3MJYA

Crystal structure of dihydroorotate dehydrogenase from leishmania major in complex with 5-aminoorotic acid
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
306
Chain Sequence
GSMSLQVNLLNNTFANPFMNAAGVMCTTTEELVAMTESASGSLVSKSCTPALREGNPTPRYQALPLGSINSMGLPNNGFDFYLAYAAEQHDYGKKPLFLSMSGLSMRENVEMCKRLAAVATEKGVILELNLSQVAYDFDAMRQCLTAVSEVYPHSFGVKMPPYFDFAHFDAAAEILNEFPKVQFITCINSIGNGLVIDAETESVVIKPKQGFGGLGGRYVLPTALANINAFYRRCPGKLIFGCGGVYTGEDAFLHVLAGASMVQVGTALQEEGPSIFERLTSELLGVMAKKRYQTLDEFRGKVRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Novel insights for dihydroorotate dehydrogenase class 1A inhibitors discovery.
pubmed doi rcsb
source organism Leishmania major
total genus 107
structure length 306
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.3.1: Transferred entry: 1.3.98.1.
pdb deposition date 2010-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3mjyA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3mjyA01
4OHQA 2QCDB 4LUIA 5LNVA 2DZXA 1F05A 5D32A 2YZRA 1EWDA 2YX0A 2QCFA 4P2VA 3HJZA 3W6YA 4O19A 2DZVA 4ZQRA 3GXTA 2Y6ZA 2WNQA 3CT7A 1OFQA 2C13A 2H8XA 2W0UA 1LORA 1I2PA 1FUYA 3H53A 1ZAJA 3PVFA 4MY9A 4OU1A 3N14A 1FWWA 3TX9A 4JEQA 3BARA 1WYIA 1Q6OA 4N9DA 4RLIA 2JKAA 2Q8ZA 4JN6A 1PIIA 4HKPA 1G67A 2WO5A 4IQLA 1KM6A 1XUZA 1Q6RA 4H6KA 3PBYA 2J9XA 4NJIA 1XBVA 1S5VA 4ZZ9A 1ZHAA 1FQ0A 3W7JA 1VRDA 4LVBA 3FJ6A 4BWLA 1V5XA 3W7PA 3NQ8A 5G2IA 4FNUA 4JIQA 5G4WA 4LVFA 1GPWA 3NEVA 5DCBA 3S1XA 1GQNA 4DPQA 4PODA 1OFOA 2PURA 1GOXA 1WOBA 1KLYA 2H90A 4Y96A 4DPPA 2X30A 3PUDA 1QO2A 1L6YA 4BF9A 3MUXA 5LGXA 2OT1A 4M7TA 5D38A 4I7UA 2CLLA 4YXGA 5CGQA 2X2GA 4BI6A 3UQNA 4UTUA 2C16A 1SSGA 4Q4KA 1DHPA 1QPOA 2O7SA 3VE9A 4MKNA 1F2JA 3GDLA 1LDCA 2FPVA 2ZRZA 1A50A 2V9DA 1TPH1 1EPXA 1W5PA 3HG2A 3I65A 3CWNA 1F6KA 4NX0A 2JK2A 3LERA 3CEPA 4JX5A 4Z1CA 1FBAA 1L6SA 4QAIA 4A2RA 5K2ZA 3G3MA 1L2UA 2RDUA 2J9YA 3BV4A 4UR7A 3OVQA 2WNZA 4UMCA 1VJIA 4ZQCA 3QSTA 4I9AA 3BLEA 3WK1A 1OFRA 3G22A 2C3ZA 5EPDA 3QPZA 4CCCA 1LBFA 3QPYA 3W2LA 2FPTA 4LS0A 5AYYA 1ZJIA 3GNNA 5F2IA 2VFEA 5D30A 3NYZA 5FEPA 1QAPA 3PC0A 5AYXA 3G1AA 3L0GA 3PM6A 3SY5A 4AHQA 3LHUA 3TU9A 3PBWA 3LXCA 4W9TA 1QCWA 5DXYA 3W2MA 3B05A 2Y7EA 1TTQA 3NQAA 1JUEA 3HGSA 4O4VA 4PCFA 3R5EA 4FEZA 3U2OA 2WSQA 4OV4A 1QOQA 5DN1A 5E0KA 1TB3A 4K38A 3CC1A 1RR2A 4RX0A 1B9BA 4GUFA 3UXDA 4GJ1A 1YLVA 1KV8A 4UFHA 1C29A 3L67A 2CLMA 3C8FA 3DAQA 3O06A 2A1YA 4EF8A 3BO9A 2WKJA 4NVTA 3C2VA 3DFNA 2GQAA 3L68A 5K7JA 3GDTA 2DZSA 4DXVA 4IUOA 2C19A 4K36A 3UY7A 1LTDA 4TU1A 1XM3A 1HO4A 2ZZ1A 4JR5A 5I3JA 3SECA 1G7UA 3LCHA 1SO5A 1LCOA 4YL2A 1TPVA 3ABSA 3W70A 3UZ5A 3MI6A 1VCVA 4O15A 1G4SA 1R47A 3GDRA 4Y6GA 2Y88A 1X8FA 5KITA 2A0NA 2WNNA 3A24A 3OIXA 3E02A 2ZZ3A 1I2RA 5LZLA 3W85A 1DQXA 1SUXA 1DVJA 2ISWA 4N4QA 2VFIA 3FIGA 3LRLA 4FX7A 3B03A 2PRHA 5DXXA 3Q58A 2NWRA 5K9XA 2DZUA 1SZGA 1GVRA 2HMCA 3QZEA 1Q6QA 4Z1AA 2A2IA 1OYBA 3ABRA 5BMWA 2JGYA 2FLIA 3DI0A 3TAKA 3N9SA 5IM51 4O14A 3NNTA 1KFLA 1LRNA 2X1RA 3QSRA 4MLJA 4R7JA 1JCNA 3B4UA 3BVJA 1Q45A 1R2TA 4QSHA 2OZ0A 3M5ZA 1KFEA 1OF8A 1W3NA 3JS3A 2NX3A 5KTLA 3TH6A 2GOUA 4PL2A 4JY8A 3PB0A 3E96A 4MVAA 3P8JA 1FXPA 3MYPA 3CB8A 1K7FA 3DZ1A 3G0UA 1VC4A 4JYFA 3N2MA 3HG3A 1HTIA 2FFCA 5G2HA 3STEA 3S8HA 1E51A 4CQ9A 4NJHA 4MUZA 4O28A 1JVNA 4WD0A 1P5BA 3SR7A 5HJLA 3FEMA 3LI0A 5G1YA 2DU2A 3BG5A 7TIMA 5HINA 4MY8A 2H3DA 5F1VA 1QMLA 4NNCA 4Z0JA 1ZFJA 5KZEA 4XKYA 4POCA 3IIOA 3NPVA 3W87A 3RFAA 2HSAA 5I3HA 4ZL1A 2QCLA 1NAL1 5HMSA 3TV8A 4XKYB 3VI2A 1OJXA 2WPBA 4GBUA 4NNBA 2NV2A 3B06A 3KHJA 4JX4A 4QJ1A 5DCDA 1IIGA 2A7PA 1SW0A 4RJEA 3M5VA 3PAJA 1H7NA 1XI3A 4UFKA 1VPXA 4UC5A 4ADUA 1XBXA 2A5HA 3PR2A 1T0OA 5FF4A 1KTNA 1TRDA 2AGKA 5U7SA 3CU2A 2VC6A 2VKZG 1M6JA 1UB3A 1JRBA 3P81A 5F2LA 4H3DA 2ZA2A 3C0JA 4IPIA 4ZMGA 3GK0A 1K8ZA 3NO5A 3DFTA 4ML9A 1OX5A 4UTKA 1MO0A 1G6CA 4LY8A 1DBTA 4Z08A 3DFSA 3EX3A 4D2JA 1GYLA 4JYEA 5AOUA 1YPIA 4AXKA 1TV7A 1LLZA 3C2EA 2ZFAA 4YMZA 3A22A 3GAYA 3M0ZA 4DO6A 3U6WA 5I3FA 1YXDA 3TUUA 1R30A 4DELA 4FXSA 2ISVA 1J4EA 2Q8LA 1SW3A 2EPHA 3GKAA 3FYPA 5SWUA 2JKEA 3RLVA 3S6DA 1F5ZA 2R8WA 3LXAA 3EX2A 3QM3A 1X7FA 1IF2A 4UTLA 4MZ8A 2EF9A 1DORA 3IV3A 2RKXA 4TIMA 3W1PA 4K7YA 2R91A 4ONVA 3SSJA 4I7VA 1GYNA 1LBMA 3NQ2A 4ZVJA 4MJMA 1HUVA 1RPXA 1YYAA 3SZ8A 4JS3A 3TSDA 1K7EA 1EEPA 3LBCA 1LOSA 3S42A 2EGZA 3T4CA 4NQ1A 4N2YA 4NXSA 5HUOA 2W79A 4UTWA 5CZJA 2FJKA 3TQ0A 3S5NA 4NXKA 5K9DA 3W2NA 4JYDA 3NAVA 2CU0A 1ICPA 4RXFA 4QQ3A 2VEIA 3B8DA 5DCEA 4HT3A 2FTPA 3L2IA 3Q37A 4WX2A 5TIMA 4AF0A 3A9IA 4JTKA 5T26A 5HR6A 5AHEA 4QNEA 4JY9A 3TA6A 3O6YX 3SFKA 2DZWA 4AF0B 3LCXA 5J5RA 1EP2A 3GXPA 4YCOA 1R46A 1PHWA 3GLCA 3CWOX 4A21A 2DORA 3W71A 2J27A 5CG7A 3W73A 1DV7A 1H5YA 3LRMA 1MZHA 1H7OA 1KLZA 1H1YA 3MMTA 2Y63A 4O10A 3STFA 4DEFA 4FX6M 2XN2A 3NQ7A 2C1HA 3STGA 3BGGA 2ZTKA 3P5YA 3W1XA 1KM1A 4R53A 1LRTA 3AJXA 1K8XA 1BEUA 5FEWA 4S2BA 4Z1BA 1KFKA 2QAPA 4O11A 4O1DA 2QDGA 4UMAA 2NUWA 5DELA 3QW3A 1FCVA 4MFEA 3FYOA 1OK6A 3A5VA 4OE7A 2TPSA 5F1UA 1D3HA 3I7RA 4JGDA 4NX5A 3N2XA 2YXGA 3ATZA 3P67A 1O5XA 4CLMA 3W1MA 4O4WA 2J88A 5CZTA 3CLMA 3LHVA 3P62A 1M5WA 3L9CA 4C1LA 3W7NA 3HO8A 3W7IA 4IX2A 1SZEA 1UUMA 4RKAA 