4F2BA

Modulation of s.aureus phosphatidylinositol-specific phospholipase c membrane binding
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Competition between Anion Binding and Dimerization Modulates Staphylococcus aureus Phosphatidylinositol-specific Phospholipase C Enzymatic Activity.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 112
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4f2bA00
2F9RA 3H4WA 4PTDA 1DJHA 1T8QA 1VD6A 2P76A 3L12A 4QJ3B 5T9CE 3V16A 1AODA 1ZCCA 4I90A 4QJ5B 2PTDA 3EA1A 4RW5A 2FJUB 2ISDA 1DJIA 2PLCA 4RW3A 3QVQA 4S3GA 5T91A 3NO3A 3V1HA 1DJGA 4I9TA 4GNKB 2O55A 3V18A 1T6MA 1PTDA 3PTDA 3H4XA 3CH0A 4I8YA 3OHMB 2OR2A 3EA2A 3MZ2A 4OECA 4I9MA 1QASA 4F2UA 2PZ0A 1GYMA 3RLGA 1O1ZA 1DJXA 2OOGA 3EA3A 4RV3A 4F2TA 3KS6A 4R7OA 6PTDA 5T9BG 3KS5A 4F2BA 5PTDA 2ZKMX 1DJWA 1DJYA 1XX1A 1YDYA 2OTDA 4QJ4B 1V8EA 3QR0A 3QR1A 7PTDA 4Q6XA 1PTGA 3I10A 3RLHA 1QATA 1DJZA 4I9JA
chains in the Genus database with same CATH superfamily
1VPXA 1XKJA 1UZDA 4L56A 3WD2A 1C3FA 2IXUA 5CSRA 2PDXA 1PX4A 2DY3A 3GXFA 1XQKA 1F3EA 5F2MA 3VAVA 3CL6A 4AZIA 2QUNA 3SRKA 4LB3A 3CBWA 2ANUA 5A6MA 1P0EA 5D2XA 1MXSA 4O28A 1UP0A 4NIRA 5IBXC 2PDQA 4H8UA 3ZSTA 3NQ6A 3UWUA 3TAKA 1MUCA 5GJNA 3EOLA 1VPQA 5G1YA 2W63A 1KCKA 3H2AA 2IPWA 1M1BA 5F4WA 3SCOA 4DPQA 2E5DA 4C91A 3SM0A 5L6UA 1W1A1 4DJDC 3IIOA 1XICA 2QAPA 4WDWA 3ARRA 4C1LA 2GJPA 2W4XA 3M47A 3BO9A 1OFPA 2EG8A 1D7KA 2V0TA 4ZTXA 2PLMA 5I09A 1SW7A 5EFDA 1YX1A 4DRSA 2E25A 1EUNA 1XUZA 5AC7A 4WY0F 2PTYA 4PTWA 1E3XA 4QLLA 4FALA 4NZJA 2VX6A 2OSWA 1AL8A 4WOQA 3SQSA 2OQLA 3GH7A 2RAGA 3LB0A 3W72A 3D46A 3F4VA 2G4JA 4DYJA 1PEZA 2WM1A 2OWWA 2CXGA 3LI0A 3WG6A 1GOOA 1NOFA 3AHYA 1E4NA 1RAKA 4O10A 1P48A 1IXPA 3KOWA 4J9JA 3AOFA 2E77A 5E09A 4DIAA 2XH0A 2OLSA 1V03A 1BG4A 4JNMA 3E6EA 2QJHA 4UTWC 2PDIA 2DZSA 2EAWA 2FDSA 1K9FA 1XBXA 5F4XA 3MHFA 4LY4A 2H3DA 3G1VA 4EOUA 4L1WA 1V5XA 3HPAA 4JHZA 3W7DA 3FKKA 4PTDA 5D02A 2ZADA 1K77A 3M0VA 1E6RA 1Z89A 2F8QA 2V5LA 3TW7A 1Z6KA 3BLDA 1V02A 3UZJA 2GL5A 3ZT6A 6ENLA 3PJTA 2XVGA 2O7SA 1E73M 1UA7A 2PWUA 4FF5A 1Q8JA 5CZJA 1G01A 2X05A 1WDWA 4ONVA 4YMZA 3TCSA 1YXDA 2X0YA 5G4WA 2ALDA 1F9CA 1EP2A 1CECA 4XIAA 4CQBA 4IGMA 1CZ1A 3B4UA 4NASA 3UCQA 3WCZA 2WMFA 3GIQA 3RMJA 4RZ5A 1RCOB 2DGAA 3WQ5A 3N29A 1QNQA 2X16A 3ZJ8A 4XZBA 3DFOA 4HN4A 3EMCA 3OEXA 5D2VA 1YMYA 4IJBA 1QI2A 2GJXB 3H53A 4D71A 1RJQA 3WJYA 1S2TA 2V63A 3G77A 1GVSA 4ALDA 4X60A 2VKZG 3PUEA 4PULA 4PMQA 4DY1A 3C3UA 1OC5A 1GEHA 4AZCA 3NXLA 1GZJA 1K7EA 1KBJA 1TZZA 1JRCA 4IL0A 3E49A 3TMLA 4LUYA 3LMYA 3TV8A 2BLEA 5A95A 4YTUA 5ECVA 2PODA 1ONEA 2C16A 3WH5A 4JZ5A 5FAJA 3AHXA 3W1NA 1VS1A 1CDGA 4LAKA 3L0KA 3S1WA 2H8ZA 4TU1A 4BF7A 4QSFA 2QVHA 4LWWA 4PUEA 4ATDA 3WELA 4XQ6A 3KRSA 3ICJA 2NQJA 4D1JA 1EJVC 1GORA 1KR1A 4HKPA 3ITVA 3N4FA 3MMTA 3EB3A 2DU2A 3PZNA 1GG0A 4IQLA 4H9VA 4MWAA 1B3ZA 1OG0A 2F2KA 1V51A 2QQ6A 3GG8A 3ISIX 2R82A 5FF2A 5HA7A 1V3IA 3GIPA 3LA4A 2ICSA 4IJCA 3CQHA 4EIVA 1OK6A 3ONCA 3D47A 4J35A 1RCQA 4O0KA 4MG4A 4QQUA 5AHEA 1E1CA 3H12A 3B9AA 3NA8A 3W1MA 5G5IA 2XSXA 3APYA 4QHRA 3O05A 4ICMA 2A21A 3ANYA 4F0RA 5HWJA 4WXYA 1KFKA 5M5DA 3LLDA 1JAEA 3E02A 3VUSA 4DVOA 3MQTA 2O55A 2D2JA 1CEOA 3TEVA 2WAGA 5HPOA 3QZAA 1LDCA 3SUWA 3TW9A 1P5BA 4YU1A 3FNDA 3U2EA 1HP5A 2F9RA 2CBVA 2EPNA 2OZ0A 2Y4SA 3GLCA 4RW5A 1IXQA 2FHCA 3NG3A 1Z32X 4DX3A 4Y9OA 3HPFA 3KRZA 4YL2A 4XD3A 4GD0A 2NXIA 1C29A 3KBSA 4G5DA 5CZKA 1A5OC 2ZE3A 1FFRA 1W1YA 1J79A 5C55A 4C7DA 3UZZA 3STEA 4JIPA 3QGVA 3LPPA 1TPH1 4H8VA 2RDTA 3LCFA 3W1AA 3DG3A 4EXBA 1Q7QA 3PTMA 3U5UA 4A2SA 2GUUA 3BZGA 2GVEA 3G1RA 3GR8A 4JYDA 4HT3A 2VCBA 3F1QA 4IIGA 4S3KA 3QC0A 3CT2A 3FXGA 3VDCA 3AMKA 2X30A 1E40A 1S39A 2PS2A 5A5WA 1BEUA 1H09A 1PTAA 4E2DA 4UMAA 1QHZA 3T08A 3P80A 5CG7A 3CMJA 4N4PA 1NM9A 5HNRA 2G3IA 4AC7C 1FCQA 1TMHA 3IRDA 1ODZA 3OQEA 2FGZA 1WZKA 3ABXA 3T4CA 1EJ7L 4US6A 1K8YA 4H9UA 2ZWYA 3S9ZA 1ECQA 3UPMA 4DPPA 1GONA 1SFLA 5JQ9A 1VH7A 2V82A 1GTEA 3JW7A 3QR3A 3LXAA 3B8WA 2RJHA 4S3GA 3OGRA 4IG2B 5DBTA 5HUOA 4AG0A 3UJEA 4FLQA 7ODCA 3HPSA 4YTQA 3GH4A 4DUVA 3NDOA 3GVWA 1UD4A 3OZPA 3LENA 4ADTA 3B0PA 2YB1A 2IXVA 2TRSA 1ZBKA 2OJPA 3QOKA 4A4AA 3LGGA 5C9UA 3H4GA 1Q66A 5XIMA 4A05A 3L21A 4CNSA 3NOYA 4K68A 3V0UA 2B7OA 4GQGA 2D3LA 3BOLA 2FZMA 1WP6A 3C5QA 2Z00A 3KL3A 5CAKA 2RKXA 5FEWA 1KLZA 2POTA 1OIFA 4J1OA 4OV4A 2B31A 4DJFC 5E9XA 1TIWA 3UBPC 3NDYA 2BY3A 4JKKA 4TX9A 5HR6A 2ZUSA 1HO1A 1NY1A 1GVOA 3DU0A 2QJNA 3N15A 2P1FA 4M7SA 3V1PA 9RUBA 5CH9A 5CJMA 2OODA 1E0TA 4IWWA 3S47A 1AFSA 3LHYA 1EWDA 1H50A 4CU8A 2V3EA 5CZ0A 1DOSA 4P8WA 3RX2A 1SPQA 2JKPA 4NKCA 2HVNA 2C6QA 4H7CA 1GOIA 1EOKA 4FXJA 4TR9A 3ORWA 2XH4A 1MQQA 5G4EA 4Z1BA 4IH3A 2DORA 5J04A 4MAZA 1J0HA 2J7FA 3D0CA 4BWLA 3GKAA 5DCDA 2ZX8A 4KETA 1M5WA 5E0FA 1ADSA 2PRLA 5G4HC 3B9OA 4H9XA 1AZ2A 3QQ0A 4F79A 4S3FA 2QCFA 5BXRA 4RW3A 1PE1A 3AS3A 3C0SA 3HV9A 4CD4A 1T8XA 2J77A 1Q2SA 3KE0A 5B80A 3K2GA 2YL8A 5HQEA 3T78A 3TN3A 4LNCA 2XGIA 1ZTVA 3GD6A 4A3RA 1O5RA 1EQPA 2ZTKA 1AD1A 2WJEA 2DZWA 3HG2A 4J2MA 2IKHA 5F4SA 1T96A 3OODA 3SN0A 1AQFA 3TN6A 3H4XA 4ZFMA 3DHFA 1MEIA 2WVUA 