4F2BA

Modulation of s.aureus phosphatidylinositol-specific phospholipase c membrane binding
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Competition between Anion Binding and Dimerization Modulates Staphylococcus aureus Phosphatidylinositol-specific Phospholipase C Enzymatic Activity.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 112
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 4f2bA00
1O1ZA 3QR1A 4OECA 1QATA 3RLHA 2PZ0A 4QJ4B 4F2BA 2O55A 1ZCCA 3KS6A 1DJZA 7PTDA 1PTGA 4S3GA 2P76A 3OHMB 2ISDA 3CH0A 1VD6A 2OR2A 3PTDA 4PTDA 1XX1A 1DJWA 1DJHA 2OOGA 1T6MA 1V8EA 2PTDA 4I9TA 5T9CE 4GNKB 4RW5A 4RV3A 1GYMA 1DJGA 1DJIA 4F2UA 4F2TA 3V16A 1PTDA 3QVQA 2F9RA 3RLGA 2ZKMX 3V18A 5T91A 4I9MA 1DJXA 3V1HA 1YDYA 2OTDA 3I10A 3L12A 4QJ3B 4R7OA 3EA3A 3KS5A 5T9BG 1AODA 3H4WA 2FJUB 1DJYA 3EA1A 3QR0A 3EA2A 4I8YA 4I90A 6PTDA 5PTDA 4Q6XA 4QJ5B 3H4XA 3NO3A 2PLCA 1T8QA 4RW3A 4I9JA 3MZ2A 1QASA
chains in the Genus database with same CATH superfamily
4F40A 3QY8A 1VBGA 3DDMA 2INZA 1B3XA 1NWUA 4AD2A 5BZAA 1GTHA 1Z7AA 2FPTA 3WLPA 2BFGA 1R47A 1CGTA 2CC0A 4HT3A 4O53A 4HMCA 5C70A 2D2GA 2VR5A 3UYCA 4O54A 1Y0EA 2IQDA 2UWFA 1XCXA 2DSZA 2EF9A 2G3FA 3ZVIA 2WKJA 3G1SA 3LA4A 1F76A 4IL2A 2FGBA 3QZ6A 1O5QA 3N6JA 4DZAA 4W7UA 4WOZA 4XB3A 3UG4A 3W25A 2FIQA 3U6WA 1TVNA 4C91A 4XD3A 3WH5A 1VB9A 4HNTA 1O5XA 3MMWA 2OYLA 4N02A 2QIWA 4UQDA 4JTDA 3PANA 1JG9A 5E0CA 3QY6A 3AI0A 1E3ZA 1I45A 4N4PA 5JIPA 1R9XA 3TMQA 2ICSA 3EOEA 4DM2A 1GKRA 1LF1A 5A6AA 4JX4A 2VURA 3EPMA 4JFTA 3SFWA 2XINA 3WJSA 3SSZA 1VENA 3MB9A 3MA8A 2QDHA 1C8XA 1H7RA 1FWDC 4MNKA 4N7QA 4NILA 3W00A 3W1PA 4WR3A 4IUGA 5AKQA 1UIOA 3LBCA 7A3HA 1EDTA 1OGSA 1SSGA 1HJUA 2EKCA 2Y63A 1EYWA 3VZYA 3C2FA 3SJNA 2WNWA 4QS5A 5BRPA 3OGRA 2B81A 3GTFA 1FWCC 3MCMA 6TIMA 2EG7A 4AC1X 3NG3A 3C2YA 3TC3A 3CGTA 4AW7A 3PUOA 1XLFA 2QVHA 3KZSA 4PL1A 4O50A 2Q3OA 1VFFA 3PJWA 3B4YA 4RZ5A 3ZT5A 1M6JA 1RVKA 2O9RA 2PWDA 1HKVA 1JRBA 1R30A 2VEIA 1BQGA 3BAJA 2WMIA 1I6NA 2DW7A 3A9BA 2W91A 3EDFA 4EK7A 1HXJA 2VD9A 1JEZA 1XYLA 2FJUB 2J8GA 2ZZ5A 3TROA 3HPAA 4C6BA 3CQ0A 4PMVA 2Z6IA 1VBJA 1A53A 4LNYA 3RK8A 4LPCA 5GNYA 4D6HA 3B3DA 