3FOKA 4FF7A 1YXCA 2E68A 2DP3A 2V2HA 2E77A 3E12A 1SW7A 4Y90A 1ALDA 3G1SA 3BLFA 1WDWA 2Y7FA 3W7LA 3MP4A 1W3TA 4KFNA 1ICQA 1N8FA 4HNUA 3G8EA 4K8HA 1AL7A 1EA0A 3CM4A 4O1CA 3LTPA 3INPA 1MEIA 5KZDA 4EF9A 2P0OA 4JTTA 5LNUA 1OFBA 1K03A 5FESA 4XZ9A 1PCKA 2VELA 1JJKA 4JIPA 3N9RA 4GUJA 1JCMP 4IMGA 3F4NA 2G5WA 1DKWA 4J9JA 2LLEA 2A21A 4MYXA 2X1TA 3FS2A 1JULA 2B0MA 3M41A 3W76A 3TFCA 2BZNA 1I2OA 1ZAIA 4JTIA 3W2KA 5G1TA 1LLWA 3MW7A 4FNQA 4WY0A 2CLKA 1I4NA 3O1NA 3TIMA 1NSJA 3GX9A 4FIQA 5IBXA 1T8XA 1ME8A 4UFLA 3H54A 3W7GA 4WY0B 1SO3A 2E09A 1VYSX 1B4EA 4EVZA 2FQIA 4U28A 3DHDA 1VGAA 3TCEA 1W56A 3NL2A 4WY0F 1WOAA 5CPMA 1HO1A 1U83A 2Q3OA 2YW4A 5AB3A 4H4IA 4JNMA 2ISSA 3EWBX 1WAUA 3TQKA 5LGZA 3L0NA 1A5SA 1OFDA 1W3IA 3QYQA 1OVDA 4UNKA 2CLEA 1CX9A 3JRKA 3LBMA 3TKFA 4FNSA 1M7OA 1TO3A 3HPSA 3NM3A 2X16A 3LCFA 1EX5A 1SU5A 1P0NA 1Y0EA 5CPNA 1OFEA 4LTSA 6ALDA 5TQLA 2ATMA 3KRUA 3DFQA 3EX1A 1SR9A 2PRLA 4MZYA 2GVGA 3IGXA 4X22A 4AWSA 1KTCA 2VXNA 3P74A 3HOJA 3UWYA 2ZCGA 3RF9A 1H7WA 2Z2UA 4FX8A 1ONRA 3QRHA 4AHPA 1D9EA 2CZDA 3MYOA 5BW6A 5D2WA 3LM7A 5EYWA 3TMLA 3ZS4A 4MLRA 4UTTA 4GNJA 2X1UA 3BG9A 4IGHA 2ZRUA 3UPWA 1HFBA 4G1KA 3M6YA 1KV5A 2JBMA 3PS7A 1GTEA 2XFWA 1TQJA 1QOPA 4UTJA 3QMRA 1TJPA 1YADA 3W1UA 1BWLA 1FXQA 1RV8A 3W83A 1RVGA 4YWIA 2FDSA 2XN0A 4XWUA 2PC4A 3BLIA 1F76A 2GVLA 3C4UA 1FY6A 2F7FA 2A7RA 1EP1A 4RZ5A 3S0CA 4HSNA 2YGYA 3LLFA 1GVOA 3VCRA 4DBEA 3QMSA 4UTHA 3H55A 2H3BA 3DI1A 1XDLA 1W5NA 2ZYFA 1DL3A 4CNPA 5G5IA 3L21A 3NQFA 5D2VA 4FXRA 5D2XA 2R14A 3EX6A 3DHFA 3LX9A 1XUUA 4GXMA 4N9EA 3DGRA 3PG8A 4YLWA 1LRQA 1OYAA 1LBLA 3GKFA 2YSWA 1KM4A 3O05A 4FHAA 3NR0A 1DJQA 5CZSA 3LDVA 3PUEA 2ALDA 5L6UA 4GRSA 3EXSA 3M1ZA 4O57A 4OQVA 3HPXA 3WJXA 3O8AA 1Z44A 1TTIA 3B04A 4O54A 1R2SA 3M43A 3PB2A 2YCEA 3T55A 2CW6A 1VHNA 2ZZ6A 3TJLA 5DBTA 4ZQMA 4M7SA 3MI2A 4DO4A 4WOQA 3C6CA 4N6FA 1LZOA 1NVMA 1Z41A 4ZQPA 4NZJA 1W8SA 3NM1A 4EWND 3VNDA 1W5MA 2E6FA 4M6QA 1VZWA 3NQVA 5AC8A 1UJPA 3LI1A 2AQWA 2A4AA 4Q32A 4ORIA 2Y61A 4UTIA 2D73A 1MEWA 4LVDA 3EXRA 1FX6A 3NXFA 3NOEA 5K4ZA 3YPIA 4CCEA 1TPFA 4WQ6A 6TIMA 5LHFA 3LTSA 3TR2A 2BXVA 2NUXA 3LTYA 3L0KA 4AH7A 2ZZ5A 4RZ4A 3TQVA 1WA3A 4HN4A 3W7DA 2RDTA 2G96A 4KKXA 2CFFA 4JTSA 3UWUA 3QFEA 3ANYA 1F6PA 1GT8A 2RH9A 1GG0A 3BW2A 3O63A 3PY2A 1KM2A 2EAWA 4A3UA 1DJNA 1G4TA 3TJXA 3O6CA 4R33A 3C2OA 5F4XA 1IXNA 2QDHA 4GUIA 4LNYA 2NV1A 1KBIA 2QJGA 3P80A 2NLIA 3L66A 5C54A 3LB0A 1MEHA 1JQXA 1EUAA 4CQAA 4XTIA 2QEZA 3GZ3A 1FDZA 2QJHA 3UWVA 4WJEA 3SI9A 2VEMA 5AFDA 3EWZA 5HR7A 2QCGA 3NPXA 1SZFA 5I3KA 3WJSA 1AW5A 1B57A 2EKCA 3DBPA 2I14A 4CNNA 1N7KA 2CZFA 3C56A 3W07A 1N55A 3HG4A 3ELFA 3DFOA 5FF7A 2QCMA 1WQ5A 4UIOA 3S1WA 4PC8A 3HBLA 3W22A 2NWSA 4LUJA 1I45A 3G1FA 4FB7A 2QCHA 1FDYA 3R2GA 4LV4A 4UFIA 4K7VA 1OX4A 5I3IA 1OABA 3F03K 3N73A 3PBVA 2B7NA 4Y9AA 3S5OA 4OT7A 4FNTA 3NPUA 1RQEA 4GE8A 4GWEA 3GNDA 1OX4B 4EIVA 4EOUA 3B0PA 4HNTA 2GJLA 4HPXA 3STCA 4E38A 4A29A 5I3GA 2VEPA 3W7QA 1KA9F 2NXIA 3C61A 3RK8A 5DY3A 4NJGA 1P0KA 1SFJA 3MP3A 2VFGA 5CZ0A 4IWWA 2FIQA 3OVRA 3BGJA 3HIJA 4LS1A 1U5JA 2VFHA 1O4UA 2ZA3A 5U4NA 1VLWA 3LGEA 4L4MA 2QUUA 1IGSA 3KVJA 4M6VA 4LRSA 5D37A 4MJZA 5H91A 1KM5A 3KAOA 2A7NA 3PF3A 1UUOA 3P5ZA 2RHGA 4K8EA 1TQXA 4TR9A 3QQ0A 1L9WA 1NFBA 3IEBA 3MP5A 1GJPA 4ALDA 1M7PA 1FCUA 2R94A 4JTFA 1DQWA 3O16A 1KFCA 1VYPX 5C6MA 3EWUA 1H51A 2V81A 2E5CA 1KBJA 4LC6A 3NGJA 3KRSA 4FNPA 3F4WA 1MSSA 4AAJA 2V8ZA 4JDBA 1IIHA 2C14A 4HNNA 1XBZA 2O7QA 1KFJA 1SFLA 1VHCA 1OFPA 3QH2A 1NF0A 2W6RA 4FIRA 1VLIA 3LHWA 1ZNNA 3TC7A 3E0IA 1BKSA 3R8RA 3IVSA 1W5OA 1QR7A 2IQTA 2C0AA 5MHBA 2BWGA 3NQDA 3LXBA 1UASA 5FEZA 3NDOA 2H6RA 3CIXA 3GVGA 4Z1DA 2BLEA 4JICA 3W84A 4BWLC 2E6DA 1D3GA 3THAA 1KW1A 2X1SA 3MWAA 3OA3A 4XBKA 2Y7GA 1THFD 3IIPA 4ORMA 3TNOA 3NL5A 4A2SA 1TTPA 3I68A 1B4KA 5C55A 4O1BA 3CPRA 1FWRA 2GQ9A 1FDJA 3RLUA 2Z6JA 4AB4A 1TPB1 3TAOA 1AK5A 2CLOA 3I7QA 2I9EA 4ADSA 4M19A 5AC7A 3GDKA 4TO8A 1WXJA 3W1RA 1ZAHA 5FEXA 5FF2A 3GR8A 3TMQA 3SGUA 2DJXA 4CCDA 3W86A 1GVSA 5HQEA 3I7SA 2YW3A 3JR2A 4ZQNA 2ZA1A 3W9ZA 2B7PA 3RU6A 4NNAA 2Z0IA 2OCZA 3LCWA 3O15A 3L65A 3BG3A 1A5AA 4IJBA 3PSVA 3L5MA 3Q2DA 5AYZA 1VYRA 1SQ7A 4UMBA 2QCCA 4HSOA 2WSYA 3OHIA 5ABTA 1JRCA 3W88A 3M7WA 4BFAA 4IMDA 2TSYA 2QUTA 4O16A 2GQ8A 4RR4A 3TK7A 2PCQA 5H2ZA 5LNRA 3IIVA 5EBUA 2OJPA 4O13A 4TMCA 3HGJA 3B0UX 1EP3A 4N9BA 3LV6A 3WJZA 3GYEA 4IXXA 3NL3A 2VFFA 3GR7A 1A5CA 1O60A 2TMDA 3KVLA 3LV5A 1RZMA 1J5TA 2ZRWA 2TYSA 1F74A 1TJRA 5LNWA 1JUKA 4P61A 1GVQA 1Z42A 1NEYA 3EWWA 1XFBA 1XL9A 4DF0A 3UD6A 3IIZA 1LOQA 4HPJA 1QDSA 2XN1A 4X3ZA 3FA5A 4QIUA 5LKYA 1VH7A 4MY1A 1K02A 3SJ3A 3E9AA 3TFXA 4UTMA 4QISA 4I7WA 2Y89A 2ZRXA 4MOZA 5CKSA 3V1PA 1O94A 3R89A 1ICSA 1X1OA 3O07A 2GUUA 3LCIA 3W1NA 5GVJA 3WK3A 4AVFA 3K30A 1C8VA 2C18A 4DQWA 1UCWA 5AHFA 2CLIA 3FFSA 4IOTA 3GXNA 1PCWA 1SSDA 3C2RA 4N6EA 4LVAA 2Y70A 5F4SA 4AWTA 3FKKA 2A6NA 1IXOA 1A5BA 3HB9A 1LYXA 1R2RA 3C2FA 3OVPA 4QM1A 5F4WA 4WXYA 1OG0A 1Q6LA 1W37A 4O0ZA 3NQMA 3TDFA 3S5ZA 3LHZA 3P82A 3EKZA 1BWKA 4NUWA 4LS2A 3S1UA 1VCGA 1XDMA 4IMEA 1ME7A 3DU0A 3NZRA 3W1LA 2CLHA 2ZZ7A 3LCLA 4N02A 3KVMA 3M9YA 4GUHA 1DOSA 5FI8A 2V2CA 4B5NA 3LHTA 2ZQ0A 4MIMA 2WQPA 2ZTJA 3RMJA 