3MJYA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-aminoorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
306
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 107
structure length 306
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mjyA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mjyA01
3GXTA 4E2BA 3C2RA 1FWNA 2Y70A 2W79A 4WOZA 3W1RA 2QUTA 4Z0JA 3DKJA 3B03A 3GK0A 4OV9A 4K6AA 4WY0F 3M44A 1KBIA 1YADA 4RZ4A 3JR2A 4ZQOA 5AN7A 3H54A 1ZAHA 2Y85A 1IXPA 3UQNA 2V5LA 3HGJA 1EUNA 4PL1A 3W1AA 3NPUA 3O05A 2ZFAA 3CWOX 3HPZA 1QO5A 3RMJA 2B7OA 4DO5A 4IX2A 4ZQRA 4RXGA 5AC6A 2NX3A 3HPSA 3P62A 1DQWA 2X16A 2NXHA 1X8FA 4JTTA 1O95A 5HMSA 4GJ1A 1TJPA 3RNDA 5EMUA 4UIOA 3NG3A 3QH2A 4HT3A 1GT8A 1GVQA 2ZRXA 5F1UA 3W72A 4MUZA 5HINA 3CM4A 1JCXA 1H7WA 1HTIA 3VE9A 4AMAA 1OYCA 3TNOA 1JCMP 3W22A 4OBTA 2JGQA 4H6KA 3W75A 1OYBA 1PIIA 4JICA 3NQ8A 2VELA 4LT9A 1DORA 1Z48A 4Q4KA 1OFOA 1KLZA 4ADSA 3N73A 4RX0A 4RLIA 4O15A 4EIVA 3STGA 1H7NA 3Q94A 3NQ6A 3A23A 3TCEA 3TKFA 4IWWA 4EWND 1QO2A 2PRMA 2QCCA 3EWUA 1EWDA 3QMSA 1AW5A 1KFLA 3YPIA 4XTDA 1RZMA 1FXQA 3S8HA 3PB2A 1OF8A 5DLCA 4M6VA 4UNKA 1K3UA 2A1YA 3HQ1A 2OCZA 4DBDA 1DL3A 3GXNA 5CPLA 4LTSA 4ORIA 1I2QA 3EKZA 5DCBA 3AO0A 1GVFA 3QSRA 2RDTA 1OFAA 1TQJA 3G1AA 2G96A 4Z1BA 3LCGA 3PVFA 1AL7A 4H3DA 2BTMA 3BG3A 3PSWA 4JX6A 3WJYA 1KFCA 1H7XA 3C0JA 2TSYA 3C2FA 3LCFA 3IGXA 3T55A 2QUVA 2X1TA 3DU0A 4O1DA 3IV3A 3LTSA 3TIMA 1JCLA 5D04C 2OX1A 1TPFA 1X7FA 4C1KA 3ELFA 3FYPA 5FEWA 2Y7EA 4LW7A 4ORMA 1U5JA 2Z0IA 3TW6A 5G4EA 3LCHA 4BI7A 4CLMA 3FFSA 5DXYA 3TJXA 1W8SA 4IMDA 1TB3A 4HNNA 1H50A 2OZ0A 2EKCA 3BG9A 4R53A 1WOAA 2Y62A 2QKFA 1LROA 2OJPA 4PL2A 5HUOA 3M5VA 4MY8A 3QZEA 1T96A 3NM1A 3GR8A 3E0IA 1YYAA 4AWSA 1XDMA 2ABBA 3HG4A 3GYEA 4JY9A 4O53A 3NQ2A 3KVJA 1OFQA 2C3ZA 3THQA 4O1AA 1J4EA 4HPXA 2LLEA 4YCOA 1KM0A 1UJPA 5LGXA 3WK0A 2NXIA 3OG3A 1XDLA 2V2HA 2VFDA 2Y89A 1G7VA 2E6YA 3NL5A 5T26A 3HGSA 2ZZ4A 3G8RA 2YW3A 3GR7A 4TX9A 2YCEA 3NR0A 1SW3A 1QAPA 3OVRA 3EWBX 3W7GA 2WNNA 1GTEA 3C2VA 4JX5A 3SSJA 4O0KA 5AYZA 1LBFA 1KTBA 3P60A 4S1FA 5K9CA 1LZOA 1HG3A 3BG5A 1XBVA 5L6UA 1TIMA 1TTPA 1TSIA 1QNVA 1VS1A 4N2YA 3CU2A 2HS6A 1W31A 1UUMA 3VCRA 3WJSA 4E2DA 1UUOA 3L0GA 3DH7A 4CNPA 3W7RA 2WQPA 2GQ9A 3PBYA 1FCBA 2A85A 4MZYA 4LVDA 1RV8A 4M7TA 5CSRA 1YXCA 5D2YA 2HTMA 4N6EA 2V30A 2WOQA 4ML9A 4PTNA 3LGEA 3C61A 4K38A 1K8ZA 1FCVA 4R34A 3O15A 3B4UA 1K7EA 2QCFA 5C5YA 1W56A 3THAA 3SIZA 3TUUA 3S5OA 1JCJA 3CPRA 3W2MA 4UXDA 1OX4B 4O0ZA 1JQVA 2QUUA 1O4UA 1Q6QA 2E5DA 1YLVA 2J88A 1XXXA 2Y63A 5AHIA 1TPB1 4LC8A 4PA8A 1EPXA 1B4EA 1EA0A 2DZVA 4LC6A 2NV2A 3W7CA 1EX5A 1EWEA 4JDBA 1FCUA 3A24A 3NQCA 4MYAA 1DOSA 3SJ3A 3Q58A 3LI0A 4Q32A 1MEWA 4JTGA 1LRTA 1YXDA 4FX8A 5F2GA 4FHAA 1NVMA 4GNJA 4TR9A 1NF7A 4MY9A 5G4WA 1GVRA 5BW6A 4ADUA 1PHQA 1VZWA 3C4UA 4AEOA 1IXQA 4FEZA 4DQWA 1F5ZA 3G24A 2HMCA 5LNRA 3DENA 1F6KA 3BV4A 2UV8G 5A5WA 5TQLA 2FB3A 1GOXA 4DF0A 1Z42A 3DFSA 4B5NA 1VH7A 5IBXA 4EF8A 5EL1A 3LTYA 5KITA 3P5ZA 1BWLA 2PCQA 1FWSA 2B0MA 2GOUA 4Z0SA 4QQ3A 4AHPA 3NQDA 1QFEA 3LHWA 3R12A 1IGSA 3SI9A 1R2SA 3HO8A 2JKEA 2DJXA 2RHGA 3N14A 4JXCA 2DP3A 3B8DA 1DV7A 5C55A 2E09A 3NQAA 3EX4A 1DQXA 4NXSA 1OX5A 2QJIA 3UWZA 5BRBA 1FDZA 4RZ5A 3MHUA 4NXKA 3S5YA 3OVQA 4OV4A 5KTLA 3S1UA 1W1ZA 4UFMA 1KM3A 1O60A 1KFJA 1CI1A 2NUXA 3UD6A 1K02A 1TPVA 4EVZA 1QPOA 1SZFA 5E1QA 1WBHA 2YX0A 4MLRA 3A5FA 3LTPA 3BW2A 2NLIA 3L0KA 3UXDA 4MFDA 2WV8A 3G0SA 3FS2A 1I2RA 2JKAA 1AW1A 4LS2A 5G1YA 3FOKA 5KZEA 1SW7A 3W7IA 3H55A 3SFKA 1L6WA 1MEHA 4I7UA 4NX0A 3DBPA 1OFBA 4XKYB 1L6SA 2Y88A 4MLJA 5LNUA 5DBUA 1SUXA 1I8JA 5EBUA 2YFOA 2I1OA 3Q2DA 4BI5A 1S5WA 1JJKA 4OU1A 1R46A 2X1UA 4FIQA 1XBYA 4BWLC 1KFBA 1WOBA 2DZXA 3N2MA 3TR2A 1FDJA 4O52A 3ABQA 3P61A 2GVLA 2R94A 1KV8A 3W2UA 3Q37A 3CEUA 4DO4A 1OFRA 4IUOA 5HNRA 2V2DA 5D03A 4I7WA 2R91A 1W5NA 2I14A 2ZZ3A 3L67A 2QCEA 3NPWA 4QITA 2ZDRA 4ZZ9A 2NZLA 5HQEA 4X2RA 5CKSA 2A21A 5DBTA 4CCEA 4YXGA 5HWNA 3UNDA 1PV8A 1H7PA 3P5YA 4LUIA 2O7SA 3UWYA 3TXZA 1FUYA 3CWNA 3I68A 1ICQA 4O14A 3MI6A 3LXBA 3QRHA 3NL6A 4A3UA 1VR6A 5IM51 3CLMA 3TQ0A 3SGZA 2NX9A 2V0TA 5C6MA 1J2WA 1K7XA 3W87A 3HPXA 3KOFA 4PFMA 1CW2A 1O94A 3UPBA 3W70A 1LOLA 3UXAA 5AC8A 1G4PA 3G22A 4ZQNA 4Y96A 1JUBA 1LBMA 2X30A 3LBCA 3W7JA 4UR8A 3SY5A 1PHWA 4MZ8A 5IBXC 1ADOA 1W5OA 2ABAA 3LCLA 2E77A 5C54A 4AB4A 3W1LA 2ZYFA 1GWJA 1H7OA 3GVGA 1VQTA 4N02A 4FNPA 4ADTA 1MXSA 1VLWA 4JN6A 3WK3A 5HR7A 2DZTA 1T0OA 1WYIA 5LHEA 1HL2A 4LV4A 4KKXA 3EEGA 3TXVA 5H91A 4OHQA 2YZRA 4IMFA 4O12A 2J24A 2Q3RA 4LUJA 4M5PA 2P1FA 3RU6A 3BGJA 3EXRA 5AHMA 4O1BA 4OE7A 3GX9A 3GAYA 3U8GA 1JVNA 3NM3A 3VE7A 3MYPA 3PS7A 1GG0A 4KWWA 1KFEA 3KRZA 4NUWA 3S42A 5E93A 1KM1A 5SWUA 5K9DA 2FPVA 4O17A 5CG7A 4UTTC 1C9DA 1SFLA 4UFHA 2J27A 4XKYA 3W2KA 1KM5A 5AB3A 1UBSA 3HG2A 5K7JA 3S9YA 1RPXA 4E0CA 2ZZ6A 4YMZA 7TIMA 1K8YA 1L6YA 4WJEA 1V5XA 2PURA 2VEPA 3QMTA 2C0AA 2BLEA 1H7RA 2Q8LA 1EP2A 2A2IA 2VFEA 2FJKA 4OT7A 3DKLA 3FJ6A 1XUUA 1VLIA 3KVMA 3LRMA 2RFGA 2E6AA 2CFFA 4GC4A 4FIRA 4MIMA 2TRSA 3QQ1A 5EYWA 4JS3A 3G3DA 4JYDA 3W71A 2E5CA 4AWUA 4YCPA 3RLUA 