1JGMA 3NQGA 5BXSA 2P88A 4TVCA 1TPC1 5D2YA 4KGLA 4D1JA 3P61A 5DO8A 5HWJA 1SUXA 3VNLA 1ZJAA 4JTAA 4F2BA 2XIOA 2QPXA 1OYAA 3CM4A 4N9DA 3FKKA 4M82A 2QPSA 3CH9A 3GNNA 3UWUA 4HA1A 2B7OA 4GIEA 1AJ0A 1GPWA 3WH7A 3AUJA 4JAWA 3PJXA 5HPOA 3VCNA 3QPYA 3MBDA 1SJAA 2Q02A 3B9DA 1E43A 2CBUA 3AIQA 4QLLA 2ZE3A 3L21A 1U1UA 3OZYA 4NZ4A 1VFUA 2EJ1A 4DI9A 3EEZA 2WWDA 3QFEA 1KM4A 2QAPA 3U8GA 1HL9A 2B7QA 4CQBA 1YPIA 3SGGA 5C9ZA 2YXGA 4CCCA 4TX6A 1OYCA 5FKYA 3HFTA 2DZXA 2HWGA 5LGZA 2JBMA 1PL9A 1NY1A 1FTXA 2X2GA 5FIPA 3M1ZA 4HA4A 2EPKX 1CXFA 4E2BA 1K77A 1O1ZA 1Z44A 4AVNA 4JKLA 1AQFA 5CLTA 1IT7A 4OBSA 3W1UA 4NAEB 4CNSA 3B4UA 4HMEA 4S3GA 2TPSA 3WBYA 2AGTA 2VFFA 3V4BA 2I1OA 3BK0A 4FR6A 3CPUA 2QW5A 2IKIA 1MW1A 4S2CA 2WNZA 2R1PA 4OWGA 5CSSA 3STCA 2PDUA 3TJLA 3RR1A 2FDSA 1E72M 3WMLA 1WZKA 1VP5A 5CG7A 1YLVA 2GVEA 2X16A 3HA1A 5CGMA 1H7WA 1KFEA 3HOJA 4ZL1A 4DBEA 4BEUA 1MEHA 3XISA 4LJ3A 3UXIA 1UZ1A 3HU7A 1UUMA 1QAPA 1FBAA 3EA3A 2PDCA 3KS5A 4DJED 2BXYA 2X41A 4NY2A 3W7RA 1Q6QA 4EXBA 5FF4A 1Y8BA 4PMJA 5AYXA 3SCQA 1DL3A 3KBSA 4IWWA 2FGZA 2OX1A 3R4IA 2OG9A 4H7VA 1GWJA 2WZEA 4UFIA 1XG4A 1MI3A 3LHUA 3N2CA 3F2CA 2P1FA 1XQLA 2Z29A 1LL7A 3LBOA 2X1TA 4KCTA 4DXKA 5E9AA 2PLJA 3U4FA 4NJHA 4HCDA 4ZA0A 3IUIA 3HTWA 3A64A 1W9BM 4AUBA 4ML9A 1E6XM 2J77A 3EKGA 1T8XA 3G1VA 1AODA 3EA1A 1S2UA 4J3WA 1V08A 4D6JA 1KCLA 4JD4A 5HMDA 4JCLA 3B8TA 1QUMA 4ZMGA 1OG0A 4RUBA 1FUYA 1FDJA 1ITCA 1WB0A 1BXBA 1R8LA 3URNA 3THUA 3UXKA 1SSDA 1H49A 1L2UA 1UJQA 3CV7A 5I3FA 1W1A1 1SZRA 3FAWA 3ZT6A 3IV3A 5A2CA 1CPUA 3RCMA 5LNSA 2V82A 3UA4A 3WELA 4XD5A 4B3LA 1OD0A 4L4PA 1OSEA 3TYAA 2XVGA 4AY8A 2IPFA 2WZHA 1Y5VA 1EBHA 4JTQA 2A0NA 5XIAA 5J8LA 1BF6A 4ICCX 4IPJA 3R7MA 2V6AA 2I57A 3SY5A 1QOXA 4NXSA 1H0IA 5LA2A 4NASA 4HCHA 2BOEX 1BPLB 3JVAA 4O13A 4GCAA 2DUXA 1E6PA 4HNLA 2DT2A 3GAKA 4NSBA 4A8RA 1HIZA 4YHEA 1JZ7A 2VFGA 4C1NA 1ME9A 1P6BA 2PDQA 3MSDA 5HJXA 3U5UA 3LU2A 3W4RA 4HYVA 2XFRA 4PZVA 1UA7A 1S3TC 1Q85A 2XVNA 4PCNA 1XLJA 1B3WA 3TXVA 3A5FA 1EA9C 4IXHA 5IFPA 3M6DA 1CLVA 3LCLA 3FN9A 2E6YA 3DG6A 3B03A 1C7TA 4L5ZA 2Y0FA 3BLDA 3RJXA 3PZMA 4A05A 5JQ9A 3OA3A 1TIMA 2FH6A 1S1PA 5CZJA 3WLSA 3EMCA 1U83A 1YBQA 