1YTEA 3PBUA 1I8JA 2Z6IA 5TBOA 4GC4A 4O18A 3W74A 2V2DA 4XUGA 5F2MA 1H60A 2DJLA 1TV8A 2YDAA 3KXQA 4JXCA 3S9YA 1TPUA 1G69A 1AG1O 1GVFA 2C15A 2HS6A 1LM1A 4BI7A 3G3DA 1SO4A 4CQ8A 1T99A 1ZENA 1H62A 3G1HA 3Q94A 4O12A 1F7BA 1J2WA 2JGQA 2P10A 2V0TA 1AMKA 2E6AA 2V5BA 3FJLA 4E2BA 3EEGA 1O5KA 3P84A 4C1KA 4BR1A 2G95A 5C5YA 2QUVA 4K37A 2F84A 4L4LA 1LP6A 3TXVA 4RK8A 1WBHA 4IXHA 4IX0A 1X6UA 5CSSA 3NQEA 1CW2A 3RNDA 3THQA 1TPC1 4AWUA 4NJKA 3VE7A 5CPLA 3CTLA 3QW4B 5C2XA 3EWYA 1HL2A 3W7RA 4M6PA 1FCBA 4LU0A 3TW7A 2ATSA 1OYCA 3LLDA 4JTLA 4RCXA 4LC8A 3NQ6A 2UV8G 3QQ1A 4LRTA 2TRSA 3MHGA 3IGUA 3TXZA 1TTJA 4O17A 3ABOA 1G4EA 4FNRA 1QPQA 2G97A 1ZALA 1GZGA 1GG1A 5D33A 4DF1A 1JCLA 3M44A 1ADOA 3W72A 4HNVA 3N3MA 3W7KA 1ML1A 2YFOA 4Y8FA 3KFTA 1SZNA 4OGZA 3DKLA 1W0MA 5DY2A 5AN7A 3A5FA 3IVUA 4IPJA 4OBTA 2C6QA 1EIXA 3M16A 1AW2A 1RQBA 3GIYA 1P4CA 3UNDA 5J5DA 4K6AA 3EX4A 1RQHA 4IMFA 4PH6A 1WV2A 3EB2A 4CNOA 3G0SA 3I6RA 3S1VA 3W1TA 5D05A 3NZ1A 3W75A 1AW1A 5AHMA 2ZZ2A 3G1DA 5EA9A 1QWGA 3PWAA 1X1ZA 2AAMA 3V75A 4XQ6A 4ICNA 4E0CA 1KM3A 3P8IA 3TROA 3A23A 1L6WA 1W1ZA 4PTNA 3DXIA 4R34A 3IVTA 4JTEA 1GWJA 3W7HA 5BOOA 3CHVA 4LWWA 3M5YA 1JQVA 3EKLA 3ZWSA 3KOFA 2I1OA 5HUPA 5D09A 1JR1A 3EWXA 2ZRYA 4K39A 2J9ZA 3QC3A 1ME9A 3W2JA 3CQ0A 3MBDA 3ATYA 5KINA 2YFNA 1AL8A 1TV5A 3W1AA 5AC6A 4UUIA 3UXAA 5AHLA 4RXGA 3HF3A 5BNKA 3NG3A 3TW6A 1QFEA 3SGZA 1XKYA 3T78A 1LROA 3F1QA 1WBJA 4QITA 3A21A 3G18A 1TCDA 4GUGA 3G1VA 4QNWA 2OX1A 3W7CA 4RZ6A 5BMXA 5HNRA 3L5AA 3P7YA 5EL1A 1TIMA 1KTBA 1TPEA 1H7PA 4JTHA 2BSLA 1GTHA 3DFPA 3W2UA 3W23A 3N19B 4UTWC 4MFDA 5G2WA 2E5DA 2GVJA 4N9CA 1WX0A 2VENA 1YDVA 4MZ1A 3W7OA 1QPNA 8TIMA 3G0XA 4LW7A 4LVGA 5KMYA 4UFJA 4HHPA 1VCFA 2YR1A 4X9SA 3OBKA 1H61A 2RDWA 1MXSA 2CLFA 1BTMA 4S2CA 4LOCA 3T7VA 4JTGA 1ZY9A 3N34A 2NXGA 5G4EA 1YTDA 4DBDA 1C9DA 2DZTA 4TMBA 3R12A 2ABAA 3LHYA 1PHQA 4M5PA 1TRIA 2OT0A 1KM0A 1TYGA 1SPQA 1W54A 4WOZA 1CI1A 1YXYA 3USBA 1PE1A 1K3UA 3U8GA 2CZEA 4PL1A 2YYTA 5AHIA 5LSMA 3R13A 3MO7A 4A22A 4KFPA 1PV8A 4OWGA 5LNSA 3BK0A 1IXQA 3IIXA 2NX9A 1UBSA 3VFLA 3M47A 2B7QA 4O1AA 3G24A 3LRKA 3ABQA 1QO5A 1S5TA 1P1XA 2BTMA 5HWNA 4WZHA 3E49A 1W31A 4X2RA 2A85A 4O8RA 3L5LA 3W7MA 1OHLA 3NQCA 1JUBA 5KZMA 3ZR4A 1PVNA 4JTUA 3WK0A 3C52A 1PS9A 3PSWA 4KWWA 4MYAA 5DBUA 3HMJG 1Q3NA 2QF7A 3MHFA 5CSRA 1VR6A 2H8ZA 3DENA 3C3NA 1B3OA 1VQTA 4O52A 1K7XA 3ZFHA 1FWTA 2RFGA 3NA8A 5D04C 5D2TA 1GEQA 1QPRA 2GJNA 5EKYA 2E5BA 5HWMA 3IRDA 2Y7DA 3BPWA 3HGRA 5EY5A 4AHOA 2NX1A 1SO6A 3AO0A 4WXZA 3T40A 2BX7A 2NUYA 2PRMA 2QR6A 3G1YA 1K8YA 2YYUA 5F2GA 3TC6A 3TE9A 3S5YA 1A53A 3QMTA 4XBSA 1S5WA 1NF7A 3HGOA 3O6DA 3PG9A 1F73A 1YPFA 4NT0A 1EWEA 2WV8A 3SIZA 3SW6A 3MJYA 3VKJA 1H63A 4AMAA 3W3OA 5HWJA 2QCNA 5KSWA 4ZQOA 2NXHA 3W7EA 3OG3A 1OX6A 3IGSA 5E93A 4UXDA 1XXXA 2B7OA 1YTKA 1FWSA 4LT9A 4UNLA 3WK2A 3G1XA 2FPYA 1EB3A 1VS1A 4GFSA 1YDOA 3QEZA 2V30A 1OF6A 2ZBTA 5FF3A 3HG5A 2FB2A 4JD4A 2V5LA 2B4GA 3NPWA 3OEXA 1O95A 3MI3A 2ZZ4A 5K3VA 3FLUA 1G4PA 3UWZA 3DH7A 3CIWA 3PULA 5HULA 5IBXC 1XBYA 5D02A 4PEKA 1I2QA 5A8GA 1JCXA 4UCGA 3KX6A 4LV9A 1H7RA 2QAFA 4E2DA 4Q33A 5LHEA 3UYCA 3W1QA 1HG3A 4WUIA 2WSRA 3NL6A 2E6YA 1OK4A 2GPTA 4TX9A 1JCJA 1H7XA 1V7YA 5AHNA 1H50A 1FWNA 4BI5A 5A5WA 3BW3A 3QJAA 3NQGA 2HS8A 4YCPA 2E1DA 2QCEA 3EXTA 3BW4A 3G8RA 3KRZA 4KFOA 2PE4A 5K9CA 3TSBA 3UWWA 3WFAA 4O50A 4JDYA 4PFMA 4DF2A 3UZJA 4ADTA 2FB3A 5CPOA 4NZFA 2ABBA 5D03A 3PUOA 4BK9A 1XC4A 3D0CA 1H1ZA 1EUNA 2VOMA 4FO4A 4JX6A 2V82A 3MBFA 1T96A 1TREA 4NJJA 1Z48A 4XTDA 1YDNA 1PL9A 1KFBA 4OV9A 3KVKA 2Y85A 4PA8A 1JCYA 2JKPA 3GDMA 3HQ1A 3P61A 2J6XA 4AEOA 1W5QA 5BRBA 3B0VC 2P1FA 5EMUA 3UWQA 2Z1BA 2QKFA 3LCGA 3LOTA 1RD5A 3DKJA 3NVTA 4KWVA 3HPZA 2OMAA 4HIBA 1FCQA 1ZCOA 4UFMA 4UTTC 3MHUA 4Z0SA 3P60A 4O53A 1XCFA 1QNVA 5FF0A 4NU7A 2CWNA 4U4MA 2VFDA 2WOQA 2Y62A 3TSMA 4IMCA 1TSIA 1TPDA 3GAKA 2ZDRA 2KZHA 3UY8A 1TPWA 4MPQA 2WJZA 2EHHA 1S3HA 3ZWTA 3WJWA 5L9FA 2Q3RA 2VEKA 3CEUA 4O0KA 2A6LA 2CZ5A 5E1QA 2QJIA 3QF0A 4RV8A 5DLCA 2YPIA 1I2NA 4N4PA 1LOLA 1G7VA 2ZRVA 3WJYA 2J24A 4S1FA 2HTMA 2NZLA 3T44A 2QCDA 5K4XA 3UPBA 5D2YA 3GB6A 4UR8A 4DO5A 3M5XA 1OFAA 4JTJA 1TMHA 2DZPA 3FKRA 1IXPA
chains in the Genus database with same CATH superfamily
2QPXA 4LUIA 1F05A 4WK9A 5D32A 4JKLA 1XHGA 1WCGA 1EYEA 1LUCB 3GXTA 2Y6ZA 1S1RA 2DIJA 2XDFA 3LSCA 5CAHA 1EC7A 1HF6A 1LG2A 3BARA 1WYIA 1TG7A 1HKVA 1EC8A 2JKAA 4JN6A 1ZL1A 2WJFA 4HKPA 4EAMA 1XUZA 3O6AA 4HA0A 1CPUA 3AMCA 4NJIA 2J9XA 1S5VA 3ZSTA 1FQ0A 3LPGA 4L5ZA 4BWLA 4Y9OA 3LSBA 2BV9A 1GOIA 1QU4A 4LVFA 4JTCA 1GPWA 1ZQ5A 1V0LA 2YA0A 1A5MC 1VRXA 1E40A 2NLYA 5DCBA 1W9DM 4DPQA 4HSHA 3TJIA 5HQMA 4DPPA 5GNYA 1QO2A 1L6YA 1Q85A 2GVEA 4XZWA 4CNSA 4MWAE 4YXGA 3UQNA 1WKYA 1OT2A 1XYFA 5MKGA 2DPEA 1DJGA 1PIGA 1EPXA 1W5PA 3KM8A 1VFHA 4Z1CA 1FBAA 3KTCA 1L6SA 1UMLA 2FYMA 2JF6A 1BG4A 3BL3A 3T0CA 1PDYA 4A2RA 4QAIA 4PE8A 3G3MA 1L2UA 4R85A 3OVQA 4ZQCA 4G5DA 3IAPA 3CQKA 3O0FA 4N0RA 4N42A 1F07A 3N2TA 1ZRQA 4HTYA 2C3ZA 5EPDA 2P88A 1BKHA 3PZQA 5AYYA 4F9JA 2BHUA 2ZVIA 3LM3A 5FL0A 1XH0A 4DWSB 4V33A 2IW0A 4XO6A 1K9EA 1E15A 3NYZA 3C8NA 4LB4A 1WNOA 3U7BA 1ISWA 4PUEA 4S3FA 3LHUA 1E9LA 3TU9A 3PBWA 4GD0A 4HYRA 3U5UA 1TTQA 