3E2VA 1E1EA 3S2LA 1DWIM 4UMCA 2BZNA 2ASHA 3TH6A 1U5VA 2Z1WA 2C1GA 5E0CA 1WZAA 3VXGA 3AYSA 2WZMA 3V1HA 4LCSA 3GHTA 1M53A 3MP4A 3TC3A 3NIYA 3DX5A 3GH5A 3A4WA 1X98A 4A8NA 2Y88A 2FTPA 4UNLA 2DUAA 3CK5A 3ZMRA 2AQOA 3KLKA 3V75A 2BBFA 3H2EA 5CBJA 5DCEA 1WCGA 4JNYA 2YCLB 1R38A 4TMCA 1I2QA 1EO5A 4H1ZA 3WQGA 1EF2A 4RDWA 2NX1A 3TW6A 2ALRA 4ZE5A 1QHOA 2Y89A 4NG3A 3S1UA 1W9PA 4LV4A 1LF1A 4ZMGA 4JN8A 4GCXA 4L80A 3QLLA 2FHBA 2FHFA 4DWSC 1WYIA 3ZS4A 3CUFA 3ITTA 4U3AA 4JFUA 4UMBA 1QDSA 4L6DA 2GJRA 2YA0A 4PBFA 4JY9A 2EXOA 3B8SA 2ZC1A 3G18A 1SFTA 3CC1A 1E43A 1TPDA 4FXFA 2ZTJA 2ZXDA 3PWIA 4DJEC 1E9IA 2A6NA 3CHVA 2QUMA 2A2IA 3IK2A 3C2VA 1ISXA 3IJLA 4FPSA 1JF5A 4GIRA 2A3EA 4XAZA 2J78A 3CJPA 4R9XA 4ACZA 1J2WA 1XXXA 2F2HA 4PUWA 4E5TA 2OT0A 3FVMA 4AHOA 2Z7GA 3U4AA 1A53A 3QW3A 5HK4A 3ARSA 3MBDA 4ZVJA 3BURA 1XM3A 4Q8UA 1LYXA 4NJHA 3R6IA 3N9SA 2FVKA 2V5JA 4HOWA 4TVCA 3G0XA 1W54A 1OVDA 3SB0A 3PC0A 2WVVB 2W5FA 1J5TA 3C61A 3R0KA 4R34A 4FI4A 1GOXA 2P3ZA 4W8AA 1V93A 3CEPA 3JZEA 3VFLA 1XYFA 2WNWA 3T0DA 1ITQA 2IQ0A 5TF0A 3UP8A 3IV3A 4YCOA 3R13A 1FKWA 1VKFA 3MI3A 4ATLA 3ONBA 1F3WA 1A3XA 3WKZA 4J3WA 4WHBA 3UCCA 2WC4A 3H2CA 4AF0A 2IKJA 3O6YX 1R7AA 3BL3A 2NV1A 5FOOA 3MVTA 2DJXA 3C4UA 1TRIA 3MCMA 4I3GA 3GW0A 2IPFA 3R89A 4C6LA 4F2UA 3K8LA 2V3DA 4Q4PA 3VGBA 3WK2A 1PCWA 3EMQA 2XWEA 4WLCA 4OKDA 4PZVA 3B05A 3XISA 3BJFA 1IEXA 4NZ5A 2E6FA 3SUUA 4WQ6A 1XGDA 4LTSA 2NX9A 2R1KA 1J5SA 3QYSA 2P0IA 4XKMA 4OZOA 3PZ9A 1NWTA 3L2IA 1FCUA 5FF3A 2PF0A 2FIQA 1VJSA 4LYPA 2Z29A 4JDBA 5C9XA 1YW1A 1OYCA 3QV6A 3GB6A 3THCA 1LOSA 1TPFA 2WJFA 1LL7A 3FAXA 1BQGA 2A3CA 4DUWA 4XZHA 1SM9A 3IJIA 3CU2A 2I17A 4JFSA 3KRUA 1T41A 5HULA 4AIBA 4AFYA 3ITGA 1F07A 2FZNA 1DJHA 2YCKX 4MYXA 1LQ2A 4LAUA 5A2BA 1TWIA 1MRQA 4UTJA 3TR9A 1DIDA 4Y8FA 2FFCA 1UKTA 1I75A 1W8SA 4KGLA 4IPLA 4HU0A 1UUQA 1FWTA 4AEFA 2BDQA 4L6OA 2A1YA 1VC4A 5GNYA 3PZQA 1I2RA 4IFKB 4J3VA 2G3MA 5AVHA 1YDYA 3KX6A 5FACA 2XWDA 2PLKA 4FMVA 1ICSA 4R9OA 5BZAA 5U4NA 2POZA 3KDOA 4GXMA 1VR6A 4JTCA 4ZR8A 4QJ5B 1Q7MA 4H2CA 3W2NA 3HPXA 3GUGA 2NVDA 2DVTA 1H60A 4ZB5A 5IDIA 1AMYA 2R91A 3M0LA 1ITUA 3AIVA 1XBZA 5AB3A 2HDJA 3FJ6A 2KAUC 1S5TA 3DIPA 5G2WA 1GT8A 3VA8A 3E2RA 5DXXA 3GKFA 5GVJA 4NNBA 2WSQA 3KTXA 4WVXA 4JTIA 4U2YA 1Z3NA 5BWAA 1FWRA 2HCVA 3AMDA 3UXDA 3L65A 3KZSA 4D6EA 1GG1A 4MWAE 4ERIA 4AYSA 1A0EA 2XVNA 2J13A 3EXSA 4DQWA 4ZO6A 3B4YA 1HG3A 4CN6A 3SRHA 3OVGA 3IVUA 1EX1A 2Z1KA 2QW5A 1W9UA 2GJXA 4O17A 3ANVA 1MFVA 2EEXA 4TIMA 1X7IA 1ZALA 3NO3A 4FNRA 4A3QA 4KCUA 3UXIA 4QISA 2ATSA 4IZGA 4UR9A 4IPIA 3HTWA 4MPQA 4V27A 2ZUUA 3W1UA 2VEMA 2AAAA 2OCZA 3PBWA 5I3IA 4C65A 2QCDB 1XRVA 3N2XA 3NQEA 3CZEA 1U83A 4O0QA 3BLOA 4PUKA 2VGGA 1XQLA 3E0IA 4QDMA 2YSWA 3PWGA 4CD5A 3SCWA 3TTSA 3VK5A 1EX5A 1TV5A 4A8LA 1WZMA 5I03A 4AD2A 2GQAA 2XN1A 1WKFA 4HK5A 4PCNA 2BGNE 1UH2A 4INFA 1AW2A 3S46A 4I90A 3ZVHB 4ZQPA 3HG5A 4RNJA 3L4UA 4TMBA 4N9DA 4O1CA 2TPSA 4Z2JA 1UQYA 5DMLA 3TVAA 2JEQA 2XU2A 1C7SA 2WVTA 2Q8ZA 2Y7DA 2PWEA 3PZGA 2WCGA 2VDIA 3WY1A 2PC8A 3LSCA 3NO1A 1PKMA 4QX4A 3TONA 1ENUA 3IJ7A 2WLZA 3RXZA 3AFBA 3DXIA 1UH4A 3GFXA 3U8GA 1SUXA 1W8GA 3N2TA 5DMMA 3S6TA 1FP8A 5K4XA 3W83A 3PAOA 3W7NA 1JG9A 3DI1A 3W7HA 3NZPA 3CO8A 3PG9A 2J7HA 3ZLFA 1BWLA 4W7VA 2C91A 3CEUA 1R3TA 4JTDA 4UR8A 4LALA 3N73A 3NQBA 3PHAA 1J4EA 2FZ9A 5LIYX 2E1WA 4PODA 5BROA 3LY0A 4GC3A 5I3HA 4YXGA 1O1HA 1W91A 1FDZA 4M56A 3TA9A 2C13A 4IUGA 3PJXA 1SJBA 2CZFA 3AS2A 3P60A 3TWAA 4BF5A 2JK2A 4BQ4A 5EFFA 3FS2A 4QJ1A 4GJIA 5JMUA 4XO6A 4A35A 4WXZA 4KCVA 3QZEA 5I6SA 4FA3A 3NR0A 1KTCA 4LUJA 1VZWA 4E4PA 1VRXA 5AVNA 4AD3A 3TFXA 3SUVA 3MSRA 2CLOA 5FL0A 3NGFA 3T40A 3GG0A 4IP7A 4RE4A 1Q6CA 4RKAA 1DJZA 4K37A 2PWDA 4MMWA 2V81A 3VFCA 2XM1A 2ISDA 3UESA 1J8VA 2ZXAA 1A49A 4PL1A 1UMYA 4DUXA 3TCEA 1FWSA 3B0XA 1AW1A 1TE1A 1K3UA 2QUUA 1UD8A 1ICQA 4LT9A 1L2QA 5FEZA 3B97A 3VOHA 1DKWA 1T99A 3KL5A 4QM1A 3VGHA 3UNTA 4JY8A 3S6OA 3M64A 3R58A 1Y8BA 1L6GA 1BG9A 1T40A 4Q33A 1RP9A 4N42A 3ZT7A 2YBTA 1JD7A 1OT2A 4JEQA 4C6PA 1KO0A 2GDUA 3BMWA 1Q6FA 4FR1A 1RSCA 1DL3A 4QDWA 3KWXA 1XLDA 4HCDA 2GVGA 1LOLA 4LYKA 3LTSA 1K7FA 1CBGA 3VM7A 1WO2A 5D2TA 3EWWA 4Q4RA 4W8BA 3HV8A 4GX8A 3U0HA 1KRMA 3CYVA 1UQZA 1HKIA 1I45A 4ZOAA 2CLIA 1WBHA 2FZBA 2PB1A 4TV5A 3B40A 1W9DM 2NQ9A 1FDJA 1TV4A 2XPKA 2PLCA 4UQEA 3FSTA 2TMDA 3PVFA 1J96A 2PZ0A 1XH1A 3BK0A 4GK8A 4U2ZA 4DWSA 1VFFA 4GYKA 1JCLA 3JUGA 2EKCA 2WZEA 1N8FA 1F61A 1XIJA 2CZVA 1AD4A 2C1HA 4GO9A 4EKJA 3M5VA 4H01A 1L8NA 2CIPA 3E2SA 2G41A 3CPGA 3P81A 4LVDA 4K38A 4S3EA 1QNRA 1VPYA 4GA8A 4K1WA 5LHFA 3U9IA 3TROA 3VOFA 2O9TA 2AKZA 4JEJA 4M19A 5HPCA 1UR9A 2V2CA 1RY0A 1JI1A 1A0CA 1E15A 5GJPA 7REQB 4RV8A 3C56A 4QAIA 5I24A 1XD0A 4UFJA 3QGAC 4IGHA 2INFA 1RV8A 2PDKA 4MUZA 3G1HA 5CPTA 1YYAA 2ACSA 3C3NA 4MB4A 5BMWA 1IYXA 5IOBA 2QZRA 4YTSA 1HJQA 3W3OA 4HHMA 1PV8A 4OUIA 3SIZA 3TWBA 4KBXA 3MV11 3SI9A 2ZZ6A 4LFYA 2VOTA 2CLFA 1ISYA 2NUYA 3W7PA 3M5XA 2H6RA 2OZTA 2QCNA 4AF0B 3SCSA 2PP3A 3N1AA 3UCDA 3AXMA 4HYRA 4Q8TA 3UY7A 3HPZA 4MJ2A 1O4UA 2A7NA 4IM4A 2GFTA 1D2KA 2BG5A 1C93A 3LRMA 1O6IA 4PMVA 3QV7A 3CWHA 2PU0A 4MPKA 4MY8A 2OSYA 1RLCL 2QXWA 