4K7YA 2ZWYA 4CQ8A 3O6YX 3E96A 2D73A 4CD6A 2BDQA 2H90A 4KEZA 1DIKA 5A6MA 1TG7A 2XYLA 3WDHA 3IJ7A 1EJRC 4WHBA 3OQEA 3TTOA 4Q7BA 1DJWA 1EP1A 4RW5A 4DJDC 3WENA 1N2VA 3NFUA 3NZRA 2IQ0A 3SDOA 4HZMA 2BHUA 4UTJA 4QG6A 4DJFD 3GHRA 4DAFA 3A4XA 2YXXA 3VK5A 4JHZA 3QQ0A 3VTRA 2QEZA 3M64A 5JMUA 3GSMA 3CIWA 5HPCA 5G2WA 3VD5A 3P93A 1P1XA 1IEXA 3QLLA 2WCAA 3C86A 2OZTA 5AOUA 2DIKA 4J2PA 3QGKC 2HBVA 2XN0A 1BYCA 4NHVA 1R9YA 3AIEA 5DMMA 5F2IA 4J9JA 2V5KA 2DQWA 1P43A 1BKSA 3V35A 2WBGA 2ABAA 2PWHA 2CLOA 3ICJA 3ANUA 5HBFA 1PJ9A 3QKEA 3RILA 2J7FA 4Q8VA 3FS2A 2XIQA 1IT8A 4KESA 4W8AA 4JIIX 1PBGA 2VT0A 4MWAE 3VGBA 1P6WA 4AF0A 3NDYA 4QR6A 4MNLA 2PFHA 3NYZA 2C14A 2MNRA 2P50A 1W9PA 4D2JA 1RBLA 5LSMA 4URIA 3M41A 4ZODA 4JDBA 4JOMA 1RD6A 4ONVA 1OYBA 1TTIA 3TFXA 2QDEA 1M01A 1CGXA 4Y90A 3VGEA 3W72A 3K8MA 4MY1A 3KM8A 1UH4A 4LUTB 4XQ6A 4Z0SA 1EC7A 3CEPA 3GDRA 3PBGA 5ABHA 1PYFA 1TB3A 2JEQA 2WMIB 3KZPA 3UNTA 4IT1A 2G0WA 4MLRA 3G1YA 5GJMA 4XBKA 1EA0A 5LNVA 3PBWA 3H2CA 4Y7EA 1V0KA 2QJHA 4NZFA 4AYSA 3S3GA 2XIBA 1Q4NX 4HB7A 1V6WA 1B2YA 1WXYA 1W8SA 3A9IA 2FFIA 5AVHA 4HYWA 4UCGA 4MKSA 1HJQA 4CCDA 4F9DA 2HMCA 1HUVA 3CHCA 5LA0A 3T0AA 3WMBA 3CAVA 3OA5A 4RCXA 1DXFA 4HNUA 1C9WA 2YXOA 1FH7A 4I9TA 3LV6A 4MB3A 1YXYA 1HKIA 3ZSTA 1HNYA 3T42A 4HGXA 4NF7A 3SRHA 1W8GA 3O6CA 4GC3A 1FRBA 4KEUA 3IAPA 3BE7A 3QH2A 4DJDD 4REQA 2B7NA 1F73A 1PTAA 1PS9A 2GK1A 1C8VA 1KM2A 2FB2A 1E0TA 3VNMA 1V77A 3KP0A 4FR1A 2YW4A 5AHFA 1M41A 1KWKA 3V0UA 3VINA 3TSMA 2FYMA 1UASA 4UIOA 4K8EA 3QKZA 3O15A 1XH0A 4N42A 3CZGA 2BVYA 4F2TA 3W1LA 1NEYA 3H7RA 1B30A 2PWEA 1OX5A 3TW7A 5DMYA 1HVXA 4QDPA 4AIBA 2A6NA 4BFAA 1Q6FA 3KOXA 1NAL1 4FNPA 3GG8A 4MM1A 3GVWA 3N3TA 4LBUA 4ATWA 2C7FA 1XRSA 3NZQA 3KW3A 3VCCA 4G7FA 3AU2A 1ZTVA 5A8NA 3KDOA 3NA8A 2Z6JA 3L4ZA 3E0WA 3MP3A 2ZCGA 3FOKA 1A3XA 1OINA 1W5QA 2P5NA 4HK7A 1GQLA 2ZC1A 2HXUA 2GVJA 3HZ3A 4B3KA 3V75A 1RA5A 1PZ1A 1E9ZB 1HL2A 3CHEA 3HGRA 3AJXA 4GH3A 5M3WA 1WXZA 5PTDA 3EDDA 4UR8A 5A6LA 1AH0A 3LRLA 3MUCA 4IX0A 4XTDA 3BJFA 1XS2A 4PTVA 3W1NA 1LUCB 2VQUA 1BG4A 1SZFA 1NDYA 1W3LA 4FA3A 1UKPA 2J7BA 3M5VA 3MUAA 2FMNA 3H12A 4C6MA 3HPFA 3BLPX 1MDLA 3VDBA 1K6WA 1XLMA 