2CZ5A 4X22A 4O18A 4RR4A 2AQWA 2GJNA 3UWUA 4OWGA 3G1VA 3T40A 3VKJA 4DELA 1G4EA 4DPPA 3UWVA 3M5ZA 1XUZA 2ZA2A 5F4WA 1F73A 3PY2A 5I3IA 4XWUA 1SPQA 4K8EA 1W3TA 4A22A 3S1XA 1XFBA 2XN1A 1J5TA 1IIGA 4FF7A 4QAIA 5LNWA 3L65A 5AOUA 3IIZA 1H62A 3MMTA 3HMJG 5AC7A 1X1ZA 3P8JA 1XM3A 3G18A 3W76A 1YTEA 3STCA 5U4NA 2BXVA 2FB2A 2ZRVA 1KFKA 3MP5A 4JIQA 4NQ1A 2NUWA 4ICNA 1TJRA 1SQ7A 3S6DA 4UCGA 1XBXA 4H4IA 4UUIA 3QSTA 3DAQA 3FLUA 3NQGA 3UYCA 1NFBA 3L5AA 4HSOA 1LP6A 4JYEA 2ISVA 4HSNA 1VCVA 3E96A 3G1HA 2YDAA 4EOUA 1TPWA 3M43A 3GKAA 3W83A 5DCDA 2JGYA 3KXQA 4FNQA 4Y6GA 1QPNA 3HF3A 1LRQA 4ONVA 1F7BA 4FO4A 3UWWA 3TJLA 1K7FA 2J9YA 1S3HA 5CZ0A 3F4WA 1VPXA 4NJGA 1UASA 1OK6A 3W7PA 4HN4A 4WZHA 3DHDA 4JTJA 5I3JA 4NJIA 3ZFHA 4BF9A 4PCFA 2OT0A 3IIOA 1VGAA 1WDWA 1FWTA 1G67A 2CLFA 3QYQA 1SZNA 2FLIA 3FA5A 4JNMA 3FEMA 1GPWA 2J9ZA 2B7QA 1C29A 4NT0A 3W88A 4XBKA 3NOEA 2CZDA 4MPQA 1JCYA 1VYSX 3HG5A 3TA6A 1SSGA 1VJIA 1AK5A 5G2HA 4AHOA 1EEPA 1QOQA 2FDSA 4AH7A 3ATYA 2CLOA 1LLWA 2TYSA 3EXSA 2CLIA 2ZTKA 1TTIA 1XL9A 3PULA 1ICSA 5CSSA 3DGRA 5F2MA 1NAL1 4L4MA 4IX0A 2OT1A 4OQVA 1Q3NA 2YFNA 5E0KA 3S5NA 1IF2A 1I2PA 5C2XA 1P4CA 3N19B 1RQBA 4Z1CA 3DHFA 1AMKA 4PH6A 3MP3A 4JTIA 4GE8A 3GKFA 4KFOA 2WJZA 1GEQA 4MJMA 1SFJA 1V7YA 1BWKA 4WY0B 4Q33A 4NJJA 3KVKA 4IOTA 2EGZA 1XC4A 1N55A 2V82A 5DY2A 2ZRZA 2A7NA 3M5YA 2JKPA 3LHZA 2EHHA 3OHIA 4UTKA 1O5XA 1LBLA 1W5MA 4Y9AA 1TV5A 3PWAA 3TSDA 2E6FA 1MZHA 4UMAA 4BK9A 3OA3A 1TPH1 3M5XA 3TH6A 1ICPA 3W7OA 1IIHA 3G8EA 2GVGA 3NEVA 4IMGA 4O16A 1FWWA 1LCOA 4BWLA 3W1MA 4JR5A 1VHCA 4XUGA 3T4CA 3NVTA 3MI3A 1HO4A 2C16A 4N9DA 4NNAA 3A9IA 3SR7A 2A5HA 3QJAA 4X9SA 4K39A 2E5BA 4RV8A 4K7VA 3O6CA 5D02A 3TSMA 3UWQA 1W0MA 2A4AA 2WSYA 3L9CA 4A29A 3NQ7A 3O6DA 3ANYA 1R47A 4FNRA 5CPOA 1H51A 2WKJA 3RF9A 5D09A 3DFPA 3CB8A 5LSMA 5HWJA 1OX6A 5G2IA 4I9AA 1S5VA 4UTIA 1B3OA 1Q6LA 2ZQ0A 1W54A 5F2IA 2V9DA 5FF4A 1SO5A 3GZ3A 1A5CA 3MYOA 3M47A 4HNUA 1ME7A 2GUUA 4LY8A 2X2GA 3R13A 4YWIA 2CLKA 2ATSA 3TV8A 1SU5A 5D2VA 4DPQA 3E12A 3S1WA 3MBFA 3LB0A 5ABTA 2GPTA 4O4WA 4QJ1A 3PAJA 3DXIA 3QPYA 3QFEA 3NL3A 2VFIA 4KWVA 1ZALA 2YR1A 3GDTA 1M5WA 1G6CA 4FX6M 1AW2A 3A22A 4LV9A 3V1PA 4W9TA 3L0NA 4XQ6A 3GLCA 3NNTA 3IVSA 4Z1AA 4FX7A 4JY8A 4QISA 2EPHA 1AL8A 2PRLA 1WX0A 4S2CA 5DELA 1OFEA 3C3NA 2WNQA 2A0NA 4N4QA 5AYXA 1HUVA 3DFTA 3W9ZA 3M6YA 5G2WA 3B05A 2V2CA 3HOJA 4A2SA 1DVJA 2G97A 4ALDA 2QCDB 2XN0A 3MI2A 2FPTA 2ZZ5A 1H60A 4O54A 2ZTJA 4O57A 3O63A 3PBUA 3MBDA 3C56A 5BMWA 3UZJA 3W84A 2EF9A 5KINA 1R2TA 3A21A 1VHNA 1IXNA 2X1RA 1WA3A 4JTLA 3LM7A 2HSAA 2V81A 4EF9A 3GNNA 2ZA3A 4U4MA 4UTTA 4AAJA 4Z1DA 3IVTA 2YW4A 5FI8A 2H6RA 6TIMA 5D2TA 3TX9A 1GQNA 5HWMA 3P7YA 2ISWA 4JEQA 4UTHA 8TIMA 1H5YA 3LERA 1ME8A 3W3OA 4UTJA 3B06A 5J5DA 3W7LA 2VOMA 3EWYA 4ZQCA 4ZVJA 1OG0A 4R33A 2CWNA 1MSSA 3LCXA 5EY5A 5D32A 4UFIA 2CLLA 5D05A 4JIPA 3MW7A 3O16A 5A8GA 1B57A 3GDMA 2GQAA 4Y90A 3G1DA 1SO4A 1SO6A 3KX6A 1Q6RA 1TPC1 2G5WA 1W5QA 3CIWA 1TRIA 3S0CA 1OX4A 3N9SA 2GJLA 4K37A 2DJLA 1TQXA 1H1YA 3W7EA 4MJZA 3WK1A 1GTHA 1ALDA 4K7YA 4MOZA 3DFOA 1DBTA 2WSRA 4LOCA 1ONRA 3CTLA 4JYFA 2H3DA 2ISSA 4GRSA 3ZWTA 5AFDA 1A50A 3M9YA 3NQEA 1PE1A 5FF7A 3OEXA 3P8IA 2CZEA 1T8XA 2Z6IA 3G1FA 3LI1A 1LM1A 4NVTA 1U83A 2R8WA 1L9WA 3K30A 4WX2A 3KVLA 2O7QA 3W86A 4POCA 4GUIA 1YTKA 4JX4A 1EB3A 2W0UA 2Q3OA 1OK4A 3LRLA 3QMRA 3JRKA 5LGZA 3W1QA 2G95A 4WXYA 3E02A 1ZHAA 1VYRA 3T7VA 2W6RA 4JTSA 4LS1A 4QIUA 1QR7A 3IGSA 4YLWA 1QPRA 3PUDA 4ZMGA 1OFPA 3V75A 2QJHA 1GJPA 4IXHA 3IRDA 1JULA 1I4NA 4GUFA 2DZWA 4O11A 1YXYA 3LOTA 1OVDA 4LNYA 3A5VA 1SSDA 2H8XA 1QCWA 4GFSA 2H3BA 3HG3A 2CLEA 1ZNNA 1FDYA 3NZRA 1X1OA 5I3FA 5LZLA 4N4PA 3TDFA 3W7DA 2QCDA 4NZJA 2J9XA 5F4XA 2VKZG 1KM6A 5D30A 4CQ9A 3KRUA 3M7WA 3L5LA 1R30A 3TQVA 3E49A 3PSVA 3BPWA 1Y0EA 3NQVA 1P0KA 1TTJA 3CC1A 3UY8A 4C1LA 3D0CA 4A2RA 3C6CA 4U28A 2AGKA 2FTPA 2BX7A 3UPWA 3W73A 1JRCA 3NL2A 1B9BA 3CHVA 4AVFA 2VFGA 1D3HA 1R2RA 2PRHA 3QC3A 1EUAA 3N2XA 3NZ1A 4Y8FA 4XZ9A 3IIVA 3WK2A 1TO3A 2YYUA 1LDCA 3EX2A 3L66A 4XTIA 3W1UA 3LRKA 1P5BA 1GZGA 4CNNA 3IVUA 3W6YA 3WJXA 4NNCA 3ZR4A 4UTWC 2NUYA 3GDKA 3NPXA 1QWGA 1I45A 1S5TA 3I7SA 3RFAA 4UTUA 1HO1A 3DFNA 4N9BA 3FYOA 1ZY9A 1Q45A 2F7FA 5G1TA 4CNOA 4HHPA 3TSBA 1VCGA 1W5PA 4WOQA 2FPYA 3GXPA 1VC4A 2FFCA 1GVSA 1LRNA 2A7RA 5CPNA 3HJZA 3R8RA 1GYNA 4CCDA 2F84A 3QM3A 3QW4B 4LWWA 5BMXA 3PR2A 3O8AA 3EB2A 3PBVA 4FXSA 1G4TA 1WAUA 2A6NA 3EX1A 3W2NA 1VRDA 4A21A 3BO9A 4UMBA 1EIXA 1YPFA 5HULA 4WQ6A 3TK7A 3L21A 3EKLA 1KBJA 4ZQPA 2C14A 3PG9A 1L2UA 4HIBA 4TMBA 3FKRA 2C18A 4J9JA 5HR6A 3CQ0A 1ZENA 1MEIA 4Z08A 5J5RA 1TV7A 3ZS4A 2QDGA 3GDLA 3DFQA 3B0PA 3T78A 1C8VA 3MHFA 4O8RA 4UTLA 5D2XA 1FY6A 2ALDA 4HNTA 3NO5A 1SZGA 3NA8A 1GG1A 3N9RA 5CPMA 1PL9A 2CW6A 4I7VA 5LNSA 4O28A 1B4KA 5D38A 3P74A 5AYYA 1WXJA 3N3MA 2QAFA 5CZTA 3QQ0A 3PUEA 3STEA 1X6UA 3MP4A 4IMCA 1G7UA 2B7PA 5TIMA 3TROA 2C13A 1A5AA 3UZ5A 2ATMA 4UMCA 4UR7A 1GVOA 2ZCGA 1QDSA 3PUOA 1ZAIA 1YPIA 5BNKA 1XI3A 2IQTA 1JUEA 1LOSA 3MWAA 3VFLA 4AXKA 2C15A 1OABA 4LVGA 1JCNA 2QR6A 1TYGA 5K4ZA 5MHBA 2VEMA 5I3HA 3B04A 1F2JA 1M7OA 1A5BA 3W1TA 4DF2A 3W74A 