3MJYA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-aminoorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
306
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 107
structure length 306
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mjyA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mjyA01
3QW4B 5CZSA 5D2VA 4CLMA 5BMWA 2CLHA 2CZDA 4UNKA 2JKAA 2O7SA 1I4NA 4BI5A 2HS8A 1VS1A 1W56A 3QJAA 1F73A 2DZUA 4UFLA 4AHOA 5L6UA 3B0PA 4XUGA 4FX6M 1YTKA 1MEHA 3HPXA 4IXXA 4GUIA 4UR8A 3TUUA 3VCRA 3TCEA 1W5NA 3KRSA 3BG3A 2E6DA 5AHMA 1HO4A 1XC4A 3CU2A 1RVGA 3KFTA 4OV9A 1N7KA 1T99A 3IIXA 4X9SA 2B7PA 3I6RA 2XN1A 3MYPA 3NQ6A 2AGKA 1S5VA 1KTCA 3M43A 2TSYA 3W7LA 5FI8A 1MO0A 4PTNA 3WK3A 4FNSA 2VELA 3A21A 3N3MA 4J9JA 2V0TA 7TIMA 1UJPA 3EX3A 3WJWA 3PR2A 1VYRA 1BTMA 2AQWA 1H7XA 3SZ8A 3ABSA 2JBMA 3O6CA 3DAQA 2GQ9A 1AL8A 2WSYA 3GDRA 1OG0A 3TSBA 2FPTA 2V9DA 1N8FA 1G67A 1VLIA 1SPQA 3EWBX 1NF0A 4ZQRA 1VJIA 4PODA 3O1NA 2FIQA 4YLWA 4R33A 1JCMP 2QJGA 2GVLA 5J5DA 1HL2A 5U7SA 1LRQA 4LS0A 4R53A 3TR2A 4JX4A 2RFGA 2VEMA 3LHZA 1L6SA 3D0CA 3VNDA 3IVUA 4Z1CA 1LM1A 3OEXA 4ICNA 3PB0A 3NPWA 2OJPA 3OHIA 2JKEA 2Y7FA 4AWTA 1T0OA 4EIVA 4Z1AA 4O12A 5LZLA 1G7UA 1LROA 4EWND 1ML1A 1F76A 3N9RA 1TCDA 1YDNA 1KV8A 3T7VA 1Y0EA 3UWYA 3ABOA 1UASA 5AYZA 2BWGA 1G6CA 3P8IA 1JQXA 3A9IA 2YW3A 1OFQA 1Z44A 4MY8A 2C3ZA 1SZFA 4WD0A 3BV4A 3GVGA 1SU5A 1XDMA 2NX3A 1KW1A 3LHWA 3EEGA 1TREA 1U83A 1XXXA 3L9CA 3TK7A 4IMGA 1TPFA 3LCXA 5F4WA 3PSVA 3NL2A 3TSDA 5FEPA 3G0UA 2E6FA 2QUTA 3QMRA 3S1VA 1TTPA 3UD6A 3EKLA 2QCFA 3W73A 3LHVA 2ZFAA 3IVTA 2Z1BA 4S1FA 4L4LA 4TX9A 3ZWTA 2NLIA 3MHGA 3B0UX 4WZHA 3G18A 1JUEA 3YPIA 2F84A 4HSNA 3W7MA 2QAPA 3NM3A 3W1RA 3O06A 1VHCA 4C1LA 3SIZA 1XBZA 4ORMA 4R7JA 4HN4A 4WY0A 3W83A 3C2EA 3V75A 1A53A 2X1SA 1ICQA 4Z0JA 4EVZA 5K9CA 1A5BA 1YXCA 4JTTA 3CEPA 5FEWA 1XI3A 3LRKA 3LV5A 2BXVA 2A6NA 3NQVA 1F5ZA 1ZHAA 3DXIA 1LBFA 1HO1A 1PE1A 4I7UA 2WOQA 3NQFA 5G5IA 4O17A 3G3DA 4YXGA 1OX5A 4IMEA 4O13A 5KZMA 1XM3A 1SZGA 1FXQA 5C54A 2BSLA 4EOUA 3C8FA 3EB2A 4Y6GA 1KBJA 2V2HA 1WA3A 4KKXA 1SSDA 3P81A 3LXAA 3M5VA 4UIOA 4N9BA 5HUPA 5E93A 4P2VA 1TPH1 3O16A 1F05A 1DQWA 3TXZA 2H8ZA 2X30A 5CZJA 2QCHA 4HKPA 2DORA 1EWEA 1K7XA 5FF4A 1LORA 1RQHA 3FJ6A 3LRLA 1H7OA 2A21A 4MLJA 2LLEA 2V5BA 4ORIA 5KITA 4DO5A 1GJPA 5IBXC 3LXCA 3M1ZA 2RDUA 4MZYA 4RZ4A 2DP3A 4MUZA 2DU2A 1VZWA 3UPBA 1OX4A 5I3FA 2DZVA 1YXYA 3G3MA 1W3IA 3PVFA 1TMHA 3CEUA 4LU0A 1FCQA 3MI2A 3L2IA 1XUZA 5AHLA 3KVKA 4JXCA 3W6YA 2DJLA 3GR7A 1FWTA 4K7VA 3SSJA 3L68A 3DFPA 1MEWA 2X2GA 3M6YA 3BGGA 4PEKA 4UMCA 3EWXA 1M7OA 4C1KA 4M6VA 1FBAA 3TAKA 1FWSA 4NZFA 1VLWA 2ZA2A 1IF2A 2FPYA 3MP3A 1IXNA 2Y89A 4ZL1A 3NQMA 4W9TA 3S1XA 1J2WA 4LUJA 2W6RA 5BOOA 5BNKA 3IRDA 1P4CA 2NUWA 3W7IA 5AN7A 3MBFA 5E0KA 3T4CA 3RNDA 3CQ0A 1ZFJA 2J9YA 3I7SA 1GTHA 2D73A 3DU0A 4DO4A 2X1TA 3LCGA 2A6LA 4AVFA 4WUIA 3W75A 3W71A 1H51A 1WX0A 2BZNA 4TIMA 1OYBA 4DBDA 3W7NA 5LGXA 2Y62A 3HO8A 3MP4A 3LRMA 1L9WA 2QDHA 1XFBA 4AWUA 1X1OA 3KVLA 3IEBA 4LS2A 3PAJA 3WFAA 4XKYB 3PBVA 4CQAA 1FDZA 3LCLA 1G7VA 1PVNA 2RDTA 4XZ9A 4NXKA 4UCGA 1GYLA 4WXZA 2ZA1A 5SWUA 1K02A 3QPZA 1SSGA 3UY7A 5D37A 2CZ5A 4UTIA 1RV8A 4ADTA 3UWUA 2QDGA 2TRSA 3HBLA 1EB3A 3E49A 5CPLA 3T78A 2JGQA 4FIRA 3LV6A 3WJYA 4P61A 1A5AA 3V1PA 4WOZA 4LTSA 2CLLA 4UFJA 2A85A 4IXHA 3N19B 4LY8A 5DXYA 4WQ6A 2CU0A 4HSOA 3A5VA 3DBPA 3N2MA 4UFKA 3P74A 3G0SA 1MSSA 2ZRZA 3FLUA 3L0KA 4NUWA 3ZWSA 1VHNA 3E0IA 2ATSA 1KTBA 1VYSX 2PURA 3TC6A 3NPXA 3N73A 1JUBA 1HTIA 2ISVA 2OCZA 3O15A 4IWWA 3EXRA 1GTEA 3B0VC 1D3GA 4GFSA 4PL2A 5F4XA 1PHWA 3TV8A 1RQEA 5DCDA 3G1FA 1ICPA 2WJZA 5DELA 5G2IA 4E38A 3UWWA 3QMSA 1J4EA 5C5YA 2VEPA 1EPXA 2DJXA 3KX6A 2NX1A 3LCIA 1PV8A 4NZJA 4HIBA 2EKCA 2W79A 5D09A 5DBUA 3QC3A 1OYAA 1H63A 3GK0A 3FKKA 3OBKA 1F6KA 1Z42A 4AEOA 1LDCA 2VFHA 1HFBA 2BTMA 3TJXA 4AHQA 4FO4A 2GQAA 3EWWA 3PBUA 4NT0A 4HHPA 2A0NA 3HMJG 3HG3A 3P61A 1P0NA 3FKRA 1G4TA 4KWVA 4MZ1A 1K03A 4IPJA 4O15A 5ABTA 3EXTA 1OX4B 1WDWA 4CQ9A 2QCCA 1JCLA 4B5NA 1WBJA 2WSRA 2WNQA 3CHVA 4Y8FA 1NAL1 2WNNA 1ALDA 4JTJA 3NG3A 3G1VA 3W1PA 1PIIA 1BWKA 3LGEA 2C18A 1D3HA 2PRMA 5CPOA 5A5WA 1TYGA 3GXTA 4RXFA 4YL2A 1WV2A 5D04C 4MZ8A 3DI1A 4UR7A 3UXAA 4O57A 3RLUA 1QNVA 5G4EA 3LCHA 5HINA 2V8ZA 4HPXA 4HNUA 3LTPA 1IIHA 3C2RA 3HIJA 3PUOA 4XWUA 1OFEA 2PC4A 3UWQA 2G97A 2V2DA 2ISSA 1OFDA 2PRLA 3S9YA 1TRDA 2JK2A 3DFNA 1I2PA 4BWLA 4O18A 5F4SA 5F2MA 3BW3A 5AYXA 3N14A 3CT7A 3O63A 5CSRA 3MW7A 3L66A 2CWNA 1I45A 2VFIA 1QOQA 4O1DA 1K7FA 3LERA 1VCGA 4JIPA 2FFCA 4Q4KA 2OZ0A 3KRZA 5DXXA 3QQ1A 1JRCA 5BMXA 3U6WA 1JULA 1L2UA 1FCBA 1GG1A 3WJZA 4DQWA 1DOSA 3T55A 4GXMA 4XTDA 5K9XA 1JJKA 1OFRA 5GVJA 1H5YA 2Z2UA 2QCEA 4ZZ9A 4GUHA 3LI1A 3GXNA 1QR7A 1K7EA 2YZRA 1TPEA 3GLCA 2OX1A 2Q8ZA 1N55A 3F4NA 3TFXA 3ATZA 2ZZ5A 1EP1A 4MOZA 3Q37A 4JDBA 1OHLA 4N2YA 3KRUA 4JTUA 3LTYA 3GDMA 4O11A 5AB3A 2G5WA 1SO6A 1XBXA 3FEMA 4FNRA 4Z1DA 4Y96A 3WK2A 5KZDA 1FCVA 3L0GA 3IGSA 1QPQA 3WJXA 4K37A 2XN2A 5AHNA 3BPWA 4DF1A 2E77A 3S5YA 4IMFA 2ZQ0A 3TFCA 4OBTA 4QM1A 2WNZA 3BLEA 1QDSA 3JS3A 3LBMA 3M16A 3W88A 3IIZA 