3NQAA 2FH6A 3HGSA 4O4VA 1JYWA 2QDEA 3GD6A 2CC0A 3BTNA 3U2OA 1S3TC 3N2CA 2VDHA 4OV4A 4AU0A 1KXVA 1B9BA 2YCKX 4F66A 4YYCA 1E73M 2VTFA 3RCNA 3VDGA 3DAQA 2A1YA 4DUOA 4P7NA 1GVYA 2Z1VA 1H11A 4WEVX 2G37A 2EBNA 3DFNA 1H0IA 1V79A 2GQAA 3ZO9A 5K7JA 1OSEA 4HZ6A 4LF2A 2ON3A 3AMGA 1LTDA 2ZZ1A 5H1WA 1HKWA 4OFCA 4KEUA 1ZGDA 4DZ5A 3L4YA 3GDRA 2OR2A 3WDJA 2Y88A 2OODA 5C71A 1CNVA 2A0NA 1ZJHA 4M1BA 4PB4A 2BGNE 1F8IA 1I2RA 1GOMA 3WELA 2PDYA 4LYPA 3SCPA 3LRLA 1UA7A 2NT0A 3NSNA 4IJCA 4JOMA 1GJUA 3GS6A 5FACA 4FALA 2DZUA 1GVRA 2HMCA 1X38A 3QZEA 3W4RA 4AZCB 1OYBA 4QS6A 1A0DA 3MUCA 5BMWA 2JGYA 1M04A 3URAA 3TAKA 4O14A 3QSRA 4MLJA 5A2BA 4R7JA 2HV5A 4YS1A 4GY0A 1JCNA 3B4UA 3I3DA 3BVJA 2ZXAA 3HA1A 4QSHA 5A6MA 5HJXA 1OF8A 3JS3A 2OGJA 3PZOA 3IAQA 3GUWA 1GHRA 3JW7A 2ZUNA 1XP3A 3VNKA 2EO7A 1FXPA 3CB8A 5BXPA 1UZ1A 1VC4A 2X05A 3SCVA 4L6DA 3N2MA 1W3KA 1VPYA 3CO4A 4C1NA 1HTIA 1FFRA 2J7BA 3STEA 3S8HA 1XLFA 4O28A 2J79A 4KRUA 1DWFM 1I0DA 1AZ1A 3RR4A 1UH2A 2H3DA 3SQLA 4NNCA 1ZFJA 4ZFCA 4DY1A 4HBKA 3D5HA 1ZJBA 1TKKA 1S2VA 5PTDA 3RFAA 1Y7VA 2HSAA 4ZL1A 2XH4A 4PTDA 2QCLA 3VI2A 2GSEA 8RUCA 2OOFA 1OJXA 2NSOA 3WQCA 2A3BA 2QW5A 4GBUA 4NNBA 3KHJA 5DCDA 2V5JA 2O9TA 1IIGA 3K4WA 1XLDA 2POTA 3M5VA 1QNSA 2J6VA 2XIQA 1VPXA 4HMEA 1YKWA 3AHZA 5CLTA 3AALA 4X2PA 2BVWA 2A5HA 5FF4A 4ZB2A 3M7SA 2AGKA 2CNCA 4FMVA 1YBQA 3CU2A 2V6AA 1JRBA 3M07A 4ZMGA 1KWKA 2EPLX 3DFTA 1OX5A 4UTKA 4QE1A 3VD4A 3QOMA 2WMIB 3ARRA 4JYEA 1NQ6A 4AXKA 3QKEA 1TV7A 5EFFA 1LLZA 4YMZA 1JDEA 3M0ZA 4L6OA 2VJXA 1FVPA 3OPSA 2ISVA 2EPHA 3GKAA 4L1GA 3FYPA 1HL8A 3RLVA 3FA3A 4CU7A 4L6HA 3CTTA 3LXAA 5A1AA 4RV3A 3NFUA 1O68A 3KL5A 2RKXA 4TIMA 3MPGA 5FOOA 5T9BG 4Y2WA 4ZVJA 2DQWA 5I77A 1GZ1A 4YYFA 2HEJA 1HIZA 1H41A 1YYAA 4H04A 1JZ5A 4KBXA 3LBCA 4IICA 2VWTA 3S42A 4JAWA 2EGZA 3T4CA 2MANA 2INZA 1XH1A 4NXSA 4FA3A 1RA0A 2W79A 3BLDA 5E9XA 4DX3A 1ZZMA 3S5NA 2INEA 3QXBA 4NZ3A 4RNJA 2PDJA 4XB3A 3E0FA 5DEZA 3EBVA 5BROA 3C0QA 4D6CA 4TV6A 4OECA 1OIMA 1SGJA 2YXXA 3SFKA 3N11A 3WBAA 1A5UA 1IZCA 2WZIA 1EP2A 4NKCA 3OGSA 1Z32X 4U3CA 4CVUA 5C0QA 2QYGA 3Q4DA 3LRMA 4W87A 4XD3A 3O0KA 3ES7A 3EDKA 4W84A 2GJRA 3W1XA 4GHRA 5CQ1A 5FJJA 4KF1A 2W61A 4MNLA 1EIBA 4X61A 5FEWA 4S2BA 3ZJ6A 4O11A 2QDGA 4NYUA 2FHCA 4UMAA 2Z7KA 3QW3A 3ARVA 3L12A 4OE7A 3WL1A 1YE6A 4GVFA 4NX5A 4CQDA 2YXGA 2HJPA 2VZTA 3ATZA 2MUCA 1QHZA 1O5XA 3RAOA 2PAJA 7REQA 4H6RA 3P62A 4PR4A 2POZA 4RKAA 1Z89A 2QV5A 2E68A 2V2HA 3UPMA 4GKLA 4Y90A 1BYCA 3DHPA 1C9WA 3W81A 3UJSA 3E1F1 3EAUA 1E4NA 2VT0A 1DJXA 3MP4A 2GK1A 3SUUA 1E0VA 2YCLB 4HJWA 2FKPA 2VVNA 1EA0A 3UR7A 3CM4A 3VU2A 3WNPA 3BJTA 3INPA 2YIHA 3FX4A 4JTTA 3UGRA 2PC8A 3FNDA 5FESA 3BLPX 3VGHA 4JIPA 4LCRA 5IFTA 1JCMP 3F4NA 1DKWA 2LLEA 3FEQA 3SCOA 3AMDA 3AICA 4XK2A 3M41A 1E70M 5BXSA 3DECA 2VUYA 1ZAIA 2Y8KA 1LLWA 3K13A 4FNQA 3BE7A 1AA1B 2CLKA 4JL2A 4MGGA 2DVUA 3GX9A 2YL5A 3AZSA 1T8XA 4GIRA 4UFLA 3W7GA 2V5KA 2GGGA 4WY0B 3PANA 5LIYX 2DFAA 2BASA 1SFTA 3HJEA 3UVAA 2PGRA 3VABA 1XIHA 1NWTA 1W56A 4WY0F 4YWSA 4IMAA 2XZ7A 5T9CE 1SJDA 4EPBC 3CHEA 2OELA 4H4IA 3GXDA 3EWBX 3VTRA 3GU9A 3GVRA 4IJRA 1OFDA 3AC0A 1OVDA 2CLEA 3TKFA 5JH2A 2CZVA 1MW2A 5JMUA 3WEOA 4FNSA 2OO0A 2OTDA 1M7OA 1TO3A 1TWIA 2UY3A 4PMVA 4PMNA 1SU5A 1P0NA 2I5QA 1OFEA 3AMKA 2ATMA 4ZEPA 3CZJA 1S2UA 4GJJA 5MKGB 4PTVA 3WH7A 2JE8A 1XF0A 2R6OA 4B2DA 1KTCA 1UKPA 3ARSA 4Z1YA 1EDQA 5REQB 3SADA 2XVLA 1H7WA 3TYUA 1SJBA 2GWNA 4AHPA 5BW6A 1BXCA 4B4FA 1WAWA 1RP9A 4G1KA 1DIKA 2OLSA 1J18A 1GTEA 3T0TA 4NZCA 4ML4A 2R24A 1P6WA 1YADA 5I03A 4H9MA 4YWIA 3TZNA 2HROA 2GGHA 2A7RA 3ID7A 3I3EA 4HSNA 2YGYA 3WLRA 2PDWA 3VCRA 4DBEA 4DUWA 3VC6A 2BNJA 8CGTA 2YBVA 4PUJA 4Z2HA 2ZYFA 5I00A 3L21A 3E2QA 3VGDA 1ZS2A 4N9EA 1J01A 3PG8A 1OYAA 1X98A 4RW3A 2Y24A 3G2GA 1K8CA 1TV2A 3F5JA 2GSHA 1ZJAA 4IPPA 4A8RA 5CZSA 2VZSA 1SR0A 1JGMA 4BCEA 4HB7A 4LYQA 1R3VA 3VX0A 2PDFA 2NQ9A 1DQUA 1XSKA 4P7RA 1Z44A 1E4MM 1CXKA 3CNYA 1TTIA 3M43A 3PB2A 1B3XA 4Q4PA 3T55A 3THDA 3NVDA 7CGTA 4YTQA 2CW6A 3U2EA 3VIKA 2FDMA 2ZZ6A 3TJLA 2X0SA 2VOTA 4M7SA 1JAEA 5CC7A 4ZR8A 1KCKA 4N6FA 1LZOA 3V0SA 2G3FA 1A0EA 4YTRA 3BUVA 1UKTA 2VCBA 1W8SA 3OBEA 1RAKA 4AFYA 2E6FA 4M6QA 3NQVA 2R9RA 5JIPA 4F3HA 3VOJA 2CLPA 2Z28A 4GYPC 3NOEA 1TPFA 4ZXOA 2VC7A 2J8FA 4GH3A 3LTSA 3WDIA 2BXVA 2NUXA 2VD9A 3LTYA 1KQYA 3L0KA 3NCOA 4F0RA 5KEZA 4RZ4A 3TQVA 2E9LA 2G96A 2CFFA 1VD6A 4DAIA 2W66A 3ANYA 4M82A 1F6PA 2VRKA 2CERA 3T81A 2RH9A 4GINA 4ICCX 2DUAA 4AC1X 2NVCA 4KEVA 1QUMA 2EAWA 3EDEA 4A3UA 1DE5A 1S39A 4XVDA 5F4XA 4YVPA 3H2MA 4S3DA 4CEUC 2NQJA 3P80A 3L66A 2XZ9A 3GXMA 3GO2A 1EUAA 1WKDA 3R43A 1MW1A 3GZ3A 1XQLA 3ERPA 3UWVA 3A4WA 3SI9A 3AU2A 1CXFA 1YNQA 3VGEA 3AS2A 3WJSA 1SZFA 3VNIA 1AW5A 1RH9A 4LF1A 2I14A 1N7KA 4GO9A 3C56A 1UR8A 3W07A 3R0DA 3DDMA 1WQ5A 4UIOA 3QFWA 4V2XA 4LUJA 3G1FA 3BXWA 2QCHA 1FDYA 3R2GA 4NZ5A 1CCWB 3IARA 2B7NA 4DLMA 3AHXA 3MSGA 4GVIA 1RQEA 4GE8A 4GWEA 8XIMA 3UT0A 3COTA 5CPQA 4HNTA 3VGFA 3RU8X 3V4BA 1KBBA 4HPXA 3STCA 1T40A 1KA9F 3ANUA 3GFXA 5DY3A 4NJGA 1DWIM 3MP3A 4IWWA 3VKCA 5I5RA 3OVRA 1I0BA 3GDBA 3UG4A 3UJRA 4LS1A 4NZ4A 4HPGA 3S2CA 4B9ZA 1MQQA 4L4MA 2QUUA 3H7UA 4LRSA 2GDQA 4Q7BA 4J2MA 1U1HA 1V0KA 3PF3A 3KBMA 2PDMA 1JD7A 3MKCA 4TR9A 