5G1TA 2EJAA 1B90A 4GNJA 3QQWA 3WK3A 3TTQA 3KZPA 2HE8A 4NXSA 2NW0A 3WNPA 3E74A 4H6QA 2XINA 4F3HA 3IIVA 1QR7A 4ZO9A 3N12A 1N8IA 5L9FA 2YDSA 4ZQCA 2W27A 4JFWA 3ZT5A 4EXQA 2ZUMA 4XAPA 4XD6A 4C60A 1JZ7A 5FCZA 1JCYA 3BH4A 4CD8A 1QASA 2XYLA 1PWMA 3P2VA 3E1F1 3LXCA 4QJ4B 1DBTA 2WBKA 3S9YA 4LUIA 1D3GA 2BOGX 2QDEA 2KX9A 3IVTA 5LIWX 5EMLA 3BOXA 3WD0A 3IGXA 1LLZA 2QCEA 2FMOA 2ZXQA 1LL4A 5D4YA 4DAIA 4DLFA 4FNSA 2VCCA 4L1GA 2Z6IA 1FHLA 1UUMA 4WUIA 1BAGA 1FWNA 1GZ1A 2F84A 2FQIA 4H7ZA 3RYSA 1LBMA 3F5KA 2YDRA 3VU2A 4BA0A 3WJSA 1GVRA 5H8PA 1I9CB 3WDIA 5E1QA 5FF0A 2WYSA 4ZQMA 1FVPA 5LA0A 1OCBA 4O4WA 2OX4A 4AYGA 4CEUC 1ZSXA 2OPJA 1Q6EA 3N17A 1LUCB 3WLPA 2RDUA 1MEHA 2BB0A 3TTOA 3IAPA 3W87A 1OSEA 1SVDA 5U7SA 1J93A 1ZJHA 1VLIA 1OCQA 3W84A 4DJFA 1BSIA 4PBEA 1E55A 1REQB 3DGBA 3OQ8A 4ZO8A 2C71A 3LM7A 4QNEA 1W56A 4PUJA 5D2WA 1KQZA 1UHVA 5EMMA 4X0NA 3VX0A 1Y5XA 2VC9A 4ROQA 5HJLA 1XI3A 1ICPA 5I02A 1J0ZA 1EJUC 1N8WA 2CBIA 3M5YA 1ZBVA 1K1DA 1Z9AA 1GZGA 3DHDA 4HA4A 1NFGA 1OX6A 2Y5SA 1Q2RA 3CZ8A 3NGJA 1CLVA 4JTGA 5LGXA 2B7PA 2DIKA 1XIFA 1OQFA 3SY1A 3QW4B 1XGEA 2DQXA 1E6XM 4W4QA 4KWWA 2G0WA 5I23A 1BSLA 3PJUA 1B2YA 1MQPA 3M07A 2E1DA 2XVPA 3EGJA 4MDPA 4HGXA 3ZR5A 4IFKA 3F4NA 3IGUA 1VCVA 2FZ8A 1X8CA 3VILA 4CN4A 1BGGA 2D3NA 3NOEA 5FJPA 1LL6A 4FLSA 4MFEA 4NAEA 2G4FA 2BVWA 3OBAA 4DNHA 1P6WA 4QS5A 4IPNB 3DC8A 1J12A 4YHGA 1OHLA 1KQYA 3EDKA 5GNXA 1BGAA 1VFMA 2DJLA 1XYAA 1AH0A 2E3ZA 1PX3A 3W1TA 5H91A 3MCNA 1P0BA 2C19A 2Y8KA 3RRAA 1ZCCA 3CM4A 4Q8QA 1UR0A 3T0BA 3WMBA 4LPCA 1PCKA 3EKGA 1IR1A 5I5RA 4KCTA 2IPJA 1P6BA 1I4NA 3WF4A 5D33A 4GPNA 4XZLX 1A5SA 3CMFA 3N19B 4IF2A 1EKOA 3CGTA 1PKYA 1M3UA 2P8CA 5IRPA 4LAMA 1A5AA 2OEKA 1A4LA 4D6CA 5F7UA 4ZB2A 1XFBA 1US3A 4I9TA 4ADUA 4HP5A 3S4TA 2ZA3A 3QTGA 1P4CA 4C6BA 1AZ1A 1KRBC 3GUWA 1BQCA 3WUEA 1V77A 1EJRC 4W5UA 5DY3A 5JH1A 2D0GA 4AXKA 2XIJA 4ZE4A 4J3UA 4Y96A 1EIBA 3LHTA 2Z2BA 2OT1A 3UJRA 3N2BA 2V30A 6XIMA 1MUWA 3SUTA 5D09A 3LV5A 3T9PA 5EMJA 2PZNA 3GDLA 4PMXA 3W7GA 1CYGA 3K8MA 1YKWA 4NU7A 4M24A 1B31A 2AL2A 3BSMA 2D0FA 2Y0FA 5G2HA 4R5EA 1O94A 3P61A 2C15A 5M2FX 5CGTA 3VOJA 3CUZA 3TYAA 3UR7A 1ZLPA 1KM2A 9XIAA 1W1B1 3QOMA 1KKOA 3H54A 3QM3A 3BARA 4YNGA 1TPB1 5DLCA 2QT3A 1F4HA 5GNZA 4NRRA 3KFTA 1VYRA 5CZTA 1PWLA 3W6MA 3M0IA 3PUGA 3GXIA 4UWMA 3AYTA 3P5YA 4D2JA 4GBDA 3CAQA 2CLHA 4KFPA 3VABA 1A80A 1JVNA 1TCMA 3P93A 3UZYA 4LAOA 3RUBL 3CIVA 3N6QA 4CU6A 1O1ZA 3WH8A 1PBGA 3LERA 4PMZA 2PD5A 3WBWA 4YWIA 4A29A 1W32A 4MY1A 4JBRA 1W3NA 4NI8A 3VMOA 4QTGA 5A6TC 2WWCA 1KRCC 5C8BB 3IV8A 4JHOA 3NEVA 1XLKA 4YVPA 2JF7A 4XZNX 1FWBC 3NURA 1UR3M 1EC9A 1KBLA 3CAKA 4R7WA 1SU5A 2PPGA 5CPNA 1MWOA 4XUYA 4KERA 4J3SA 4S3AA 5A8GA 3CZGA 4DM2A 4PSRA 1W3IA 3KHJA 4C6MA 5EMUA 2PGWA 4URIA 1S3TC 1US2A 4DBUA 1JYVA 1OJXA 2Y63A 3GXPA 5J5RA 3IWPA 1EA0A 1V3HA 3LOTA 2A3AA 4F4RA 2V2DA 4O1FA 2FTWA 3GXNA 4OT7A 3A64A 2GK1B 1FKXA 2PWVA 4BS0A 2DH3A 1NDWA 5H8UA 3CLMA 1QO2A 2GVLA 5DELA 5IHSA 4NVTA 3CASA 2VMFA 4G7EB 1KM4A 1Z69A 2OGJA 5GPRA 1MEWA 3VUPA 1TZ7A 2WXDM 4LY8A 4FP1A 3QF0A 2QCLA 2FFIA 3NZRA 3W76A 2MANA 4RDYA 3BLFA 3WH7A 2VZTA 4PCPA 1JDCA 2HVOA 3PZMA 1W1VA 3UGRA 1A5LC 5ABEA 4OOUA 1GVYA 3C0JA 2ODOA 3DFPA 3QH2A 3IUDA 4AD5A 2X41A 4GUJA 4GX9A 1EBHA 4IMGA 3CV6A 3UR2A 2ZKMX 4J27A 7XIMA 3FOKA 3EB2A 2DPEA 3LCIA 4ZFCA 3TYUA 4PN2A 1E3ZA 1B9BA 5C0QA 4UCGA 1AL7A 1X8FA 4AMAA 3QZ6A 3ALFA 1KBKA 3ANUA 1E56A 3VD4A 2HTMA 1XJBA 4V15A 2OU4A 1GNXA 3KS5A 7PTDA 3URBA 4P7NA 1J01A 3CZKA 4KMQA 4H7VA 3WEZA 4D6FA 2H9AB 3UXAA 1CCWB 4G9PA 4U31A 4WRHA 3VKCA 1WKYA 4ML9A 1U1JA 3O0FA 3A9IA 3JVAA 3MWCA 3UF9A 3T81A 3OOQA 4WSJA 3WLSA 1JDAA 3GY1A 3W7EA 1LJYA 2W6RA 2BHZA 3EDDA 3OU8A 4A3YA 1BXNA 4GYJA 2WHLA 4GBUA 4C5YA 3LPFA 3BE7A 4XWUA 3QMSA 1MZHA 4ERGA 2NT0A 4DZAA 4UTMA 2J9YA 5HMFA 2KZHA 1UCWA 4GGBA 3S8HA 3S2CA 3RN6A 3DYPA 4FAMA 3PWAA 1K02A 1ZUAX 1HN1A 1QXLA 1TTJA 3STCA 1DXEA 4GVGA 5I3KA 4S3DA 2RGMA 3UA4A 5IBXA 2PDBA 4EAYA 1XLGA 2PDNA 3HOJA 3QPZA 4J7RA 1QUMA 3UWEA 1D3HA 2ACRA 1QI0A 1CX9A 1PS9A 1D8CA 4YTTA 2WLYA 2PUZA 3SFKA 1XPGA 3BLIA 3WF1A 4BY3A 4F2TA 4IHCA 4G2DA 3T0AA 1E4MM 1YHTA 2CERA 3R2GA 4AY7A 2YCLA 4JGDA 3K4AA 2UY4A 3HN3A 4F66A 1DJNA 2GQ9A 1I0BA 1ZFJA 1JZ8A 5HNUA 2BOEX 1RXOB 3PULA 1UOKA 1YEYA 1UR8A 3V3WA 3C6CA 5AC8A 3S5SA 5CC3A 3H70A 3EPMA 3SSJA 2IS7A 5KEZA 4RE2A 1H0GA 1QNSA 3WLTA 3AO0A 2ZWZA 2V5DA 3W6YA 3W1QA 1UZHA 1JFHA 3CQKA 1TR1A 4NQ1A 1O7AA 2ON3A 3WQFA 2PWGA 1TCDA 1OT1A 4O52A 4OOZA 3B9NA 1OADA 1T5AA 3W2UA 3UJSA 3A21A 3V0SA 3KVJA 2Z24A 1GHSA 5DFAA 1BKSA 2PEVA 5HXMA 2OFJA 3L23A 1TWZA 4H6RA 1R3QA 1DJXA 4D6JA 2FZDA 3ABQA 3P74A 4PTNA 4R53A 1K9DA 4FNTA 3N6JA 4O1AA 4AIOA 3DG7A 3UFYA 1SSGA 5AHLA 4H8NA 4GUGA 3GVVA 2QIWA 1UC4A 2GVYA 4UOQA 2FB3A 4HNUA 3EOSA 2QV5A 5JH2A 3PBUA 3T05A 1MI3A 2IUZA 3NYDA 3W53A 4M5PA 1NTHA 4UQCA 3DFSA 1BRLB 2JEPA 1MW2A 4JNZA 2W67A 1UROA 2ATMA 2YJQA 2J4GA 3TE9A 1SW0A 5I78A 1FWFC 1WB0A 2Z0IA 3TZFA 4NXKA 1A4MA 2UY5A 2G3FA 3SUSA 5IXEA 4RCXA 3ES7A 2RGLA 3FEMA 4Z2GA 1JQVA 1OM0A 4UNIA 2XFWA 3LBMA 3CL8A 2ZVIA 3W71A 2QUVA 4FNPA 3CPRA 6ALDA 1BRLA 4S3CA 3KDNA 3RR1A 1VFTA 5A1AA 5LIKX 