4DF1A 3QEZA 4G1KA 5DCEA 5U7SA 3G1SA 4M7SA 1OFDA 3G1XA 3GNDA 1ME9A 3LX9A 5I3GA 4NJHA 4O10A 2YSWA 2AAMA 3W2LA 1Q6OA 1JR1A 1QMLA 4O50A 5H2ZA 4LRSA 3F1QA 4P2VA 3W7HA 3KRSA 2JK2A 4KFNA 4R7JA 3W7MA 4X3ZA 2YPIA 3M1ZA 4GUGA 2TMDA 3LXAA 3OBKA 4K8HA 1PCKA 3W1XA 1A53A 1KM4A 3O07A 4UTMA 3WFAA 3W85A 1FBAA 3N34A 3C52A 4MKNA 1XKYA 4RZ6A 1LORA 4AHQA 2XFWA 2QCHA 1FQ0A 3DI1A 4HKPA 1M7PA 4QM1A 5AHLA 2DZPA 1YTDA 3F4NA 3PBWA 4NZFA 4OGZA 4LVFA 3LBMA 4IJBA 3TAOA 1XCFA 4NX5A 3I7QA 3LHYA 2R14A 3TFXA 4O4VA 4JDYA 3MUXA 4O1CA 3W23A 6ALDA 1KTNA 3E9AA 3B0VC 1KA9F 3JS3A 3R2GA 1RQHA 1VYPX 3IIPA 4E38A 4N9EA 3LLDA 5LKYA 3GB6A 4JTFA 2PC4A 1DJQA 2NWRA 3WJZA 5FEZA 4LVAA 1ZJIA 2CLMA 4RCXA 2QCGA 1G69A 3KHJA 3NQMA 1SR9A 3SGUA 2VEIA 1BEUA 5LNVA 2ZRYA 3RK8A 4BR1A 1YDNA 3STFA 3PB0A 4K36A 2VC6A 3VI2A 4XBSA 2RH9A 3WJWA 3VNDA 3EXTA 4QSHA 4IGHA 3LV6A 4MFEA 3LHUA 1KTCA 3ABRA 2KZHA 1P1XA 2QCNA 3BGGA 1O5KA 1IXOA 3ABOA 3L5MA 2Z2UA 3MJYA 4MVAA 4BI6A 1VCFA 2QCLA 3LHTA 1FCQA 5DY3A 2B7NA 1A5SA 3G0XA 2CZFA 3OIXA 4FB7A 3H53A 1PS9A 4HPJA 5AHNA 5F1VA 1JUKA 4DEFA 4JTUA 5FESA 2DZSA 5DN1A 5FF3A 1GYLA 2I9EA 3W2JA 1UCWA 4S2BA 1I2NA 3U2OA 3ZWSA 4RXFA 4FNSA 1DHPA 3G3MA 4JGDA 4WUIA 2Y61A 3T44A 1JRBA 2EAWA 3LDVA 2RKXA 5F2LA 1RR2A 1SW0A 3P81A 2QAPA 4N9CA 5KZDA 3EX6A 1K8XA 1OF6A 3NYZA 4WXZA 3TW7A 2Z6JA 1LTDA 3DZ1A 3P82A 3R89A 2BWGA 1W3NA 3KFTA 1SO3A 1I2OA 4LRTA 3BARA 3W7QA 3R5EA 4UC5A 2QJGA 4BFAA 1NSJA 3M16A 1YDVA 2DU2A 1T99A 1D3GA 2X1SA 3NPVA 3GIYA 1F74A 1TRDA 2QF7A 2FQIA 3MO7A 2VEKA 1D9EA 4LU0A 2ZRWA 4TU1A 2ZRUA 3C8FA 4FNTA 4O13A 3QPZA 1TMHA 3LV5A 2ZA1A 3TMQA 4NJKA 1ML1A 2NXGA 4GXMA 3B0UX 1RQEA 2CU0A 2B4GA 5KMYA 4JTEA 2DZUA 1H61A 3EX3A 4GUHA 4QNEA 5EA9A 2A6LA 5FF0A 3SECA 4TO8A 3HGOA 3C2OA 2WPBA 4NNBA 1CX9A 1LYXA 2WNZA 4ZQMA 3G1YA 4WY0A 4DBEA 3SZ8A 5HUPA 2ZZ1A 3SW6A 3L68A 5I3KA 4UNLA 3PM6A 5EPDA 2GQ8A 1H1ZA 4NU7A 2Y6ZA 4MYXA 2XN2A 1G4SA 4UTWA 3CT7A 5AHEA 2TPSA 3P84A 2Y7FA 2RDWA 2C6QA 1W3IA 2V5BA 3G0UA 2NWSA 4M6QA 1UB3A 3IGUA 1F76A 3L2IA 1XBZA 4D2JA 5K2ZA 4CQ8A 1AG1O 1E51A 1ZCOA 4JTHA 1K03A 5FEPA 4P61A 3LLFA 1JQXA 4AF0B 1OYAA 3P80A 2NV1A 3LHVA 3LXCA 2GVJA 3BW3A 2E1DA 3TAKA 3W1NA 1W37A 1Z41A 2BSLA 3U6WA 1OJXA 4O19A 1LLZA 3QW3A 1SZEA 1LOQA 3LCIA 1YDOA 3IEBA 2J6XA 2YGYA 4RJEA 3CIXA 4RK8A 5AHFA 5K4XA 1TPUA 2VENA 3BK0A 1FWRA 4LVBA 2QCMA 2OMAA 3M0ZA 3I65A 1H63A 4PEKA 4JD4A 1N8FA 5F4SA 3W7KA 2ZZ2A 3BLIA 3I7RA 1N7KA 3QF0A 1RVGA 1DKWA 3GAKA 3TC6A 3EWZA 5FEXA 3TQKA 4TIMA 1TV8A 4N6FA 1P0NA 2CLHA 2H90A 4MZ1A 3TE9A 1WV2A 3DI0A 3PF3A 3HBLA 3P67A 3PC0A 4RKAA 1THFD 3IIXA 3O6YX 3S1VA 2C19A 1M6JA 5LHFA 4WD0A 5D2WA 1TPDA 1KM2A 1PCWA 3W07A 2RDUA 4HNVA 3TMLA 1TTQA 3I6RA 4MY1A 4L4LA 1OHLA 3PG8A 2VFFA 3MHGA 2YXGA 1WBJA 1KV5A 3GDRA 3CEPA 3BLFA 5D33A 3RLVA 2H8ZA 2JBMA 2V8ZA 3M41A 4IXXA 3INPA 4PC8A 4LS0A 3NDOA 5FF2A 4YL2A 1BKSA 3ABSA 3AJXA 1EP3A 1FXPA 2P10A 2VFHA 2ZZ7A 4GBUA 2FIQA 1QOPA 1TPEA 2E68A 1TCDA 1MO0A 4DO6A 4IQLA 5CZSA 4ZL1A 1RD5A 4UFLA 5D37A 3TU9A 4FNUA 2HS8A 2NX1A 4QNWA 5CGQA 4M19A 4M6PA 4IMEA 2Y7DA 5L9FA 2Z1BA 3FIGA 1EP1A 4CCCA 3HB9A 4IPJA 3NXFA 1PVNA 4UFKA 3EWXA 5GVJA 1ZFJA 2BZNA 5G5IA 2QEZA 3ATZA 3O1NA 4GWEA 4DXVA 3BVJA 1ZAJA 3KAOA 3UY7A 3HIJA 4CQAA 2E6DA 2DORA 4PODA 1F05A 2PE4A 1KW1A 3TFCA 3HGRA 4UFJA 3OVPA 2WSQA 1Z44A 1FX6A 5BOOA 4AF0A 2ZBTA 4JTKA 3W1PA 1WQ5A 2Y7GA 3FKKA 3LCWA 3NGJA 2Q8ZA 1F6PA 3S5ZA 3TC7A 2D73A 3NAVA 3NQFA 2VXNA 5CZJA 4TMCA 1NEYA 2P0OA 3W7NA 5EKYA 4KFPA 1BTMA 4IPIA 3FJLA 4FXRA 1DJNA 3BLEA 3C2EA 3EWWA 1KLYA 2A7PA 2WO5A 2C1HA 1HFBA 3USBA 4AWTA 5K3VA 2QDHA 3O06A 5KZMA 1TREA 2YYTA 5DXXA 3F03K 5K9XA 5KSWA 5TBOA 3BW4A 4GUJA 1QPQA 1NF0A 5HJLA
chains in the Genus database with same CATH superfamily
4OFCA 2VP8A 4E2BA 2Y70A 4ACZB 3W1RA 2QUTA 3DKJA 1ISVA 3NZGA 3DYPA 3WD1A 1E4LA 1TIWA 1JD7A 2YBUA 4ZQOA 3MB9A 5AN7A 1ZAHA 3BMXA 3UG3A 3HGJA 1EUNA 2P0IA 3O05A 2ZFAA 4CN4A 3M4HA 1QO5A 2B7OA 4D1IA 4ZQRA 2E4TA 2NX3A 3HPSA 3P62A 5BXSA 1X8FA 3WEOA 3WD2A 1XIMA 3U4AA 3SY8A 1EXPA 4XK2A 3MV01 3PFMA 2QNEA 4UIOA 1E0TA 3S2JA 2ZRXA 2Z4GA 3BCFA 1S2TA 5H8PA 5HINA 1T41A 3VKCA 1HTIA 2BXYA 3XINA 1OYCA 3TNOA 3QHMA 1RK6A 2JGQA 4H6KA 3W75A 4B5TA 1DXEA 1Q7QA 2FVMA 1WZKA 3BTNA 3UG4A 1KR0A 5F7UA 3ONBA 3OGRA 1OFOA 1KWKA 4ADSA 3N73A 3GIPA 3L7RA 3A3WA 3UZZA 2YL8A 2YA2A 4O15A 1BF6A 5CPQA 3Q94A 4B9YA 3IWPA 4CVWA 3Q45A 5CGMA 4NI3A 4IQDA 1QO2A 2Z1VA 2QCCA 5BYWA 1AW5A 3VGFA 1KFLA 3OIHA 3YPIA 3S8HA 3NCOA 3PB2A 3TYZA 3SUTA 3AMLA 1K3UA 2A1YA 4DBDA 2VO5A 1EQPA 4Q4RA 4KRZA 4ORIA 3MS8A 1DWGM 5DCBA 2OR2A 1E3XA 3SRDA 3APTA 3QSRA 1HKMA 1OFAA 1TQJA 2P3EA 3PVFA 4OTKA 3AICA 4JX6A 3BJSA 1W9BM 4FA3A 1QHOA 3IV3A 4KH2A 1EJSC 1TPFA 3BSHA 1BLIA 3FYPA 4YIWA 2Y7EA 5A8OA 2E9MA 2JEPA 2WZTA 2WKGA 1U5JA 2Z0IA 2WCAA 3TW6A 3LCHA 4BI7A 4CLMA 5DXYA 2FGZA 1ZRQA 1JXJA 4H6RA 4F48A 3GH5A 4EXQA 2HWGA 4M56A 4BY3A 1T96A 4XAPA 2D2GA 1YYAA 1UWTA 2ABBA 3GYEA 4JY9A 4ICMA 4O1AA 4YCOA 1TMLA 1UJPA 2IXVA 3V4BA 3F4DA 1JFHA 2V2HA 2Y89A 2D20A 4DUXA 2DVXA 2YW3A 3ABZA 4D6CA 3EWBX 3SSJA 4F2TA 1JDCA 3E2QA 1NWTA 4H19A 3GTHA 1UQZA 5TD4A 4TTGA 4MB5A 4Q4MA 