1L9WA 1NFBA 4RDWA 4Y9MA 1JZ7A 3H21A 1M7PA 1FCUA 2F6UA 3N4FA 4OKDA 1NWSA 5C6MA 5CG0A 2V81A 2E5CA 4WSHA 4FNPA 4AAJA 2V8ZA 4JDBA 3QY8A 3WH5A 2X41A 3M64A 1XBZA 4HNNA 4KT2A 1B3YA 1SFLA 1AD1A 1VHCA 1OFPA 1UR1A 5M2FX 4TOQA 3K4AA 1VLIA 3H2CA 4LNCA 3TC7A 3E0IA 1BKSA 3FYYA 2AAAA 1W5OA 4HYVA 3B0XA 2BWGA 2BBFA 3NQDA 1FHUA 5FEZA 3HPFA 4YHEA 5I6SA 1UWQA 2QNEA 1XC6A 5BOEA 3W84A 1O66A 4GX8A 3KE0A 5FSDC 1YX1A 5AECA 1EDTA 1PX4A 3CK5A 3G6MA 4JEJA 3PP7A 4ORMA 1YDYA 4A2SA 1GOOA 1BRLA 3VM5A 4QJ3B 1LQ0A 1J11A 2GQ9A 4AB4A 3WDHA 2I9EA 4IZGA 4IPNB 2JEPA 5AC7A 2CETA 2Y0FA 1WXJA 5B7YA 6REQB 6ENLA 4W93A 4G7EB 3SGUA 4LGXA 4FSAA 2BP1A 2QIWA 1EO5A 3BLLA 3W86A 1GVSA 3ISIX 5HQEA 3I7SA 3F5KA 4HN8A 2IQDA 2D2JA 1D8WA 3T08A 1XRVA 2X42A 3EPOA 3LCWA 1PX3A 3WENA 1IEVA 1A5AA 3SRDA 3VNJA 5AYZA 4QCEA 4E2VA 1SQ7A 3EA2A 2WSYA 5E6ZA 1DWAM 2VGGA 3MUIA 4IMDA 2TSYA 1B2YA 1GZJA 3RUBL 1F3EA 2CBVA 2PCQA 1K77A 1AH3A 2QV4A 3IIVA 5EBUA 3RPMA 2OJPA 1U22A 1XRSA 4D1JA 3HGJA 1H5VA 4PSPA 4EE9A 2PWDA 4N9BA 3T2OA 1QWKA 1KXHA 3NL3A 3VOCA 3VNMA 1MXGA 2G50A 3ARPA 3GR7A 4DJEC 1JUKA 1Q2RA 4DNHA 4F2TA 3HURA 5M3WA 2Y8UA 3A47A 3U7VA 4E2OA 5M17A 2XYLA 1IEWA 1QDSA 2XVPA 2J62A 3FA5A 4HYWA 3WO8A 5LKYA 3C3UA 4MY1A 1K02A 4GYKA 3SJ3A 4ROPA 3E9AA 3TFXA 3KBVA 5LA2A 3OODA 3PTKA 2Y89A 2ZRXA 1E6ZA 4RNIA 3HFTA 1C8VA 2P0IA 4M8UA 4A8IA 1UCWA 3FFSA 4IOTA 4KCWA 3VZZA 4C6FA 2R1LA 4N6EA 4L4OA 2Y70A 1CXIA 1DXIA 4GH1A 3HB9A 3OVPA 4PMXA 3M0HA 1V6XA 2CXGA 3IANA 1Q6LA 5D9PA 2C1GA 4GG9A 1RXOB 5D8ZA 3S5ZA 2WWCA 5A95A 2ZVRA 2CIPA 7TAAA 1BWKA 1FP9A 4NUWA 3KCLA 1E3XA 2PWUA 3DU0A 2CLHA 2ZZ7A 4RPQA 2ALRA 3KVMA 3ZJ8A 3OHMB 2QVHA 4IL2A 1DOSA 4PEEA 4LSBA 5ABFB 1CT5A 5M1TA 2Z6IA 3P2VA 4WHBA 3W74A 2V2DA 4XUGA 3URNA 2OZ3A 1RJPA 1TPUA 1XSJA 1OBAA 4BI7A 3G3DA 4HMNA 1EQPA 1ZENA 3I3BA 3LQLA 3Q94A 1F7BA 4I90A 2TAAA 3FJLA 1O5KA 3RR1A 4C1KA 4BR1A 2G95A 1RCQA 1H2JA 1XS2A 4K37A 4H9XA 4I8YA 3TXVA 3RM9A 1WBHA 3AIQA 3ZLFA 1A0CA 3LU2A 3AIEA 3DC8A 3I4KA 5CPLA 4LFYA 3BMWA 4LU0A 3IJIA 1OYCA 1W2VA 4LC8A 2X2YA 3ARTA 1CENA 9XIAA 4LRTA 3MHGA 4WR3A 4C6IA 3M46A 1ITCA 4H8NA 1G4EA 4FNRA 4ZA0A 1Q5MA 1QPQA 2CWXA 4L80A 3BMXA 1F61A 1M7JA 5D33A 3TWBA 1JCLA 2BOFX 1ADOA 4KWOA 4TUFA 3V16A 5HPOA 3N3MA 1CGVA 3KFTA 1U5HA 5I07A 1SZNA 2ZICA 4PBEA 1XIMA 3DKLA 3IVUA 4IPJA 2C6QA 1RQBA 1UP0A 3B8UA 2F6KA 4PCPA 1RQHA 4JFUA 3EB2A 4CNOA 4FLSA 4E8GA 4AD2A 4I5XA 5I79A 4NF7A 4ZE4A 2A3CA 3NZ1A 3FCPA 1P0DA 5EA9A 1UWUA 1GPFA 3M0YA 1KM3A 3M0IA 5XIMA 4PCSA 3F7JA 3HQNA 4DI9A 3SCUA 2XU2A 2XWDA 3IVTA 5G1MA 2PTXA 3R10A 3EKLA 3ZWSA 2PDHA 5TD4A 5D09A 1JR1A 2VR5A 3ICJA 3IK4A 2DY3A 1ME9A 2C0HA 1MFUA 2RGMA 4HOWA 3N29A 1F3WA 4XZBA 1P7TA 4B9YA 1AL8A 1UD8A 2I17A 3VD9A 5AHLA 1NFPA 3WF1A 2X7WA 5IHSA 1AFSA 3NG3A 1RUSA 3SN4A 1OC6A 1WBJA 3BICA 4PMYA 4KERA 1Z8AA 3U2ZA 2V69A 4ACYA 4J3VA 3HV8A 4MB3A 4QNWA 2FTWA 3W7CA 3B97A 1XIGA 5HNRA 5EL1A 3VD7A 3F2BA 2DW7A 1H7PA 4JTHA 1M7XA 1VFFA 4IGMA 2PBOA 1AQ0A 1LT7A 3W2UA 1A3XA 4GCAA 2GLKA 4FXJA 4N9CA 2XM2A 3BLKA 1XLLA 2WVVA 3TR9A 4MZ1A 3W7OA 2DW6A 4LAMA 1UWTA 4D72A 2IPJA 3K1GA 1MXSA 2CLFA 1BTMA 1ZY9A 2XPKA 3N34A 4GXWA 4ILSA 3RLGA 3FY1A 3R12A 1QNRA 3OIHA 5HMFA 1VIZA 4GPNA 1SPQA 1W54A 3CUIA 4DM1A 1CI1A 1YXYA 4W8LA 4XAPA 4MF4A 1CLKA 5AHIA 1V77A 4DJFC 1PV8A 4OWGA 1IXQA 1FWEC 4ZO6A 3G24A 4S3KA 1JDAA 3LRKA 2OVLA 3ABQA 2EEXA 1S5TA 4AWEA 3SN0A 2BTMA 3E49A 1W31A 2J75A 2A85A 2V63A 3W7MA 5KZMA 4KWWA 4H19A 4MYAA 1Q3NA 1V3JA 1XG3A 3IS4A 2G41A 3WMCA 1K7XA 3IJQA 1K6AA 5I2UA 2RFGA 3NA8A 4DJDC 3ORWA 3WBEA 1B54A 1EGVA 2YA2A 2Y7DA 3BPWA 3HGRA 1CLVA 1QASA 3VKKA 2NUYA 2OU4A 2QR6A 2YYUA 5F2GA 2CBUA 3S5YA 1A5OC 1MDRA 5D9OA 1FHVA 3PG9A 1F73A 1EWEA 3SIZA 3MJYA 4E3TA 4CN4A 5HWJA 5I06A 3T0DA 2A3LA 5TAOA 4HNOA 5T8GA 3MZ2A 5E70A 4HK6A 3IGSA 5E93A 5FJOA 1XXXA 3PWIA 2FVMA 4UNLA 3WK2A 3G1XA 1KD0A 3BDKA 3VD3A 2Z2BA 1B9ZA 1DYSA 2V30A 5C9RA 4GZEA 5C7VA 1UKOA 1E9IA 2V5LA 3JZEA 2B4GA 1T8QA 3OEXA 2J4GA 4UOJA 3MI3A 1BF6A 1G4PA 3FLUA 4NG3A 3DH7A 3CIWA 4HU8A 3MMWA 4UWMA 3ITOA 5A8GA 2J8GA 5LIUX 1H7RA 3GHTA 1FFQA 4Q33A 2VVSA 3DHUA 3PZMA 3UYCA 3W1QA 4IGSA 2WSRA 5EB8A 1DPMA 1LL4A 5HK4A 4TX9A 3GHRA 2V5CA 2BVTA 3RYSA 1T6MA 3AQUA 5AHNA 4I9TA 4JIRA 5A5WA 2OX4A 4YCPA 1JL8A 4G2DA 3BW4A 3G8RA 4KFOA 2PE4A 3TSBA 3WFAA 4O50A 1WDRA 4DF2A 3IACA 4NZFA 2BOEX 3C2YA 1AH0A 2ABBA 1V51A 5EMYA 3WYZA 3TTYA 3ITLA 3QOKA 1VKFA 1EUNA 4FO4A 1PL9A 3NZQA 4K68A 3KVKA 4AD0A 4C90A 1JCYA 3BQ6A 1R3SA 3SRHA 4I9JA 3LQGA 5EMUA 3LCGA 4ERAA 3GG8A 3DKJA 4GACA 1JPIA 4UTTC 4O1FA 3P60A 2GUYA 4O53A 1XCFA 4K1WA 4NU7A 3CMJA 2CWNA 1TX2A 1A49A 1J12A 1SZRA 2WOQA 3IRSA 1O5QA 2Y62A 3BAIA 1TSIA 1TPDA 2GZXA 1D3CA 2VCCA 1TPWA 3CL7A 4DWDA 3PBMA 3WJWA 5L9FA 2VEKA 2OOGA 4JIEA 1RALA 2VP8A 3UESA 4N4PA 5C9WA 1Q7MA 2OPJA 3WLPA 4JFTA 3ZYZA 4XSLA 2NZLA 4YJ5A 3T8LA 1ZBVA 1EF3A 4MM1A 1HX0A 4UQAA 2FJUB 1TELA 1NWUA 2DT2A 3BWWA 1TMHA 3GBEA 2QCDB 2WVTA 4URIA 9RUBA 2YDQA 3W6YA 4B5SA 2DZVA 2JEQA 3SCWA 2WNQA 1I2PA 2F8QA 2VDGA 2PODA 1CTNA 4P8UA 3WQVA 1ZAJA 3PVFA 4AZ6A 4OU1A 3N14A 3HFYA 3MVTA 2EJAA 3QN3A 3AIRA 1J93A 4Q7IA 3CZ8A 3FJNA 4N9DA 2PGFA 3VNYA 2Q8ZA 1E6PA 1J2BA 3AS0A 2WO5A 1Q6RA 4H9UA 4H6KA 2PTYA 3W7JA 2YL9A 2F61A 