1U2YA 3ES8A 4JTRA 2E28A 4GHRA 1QPOA 3AZSA 2WWDA 3HG4A 2L5HA 2IPGA 1OF6A 2PTWA 3TN5A 3P0XA 1VIWA 3VDHA 1B4EA 1S2AA 2DW6A 1T0OA 2GWNA 3WLJA 3G1SA 1LM1A 3UXKA 1SO5A 4IT1A 4QG9A 2PSNA 4E38A 4D8LA 4IQEA 1XBYA 1QI5A 3NPUA 3AWOA 1Z42A 4DO5A 1TWDA 1GK8A 5BRQA 2PFHA 1FHDA 4AVFA 1Q6DA 4AMCA 3GS6A 1QTWA 5TQLA 3CUIA 2NSOA 3MC5A 2PI6A 3W7RA 1JULA 1PKNA 4A3HA 4HK7A 1PZ2A 3W01A 1XDLA 3G1YA 3VX1A 3BTNA 1QAPA 1H63A 4N9EA 3ENLA 3H24A 3OBKA 4RJEA 3TTEA 2OYLA 2FKPA 4JL1A 3PANA 3IJ8A 4LGXA 5I07A 3BANA 1FRBA 4UIOA 4EANA 3MTWA 4RZBA 3DN5A 1XGZA 4YPJA 2XH7A 5HDRA 1KFWA 4QP0A 1DP0A 2Z28A 3SCVA 1RD5A 3NQ2A 2PURA 3T07A 1NSJA 1YNYA 2UV8G 5K9CA 3RCMA 4I5UA 3NL6A 5ENLA 1H7PA 3QHOA 4UCFA 3FX4A 3MJYA 1PXGA 2BOFX 4C6EA 9CGTA 3D6NA 2OMAA 3G1XA 2CBJA 4IPPA 2GYIA 1ZL1A 1PTDA 4S2CA 1ADOA 3ARPA 2WB5A 1OABA 1NOWA 1KV5A 2TAAA 3DC0A 2E7FA 1BYCA 1NJJA 4GVHA 4LEQA 1HKVA 2XGBA 3TC7A 3RM4A 3MDWA 1SFJA 5BWFA 2J75A 1Q4NX 3BLEA 3QXBA 2JGQA 1RK6A 2YX0A 3PF3A 3SCRA 3HF3A 1BKHA 4M0XA 3GM8A 4MJZA 4IUOA 2XIOA 3SCQA 4AZ6A 3SZ8A 4X63A 3PPGA 1EO7A 1UKSA 2BSLA 5EU9A 1ONWA 1FWWA 3CQ0A 4WSHA 1PJ9A 3A13A 2PAJA 4UNKA 3CL7A 4CCZA 5G2IA 1CLXA 4UFLA 3WUGA 2VGFA 3VYLA 2VX7A 4FNUA 5CLWA 3SURA 1W1TA 3ECQA 1FQ0A 4EAMA 3PNZA 1DWAM 1WKEA 2HSAA 4P61A 3U48A 2ABAA 3OW1A 3KTCA 2D24A 3EZ4A 2PD9A 2C0AA 3WSUA 3NSMA 3HGOA 4B5TA 1KFEA 2PDUA 3GDRA 2ZA1A 1R5YA 2I9UA 1S1RA 1K4HA 4HCLA 1I0DA 4OE7A 3KOFA 4XZIA 5JXQA 2QF7A 1AVAA 3M0MA 4YS1A 3F5LA 4CQCA 2WC7A 4IIFA 1HJUA 2VO5A 4JOMA 1ZZMA 1A3WA 4GQRA 4L4MA 4NAFB 3B8TA 3JRKA 3VE9A 1JJKA 3M7WA 2GDQA 4P7QA 3ZIZA 2R1NA 2DQWA 1M6JA 4MWAB 3GQYA 1TVNA 3AIWA 2A3LA 3FW6A 4K7VA 1PYMA 1HJSA 3NQCA 1UBSA 1ZS2A 1L0PA 1E5NA 3BCDA 2R1MA 3N13A 5C2XA 5FIPA 2BODX 3BW2A 1DV7A 1TB3A 1E9ZB 1KD0A 2BVTA 3AYRA 1E51A 4MF4A 7A3HA 3P0WA 4PSPA 1C8XA 1LT7A 2EO7A 7ENLA 4ORIA 3ZJ7A 4ENLA 4JDYA 5D32A 4J3ZA 3LGEA 3ZR4A 4JTSA 1EWEA 2Y7FA 1H1YA 1PUDA 2NQLA 5BXTA 5D38A 1YNPA 3WLIA 2JBMA 5CCZA 4XAYA 2NVCA 1TV7A 2J8TA 4I6KA 4D6DA 4NZCA 2QDHA 4GLEA 2O92A 1WQ5A 1WZLA 3WNOA 1XCFA 5I0DA 4PC8A 4A2RA 2PTZA 1GQIA 3WENA 3NZGA 1GVEA 1WNOA 1Y65A 2F38A 3EOOA 2XSBA 2WPBA 2G96A 3EA3A 1ELSA 1WE5A 4GIAA 2R24A 3EKZA 1IIGA 4GI4A 4DYEA 6TIMA 3GNXA 1GEQA 4K8GA 1QATA 1NDZA 3LBCA 4MZYA 2BP1A 2VD8A 3L4XA 3W2KA 1G69A 2HS6A 3RMEA 1UPPA 4B90A 1IWPA 3MUIA 4FEZA 4GABA 2GOUA 2PA6A 4MAVA 3DYMA 1P6CA 3OVQA 3RFAA 4AU0A 4NJGA 3NAVA 2VCAA 3I10A 2PWHA 3GZ3A 1I1WA 1G7VA 4D6IA 2VYOA 2VQTA 4Y6GA 4ZENA 4RE0A 5FF4A 1HL8A 1W1IE 4NZ1A 5F1VA 2CETA 1TV3A 2BFGA 5DRCA 4H6EA 1RALA 2YLAA 2E6AA 3NJ3A 1Y7VA 3G6LA 2P5NA 3DFQA 5I3DA 1K8XA 5KTLA 2AOSA 2DUXA 3WQWA 1I8JA 1ONRA 2DT0A 1JI2A 2AMXA 2DZAA 2CKSA 2VWTA 4MSSA 4ROPA 3LYEA 1CXIA 1ZPTA 3C8FA 3WDHA 4AVOA 3A22A 4KEUA 4JTQA 3LS9A 3IS4A 3AC0A 4G7FA 4IJRA 2OQHA 3LTPA 5LXXA 1KM0A 3GU9A 1P7TB 3A3WA 3FA3A 1ZBWA 4EVZA 7TAAA 2I57A 3VIMA 4W89A 1I2PA 4IPJA 1XBVA 3IJDA 2Q8XA 1VFHA 4B2DA 4CN1A 1U5HA 4UR7A 2YXOA 4JX5A 4JTFA 5D03A 4AAJA 3C0QA 2CWNA 1P1XA 2G3NA 4NYYA 3GXDA 4DF1A 3HB9A 1OX5A 1KC7A 1OFOA 5H8MA 1H7RA 4R3UA 4TO8A 3WLOA 2CLLA 3BJSA 3BICA 3MI2A 3MO7A 4FIQA 3TR2A 2OVLA 4GNVA 3UU0A 1VEMA 5I79A 1QT1A 3WNLA 1YDNA 4KESA 1XIBA 4WEVX 1NFPA 4WGXA 5T9BG 1SJAA 3UXLA 3CIXA 3WJXA 2OKOA 1KM5A 2XJ7A 4QJ3B 3WMLA 1QWKA 2X1TA 4NZ3A 3I7QA 5E6ZA 4UTIA 3GO2A 2O4QA 3HFYA 5H6HA 4F0MA 4L9ZA 3M0YA 5HANA 1S46A 3BQ5A 3YPIA 1O5KA 3WUBA 3ITCA 5K7JA 4DZ5A 3VKKA 1BLIA 2NT1A 2PBGA 1TIMA 1CXEA 3CUJA 2UY2A 2W79A 2FB2A 2QVNA 4FS9A 5I3JA 1LCOA 3VKAA 3F2BA 2E5CA 1R6WA 1UD2A 3ID7A 3E3HA 1XLCA 3KWSA 4PTVA 1ME7A 2OSXA 2W91A 3I6RA 1FY6A 2QCDA 3W7CA 4TVDA 3MMDA 2J6VA 4MYAA 4AZBA 1OGGA 1YBQB 3V18A 1TPC1 2F6XA 2GJLA 1S3HA 1I2NA 3LNPA 1PPIA 2NXGA 3TU9A 2I1OA 3WD1A 4E8DA 3APTA 1S2WA 3ZVHA 4WSKA 1TQJA 3DDMA 3EWZA 1GPFA 3AIBA 2RFGA 3DHUA 2OWCA 1YPIA 1R3RA 1R86A 3IEBA 4B5SA 4OGZA 1R3YA 2YCIX 3DERA 3W1LA 3M44A 4FIRA 3WLKX 3B0UX 1EJXC 3MCOA 2VZVA 3D3FA 2YA2A 2Q09A 2Y70A 2YLLA 3O6DA 1W31A 4RPPA 3RJYA 4H19A 1H1ZA 1H7NA 2JFEX 3WLLA 1KFCA 5DF0A 4JTEA 1DJQA 1W1ZA 3VD3A 4Q4SA 4C6QA 2DUZA 4KEMA 4HHPA 5CC6A 3BCFA 1IEQA 3BGGA 3GYCA 5A6BD 2ADAA 3NPVA 3A23A 1ZAIA 2J8GA 3WLNA 3NSXA 3SCUA 4IGNA 2QYGA 1PYFA 1R7OA 2P53A 3KBVA 3CTLA 3NTYA 5E93A 3K13A 3H22A 4QCFA 3ZWSA 1XD1A 4C6FA 2PDJA 3ELFA 2ZCGA 4IISA 4X9YA 3AUOA 4UTUA 4P5UA 1RHCA 3GTFA 1JPMA 3P82A 4ATWA 4D6HA 3TQKA 3AU2A 1WOBA 4L9YA 4UB9A 5CSSA 3GC5A 3W28A 1E4IA 3BAXA 1VHNA 4LCRA 4XG1A 3FSUA 4LC6A 3M46A 4N6FA 3L9CA 2QHAA 2BGQA 4GXWA 3L4YA 4GVFA 1M68A 1XV8A 2Z2AA 4R88A 2FPYA 2E09A 5TIMA 4FK9A 3L0GA 3HFTA 1CGUA 1X96A 3H26A 3EYPA 4S38A 1FWJC 1HXJA 1O5XA 4W86A 6XIAA 3Q37A 1NP0A 3WEMA 1ZQ5A 3RO8A 1LWIA 2XVLA 1OK4A 3ZLGA 1J9YA 4QE5A 2DSVA 3QVQA 2DZVA 4X0VA 4QBXA 2QPSA 6A3HA 3GNOA 3G2GA 2IKIA 3IIXA 4OBRA 2R94A 2QJGA 3VKBA 4JYEA 4WD0A 4GIEA 4F8XA 1TX2A 2OELA 2GGHA 2WV8A 3BAJA 3LU2A 1IGWA 4MB1A 2F6UA 2W0UA 2G97A 1YE6A 4X22A 4ZEPA 3S5YA 1M7JA 3MUCA 1OFRA 3NEHA 1WUFA 1XCXA 3TOPA 3GDMA 2BXVA 2VC7A 2GQ8A 1XIDA 1MQRA 4KKXA 4HU3A 2PP1A 2Y2WA 1T8QA 3AWNA 2VELA 2NVAA 4U33A 3NNTA 1A5NC 3BSGA 2Q01A 2ZDRA 3UG8A 3VNKA 