3AYSA 5LNUA 4FX8A 4Q4PA 4FOJA 3E2SA 1X6UA 1DQUA 2Z7KA 3FW6A 5A3HA 3TV8A 4UMCA 1VS1A 2O7QA 3GXMA 4HOWA 3T4WA 2H8XA 3EA2A 5AZ0A 5K9CA 1R3WA 4ZB0A 2IKHA 3AROA 3QBUA 4ZB5A 3R0KA 3U7VA 3QPEA 4B3ZA 2XH0A 2WC4A 1E4IA 3KX6A 5C7VA 3CH0A 2E9MA 4K37A 5D9PA 5EMKA 4V1YA 1S46A 4AIEA 4ZQRA 4F9JA 1P5BA 1QPNA 3OVGA 2CZ5A 5DCDA 1XL9A 4CQCA 1A0CA 1XBZA 1WO2A 3A3WA 2A7NA 2XISA 2MANA 3CUIA 2G3JA 4Q4KA 7REQB 1U5VA 3QQWA 2P53A 4GGHA 3SFKA 3WUFA 3HG4A 3QFWA 3B8SA 1R2TA 4BJHA 3EWWA 5GJNA 4ERAA 3TR9A 3OLDA 4LTSA 3N4EA 3M0JA 1KQZA 3OPSA 3W27A 5KZEA 1B1YA 4UQCA 2XH7A 5I07A 4JXCA 3SIMA 3S5YA 2GGIA 1QW7A 3EDEA 4QJ5B 3H54A 4NI3A 1YBQB 5A94A 3JU2A 2CEQA 2D0GA 1UWQA 1EGVA 1U30A 2X42A 4W7WA 2GDQA 5XINA 3FY1A 4IJRA 4I8DA 1JFHA 4DUOA 2PDGA 1B3YA 1XLLA 1B0IA 3WBWA 3NWRA 4O1FA 3CLMA 4C6KA 1SO6A 1CXHA 3DFTA 4IIEA 2XZ7A 3THDA 1IYXA 4L6HA 1J2BA 3N18A 3ABOA 2HXTA 1TZ9A 3N13A 3CQKA 3L5MA 1KBJA 5CZKA 2I14A 4QIUA 3NPWA 3A12A 3ONCA 4AWSA 4LVDA 5E93A 7ENLA 2FZMA 3HG3A 3BW4A 4QEEA 1W3NA 3GVQA 4UTTA 1ZU8A 3LLFA 4X63A 1SZEA 4YNGA 1R2SA 3UR5A 1XKJA 4JGDA 4C6OA 1Q66A 1POJA 1GOQA 4IGMA 4DBWA 3HQOA 4N0RA 1ZAJA 4AIOA 3MSRA 2G3NA 1PO9A 5FD0A 4Z2KA 3GHTA 3WUBA 1FWBC 1PUDA 1NOWA 4KWUA 3CU2A 3FSTA 3KHJA 2NLIA 3E0IA 4MPKA 2BOFX 4QLJA 1PB0A 1IE7C 4GA8A 4ADUA 4PE8A 2G97A 1REQB 1OIMA 4JQ2A 3O06A 1J0KA 1PIIA 3PSVA 1TPH1 2VFEA 2F6XA 4NX0A 3BC9A 4CU7A 3IJIA 4XVDA 2GJXB 2WMKA 1KLYA 4MVAA 2IKGA 3N12A 4J1OA 3NQCA 3MPGA 3B04A 2J4GA 3E02A 1I75A 3RCNA 1TRIA 3ARUA 4GX8A 3RM8A 3S8HA 3P7YA 1CXIA 5HWNA 3G0SA 3CPRA 1M7OA 1TJ2A 1J96A 3KOZA 3P5ZA 2XSAA 1ZENA 5C71A 4WCJA 1E6NA 4XZHA 3MSYA 5DBTA 1RJPA 1D3GA 3IUDA 1JF5A 2DZWA 3W38A 3B8VA 1N8WA 2ALRA 1HKMA 4BWLC 1QI4A 3INPA 2DORA 3M0ZA 4GKLA 3S2MA 3NVTA 4CD4A 1W1B1 1C8QA 4G6CA 2NQZA 3CV2A 2NLYA 4K68A 1L2QA 4EPBC 3B9EA 1K7XA 3W7JA 4YHGA 4OV9A 1F4AA 2POTA 3IV8A 1XR2A 1JPDX 1A49A 3PFMA 1JZ2A 4IF2A 3TSBA 4HU8A 2REQA 5E6YA 4MZ8A 1KLZA 3T08A 1RZMA 3BL3A 1ICQA 3NSMA 3JRKA 1S5NA 1GHRA 1GUVA 3RLUA 1JPMA 2WZTA 4PCSA 3TN5A 4PUJA 2VZOA 1V93A 3Q37A 5CAKA 4O14A 1ISZA 2WCGA 5FOOA 3BSHA 4AQLA 4PMZA 2OLSA 4KWOA 4HVXA 4WJEA 3PBVA 1G0CA 3DFSA 1KKRA 4DLFA 5CGQA 