEPA 4XUGA 2I9EA 4YWIA 3FVDA 3TZNA 4C1KA 1IT0A 2EJAA 3M46A 4AVOA 3DFPA 3FK4A 1WYIA 3HB9A 2IMRA 4DLFA 3FXYA 1W3IA 1K8XA 2D2HA 6TAAA 2C19A 3VIIA 3FJNA 3MUIA 5EMLA 2ZWZA 2TSYA 4WDXA 2CLLA 4DIAA 7ENLA 3AIVA 3E02A 2FZDA 3M5XA 1AVAA 4AF0B 2POTA 5KZMA 3LBMA 1QT1A 3NM3A 1J96A 3AIWA 5F4WA 3KRZA 3WH8A 3IJLA 4EXAA 1Y8BA 3K4DA 3WNPA 3AXMA 3AMDA 4Y9PA 1JDFA 3EX2A 1AMYA 5A8PA 3GYEA 3HPSA 4UQBA 3W22A 5CXPA 2HBXA 1S2UA 4IPNB 2NV2A 2VFHA 3L4UA 5D09A 3PBMA 4POCA 1NDVA 3N3TA 3RPTA 4GE8A 2NVAA 3RU6A 2CXGA 2NLYA 2FH8A 4LRSA 4YHEA 2A3EA 1CX9A 1HF6A 4PL2A 1AA1B 4QCEA 1I1XA 3G1YA 4C5ZA 1TWWA 1P1MA 1XLMA 4JKKA 2XWEA 3IGSA 4IPPA 4MMWA 4Z1BA 1B3VA 4JD4A 4O18A 4GYKA 4C7GA 2OQYA 3TYEA 3W75A 1H3GA 3MZ2A 1M03A 3S42A 3CYJA 4PUMA 1KWGA 2ZZ6A 1UA3A 5HNNA 4O52A 3P2VA 4HNNA 3KUMA 1FA2A 3PANA 4BJHA 2EQDA 3TJ4A 3UZZA 2VRKA 4ZSUA 4GC4A 3HGRA 4ZQCA 4S3JA 3VUSA 1LBLA 3G0UA 4AD0A 5LIXX 4F79A 1NELA 5A2CA 1CGYA 2W79A 3T9PA 2HS6A 2X1TA 4Z1YA 1LWIA 3G2GA 3VKCA 1VRXA 3LBCA 4EVZA 1KXQA 1YBQB 1Y7VA 4GPNA 1A49A 3CZEA 3W7LA 2VR5A 4NI8A 3TXVA 4ZL1A 1AW1A 4FX8A 2JK2A 3TTYA 1PIFA 3C2OA 1H60A 3NA8A 1KRCC 1IWAA 2AL2A 3H2EA 3MI2A 1SM9A 4DJFD 3B0YA 3AU2A 3G1SA 4AIOA 3OOQA 3I65A 1ZCCA 2GJXA 4Q7NA 1HX0A 3KOXA 4GYJA 1JUKA 4NF7A 4F9DA 2IPJA 3CB3A 4IZGA 1E70M 4H9UA 1KC7A 3R1ZA 5HNUA 1LCOA 1DOSA 3LLFA 3DDMA 1JFHA 1LRQA 1KTNA 1KV5A 4EXBA 5CSRA 2Z2UA 1VQTA 4HZ7A 2QLYA 5DBUA 1BTMA 3D47A 2XISA 5ABGA 3CUZA 3WBWA 1OFQA 1M1BA 4ONVA 5FAJA 3HURA 3O2LA 4ZO9A 3PF3A 2VZSA 2W5FA 1MFUA 2QCDA 1JCTA 1NTHA 4BR1A 1MRAA 1TREA 5LXEA 3S6TA 3VDBA 3MBDA 1Q6EA 5KETA 1A5LC 4HMEA 3Q65A 1XD1A 1FDZA 2HPMA 2E4TA 1ONWA 2J8GA 1YDNA 2BMBA 3TTQA 3S2MA 4H9YA 1KKRA 4QE4A 2VEKA 3Q94A 1X1OA 3TUUA 3F4NA 3AO0A 4FZIA 4WCJA 2NX3A 4HOZA 3WQWA 1GHSA 1IYXA 3ABZA 3EKZA 4PUNA 2YZRA 1Q3NA 1HL2A 5JH1A 1HKVA 2DZUA 5FSEC 4JAWA 5CJNA 3SQLA 3B05A 3VOHA 1Q2SA 1SQ7A 2V3DA 2R1NA 4WY0A 3TW9A 1IZJA 1NSJA 1VC4A 2QIIA 2REQA 