1GKRA 4TX8A 1EDTA 3N2CA 4WDTA 1RPKA 5AKQA 3P14A 1V4YA 2HISA 1Q63A 3G24A 4OIFA 5C6MA 2CFFA 1OZMA 1QOQA 1GOMA 1VFUA 4M1RA 3WQ6A 3GFZA 4MB3A 1QBAA 3V5CA 4FLOA 3L67A 2WVSA 1P0KA 1N55A 4U10A 3PN8A 1RVKA 1JEZA 1FA2A 1EP3A 1HVQA 3RLHA 1Z44A 2ZIDA 5FF7A 1EIXA 1YXCA 4AVNA 3A3HA 3N25A 1OIMA 2C0HA 4HQVA 1CGTA 2C7FA 4L4LA 3LNMA 1TSIA 4UZSA 4QEHA 3KM8A 3POCA 4L7ZA 5HR7A 3I4KA 1UMLA 4PB5A 3UJ2A 3AXHA 3OIHA 1OEPA 5FJJA 4WIWA 4E4FA 3WUFA 5JU6A 1ZAJA 4XV0A 2HE5A 4O53A 4OECA 3O6AA 5FJRA 3LHVA 4B5XA 4ZOBA 3R0DA 4RNHA 5EKYA 2CNCA 3F4CA 3T8LA 3WJWA 1E9LA 2AGKA 1DTNA 2FTYA 1J0IA 3ARYA 1R9XA 2J7EA 2YYUA 3V5OA 5LNRA 4ZL1A 4EXAA 4XZWA 4QGCA 4UOJA 4PFHA 3N04A 4K8HA 3P3BA 5ABFB 1VEOA 1G0CA 1EFZA 5HOSA 3QR1A 1W3TA 1IF2A 4B4FA 2Y85A 4HZ8A 2WZTA 4EX4A 5LNUA 3AMCA 1AW5A 3M41A 2D22A 1I1XA 1Q5MA 3RLUA 2YR1A 3JR2A 2PDGA 1OFEA 3DCPA 3WX7A 1TJPA 4FX8A 2JIEA 2OWXA 2PDFA 1C8VA 1V6WA 3OGVA 2ZX7A 4AD0A 3R94A 4E8CA 3A6OA 3U2CA 5ABTA 3L7RA 3QLDA 7TIMA 1XC6A 1T6MA 2C1IA 1GKPA 3GVQA 4HSOA 1ECEA 1UJPA 4JQ2A 4H3DA 4LVGA 2YBUA 3ITXA 1N2VA 2WHMA 1TELA 1SMDA 4QROA 4XBKA 4HA0A 4M3PA 3PB2A 2WQDA 4CGTA 2F7FA 5E6YA 1H5YA 1IT7A 1PO9A 3NQVA 3A4JA 4GWEA 2EPOA 4GISA 2X7WA 2ZDSA 5HMSA 2VP8A 1US0A 3L4TA 2BXYA 1HZYA 1LWHA 3ZJKA 3PBGA 4ERAA 4JTAA 2EKGA 5A2CA 1F74A 3N18A 1Y5WA 2CHNA 4HMNA 4DBEA 1UKOA 4EWJA 2VUNA 3K4WA 3LCGA 2Q71A 2VX4A 3NDZA 1L9WA 4GI6A 1ZB5A 4XK2A 3NQ8A 3PZIA 4PGLA 3EX6A 3RK8A 3DFYA 3UWWA 3S42A 4O50A 3W82A 4YHEA 1SZFA 1MVYA 3RR4A 3U6WA 4ZA0A 3PAJA 5TAOA 1UUOA 3UY8A 5A8QA 3GXTA 2FLIA 5AECA 2V68A 2I5GA 4W93A 1SQ7A 5JIWA 2DZUA 3NCOA 1ALDA 5HMDA 2VHLA 3AJXA 4KWOA 4CQAA 4I6VA 4JFVA 3IUIA 3A12A 4HIBA 1KCZA 4UFKA 3EX2A 4B3KA 5D9PA 5HATA 3W7QA 2J7DA 1LQAA 2V5BA 3AHTA 4AHPA 3AHVA 4V28A 3AZTA 2X42A 3AIEA 1YTKA 4Q8MA 4AZ5A 3NYZA 1WXJA 5IFTA 1G7UA 5C70A 1MW3A 3AALA 3DAQA 4Q4KA 5ECUA 3DOPA 4JN7A 2X2YA 4FX7A 1RJRA 1PZ1A 2AKMA 3W7OA 1S38A 3HQ1A 4LUTA 2PRMA 1D3CA 4B16A 3VGEA 4RXFA 1SR9A 3BG3A 3EKLA 3T0CA 3E96A 2Z27A 6CGTA 1VRDA 1Q8AA 4DJED 5AHFA 3BW4A 1YRRA 3CHCA 1XIHA 4OFCA 4HJFA 3TXZA 2VVSA 3W9ZA 1GW1A 1VD6A 1WDRA 1P43A 1DQWA 3CZJA 2FPVA 1XISA 5GQBA 1GQNA 3DGRA 2G8ZA 2MUCA 4LUSA 2GSHA 1M03A 1WX0A 4CLMA 1UWAA 4Y90A 1SZEA 1GOKA 1EHAA 1W2PA 5I00A 1MDRA 4GZJA 4M6QA 4JTJA 3GE7A 3CAWA 3QFWA 1LROA 3WQ8A 1P0DA 1JUEA 4WJ8A 2OZ3A 3A5VA 2QCGA 2WCAA 2JALA 2ACUA 2B7NA 4MZ1A 1OINA 1BXBA 1BTMA 2DT2A 4OVXA 4KW2A 4AWSA 1ZHAA 4LOCA 4K8EA 4MLJA 3TP4A 4WKFA 2BHYA 2J7CA 3MT1A 2J27A 4Q4OA 1H2JA 3RU8X 2XFRA 4N4QA 3BPWA 3S1GA 1KA9F 1GQLA 1XR2A 2VTFA 3SN1A 1AK5A 3UR5A 5D04C 1X1OA 1DIEA 3T2QA 3L2LA 2I16A 3BAKA 4PH6A 4F0LA 5REQA 4KWSA 1TYGA 1VJIA 4Z1YA 3EMZA 1GUVA 3VI2A 4C6NA 1E6ZA 2VR4A 4O1EA 3NUKA 2QDGA 3MHGA 4D8ZA 4CUCA 4PMRA 3TK7A 2B0MA 3QKEA 1Q6GA 4MDOA 4AEOA 4HD5A 4K2SA 5A8PA 4QXIA 3VIJA 1UD6A 5BXPA 3WK0A 1TV8A 1HGWA 4M6VA 2P8BA 1G5AA 2CLKA 4GY1A 3TA6A 3BW3A 1MSSA 4CEXC 3L4ZA 2Y8UA 3O07A 2X1SA 4EF8A 3UG3A 4LBUA 3BV4A 1XF0A 2TODA 4QG8A 2YL9A 1W5PA 4B15A 3PZOA 1KRAC 3OIXA 2OEJA 4LEFA 3WDQA 3LPGA 3TSDA 1CB2A 3OTRA 2ACQA 3M16A 3EA1A 2WNZA 1X7FA 2ZX6A 3MSDA 3QN3A 3TDFA 2OKTA 3EOUA 3EWDA 1V3KA 3EBVA 1RQHA 4ZQNA 3VC5A 4AUBA 2WSKA 1YDOA 2DSZA 2GDVA 4N02A 3NPXA 4CCDA 2FGLA 3ERPA 3O1NA 4Q32A 1F5ZA 1BTCA 3MA8A 5MHBA 2HNHA 2ZZ3A 3B06A 3DYOA 3BMVA 3PSVA 1ZENA 2V9DA 2QIIA 1HVXA 3RM9A 4BQ2A 2QJJA 2RHGA 2VEGA 3NL3A 4FSAA 4G7EA 1XYCA 3RAOA 4NILA 1W5NA 1RBLA 3CWNA 2EHHA 3KCLA 2VEKA 3QHMA 3AXXA 3PTDA 1J10A 3VMNA 5C5YA 4LVBA 5EMYA 1F6PA 1JIBA 2J88A 2NZLA 4W7UA 2Q8LA 2PWFA 4UUIA 1O95A 3PFRA 3RDKA 4AZGA 4Z1AA 3V5FA 3E0VA 4IMDA 3W70A 1B9ZA 3OZYA 4JX6A 1YPXA 1S2UA 3KS6A 1FWDC 3W7KA 2D73A 1TJ1A 2VURA 5LNVA 4GJ1A 4GH3A 3UWYA 4F9DA 3WL0A 4PTMA 2HBXA 1EPXA 1VFSA 1W2VA 4KFOA 5CAHA 5DXYA 3EXRA 2PGFA 1DJWA 1VENA 4WK9A 5EB8A 2J6XA 5T26A 1OCNA 3PZVA 2ZXBA 1EXPA 3VNIA 4O13A 1X6LA 4CNNA 3MANA 1E0WA 3REQA 1DVJA 2PDLA 2EG7A 2YIHA 1JPDX 5M3WA 4PB3A 4PL2A 2DVXA 1VBHA 4GIYA 4N7QA 4B2DD 4FO4A 1RVGA 1EUAA 3W26A 1S5NA 3VGFA 1K03A 4RZ4A 1GWJA 2Y1HA 1OX4B 1O5QA 4O16A 3UZWA 3ZSSA 1YPFA 5HWMA 4G8TA 4J28A 4AEEA 1SZNA 1XSJA 2YOCA 5F2LA 3FXYA 2RUSA 1OBAA 3OLGA 2CLPA 3UA3A 3ZQ9A 1VBRA 2HS8A 5FKYA 4N2YA 1W5QA 1X1NA 5EY5A 1RBAA 3SQMA 1GQJA 3NZ1A 1S5VA 3H2NA 1NU5A 3G8RA 3RX4A 2NWSA 4NZ4A 3M0XA 4J4KA 3WH6A 4L5ZA 5DRIA 1VEPA 3C52A 3LBOA 5I3FA 5K9XA 4CU7A 4Q6JA 3WO8A 4C7GA 3CS2A 4JIHA 1NFBA 1XINA 2WBGA 3ZJ6A 4PYSA 4BHYA 3SW6A 2VOMA 2GUBA 3WBYA 5CGMA 3B3DA 2WW5A 4H9ZA 2BY1A 3B9DA 4LANA 5EGRA 3GR4A 2VUYA 2CXEA 3CQJA 4RX0A 3WF2A 3VNMA 1KLYA 2VRQA 4HZ6A 1FWCC 2UBPC 3UWZA 4GO8A 3VGDA 1UG6A 3TZNA 4XSMA 4WR3A 3GNNA 3K1GA 3UG5A 3WQPA 1XP3A 3O63A 1B3YA 2Q3RA 4EP8C 4UTHA 5DCBA 1HJXA 2QCHA 3RGTA 4EACA 3J7HA 1OY0A 4JTKA 4AH7A 4G1KA 3IRSA 5CC7A 4GY7A 2OTDA 4AIUA 2J79A 1QPQA 1U30A 5C54A 1D8WA 4JX4A 1X6UA 3I4EA 2AQWA 3AXIA 3MUXA 1JDDA 2QCMA 4AIEA 1JCTA 3E9AA 3I3EA 4U28A 4QNWA 4JTHA 1KCXA 5B7YA 1H3GA 4AISA 4YCPA 3SY5A 3R25A 3IJ9A 4NNAA 1FH7A 1TREA 4ZGYA 5ABFA 3TFCA 4R27A 3TSBA 1V3LA 4WOZA 3REQB 1BWKA 1XYBA 3F7JA 1JQXA 3AS1A 1LRTA 1E4LA 1NARA 2DIJA 2QULA 4IMFA 