3S5NA 3BLFA 1SFLA 2ATMA 2ZZ3A 4LUIA 1W31A 4I7VA 5H2ZA 4E2BA 5K3VA 4NJKA 4UTLA 1LLZA 4ZQMA 5KZEA 3ANYA 2FPVA 4LWWA 3DFQA 4X22A 1EUAA 3M7WA 3GDTA 4K36A 3FJLA 4RJEA 1JVNA 4O52A 1R2RA 1TTQA 1THFD 4CQ8A 4LV4A 1K3UA 5IM51 3LDVA 3ELFA 1ZAIA 1EEPA 2FB2A 1BKSA 2BLEA 3E12A 4O14A 4ONVA 1DJNA 1KLZA 2CLIA 3N2XA 1F6PA 1ZENA 2FB3A 1AL7A 1PHQA 4GJ1A 4AXKA 4EF9A 3W85A 3NQDA 1K8XA 1KM3A 4MIMA 4ML9A 2NXGA 5DY3A 1RD5A 2XFWA 4JGDA 3NDOA 4O16A 1TPB1 3SJ3A 4I7WA 4OQVA 3E96A 2ZCGA 3PSWA 2FDSA 1KA9F 3TA6A 3NPUA 2Z6IA 1JCJA 2B4GA 3BO9A 1AW5A 2ZZ6A 2YCEA 4FNQA 3LOTA 1M7PA 1JUKA 5FESA 4CNOA 4O4WA 3NZ1A 4EF8A 3PUDA 3MBDA 4PH6A 4HNTA 2ZZ7A 4JD4A 3LLFA 4TMCA 4K6AA 1GT8A 4N9DA 3UXDA 2VFEA 2QEZA 2ZRXA 4TMBA 5D03A 2ABAA 4H3DA 3S8HA 3O6DA 4GUFA 1DKWA 1O94A 2TYSA 2OT1A 4U28A 4FF7A 2Y61A 1LOSA 3PULA 4XBSA 2C15A 4NJHA 1HG3A 3C61A 2G96A 2YPIA 3NA8A 1B4KA 8TIMA 5G4WA 3O8AA 1H62A 3UYCA 3NQAA 3P67A 3PBWA 3MYOA 1FDJA 3LHYA 4FXRA 4M7TA 1TB3A 4O53A 4XQ6A 1TJRA 4QQ3A 3BW4A 2QUVA 1OF8A 5LNWA 3W2MA 3QSRA 1DBTA 2FQIA 3M0ZA 1TTJA 4U4MA 1M6JA 2CLOA 3HQ1A 2ABBA 2HS6A 5H91A 5I3IA 3LM7A 4QAIA 1TTIA 4MLRA 4LVGA 4FX7A 4M6QA 2CLEA 3HOJA 1ZY9A 1SZNA 3TX9A 1SZEA 2IQTA 1FUYA 3LHUA 1GVFA 4FNUA 1TV7A 4TU1A 3KVMA 3C2VA 4LW7A 2DZSA 3C52A 4RV8A 5KMYA 1VH7A 3OA3A 3M47A 3W84A 3NNTA 4O54A 4OE7A 2F7FA 1QCWA 2QCLA 3CIWA 1ADOA 2KZHA 2WV8A 1OK6A 2EHHA 4IX2A 3E02A 4GC4A 1XCFA 4DEFA 2Q8LA 3W7GA 4BWLC 3HGJA 2A7PA 1WBHA 3W22A 2OMAA 3S5OA 1FXPA 2VFFA 2Y63A 1O4UA 1H50A 2QR6A 3CM4A 3GIYA 3OVQA 2OT0A 4R34A 3G1YA 1W37A 2QJHA 3GAYA 2H8XA 4LVBA 3W1NA 1GOXA 3ABQA 4LC6A 2GQ8A 1EX5A 3G8RA 3LCFA 4LT9A 3P84A 5A8GA 4XBKA 1A50A 1TPWA 4BI7A 1WQ5A 4KFOA 1G4SA 2ZZ2A 3R13A 4O10A 1X7FA 2YFNA 4K8HA 3KAOA 3NGJA 3NYZA 3TW6A 3NQEA 3Q94A 3P8JA 1FWWA 4K8EA 2R91A 3KVJA 4DF2A 3CC1A 3IV3A 4WJEA 1AW2A 4K39A 2FJKA 2YGYA 2A7RA 1KM1A 4UTUA 2QUUA 1KFLA 1QPOA 4JTGA 1H7NA 4UUIA 4MY9A 2EAWA 3JR2A 4RK8A 5CG7A 1U5JA 3DZ1A 4DO6A 4IMDA 4NNBA 3VKJA 1RZMA 1W3TA 2ZBTA 4HT3A 3W2JA 2VFGA 3KXQA 1W5QA 2GVJA 4FB7A 3L0NA 3STFA 1DL3A 5AHFA 3NM1A 1GQNA 2Y7GA 1IXPA 4DF0A 4E0CA 4GE8A 3QH2A 2RKXA 4NU7A 1FQ0A 2RDWA 4RX0A 3E9AA 3MWAA 3EX6A 4ZQPA 3TW7A 1G69A 2E5DA 2VENA 4IMCA 4NXSA 2NXIA 1JRBA 3INPA 2H6RA 3B03A 3DFTA 3SY5A 3M5YA 3P7YA 1H60A 4DELA 3HB9A 1OFOA 1OK4A 1FWNA 3C2FA 1LYXA 3TMLA 5LNUA 2YXGA 3R89A 1SUXA 1R47A 1QMLA 2B7OA 3L65A 2C16A 3SGZA 3HGSA 2ZZ4A 2QCDA 4S2BA 2P0OA 1WOBA 4MJZA 2GPTA 2Z6JA 3EWYA 4GUJA 4JIQA 3W2KA 3G1XA 1R2TA 4AF0A 2ZA3A 1PCKA 3KHJA 1TO3A 4N6EA 5DCBA 2X1RA 4Q32A 1C29A 1T96A 1L6YA 1AG1O 5AC6A 1GZGA 3W76A 1LOQA 3UPWA 3M9YA 1VPXA 5CZ0A 3WK1A 5FF3A 4JTEA 3RK8A 1V7YA 2G95A 4IOTA 5D30A 4DXVA 4RCXA 1PCWA 1JR1A 1LTDA 1TPC1 1X6UA 3C56A 4IPIA 3A5FA 3GZ3A 3SFKA 1VGAA 5I3JA 1XUUA 4FNPA 4Z1BA 4OV4A 1FCUA 4N4QA 2QAFA 3W7HA 1QOPA 3SI9A 3QPYA 4Z08A 3OIXA 1W1ZA 4O28A 2H3DA 2R8WA 2V30A 2Y7EA 3W9ZA 3TROA 2WQPA 1FY6A 3DENA 3CWOX 1ZJIA 1ZAHA 3W74A 1ME7A 1Q3NA 4LNYA 4LVDA 3W7PA 2ZRUA 3IIPA 1EP2A 1DQXA 1VRDA 3BK0A 2E1DA 3FYOA 1AW1A 1V5XA 2E09A 4QISA 4S2CA 1UUMA 3I7QA 1R30A 2WO5A 1G4PA 3STEA 3RF9A 3EX1A 3CPRA 3QRHA 3SR7A 1VC4A 4AH7A 2EPHA 3G24A 5F1UA 1VR6A 1BWLA 3W1UA 3SECA 3CWNA 4FEZA 3F1QA 5FEXA 1J5TA 4UTMA 1GVRA 3W70A 2GVGA 3QW3A 3IGUA 3BGJA 5I3KA 4WXYA 4IGHA 1IXOA 3LB0A 4PC8A 5TQLA 2C6QA 4UTWC 3P82A 4GRSA 3LHTA 2FTPA 4QNWA 1M5WA 5D32A 4JTFA 4UTKA 3A24A 3G0XA 1S5TA 4OU1A 6ALDA 3W87A 3W7KA 3HPSA 3STGA 3UZ5A 5AC7A 1CI1A 4NNAA 2PCQA 4Y9AA 4ZQNA 4LRSA 2C13A 4JY8A 1I8JA 4JY9A 3GKFA 3T40A 4YCOA 1B3OA 4HPJA 5C2XA 4M5PA 5K4XA 4QJ1A 1O95A 1B4EA 2J27A 1RPXA 4PA8A 2Q3OA 2V5LA 2ZRWA 3P5YA 1W8SA 3UWVA 1OVDA 1O60A 4O0KA 3DHDA 3EX2A 3I68A 5CPMA 1EWDA 2C1HA 3PF3A 1JCXA 2CZFA 3C2OA 3QFEA 5HR6A 3LXBA 3VE7A 3S42A 1NVMA 3W23A 3G22A 1FDYA 1YPFA 1SQ7A 3PG8A 1IGSA 3N34A 3W1TA 3L5AA 4KFNA 1IXQA 4MFDA 1L6WA 2YYTA 2ZYFA 3ZS4A 2Y6ZA 3W2UA 2CLFA 4ZQCA 1ZAJA 4NVTA 3PB2A 4O4VA 2NV2A 3TNOA 5HUOA 4CCDA 3BVJA 4WX2A 3TMQA 3ZFHA 2E5BA 3OG3A 3KOFA 1W5PA 4N4PA 1YLVA 3TDFA 1LRTA 1HUVA 4G1KA 4FXSA 2RHGA 5LNRA 2H90A 3NR0A 4AHPA 5K9DA 5HMSA 2Y70A 4PL1A 1QO5A 1EP3A 1W5MA 4XKYA 3QF0A 4RLIA 1SW3A 4E2DA 3LX9A 1YTDA 3NPVA 1W54A 5FF7A 1LLWA 4WOQA 5HR7A 1PS9A 3RMJA 2YX0A 4CCEA 3S6DA 2YDAA 3O6YX 2VXNA 3P60A 1F2JA 1LZOA 3HGRA 1GVQA 3QSTA 3MP5A 3TXVA 4UFHA 5LKYA 3U8GA 2A4AA 3NQ8A 1DHPA 1BEUA 3DHFA 4JYDA 5D02A 5LSMA 2NWSA 1CW2A 4NJJA 3PC0A 5EL1A 2W0UA 4JX5A 1KM0A 4RXGA 4MVAA 3NQ2A 5IBXA 5EKYA 4LV9A 1YDVA 2TMDA 3QZEA 5EBUA 1W0MA 4O50A 3GB6A 2H3BA 4FHAA 1K8YA 3DFSA 2X1UA 3PY2A 4BK9A 4RKAA 3L5MA 4KFPA 3W7OA 3QEZA 1H1ZA 1SW7A 3S1WA 3W1LA 1S3HA 4I9AA 2ZTKA 1TIMA 2CLKA 1TV8A 5F2IA 3BARA 3RU6A 5G2HA 4JS3A 5HJLA 5K7JA 4H4IA 3DFOA 3TU9A 3W7CA 3UZJA 1I2QA 1R2SA 4K7YA 1X8FA 1OX6A 3ABRA 3MHFA 2I9EA 4CNPA 1TSIA 3Q2DA 4O19A 4JDYA 4JYFA 1Q45A 3M5ZA 5D2TA 1UBSA 4JR5A 3JRKA 2J24A 3LTSA 3NOEA 2E68A 3QMTA 5G2WA 4JYEA 4MJMA 3L5LA 3TQVA 3OVRA 2CFFA 4UFIA 5LNVA 3W1XA 1FWRA 1TQXA 2PRHA 1KFBA 1QFEA 3W7EA 1YTEA 2ZRYA 1ZCOA 4Z0SA 1ICSA 2Y88A 5CSSA 1SW0A 4UMBA 2HSAA 4POCA 1SO4A 3TAOA 1O5XA 4UMAA 4CNNA 