3KOYA 3WNOA 2XN1A 3ONBA 4UNLA 5CGQA 5FIPA 4C6MA 2E5CA 4BKNA 1SFSA 3MANA 2DPEA 1YXYA 2Y7DA 2AQWA 1AZ1A 1B3ZA 1X1NA 4H9XA 4LU0A 2QV5A 3GIQA 3V0TA 2L5HA 1RBAA 1FBAA 4E3TA 2ZX7A 3BSGA 4IFKB 5DMMA 2ZZ1A 3S5YA 5H1WA 3E5PA 1SUXA 1EP3A 1KBBA 5EYWA 3KTCA 3TWAA 2OZ0A 3PPGA 3DGRA 3LLXA 3EWXA 1UKTA 1Q7QA 3BAIA 3WZ0E 5FJIA 1VR6A 3QZ6A 4Q22A 4UFHA 4MWAA 2YDQA 3MWCA 1M7JA 3WLRA 2Y8UA 4J35A 4Z0SA 5J5RA 3LQGA 6ALDA 3BAYA 1TMHA 3TOPA 4MVAA 4LGXA 4JTCA 4HCDA 4EX4A 4AWSA 1B9BA 1NU5A 4G1NA 3ZVHA 4C65A 1G7UA 4CNSA 1UP0A 7PTDA 1G4PA 3BXWA 4K2SA 1UIOA 1FOBA 2A7NA 1J79A 5C5YA 3TTOA 2WK2A 4ORMA 3WUBA 1ONXA 4I8DA 1J6OA 1B4KA 2OR2A 3DXIA 2PWDA 3OZMA 1IQ8A 3W88A 3KOZA 5I06A 3GO2A 1HJXA 3CIVA 1RJQA 2ZRVA 1V3MA 3SUVA 1WDWA 3BSMA 4DBWA 1ZY9A 3I3EA 1RV8A 2GL5A 2X7WA 4JFTA 5AZ0A 2ANUA 3ELFA 5JU6A 3QW3A 4NJGA 2ISVA 2IKJA 3GXDA 4JHZA 1KCZA 4WEVX 1XH1A 4ACZB 5K4ZA 2NVCA 1W1A1 5CSUA 1IEQA 1QPOA 4X3ZA 1S38A 4HA3A 2PWGA 1G0CA 3CQIA 3TJXA 4N02A 2GSJA 3WBAA 2ACQA 4U10A 4UR7A 3DHFA 3FYYA 6REQA 4HHPA 3OPSA 1UWAA 1ITQA 1DV7A 2Y88A 4LCQA 4HHMA 1FXQA 2ACRA 5K4XA 1YXCA 3DN5A 2BP1A 3DBPA 3NCOA 3WJWA 3RG6A 4MNKA 2FYMA 5FA5A 4WOZA 1OG6A 7CGTA 2Z24A 1UR8A 1DXFA 2QGHA 3BK0A 3R8GA 3T07A 3VKBA 3W9ZA 3UD6A 8A3HA 1NAL1 4R53A 3CK5A 1HTIA 1R7OA 2RJHA 1XYLA 3WQ4A 4PBFA 4K8EA 1V8EA 3CBWA 3PPCA 2XIQA 1DTUA 3KBJA 2HSAA 3UZ5A 3TC3A 2Q8ZA 3QFWA 3IANA 1EIBA 1J0YA 1W56A 1W3JA 3PTKA 1I2RA 1MQPA 2BHZA 3TROA 2E9MA 1PJ9A 3EYPA 4PL1A 2G96A 1UW9A 3N2XA 3DI1A 1MDLA 1L6GA 1HL9A 4IG2A 4W84A 3EDKA 4IOTA 3HMCA 1CB2A 1N8WA 4JTIA 4HCHA 2BHUA 1S2WA 3HGSA 4IMCA 3XINA 4WR3A 4RKAA 5AYBA 3KZPA 2F6KA 1GCYA 3T08A 3Q45A 3DENA 1E9YB 4WDTA 2B31A 3BOFA 4UTWC 1JXKA 4YJ5A 3WIJA 4AY8A 4B5VA 2AGTA 1UR9A 1PDYA 1J18A 3SJ3A 4B9ZA 4XQ6A 1QW7A 1P0KA 1Q8AA 4GH1A 4NU7A 4TVDA 1NDWA 4YL2A 3LI1A 2E28A 3WLNA 5LSMA 3URQA 4ZQPA 1OBAA 3V5FA 2Y5JA 1YYAA 1OFAA 3KBVA 5JIPA 4GI4A 4QISA 4FR6A 3WL0A 1DQUA 4ZZ9A 3FYOA 