4A21A 1NWRA 4JS3A 3TQPA 2FH6A 1B54A 3HU7A 3ZR6A 3LHWA 1DTUA 1YADA 2I7GA 4IGSA 3M5ZA 1EC7A 1V08A 4IMEA 3BLKA 3EWBX 4LJ3A 4AWEA 3WYZA 4POCA 1TMQA 2QNEA 2Y8VA 3URAA 3DEQA 2JQXA 1XC4A 2Y5EA 2Z1VA 2CC0A 1XCWA 1PKLA 1KCLA 3ZO9A 4GYPC 3SADA 3DFNA 1KBBA 3TIMA 1G4PA 4ML4A 5GJMA 2YBVA 1XLIA 1TVLA 1VP5A 2C8NA 1UPMB 4GFIA 2V3FA 1NOUA 1EDGA 2DDXA 4LVFA 1BVWA 3N34A 1TA3A 4MGGA 1RP8A 5HQMA 2XVKA 1B4KA 4TXEA 3FIGA 3MZ2A 4GCAA 2EPLX 3W02A 4JYFA 4R85A 3K46A 3TYDA 3SSZA 1XSKA 1H4PA 1V7AA 4AC1X 1XX1A 3KVKA 2XFFA 1TMLA 4MWAC 1G67A 1HJVA 4BCEA 1RPXA 1AODA 1TPUA 5BU9A 2QEZA 3FDKA 4C6OA 1YIXA 1DWFM 1EH9A 3QEZA 2VFIA 2DT3A 4GZ7A 3FYYA 3NQFA 4YTRA 4GQ0A 4LV9A 4DF0A 4N9CA 5HMEA 1QO5A 4LNYA 1DXIA 4OUEA 3LPOA 4Q3MA 3V35A 1ZCOA 1GVFA 3M43A 1HW6A 3S6DA 1DIKA 1A47A 4Y9MA 3TQVA 5AHNA 4HSHA 2P10A 2O4MA 1QFEA 2VI0A 4JQ3A 1KXVA 2E9MA 1Q6LA 2CKRA 3SRDA 3G0SA 4LC8A 1QNOA 2XZ7A 1DEDA 2C18A 4YN5A 2A79A 1JGMA 4KEVA 1M7XA 1E72M 1EGVA 3B8VA 4Y9AA 4NX0A 1BYAA 3W29A 4M80A 2ZZ5A 1BF2A 1IT8A 1ONXA 4HYWA 4F2BA 4JD4A 3UT0A 1VYPX 4BFAA 3PBMA 2YGYA 4LBRA 5KITA 2YXXA 1FTXA 1WAWA 2QV4A 4PUUA 1RUSA 1M7OA 3IACA 2VFEA 3W4RA 3I68A 1UR4A 3R10A 4CVWA 1OGBA 4EF9A 4LF1A 4BEQA 1C90A 3ITLA 3GHUA 5E0KA 2WHKA 3R1ZA 3OP2A 3S1VA 3IGHX 4HZ7A 4H2HA 2BV9A 1J11A 4KF1A 3QV9A 4GUHA 4G1NA 2FJKA 3S2NA 4I9AA 2NQHA 3UVAA 3L68A 4P7RA 3BGAA 3XINA 1XIIA 5DMYA 1VF8A 3V7PA 3SEPA 3F2CA 5CBBA 3AJ7A 3HQOA 1WDDA 2LLEA 1OD8A 1XHGA 4Q6XA 1QPKA 1JNDA 1SR0A 3OGSA 4UQAA 2PTDA 1G4EA 4PCSA 2EF9A 1WAUA 4DI8A 4DBSA 3O7UA 4M82A 3UD6A 1PIIA 3QJAA 1WOAA 2Y7EA 1OGSA 1Z8AA 3HMJG 1CXHA 3C8NA 1E71M 6REQA 1R2RA 4O14A 5DQPA 3THDA 3RCNA 3VIHA 1XL9A 5RUBA 3MMWA 1QNPA 4JTTA 4LUTB 5HNNA 3K30A 3L4WA 3MV01 5EPDA 1ZNNA 1NF7A 2OLHA 2UY3A 4L61A 1S5MA 1B5TA 4CKQA 4JQAA 5FI8A 4KRUA 5D8ZA 1O12A 1OF8A 1PB0A 5AN7A 4H8HA 4PRWA 3FHAA 4IIHA 1JD9A 2XIIA 4P8XA 3R0UA 3I6TA 3UERA 2HK0A 3KOYA 4B4HA 2GJNA 3SCTA 4OBTA 3IGSA 5LYRA 3W74A 2GWGA 4J3XA 3RPDA 3WEOA 5M1TA 3PJWA 4O54A 5A8OA 1NAL1 3NQGA 1JUKA 4NT0A 4ZSUA 3CYJA 4WY0A 1U5JA 3EPOA 5D9OA 1J6PA 3NQDA 3S83A 2D20A 3LMZA 2QMKA 3VMPA 1HT6A 3MS8A 2WKJA 2X1IA 1MW1A 3AHZA 1XYLA 4HN8A 4UFIA 2WMKA 3W00A 5A3HA 1JYWA 4E2BA 4L4PA 4KPLA 4I8YA 1BHGA 4NHVA 4K3ZA 3H21A 1EZWA 1NDYA 4GZEA 2QF8A 4Q8PA 2OB3A 3RG6A 2VEIA 1SSDA 3ZYZA 2BHUA 2UWFA 4UBPC 2CITA 1LQ0A 3SECA 3W2MA 2YDQA 3FJ4A 3O15A 5EBUA 1BFNA 1U33A 4LW7A 2G37A 2YFNA 1XFCA 3MUZ1 2ZA2A 1ME9A 3KTSA 2VR2A 4Z08A 4ECLA 2O56A 1ML1A 3PS7A 4IP5A 2PC4A 2QGHA 1B3VA 2FVLA 1XIEA 4Y2WA 3PY2A 1AQMA 3II1A 2D2GA 1XG4A 3TQ0A 1HGYA 1AQHA 4LB4A 3TYCA 3S1XA 1MO0A 2VRJA 3FGCB 3ZVIA 1LTDA 2DSWA 3VDBA 5D30A 3EX3A 4ZTYA 4QQ3A 3NL2A 3OA5A 5AYIA 2V69A 2DZBA 4LYRA 5G1MA 3VNLA 2VFGA 1U1UA 3URNA 2HXTA 5FAGA 1FWGC 5AHMA 4U3CA 4H83A 3O9NA 1KWKA 3OVPA 4PB4A 3P6LA 1A5BA 1GHRA 5LA2A 1W6TA 2OO6A 3E5PA 1IWBA 1XDMA 2YW4A 3BVJA 3CUGA 4Q8OA 1MDLA 4PMYA 5DX7A 1CB7B 4GNKB 3QC3A 4X61A 4RR4A 1NQ6A 2DVUA 1L2UA 4I9MA 1OFDA 3TJLA 1R30A 1DHKA 3WK1A 4H04A 4D1IA 2O7QA 4AWUA 3TTYA 2WMJA 4WJEA 3VIKA 1W3HA 1MMFA 4Z42C 1EXBA 4E6MA 2Z6JA 3JZUA 3OA3A 2FGBA 1E9YB 3EA2A 1V6UA 1XYMA 4GGHA 4JICA 1TO3A 2V5KA 4ZB0A 2DFAA 4YVXA 1LBFA 2QCCA 4J2PA 3OB8A 1EGZA 4QE1A 1ITXA 2TYSA 3C0LA 3GAYA 4WDXA 1EZ2A 2R8WA 3GIYA 1BYBA 4BQ5A 3ZM8A 2E0PA 3TN4A 1JCMP 4EK7A 3SAZA 1B0IA 2AAMA 2GZXA 2SFPA 2CHOA 3STGA 2B81A 4LH8A 2ZZ7A 4O19A 3SJNA 4QE4A 1V3MA 4AWTA 2J8FA 3VD9A 3WQDA 4RZ6A 1A0DA 1Q85A 4MUPA 3MP5A 1ZBCA 1QK0A 5MKGB 4LYQA 3W24A 4AB4A 3FKRA 1PZ3A 3W88A 3MKVA 1EQCA 1UR1A 2EQDA 2FYMA 3H4WA 3L5LA 1JZ6A 2ESCA 1DWHM 3OLDA 3CZLA 3CHFA 4PMJA 4DXKA 4MVAA 4PMNA 1H62A 4NUWA 1O68A 4MM1A 1M01A 4EPDC 4ACYA 4MLRA 4AY1A 4NZFA 1PX8A 2P76A 3HGRA 1ME8A 1RCXB 3TAOA 1TG7A 3NM3A 3IPWA 1NWSA 3DI0A 3IVSA 3IJQA 2VQUA 3TMQA 2VFDA 5CQ1A 3T44A 2MNRA 4UTTC 1FWIC 1SJDA 3HMCA 1MXGA 2XHYA 5BOOA 3W22A 3LG3A 3ABZA 3PP7A 2RDWA 4HHLA 4FXSA 2AMGA 1CGYA 1W3LA 1XYZA 3A24A 1JFXA 4QR6A 3AQUA 3GFYA 3OJGA 3WNMA 1ITCA 3SR7A 1RQEA 2J62A 4ORMA 1DHPA 2VNCA 1HP4A 1C8QA 4M81A 3P62A 1XSIA 2RH9A 3POHA 4IXXA 1JYNA 2QJIA 3EWCA 3R79A 3CQIA 5FSEC 2NV2A 5CJ5A 3B0YA 4MKSA 4AX6A 3LRLA 4PCTA 1W17A 2R1PA 1H7OA 4DZHA 5C2CA 3THAA 1XW8A 1IEWA 5A6BA 4B5VA 3B9EA 4YWSA 1E1CB 3MBFA 4IQDA 2WMIA 5D9MA 5M17A 5EL1A 5HAOA 1H51A 4RNFA 3O6CA 2OR2A 2ZUWA 2Z1XA 2QUTA 4PEEA 1YLVA 2HJPA 3GR7A 2JGYA 1M65A 4N9BA 5LHEA 1FUYA 3MW7A 3H8AA 2W66A 5LSMA 1UKPA 4NSBA 2VZOA 2Z25A 2UZ9A 3BCJA 3RCYA 2A0NA 4W87A 4Y8EA 4NNCA 4XTIA 1UKQA 2FDMA 2GQ3A 2P3EA 1NVMA 4DO4A 3BQ6A 4PA8A 1H1NA 1P0NA 2PDYA 1LBLA 2BVYA 1QCWA 1ZP3A 3VOCA 3FJLA 1VLWA 3MZNA 3AIRA 3LEPA 3HM7A 1H41A 1HKJA 3EWUA 3GDKA 3GVGA 4HU4A 5HQLA 3CWOX 2EGZA 3N9RA 4MY9A 1KW1A 2CBUA 3M6YA 4K1GA 5C2GA 2J66A 1EOMA 4CD6A 4KRZA 1OB0A 2CW6A 2D69A 1LP6A 3HA1A 4EPEC 3T55A 2QPUA 1ISVA 3PTQA 1QI3A 5BYWA 2WPGA 1E70M 3QY6A 4XB3A 4GJJA 3T2PA 2F6KA 2XN2A 3VIFA 1AH4A 2QMJA 4X2PA 1ODUA 3ARUA 3M0HA 3INPA 1EBGA 4K6AA 4UTLA 3WF0A 4HK6A 3BGJA 2AL2B 3DUGA 1MXDA 1GGOA 4N6EA 2PGRA 2NSXA 3WF3A 3AI0A 3KBJA 1W0MA 1EYEA 2GGIA 4Q8NA 4HHHA 1V02E 4C1KA 3Q94A 2YZRA 3GU1A 1KXTA 2R14A 