4A3HA 1QW8A 3UU0A 3UZZA 2NW0A 4H8HA 2P3EA 5G4WA 3UCDA 4P7OA 1AJ0A 3N13A 5FJRA 4W7WA 2XFYA 3S1XA 1GQNA 3AMLA 3NTYA 3WMLA 1GOXA 1WOBA 4J27A 2E0PA 5GJPA 2W4XA 3W27A 3PUDA 3EB3A 4E5TA 4RE3A 1W3JA 2OT1A 1UZDA 3N6HA 5CGQA 4UOQA 4UTUA 2EPOA 4Q4KA 1XRTA 1QPOA 2O7SA 3VE9A 4E8CA 3N15A 4M29A 2NT1A 1TPH1 3WQGA 4NX0A 1R3YA 2JK2A 4F0SA 4JX5A 3WH9A 3KWSA 3R7MA 2Z2AA 4H9ZA 3U2CA 5K2ZA 4FLOA 3WLKX 1T5AA 2ISDA 3QSTA 4NHVA 3BLEA 1OFRA 3ONCA 4NL1A 4CCCA 1R85A 3W2LA 1MW0A 4LS0A 3E74A 1ZJIA 2HQAA 3GNNA 3ZJKA 2VFEA 1HJWA 3VKBA 4V1YA 4IP4A 1VFTA 2PDLA 3VIPA 5D30A 1SMAA 3RHGA 3T1GA 3AIWA 2EXOA 2J78A 4WIWA 4ERGA 1QAPA 3LEPA 1V6UA 1NH6A 1UD6A 3PM6A 2GUBA 4J7RA 1KNWA 3B05A 4B90A 1KKOA 3BAWA 1J6OA 2BODX 5GJMA 4YU1A 4FEZA 2WSQA 1QOQA 5I23A 5E0KA 1WZMA 2GL5A 1OCNA 2CCRA 1A3WA 1KV8A 1YLVA 3OVGA 1C29A 2DT1A 2WSKA 3L67A 3CV6A 4Z2LA 3O06A 3SM0A 3MC5A 1BSIA 1R3QA 4F48A 4PTWA 4D9PA 2WKJA 4NVTA 3IJ6A 4JCMA 3BOXA 1TWZA 4TVDA 4IUOA 4JHZA 3TWAA 4TU1A 1XM3A 2JF7A 1JCTA 1G7UA 2QJMA 4YL2A 1TPVA 3ABSA 1KFWA 3AXXA 1G0CA 1AQFA 4QXIA 2REQA 4IIDA 2WNNA 1WE5A 1W91A 1ONEA 3W6LA 2J66A 1DQXA 1SUXA 2OKOA 4CU8A 1DVJA 2ISWA 4N4QA 4XD4A 4R7WA 2BVDA 3CV2A 3FIGA 2PRHA 5DXXA 1E4IA 3GFZA 5K9XA 5ECUA 2HNHA 4Z1AA 3EA3A 3ABRA 4LYKA 2ACQA 1QBBA 1U5VA 4Q7NA 3DI0A 5IM51 5I02A 3NNTA 1KFLA 3DX5A 2X1RA 3VA8A 4GYJA 2ZKMX 1BFNA 5D9MA 1R2TA 3A4JA 3T07A 2OZ0A 2ISFA 3M5ZA 4NI3A 1JF5A 1DXFA 1KFEA 5EBAA 2GOUA 5H6HA 2PWGA 4JY8A 4BHYA 3WSUA 4HZ8A 5H8UA 4MVAA 3P8JA 4W88A 1IV8A 3WZ0E 3NXLA 3SEPA 4FAMA 2X7VA 4CNUA 4JYFA 4W5UA 2FFCA 1EBHA 1UUQA 1E51A 4CQ9A 3GYCA 5G1YA 2DU2A 7TIMA 3KTSA 1OG6A 4S39A 5FD0A 1JDFA 9XIMA 1M3UA 4L56A 3ZQ9A 4XKYA 4S3CA 4POCA 1OB0A 3IIOA 1VB9A 3W87A 4OUEA 3S46A 1ZTVA 5I3HA 4WKAA 4JFWA 1NAL1 4LBSA 2A7PA 1IHIA 2NVAA 3PAJA 1XI3A 3J7HA 3V5FA 1XWYA 2XH0A 5GNXA 1XV8A 3U5YA 4C6KA 1XBXA 3F4VA 3PR2A 1C90A 3VOIA 2OEMA 1TA3A 5BU9A 2VKZG 1UB3A 4D8AA 4H3DA 3NUKA 2QZRA 3NO5A 3BAXA 4D6GA 4KCTA 1MO0A 1DBTA 3M0LA 1GYLA 1E72M 1YPIA 4MTVA 4AZ7A 4G9PA 2ZFAA 3CUJA 3OZMA 2KAUC 4BY3A 3IJDA 3PZ9A 1J4EA 2Q8LA 1J0YA 4JQ1A 3S6DA 1ISZA 2R8WA 3PNUA 3GSMA 1IF2A 4UTLA 4MZ8A 2EF9A 4M24A 3TA9A 2BG5A 1W8GA 2R91A 4ONVA 2ZWZA 4I7VA 1GYNA 1EJRC 4E8DA 5AVNA 2YOCA 4GQBA 1TJ0A 4M80A 2EPKX 3W37A 3CUZA 1EJTC 1MW3A 3WUEA 1TIWA 4NQ1A 3L4XA 5HUOA 2UY2A 4KETA 5CZJA 3QZ6A 3T2PA 4DI8A 1BF2A 5K9DA 1HNYA 1S5NA 4OZOA 1HZYA 4JYDA 3NAVA 2UWFA 3TYDA 3LENA 3RN6A 4HT3A 3L2IA 3EWCA 4TTUA 1XLIA 3SCNA 5T26A 4UB9A 2R1MA 3G5EA 3UXLA 4JY9A 3TA6A 1GW9A 4KH2A 2BXYA 4AF0B 3S2JA 2NQLA 4C60A 4YCOA 3L2MA 4A21A 1FHDA 2ICSA 3LD5A 3W71A 2J27A 2PF8A 3RX3A 1DV7A 1VBRA 1BG9A 1MZHA 3WY1A 1H7OA 1KLZA 4O10A 3AROA 4FX6M 3GZAA 4DJFA 4BQ5A 4US5A 2E8ZA 3OG2A 3AXIA 3STGA 4HCDA 1KM1A 4R53A 1C93A 1K8XA 1BEUA 4Z1BA 2QAPA 4O1DA 1W1VA 1FCVA 4MFEA 3A5VA 1UD4A 3SAZA 1J0HA 2P53A 3POCA 1H49A 4JGDA 2DSVA 2DZAA 4REQB 1Y5XA 1V03A 4DJDD 4HZ7A 3ALFA 3H8AA 2J88A 3WIJA 3A3HA 3L9CA 2Y1HA 1UPMB 3W7NA 1JXKA 3HO8A 2Z1SA 3MMDA 1EBGA 3WDPP 4DJDA 1EYWA 4R5EA 4XIAA 3E12A 3UG8A 1RD6A 4N7QA 4M51A 3AIVA 3W7LA 4DYJA 1W3TA 1PZ0A 4MHBA 3P0WA 4DZAA 1VPQA 3GRIA 2HE5A 3O9NA 2FHBA 3BJFA 4GJIA 1N8IA 1OC5A 4PTXA 5A6AA 5LNUA 1OFBA 4XZ9A 2VELA 1P0EA 1V8EA 3N9RA 3OTRA 4GUJA 2G5WA 2GJXA 4J9JA 1JYXA 4MYXA 2VWSA 2X1TA 3R8HA 4AZIA 3UCQA 2B0MA 3R11A 3B8IA 1R87A 4JTIA 5CJNA 1UKQA 4DHGA 4HA4A 4AISA 1W9XA 4Y9NA 4OUIA 3UG3A 1NSJA 4FIQA 3H54A 3VO0A 3R6IA 1SO3A 3QHNA 1FH8A 3SURA 1PIFA 4C7DA 1RLDA 3DHDA 2QJJA 5CAKA 3QLDA 1HO1A 1U83A 3TTEA 4NAEA 4IFKB 3VOFA 3AYRA 4JPGA 2FH8A 4JNMA 2VX4A 2H9AA 3RX2A 3WD1A 4FLQA 2ZDSA 1A5SA 4GISA 3NSXA 1CX9A 3PZGA 3WD4A 3HPSA 3NSMA 2VYOA 2X16A 1U30A 4DUVA 3LCFA 1EX5A 3B9OA 1W3HA 3E6EA 5CPNA 3FSUA 2X0HA 2BFGA 3KRUA 4W7UA 1NDWA 5BYWA 3OQEA 4ZE5A 4AWSA 4RPPA 3P0XA 2VXNA 1E1CA 2ZADA 4KCVA 3HOJA 3CZGA 2Z2UA 1ONRA 2QGHA 3EOUA 3ZXWA 2V38A 1Q6DA 4QX4A 4QBXA 5EYWA 4UTTA 4EX4A 4C5YA 3BMVA 4IGHA 2VC9A 5DMNA 3UPWA 1HFBA 1KV5A 1WDQA 3P14A 4FOKA 3C0LA 4JHMA 3S83A 1RV8A 2FDSA 3K1DA 3B8WA 3W25A 3WLOA 4HVXA 1F76A 2UY4A 1FY6A 3S0CA 1EP1A 4RZ5A 3F5LA 1UJQA 3LLFA 4OVXA 1GVOA 3WDRA 4QDMA 3QMSA 4UTHA 3QGVA 1RHCA 3H55A 3DI1A 4CD7A 4ZO7A 4NAFB 3TYAA 1DL3A 4CNPA 3BLOA 2CBIA 4FXRA 4Q6JA 1I75A 2R14A 3EX6A 4HU3A 3DHFA 3LX9A 3L4UA 1LRQA 3GKFA 2YSWA 1CXLA 3RPDA 3CQJA 3GU1A 4TTGA 2X1IA 3LDVA 2G3MA 4C6EA 2PDCA 4GVHA 3CAQA 3M1ZA 5FL1A 3CV7A 3O8AA 2ACUA 3RGTA 4E4UA 2WMFA 3WNKA 3W0KA 4O54A 1R2SA 2YCEA 2OSXA 5TNVA 2A3AA 5XIAA 1VIWA 4PRRA 3MI2A 2REQB 4AZBA 5E6YA 4ZO8A 3PPGA 1HKKA 2V68A 3R0UA 4NZJA 3DEQA 4E4FA 3TCSA 3AWNA 3NM1A 3PJXA 4EWND 3VNDA 2DT3A 3AFBA 2WMKA 1VZWA 3UZXA 1UJPA 1MUMA 5GNZA 2AQWA 4AEFA 4BF7A 3FGCA 2WZEA 2Y61A 3VZYA 4LCSA 3EXRA 1FX6A 3NXFA 4CD4A 3VINA 3WN6A 5K4ZA 4CCEA 1H0GA 5E5CA 3LPOA 2IUZA 1V6YA 4Q4SA 2ZZ5A 3HQOA 4RDVA 1BAGA 1J79A 1W17A 1J96A 2OZ8A 4RE4A 3H6OA 3QFEA 4OJYA 1GT8A 4FR6A 3UZWA 3HMCA 1GG0A 3PY2A 2F2HA 3AUJA 1KM2A 4AIUA 4MWAB 3TP4A 1G4TA 3TJXA 4R33A 1YNYA 3C2OA 4XV0A 2QDHA 2PDPA 2NV1A 1KBIA 1S2AA 2QJGA 3A3WA 4IG2B 3BOLA 1MEHA 2YJQA 2QEZA 1RY8A 3PZNA 1OEPA 3W26A 3TN5A 2XFRA 3EWZA 5AFDA 1XGZA 4GI6A 4S3JA 4CNNA 2G8ZA 5CC3A 2XSXA 1N55A 3ELFA 