3IIOA 5AOUA 4UXDA 4N6FA 1YYAA 3RLVA 3NQCA 5HWNA 2VEIA 3GDKA 3DI0A 3HPZA 3Q58A 5AFDA 4HNVA 5HQEA 5MHBA 2QJIA 4NJGA 4ZVJA 2RH9A 4AB4A 3I65A 1S5WA 5I3HA 3M5XA 3P5ZA 4M19A 3ZR4A 3W7DA 4RZ6A 1WXJA 2A7NA 3TJLA 5J5RA 3QQ0A 3EKZA 1C8VA 1TPVA 4MFEA 4ZQOA 4UNLA 4QIUA 3OVPA 4MY1A 1KFEA 1GYNA 5HNRA 1OJXA 3PWAA 1WOAA 2YR1A 2P10A 2C19A 1MXSA 3VFLA 4OWGA 5KTLA 1UUOA 1XBYA 1DV7A 2QCMA 3DGRA 2WPBA 3I7RA 2VKZG 2EGZA 3TIMA 5F2GA 4BR1A 4OHQA 5BRBA 3QYQA 4LS1A 3HJZA 3THAA 1Q6QA 3C4UA 5T26A 2XN0A 2J6XA 4GUGA 3L67A 1IIGA 1XL9A 3H54A 4UTTC 5L9FA 1A5CA 4JTIA 1VCFA 1WYIA 3LBCA 2DZTA 3MJYA 3NQGA 4LC8A 5BW6A 3M44A 1KM4A 1TV5A 1PL9A 4JEQA 3G1HA 5LHFA 3USBA 3W7JA 1EA0A 3C6CA 6TIMA 2ZDRA 3R2GA 1W3NA 3P80A 5KINA 4YMZA 3W1AA 3F4WA 2A5HA 1DORA 2CLMA 1I2OA 4NX5A 1KFJA 1JQVA 3NVTA 1LCOA 1OABA 4K38A 1Q6OA 3G8EA 1ME9A 3TC7A 5G1YA 1WAUA 4QSHA 1F74A 3S1UA 1AMKA 5DY2A 1AK5A 1H61A 3B8DA 3FYPA 1C9DA 3CB8A 5F2LA 3H55A 1P0KA 1X1ZA 2TPSA 1OFPA 3W3OA 4NNCA 1EUNA 5D2XA 4JTSA 3S5ZA 3EWZA 3DKLA 3CTLA 4IX0A 4Y90A 1ZNNA 2V81A 5D2WA 5DBTA 3CLMA 4X3ZA 4A3UA 4OGZA 3MHUA 1LRNA 1DJQA 5C6MA 1Z48A 4NJIA 3O07A 4DPPA 3EXSA 3RFAA 3T44A 4O0ZA 2X16A 3NL6A 2E5CA 1W5OA 3VI2A 1KBIA 5TIMA 2DZXA 3NQ7A 4JNMA 4QITA 1OFAA 1GG0A 3NAVA 5AHEA 1LP6A 3LI0A 3HG5A 3GAKA 1VYPX 2WKJA 4YWIA 4XTIA 5D38A 3B4UA 1KM2A 3SW6A 2FLIA 4WY0B 3MI6A 3W2LA 4ALDA 2Z0IA 4UTJA 1Z41A 1G4EA 5KSWA 2GUUA 4UTHA 3NO5A 3BW2A 5LNSA 2ISWA 3QM3A 4MPQA 3GXPA 3EWUA 2ZRVA 2J9XA 4JTHA 1NEYA 5DLCA 2PE4A 2WSQA 3R5EA 1GVSA 4GWEA 1K8ZA 5LGZA 3DKJA 5F1VA 2NV1A 1SFJA 4LRTA 3AJXA 1EIXA 3U2OA 5CKSA 1TRIA 5AC8A 1QWGA 5C55A 1KM5A 1R46A 3S0CA 4DBEA 3W72A 1A5SA 5D2YA 2GJNA 1MEIA 3K30A 3TQ0A 1QPRA 5LHEA 3TQKA 3MI3A 3W7RA 3H53A 3SGUA 3PM6A 1DVJA 5D33A 4X2RA 3AO0A 4O8RA 2QCGA 2DZWA 5EY5A 4FNTA 2EF9A 4N9CA 3NXFA 1ME8A 3PG9A 3TSMA 2C14A 5K2ZA 4JICA 3B04A 5HULA 1D9EA 3HG4A 2BX7A 2Q3RA 3THQA 4YCPA 4MYXA 3FA5A 4BF9A 1YDOA 3F03K 4UFMA 2E6YA 1H7PA 2B7QA 4JN6A 4H6KA 1H7RA 2C0AA 2GOUA 4O1AA 3WJSA 4A21A 5K4ZA 3PBYA 2J88A 2YW4A 4MYAA 2O7QA 1FX6A 4QNEA 1QPNA 4Q33A 1P5BA 5FF0A 5CPNA 2NXHA 1TPDA 1T8XA 2NUYA 4ADUA 4FIQA 3GKAA 5FF2A 4LVFA 4LVAA 4NX0A 3C0JA 3FIGA 4L4MA 4AWSA 2HTMA 2YFOA 1O5KA 2A2IA 1LOLA 4DPQA 3EX4A 2YSWA 1NF7A 2NX9A 2NUXA 2CW6A 3UNDA 3DH7A 3W86A 3WK0A 2I1OA 3HG2A 4PFMA 2ZTJA 3FOKA 3CIXA 3P62A 1GEQA 3UWZA 3UY8A 1MZHA 5I3GA 1RR2A 1OFBA 3HGOA 1I2RA 2VFDA 2QKFA 3W7QA 5EYWA 2HMCA 1NSJA 2DZPA 1GWJA 2E6AA 1E51A 1GVOA 1QO2A 5FEZA 5TBOA 3GYEA 3W07A 1ONRA 2R14A 4O1BA 2AAMA 3W1MA 2QCNA 3LLDA 3HF3A 4N9EA 4HNNA 2GJLA 5U4NA 3VE9A 1B9BA 4BI6A 1OYCA 2J9ZA 1KTNA 1YADA 1NFBA 3B06A 1YPIA 1SO5A 4WY0F 1H7WA 5HWJA 3STCA 1TJPA 4JTLA 1LBLA 2Y85A 3FS2A 1P1XA 4ZMGA 1JCNA 1YXDA 1Q6LA 3GR8A 2Y7DA 4OT7A 4PCFA 2YYUA 3R12A 4IUOA 3FFSA 3PS7A 4RR4A 5DN1A 1VCVA 3L21A 4FX8A 4AMAA 4LOCA 1GPWA 4TR9A 2ALDA 1ZALA 2VOMA 1XBVA 3B05A 3BLIA 4ADSA 3UQNA 1I2NA 2I14A 2R94A 1F7BA 5EA9A 2V82A 3A23A 1VQTA 1XKYA 5CZTA 1QAPA 1Q6RA 2JGYA 3TH6A 3NL3A 2VEKA 4KWWA 4A29A 3GX9A 2B0MA 2NWRA 4A22A 1SR9A 5HWMA 1LBMA 4M7SA 2VC6A 4D2JA 4TO8A 1B57A 1RQBA 3A22A 5CGQA 3G1AA 1KFKA 3IGXA 2UV8G 2ZZ1A 3ATYA 5G1TA 2CZEA 4UTWA 3TKFA 4M6PA 1KV5A 3R8RA 5DCEA 3O05A 3GDLA 3TE9A 5AHIA 1UCWA 4NQ1A 3NZRA 1H1YA 3GNDA 1KFCA 1TPUA 4IQLA 3G1DA 3W2NA 4GBUA 2JKPA 2A1YA 4GNJA 4O1CA 2NZLA 2QCDB 3IIVA 3MUXA 3BG5A 2P1FA 3N9SA 1JCYA 3MMTA 3W1QA 3GNNA 4A2SA 1CX9A 3G1SA 5D05A 5EPDA 4AF0B 3IVSA 3C3NA 1TQJA 4JTKA 3NEVA 3M41A 4N02A 2B7NA 1KLYA 4AAJA 4MKNA 5EMUA 1KM6A 3PUEA 5E1QA 1XDLA 4A2RA 1OF6A 1UB3A 1SO3A 3NL5A 4UTTA 5AYYA 3LCWA 4UC5A 4JX6A 3MO7A 2QF7A 4CCCA 4RZ5A 2V2CA 4IJBA 4BFAA 3BG9A
chains in the Genus database with same CATH superfamily
1RBOB 5BMWA 2CZDA 3CAWA 2JKAA 3QHMA 4BI5A 4C6BA 4YYCA 2WVUA 3KHDA 4UFLA 3B40A 3B0PA 4XUGA 3WIJA 4FX6M 4D1JA 2XHYA 4UR8A 3TUUA 2V5DA 1ZZMA 4ZO6A 3GVVA 3BG3A 5AHMA 4AYSA 1HO4A 1OGSA 1RVGA 2FHFA 4ZO7A 3Q45A 3U7VA 3NQ6A 1QVBA 3PJUA 1EDGA 3LZ3A 3KBVA 2TSYA 5FI8A 1MO0A 3D47A 3B9AA 1WDQA 3BLDA 5JH1A 3F5LA 3A21A 1TE1A 3WJWA 3PR2A 4CU8A 2DSWA 2DZBA 1ONWA 1VYRA 5AZ0A 3SZ8A 2OB3A 4W84A 3DAQA 3EOEA 2FPTA 2XG9A 4WDWA 4GPNA 1PIGA 1C8XA 2PTDA 1MFVA 3O1NA 2FIQA 4R33A 3AICA 1TZ9A 2O9PA 1HL2A 2XWEA 4Q8OA 3P14A 4GA8A 1LRQA 4LS0A 1WKYA 3TR2A 2RFGA 2P53A 4K1GA 3LHZA 2Q71A 4GQ0A 5TD4A 2MANA 3PB0A 1RPKA 3OHIA 2Y7FA 3F4DA 2W5FA 3FGCB 1B54A 1G7UA 1LROA 4H8VA 1EGMA 1GKRA 5CPSA 1TCDA 1YDNA 1EX1A 1KV8A 3T7VA 1Y0EA 3SUTA 3ABOA 2DY3A 4HU3A 4XZNX 2BVDA 4B2DD 1ZBKA 1JQXA 3AZRA 4CN6A 3G1RA 3CUJA 1Z44A 4MY8A 2F61A 5ABEA 3H8AA 4IMGA 1MI3A 3LCXA 4IF2A 5F4WA 2WMJA 5FEPA 2DSUA 3WUBA 1DWIM 3P2VA 1CENA 3QMRA 5CPQA 1TTPA 1BG9A 3GH7A 2QCFA 2V6AA 3LHVA 4UOZA 1J9YA 3ZWTA 3B0UX 1DWGM 4WZHA 3YPIA 2IKHA 2J79A 4ZO8A 2QAPA 2DSKA 3KBJA 2NQHA 4MADA 4Q4PA 3SIZA 4DZHA 3COTA 1XBZA 1L8NA 2QUNA 4R7JA 1D3CA 3D3FA 4WY0A 4G2DA 4J35A 3WLOA 1VEMA 2PP3A 4JQAA 4XG1A 3NSXA 3LRKA 3HFTA 1ZUAX 3RJXA 2BMBA 1JZ4A 1CXHA 5DANA 4I7UA 1CGVA 5G5IA 4ATWA 3FK4A 1U1JA 2FTWA 3WMLA 4WJ8A 2VOTA 5LIWX 4EOUA 3E2QA 3C8FA 3EB2A 1WA3A 4KKXA 2CWXA 3P81A 