5CAHA 3WZ0E 1HGYA 2EPNA 1EC7A 1LWIA 1W31A 4GG9A 5A6KA 3L0GA 3EPOA 3MY9A 3G77A 2WQPA 3UPMA 1FCBA 3UA4A 3ITCA 3GM8A 4RV3A 5CSRA 4GQRA 4EK7A 5C71A 1JF6A 2AAAA 4FLQA 5AZ1A 2G50A 3G1RA 2GYIA 5DFAA 3LGEA 4K38A 3CMGA 1H1NA 4C1NA 3O15A 3RM9A 3B4UA 3MDWA 3RM4A 1W56A 3SIZA 1TUXA 3TUUA 4RE3A 5LIYX 5CPSA 4UXDA 1OX4B 3WLRA 1JQVA 2QUUA 2VQUA 3UXIA 1A3HA 2J88A 1N2VA 1TPB1 1EPXA 4PMOA 2DZVA 2G3JA 3W7CA 3SCQA 3C3UA 4JDBA 1FCUA 4MYAA 2NW0A 3LI0A 1Y5XA 2I5QA 4S3GA 4YVXA 3URQA 4GBDA 3I4EA 4GY0A 4MY9A 1GVRA 3A3XA 4QP0A 1VZWA 3C4UA 1IXQA 4IGMA 3VX1A 1A3XA 2VURA 4EPDC 2VC5A 3G24A 3HURA 5LNRA 1JFXA 2J4GA 4DJDA 4ERGA 3TYCA 2UV8G 2FB3A 4AYGA 4ERIA 4CNSA 5IBXA 3UETA 3T1GA 3USZA 5EMMA 5EL1A 3LTYA 5KITA 1ECQA 1BWLA 2B0MA 4Z0SA 3C0SA 1QFEA 3ORWA 1KBLA 5ENLA 5T8GA 3R12A 3KL5A 1IR1A 3SI9A 1EA9C 3MVTA 4V2XA 3CL7A 2PDKA 3NQAA 3UWZA 1OX5A 2QJIA 5KETA 3T09A 4RZ5A 3S5YA 3OVQA 1E6XM 3DFHA 1WXZA 1KM3A 3N4AA 1KFJA 2NQLA 2AL1A 3E1F1 2NUXA 4L6DA 4MB1A 2W61A 1TPVA 3W27A 1QPOA 2O9PA 5JBFA 4BQ3A 5C8BB 3BMVA 3WNKA 3LTPA 3U5UA 2NLIA 3H21A 5HATA 2BOFX 4F4RA 1RBAA 3MSRA 3FN9A 4QS5A 1I2RA 2PDMA 3VCCA 1FHUA 1H0GA 2HPMA 3QV7A 1SFSA 2WB5A 4H9UA 4LGXA 2E40A 4H01A 7ENLA 2PUZA 2PDPA 4FIQA 2ZX7A 1WUFA 3KLKA 4ZXLA 1ONWA 3VDBA 2DEPA 4UQ9A 4DO4A 1OFRA 3ABXA 2R91A 1W5NA 2I14A 2ZZ3A 3L67A 1V79A 3AFBA 1LWJA 3W02A 4GABA 3MWCA 1E6ZA 4E5TA 3JZEA 2G3MA 2A21A 3UNDA 3UXKA 4M24A 2YCIX 1H7PA 3P5YA 1EJ7L 4B9ZA 2VC9A 1BGGA 4O14A 1M41A 2BHZA 3LXBA 3ZO9A 2J7HA 1E6QM 2HDJA 9RUBA 1VR6A 3VIHA 2NX9A 3QTPA 5DMNA 1XLDA 3KOFA 2G3NA 5D9MA 1BYCA 3KUMA 3UPBA 1O94A 3UXAA 1QUMA 3GRIA 1UJQA 4MDPA 1P0EA 3SY5A 1PHWA 4MZ8A 1XRTA 1JPKA 2ABAA 4XAZA 3CV7A 3VOIA 1GWJA 2ZOXA 1H7OA 7ODCA 4FNPA 3TYEA 4ADTA 4CD7A 1F8MA 1UG6A 4Y9OA 5HR7A 1T0OA 3M0HA 3WQ8A 3R0DA 1FH8A 1WXYA 4LV4A 3VKKA 4CVUA 3KS6A 4L4PA 4IMFA 2J24A 4M5PA 2P1FA 3EXRA 3GX9A 4IIBA 5CLTA 4AQLA 1HP5A 4IFOA 1GG0A 4Q8NA 4KWWA 3KRZA 4AW7A 1ELSA 3CASA 3K5XA 5K9DA 2FPVA 4LJ3A 1C9DA 1ZBVA 3CZLA 4L9ZA 2WLYA 2J27A 4Y9NA 3M0MA 4UQAA 5AB3A 3W53A 5K7JA 3CK5A 1RPXA 2YA0A 3TN5A 3NSXA 4Z42C 1V5XA 3TWBA 2VEPA 1QHZA 1ESWA 2GQ3A 1H7RA 2Q8LA 2Z2AA 1E5JA 2FJKA 3CMJA 1E6NA 1XUUA 3LRMA 3RO8A 4DHGA 2RFGA 4FIRA 4KPLA 3QQ1A 3POCA 5AVNA 1XLFA 2QXWA 4WK9A 1H49A 2E5CA 2O56A 4YCPA 3TYDA 4X22A 1R9XA 1PEZA 1BAGA 3UWUA 4GO8A 4ZO8A 1EC9A 3M5ZA 3T4WA 1HKWA 1YHTA 4ECLA 1U2YA 2XH2A 3EPMA 3PY2A 3LQGA 1E3ZA 4K8EA 4HQVA 5HQMA 3MSDA 4US6A 1IIGA 4JEJA 4C7DA 1PIGA 1NDVA 5LNWA 3UVAA 1NFPA 3WLMA 1E55A 4H8HA 3GXIA 1DPMA 2DSKA 4GQ0A 2DT1A 3KTCA 2D2OA 4LAUA 1KFKA 1O66A 3WNMA 4JIQA 3RO6A 2Z28A 4GCAA 4WKAA 1TJRA 3VNMA 3DG6A 3BGAA 3RRXA 3N4FA 3QSTA 4GZIA 1NFBA 2IKHA 3NURA 4XZWA 3ISIX 4EPBC 5C7VA 3E96A 3EDKA 4EOUA 1FKWA 4HOZA 2INFA 4Q4QA 2O0TA 1OGSA 3KXQA 4PMUA 3FHQA 4GIEA 5D9OA 4ONVA 1FWEC 5EMJA 5A2BA 1S3HA 4D72A 1NIUA 4L1XA 2O9TA 1FWDC 3W7PA 3GSMA 1XISA 4ES4A 4R7WA 3FHAA 1OSEA 2OT0A 4UOZA 1NH6A 2DIEA 4U31A 1HNYA 4JNMA 2BB0A 2FZDA 1C8YA 1EGMA 2I7GA 2E9LA 3RLHA 1UP2A 4J28A 4NT0A 2CHRA 5CXPA 1J93A 2X09A 1FWJC 1VYSX 1X96A 3PZTA 3RPDA 5G2HA 3BSGA 1TG7A 3BDKA 4J5NA 2XVNA 3WQ4A 1EEPA 3ATYA 5A6AA 2CLOA 2CBIA 3O0FA 2CLIA 2ZTKA 3PULA 4LYRA 4W7VA 5GJNA 7REQB 5CSSA 1CT5A 1E9ZB 1NAL1 5HPCA 4LNCA 1EO7A 4ZGYA 1XRFA 4NRSA 2WHLA 1XLGA 3QR3A 4JFSA 3PZ9A 4GQQA 1GQKA 2Z7GA 2WJZA 1GEQA 5M03A 1V7YA 2VRJA 1C7TA 4QE5A 3AROA 3KVKA 4NJJA 2VZOA 4GI8A 1W32A 3ARWA 2PC8A 3OODA 3VDCA 2V82A 5BXRA 5DY2A 1DJWA 3CYVA 3W0KA 3WKZA 2EHHA 2OKOA 4ZEPA 2V3GA 1R85A 2TODA 1LBLA 1W5MA 4H8UA 4PR4A 3TSDA 2VEFA 3U7BA 4V1YA 2E6FA 1MZHA 1CENA 3SCWA 2VGGA 5AZ0A 4IMGA 3FDGA 4O16A 1LCOA 2PF8A 4B5XA 3J7HA 1L2QA 4JR5A 3K8KA 3T4CA 3NVTA 4FR1A 4N9DA 5E5CA 4X9SA 2E5BA 1SJBA 4Q8MA 2PLJA 4NL1A 3O6CA 3TSMA 2V3FA 1W0MA 3L9CA 4AZGA 3O6DA 2D24A 3DFPA 1X6LA 3CB8A 3MU7A 5HWJA 3G6MA 1LL4A 4L6OA 4UTIA 3M64A 4REQA 1XIFA 2HXUA 4PB4A 3EDJA 1PUDA 1TX2A 2P3ZA 1DJXA 3OP2A 2QVNA 6XIAA 2ZC8A 4LYQA 3CTTA 1DJZA 1JDEA 4DPQA 1XKJA 5ABTA 3SY1A 1JYWA 4PUMA 3QPYA 4S3KA 2VFIA 3AU2A 1XYFA 1ZALA 2YR1A 4KRTA 1M5WA 5CQ1A 1AW2A 2YA1A 1DWAM 3GVRA 3W29A 1XYLA 4DO7A 4FX7A 2PRLA 1WX0A 1DWIM 2OEKA 2WNQA 3C3NA 4N4QA 2OSYA 3B05A 2V2CA 5JBEA 3FGCB 2ON3A 1XLJA 2XN0A 1Y5VA 3PAOA 4HD5A 4O54A 4O57A 5DRIA 3MBDA 4EXBA 3C56A 2XTKA 5BMWA 2EF9A 5KINA 1K9FA 3LM7A 2HSAA 2CC0A 3GNNA 2ZA3A 3B8VA 2WWCA 3DYOA 4LALA 3IVTA 5FI8A 5D2TA 5HWMA 4YHEA 1DYSA 1M03A 5BOFA 1B31A 1AJZA 4BKNA 2GLKA 1V03A 4RNFA 3B06A 3EWYA 4ZVJA 2WVUA 3OYXA 4PMJA 2PODA 5EY5A 4PUNA 5D32A 4UFIA 2WZEA 1WKEA 2C0HA 2HNHA 1R87A 4TVDA 2W9MA 3R43A 1FFRA 4ZOEA 1JAKA 4HA1A 1TPC1 1XQKA 4H9XA 3CIWA 4IGSA 4MHBA 5AVHA 3OQ8A 2PDNA 1XIJA 4QE1A 3VKDA 1TRIA 3S0CA 3UA3A 4GPNA 3N9SA 1U1HA 1TQXA 6REQB 1H1YA 3W7EA 4XSMA 2PWHA 4MJZA 3CAQA 1GTHA 3LS9A 4MWAC 3QC0A 4K7YA 2VMFA 5DF0A 1UZ1A 4DYKA 3GHUA 4GRSA 1K6AA 3QBUA 3ZWTA 5AFDA 2ALRA 1PE1A 1J0IA 3HFTA 3LD5A 3P8IA 4W4QA 2Z6IA 3LI1A 1AZ1A 3LBOA 2WBGA 2G3IA 3VPLA 3AYTA 2IKGA 3KOWA 1IZKA 1S3TC 3EMQA 4WX2A 3UESA 3AIRA 4LEQA 1TFVA 2QMKA 3D3AA 4PMQA 3E2VA 1EB3A 2Q3OA 1MDLA 4FMVA 1OK4A 3LRLA 3JRKA 3WLSA 