4GKTA 3DFOA 1LL7A 1K9DA 1NOWA 3HBLA 1ZSXA 3W22A 1HVQA 3MJMA 3MUAA 4FB7A 4LV4A 5I3IA 1UR0A 1BYAA 3R25A 4NY2A 2J7EA 3S5OA 4OT7A 1EJ7L 4CUCA 3GNDA 1OX4B 4EIVA 3B0PA 3D3AA 4LUSB 4R9XA 4MNKA 3G1RA 1XLAA 2EG6A 4UZUA 5I3GA 4D6JA 3W7QA 3C61A 1M9HA 4GIAA 4GQGA 2VZOA 1QBAA 1SFJA 3TEVA 1DJWA 5CZ0A 3UJEA 5DO8A 1U5JA 1O4UA 2ZA3A 1VLWA 3LGEA 2WZTA 3UR2A 2GOKA 5JQ9A 3KVJA 5IXEA 5FA5A 4M6VA 4KW2A 5A6BD 2E4TA 4MJZA 1KM5A 1UW9A 2OB3A 1UUOA 3MB9A 4A8LA 1UYQA 4CGTA 1TQXA 3QQ0A 4M1RA 3L23A 1GJPA 1QI4A 3E2SA 3C5QA 3H26A 4JTFA 1Z6KA 4D71A 1KFCA 1VYPX 2J7FA 4LAZA 1QTWA 3H2NA 3EWUA 1KBJA 3TTOA 1R0MA 1O6IA 3I6TA 2IPFA 1FHLA 2C14A 2XM1A 1UWSA 3AZTA 4NP7A 3CHDA 3QV9A 2YKKA 3LHWA 3WFZA 1UZ4A 1ZNNA 2AKZA 3IVSA 2VM8A 2Q09A 2OYMA 3H23A 3Q67A 1F3XA 3GTFA 1P0BA 1UASA 2PZ0A 3LPPA 4Z1DA 1G94A 5AC5A 4DO7A 4HHHA 1LF1A 4DYKA 1A47A 1VFMA 5LIXX 3ZR6A 4AZ5A 1KW1A 4CNTA 1DJYA 1RLCL 2Y7GA 6A3HA 1QI0A 3TTQA 1THFD 3IUHA 2Q8XA 3S9ZA 3BCJA 1TTPA 3L4ZA 4F8XA 3CO8A 5C55A 2AMXA 4IIEA 1TUXA 4O1BA 3CPRA 1FWRA 3TYZA 4IQJA 3VGGA 1VJSA 1R9YA 3MSYA 4AD1A 1TPB1 4GOAA 3I7QA 4W5ZA 4ADSA 4M19A 3PTDA 3ZR5A 1Q7ZA 2Z24A 3CPGA 5FEXA 3TMQA 3GR8A 1XYMA 4H1ZA 2DJXA 1B3WA 4QJ5B 3VUSA 2J74A 4CCDA 1DHKA 1EXPA 3ARUA 5E09A 2QPSA 1NM9A 3LZ5A 3JR2A 4A35A 5C2GA 3W9ZA 4QEEA 1BSLA 2D69A 4AZGA 1LWHA 2OCZA 4Q22A 4ATLA 1VEPA 3BG3A 1XYZA 3PZUA 1NWRA 3PSVA 3L5MA 3Q2DA 5EMMA 3WLQA 2ZX8A 1WO2A 4DWSC 4EACA 2PU1A 4BQ4A 1OT1A 1VYRA 3W29A 2QCCA 5C9XA 5ABTA 2IKGA 1ZP3A 1BQGA 3W88A 3M7WA 2HBXA 2GQ8A 3VILA 1RK6A 5LNRA 2EJ1A 1BD0A 2L5HA 1VP5A 4O13A 1T41A 4TMCA 3GFYA 1FH7A 1EP3A 3LV6A 3WJZA 2HWGA 4IXXA 2TMDA 1KRCC 3LV5A 3RJYA 2ZRWA 5HBFA 1F74A 4P61A 3U48A 4W86A 4QG6A 3AI0A 1GVEA 4C7GA 1XFBA 1V6WA 2E7FA 2OEKA 3IIZA 2XN1A 1UD3A 3CBWA 1XYBA 4X3ZA 1VEMA 2BVYA 3PAOA 1E1EA 5CH9A 3KWXA 1IEXA 3JZUA 4I7WA 1EJVC 3GY1A 2FVKA 3NYDA 4MOZA 2OKTA 3R89A 5C8BB 1UP2A 3FXYA 1WZAA 4L1WA 3O07A 4FPSA 1CGWA 4AVFA 3I4EA 5D4YA 4XZLX 3GXNA 4NZ1A 1PCWA 2FGBA 4Q8VA 1SSDA 3C2RA 3OZOA 4LVAA 4MSSA 2WCAA 4X0NA 3OLIA 4AWTA 2BHYA 3WLJA 2A6NA 3LMYA 1LYXA 4ZOCA 3AHVA 1R2RA 3UVIA 3GC2A 4GCXA 4QM1A 4WXYA 1F8MA 4O0ZA 3WLMA 1KXQA 5LA1A 3FHAA 3LHZA 3P82A 4NAEB 4GO8A 1PAMA 1ZP4A 1RPKA 1VCGA 2H9AB 4YVVA 5EMJA 3NZRA 3W1LA 5A8QA 7A3HA 4C91A 3O7UA 3BOFA 4GUHA 1MQPA 2GDUA 2WAGA 1XKJA 1CLXA 3QQWA 3LHTA 4MIMA 2ANUA 2WQPA 3A6OA 3DCPA 4AX6A 1I8JA 3TOPA 4ENLA 3KW3A 1TFVA 4GC4A 5BXRA 4C6OA 3O2LA 4WVXA 3KXQA 1E1CB 1G69A 1AG1O 1GVFA 2C15A 2HS6A 1LM1A 1SO4A 1QXLA 5GQBA 2V0TA 1AMKA 4E2BA 3P84A 4DLFA 4NYYA 5C5YA 1WUEA 3S47A 4GQQA 2QUVA 4XX6A 1W9UA 2QS8A 4L4LA 1U1JA 4RK8A 4IXHA 1JZ8A 2FZ9A 4IX0A 1CW2A 3RNDA 3THQA 2XISA 4AWUA 3B9AA 3V0TA 4L4PA 1E0XA 3PPFA 1UHVA 1GORA 5M5DA 3RITA 3CTLA 3EWYA 3HU7A 1JXJA 4M6PA 1FCBA 5BZAA 1BGAA 2CBJA 1C3FA 4JTLA 4RCXA 3AZRA 3NQ6A 1AODA 2UV8G 1JZ4A 3BAYA 2J47A 3IGUA 3VZXA 4O17A 3VNZA 3ABOA 1D7FA 5A69A 3II1A 1X39A 4YVXA 3CPUA 1QNQA 3FAXA 4DF1A 2HRWA 4ZB0A 4HNVA 1ML1A 3RG6A 1P6BA 4OGZA 1GQKA 4I5RA 2CHOA 5AN7A 3F4DA 3WQ8A 1EIXA 1AW2A 1LT8A 3UEQA 3GIYA 3UNDA 5J5DA 3W02A 3ZVHA 4IIFA 1IEIA 3VMNA 4IFOA 3G0SA 3I6RA 3SRFA 4Q4OA 3OOQA 4JFVA 3NIYA 1J0ZA 3W1TA 5D05A 1EJUC 1XD1A 4A6GA 1JDDA 1G1YA 2PWHA 3G1DA 1X1ZA 2AAMA 3OQ8A 3GVQA 4JZ5A 3CUGA 1TZ7A 3CWHA 3A23A 2HVNA 4PTNA 1CYGA 1GWJA 3W7HA 4ZENA 3GH5A 2I1OA 2ZRYA 3UR5A 2XGZA 4I8DA 3CQ0A 2WZHA 3MBDA 2BXZA 4K3ZA 2O9RA 4B3KA 1CBGA 1TV5A 2XJ7A 1SJCA 2I5IA 3IGHX 1CXHA 1GOWA 2C7FA 3EMCA 2ZIDA 3RDKA 2P8CA 3HF3A 5BNKA 3VVGA 3TYCA 1I9CB 3TW6A 1QFEA 3C86A 1BYDA 1L6FA 1OD0A 4NSBA 1JYVA 4GUGA 1EOKA 3G1VA 1UQYA 2WHKA 3FHQA 1TIMA 1TPEA 5CPSA 4RNHA 2BSLA 1GTHA 1EA9C 4QG9A 4UTWC 2GVJA 1HP4A 1W9PA 4D6DA 2J77A 8TIMA 4CKQA 4LW7A 1YIXA 3UA4A 5KMYA 3MDUA 1VCFA 4EP8C 1FWGC 2RDWA 1JEZA 4B15A 4C65A 3TYBA 3VOGA 3CMFA 4S2CA 4LOCA 4JTGA 3SY1A 2NXGA 4DBDA 3CH9A 1C9DA 3MZNA 4LAUA 3EOOA 3EA1A 3H12A 5LXEA 1PHQA 3QV8A 5A6LA 4LUTB 1Q6FA 1TRIA 2HCVA 1TYGA 4RUBA 1KQZA 1HT6A 2WC4A 1P1MA 3U8GA 4AC7C 4PL1A 1H3GA 2FVLA 4WF7A 3WQFA 3R13A 4MADA 3KOYA 4KFPA 2NX9A 1PX8A 1UBSA 1ADDA 3M47A 4O1AA 3NQBA 2E1WA 1JZ6A 3E0LA 4ACZB 1P1XA 1IZKA 3AHYA 3CHCA 3L5LA 3NQCA 4H7CA 4JTRA 1TZ9A 3BANA 3QBUA 1NY1A 3WK0A 3LY0A 1QATA 3THCA 3ZOAA 1PS9A 5HJYA 3U0HA 3GM8A 3VIMA 3T2QA 2QF7A 3MHFA 1N2VA 4QDWA 3DENA 1B3OA 4S38A 3WNOA 4RNFA 5HWMA 1I1WA 3UJ2A 2NX1A 1O1ZA 4U5KA 4QROA 1EJXC 2PRMA 3EDDA 3G1YA 1EQCA 2OG9A 4XBSA 1S5WA 3KEHA 4YTUA 2F38A 1BLIA 3ZZ1A 3VKJA 4AMAA 1EKOA 3W3OA 4KQNA 2PTWA 1FKWA 3UG5A 1XD0A 2VNCA 1YTKA 1FWSA 4LT9A 2PDIA 1EGMA 2OGYA 3CZKA 4DUXA 3V5OA 2YBTA 2P3ZA 5FF3A 3ONBA 3AYTA 2FB2A 1HJXA 3NPWA 1V02E 1K4GA 3UWZA 3PULA 5HULA 2IQ0A 2VZVA 1HKMA 5D02A 4PEKA 5LA0A 5AZ0A 4GZ7A 3CB3A 3DYPA 3S6OA 2XIIA 2V67A 4Q8UA 1HG3A 3NDYA 4WUIA 2E6YA 3BURA 1H7XA 4M6UA 1V7YA 1H50A 1V3MA 4BI5A 3NQGA 1MYRA 2AGTA 5K9CA 3WNNA 3UZJA 2FB3A 4M3PA 3W6MA 4BK9A 4HHLA 4XKMA 1WP6A 5DT7A 1J10A 3MBFA 4LAKA 4XTDA 4U3AA 4QCFA 4OV9A 3TQPA 3WQPA 1TWSA 2C1IA 1MZRA 2JKPA 3IUIA 3TNBA 3P61A 4AEOA 5BRBA 3UWQA 4J1OA 2QKFA 2GJPA 2I9UA 2OMAA 1T7LA 5GPRA 1XGDA 1OWQA 3MHUA 4Z0SA 2Q01A 3K46A 4PMJA 3V5CA 5FF0A 2PDQA 5DFAA 4D1IA 4CD8A 1Q6CA 2VFDA 2ZWYA 