1A5OC 4K6AA 3QW3A 4RLIA 3N2OA 2ZX8A 3PN8A 3CT2A 1NM9A 1GKQA 3BARA 3ITVA 1AW5A 2OT1A 4X2PA 1YDOA 3JZUA 4U2ZA 3W7OA 3HO8A 3BQ5A 3G1AA 1PZ0A 4D6CA 5G2HA 5LHFA 5C0QA 4FNRA 3TZNA 3W23A 1TTJA 1AJ2A 3MUIA 2OT0A 3DFNA 2GK1B 2C1HA 3NQ2A 2VM8A 4Q4MA 3ISIX 2Z1SA 1B5TA 2INEA 1E71M 3WNMA 4N9BA 2O55A 1JDCA 1A5NC 1TV8A 6ALDA 5D30A 3IVTA 1L6GA 3ITTA 1L6SA 1F8MA 4DELA 3IPWA 3W81A 2E09A 5FAGA 3PM6A 1HT6A 2DDXA 4PUKA 4WGHA 3NURA 5FSDC 5KZDA 2ODOA 2QV5A 3BOFA 2JF7A 3KHDA 3H4WA 1K8ZA 1V6XA 1QHPA 3NXFA 3BLFA 4GX9A 5LHEA 2P8CA 4MWAA 1GQNA 5HAOA 3R11A 2ZBTA 4FXFA 1VJSA 3STGA 3GYCA 2AL2B 4XWUA 4GXMA 5F7UA 2WSKA 3W2JA 2WMHA 2XWDA 4GHRA 1QK2A 1W32A 5HNUA 1EUNA 1VFHA 1OGBA 4J5NA 5GNXA 1Q6CA 4PFMA 3W37A 3BV4A 2HVMA 2V5LA 5BW6A 5H1WA 1H41A 2Y8KA 1EWEA 2DFAA 3SRDA 4RPQA 2DH3A 4FOKA 2RGLA 3TYBA 4RXGA 2ZA3A 1LBMA 1ZGDA 4UWMA 2WVVB 1H7XA 2V3EA 2Y89A 3RO6A 3GYEA 1W1VA 4UQ9A 1Q7ZA 4WSKA 2OTDA 2BOGX 3MW7A 2RDXA 4ZO9A 3UR8A 1PX3A 4DI8A 2WK2A 1K8YA 1R2RA 3AISA 4MB1A 1WKFA 3M43A 4GI8A 3ITYA 3P2VA 2Y88A 5FACA 4PCPA 3ZYZA 5E0FA 4O8RA 2GQAA 4PGLA 3WQ4A 5HJLA 4PMOA 2HPMA 1T5AA 1IIGA 1SO5A 3QV6A 1AMKA 4LC6A 5EGRA 4U3AA 2D22A 3L4TA 4PN2A 3DI0A 3NQ7A 4JHMA 4QEHA 2I7GA 5F4WA 2XIJA 4D71A 1DWFM 3M0MA 2DGAA 3CPGA 3PTQA 3STEA 4L4OA 3MVIA 4P8WA 4C6DA 3H2OA 1TV5A 2I56A 5D2XA 2QCCA 2WQDA 3ZLFA 5A2AA 3W28A 3CMJA 4LS2A 5A8QA 3PC0A 4Y96A 4LWWA 1O4UA 2YB4A 2Y2WA 4JS3A 2GSHA 4JIEA 5BOEA 2R1NA 4IM4A 2ANUA 2OVLA 3I3BA 2CU0A 3OBKA 3UGRA 5EMUA 4Q4OA 1TKKA 4AEEA 7PTDA 1UG6A 3H7VA 3LN3A 3SQSA 1ADDA 3GU1A 4KWWA 4JN8A 1XFCA 4GI4A 3UY8A 4UXDA 5I03A 4F0SA 3KBVA 4JYEA 2WVVA 3TUUA 1KBBA 4S3CA 1S5TA 4AISA 4L1XA 3VOGA 3UYIA 1NIUA 4ZR8A 4LC8A 2UY2A 2AGKA 4Z42C 1U22A 3MHGA 1RSCA 2VMFA 3BO9A 1GOOA 2IS7A 1XKYA 1YTDA 4XTIA 4PH6A 4I8YA 5I78A 2Y5SA 2IKJA 3W2NA 3UXLA 4FIQA 2CW6A 2IW0A 5BU6A 4QISA 3DYMA 3ANYA 1QNPA 3RX3A 4HSNA 1XLAA 3GG0A 1DJXA 5T8GA 1GYLA 4UNIA 1JNDA 4E38A 3I4KA 3MI2A 5KMYA 3W2LA 4DJEC 1H0GA 2OEJA 1TWIA 4A3UA 4ZGYA 3ARQA 3ZR4A 3RF9A 3W53A 1KR1A 3RMJA 2OQLA 3LI1A 4AX7A 5HQMA 3TC6A 5DLCA 1EH9A 4ZQCA 1U2YA 3CUXA 4NZJA 1XYAA 4IJCA 4IIGA 2IQTA 4K1WA 4RKAA 3WLRA 3S42A 4M51A 4DAIA 