2G95A 3GO2A 4JTSA 3MV11 2GJRA 1VFMA 3MQTA 3PUDA 1L6GA 2XIJA 3VC6A 3NEHA 1DHKA 5C2CA 1RJQA 3S2LA 1I4NA 2DZWA 3LOTA 1E43A 1SSDA 4AWEA 4QTGA 2H8XA 2FMOA 3HG3A 3NTYA 2I56A 1FDYA 3NZRA 2F2KA 1S5NA 4D6EA 4N4PA 3F7JA 3TDFA 1X1NA 5MKGB 3CNYA 4NZJA 2J9XA 2XVPA 1ZZMA 3V16A 5HPOA 1V3KA 2BVWA 3TQVA 3AC0A 2XSAA 2F6XA 3KP0A 3GUWA 2QT3A 3NQVA 1P0KA 3URNA 2J25A 3S47A 1UQYA 2W66A 3AHTA 4U28A 1LL6A 1WDSA 2BX7A 1RHCA 1BVZA 1B9BA 1R3SA 1OQFA 2FZ8A 1AD4A 3QC3A 3N2XA 2IMRA 5HAOA 4Y8FA 4HB7A 1H5VA 3IIVA 1EJUC 2YYUA 3EX2A 3VNJA 4XTIA 3W1UA 5AYIA 1GZGA 4WGHA 4MG4A 3RILA 4L7ZA 1MNSA 1OGGA 4OUEA 3GDKA 1QWGA 1VFOA 3WSUA 3I7SA 3WMBA 4FALA 3UJFA 3JU2A 4V15A 2AMGA 4GA8A 4J2MA 3PTMA 4N9BA 3WH5A 4E8GA 3C2YA 1ZY9A 1MUCA 5G1TA 4HOXA 5AC5A 4CNOA 2AKZA 4WOQA 1IZCA 3F5JA 1VC4A 2GGEA 3I3BA 3EAUA 1GVSA 5E0FA 1KO0A 1FWCC 3LEPA 3XISA 3QW4B 3WQCA 3A47A 3PBVA 4FXSA 3EA1A 3TP4A 2PPGA 3EX1A 1I0DA 4A21A 3ZLGA 1XG3A 4JL1A 1TMQA 2EQDA 5HULA 3BE7A 3VGDA 1Q7ZA 5LIWX 3E5PA 1UPMB 4H41A 3EKLA 1UWRA 2YBVA 4ZQPA 1IV8A 2C14A 4KWUA 2DIKA 1MEIA 5J5RA 1T6MA 3AISA 1LT7A 1TV7A 3PPHA 3S6OA 3GDLA 3PZNA 3B0PA 4O8RA 3VIGA 1VEPA 1XGZA 2ALDA 4PTDA 3MUZ1 3R25A 4HNTA 3NO5A 2Q02A 3NA8A 4KIRA 3N9RA 5CPMA 1CGTA 1J0JA 1PKLA 4DUWA 5D38A 2EEXA 5AYYA 5B80A 3N3MA 4HU8A 3MP4A 1G5AA 3A4JA 1S38A 2B7PA 3TROA 3KDNA 2O55A 1H4PA 2EG6A 4UMCA 5BNKA 2IQTA 1E1CB 2V38A 3C5QA 1WNOA 4LF2A 3VGBA 3A13A 4QXIA 2OZ8A 1TYGA 1I1XA 3MJMA 1T8QA 4DF2A 3W74A 4GXPA 3QEZA 4ZA0A 4F3HA 3G1SA 4QLJA 3G1XA 3GNDA 1ME9A 3SQMA 3WLIA 2L5HA 3GU2A 4JCMA 4ATWA 3W2LA 5H2ZA 2INZA 4P2VA 4XG1A 1CLVA 4R7JA 4N0RA 2Z27A 3T05A 5ECUA 1JZ7A 4JTAA 1Z69A 4CEXC 1YX1A 1XLAA 3T2QA 4K8HA 3OBKA 1LWHA 2YIHA 5FIPA 3IGHX 5C7HA 4IIHA 3P0WA 1FBAA 1XKYA 1WE5A 3QV9A 4AHQA 3WLHA 1HKJA 3VOFA 2GFTA 1ZJBA 4L1GA 3DI1A 1C9WA 3GXFA 3QV8A 4QM1A 1GHSA 5AHLA 1KFWA 2DZPA 3B40A 2IPGA 1V8EA 4OGZA 1KCZA 3UFYA 3B3DA 1J9YA 3CUXA 2R14A 3ES8A 3W23A 1NARA 3B0VC 4F66A 4NZ1A 3E38A 3L2LA 4AZIA 3ZR6A 1VYPX 3IIPA 4C6EA 5LKYA 3E0WA 1XSIA 1F6YA 2PC4A 3L23A 2PGEA 2BDQA 3WJZA 5FEZA 3U2ZA 4LVAA 3K4DA 2PEVA 1XPGA 9XIAA 2Q8XA 3KHJA 3NQMA 3UXLA 3SGUA 1FHVA 1CGXA 1SR0A 4L64A 2Z1SA 1YDNA 2IXUA 5TNVA 2QF8A 3CH9A 4K36A 3IARA 4I5XA 3VI2A 4XBSA 3PJTA 3VKAA 3GUGA 4YTQA 1JG9A 2KX9A 3V5CA 3LV6A 4C6JA 5FJIA 2DH3A 1KTCA 3ABRA 2KZHA 3L5MA 3ARYA 4F0RA 4MVAA 3LHTA 2B7NA 4MWAA 3L4VA 4HPJA 1XW8A 2YBTA 1JUKA 4DEFA 1IEVA 5FESA 4CU7A 3EEZA 5FF3A 5HBFA 4S2BA 3ZWSA 2BY3A 4WUIA 2C1IA 3I4KA 4DJFC 4ZB0A 2EAWA 3LDVA 3FX4A 4K2SA 3KP1A 1GZ1A 3ZZ1A 2QAPA 2BODX 3KL3A 3V7PA 1OF6A 1UWAA 4E8CA 2OEJA 3OZYA 2ICSA 2BOEX 3P82A 3WYZA 1SO3A 2W92A 3TTYA 4LRTA 2MNRA 3W7QA 3QPEA 3BAXA 4IHCA 3I10A 4NKCA 2DU2A 3W24A 3PTQA 4NYUA 4BS0A 7TAAA 5FL1A 3TYAA 2X1SA 3NPVA 3GFYA 1F74A 3HV9A 2FQIA 4A3HA 3MO7A 2VEKA 1E0WA 1JZ5A 2PZ0A 4LU0A 2ZXQA 1OB0A 3CUHA 3WLNA 2YCKX 4XUYA 3LV5A 1ML1A 2X8RA 1RQEA 2CU0A 4JTEA 1J0YA 4O1FA 3VINA 1XSJA 3EX3A 5EA9A 2A6LA 2J6VA 5FF0A 4TO8A 3HGOA 2WW5A 4FR6A 3C2OA 4Y2WA 2WPBA 4QDMA 3W01A 1XYAA 4HP5A 4YVVA 3UJEA 3VUSA 2ZZ1A 3SW6A 3L68A 5I3KA 4UNLA 1UWUA 3VGHA 3GTFA 1KKOA 2VOTA 3SUVA 4QJ5B 2PWVA 4JKLA 3P84A 2RDWA 2C6QA 4YWSA 4PB3A 1POJA 4GVHA 4UR9A 4D2JA 4C6MA 4JTHA 1K03A 4IIDA 4P61A 4EPEC 1FP8A 4AF0B 3P80A 2NV1A 1V4YA 1PZ2A 1YMYA 1EXBA 4N7QA 4V33A 3PBMA 1NELA 2E1DA 3H4WA 1W37A 4ZSTA 1EDTA 4NASA 3WG6A 2BSLA 5A8QA 1Q4NX 4O19A 1LLZA 3WBWA 3WQFA 2J75A 3VGEA 3MT1A 3LCIA 3GXDA 4RJEA 2W62A 3CIXA 2CCRA 5K4XA 2VENA 4P7NA 1XYMA 2WMIA 4LVBA 2OMAA 2VQTA 1H63A 4PEKA 4ATDA 4A4AA 4WHBA 1ZBKA 3QYSA 1N8FA 3ITTA 3WF3A 2F38A 2E28A 1KCXA 1DKWA 3N15A 4ZTXA 5FEXA 4NAEA 1P0NA 4MZ1A 1Q6FA 1AQMA 5HMEA 2I17A 4GHRA 1D2KA 4E8DA 1B9ZA 3KBSA 2NQ9A 3MO4A 1TPDA 4ZCWA 2Z29A 4PGLA 4L4LA 1J6OA 3MHGA 2P88A 1WBJA 3MUCA 3BLFA 5D33A 3RLVA 3D6NA 3BANA 1SJDA 2RJHA 4IXXA 2PGWA 4C7FA 1YBQA 5I06A 3NDOA 3EMCA 2O9OA 4O8AA 4YL2A 3F2CA 4GD0A 2O4MA 3AJXA 1T5AA 1FXPA 3AS1A 2J66A 3OLGA 2ZZ7A 3KS5A 3FK4A 4GBUA 2FIQA 1QOPA 1TPEA 1BVNP 1NDWA 1MO0A 4IQLA 1WCGA 4ZL1A 1WDPA 2HS8A 1V93A 3VZZA 1S1RA 5L9FA 2Z1BA 1BXNA 3RR1A 1PKNA 2BV9A 4TTUA 3MPGA 3HB9A 1PO9A 2BGQA 1V7AA 4MGGA 4CD6A 4HK7A 2J7DA 2BZNA 5G5IA 3VO0A 5GNZA 2RGLA 4LUSA 4CQAA 1H2JA 1TVPA 2PE4A 1LLOA 3HGRA 1CIUA 1Z44A 4F9JA 2FH6A 4EKJA 4GLEA 5BZAA 1A0CA 3BAIA 2Q8ZA 3OZMA 1EDGA 3NAVA 2IUZA 2VXNA 2PTDA 4DZ5A 5EKYA 4KFPA 1BTMA 4FXRA 2RGMA 2HJPA 3C2EA 1ZBWA 2IW0A 1NOUA 2C1HA 4FXFA 3USBA 3CAKA 5K3VA 3DESA 3EGJA 4HGXA 1XIDA 5KSWA 2BMBA 3QY6A 4GIAA 3BW4A 1ZS2A 4GY1A 1NF0A 1Q8AA 4DWSD 1HVQA 5HJLA 1UKTA 1AVAA 2XSBA 3A3HA 2W79A 4WOZA 5A2CA 4Z0JA 4H8VA 3B03A 4OV9A 1WKYA 4WY0F 1FKXA 5RUBA 3LQLA 3H54A 5BWFA 1IXPA 1W9XA 2V5LA 3UQNA 3URBA 1GORA 4PL1A 4D6HA 1UP3A 1R3RA 1YE6A 3HPZA 3TTQA 4RXGA 5AC6A 1TA3A 1OD0A 4DBSA 4PBFA 1DQWA 4WKHA 4GVIA 1HL9A 2NXHA 2D2HA 3QXBA 5BXPA 4JTTA 1O95A 3ARVA 4HCDA 2V5CA 4GJ1A 5EMUA 3U7VA 3NG3A 3W72A 4MUZA 3SSZA 3CM4A 4PMDA 3VE9A 2IPFA 1JCMP 3B9OA 2DDXA 1E0VA 2Y5EA 2E9BA 4C6LA 4JICA 5C9ZA 2VELA 1DORA 5CH9A 4Q4KA 4RX0A 4FPSA 4S3JA 3ITLA 4IFKA 3NQ6A 3VD7A 3B9AA 4C1NB 2UY2A 1BYDA 