4LC8A 1OY0A 2F9RA 3H2AA 3LCFA 1I60A 4ZFMA 1XKYA 1WKFA 1K9DA 3DI0A 3SB0A 1BSLA 4YYFA 2VUNA 4M82A 2X1RA 1F6YA 4W4QA 3RAOA 2V0TA 5FJTA 1UUMA 4FXRA 4LUIA 1VHNA 1XYZA 1JG9A 1UASA 4NNAA 1OADA 2OQLA 3VYLA 2V63A 4QAIA 4NRSA 4RE0A 4AZ5A 4PC8A 2Z7KA 3DC8A 2YZ5A 1L8PA 3MMUA 3K1DA 5FF2A 4KWOA 1SW0A 4BS0A 2WYSA 3WDQA 2NQHA 2B7QA 4MWAE 4ZSTA 1EJRC 4KIEA 3R58A 4JTQA 4WGXA 5CAKA 4HJFA 1WZAA 3KCLA 1L6SA 4FXFA 2YKKA 1HVXA 1GOXA 4YS1A 6XIAA 5REQA 3PZGA 1VHCA 2EHHA 3RMJA 1A5CA 2C6QA 2D1ZA 3B8DA 2DUAA 3B3DA 2XM1A 3RLGA 4F0RA 1LQAA 4B2DA 4QDPA 3L4ZA 1A50A 4PMOA 4TVCA 3R12A 2YLLA 4AZIA 3LGEA 3PBGA 5K9DA 3C0SA 4OFCA 2ASHA 1CT5A 1QOPA 4O8RA 2CITA 3KVLA 1E40A 1OFPA 4NYYA 1FWDC 2VJXA 4O1BA 5JBDA 3EOLA 2AL1A 2BDQA 2J74A 3ZIZA 1TVPA 3VKKA 3ANUA 1OHLA 4JX5A 1E0WA 1E0XA 2WM0A 4P7NA 4LF1A 3ARPA 5C9ZA 2BG5A 5JUVA 2G41A 1XC4A 4RNIA 1FH7A 4HU4A 5E1QA 4QTGA 3IV8A 1RK6A 5LGXA 1G4TA 3TN5A 1W8SA 1UBSA 3PWGA 3BJTA 1NP2A 2HDJA 3AS0A 4AG0A 4IISA 3IACA 5T26A 3U2OA 1J2WA 1H4PA 1PXGA 2EPOA 4KFNA 1HZYA 2VURA 4C60A 1K8YA 1EJWC 3W1TA 2XIBA 3NTYA 4GABA 2WCSA 4Q4KA 2V30A 1GG0A 4A35A 3CL6A 4UFKA 5M2FX 1K7XA 4RCXA 1C9WA 4GACA 4V1YA 4LF2A 1Z44A 5H8UA 2VEMA 4GCAA 3CAWA 2WMHA 3O06A 3TH6A 2PDKA 2XIOA 2PP1A 2ZIDA 5K7JA 4YWSA 5GJNA 5CEWA 2ISWA 5FJUA 4OIFA 4I8YA 3PUDA 4UTJA 3W7IA 1ADSA 3PPFA 3N2MA 4WF7A 5HPCA 1T5AA 3MBFA 1E4LA 4M51A 4K8GA 2D2GA 4H7ZA 4GI8A 2YCKX 2X8RA 1XSIA 4AHPA 1OD8A 1ENUA 2WVVB 3TTSA 4DBUA 4A6GA 3OA5A 1EZ2A 1YDYA 3KDNA 4ES4A 4HPGA 4QQ3A 1D8CA 4S3KA 3WLIA 2NX9A 4MY1A 5E70A 1GJPA 3L67A 1TE1A 3MZNA 1JYNA 3UA3A 5I09A 4A4AA 4JTLA 1U5HA 2HE5A 3W7GA 3IJQA 3WUEA 5AC5A 3I6TA 4AFYA 2ALDA 4RZ5A 3U2CA 3CXOA 4W7WA 4DAFA 4D6FA 2PFHA 2X16A 3NQBA 4IIBA 4CNTA 2FPTA 4GVIA 3WEOA 3SRKA 3QC3A 3C56A 4IIFA 1OX4B 2C7FA 5E9XA 2TYSA 3THUA 3MS8A 5C9UA 1R46A 4CCCA 1R87A 1GW1A 2BFGA 4G7FA 5XINA 4GGHA 2Z4GA 3TX9A 2IKHA 3EX4A 2W92A 2E9BA 2Y5SA 2BVYA 1SVDA 1CGVA 4MLRA 