3LLXA 4TQTA 3BOLA 3R8GA 4ZFCA 5A8NA 3O16A 1EJVC 1DQWA 2X30A 2PTWA 5CZJA 4HKPA 3WUEA 1K7XA 5FF4A 4YYFA 2DPEA 3GC5A 4C6JA 4LANA 2LLEA 4ORIA 4DUVA 4DO5A 1C9WA 3RXZA 4MUZA 1YXYA 2OG9A 4P7NA 1W3IA 3CEUA 1MNZA 1QWKA 3UZZA 3KVKA 5A8PA 2Z1KA 1XIJA 1FWTA 2YBUA 3L68A 3DFPA 3WLSA 3PFMA 2X2GA 3BGGA 1XRVA 2V69A 4UMCA 1OY0A 3ZR6A 5C2GA 3U2EA 2PD5A 1FBAA 5CGTA 1TR9A 3SY8A 4AZ6A 5E9AA 4JEJA 5IFTA 1R0MA 1IXNA 1FRBA 3NQMA 4EACA 5GJNA 1UR9A 5I06A 5DO8A 3DN5A 3S1XA 4LUJA 1EC7A 3SFWA 1ITUA 2W6RA 5BOOA 4HK5A 4TUFA 3CH9A 1EKOA 3MBFA 3MWCA 5E0KA 2X2YA 3RNDA 1XP3A 3QOKA 2HNHA 2O92A 3SCVA 1GTHA 2F2HA 1RCQA 3NUKA 4KWUA 4Y9OA 3D6NA 2VJXA 3N2BA 3K4DA 4X9YA 2OSYA 2GFTA 3BMXA 1NJJA 1C92A 1TCMA 1JCTA 4GY0A 4FR6A 4TIMA 4ZO9A 3GYCA 5C7VA 2OGYA 1E1CB 4C7DA 3PNZA 2PC8A 2VZSA 1V0NA 3GH4A 3NJ3A 4P7LA 3KVLA 2HJPA 4QROA 4LX4A 2P3EA 1QBBA 3CK5A 3L4VA 3PBVA 3ZZ1A 3LCLA 1L6FA 4XZ9A 1IT0A 4UCGA 2X42A 2ZA1A 3QY8A 1K02A 3SY1A 5FJOA 5HNTA 4ADTA 3HBLA 1EB3A 4D72A 2CHOA 4IJCA 1VFSA 3V1PA 4LTSA 3KBWA 3EDFA 3UNTA 1OB0A 3XINA 2I17A 4IXHA 4DWSB 1SMDA 4HTYA 3IJ8A 1VEOA 3IJ9A 3U7BA 3N2MA 3G0SA 1AQHA 3WG6A 3T42A 2ATSA 1KTBA 2PURA 1E4LA 4UQCA 1HTIA 3L4UA 2HK1A 5I0DA 4AY8A 4PMOA 1XYZA 4GFSA 2WK2A 1ICPA 5DELA 5G2IA 2VNCA 4WSJA 1EZ2A 3RJYA 4GZEA 1J4EA 3NSNA 3EB3A 3LCIA 3BGAA 4GOAA 4HIBA 1B0IA 1K9TA 4X0VA 1W1B1 3QC3A 3TYBA 5HA7A 4PE8A 2EPLX 1B3XA 1GNXA 5EMMA 3S9IA 3EKGA 1SFSA 2G4JA 3GK0A 3OBKA 1IT7A 3QBUA 3MUIA 2ZOXA 3GS6A 1Z42A 5FSEC 1OSEA 4Z42C 3GXDA 4QE4A 2GQAA 4NT0A 1AQMA 2A0NA 3HG3A 2WC4A 1E0TA 1RD6A 3URBA 1NH6A 4JBRA 3EXTA 4S3EA 3U2ZA 1UW9A 4FA3A 1GOQA 1JCLA 2XH7A 2WNQA 2V5CA 2AQVA 3TTSA 4AD2A 3OGSA 2R1NA 1ALDA 3NG3A 4Y9PA 4GINA 2NVCA 3LGEA 2PU0A 3MC5A 2PDFA 4ZB0A 4RXFA 2IW0A 4PMVA 4YL2A 3CXOA 4Q7BA 3DI1A 5A95A 3UXAA 1XH1A 1DXFA 3LCHA 1PUDA 2WWDA 3SADA 3SIMA 1M41A 1AZ2A 1EJUC 2PC4A 3UWQA 4S38A 3UWEA 2QGYA 4LYKA 4Q8VA 1OFDA 3GQYA 3KL0A 4A3RA 5F4SA 3BW3A 4LH8A 2XTKA 1IZKA 5REQA 1IWAA 1I45A 2VD8A 3FDKA 4XB3A 8XIAA 4O1DA 2VURA 1CT5A 2OZ0A 3AMGA 5REQB 2GUYA 3RM8A 5DXXA 5CC6A 3QQ1A 1XD0A 4AXNA 4PUMA 1PDZA 1DOSA 3ES8A 4TVDA 3TYAA 1GQIA 1UH3A 1OFRA 3CGTA 4NRRA 4ZZ9A 2Z7KA 3PPHA 7ODCA 2VWSA 2YZRA 3PJTA 1QNRA 1UQYA 3W02A 1W8GA 3F4NA 1N2VA 1GZJA 4Q8WA 1EP1A 3Q37A 4ENLA 3GDMA 4UNIA 4O11A 4DJED 4FNRA 4Y96A 1EQCA 3IGSA 4K37A 3BPWA 4RL3A 1BYDA 3TFCA 4V28A 3SCRA 1QDSA 3JS3A 5LIYX 4GQGA 4IFOA 3W88A 2G37A 2FMOA 3IIZA 4E3VA 3BLFA 1MNSA 3KZSA 2PGEA 3RU8X 4CEXC 2ZZ3A 1U5VA 1W31A 5H2ZA 2EG7A 3ITXA 3B9NA 4ZQMA 5KZEA 5EGRA 2FPVA 4LWWA 2PBOA 4MDOA 3A3WA 4S3AA 1EUAA 3GDTA 4O52A 4HSHA 3N6QA 1E9LA 4PBEA 2Y5SA 1VB9A 5IM51 3ELFA 4L1XA 1J96A 1BKSA 1E6SM 1GJUA 1HX0A 1AL7A 4GJ1A 1ZRQA 1EPVA 3WD2A 3BICA 4S3GA 1KD0A 4ML9A 3GTNA 1IQ8A 4PTMA 4B92A 3BAYA 4JGDA 4C6DA 3NDOA 1V02E 1EBGA 5HANA 2VT0A 4RPPA 4OQVA 3PSWA 2EO7A 1KA9F 4Q6JA 3L12A 4JZ5A 2DW7A 3UETA 5B7ZA 1JCJA 4FNQA 3V1HA 2OKTA 3OPSA 3UVAA 3WLIA 4KESA 3NZ1A 5HMDA 3LS9A 3WQEA 2ZWYA 1KWKA 4EF8A 3PUDA 3L23A 3MBDA 3DFYA 4TMCA 2GSJA 3WDQA 3CV1A 1W17A 4FP1A 1O94A 2TYSA 1EJXC 2OT1A 3WN6A 2GZXA 2D1ZA 2Y61A 1LOSA 4Z2GA 4BJHA 1JPDX 4XBSA 2C15A 1DIOA 1HG3A 8CGTA 4J3SA 1H62A 3FHQA 1MDRA 2PPGA 3P67A 1PX8A 2AKZA 3PBWA 1H41A 4ZODA 4K68A 4FXRA 3ARPA 4CNTA 3H7VA 2PF0A 1E70M 1OF8A 3IAPA 1J0IA 3OW1A 3W2MA 3QSRA 1KWGA 3VD4A 4DB7A 1M6JA 1DWFM 3NCOA 2HEJA 2CLOA 1TIWA 1EXBA 3HQ1A 2HS6A 1HL9A 5I3IA 2XVGA 4G9PA 2QV4A 3LM7A 4YIWA 3LPPA 1YHTA 3FEQA 3KCLA 1ZY9A 4Q8NA 1YQ2A 3PJWA 2Z1XA 3I6EA 4H8UA 1TV7A 1O7AA 3KVMA 2DZSA 5KMYA 4QJ3B 4OE7A 1JI1A 1V0MA 3PZNA 4W7VA 3PZVA 2ZX9A 3WDPP 2EHHA 3BSHA 4GYFA 4IX2A 3SQSA 4GC4A 3SUSA 2Q8LA 2A7PA 1WBHA 3TJIA 3XIMA 2Y63A 1O4UA 2QVNA 1H50A 2QR6A 1GOIA 4H2HA 3OVQA 1POJA 2QJHA 2IXVA 3NURA 1EO5A 2F9RA 2QGHA 2F38A 1CDGA 3LCFA 2PD9A 3N2OA 4XBKA 1A50A 4RNFA 3OQ8A 4O1FA 3KAOA 1WXZA 1Z3NA 3V18A 3WQ5A 2J8TA 1JPHA 2NVAA 1FWWA 1PBGA 4K8EA 4IIDA 1IHIA 4Q4MA 4XD6A 4DF2A 3CC1A 4B4HA 4WJEA 1AW2A 2BVTA 4UTUA 4JTGA 4QE5A 1H7NA 1AJ2A 3QR1A 1G1YA 2XIQA 3JR2A 5CG7A 1TVPA 1RZMA 4NP7A 3W2JA 2VFGA 3SCNA 4FB7A 4JIRA 1JFXA 1DL3A 1RLDA 4E0CA 3VU2A 2J74A 4X63A 2QT3A 4RX0A 3AMCA 3MWAA 4XIMA 1LQAA 2VENA 2JF6A 4UOQA 3INPA 3LYEA 1UWSA 3P7YA 1XLLA 4DELA 4D8AA 3VTRA 4QLKA 4MNKA 4Z1YA 1OK4A 3UR7A 3GG1A 1FWNA 3C2FA 1SMAA 2WJFA 3R89A 3P0WA 1R47A 3MSDA 3L65A 3K4AA 2X0YA 4P8VA 3SGZA 4S2BA 4LAOA 4ROPA 4LFYA 2NQLA 2O4MA 4MJZA 4GUJA 3EWYA 4HCDA 4JIQA 4LBRA 3W2KA 1CZ1A 3HURA 3WD0A 4IGNA 4N6EA 5DCBA 1T96A 3W76A 2GOKA 5A1AA 1LOQA 3UPWA 2G3JA 1VPXA 2DSZA 5CZ0A 4WVXA 1PWMA 4JTEA 4REQB 3RK8A 4Z2LA 3AS2A 1AH3A 4IOTA 2CEQA 4RCXA 2YA1A 1W9XA 1PCWA 1TVNA 2OXNA 1WZKA 1V4YA 4HYVA 3EWCA 1NQ6A 1JPKA 2YOCA 2FYMA 1XUUA 6REQA 4M51A 4ACZB 1FCUA 1FH8A 3PZMA 3W7HA 3SI9A 1JAKA 3RAOA 1WB0A 2Y7EA 1M7XA 3CWOX 2Z2BA 1ZAHA 1EJRC 1Y8BA 4J2PA 4B5SA 4LNYA 4XD5A 2WMHA 2PWGA 3W7PA 3MVIA 3A64A 3OYXA 1Q8AA 2G3MA 4L6DA 1V5XA 4QISA 2OEJA 1BPLB 2DUXA 1LT8A 3I7QA 1XCWA 1G4PA 2WB5A 4HN8A 3EX1A 3QRHA 4C1NA 3QZ6A 4MWAA 4AH7A 2QNEA 3WLPA 3E1F1 3VAVA 3N6JA 1BWLA 1TWIA 2J6VA 1GKPA 3ALGA 1GVRA 2GVGA 4MJ2A 4QG8A 