4Y9PA 2DW7A 1RZMA 1FXQA 1GPFA 3BQ5A 2PDJA 4MB4A 1EF2A 1OF8A 4AFYA 2G8ZA 2YDQA 2WCGA 1TWDA 5CPLA 1XJBA 5HA7A 4M29A 3CZ8A 1NQ6A 1BFNA 3CQIA 2RDTA 3I6TA 1UYQA 3G1AA 2G96A 4Z1BA 3TWAA 1Q63A 4H3DA 2BTMA 3WJYA 1KFCA 3C2FA 3LCFA 3CYJA 3VDHA 3H2AA 2X1TA 3TIMA 1JCLA 2OX1A 4WSHA 4YS1A 3B8UA 1UROA 1BQGA 3R7MA 4C1KA 5FEWA 5EMLA 4ORMA 2XGZA 4BQ2A 3FFSA 4DBUA 4PUWA 2V5DA 2OPJA 1VBJA 2EKCA 4K68A 5FJUA 1UR1A 4EWJA 2QKFA 3R8GA 2EPMX 3VNZA 3M5VA 2VZUA 4LF1A 5CC3A 5EU9A 4MY8A 2J7GA 4GCXA 3UERA 3ZT7A 3LPFA 3HG4A 4O53A 4CD5A 2UBPC 2Y0FA 3KVJA 1OFQA 2C3ZA 3THQA 4GY7A 4HPXA 2LLEA 1KM0A 1DIDA 5A1AA 4DJED 2NXIA 3UGVA 3N18A 5HMDA 2DY3A 3KBNA 1W3LA 5T26A 2VDIA 2YCEA 3NR0A 3W7GA 4O0KA 1RAKA 2ZE3A 3P60A 1JDDA 3II1A 3WD3A 3R8HA 4HA4A 4JIHA 1TSIA 1VS1A 3M0XA 1UUMA 3VCRA 1UUOA 3V5OA 1P6WA 3DH7A 3VIKA 4CNPA 1E4MM 4Y7EA 4I8YA 4DY1A 4LVDA 2DFAA 1NJJA 1OIFA 1KCKA 4M7TA 1J2BA 2WVSA 2J78A 2W3ZA 5D2YA 4C5ZA 4C65A 1Q6EA 2GGIA 4H9YA 1BKHA 4R34A 4AIBA 3N2TA 1ZUAX 3FXYA 4R5EA 5C5YA 1P43A 4QEEA 3CPRA 3T0AA 1OGBA 4O0ZA 2ACQA 4AD5A 1OIMA 4UZSA 4KCWA 1EA0A 1DXIA 2VVNA 3A24A 3ZR5A 3ENLA 3FJNA 3ERPA 3AIEA 2PD9A 2PU1A 4Q32A 4JTGA 1YXDA 5LA2A 2XWDA 4OZOA 4ROPA 4J2PA 3CUJA 1PHQA 2F61A 6ENLA 3W26A 3E2SA 4AY1A 4KCVA 2HMCA 1F6KA 3BV4A 3R0KA 1UWIA 5A5WA 1GOXA 2PBOA 1E6RA 1Z42A 3DFSA 4B5NA 1VH7A 1MXGA 1E40A 1XDJA 4UOJA 4Q7BA 3W37A 5CC6A 5AC4A 2PCQA 3IANA 2GOUA 4AHPA 4LAMA 4E2VA 1XINA 3HU7A 4UTFA 3LHWA 4HA0A 1R2SA 2DJXA 2RHGA 2PP3A 2Y8UA 4JXCA 2DP3A 3BLLA 3EX4A 1DQXA 4NXSA 4HOWA 4LUTA 2X0YA 3W6LA 4NXKA 1GEHA 2OGJA 1O60A 4XD4A 1CI1A 4HNLA 2ZUVA 3UD6A 2PDXA 2BBFA 1QTWA 4LUYA 3RG6A 3JUGA 3GG0A 3A5FA 4XKMA 4W5ZA 3UXDA 4MFDA 3LNPA 1GKQA 3FS2A 2CPUA 2JKAA 3T0TA 1RH9A 2YDRA 3BL3A 1CTNA 3T81A 3WUBA 2MUCA 1B3XA 3H7VA 1L6WA 1MEHA 1KGWA 1GUVA 4I7UA 2D3LA 1L6SA 1RBOB 2Y88A 5CEWA 1M65A 4EAYA 4Q8UA 1S5MA 3EDFA 1PTGA 4I5RA 1IHIA 4BI5A 3QZ6A 4TV5A 2YKKA 5EGRA 3PZVA 1R46A 2X1UA 1EDQA 1KFBA 1WOBA 2DZXA 3CWHA 3N2MA 3TR2A 3NOYA 4RDYA 1FDJA 1S2VA 3P61A 2R94A 3RX2A 2J79A 5A6JA 3AIBA 3N12A 3OZPA 5A6TC 5ABFA 1L0PA 3AMGA 2V2DA 5D03A 2A3LA 2WSPA 3QOMA 2Z1WA 2ZDRA 4B2DA 1GVIA 4X2RA 5CKSA 4YXGA 1PV8A 3U4FA 4PB5A 3S9ZA 5HDRA 4D6DA 4IPNB 2HXTA 1M7XA 3I68A 1RVKA 1ICQA 5A6BD 3DC0A 1LF1A 4NF7A 4A3UA 1UIPA 5IM51 3CLMA 3TQ0A 3SGZA 5C6MA 2V0TA 1J2WA 2VX4A 1K7XA 5FJOA 1FWBC 2WJDA 1LOLA 3RHGA 1SMAA 1UR2A 1G4PA 4ZQNA 1YNPA 3QV6A 2X30A 4CCZA 3LBCA 4C60A 4ROQA 4J3TA 3QOKA 2A79A 4DUVA 1QASA 3PZGA 4I90A 4HCLA 4JN6A 3WK3A 3WNOA 2VJXA 3CJPA 5LHEA 5I78A 4KKXA 1XCWA 4KS0A 4OHQA 2YZRA 4HZMA 3PFRA 3AXKA 5AHMA 1AFSA 4OUIA 1DQUA 3VE7A 4B15A 4DXKA 4JIRA 4ZTYA 3OTRA 4JN7A 3WMCA 4H6EA 2YL9A 4NUWA 3S42A 1RCQA 1TJ0A 3WQVA 1MRAA 1YEYA 1AH3A 1AH0A 4O17A 4RNJA 4UFHA 3MSGA 3W2KA 1KM5A 1VIZA 3HG2A 1RJRA 3WX7A 4PBGA 3R4IA 2PB1A 3RCMA 4WJEA 4GNVA 2W5FA 3MVIA 4FS9A 3TONA 2QS8A 2CBUA 2A2IA 3LA4A 1M7JA 2DSVA 4OT7A 2XDFA 3HZ3A 3K13A 1VLIA 1EH9A 3KVMA 4Z2GA 1EQCA 4MIMA 1YDYA 2TRSA 4MDOA 4GH3A 3G3DA 2X7WA 1F3XA 5A95A 4HBKA 1KGUA 4RR4A 2AQWA 2GJNA 5FJPA 4MJ2A 2Z26A 1A5LC 4DELA 3UWVA 4P7RA 4KF1A 1QI4A 1YE4A 1NWSA 2HQAA 1DTUA 2GSEA 3CZEA 5F4WA 3ZVHA 4XWUA 1AH4A 1W3TA 4A22A 2D23A 3NXLA 4KESA 1G0CA 5BROA 2BHUA 4DIAA 2I16A 1AODA 1J10A 5AOUA 3LSBA 1H62A 1CB7B 5AC7A 1JGMA 1ITXA 4LY4A 3S4TA 1UA3A 1YKWA 4EE9A 3G18A 3WEZA 3W76A 1UWSA 3FJ4A 4MJ4A 2EPKX 2BXVA 2POZA 2ZRVA 3MP5A 5AECA 1IEIA 4UCGA 2J7BA 3DAQA 3NQGA 3N1AA 3NJ3A 3L5AA 4HSOA 1PWLA 1YIXA 3KZSA 1L8NA 4ZSUA 4QR6A 1TPWA 5I6SA 2OQHA 5DCDA 2JGYA 5IRPA 2WZHA 1UKOA 5B7ZA 1J0KA 1V0KA 1CGVA 3UWWA 3EWDA 1QK2A 3QGAC 4J3SA 2ZADA 5CZ0A 3F4WA 3O2LA 3KBWA 1CWYA 8RUCA 1OK6A 1MI3A 1HN1A 3WBXA 4HN4A 3DHDA 4RDZA 4AD4A 4HN8A 4JTJA 5I3JA 1O1HA 4NJIA 5JMUA 4REQB 4PCFA 4HJFA 3MUAA 1UWQA 1FWTA 1G67A 1O7AA 5TF0A 1TR1A 1SZNA 5FA5A 2CBVA 3FEMA 5FAGA 2J9ZA 3WNLA 3LK6A 3M0IA 2DSZA 2QUMA 3T08A 2B7QA 1UW9A 2XVGA 3AQUA 4GZEA 1YQ2A 2PF0A 4XBKA 1QI0A 1JCYA 1Y65A 3HG5A 1GJWA 1SSGA 4C6FA 1WO2A 4AHOA 2O4QA 2WAGA 2GGJA 3A9BA 4AH7A 1LLWA 1E6PA 1TTIA 1HKKA 1DP0A 2OB3A 4XZIA 2E7FA 4Q22A 3DGRA 1XYZA 2HVMA 4L4MA 4OQVA 1RCXB 1ITCA 1IF2A 1I2PA 2YCLB 3SJNA 3OBAA 4PH6A 3N6HA 5CC5A 4JTIA 1XSKA 4DM1A 4DBWA 4MJMA 1Z9AA 3D3FA 4WY0B 3BQ6A 3B4YA 1VPQA 4YNGA 5T91A 3T0BA 1R86A 1YNQA 2WWDA 1M53A 4JFVA 4M3PA 2ZRZA 5JUVA 3M5YA 1OINA 3OHIA 1W6TA 1O5XA 1S46A 2FTWA 2VC7A 4UMAA 3SN1A 2X7VA 3OA3A 2PCEA 3AI0A 1IIHA 2GJXA 2CLPA 1UH3A 4Y9MA 4JQ4A 4U2YA 1WKFA 3LN3A 2PDYA 5I09A 2GSHA 1VHCA 3MI3A 1XICA 2XG9A 1HO4A 3SR7A 3QJAA 3ZXWA 4K39A 1CEOA 5D02A 1MUMA 2WSYA 1XLHA 3ANYA 1R47A 5JH2A 5D09A 1UIOA 3THUA 2GSJA 4I9AA 4WJ8A 1Q6LA 1XYCA 1R9YA 4IH3A 1W54A 2A3EA 2V9DA 3GZ3A 1A5CA 4ZFCA 1ME7A 2X2GA 4Q8VA 4DLFA 3M0LA 1AUSL 1W1VA 3ARSA 4JQ3A 5D2VA 4B91A 4US5D 3S1WA 3ITGA 3B8WA 3LB0A 1XHGA 2QJMA 4H00A 3DBNA 4DNMA 1BYBA 3MANA 1V6YA 3PAJA 2E25A 4MNJA 6A3HA 4W8AA 3NL3A 4D8AA 3O7UA 2VNCA 3GDTA 4AX6A 1G6CA 3V3WA 3V1PA 2VX6A 2W63A 4XQ6A 3VABA 3GLCA 1GQLA 1BVWA 3IVSA 4JKKA 4Z1AA 4JY8A 2PDIA 1AL8A 5DELA 1OFEA 3KBVA 1K77A 1KGXA 3DFTA 5G2WA 5AY7A 4WDXA 2V6AA 1E70M 