3VO0A 2PDHA 3OO2A 5DY2A 1TKKA 3BZJA 3KP0A 2IQTA 2TSYA 1GYMA 2GGGA 3BSHA 3OHIA 1KFJA 3RRXA 1R2TA 1QJWA 4MOZA 1FX6A 1QOXA 3KP1A 3EX4A 4DLMA 3WJZA 3M1ZA 3NZQA 2CLMA 2HZGA 1HKMA 5DEZA 2VENA 1RR2A 2D2HA 1UWRA 1Z41A 3TLQA 3AMLA 1XWYA 4S3BA 3CHEA 4CQ9A 1EJSC 4IMCA 5HUPA 4BK9A 1F6YA 1TZ9A 3IARA 5AFDA 3B8UA 3M7SA 1OFBA 4FZIA 3W1RA 4JXCA 1XUUA 4DWSB 4JCMA 4KCWA 2E9LA 3P67A 4BF9A 4QCEA 1Q45A 3BWWA 3ABRA 1AG1O 4OJYA 1S2VA 3LQGA 4GC4A 1DQXA 4IG2A 4Z0SA 1GJUA 1K7XA 5BW6A 4KT2A 3SGZA 3OBEA 2XIQA 3MO4A 2I5QA 3MP3A 2PDWA 2VJXA 3S9IA 2OZ8A 4CNUA 1EJWC 5I2UA 3FN9A 4J5NA 4RXGA 4IP4A 3L2MA 2FH8A 4E2OA 4ZO7A 1SW3A 4RV3A 4EPKA 4NJKA 1TFVA 3CAVA 2OYKA 4FNQA 2V3GA 3BMXA 1N82A 4V1XA 4CNOA 4XVEA 1ZJBA 3VINA 1JPIA 1HIZA 2EPMX 4UQDA 1UP2A 3NQAA 3DG6A 4I7VA 4N0RA 3CB3A 3WFZA 4DM1A 4NF7A 3P7YA 1DQUA 5CKSA 1IXOA 2Y5JA 5D9NA 3RITA 4LAZA 1F7BA 1ZJAA 3P8IA 4YLWA 1R0MA 2B7QA 4OV9A 4Y9PA 4BEUA 4HPJA 2VFFA 1LUCA 2X2GA 3T6CA 2V2HA 3ABOA 2NX3A 3WQEA 2CEQA 2ZRXA 4JL2A 2PDMA 3XIMA 3ARXA 3W7IA 8RUCA 5FJOA 5JBDA 3USBA 3HZ3A 3EAUA 2WZHA 4AY8A 1W5OA 3Q65A 3SBFA 3IIPA 3VKDA 3G1AA 3KUMA 4JTLA 4DO6A 3GDBA 7REQA 3H7VA 3TKFA 4MKNA 1XLAA 1GVQA 2GUYA 1F76A 1B3WA 3A5FA 3AS0A 3WBXA 5K9DA 3LCWA 3ARZA 2CESA 4REQB 3AAMA 3CUHA 3QV8A 1KM1A 2ZRZA 1IR2A 4Q4MA 4CQDA 2VGBA 3AICA 5CPQA 3KBNA 3KXQA 3GYEA 4HJWA 5HBFA 4I7UA 1HF6A 2W61A 3VNZA 3I3BA 1JUBA 5H1WA 1GKQA 1VGAA 1CXLA 4CQ8A 4S2BA 1T7LA 5K4ZA 2GVJA 1OX4A 3LGDA 4XO7A 2HWGA 4JIRA 5A6LA 4L6HA 4PUMA 4GG9A 4D72A 4AD1A 1CT5A 4C90A 1IIHA 3E0FA 4DXXA 1KKRA 2DIEA 4GKLA 1Q65A 3G1DA 1DXFA 1SFSA 3SCPA 3RHGA 4GI8A 1RD6A 1UH3A 2A7RA 4HB7A 4HMEA 2OGYA 2A3BA 2OEMA 1EYWA 2X0SA 1XIGA 4IIBA 1IGSA 4RLIA 1R3VA 1W9XA 5KINA 4LS0A 4FX6M 3U4FA 4ZQOA 3M9YA 1WDSA 4AX7A 1QK2A 4UFHA 1UA3A 4HOXA 3VNYA 8A3HA 3EEGA 4K7YA 2WZIA 3R8HA 3G8EA 2VXNA 1L8PA 1R87A 3R5EA 4F48A 3G5EA 4XKYA 4AZ7A 2H3BA 4QITA 1VFLA 1FHVA 4JIQA 4DJFD 2XIBA 5HJYA 4W7WA 4XAGA 4QLJA 3O06A 1GJWA 1S1PA 3APGA 1SO4A 2X0HA 4W9TA 3QRHA 4Z17A 3ABSA 4V2XA 3R7MA 4DBWA 1UIPA 4ASTA 1R3WA 2XG9A 3RLVA 3SY8A 3B8DA 4JR5A 1CENA 1KWGA 5IDZA 3NQMA 4BWLC 1IWAA 4NI3A 2ISVA 2VDHA 1K4GA 1W3KA 1TPWA 1KTNA 5CG0A 1G4TA 4QIUA 5CPSA 2QDDA 2NV9A 1ISWA 3OZOA 3VNDA 5ABGA 3WD4A 4F0KA 4IL2A 2HRWA 3TLLA 3DBPA 5E5CA 2Y6ZA 3THUA 2ZC8A 3OHMB 5FEPA 1C8YA 4Z2IA 1YXYA 3A47A 3DECA 3QQ1A 1R85A 2DZPA 1AJZA 3RILA 4FR6A 4HNTA 2EPKX 1VHCA 4GH1A 1FWAC 3VD5A 2HBVA 1TR9A 1YQ2A 5D2YA 1W1PA 5A6SA 4GYPA 4GRSA 3S5OA 2ZQ0A 2BMBA 3HGSA 2OG9A 3RO6A 4W85A 3B03A 5FD0A 4O1DA 3MB9A 3PTKA 3G6MA 3H6OA 2HVMA 3IJ6A 3T0TA 2JKAA 2Z7KA 3ZXWA 3CLWA 4Q4QA 3IK4A 1VCFA 1VFOA 5AZ0A 1JPHA 3LTYA 4GKTA 4LQ1A 1CI1A 1CXFA 3GC2A 1BD0A 2OXNA 3UVIA 3QSRA 5LZLA 3SGGA 4GUFA 1EGMA 1A3HA 3FY1A 1F3XA 3RX3A 4AZHA 4PUNA 5E70A 3HURA 3THQA 4C6KA 4I9JA 2X40A 4Y7EA 3QPEA 3E0LA 4TQTA 1X6NA 3WBEA 5LA1A 3TNOA 3EDEA 4E2VA 2DSKA 1AUSL 1LORA 3WMSA 1EB3A 1TUFA 3KL0A 2ZBTA 2BX7A 4EWND 3G0UA 3BXWA 2YCEA 2VWSA 3W86A 3P84A 3E0WA 3CXOA 3O16A 2WO5A 1J6OA 2Q02A 5A8MA 3LV6A 3JU2A 3TJIA 3B04A 3VCNA 3VNJA 3QMTA 1EL3A 3UZXA 1LG1A 2FVMA 4F0SA 1EF3A 1KXQA 3TUUA 4FF7A 4I5XA 2EBNA 3L66A 4QRNA 3FGCA 4UQ9A 1YE4A 3S5NA 5LNSA 1EDQA 3EOEA 4ES4A 1TV2A 3FHQA 2WMHA 3L0NA 3KOXA 2J9ZA 2GK1A 1R3SA 3LCXA 4Q8VA 4GZIA 3PBYA 3U7VA 5CXPA 2NUXA 2HEJA 1HNYA 3Q45A 1PAMA 1Q7ZA 1J18A 5AYYA 2B4GA 3BLPX 2WANA 1TX0A 4H41A 1BPLB 1DJIA 3DKJA 2CLEA 3C2RA 2PE4A 4LU0A 3GNDA 4JHMA 1V0MA 1Z48A 3EX1A 4H00A 1XPYA 1B57A 3N4EA 2OLAA 5D8WA 5JBEA 2G3JA 3HJZA 1GOWA 4LUSB 3N9KA 3MVIA 3C2FA 1VAHA 1WUEA 4V1YA 2NWRA 4W88A 1DWJM 3W1XA 3TNBA 3L5MA 3AIQA 1X97A 4R7JA 5KETA 2XISA 4MJ4A 2GGJA 4C6CA 3NO5A 3BG9A 4Z2LA 1FH8A 3MWAA 4MNLA 5FJTA 3T4WA 1EEPA 2F61A 4IX0A 4Z1CA 3WLQA 4AXNA 4K39A 2OX1A 2I9EA 5J8LA 1WBJA 4YJ5A 1F4AA 1PIFA 1ZAHA 1H7WA 1UJQA 4ZOEA 3W73A 3NVDA 4QEEA 1IQ8A 1VB9A 3W38A 2E67A 4B5NA 5IFPA 1LWJA 7CGTA 4GI9A 2YYTA 3SJ3A 4IQJA 3S5ZA 1SMAA 4HVXA 1XS2A 4P7LA 1K8ZA 1Q6RA 1AJ0A 1UYQA 2QS8A 3LUTA 5C9ZA 2PU1A 2X1UA 3GG7A 2WK2A 4AZCB 2J9XA 4NL1A 3VKJA 1GW9A 3LQLA 3FYOA 1NH6A 3CV2A 1OG6A 4L4OA 4XD4A 3RPMA 5FSDC 3GNPA 1BXCA 1M04A 3KVMA 1L6SA 3PPCA 3FEQA 4KIRA 4D8AA 4R7OA 1XLHA 3WLMA 2IQDA 1ZGDA 3MHUA 3OVRA 2YB4A 2AQVA 4XX6A 3HO8A 1C7TA 1AQ0A 1HKWA 3U57A 1ZU8A 5A69A 1G4SA 5BU6A 4GACA 4HU8A 1O66A 1LG2A 2WSRA 3MYPA 2EG6A 4Q7BA 1F73A 2VZUA 1JXJA 3EPNA 5JVLA 3W23A 1UWUA 1V0LA 2Z26A 3GAKA 3PR2A 4QDPA 4S23A 1A5UA 4P7OA 4B5UA 1YBQA 2W3ZA 3W2LA 4PMOA 1SZRA 2ZZ2A 3FCPA 5HWNA 3P5ZA 2VDGA 3GU2A 4NJJA 1TQXA 4NAEB 5EBAA 5KZDA 1H11A 4HNCA 2Q3OA 4PMUA 1PVNA 5XIAA 4D9PA 4BKNA 5K3VA 2BS9A 4M7TA 4HYVA 1PSCA 1KM6A 1OCJA 3I7RA 3WQVA 4NP7A 2RJGA 2WNNA 4H9YA 3PK7A 2CCRA 4PMDA 4PFMA 4GE8A 3KOZA 4OTKA 3LZ5A 1FXQA 1V0KA 5T9CE 2HK1A 1EP1A 2Y61A 1IEVA 4JAWA 4V33A 3O3RA 4UC5A 1Q3NA 4RDVA 4AD4A 4ZODA 4LS1A 1XG3A 5A6AA 5AYXA 3PZTA 3H7UA 2GPTA 3BAIA 3SCNA 3ME3A 3R4IA 2ISWA 1CGVA 4B9YA 4HPHA 3CT7A 3BJTA 3NFUA 2E6DA 4IIEA 3GDTA 4L9XA 2HQAA 1I2OA 1WDPA 2Z2UA 1WKDA 3FVDA 2GGEA 2V6AA 4MB5A 3BOFA 3G3DA 1Y5VA 4W8LA 3S2MA 4Z2KA 1SO3A 4P8UA 2PCQA 4JIIX 3BAYA 3VOIA 4HA1A 3FFSA 