3ITTA 3LPFA 4BS0A 3GAKA 5B80A 2XWEA 1RJQA 2KZHA 2J7GA 2WJZA 3A4AA 2EHHA 4IT1A 2NVDA 3WBYA 1S3HA 1BGGA 3CEUA 4DXXA 2G0WA 2QJIA 3QF0A 4RV8A 1I2NA 3PPHA 3M0MA 3U57A 1UD2A 1S2WA 4BQ2A 5K4XA 2HXTA 4PUWA 4C6BA 3GB6A 1UKSA 4JTJA 2C79A 1H1NA 5BWFA 1J5SA 5LNVA 1E3ZA 3GU2A 1PO9A 2YZRA 1EWDA 2YX0A 1KR1A 4P2VA 1R9ZA 3HJZA 1XIFA 3PK7A 3CT7A 1KRMA 2H8XA 2W0UA 1LORA 1PKYA 2ZE0A 1FUYA 3H53A 2PP0A 1XIBA 4KPLA 3BSHA 2XSBA 1MUCA 1P43A 3NO3A 1FWWA 4JEQA 1Q6OA 4MNMA 1Q8JA 1VBJA 3V3WA 1HL9A 1G67A 1GKPA 4IQLA 3ARYA 1KM6A 3URQA 3CUHA 2VX7A 3PBYA 1XBVA 4TXEA 3WNMA 3OLDA 3FJ6A 2BGSA 3W7PA 1UOKA 2HE8A 5G2IA 4FNUA 1IR1A 1PUDA 3UXKA 4EANA 2PTDA 1ONWA 3PZTA 4PODA 4U10A 3KBWA 2PURA 1OGSA 2WPGA 2H90A 5C70A 4Y96A 3CT2A 4DBUA 2WM0A 5LGXA 4I7UA 3H24A 3N9KA 2XIBA 1VAHA 2X2GA 2WW5A 4LAOA 4BI6A 4EXBA 2PDUA 1SSGA 5BRPA 4MKNA 1F2JA 3GUGA 4X9YA 4B2DD 1LDCA 2FPVA 2ZRZA 2V9DA 3DYOA 3I65A 3CWNA 3LERA 3RMEA 3CEPA 1BWVA 2WQDA 1M01A 4Y7EA 4Z42C 3BV4A 4UR7A 4GNVA 2WNZA 3BCFA 2VEFA 1EC9A 3IV8A 4I9AA 4U31A 2PBGA 3F4CA 1IWPA 4D6EA 4CVWA 5FAJA 1FP8A 5CSUA 2WYSA 4DWSA 1LBFA 1EH9A 4C6JA 4XBJA 5F2IA 4KIRA 4C7FA 2FMOA 1MQRA 4BJHA 1KCZA 1RA5A 5CBJA 5FEPA 4IHCA 3WH6A 3G1AA 1GOKA 3L0GA 2HVOA 1K9TA 3MT1A 4AHQA 2I16A 3LXCA 4W9TA 1KWGA 1JI2A 1VF8A 2YXOA 1UC5A 2FZ8A 2Y7EA 4KEZA 2BY3A 1W1IE 1JUEA 4PCFA 3R5EA 1RK5A 4K38A 1RR2A 5C9ZA 2XFFA 4GUFA 4PMQA 4GJ1A 4UFHA 2CLMA 1IQ8A 4F0KA 3BO9A 4XO7A 2IKJA 5ECVA 3KCJA 3C2VA 3W01A 3L68A 5I7GA 5AYBA 2O56A 2DZSA 1UR2A 3H2OA 2C19A 4IIHA 4K36A 3UY7A 1DIOA 4JR5A 3SECA 1G9HA 3LCHA 3VK5A 1LCOA 2IKHA 2PB1A 4LXFA 3THUA 5J04A 3W70A 3RM8A 4D8LA 5HANA 3MI6A 3REQA 4HGXA 1G4SA 2QHAA 3T4WA 1R47A 1IWBA 4F79A 3FVDA 3UA3A 3H7RA 2OFJA 1UBPC 4JBRA 3VPLA 5KITA 5DT5A 3A24A 2Z27A 3OIXA 2W91A 2ZZ3A 1R3WA 5LZLA 4Q4RA 4FX7A 3B03A 1CB7B 1QVBA 1MFVA 1Q6QA 2A2IA 4Q3MA 3L4VA 2FLIA 3N9SA 2OYKA 1LRNA 4AY1A 1XIEA 4UQ9A 1C91A 3D3FA 2Z29A 2OLHA 1W1B1 4XG1A 3WLSA 2D24A 4Q4MA 2V3EA 2NX3A 4KCUA 5KTLA 4P8XA 5DQPA 3WLNA 2PP1A 3I6EA 3DZ1A 4F0MA 3PWGA 1YEYA 4AVNA 4GIEA 5G2HA 1XIIA 3SUWA 1B0IA 4MUZA 1JVNA 5AY7A 1P5BA 2WXDM 3VDBA 1YE4A 4C1NB 1PYMA 1V3HA 5HINA 3E0VA 3M4HA 1GKRA 5F1VA 3TOYA 1O7AA 1QMLA 3MTWA 4Z0JA 1E1FA 3PN8A 4Q8OA 5DANA 3VX1A 3P3BA 3V35A 1HKIA 3RILA 1HXJA 1TR1A 2DV0A 2WPBA 1E4LA 3A64A 2NV2A 3VAVA 1SW0A 4RJEA 1ITUA 5BRQA 3WF3A 4UFKA 4AYGA 3S9IA 1P6CA 1DJZA 3OA5A 4UC5A 2HDJA 4ADUA 3CAWA 1AJZA 4A3QA 1T0OA 5U7SA 1M6JA 3B3DA 3SBFA 2WMIA 3C0JA 4IPIA 2JIWA 2HISA 3ABXA 1G6CA 1YBQB 4LY8A 4E6MA 2XH7A 1RJRA 3PPCA 3A4XA 5BWAA 4D2JA 2IMRA 1XICA 5D8WA 4RL3A 3C2EA 3OP2A 4ES4A 3A22A 3GAYA 4HPHA 1A4LA 4JQAA 5I3FA 1YXDA 4DELA 1JZ3A 1DP0A 3E2VA 4R3UA 1QRQA 1XFCA 5SWUA 2JKEA 3E3HA 1WDSA 2G3IA 3IV3A 3VXGA 4K7YA 4PUDA 4Y9PA 1MI3A 3BSMA 2AMGA 3NQ2A 2BMBA 1DJHA 1HUVA 4JS3A 4O0QA 4IISA 4I3GA 3B0YA 4DN1A 2C91A 3BZGA 2PWVA 4QQUA 4N2YA 1D2KA 1TVLA 1AUSL 4UTWA 3TQ0A 1ELSA 4NXKA 3W00A 1NOFA 3W2NA 2DSUA 4WDTA 4QQ3A 2VEIA 1DIEA 5JBDA 4KESA 4IP7A 3B8DA 3AYSA 2FTPA 4WX2A 5TIMA 3F2DA 2OWCA 1Q66A 3A9IA 4JTKA 5HR6A 4QNEA 2FGLA 4G1NA 4L61A 1FWFC 5J5RA 3V36A 1QT1A 3NEHA 1PHWA 3HM7A 3CWOX 4QGCA 5CG7A 1H5YA 3VKAA 1V3LA 4LH8A 3MMTA 3I10A 1D8CA 3STFA 4DEFA 3VC5A 3BAJA 1JPMA 2E9MA 3EZ4A 5FJPA 1ZCCA 2C1HA 4AQLA 3BGGA 1HQTA 3WQ5A 1FWBC 1LRTA 3H2AA 4HJFA 1B5TA 1I1XA 5DELA 3QVQA 3FYOA 1OK6A 2TPSA 1D3HA 5FJTA 3V18A 4B4HA 2G4JA 4KS0A 2Z1KA 3W1MA 4O4WA 3ZSSA 3VIJA 3ARQA 4TX6A 5CZTA 3CLMA 3GC5A 1JG9A 1MNZA 2XINA 2Y5JA 4C1LA 1NTHA 3V0UA 3EOLA 4IX2A 4NRSA 1VFUA 7REQB 2DP3A 1V0NA 2E77A 2Z1WA 5LXXA 2YCLA 2VMFA 3JU2A 3M0VA 3GNOA 2NQHA 3BLFA 3RLHA 2OQYA 5HNUA 2JALA 4KFNA 4U2ZA 4W8BA 1ICQA 1N8FA 1ZBKA 4HNUA 3G8EA 1AL7A 4BKNA 4PRTA 4DAFA 2PEVA 1L2QA 4O1CA 2GK1B 1MEIA 4WSJA 5KZDA 4EF9A 5ABHA 2P0OA 1A80A 1N8WA 2DSWA 3ITXA 1JJKA 4IMGA 3CHFA 2A21A 3LMZA 3FS2A 4CQCA 1JULA 3MANA 4HNLA 2CKRA 3TFCA 1M03A 1GYMA 1I2OA 4F9DA 2YCJA 3QC0A 3ZT6A 4ZXLA 5G1TA 3VIFA 4WY0A 1ONXA 3O1NA 5H8MA 1E0WA 2V3FA 2E09A 2R1PA 5CBIA 2FQIA 1UPPA 2J13A 3IUDA 3NL2A 1WOAA 4GFIA 1OADA 2Q3OA 2YW4A 5AB3A 4R9OA 1AVAA 2ISSA 1HVXA 3TQKA 5LGZA 1FWJC 4UNKA 4QR6A 3JRKA 3LBMA 3CASA 3OLGA 4MB1A 6XIAA 2DEPA 1WXYA 1A5NC 1HGWA 3PUGA 1Y0EA 4LTSA 3SGGA 5TQLA 3LK6A 5REQA 3WUBA 3DFQA 3EX1A 1SR9A 2O0TA 4L7ZA 4X22A 1NQKA 3VM7A 4UNIA 3P74A 3UWYA 2DH3A 2PWEA 4JN8A 2ZCGA 3RF9A 4FX8A 4TVUA 5JUVA 3QRHA 5IHRA 2CZDA 3MYOA 4IF2A 3GXIA 1QI5A 1X6NA 5C2CA 3XINA 3TMLA 4GNJA 2X1UA 3EEZA 3BG9A 3OGVA 2ZRUA 4XAFA 4B91A 3CL6A 1KXTA 2XFWA 4JL1A 3QGAC 4LY4A 1UR4A 4OOZA 8XIAA 3TC3A 2CEQA 4KWUA 3UP8A 3W1UA 1W6TA 1BWLA 1NU5A 1FXQA 3NZGA 2OWWA 3W83A 1RVGA 1KCLA 4XWUA 5T91A 1XGEA 1CZ1A 1XLHA 2GVLA 3C4UA 2F7FA 4UQDA 1HJVA 2XGBA 1GJWA 2H3BA 1XDLA 1CIUA 1W5NA 1J0IA 1QK2A 5G5IA 2ZX6A 1JD9A 2R1KA 1XUUA 4GXMA 1JNEA 2IXUA 3QR1A 4B5TA 4YLWA 2WM1A 4GMEA 1F9CA 2E25A 1KM4A 3DBNA 3O05A 4FHAA 1OZMA 1DJQA 3PZVA 1RBLA 3E5BA 3PUEA 2ALDA 4GZJA 2NQZA 3N6JA 1PTDA 3SCSA 4O57A 4OQVA 1TUFA 4GI4A 1QW7A 4YPJA 5DMLA 4KWSA 1QI3A 1EZ2A 2GGJA 1Y65A 2PCEA 2BDQA 4O1EA 3WL0A 5IFPA 4GZIA 1VHNA 3GH7A 3DIPA 1JF6A 4J40A 5DBTA 4ZQMA 1ZBWA 3A9BA 4WOQA 3REQB 4WJXA 1PXGA 1YHTA 1NVMA 2OO6A 1BVWA 2ACSA