4ALDA 2ZTJA 4D9PA 4B92A 3SN4A 4NZ4A 1Z7AA 4HTYA 1BTCA 3W84A 1ZL1A 1R2TA 3A21A 1VHNA 5IXEA 4JTLA 2V81A 3RMEA 4IP7A 4Q4SA 4Z1DA 4S3FA 2H6RA 1GQNA 2GDVA 2XJ7A 4PMVA 4R27A 1I9CB 1B3ZA 3WCZA 3AAMA 8TIMA 1H5YA 1ME8A 3W3OA 1DJGA 4YN5A 4WSKA 4ZQCA 1OG0A 4G8TA 4R33A 2CWNA 1TWIA 4Q7NA 1JPMA 1VFSA 4JIPA 3MW7A 1B5TA 8XIAA 4U10A 2Q71A 3DX5A 3G1DA 1KNWA 1SO4A 2RUSA 1Q6RA 3QFWA 2G5WA 3HV8A 2JF6A 1OX4A 2GJLA 4K37A 2BG5A 1XLLA 2DJLA 4XISA 4P8XA 3WK1A 4K1GA 2EO7A 1PXGA 3DFOA 3O9NA 3OOQA 3RRAA 2J47A 1CXIA 1RA0A 1CGUA 2WSRA 4LOCA 1ONRA 3CTLA 4JYFA 3N13A 3GVWA 3M9YA 3NQEA 4AX7A 3GY1A 2CZEA 1T8XA 3G1FA 3TJIA 1EKOA 2ZC1A 4IIEA 1IEXA 4TVUA 3BUVA 3ZSTA 1UD6A 3KVLA 2O7QA 3CQHA 5A6SA 1EYEA 3WQWA 1GKPA 3CZJA 4UOQA 3QMRA 5LGZA 3DIPA 3E02A 1ZHAA 4AD0A 4LS1A 3IGSA 3IPWA 2BP1A 4WJXA 1Q6GA 4YYFA 1OFPA 1LQ0A 3IRDA 5I77A 4LNYA 3A5VA 3LUTA 3CH0A 2CLEA 2X1IA 3TVAA 2QPXA 2OX4A 2JF7A 2DGAA 2OLAA 2R1KA 3AS0A 3PBGA 4XZHA 3MMUA 2QCDA 1W1YA 2VKZG 3E5BA 4CQ9A 2VRKA 3IAPA 3L5LA 1RP8A 3PSVA 1FWGC 1OBAA 1Y0EA 4M82A 3OBEA 3S9IA 1TTJA 4C1LA 4A2RA 3UF9A 5CBIA 2FTPA 3UPWA 3W73A 1JRCA 4B5VA 4AVFA 1UA7A 1Q6CA 3BAJA 4Z1YA 1OC6A 3WK2A 3CLWA 3L66A 3HJEA 4RW3A 3SCPA 3LRKA 4CNNA 1CECA 3NZPA 2VVSA 3NPXA 1TX0A 1I45A 1PX8A 1XR2A 3DG7A 1XX1A 4KMQA 5DX7A 4W85A 2HNEA 3FYOA 3WDRA 4HHPA 1VCGA 2FPYA 4H7ZA 1L6FA 4GINA 2ODOA 4R3UA 2WJEA 1WAWA 2WYSA 3HJZA 1HJWA 5DMMA 2OO0A 3R8RA 4CCDA 4EANA 2ZUTA 3QM3A 4LWWA 3PR2A 3EB2A 3LPOA 2A6NA 3CV1A 1VRDA 3BO9A 3WL0A 1KC7A 8CGTA 1OCBA 1EIXA 1YPFA 1V0LA 1UR3M 3BOFA 3TK7A 5JIWA 2DUAA 4OJYA 3A4WA 3PG9A 1L2UA 2R24A 4TMBA 3FKRA 2BVYA 4Q8TA 1MYRA 3RM8A 3MZNA 5BCAA 4BQ5A 1GOMA 3WUFA 5LXXA 4PCNA 2VRQA 2ZUMA 5D2XA 1R3TA 3AYSA 1RUSA 1TUFA 4P7OA 3IJQA 1JZ3A 2ACSA 3IJ7A 1GG1A 4CU6A 1PL9A 3VVGA 1GGOA 4I7VA 4O28A 3ID7A 5DMLA 4HMNA 3P74A 3NUKA 4TX8A 1TJ1A 3PP7A 3PUEA 3MC5A 4IMCA 1G7UA 1GKRA 2C13A 1RY8A 3TN3A 5IFPA 1GVOA 3AU6A 2ZCGA 1VF8A 1ZAIA 1YPIA 1JDAA 2EG7A 2NQHA 2WM0A 1IQ8A 3WFZA 4GKTA 1JUEA 3VFLA 4C6DA 1JCNA 3KDOA 3GU1A 2VEMA 4L4OA 5I3HA 1VBGA 1F2JA 1SZRA 1RY0A 4ZOCA 3L12A 3WF2A 1RA5A 2IPJA 5DCEA 4QJ3B 1OFDA 3BICA 3LY0A 1EJWC 2QVHA 3V0TA 4F9DA 1R3WA 2OEMA 5FD0A 1MMFA 2AAMA 1Q6OA 3CO8A 5A94A 1QMLA 1EO5A 4LRSA 3F1QA 3OLIA 2WHJA 1CLKA 1YNYA 2NT0A 5A2AA 1E1FA 3VNLA 2PDFA 4A8IA 4KQNA 3N3TA 3MMWA 3W7MA 4GUGA 4Q8QA 1B90A 1K4GA 3C52A 4RZ6A 1LORA 3VOHA 3PWIA 4L65A 1N82A 3GC2A 4HKPA 4URIA 3KCOA 1YTDA 1I60A 3F2DA 3PBWA 4NZFA 3GBEA 4LVFA 3LBMA 1BSIA 4I6KA 1XCFA 4MAVA 1JAEA 4Z2IA 3NIYA 3C0QA 3I7QA 1PKYA 4O4VA 1V3HA 4JDYA 1D3CA 3E9AA 3JS3A 3THCA 4WDWA 4NHVA 5FCZA 5XINA 3QZAA 4H9TA 3FVDA 4W8BA 4YVPA 3S2CA 1DJQA 3CZGA 2NWRA 3L2MA 1ENUA 2FKPA 2ONEA 2CLMA 2QCGA 3S2MA 4KEZA 3AZRA 1SR9A 3GHSA 1EOKA 4ZO6A 3E2RA 2DSUA 4KEUA 5LNVA 4MB3A 3PB0A 4PTMA 4IPLA 4I6VA 3ARPA 4ZB2A 5I5RA 3C86A 4IGHA 1MW3A 3OW1A 2J8TA 1O5RA 2PU0A 4LCRA 4F0KA 1P1XA 1O5KA 3GD6A 1R3QA 5C9RA 2XSXA 1QI2A 2Z2UA 3MJYA 4BI6A 4QJ4B 2QCLA 1O68A 1FCQA 3ES7A 1SFTA 2CZFA 2I5GA 3I3EA 3IAQA 3REQA 5E9XA 2Y2WA 2CHNA 5BU9A 1PS9A 1MRQA 4UNIA 5F1VA 3B9EA 4LAOA 1H11A 1TJ2A 2DZSA 2D22A 2WQDA 1GYLA 1VFFA 2W91A 3AMKA 2GVYA 3N4EA 1VB9A 1I2NA 3VDAA 5BXTA 1XH2A 3VZXA 2P76A 1O6IA 2WMIB 4S3AA 3RR4A 2PLCA 2RKXA 1RR2A 1FH9A 3P81A 5KZDA 3AHVA 4ZR8A 1EC8A 4FOJA 3TW7A 3R89A 2BWGA 1DJHA 1DWFM 4NAEB 1XP3A 2CYGA 3R5EA 2D2JA 3L4XA 2IS7A 4UC5A 1EJRC 1UKSA 4DI9A 7A3HA 1YDVA 5BRPA 3SRFA 1D3GA 4QG8A 2VEGA 3PWGA 2QGYA 1J11A 1TRDA 4S3DA 4C6NA 1RSCA 3UEQA 1D9EA 3D47A 2OWXA 1HJVA 5CJMA 3P3BA 3H70A 4AZHA 3C8FA 2X42A 1D8CA 2WC4A 1TMHA 1FWIC 1EF3A 3V35A 3W82A 4XAYA 1YBQB 1XLEA 4CNTA 1H61A 4INFA 4GUHA 2W67A 3FA4A 5I0DA 1MW1A 2WC7A 2PZNA 5C2GA 3EB3A 4Q4OA 1CX9A 1XD0A 3CUIA 5CSYA 5HUPA 1ADSA 3PM6A 5GJMA 4JNYA 1HL8A 3DHUA 1H1ZA 3CBWA 2PLKA 2Y6ZA 4NU7A 2XN2A 5AHEA 1AD1A 2RAGA 2Y4SA 1QW9A 2GUYA 1W3IA 3G0UA 1KXTA 4AXNA 3IGUA 1WKDA 4JIIX 2WM1A 4L61A 3B9NA 4LUSB 5K2ZA 2FZ9A 4DI8A 1AG1O 3PJUA 1ZCOA 1AQ0A 3ZJKA 2FZBA 2NQJA 1NU5A 4A3QA 1BXBA 5LIKX 1W1A1 2OQLA 1HVXA 4HHLA 1JYVA 1VAHA 4IP5A 4QHRA 1KWGA 1QRQA 3TAKA 4V1XA 4DLMA 1K9EA 1V6UA 2YJQA 3QHOA 1SZEA 2HROA 1LOQA 4C7GA 4YYCA 1UZHA 4P7QA 1K9DA 3IEBA 2YGYA 3U2CA 3VILA 2WZMA 4IT1A 1FWRA 4W84A 4Z2KA 4GYPC 3M0ZA 3BLIA 3QF0A 2QLYA 3TQKA 4TIMA 4N6FA 1C3FA 2CLHA 2Z1KA 2XIQA 4F8XA 3TE9A 1WV2A 2OODA 4I9MA 3P67A 4RKAA 3VMNA 3IIXA 1TA3B 4OOUA 1M6JA 2R1MA 3F4VA 5LA0A 3BJTA 1IWBA 5D2WA 3VNYA 1TWSA 3W07A 4R88A 2G41A 1XH0A 3I6RA 3LENA 5E9AA 2CEQA 1KV5A 2H8ZA 4IISA 3EB4A 1B30A 2JBMA 3OB8A 3LNMA 4KETA 3WIJA 5FF2A 1BKSA 2VGFA 4PE8A 4Q6JA 2P10A 4JPGA 3WNNA 1OY0A 2D0GA 4IFKB 4Y8EA 5I7GA 1ITUA 4FNUA 5CGQA 4M6PA 4HYRA 4IMEA 1EJTC 2PA6A 5DT5A 3NZQA 1YPXA 4CCCA 3NXFA 3ALFA 4CUCA 3MUIA 1Q85A 2NQZA 3M46A 3AMDA 2FMNA 3UY7A 3U2EA 2E6DA 2DORA 2XFYA 5A6LA 4F0SA 1IEWA 2QYGA 2WSQA 3ZIZA 3OPSA 1S2UA 3BLKA 1QK0A 4JTKA 1WQ5A 3VOJA 2OFJA 4MUPA 2A3BA 4S39A 2XHYA 3SEPA 2OU4A 3VZYA 2P0OA 1KCLA 2PSNA 1PWMA 3GHTA 1DJNA 6REQA 3EWWA 1UUQA 2VL4A 1TREA 5DXXA 3F03K 1N8WA 5TBOA 2XYLA 1O5QA 1KKRA 3GXTA 3C2RA 1KXQA 2V68A 3F4CA 3M44A 3PUGA 