3BGJA 5I3KA 3O9NA 4KMQA 5T9CE 3FNDA 3WQ6A 4DVOA 1CGTA 2CXGA 5TQLA 2YBTA 4MNMA 1MQQA 3B0XA 4JTFA 1X6NA 4C6KA 4XK2A 4U5IA 5JU6A 2PGWA 4KIRA 3HPSA 3UZ5A 3VNIA 5AC7A 4M80A 2PCQA 3BH4A 4ZQNA 2J7HA 3ERPA 3CZEA 3G2GA 4EK7A 2DV0A 1B3OA 4HPJA 3WQPA 5C2XA 2L5HA 4NF7A 4KBXA 5K4XA 4QJ1A 1JYVA 3AQUA 5AC4A 1B4EA 4DI9A 3H70A 5EFFA 2BOFX 4JOMA 2J27A 2QDEA 1RPXA 3C0LA 4ZOAA 4PA8A 2Q3OA 2WHMA 4XZLX 1W8SA 1W3JA 1OVDA 3DHDA 3I68A 5DX7A 2C1HA 3IJ7A 1HL8A 4G7FA 4J40A 3S42A 2QQ6A 3LPGA 3W23A 3V5FA 3RYSA 1P6BA 1SQ7A 3N34A 4QFUA 3AIQA 4NAFA 5A6TC 4ZQCA 4L9ZA 2D24A 1EGVA 1TV3A 3LZ5A 2BDQA 4H00A 1O5RA 4DNHA 2YCKX 1CGUA 4FXSA 3U2CA 3SQMA 4KEMA 3BV7A 7REQA 2ACSA 3NYDA 4PL1A 1T41A 2REQB 5M3WA 2ZVRA 4IIGA 1E9YB 5FF7A 3ENLA 3OZPA 1LLWA 4F4RA 4ACYA 5BWFA 1UOZA 1RBAA 2PEVA 2H9AB 3M0YA 3ARUA 1DQUA 2VXNA 3GIQA 4NHVA 4B16A 5ENLA 3M0XA 3CUFA 1GVQA 3PZOA 4H9YA 4MNJA 3TXVA 3EOUA 4UFHA 5GJPA 1HJXA 3AXXA 1LG2A 4CQCA 2XUCA 1OGBA 3PC0A 3BAIA 4JX5A 5IBXA 2BHYA 1MW0A 5C70A 2YXXA 4DLMA 5EBUA 2OTDA 5TF0A 4IIHA 1HXJA 1VBJA 5EB8A 1X1NA 3DOPA 4BK9A 1UR2A 4RKAA 3THCA 1SW7A 1OCQA 3VFCA 1VF8A 1IEVA 3RU6A 1XLGA 3I4EA 3DYMA 3STPA 4B15A 1UMLA 4HP5A 8XIMA 4GYPA 3TU9A 3W7CA 3UZJA 1R2SA 1WAWA 3MHFA 4D6CA 1ZS2A 4H6EA 1UBSA 3CUHA 2E68A 3TQVA 4UFIA 1FWRA 3UXIA 3ZM8A 4E4UA 4KERA 4CU7A 1JF5A 2YDQA 3WO8A 1XYCA 4DJEC 2ZRYA 1RJRA 1W3HA 3MQTA 1SW0A 4UMBA 3R43A 2E8ZA 1SO4A 1WKFA 1VD6A 3OYZA 6ENLA 4CNNA 5AOUA 1S1PA 2INZA 5T8GA 4UXDA 2V3DA 4CD4A 5HWNA 3MA8A 2D2JA 4NAEB 3HPZA 4JFSA 2PI6A 4YTTA 4NJGA 4ZVJA 1E4NA 3CV6A 4M19A 3ZR4A 4PCTA 3TJLA 4C91A 3EKZA 1WXYA 3PWAA 2YR1A 1H2JA 2C19A 3DGBA 1WDPA 5KTLA 3W29A 4HGXA 1JXJA 3DGRA 2QCMA 3I7RA 4AQLA 1JZ7A 1UKTA 4I8YA 2EGZA 3SN4A 1GPFA 1Q6GA 5F2GA 5BXPA 4MM1A 4OHQA 3WQOA 3KL5A 4IGMA 4JKKA 2I5GA 4D6GA 3EDKA 2J6XA 3UU0A 4OZOA 3L67A 3CMGA 1XL9A 3ZIZA 1VCFA 3E2RA 1TUXA 1UYQA 1NY1A 2IQ0A 1FH9A 5BW6A 4YNGA 1TV5A 1PL9A 5LHFA 5A8MA 1XICA 3C6CA 4F0RA 1FWEC 5KINA 2QPSA 4WJXA 1J10A 3BURA 3GC4A 1DORA 2CLMA 3DHUA 4NX5A 3WLRA 1UKQA 1OABA 3UG8A 3G8EA 1UG6A 4ZCWA 1JF6A 5DY2A 1H61A 3FYPA 4MKSA 5F2LA 1N8IA 1W1PA 5FD0A 3KBMA 3WD1A 1OFPA 4NNCA 3RLHA 1EUNA 1V6WA 1KBLA 1OT1A 4AD1A 5JIPA 4Y90A 1KR0A 4QR6A 2D23A 2XFYA 4AG0A 5C6MA 3TYCA 2QIWA 1SYTA 2ZUUA 1Z48A 3MKCA 1TZ7A 3HV9A 3H2OA 4DPPA 5HATA 1YW1A 4O0ZA 3UG5A 4TTGA 2V67A 2X16A 3NL6A 1GVIA 2X40A 1EIBA 1W5OA 3RN6A 1KBIA 4HA0A 4QSFA 2DZXA 4J3ZA 1GG0A 4CEUC 3NAVA 5AHEA 2ZUTA 4R7WA 3LI0A 2I7GA 1Q65A 4HTBA 4NI8A 2E9BA 4XTIA 4JKMA 2V3EA 1KM2A 4GXWA 4BF5A 1OD0A 1VPQA 4YWSA 4UTHA 3O0KA 1RA0A 3BW2A 3ZLHA 5LNSA 2ISWA 4H7CA 3E74A 3GXPA 4R27A 4V1YA 2C1IA 1S2VA 4YS1A 4JTHA 4DY1A 1A47A 2WSQA 3BOXA 3GVQA 3GSMA 4LRTA 3U2OA 1CTNA 2WYSA 1TRIA 4FSAA 4QXIA 5C55A 1KM5A 5HK4A 3S0CA 4R5EA 1P6WA 2YZ5A 4DBEA 3W72A 1A5SA 4FLOA 2OQYA 1EA9C 4W93A 3U4AA 3K30A 3N15A 4PULA 2WWCA 1XIDA 3W7RA 1S2CA 3VIMA 3SCSA 1OEPA 2A3BA 2QCGA 4PUEA 5EY5A 2EF9A 1VPYA 2Z24A 1LL6A 1ME8A 3VNMA 2FZMA 1OM0A 1JDAA 3TSMA 1QU4A 1IEXA 2C14A 2Q8XA 3II1A 5K2ZA 3S9ZA 5C0QA 1D9EA 5TAOA 2FFIA 3CLWA 3VZXA 1FH7A 1YDOA 4LAUA 2WLZA 4DRSA 1CBGA 3IPWA 2YLLA 4J28A 4JN6A 4HD5A 4GI4A 5A6SA 2GOUA 3WJSA 2GGHA 1W9DM 3OOQA 4QNEA 3XISA 1QPNA 4Q33A 1HJVA 5CPNA 3BJSA 1BSIA 6A3HA 4ADUA 3H2NA 1EEXA 1NU5A 5CZKA 1XGEA 4PTWA 3K1GA 4LVFA 4RE2A 1ZBWA 1GZ1A 4LVAA 4AWSA 3A9BA 1REQA 1JZ6A 4AC1X 1GCYA 2YKKA 4QDMA 1M7JA 5BYWA 3RX4A 2NUXA 1HW6A 3BJTA 1Z6KA 3HG2A 5AVHA 5AZ1A 2VWTA 3UY8A 1WPCA 1V3HA 4AZIA 3UCCA 2QMKA 5EYWA 1NSJA 4PMDA 4NAFB 2ZE3A 1WZMA 1R3VA 4JPGA 3TA9A 2QCNA 1JDEA 1QI4A 3LLDA 2VMFA 5U4NA 2GJLA 2DVXA 4BEQA 2VGIA 2PDJA 2J9ZA 3EDJA 4CU6A 3BMVA 1NFBA 1SO5A 1JDFA 4W8LA 3GU1A 1LBLA 4FPSA 3JVAA 1P1XA 2VO5A 2I5QA 1JCNA 1ZU8A 2FVLA 3PPGA 1F3EA 2YYUA 3PS7A 4QLLA 4QS6A 1VCVA 4FX8A 3VGDA 2ZVIA 4AMAA 4FI4A 1XD1A 4GXPA 3VO0A 2YCJA 2VOMA 1XBVA 2EBNA 3UQNA 1RY0A 4J5NA 1US0A 4EPBC 1ECEA 3WMCA 1XKYA 4Q4SA 5JBDA 5HNNA 3GVWA 2NWRA 3QN3A 4M7SA 3VOCA 4D2JA 1RQBA 3G1AA 3WDHA 3SUVA 3GG8A 4GHRA 3OBAA 2CZEA 3W38A 5DMMA 1ZTVA 3R8RA 3O05A 3V5CA 2PDLA 3I6TA 3SGGA 3S2NA 5AHIA 3MJMA 1PIFA 4KQNA 3TVAA 1XLKA 4TTUA 2DH2A 1KFCA 3G1DA 4ECLA 3W2NA 4GBUA 4IL2A 3MUXA 3BG5A 1P48A 1HP4A 3VGEA 2XVPA 3MUY1 2D3NA 3N9SA 1JCYA 4HU0A 3GNNA 2UY3A 3IVSA 3IUIA 1IR2A 3WNOA 3C3NA 4YVPA 3K2GA 3EYPA 2G50A 3AJ7A 1KM6A 1ADSA 1OCJA 4D8ZA 4A2RA 2YCLB 4EX4A 1UB3A 4BQ4A 3OB8A 2HPMA 3VMNA 1YE4A 3E3HA 4H83A 4RE4A 4RZ5A 2V2CA 4IJBA 5MF5A 1ZB5A 3QW4B 5CZSA 2CLHA 2YXOA 2G41A 1VS1A 1W56A 1F73A 2WVVA 4FLQA 3VYLA 3ZVIA 1XQKA 3WNNA 4GUIA 3EMCA 3TCEA 1W5NA 1CXLA 2VEGA 3CIVA 2E6DA 3MCMA 3OJGA 4OV9A 3S5SA 1LUCB 1N7KA 1T99A 4I8DA 3MYPA 1S5VA 1JFHA 1KTCA 1LUCA 5HBFA 2DQWA 1DJHA 3W7LA 2C71A 2CETA 4YJ5A 5CBBA 3N3MA 4YU1A 2V0TA 1QBAA 1UJPA 3EX3A 5FL0A 4M56A 4D71A 1H7XA 1J0ZA 2XM2A 2UY2A 3AYTA 1R3SA 2BY0A 3TSBA 4W4QA 2AL2B 3Q65A 1SPQA 4LALA 1S5MA 1TG7A 3W25A 4ZQRA 4PODA 4BQ3A 1JCMP 1SJCA 5CEWA 2GVLA 5DMLA 4GC3A 4W5ZA 4GX9A 1OINA 2J7BA 2GGEA 2VEMA 1L6SA 3D0CA 3VM5A 3VNDA 4AIOA 4AU0A 4ICNA 2JKEA 2W92A 3CS2A 3NGFA 1T0OA 4Z1AA 4KF1A 4O12A 3ZT6A 3GHRA 