4GZEA 5T9BG 3DU0A 1LRQA 2HVNA 1QVBA 4Y9OA 4GIYA 1F5ZA 4ENLA 5K4ZA 3FLUA 1E0XA 2WZMA 4FZIA 2F9RA 2AAAA 4LXFA 3VZXA 5GQBA 4OOZA 1FHUA 3ITCA 4GFSA 5AC8A 4WKAA 2XSXA 4DZHA 3MP5A 4NJJA 2E5BA 2WM1A 3T6CA 3UR2A 1R3QA 5M1TA 4JNZA 1TJPA 4S3JA 1DBTA 4M24A 3OZOA 3WFLA 2H9AB 4TV5A 3W7HA 2EEXA 1VIWA 5HMEA 1CLKA 5CGTA 2FVMA 3W1RA 4N6EA 2BV9A 3WZ0E 2XFFA 1DEDA 1GNXA 3NVDA 3UESA 2ACUA 2Y61A 4BI6A 3RFAA 1TWZA 2Y5EA 4W8BA 4ZQMA 1GJWA 3ZJKA 1BYBA 3YPIA 2E25A 2QUUA 4KFOA 1FCUA 3VABA 3W71A 5JUVA 4XX6A 1F6YA 1B57A 3LCFA 2P8BA 3A4WA 3U0HA 2TODA 2X30A 1NOUA 4BK9A 4XSLA 2V2HA 3W7CA 4MPQA 1BEUA 4LU0A 4J2MA 3R8HA 1I0DA 2BGQA 1IZKA 4ALDA 3FJLA 3GR4A 2XH2A 2Z1VA 3WK0A 3G8RA 2GDUA 1TUFA 3S2CA 3OIHA 4V28A 3U2ZA 5BMXA 4KT2A 2J79A 1E73M 4ZOEA 3TJIA 2P76A 4IPIA 4WX2A 3N17A 1UIPA 2AOSA 2R8WA 4MAZA 1AVAA 1KCZA 2L5HA 4DF1A 3BLIA 1J8VA 2F2HA 3ZR5A 4C6FA 1VHCA 4IG2A 1W17A 3A21A 3NL2A 1ONEA 3QHOA 4E4UA 1XDLA 4WK9A 3P60A 1VAHA 1XP3A 3H26A 5BWAA 3WF3A 3M5ZA 3LLDA 3MJYA 1XDJA 2D2OA 2DEPA 4AVFA 2DSKA 1P1MA 1Q5MA 3RRXA 3WNNA 2PF0A 1GOIA 2OFJA 4AY7A 1J12A 1GQIA 1VPQA 2E6FA 4L65A 4GABA 3OVQA 4NU7A 4ATLA 4N4QA 4PUEA 1EJ7L 1QI0A 1NQ6A 4D1IA 1I2RA 2J78A 3A3HA 1X6LA 1MEIA 3W6LA 1EQCA 2BY2A 2OSYA 3WSUA 4D72A 5B80A 1XHGA 2PLMA 2V9DA 4EPDC 3STPA 1E40A 5EFFA 3AYTA 2YIHA 3VNDA 1XIHA 4PEKA 3TONA 2EPMX 5HQEA 1E15A 1JDAA 4UNKA 4C6QA 1Q2RA 4D6EA 4GYPC 3NYDA 1O68A 3M44A 2PWUA 3G3DA 3S6TA 1XLHA 3KBWA 5ABFB 1GK8A 4MUZA 3A4AA 2QNEA 3MHFA 1WX0A 1FH8A 1QASA 3SCPA 1R9ZA 3SN1A 2VC5A 3TK7A 3GIQA 2EG8A 3BGJA 4LV4A 3GX9A 4R7WA 3SCSA 1REQA 4REQB 3SUUA 1KM1A 1PKYA 3W76A 2PU1A 1DYSA 1L9WA 3WQCA 2ZRZA 1E0VA 4P8UA 2FZNA 3G5EA 1RXOB 3WLTA 5FA5A 4AZGA 4EF8A 2QIIA 4X2RA 2E3ZA 1W5NA 1DE6A 3WNPA 3MKCA 1XISA 1DE5A 4B9ZA 2WANA 4H00A 1SQ7A 1H5YA 2E4TA 3N29A 3LXCA 1XYBA 1XSIA 3EXSA 1DP0A 1KQYA 4UC5A 3UP8A 1V0MA 1WDDA 5C9UA 1R3RA 2CCRA 4QGCA 3ALGA 1OFEA 1IHIA 4JIHA 4L9ZA 1LG1A 3TLQA 1EGZA 2HE5A 5I3IA 3L4XA 3WQOA 4EXAA 1XIDA 3F7JA 3K1DA 3BGAA 3P67A 4X0NA 2HCVA 1DWIM 2WHKA 2HEJA 3LRKA 3B05A 2ZRWA 3TTQA 4GO8A 4Q33A 2FVKA 2UY5A 3O6AA 4P7QA 2ALDA 2ZZ7A 1U5HA 3IIVA 1IIHA 1OFDA 2R1MA 1L8NA 1OFRA 3IIZA 