2PTYA 1YADA 3VD5A 2XWEA 3JR2A 1B2YA 4GZJA 2Y85A 4DX3A 2PWEA 3W1AA 3NPUA 4CKQA 1V3LA 3BH4A 3RMJA 4DO5A 4E2OA 4GVGA 4WCJA 4IIFA 4V27A 2X16A 2XGIA 5CLWA 1FA2A 2DQWA 1HJXA 1RPKA 4GZ7A 3RNDA 2PWUA 1PX3A 3QH2A 3A12A 4HT3A 1GT8A 3AHZA 3E3HA 3O3RA 5F1UA 3HMCA 1GCYA 2HE8A 3CL6A 3GR4A 1JCXA 4HZ7A 4X9YA 1A3WA 4H2HA 4AMAA 5MKGA 3RPMA 4OBTA 3EOUA 1IWPA 1O1ZA 3IJIA 1OYBA 3KTSA 3NQ8A 1Z48A 3GE7A 3WLOA 3GQYA 1PYFA 4RLIA 2ZIDA 4A8NA 2GWNA 4UQDA 1B3VA 4JAWA 4EIVA 1HKVA 3STGA 3BCJA 1H7NA 2H9AA 3A23A 3TCEA 3SRHA 3NYDA 3ARXA 3TKFA 4AVNA 2DT3A 3VXGA 4EWND 2IQ0A 2PRMA 4M0XA 4XV0A 3EWUA 3LGDA 1Z6KA 3WLPA 3RYSA 3CAVA 5E6ZA 4PSRA 1JIBA 4W89A 1JZ4A 5DLCA 4M6VA 4UNKA 4WF7A 2OCZA 4A6GA 2VR2A 5JIPA 3ARQA 3OQEA 2QDEA 1DL3A 3GXNA 5AKQA 4JTCA 3UW6A 1I2QA 3EKZA 4HA3A 3AO0A 4Z17A 1IR2A 3B8IA 2Z1XA 2OG9A 2TAAA 2PDBA 2OLHA 2PI6A 3BG3A 3PSWA 4G6CA 1QATA 3C0JA 2TSYA 1U5VA 2A3AA 1HP4A 3K2GA 4W88A 4P7LA 3T55A 2QUVA 4KCUA 3BAYA 2XPKA 5LXEA 4LW7A 5HJXA 4H6QA 5G4EA 4MKSA 3TJXA 1W8SA 1U1UA 3WLKX 4IMDA 4IJCA 1TB3A 4HNNA 2OZ0A 1OM0A 1W9DM 3BG9A 4R53A 1LT8A 3MTWA 2MANA 2Y62A 4DJDD 1LROA 1C8QA 2CKSA 2OJPA 2OO6A 2XH0A 3A4AA 3SM0A 3HQPA 4IL2A 2WVVA 3NM1A 4LAZA 1PDZA 3E0IA 1S2CA 1Y7VA 1XDMA 3FAWA 4LUTB 3NQ2A 1XQLA 2OZTA 3DN5A 1J4EA 5LGXA 3TA9A 2BXZA 3H2NA 3GFXA 4MWAE 4CU8A 1GOQA 1XIHA 1XDLA 1H0IA 2VFDA 3N29A 4GI6A 3NO1A 1W2PA 4S38A 1GK8A 1OCNA 3G8RA 3GR7A 3UJSA 3AXXA 4JX5A 2WNNA 1GTEA 1S2AA 1LBFA 3GS6A 2HCVA 4FI4A 1TWZA 1BRLA 4S1FA 5K9CA 4C6PA 3UCCA 1LZOA 3DYMA 1HG3A 3BG5A 1IE7C 1TTPA 1QNVA 4ZE5A 4OKDA 3VD3A 3SAZA 3BAWA 2GQ9A 3PBYA 2A85A 4MZYA 2DZBA 4FOKA 3H23A 1VP5A 1RV8A 3I6EA 4F79A 1P0BA 1PJ9A 1YXCA 3WDPP 2EKGA 2HTMA 1XCXA 2HPIA 4ML9A 1XLCA 4GYPA 2DIJA 4TOQA 1K8ZA 1GHRA 1FCVA 2HZGA 1QNOA 2D69A 2QCFA 3THAA 1CYGA 3S5OA 1SJCA 2AQVA 1O4UA 5REQA 3B0XA 5ABFB 1XXXA 4RUBA 1ZTVA 3ALGA 3ZJ7A 1PBGA 1QVBA 4M1RA 3NQCA 3Q58A 4KT2A 1RK5A 3TC3A 3VCNA 1MEWA 1REQB 1LRTA 4FX8A 5F2GA 3TZNA 2UY3A 1EOMA 1NVMA 1XRSA 4GNJA 3RLGA 4HNCA 1NF7A 4O0QA 3ZT6A 2ZX9A 1ZGDA 5BW6A 4AEOA 4Z2LA 2P50A 1D8WA 4ML4A 2VR4A 3UGRA 3WD4A 3M0YA 1M04A 3LU2A 4KWSA 3P14A 3P5ZA 4KIEA 2F2HA 4I3GA 4A3RA 4OIFA 1IGSA 3AXHA 4AISA 3HO8A 2JKEA 2G4FA 3N14A 4AEEA 1IWAA 5C55A 5BRBA 1FDZA 5JU6A 4AMCA 3AWNA 3S1UA 4KEMA 4UFMA 3MDUA 5B7YA 3ZLFA 2EBNA 2C71A 5E1QA 3RU8X 1CCWB 2YX0A 3FSUA 1TZ7A 1V77A 4RL3A 1QJWA 3G0SA 4JTDA 1UH4A 4LBUA 4QX4A 1AW1A 4LS2A 5G1YA 3FOKA 4PMRA 3W7IA 3H55A 3RJXA 1XIEA 3P0XA 3WF4A 3DG3A 5I2UA 3DBPA 5I00A 1OFBA 3CHCA 4MLJA 5LNUA 1TV4A 4MNKA 4XVEA 3H6OA 1UD8A 2O9RA 2JE8A 1SUXA 4Z2JA 1I8JA 1UOZA 4PCPA 1E6SM 5EBUA 2BY1A 3Q2DA 2PDQA 1HGWA 1JJKA 1FFQA 1XG4A 4OU1A 3CHDA 1XBYA 4BWLC 1BQCA 4O52A 3ABQA 2GVLA 5TAOA 4W87A 3W2UA 2NVAA 2GWGA 4JQ2A 4DZAA 4EAMA 5HNRA 3QLLA 2OYMA 2QCEA 4JFTA 2FZMA 1MFUA 4QITA 3VOCA 1XIGA 4ZZ9A 3FXGA 1XV8A 7CGTA 2AKMA 4LXFA 1UR8A 3QY7A 5HWNA 3OZOA 3U3HA 1W9PA 5H1WA 4RE2A 2NVCA 2B81A 3ZVHB 3H22A 3TTOA 3TXZA 3VD4A 4ZO7A 4MTVA 4EX4A 3L4YA 1US2A 5GPRA 3QRHA 4WSJA 3WH7A 2BY0A 3QGKC 3T8QA 2WMFA 3HPXA 3CUGA 4J3VA 3W70A 2CITA 3S3GA 5AC8A 3G22A 3MKCA 4Y96A 1HIZA 1JUBA 1LBMA 1OG6A 3W7JA 4A3YA 1ONEA 4DYJA 5IBXC 3F5KA 3LCLA 1TCMA 3V36A 3GG1A 5C54A 2V67A 4AB4A 4U2ZA 3AUJA 3GVGA 4UBPC 1VQTA 2WBKA 1N8IA 1CXLA 5BRQA 1VLWA 1ZB5A 1HL2A 2VDHA 3EEGA 3TXVA 5H91A 4K1WA 3MKKA 2Q3RA 4LUJA 3RU6A 3BGJA 4O1BA 1XIIA 4OE7A 1BG9A 4UCFA 5E09A 3TEVA 2BY2A 3GAYA 5KEZA 4LYPA 1JVNA 3NM3A 3MYPA 4M81A 1KFEA 2C7FA 4QSFA 2GOKA 4AC7C 1FP9A 3BLPX 2FHBA 3PNZA 4XZLX 4S3EA 1SFLA 5CG7A 1I75A 1Z8AA 1JZ6A 4XKYA 1UBSA 2XFRA 4IUGA 3EPNA 5FSEC 4D6JA 4E3VA 4OBSA 4W7WA 7TIMA 1K8YA 5HNUA 4BCEA 2VUYA 1TVLA 2PURA 3E6EA 1OCJA 3IJDA 2C0AA 2BLEA 1A49A 2VFEA 3VTRA 4KCTA 3DKLA 3TN4A 4AYSA 2E6AA 5J04A 3WBEA 3P2VA 2XZ7A 3H24A 3DGBA 1HKIA 4JYDA 4DVOA 2CZ5A 4YHGA 1FH7A 3THDA 3UP8A 3SQLA 4O18A 4MADA 5M1TA 3RCNA 4OWGA 3G1VA 1R0MA 1CGWA 3CHEA 1VENA 3T40A 3VKJA 4QS6A 3WMLA 4DPPA 1KBBA 2Z24A 3UT0A 1HQTA 3WFLA 2ZA2A 3UBPC 1F73A 5I3IA 5XIMA 1C91A 3EOEA 1GOWA 1XFBA 1CPUA 4Q8PA 4FF7A 2WMKA 3RITA 2PP1A 3B8TA 3L65A 5CC7A 2D0FA 3IIZA 3HMJG 4MSSA 2F6UA 1XM3A 1YTEA 3BJFA 3STCA 5U4NA 2AGTA 2FB2A 4NQ1A 2NUWA 2BHYA 2REQA 2OYLA 2VCAA 1F3EA 1XBXA 2GJXB 4UUIA 2OSXA 3FLUA 3SUUA 2AQOA 1CXFA 2ISVA 1EIBA 4HSNA 3TW9A 3ZYZA 1MZRA 2YDAA 1F07A 4A05A 1OZMA 3M43A 2CWXA 3GKAA 3W83A 3RGTA 4XO7A 3WF0A 4FNQA 4Y6GA 3BMWA 3HF3A 4FO4A 2ZWZA 3IJ9A 1GVEA 4RZBA 4MNLA 3TJLA 1K7FA 2O92A 1UASA 1QXLA 2ZX8A 3LMZA 1NP0A 1WZAA 3CQJA 4RDWA 1JYXA 5BOEA 1WDWA 2CLFA 5GQBA 2PDGA 1J01A 2FLIA 3FA5A 3JVAA 4YU1A 4H04A 3AIUA 4HVXA 1EZWA 3W88A 3ONCA 4QAWA 2DUZA 3EA2A 2CZDA 2DUXA 3H2EA 4Q4PA 3TA6A 2BS9A 1AK5A 1KRMA 2PGFA 3OU8A 3VM5A 1K8CA 4JHMA 2FDSA 4GIRA 2PMQA 3NQBA 2TYSA 1UZDA 1XL9A 1JNEA 4LCSA 4Q3MA 2WCSA 5F2MA 4AZCA 1ZP3A 2OT1A 1Q3NA 2YFNA 1SYTA 2VUNA 3TLQA 4LSBA 5A8NA 5C2XA 2JFEX 4MF4A 3N19B 1BD0A 2QIWA 1A5MC 4Z1CA 1AMKA 1EX1A 1TKKA 3MP3A 1E15A 3K4AA 1JD9A 3LLXA 3ARRA 1J18A 2FFIA 2HVOA 1SFJA 2NT1A 3URAA 1TZ9A 4A8RA 4Q33A 6XIMA 4A35A 4IOTA 2EGZA 3FYYA 1XC4A 4GC3A 3FSTA 4HPHA 2OELA 2JKPA