3UWYA 1A0EA 4ZTXA 2PF8A 4BEUA 5LXXA 4YTQA 2C3ZA 2Z4GA 4AISA 2NX3A 3LHWA 1HN1A 1XXXA 4J7RA 3B8UA 4YPJA 1ITXA 1TPFA 6CGTA 1OIFA 3PSVA 4JNYA 4KEVA 3G0UA 3FYYA 2QUTA 1GOOA 4PUNA 3S1VA 3KDOA 1HKVA 1OT2A 4PBFA 2QDDA 3IVTA 2Z1BA 5FA5A 2BS9A 4GI8A 2XGZA 3MMUA 2PWDA 2NLIA 4OOUA 1IE7C 3G18A 3TCSA 5A6JA 4HSNA 3W7MA 5BRPA 2ON3A 3NM3A 3BSMA 1QI2A 5BU9A 4F48A 2WZMA 4DN1A 1GUVA 5C9RA 3QYSA 4HHHA 4D9PA 3MS8A 4DWSA 3W83A 2OELA 2PDXA 3V75A 1A53A 3CAVA 1ICQA 3M64A 4EWJA 2E25A 2ZC1A 1EJ7L 1G0CA 1A5BA 4JTTA 3CEPA 1EJWC 5FEWA 1XI3A 1B5TA 2A6NA 3ZVHB 1F5ZA 4W85A 3WQWA 2GK1A 1PE1A 1HO1A 3N29A 3RILA 4DXXA 5CGMA 4CNSA 1YKWA 4O17A 1FKWA 2IPFA 2CHRA 3G3DA 5IDZA 4EPKA 4DUOA 1F8IA 4O13A 5KZMA 1XM3A 1KB3A 1SZGA 3CAQA 3T08A 1FXQA 3N4AA 4LUTA 3ZR5A 4NIRA 1KBJA 2V2HA 2FKPA 4YTRA 1TWWA 4N9BA 3GHTA 3VD7A 2XISA 4LUTB 2YDSA 1F05A 4IL0A 3TXZA 2H8ZA 4AFYA 1IEIA 1X97A 3ARXA 2DORA 4HA3A 1LORA 1FWFC 1RQHA 3LRLA 1H7OA 2PDCA 4K8GA 4C60A 3C0SA 1SJAA 2YLAA 2INFA 1VFUA 5KITA 1Q6CA 1W3KA 3KOYA 5IBXC 4BA0A 1Q8JA 3M1ZA 4JL2A 2E40A 2JEQA 4Q4RA 4RZ4A 2R1MA 1GOWA 1IYXA 1VZWA 2DU2A 1TMHA 2BFGA 4AIUA 2UWFA 3VMOA 3L2IA 5AHLA 4JXCA 3U5UA 3W6YA 4H04A 1O12A 5HAOA 3SSJA 3VZYA 3TNBA 2MUCA 1M7OA 5E70A 4M6VA 4WEVX 4BF7A 1FWSA 3GHUA 2ZA2A 3RCYA 1IF2A 2FPYA 1I6NA 4J3XA 2Y89A 4ZL1A 4W9TA 2ANUA 4U31A 2HXTA 2E1WA 1J2WA 2BGSA 4NZ4A 5CBJA 1NIUA 5BNKA 4N0RA 1P4CA 3ARSA 1GQJA 4ERIA 3GFXA 3W7IA 5AN7A 1AUSL 1NWSA 3DERA 1F61A 2V3GA 5ABHA 1FWIC 3I7SA 3A12A 2Z7GA 3ORWA 4WRHA 4LBUA 4P7OA 3LCGA 4TVUA 1M9HA 3U0HA 4M8UA 3ITGA 5CBIA 3W71A 3VOJA 2PP1A 4L80A 3I3DA 3FX4A 3W7NA 5LGXA 3HO8A 4CQBA 2PDUA 4L61A 3WH6A 2VCBA 1WZLA 2XIMA 3CL8A 1XFBA 3ARVA 3QKZA 5M17A 1AMYA 4NYYA 5E0CA 2PS2A 3RR4A 3GFYA 1Q4WA 4XKYB 1CECA 3TWBA 1Y7VA 1GW1A 4L1WA 2WPGA 1FDZA 3LA4A 4HZMA 3HJEA 2WJDA 5SWUA 4MTVA 3TQPA 2UY5A 3QPZA 1RVKA 3E2VA 3UY7A 4BKNA 5D37A 1J0JA 1V0KA 1RV8A 1XIEA 5AVNA 3E49A 5CPLA 4L56A 4HJWA 2BOGX 1JPMA 3IANA 3K13A 4BY3A 3CASA 5I3DA 2CLLA 4UFJA 2A85A 3F4CA 2J77A 1AD4A 4LY8A 1J5SA 3A5VA 1EHNA 2QUMA 2WCAA 3G5EA 3VNZA 1DJYA 3S6OA 4QG9A 8A3HA 3TC6A 3NPXA 3N73A 3TLQA 1JUBA 1L8PA 2F8QA 3EXRA 1VFMA 3VDBA 3B0VC 4PL2A 5F4XA 4E8GA 3V4BA 3QV7A 5DCDA 1B3VA 1XLAA 4E38A 3CZKA 2BODX 4DAIA 1EPXA 2DJXA 5AY7A 2NX1A 4NZJA 1TX2A 4PMUA 5I02A 4XZHA 5DBUA 5D8WA 3PZTA 2XGIA 1OYAA 2JALA 1EC9A 2ZADA 1K4HA 1UHVA 4U5KA 1Q7MA 2VFHA 3TJXA 6PTDA 1M1BA 4AHQA 5JQ9A 4JFTA 1UD8A 3EWWA 4AZHA 3P61A 1OX4B 2YL6A 1WDWA 2GJXA 2XIJA 4R85A 1RH9A 5B80A 2O55A 3WEMA 2WNNA 1BVWA 4H9XA 3CQJA 1DTNA 4JTJA 5A6BA 1E0UA 1OADA 3QY6A 2QW5A 5TNVA 5A8OA 2C18A 3GM8A 3LENA 3AI0A 3CJPA 3MUZ1 4GCXA 5A5WA 1TYGA 3GXTA 1WV2A 3H23A 3R6IA 3ITOA 1CCWB 1E55A 4O57A 1EH9A 5HPOA 3WQFA 4HPXA 3MY9A 1ZL1A 4S3JA 1UKPA 1UR3M 3HIJA 4XWUA 3B8TA 1V02A 2J4GA 3SRKA 4D6FA 3RDKA 2PRLA 2JK2A 3DFNA 4BWLA 3SUWA 3G77A 3R7MA 1CLXA 1GJWA 4RNJA 3MW7A 5CSRA 3L66A 3AHXA 3N6HA 3AMLA 2VFIA 5M5DA 3AXIA 4RE0A 1K7FA 1VCGA 2FFCA 3GWQA 3HFYA 4UQ9A 4DZAA 4MB4A 5BMXA 3HMCA 3OIHA 4JIEA 1FCBA 3WJZA 4DQWA 1V6TA 2R82A 3T55A 3GUWA 4GXMA 2X09A 4XTDA 1NP0A 5K9XA 2WNWA 4AUBA 5A2CA 2V3FA 2XFFA 1XH0A 1PO9A 4N7QA 3GLCA 2OX1A 3ATZA 4L65A 2BBFA 1OHLA 4GIEA 4ATLA 2G5WA 1AJ0A 4N42A 1SO6A 4E8CA 1DYSA 4Z1DA 2WBGA 3B97A 3WK2A 4S3CA 3SRDA 2XN2A 3GTHA 3S5YA 4IMFA 2XGBA 2WNZA 3BLEA 5T91A 2GWNA 3SBFA 3SRFA 1J8VA 3ITVA 4EPEC 4IIFA 4P5UA 4E2BA 3EPNA 1U33A 2ESCA 1FHDA 4UTLA 1I9CB 3S46A 1IWBA 4HHMA 4CKQA 1R6WA 4U3AA 2AL1A 4K36A 3FJLA 1JVNA 4M3PA 4CQ8A 1K3UA 1UIPA 2BY3A 1EEPA 2FB2A 1UZHA 3E12A 1DJNA 1KLZA 3VIKA 4YTSA 2CLIA 2DZAA 2WM0A 3N2XA 1H1NA 1ZENA 1PHQA 4AXKA 1VFFA 3W85A 1NDYA 4PSPA 4RZBA 5M1TA 4IJRA 5HNUA 3TOYA 1KM3A 4MIMA 3WBWA 3CL7A 3N4FA 2XFWA 3GFZA 3MUAA 3TP4A 3GNPA 4I7WA 1XIGA 1ZJBA 1U1UA 2OLSA 2Z6IA 3T0CA 3KOWA 2ZZ6A 2YCEA 1UA3A 1JUKA 2ZXBA 4PRRA 4INFA 2V68A 1QNQA 2PP0A 1V79A 2UY4A 3THDA 3QR0A 4GI6A 1ZPTA 3CZLA 3LLFA 3SB0A 4K6AA 5LIXX 3ARZA 1XFCA 2ABAA 3S8HA 4GUFA 1DKWA 3P0XA 4XZWA 1JZ5A 2RGMA 2YA0A 1NFGA 2ACQA 4U3CA 3C61A 3WBYA 3NA8A 4TV6A 8TIMA 3UYCA 3NQAA 5A6AA 1UD4A 1M65A 2VD9A 4PMXA 1FDJA 2CZVA 3LHYA 4O53A 4H41A 1F4HA 1TJRA 5D9PA 3V0TA 5ABFA 1VP5A 6REQB 2QV5A 1Z32X 1C91A 3GG7A 2FQIA 4L1GA 4U4MA 4V15A 1UBPC 2ABBA 4ILSA 2W61A 3LMZA 4QAIA 3GDBA 2B31A 3AWOA 4LVGA 2QIIA 1V3LA 4GIAA 4PMQA 3VKKA 3KBSA 2IQTA 1FUYA 3RIKA 1C8QA 3C2VA 4RV8A 2V63A 3QGVA 1OC5A 3NNTA 4FAMA 4O54A 3H26A 1A5MC 3SCUA 2BY2A 1OC7A 1OK6A 3VIHA 4E8DA 3E02A 4C5YA 3VDCA 4BWLC 1BGAA 2KX9A 2Y2WA 2OYMA 3CO8A 2FZ8A 3KTXA 3QXBA 3CM4A 3BAJA 2YL8A 3G1YA 4LB3A 3GAYA 4IMAA 3W1NA 1BG4A 3ABQA 2GQ8A 3G8RA 5A8GA 2DIKA 3KCJA 4IICA 1QK0A 5CXPA 1G4SA 2NLYA 1AODA 2R1KA 1XIFA 3URNA 3NYZA 3TW6A 3NQEA 2HE8A 3W4RA 1LL4A 3CZJA 3IRSA 4C90A 2R91A 3KVJA 3IV3A 1UR0A 1HJUA 2BY1A 4MY9A 4RK8A 3HQNA 1UC5A 3FAXA 4DO6A 1US3A 2ZBTA 3KEHA 3WH7A 3KXQA 3R4IA 3M07A 1XLEA 3STFA 1Q2SA 5AHFA 1GQNA 4DF0A 4AY7A 1D7KA 4GE8A 3QH2A 2WZTA 1OQFA 4NU7A 1PWLA 4W86A 2RDWA 2RUSA 3E9AA 5C8BB 5G4HC 4XVDA 1G69A 4IMCA 2XPKA 4NXSA 1NWRA 3NFUA 1JRBA 2H6RA 2QVHA 3VX1A 3NQBA 3SY5A 1MXDA 4G7EA 3LNMA 