4S1FA 3WLHA 4HZMA 2ZRUA 4Z1DA 3E38A 3KVLA 5C71A 3SRFA 5CC5A 3AMGA 5AYBA 1V79A 3IIZA 2WM0A 2NQZA 4FXRA 4B9ZA 5AOUA 4J40A 5A2AA 3USZA 1CLKA 3OLIA 5J5DA 1R8LA 2ZYFA 2ZUNA 1UD3A 3M0KA 4A6GA 5IM51 3OG3A 4UTWA 4GOAA 4FOJA 3TX9A 1VCGA 1DE5A 3MKKA 3OPSA 4XTDA 3WDRA 3FK4A 3UZ5A 3VCCA 4E0CA 4QLKA 4UXDA 1POKA 4S3JA 1XH2A 1LLWA 4DJDA 1FBAA 5LIXX 3V0TA 4DJEA 1E5JA 3R12A 3ZLHA 4JN6A 1K70A 3M0ZA 1EJTC 2VEPA 2P0OA 3JS3A 1IZCA 4B91A 3MU7A 4KEZA 3B8IA 4CCCA 5KSWA 1J0KA 3WL1A 4HCHA 1E0UA 3O0KA 1NP2A 3W2JA 4QS6A 1W3JA 1L6YA 5JUVA 1X1ZA 4RPQA 1K6WA 2OYMA 2PBOA 1KGUA 4LF2A 1TRDA 1WA3A 4JFTA 4IXHA 1GTHA 3L12A 4JTUA 3TJ4A 1UZ1A 5BRPA 4IFOA 4TUFA 3VZXA 3H2OA 1RBOB 1REQA 2P50A 8CGTA 2X7VA 3W75A 1M7PA 1GYNA 2VC5A 2YDAA 1WXZA 5DO8A 1VBUA 4KWUA 5BOEA 4XZ9A 6PTDA 1H0IA 3FLUA 1A5KC 5FA5A 1L6FA 1PIGA 3DZ1A 1QI4A 2YZ5A 1QW9A 2A6LA 2DZTA 4ZBCA 3ZWTA 3BLLA 1QVBA 1MYRA 4ADSA 4L1XA 3L5AA 5CSYA 4B5WA 2CU0A 2PCEA 1QBBA 4ICNA 1ISZA 1ZRQA 3H2MA 1E6SM 3HJEA 1FXPA 3EWXA 1DE6A 4F9JA 3UQNA 1DIOA 1PZ0A 3A4XA 4DN1A 1JZ2A 1OFQA 3GBDA 2E40A 3E5BA 4CCEA 3LD5A 3MDUA 5M03A 1QNVA 3BV7A 5DMNA 4W5ZA 3I6EA 3U2ZA 2PMQA 3S0CA 3RU6A 3M6DA 1CIUA 2VX5A 3PSWA 3UPBA 3GW3A 4A8RA 2D23A 3NWRA 2ZICA 3NQ7A 4HMCA 3SO7A 3AXKA 3CNYA 5T8GA 2GOKA 5AY7A 4TTUA 2J47A 2WSPA 1Q6QA 2ISSA 4HTBA 1NQKA 2XIMA 2Z1SA 2YL6A 1OYAA 1R9ZA 5JBFA 2BGSA 4O1BA 1GPWA 5B7ZA 3GTNA 1AMKA 2XFYA 1JDEA 5AC6A 2J24A 5F1UA 3N14A 5H2ZA 3RPTA 3OG2A 4KWVA 4MNMA 3HQNA 3PM6A 3STFA 3C2EA 1LZOA 2ZRYA 5CPMA 1F05A 4XZMX 3W7JA 4ZSTA 1H61A 4PBGA 4B3LA 4RNIA 5EMKA 4U4MA 4Y9NA 3G3MA 2QLYA 2FMNA 8XIAA 2BWGA 1IEIA 4O15A 1QWGA 3FJNA 3VZZA 1HJWA 1TWSA 2P88A 4JQ4A 2CPUA 3WQ4A 1VQTA 2EJ1A 3LLXA 1DYSA 3ARVA 3CH0A 3LHUA 3W27A 2QJMA 3FA5A 5AC4A 2VFHA 3KBWA 4G56A 3WBAA 4W84A 4WDUA 3EDJA 4BJHA 2HNEA 1AH3A 2A5HA 5REQB 1RK5A 5I77A 3HIJA 3QMRA 4GVIA 3UWQA 1FCVA 2CYGA 2DP3A 4TX6A 1C9DA 4RUBA 3N6HA 5HNTA 4M29A 4KS0A 4IICA 4KIEA 1E1FA 1QMLA 2BY2A 4US5D 4ZXLA 3GNRA 3TXVA 3I7SA 4GINA 3CTTA 3VDAA 1KV8A 3WQOA 4B3ZA 3Q4DA 3QPYA 3LZ3A 2VM8A 5IHRA 3WLRA 3CMGA 2H9AA 3CH9A 4O12A 1V6XA 1C9WA 4H6KA 1J0YA 3MUY1 1FDYA 1KM3A 5BOFA 3UG4A 2D0HA 1VJZA 2NXHA 2WSYA 4WY0B 2R1LA 2BASA 3CIWA 2PP0A 4RL3A 4HPXA 1P7TA 2E6YA 4PRTA 3N4AA 4KRTA 1WPCA 3QSTA 3B0VC 3MJMA 3UR8A 4S39A 4QG6A 3LDVA 2W9MA 3D5HA 5AHIA 4X2RA 2XTKA 2ZFAA 1RA0A 6TAAA 1UR2A 3EEZA 3VIIA 3STPA 3R43A 2CHRA 3TYBA 1I6NA 3DHPA 2J7GA 3K5XA 4GQQA 3W6LA 1LRQA 3C2YA 1H49A 1JL8A 2BY0A 2DZXA 3WMCA 5CEWA 1R2SA 2GSJA 1QRQA 3GTIA 2WNQA 4IOTA 3N2OA 1Z7AA 1XIMA 4Z2HA 3GG1A 1EPVA 3QTPA 2ZUVA 3M0JA 3VIPA 3KCOA 1S5WA 3Q58A 2NUWA 4QAWA 1E6QM 3W37A 1GCYA 3S2JA 4HBKA 1JZ3A 3ARWA 2HXUA 3O2LA 4ZQRA 2BNJA 3U7BA 1G6CA 4M8UA 3WFLA 4JPGA 1VYSX 2YA1A 3V4BA 2HPIA 1AA1B 4GQBA 1OC7A 3PUOA 2WMGA 4BI7A 1E6PA 2IKGA 1MRAA 1RQBA 2O9PA 1W5MA 5DBUA 2NQ5A 1ZJIA 2WJDA 3ARTA 3W25A 3BG5A 1KGXA 3GWQA 5CSUA 4PR4A 5KMYA 2D1ZA 4NY2A 3DESA 3SDOA 3A3XA 4C6JA 4CNPA 1EEXA 4ACZB 1B3OA 2DH2A 4BZYA 3C2OA 5F2GA 4WF7A 3H23A 3V16A 4CD7A 2XM2A 4TVUA 4DBDA 2O9RA 1PDZA 5C7HA 3T8QA 3FV9A 3SIMA 1UWTA 3VPLA 3WIJA 3FDGA 1M41A 1HTIA 2WVVA 2HMCA 4E3VA 3Q2DA 2ZX5A 2G95A 1D9EA 4HNLA 2E68A 1KBIA 3T2OA 2XZ9A 1B3XA 3NPWA 3WZ0E 2H90A 2ZVRA 2WHJA 4JQ1A 1GQKA 1VBGA 4AW7A 5E9AA 4OWGA 3WN6A 4DF2A 1IHIA 1RA5A 3AROA 4TOQA 3GHSA 5A94A 1CXKA 2QAFA 1G94A 3D3AA 4Q7NA 3VVGA 4DUOA 3KHDA 3NL5A 1TJ2A 2XSAA 5D37A 1POJA 2Q6ZA 4MJMA 4C1NB 4XBSA 2X8RA 3TYZA 2ZRWA 4UFMA 1DWGM 3CV1A 1XLFA 2Y7GA 5A6KA 2ZOXA 1X38A 4BR1A 1K9TA 2X09A 3PZUA 1DJYA 4ICCX 1IZKA 3HQPA 5LKYA 2E8YA 3HGJA 1V0NA 4O18A 2R9RA 3LRKA 4BI5A 1TPEA 3UEQA 1CWYA 1MFUA 2CWXA 3AIUA 1OFAA 3W7LA 3W07A 3GC4A 3GX9A 1RH9A 3PPHA 3URQA 1BVZA 4MTVA 4QFUA 1V3JA 3QR0A 1DPMA 1RJPA 4LBSA 1UWSA 1GOQA 4O4VA 3U5YA 3ATYA 1A5MC 4B92A 1OD0A 3LCHA 1UZ4A 4HMDA 1FOBA 4M6PA 3IAQA 5LXEA 3LSBA 1F8MA 4C5ZA 4H9TA 5BXSA 3MSYA 4DWSD 2WKGA 4NAFA 3W1PA 3WNNA 4TTGA 1Y0EA 2GLKA 2W92A 1I60A 4XSLA 1TVPA 3MUAA 4AQLA 5BRBA 4Z0JA 2HV5A 4M51A 3R8RA 2QR6A 1IE7C 3UGVA 3GHRA 4DI9A 3R8GA 3UYIA 1JZ4A 1N7KA 3ATZA 3GSMA 4CVUA 2YPIA 1MW0A 1Q4WA 2PRHA 3G22A 5FESA 3TJXA 2EPHA 5SWUA 2XUCA 3VCRA 5MKGA 5KZMA 1HUVA 4DZIA 3AISA 4DXVA 1OWQA 2WKLA 3QHNA 3W81A 9XIMA 3UPWA 1R9YA 3E12A 1QW7A 1NWUA 2CZEA 4HOZA 1ADDA 4WKHA 3N11A 4BQ3A 4XKYB 4BI6A 5LNWA 1BVNP 1CTNA 4FLRA 4L64A 3RF9A 3VGGA 4MZ8A 5EYWA 1A50A 3NM1A 4LRTA 4HNVA 1O60A 3LXBA 2DW7A 1SYTA 3LM3A 1KB3A 3RM8A 3ALGA 5C9RA 3DKLA 3PUDA 3TOYA 1JCNA 3O8AA 1HL2A 1U1HA 1NDVA 4DEFA 4U5IA 4H4IA 2JIWA 1J0JA 2E4TA 4NRSA 3TC6A 4YIWA 1ESWA 1DORA 4A3UA 5BNKA 5TBOA 1NIUA 4C7FA 1JNEA 2Z4GA 3VE7A 1LOQA 4QSHA 2BVDA 4I8DA 4MADA 1LT8A 1SO6A 4A8IA 1SGJA 1J2BA 2OOGA 2YXGA 3BAWA 1ZY9A 4LRSA 1K8CA 3QYQA 4MHBA 3WNKA 2J74A 4F40A 2A3HA 4P2VA 4RK8A 3SQLA 3SGUA 2FJUB 2Y62A 3WH9A 1S2CA 5XINA 3QKZA 1WV2A 1XLMA 3PBVA 4F0HA 1V6TA 1BWVA 4HNNA 5JIPA 3AU6A 1NF0A 2INZA 3F4DA 4IFRA 3ZOAA 2NLIA 1K6AA 2CZ5A 2O0TA 5ABHA 2VD9A 3CUXA 5FL1A 4A22A 1M9HA 1QHPA 1CW2A 1OC6A 1F2JA 2PDCA 3UJFA 3E2QA 3LN3A 3T09A 5EA9A 1R47A 1V8EA 4WKAA 1GJPA 4XBJA 5HINA 4DB7A 2INEA 3PB0A 1H5VA 3QY7A