1Z32X 3W0KA 4HN8A 4LAMA 2CHOA 1EXPA 4F0KA 3ONCA 3H22A 3W1PA 3C3NA 1H5YA 1PCKA 5I5RA 1M53A 2PGRA 3QM3A 1W1PA 3K30A 3VC5A 4F0SA 3OVPA 4Y7EA 1EZWA 3D3FA 3N6QA 4JDBA 1VLIA 1E0UA 2ABAA 1BAGA 4UFIA 1FWEC 3VKJA 2ISDA 5HWNA 3NPXA 4PTNA 3GDKA 4ZO8A 3O1NA 4FIQA 2ONEA 3U9IA 1AUSL 1TE6A 1TWZA 3A3XA 1WZLA 4NXSA 5MF5A 3VVGA 4WZHA 3M5ZA 1ZBCA 1OX5A 4HP5A 5HNTA 1XLIA 2Y1HA 1W1TA 3SGGA 2X09A 3OYZA 3GR8A 4AD3A 5BWAA 3W7JA 3C52A 3GW3A 2CIPA 1Z7AA 2ZXBA 3CLWA 2EBNA 3SADA 1N8FA 1TV2A 3BGAA 4JQAA 5BYWA 2E7FA 1XUZA 3CMFA 3STGA 2J7DA 2C79A 1C7SA 1KFJA 1XXXA 1TCDA 4RE3A 1QNQA 3PZIA 5MHBA 2PRLA 4ZR8A 4Q8MA 2ZRUA 1IWBA 4W86A 1XPGA 3POCA 3EMCA 3C2YA 4JY8A 1HP5A 3W1QA 3AC0A 2ZTKA 4C6BA 3FDGA 5D04C 3GIYA 4IP5A 4RNFA 2WZIA 4AWUA 4ZE5A 1KKOA 4DZHA 4FF5A 1ONRA 4N4PA 3BLEA 3DU0A 4JIRA 2FLIA 4FP1A 3AQUA 4P7LA 5A3HA 4ICMA 4YVVA 4RXGA 4O1CA 1UD2A 3GVGA 4GIRA 3WLJA 4AY7A 1BD0A 5JBEA 3U0HA 3BAXA 1K03A 2JBMA 1H63A 4WJXA 5FD0A 4RV8A 4DJDA 3NQMA 4DO4A 1T0OA 4HA4A 5AB3A 1W31A 1JPDX 1AJZA 3UP8A 2HK0A 4H7CA 4MM1A 1AD4A 4DF2A 2AL2B 1CLXA 1F2JA 2YYUA 1J0KA 2D0GA 2O4QA 1ME7A 1FWSA 1PB0A 2AGKA 3MB9A 3VABA 3P80A 4HNTA 1OCQA 3CHFA 3PUEA 3M9YA 5E0KA 1V77A 2Q8LA 2B4GA 4QAWA 3TFCA 3NZRA 4UQEA 3GSMA 5KSWA 3REQA 4KERA 5I0DA 4K37A 3TQ0A 3UXDA 4EANA 1D7FA 1PS9A 3ABXA 2OJPA 2VRJA 3KZSA 3VTRA 1X98A 4Y9MA 3GFXA 3LHZA 1RQEA 3DFSA 1H7WA 1JI1A 5FEWA 3FIGA 3VOGA 1DEDA 3GXMA 4AWTA 2WSRA 1OINA 4RZBA 2QUNA 2FJKA 2VZTA 3CV1A 1XH2A 1CPUA 1IR1A 6XIMA 2J78A 3ABQA 2P3ZA 2I5IA 4IIGA 4L1GA 1UR3M 2E8YA 1VJZA 1LTDA 4K7YA 2WWDA 1JZ5A 3LSCA 4JPGA 1F8IA 1F07A 4IL2A 2FGLA 5A8QA 2G37A 3TTEA 3I10A 1U1JA 1O5QA 3WF3A 4MB5A 1WOAA 4ASTA 3M43A 4GKLA 1TPH1 1R6WA 3MMTA 1TZZA 3A9BA 4S3GA 1JNEA 4WSJA 2Z6IA 1QHPA 3M47A 4HPJA 2X1UA 1HJUA 5GNXA 3VX0A 5CZJA 8RUCA 3TW7A 3BW2A 4MG4A 2ZVRA 2DSKA 4DWSA 1ONEA 3PBWA 5D33A 4WY0B 2DZWA 1WDPA 3VOJA 1XM3A 4L4LA 2C16A 2YJQA 5ECVA 1MW1A 1MMFA 3NR0A 3AMKA 2YPIA