2E0PA 1H60A 4PCNA 1WUEA 5HQMA 2WHLA 3OLEA 1OFOA 2QZRA 4YVVA 4EAMA 5KETA 4C65A 5LNUA 2WBKA 2QHAA 4AD0A 1QMLA 2B7OA 2YL9A 3HGSA 1X96A 3CZGA 2QCDA 5FOOA 3R79A 3VNLA 5D9MA 4AF0A 1PCKA 2X1RA 4A8IA 5I5RA 2GVEA 5AC6A 3FXGA 3M9YA 3KLKA 4OKDA 2XINA 3HQPA 2D0GA 3WK1A 5FF3A 4J3TA 1ZJAA 2VUYA 5IHSA 1JR1A 3ARRA 5A69A 1AH0A 4IPIA 4JKLA 3I4KA 3SFKA 5EMJA 4KRZA 4TOQA 4XX6A 1UH2A 4GYKA 1RALA 3UGVA 5H8UA 3QPYA 3B9OA 4Z08A 5CSUA 1R86A 2X05A 2R8WA 2V30A 4TX6A 2WQPA 1ZJIA 1HNYA 2Z27A 3C5QA 3PUGA 3WNMA 4UQBA 4URIA 1Q3NA 4LVDA 4ZBCA 1PB0A 3IIPA 2O9OA 2YDRA 1DQXA 3BAXA 1VRDA 3ZLGA 2E1DA 4C6PA 1SVDA 1XLDA 5BU6A 4Z17A 4S2CA 3FA3A 3WX7A 3STEA 1XISA 1VC4A 4PB5A 1VR6A 1BHGA 2O0TA 1TWZA 4FEZA 4PR4A 1JYWA 4UTMA 3CUGA 3CMFA 2HXUA 3M0MA 3R94A 4WXYA 3ITCA 3LB0A 4PC8A 1FFQA 7PTDA 4UTWC 3P82A 1PTAA 2RAGA 3OZOA 5D32A 3GNOA 4OU1A 3W87A 1ONEA 3W7KA 3NEHA 3ECQA 4UR9A 4LEFA 3TTQA 4Y9AA 1A5LC 5E6ZA 3AISA 5MKGB 4XAZA 2C13A 4JY9A 1W1A1 4A8LA 4KGLA 3SM0A 3R0DA 5I03A 1O95A 2G3IA 1GHRA 1TJ2A 3WF0A 5H8PA 3TTYA 2V5JA 3UWVA 1O60A 3T1GA 4O0KA 2OZTA 1FWHC 5CPMA 3PF3A 4EANA 2WVSA 3QHOA 4LCQA 1M68A 3LXBA 3VE7A 3QV6A 1NVMA 1SFTA 2XU2A 1ISXA 3W1TA 1WUFA 1PZ2A 4MFDA 1L6WA 4WK9A 4FK9A 5CJ5A 3W2UA 1RK5A 3VABA 4C6IA 1TZZA 4Q8PA 3QV8A 4O4VA 5FJPA 2NV2A 3TNOA 3TMQA 2E5BA 3UZWA 3CQKA 4N4PA 3G6LA 4XIAA 1R3WA 1LRTA 1HUVA 1XLJA 5LNRA 2EPKX 4AHPA 1V6VA 3DX5A 1F3XA 4PSRA 3NWRA 1EP3A 1UC4A 3QF0A 1OZQA 3U5YA 1SW3A 3HPFA 4IG2A 4PTDA 3UZYA 3LX9A 4B3LA 1FTXA 2Y5EA 1GORA 9XIAA 5HR7A 4WDXA 1M01A 4QCFA 3B3DA 3RMJA 4QBXA 2YX0A 2NQJA 1LL7A 1E0WA 4F2TA 1F2JA 4IZGA 3HGRA 2R6OA 3GZAA 2ZC8A 4KEUA 3U8GA 5BXTA 4JYDA 4JAWA 1CW2A 4NJJA 2G0WA 5EL1A 2W0UA 2D2OA 4RXGA 1P1MA 3H4XA 5EKYA 4GO8A 4GQRA 3P3BA 3QZEA 3T09A 3T07A 1W0MA 5FJTA 1TJ1A 3DFSA 2X1UA 3PY2A 4GNKB 1Y5XA 3UJSA 3QEZA 4MF4A 3REQB 5CC7A 4US5D 3S1WA 3W1LA 2ZTKA 1DWJM 5F2IA 3CPUA 4CGTA 3H2CA 1P6CA 1PYFA 4C6OA 2EPNA 5LIKX 1KKRA 2ASHA 5DQPA 2VCAA 1JNEA 1Q13A 1XIHA 4J1OA 3DFOA 1XYFA 3LM3A 3WH5A 3JZEA 4CNPA 3Q2DA 4O19A 3A3HA 4JR5A 1POKA 3LTSA 1B31A 5IOBA 3QMTA 3BTNA 3M46A 1W2VA 3CHCA 4JTRA 3MO4A 3S6TA 3EB4A 2PRHA 1KFBA 2DSVA 2QPXA 1ZBVA 3KM8A 1ICSA 2NW0A 2Y88A 5CSSA 4UZUA 1F9CA 1BSLA 5LIUX 2HSAA 1YBQB 1YRRA 4POCA 2WVTA 3BE7A 2RDXA 5A6KA 2C7FA 2HK0A 2GGJA 1O5XA 3FDGA 3WQDA 2WANA 4UMAA 3EA3A 5I2UA 4F0KA 2XFRA 4N6FA 1YYAA 4DBUA 2Z2AA 3NQCA 2VEIA 4AIEA 3DI0A 5IXEA 3BLOA 5AFDA 5MHBA 2QJIA 2DW6A 1XX1A 5I3HA 4RDVA 3M5XA 1XF0A 3P5ZA 3W7DA 4RZ6A 3QQ0A 1C8VA 1YE6A 2FTYA 2W4XA 3FA4A 4LBSA 3TYZA 4ZQOA 4QIUA 1CEOA 2XVKA 4GD0A 2P10A 3VFLA 3ONCA 5KZ6A 3WUFA 1QK2A 4O0QA 4IQEA 4MAVA 5BRQA 1BXCA 5BRBA 3JUGA 4O1EA 1Q2RA 1TX0A 3E0VA 3THAA 1Q6QA 3M0LA 5A6MA 5T26A 3GIPA 3T8LA 4I9MA 4GUGA 2FZ9A 1DJZA 1B2YA 2OX4A 1KR1A 1Q4NX 2DZTA 3FXYA 4LC8A 4F2BA 4JEQA 3R8HA 1DIDA 2CPUA 3ME3A 4ZOCA 3L4ZA 1ZBCA 2F6UA 3SDOA 2OQHA 5EFDA 2A5HA 4QEHA 2C0HA 3A4XA 1KFJA 4IIBA 2OKOA 3NSMA 2X0SA 3QVQA 5XIAA 4E6MA 3MCNA 3AYVA 1AK5A 3B8DA 2CNCA 1S1RA 2J62A 3VNKA 3CB8A 4ZOBA 3H55A 1P0KA 1XW8A 1X1ZA 3RM9A 1JNDA 5DT7A 5CC3A 1EF2A 3W3OA 3SCQA 3BWWA 1KBBA 3ITTA 4M81A 3DKLA 3WL1A 5LXEA 4IQJA 2V81A 1DPMA 5D2WA 4X3ZA 4A3UA 4FALA 3MHUA 2EJ1A 3O07A 3WUGA 2WW5A 2P88A 1Z9AA 3RFAA 2G8ZA 2JQXA 5ABGA 4GVIA 1SGJA 3T4WA 2QXWA 4A05A 3VI2A 2VQTA 3AIUA 3ARQA 4QITA 1EF3A 3WF2A 4ICMA 4AEEA 7REQB 4YWIA 1IWPA 3SUUA 1NOUA 3SW6A 4LPCA 3W2LA 5M03A 2Z0IA 1G4EA 5KSWA 1UD6A 4HZ8A 4KT2A 2FHBA 4JHZA 1R8LA 3LBOA 3EWUA 3U4FA 3GU2A 1PEZA 3OTRA 1FWAC 4J3WA 2PE4A 3T6CA 2PCEA 3WF4A 1GVSA 2VRKA 1XLBA 3AIVA 1SFJA 1GONA 3AOFA 3AJXA 1EIXA 3MSGA 5AC5A 4UOJA 3RRXA 5AC8A 1QWGA 1UPPA 1R46A 4GMEA 1AVAA 5C7HA 1QHPA 4H7ZA 2DVTA 5D2YA 2EXOA 2GJNA 2BGNE 3TQ0A 1QPRA 4J3VA 2XH2A 3MI3A 3RX3A 1RBLA 3SGUA 3PM6A 1DVJA 2EPOA 3EEZA 5D33A 5IHRA 5E09A 4DJDA 2ZUVA 4FNTA 3NXFA 5H6HA 3WLKX 1QNPA 4DJEA 1UROA 1V03A 4JICA 3HG4A 1I1WA 2BX7A 2Q3RA 4IM4A 4ATDA 3BCJA 4FLSA 4MYXA 4ERGA 3H21A 4UFMA 4NYUA 2E6YA 1H7PA 3AHYA 1W9BM 2B7QA 4DJFA 1H7RA 2C0AA 3RMEA 4BQ2A 4O1AA 4C1NB 3BLKA 2J88A 4LCSA 3ZXWA 1LF1A 2VYOA 3EWDA 2AMXA 5CPTA 2NUYA 1X39A 2IPGA 3GKAA 1KNWA 3NZQA 2A3HA 1GOKA 2HTMA 2YFOA 2A2IA 2VZTA 4B5UA 3V36A 3UNDA 4B91A 1XDJA 1KRCC 4PGLA 3P62A 1GEQA 1QATA 3N13A 3MMDA 4GX8A 4XV0A 3UWZA 4K1WA 3HGOA 1I2RA 2VFDA 2QKFA 3OA5A 4RDYA 1EOKA 2HMCA 3CO4A 2BHZA 1GVOA 5FEZA 1QO2A 1XYLA 2EKGA 2CIPA 1KRBC 4KEZA 4HNNA 2XM1A 1B9BA 3FGCA 1YADA 4WSHA 1XS2A 1CWYA 3O6AA 1W9PA 2AGTA 4JTLA 5BROA 1AQ0A 1E1CA 1LG1A 1T5AA 1HKIA 3PNUA 3R12A 1TWSA 3FFSA 4RR4A 2PTXA 1ZALA 3BLIA 4HMDA 2V82A 4FR1A 1KRAC 5CZTA 1QAPA 4OFCA 4AZ5A 3TH6A 3NL3A 2XSBA 4GG9A 4Y9NA 4A29A 3KTSA 4NG3A 1TUFA 2P8CA 3LPFA 5KEZA 1W91A 2G3FA 1B57A 3S2JA 2BB0A 3K1DA 3IGXA 2UV8G 3ATYA 5G1TA 4P8WA 5JIWA 5C9UA 2PBGA 3S2MA 3GDLA 1OC6A 2A3CA 4WCJA 3ZQ9A 1WKDA 2FMNA 1H1YA 3VX0A 4X2PA 4M0XA 3GO2A 3CHEA 1TPUA 1MDLA 4LYRA 2A1YA 5EMKA 4WR3A 2P1FA 1GVEA 4V1XA 3E0FA 3MMTA 3G1SA 5D05A 2PDQA 2XVNA 2CESA 2WXDM 3AFBA 4N02A 1K4GA 1A3HA 1KLYA 4AAJA 2CXEA 1J12A 5EMUA 2CYGA 3N3TA 3LCWA 1R3YA 4UC5A 4JX6A 3MO7A 1JL8A 4BFAA 3BG9A 