5HNTA 1UC4A 4IQLA 4J3SA 4F4RA 1KC7A 1M3UA 4Z08A 1A5CA 2HK1A 4E6MA 3CL6A 4Q3MA 1A50A 2WMGA 1MFVA 3DFHA 3MDUA 1TO3A 4RZ4A 5MF5A 1QPRA 4LYQA 3WK2A 1PKNA 1NJJA 1WZLA 3L4YA 4EKJA 3AHTA 3E3HA 3FHAA 4W87A 3C8NA 2A5HA 5DRCA 4IMAA 4KERA 1IZJA 3S9ZA 4E3TA 3WLQA 1I60A 2ZDRA 1JR1A 3MKKA 2VWTA 1X8FA 3FA5A 3RYSA 3NZGA 4G9PA 3WLNA 4BF5A 2ZADA 3VGFA 2AL1A 2E68A 1Q7MA 3AS3A 1G9HA 3PJTA 1UP0A 4IGSA 2WV8A 4Y9PA 3G1XA 1K9TA 1S3HA 3WL1A 2J88A 1H2JA 3N2TA 2MUCA 3KS6A 3QEZA 3FEQA 4LYRA 5KETA 1YTEA 4E8DA 3TYUA 4US5A 3TC7A 4PB5A 1OJXA 4YTSA 1NP0A 2NQ5A 5DY3A 2XM1A 3VKJA 1BFNA 1DIEA 1JI1A 4E0CA 1G4TA 1T96A 3MUY1 1W0MA 4AHOA 1TX2A 2FQIA 4YTTA 1CLXA 2PMQA 3VDGA 3ZMRA 3EAUA 4MZ1A 4OE7A 4JFWA 4LRSA 3AMGA 1O7AA 4ZTXA 4H8VA 1SFTA 1V3HA 2BG5A 4WSJA 4M81A 4AFYA 4AVOA 1W9XA 4M8UA 3CQIA 1NTHA 3V3WA 1XD0A 1TMHA 1WAUA 1UWUA 1S2VA 1H51A 2V3FA 2CETA 5AC6A 2C15A 5CSRA 2KAUC 3CEUA 3IRSA 3VIGA 4W89A 4QROA 1C91A 1G01A 5F1UA 2NVAA 1IV8A 3G0XA 4CUCA 2V81A 1XLGA 3F1QA 5D33A 1MUCA 3WLMA 1WAWA 4L64A 1JVNA 1JUEA 1UBPC 3FVMA 1GORA 4I9MA 4US6A 1YX1A 3FJ4A 3PR2A 1HL8A 3AZRA 1GJPA 4ROPA 1PCWA 1IR1A 1S2CA 3G6MA 4A3YA 1YXCA 3LZ5A 4KEMA 3LG3A 4LVBA 2J66A 9XIAA 2FDMA 4O1EA 3WH6A 3W7NA 1KWGA 3DX5A 1YIXA 3AXKA 2XU2A 2W62A 3O0KA 1DKWA 3I4EA 5BOFA 1ADOA 1QT1A 2VKZG 5AC4A 3TAKA 2OSXA 3STFA 1W31A 1J5TA 4DYKA 1CZ1A 3H24A 2DZUA 1UH2A 2EXOA 1OM0A 5G1YA 2ZC8A 4HCLA 3BCFA 1SFLA 1VCFA 1TVLA 1AW2A 3E2VA 1D7FA 1QPKA 4HA0A 4FF7A 2WMJA 4ORMA 4WY0B 4P7RA 1WDRA 5FEPA 2DZBA 5JIWA 4S3AA 1B9ZA 4Z2HA 5AC7A 5GVJA 1XYZA 3TMLA 1W5OA 5E6ZA 3KCJA 1QNQA 4PBGA 1DPMA 3HGJA 3DGBA 2XM2A 3EXRA 3O7UA 3NQBA 4U31A 1LROA 3U57A 3MUZ1 1VYSX 2W6RA 1HZYA 1B3VA 2Y6ZA 1UCWA 3T4CA 4WJ8A 1VQTA 3LK6A 3ZJ6A 4QJ3B 1AJZA 4Q7NA 1FKWA 1KFWA 2H6RA 4YN5A 2GQ9A 3C4UA 3H8AA 4RDWA 3G1RA 3VXGA 1V3IA 1BTMA 5DMNA 8A3HA 1GG1A 2HJPA 3KOFA 1C92A 3W83A 5DMLA 5DEZA 3WYZA 3GH7A 3UERA 2XIMA 1QXLA 4GBUA 1LWHA 3BAWA 3VE7A 5XIMA 1J6PA 4XAPA 4PSRA 2OGYA 1XIFA 2DIEA 9XIMA 3WH9A 1TPVA 3LCIA 3LHVA 4A8NA 3HV8A 5IOBA 3EOSA 3V5OA 1K9FA 4AZHA 1D3HA 4DPQA 3H2AA 4OQVA 5HMFA 5BRQA 1V3KA 3KWSA 1EL3A 1WUEA 3WJYA 2FTYA 1KD0A 1YRRA 5DN1A 5IBXC 2R91A 