3PZUA 5D2VA 1UIOA 2J7CA 1I4NA 3P6LA 3QJAA 2DZUA 2OPJA 4AHOA 3GVRA 1YTKA 3HPXA 4G5DA 3QOMA 3VCRA 2HVMA 2VC9A 5ECUA 4DBWA 3BAKA 1XC4A 2O9TA 2TAAA 3WLNA 2DT1A 3IIXA 3VDAA 5BXSA 3I6RA 2XN1A 2XZ9A 2AGKA 5T9BG 1UWIA 3M43A 1V6XA 1T7LA 2VHLA 2VP8A 3PJXA 4PTNA 3KP1A 3WK3A 2VELA 3L4YA 4NAEA 3AROA 4BZYA 1JPIA 3NZGA 3V5OA 2WSKA 4P7RA 1BTMA 2AQWA 3WDRA 2JBMA 3O6CA 1UR4A 4RDZA 5D9NA 1G67A 1VLIA 4Z2KA 5DMYA 1NF0A 4C6MA 4W5UA 3EAUA 4S3DA 5J5DA 3ZJKA 3SCPA 2PU1A 3I3BA 2WZHA 5U7SA 2BASA 4UBPC 3GBEA 2W3ZA 4R53A 2HV5A 3WSUA 4DO7A 3B8VA 3CUXA 1GOMA 5PTDA 4R9XA 7TAAA 1LM1A 3OEXA 4QAWA 3NPWA 2OJPA 4HOWA 4D6JA 3EMQA 4AWTA 3GW3A 4EIVA 2Z29A 1ISWA 1ML1A 2J7GA 1HKKA 1US2A 1UASA 5AYZA 2BWGA 1G6CA 2J78A 4XZBA 2J13A 2YW3A 3W6MA 4F66A 4Y9MA 3OP2A 3AIBA 1IEWA 3BV4A 3POCA 3EOLA 1XSKA 1XDMA 1KW1A 1XRSA 3TK7A 2R1PA 1BLIA 3SRHA 1BQCA 3TSDA 4QX4A 2E6FA 4H9MA 1E1FA 3VVGA 2ZFAA 4L4LA 1W1TA 4TX9A 4JTAA 3PPCA 4GY1A 4H6QA 4GYJA 1L0PA 1JUEA 2F84A 1E73M 1QRQA 4ZXOA 2QF8A 1VHCA 4C1LA 4PMJA 4ORMA 2TODA 4MWAD 3T9PA 4UCFA 1XHGA 5CSYA 3C2EA 3EBVA 2X1SA 2E4TA 3WEOA 2PDWA 5CLWA 1M53A 1V6YA 1YXCA 1UZ1A 1KC7A 2ZXAA 3B9EA 4HMNA 3LV5A 2BXVA 4AZCB 2HZGA 4ZGYA 3B8SA 9RUBA 3F7JA 1OD8A 1UWUA 3L4XA 2OWWA 1E56A 1OX5A 3FV9A 4C6CA 3C0QA 5C54A 2BXYA 1RJQA 4Q6XA 4OBRA 5CAHA 5E93A 4W7UA 4P2VA 1TPH1 2CBJA 1YNPA 1Q6FA 1W2PA 2ACRA 1IGWA 4NI3A 1C93A 4S3BA 2DT0A 3T2PA 4GJJA 1F8MA 4MLJA 3F5JA 1EZWA 2HQAA 3VILA 4HPGA 5ABFB 1R85A 2RDUA 4MZYA 3WMBA 3NVDA 3UPBA 1OX4A 5I3FA 2OEMA 3UJEA 3PVFA 4XZMX 2PZNA 1FCQA 4X0NA 3MI2A 2HROA 3VMPA 4HK7A 2O9RA 1M03A 4HB7A 1TFVA 3GR7A 4K7VA 4DJDC 4DM1A 1MEWA 3M6YA 2PGRA 4PEKA 3W53A 1W1YA 2YIHA 3VKCA 1KFWA 5J8LA 2W66A 5DF0A 2GGIA 3WH9A 3MP3A 4CD7A 3CV2A 1D8WA 4DZ5A 1V51A 2HISA 1TWDA 2VVNA 4QS5A 1ISYA 1EOMA 3CB3A 2NUWA 2WJEA 3GXMA 3T4CA 3CQ0A 3EPMA 5FL1A 5RUBA 2J9YA 4B3KA 2IS7A 3WKZA 3BUVA 4L5ZA 3R25A 3H2MA 4TXEA 3DU0A 1Z7AA 3O2LA 1MUMA 1XG3A 4H6RA 2Z1WA 7XIMA 3DG3A 3AIWA 4WKAA 4G56A 2CBUA 2WCSA 4NSBA 1H51A 1WX0A 3LQLA 2BZNA 4QJ4B 2Y62A 3MP4A 4PB3A 1EDTA 3EDEA 3PZGA 3NDYA 2PDBA 3S3GA 2QDHA 4GH3A 2DVUA 4AWUA 3W01A 3K8KA 3E0WA 1G7VA 3LG3A 3MCOA 1PVNA 1E6XM 1HP5A 4NXKA 3N25A 4WXZA 2X7WA 3W82A 1ZP4A 4X60A 2XIIA 1ZCCA 4LXFA 2FGZA 4UTIA 3UWUA 1UZDA 2QDGA 4V33A 1HKMA 1EJTC 2JGQA 3LV6A 3WJYA 1A5AA 4WOZA 1E6NA 2OO0A 5CCZA 4U2ZA 2GUBA 4ZEPA 4HSOA 4WIWA 3KS5A 1MSSA 4IQDA 1I0BA 3FLUA 2ZUSA 1B9ZA 3L0KA 2REQA 5GQBA 1VHNA 1VYSX 3WNPA 1PKYA 1XLHA 2OOFA 3BCDA 4RV3A 4V2XA 3VXGA 4KCWA 1GTEA 3UR2A 1D3GA 4ZFMA 4R88A 1RQEA 1LT7A 2WJZA 2D2HA 2E7FA 3QMSA 2VEPA 3KX6A 1PV8A 2EQDA 4IPLA 3QPEA 2W79A 5D09A 3IJDA 3C8NA 1MYRA 2OSWA 1H63A 3SCWA 4HYRA 1F6KA 1HVQA 4AEOA 1FHVA 1LDCA 2XIOA 1BQGA 1CGWA 3DG6A 3AYSA 4FO4A 4HHPA 2WMFA 2C79A 1P0NA 3FKRA 1G4TA 1TKKA 4MB5A 3BZJA 1K03A 4O15A 2QCCA 3LQGA 4B5NA 3MKKA 1WBJA 2WSRA 4Y8FA 1NP2A 2XH4A 1DJGA 1XH2A 3G1VA 3W1PA 1PIIA 1BWKA 2EPMX 3H2AA 2BXZA 4GBDA 3AUJA 1D3HA 3CYVA 2X7VA 2HCVA 2GDVA 5CPOA 3V35A 3W24A 4I90A 2PWHA 2INEA 3OU8A 2W91A 4Q8QA 3TONA 3W0KA 2POTA 1R7OA 3QLDA 3QV9A 4UR7A 4HNCA 1DE6A 5HINA 4IUGA 4HNUA 4LCRA 3LTPA 1IIHA 1EJSC 4XKMA 3PUOA 2CC0A 1OFEA 2V2DA 2ISSA 5DFAA 1ITCA 1FWJC 2VVSA 1TRDA 3BOFA 1I2PA 3T2OA 1C7TA 3N14A 1RXOB 3DCPA 3IJQA 1UQZA 2E3ZA 1E6ZA 2XVLA 1BVNP 4HK6A 2Z26A 3PN8A 2OWCA 1D2KA 1S2WA 4RE3A 3KOZA 3LERA 4Q4KA 3WMSA 1JRCA 3U6WA 3R1ZA 1JULA 2PZ0A 3HA1A 3ABXA 4PN2A 4OTKA 1JJKA 1UP0A 1HKJA 3UF9A 5GVJA 1H5YA 2Z2UA 4GUHA 2E9LA 3ID7A 3ANUA 3A13A 1TPEA 4AD5A 3GXFA 5C2CA 1Q66A 4AC7C 2ZZ5A 4AVOA 2Y1HA 1ZSXA 3KRUA 4JTUA 3LTYA 3NXLA 5AB3A 5CC5A 1XBXA 4FF5A 2Q02A 1HGYA 3L0GA 4I5UA 5I24A 5AHNA 4DF1A 2E77A 2ZQ0A 4OBTA 4QM1A 5CJMA 1PTGA 3LBMA 3M16A 2R1LA 3S5NA 2XJ7A 2IKGA 1SFLA 3ZSSA 2ATMA 3VKBA 1W9UA 4WSKA 4LUIA 3K4WA 2Y8VA 4MB1A 4I7VA 1S2UA 4XSMA 4NJKA 3LSCA 1LLZA 2DUZA 3M7WA 3PFRA 4RJEA 1K9DA 3M0VA 1R2RA 1TTQA 5JXQA 1I0DA 1THFD 3I10A 1E71M 4LAMA 2BLEA 4O14A 3MV01 4ONVA 1C3FA 3TYUA 1F6PA 2Y24A 2FB3A 3VNYA 1BGGA 4EF9A 3QKEA 3NQDA 4YHEA 4BHYA 5JBEA 1ZLPA 3GY1A 3QR3A 1K8XA 3SAZA 2NXGA 3M0JA 2IXUA 2XIBA 4O16A 3WLHA 1A5KC 3SJ3A 1MQRA 4LB4A 1PKMA 1CXEA 4H8NA 2ZCGA 2FJUB 3NPUA 5I6SA 2B4GA 2AOSA 3BO9A 1AW5A 2PLJA 1IEQA 3U9IA 2W27A 5FESA 5FSDC 2PMQA 2Z28A 4PH6A 3WQ4A 5FIPA 4HNTA 4JD4A 1W3LA 4AZCA 3GTXA 2VFEA 2QEZA 2ZRXA 4TMBA 3N9KA 1UKSA 4U28A 3WLLA 4FF7A 1KRMA 4QLJA 1WDSA 4NJHA 4BCEA 2G96A 4ERAA 4CVUA 2YPIA 2OGJA 4JN7A 5G4WA 3O8AA 3HU7A 3MANA 1QW7A 3JZUA 4LY4A 4TV5A 3OBEA 3TEVA 4MWAB 4QQ3A 5DT5A 2QUVA 2GYIA 1DBTA 4HJFA 1TTJA 3SCOA 3L2MA 3R11A 4WDTA 3AHVA 5CH9A 3CNYA 4H19A 4MLRA 3VD5A 1JYNA 2V5KA 2BHUA 3HOJA 2YCLA 1W6TA 4AYGA 1H11A 1BYBA 3FAWA 3BC9A 3SEPA 4FNUA 3MB9A 1AA1B 2GL5A 2C1GA 1R9YA 3C52A 4LW7A 3IGHX 2HBVA 2XWDA 3OA3A 3M47A 3W84A 4F79A 2OZ8A 5J04A 4RNIA 3WFZA 3VK5A 2KZHA 4A8RA 1X7IA 1TVLA 4DEFA 3IWPA 1ISZA 3W7GA 1TMQA 3HGJA 5HPCA 3W22A 2OMAA 3S5OA 1FXPA 2VFFA 3TJ4A 3DC8A 3K46A 4GQQA 3GIYA 3W27A 3TC3A 2XSXA 3MZ2A 4JQ3A 1W37A 3RX2A 3THUA 3P84A 4M82A 1KXHA 1QI0A 5LA2A 1TPWA 4CQDA 1IV8A 4ICCX 4W7WA 1F3TA 2PLKA 1WQ5A 4KFOA 2YB4A