3ITLA 2EAWA 2XN2A 1AH4A 2ISSA 3I68A 1YMYA 3KXQA 3W7DA 4GBDA 4BI5A 1XG3A 4GNVA 4MB5A 4N2YA 3GB6A 2RH9A 1EEPA 1Z6KA 2V3GA 2PGEA 4U5KA 1ML1A 3URQA 4LUTA 5DRIA 4GIRA 1LRTA 4DWSC 1HJSA 1LQ2A 1Q3NA 1TFVA 1UR2A 5LNWA 1FWRA 3LSBA 4RZ6A 4AEFA 4XZLX 3OLGA 3UWZA 8TIMA 1FWNA 4XK2A 2PDPA 3UCQA 1A47A 4O16A 2A3HA 1Y5XA 4XVEA 3W7LA 2J27A 4CD8A 4C7FA 1D7KA 4PMRA 1VZWA 2Z27A 1M65A 1FHDA 2GLKA 4PMUA 4LUYA 1UROA 4UTWA 2Y7DA 3IRDA 4Z1DA 1P0DA 5A69A 1DIDA 3GS6A 3ZLHA 1DHPA 1HQTA 3ONBA 2QYGA 3EYPA 4YVPA 3KP1A 1UR1A 3WD1A 5BMWA 4JTIA 2SFPA 4OBRA 4I6VA 1JAEA 2R82A 3DOPA 2FHBA 2GGGA 3PZTA 1Z32X 1JUBA 3K46A 5HA7A 3U3HA 5HWMA 1TRDA 4LB4A 4WZHA 5D9NA 5HUOA 4NRSA 4AZCA 3GXDA 2PSNA 4JL2A 4RK8A 4OFCA 1SR0A 4X60A 1BRLB 1K6AA 3NSXA 3GFXA 3OLIA 1JJKA 1A3HA 1CX9A 1H50A 3VGGA 3RITA 2R1LA 5DF0A 2YDAA 1FX6A 2YA1A 1MXGA 4D6GA 3OQ8A 1DJHA 1MW3A 4A21A 4X9SA 1B9BA 3H2FA 2NT0A 3O9NA 2G37A 1GHSA 1SO4A 5DY2A 4S3KA 3MYOA 1B4EA 1OHLA 4HNOA 4XAFA 3WLOA 2YCIX 4PODA 2VEKA 1EJUC 3THQA 4KKXA 4B5WA 4TR9A 1GONA 4IPPA 4MKNA 4O0KA 4FNQA 2HK0A 3D47A 1OC6A 2TRSA 3BAKA 2C18A 5DCEA 3PWIA 2WHMA 3C3NA 3TYZA 2OKTA 1CB2A 3P84A 1R3SA 1NARA 1OFAA 4U3CA 4QE4A 3V18A 1YPXA 4MMWA 2V38A 4CLMA 3HQNA 2R94A 4AD5A 2D20A 5TIMA 1KW1A 4P8VA 3HV9A 2WJEA 2V0TA 1GEQA 3Q4DA 2ACQA 3C8FA 4YVVA 4MF4A 4ICMA 4TTGA 4JN7A 4PFHA 1JCLA 2I5IA 4L61A 1V8EA 1LOQA 4X61A 3WNKA 1S2AA 3B8DA 1XIEA 2OSWA 3C2OA 2G4FA 3OVPA 3MV11 4RE4A 3PZGA 1FWSA 4OJYA 4PCFA 5CZSA 4HKPA 3W1XA 4QCEA 2IXUA 4RNFA 1H7PA 4XUYA 1JDDA 3CASA 1O66A 5G2IA 5A8GA 4X22A 4H9YA 1C9DA 2DUAA 2WB5A 3VA8A 1TZZA 2DZPA 1KRCC 1I8JA 3TYCA 3DBPA 1V51A 3W7GA 1R38A 3VKKA 4LBSA 3WBEA 3TX9A 4FK9A 2DT3A 4H41A 3I10A 3M5YA 1L0PA 1FWTA 1MFUA 4HD5A 3IVSA 2D3LA 4HPGA 5FL1A 4IMEA 5I77A 3PJUA 1FQ0A 1C8YA 5H8PA 1XLCA 1S5MA 2ZX9A 3A24A 3MTWA 3VNKA 3JW7A 3H2EA 4EWND 4GINA 3GUGA 2J9YA 1IXOA 4YS1A 4C7DA 3LTPA 5J04A 4Q8TA 3ZWTA 2PD5A 7REQA 4DVOA 1E1CB 3GW3A 3SI9A 2VCAA 3P8IA 4LUJA 2PDXA 3WQWA 3HMJG 1TTQA 2YL5A 4PUNA 2PUZA 4LGXA 4GD0A 2VQTA 1NF7A 3GDMA 3BJTA 2Q6ZA 3EX4A 1LLWA 1MZHA 1D9EA 1I4NA 4F8XA 2V2DA 1JXKA 4IFKA 3N9KA 2PWGA 4QHRA 4HHMA 3BANA 3PG8A 3BAIA 4KETA 1W54A 2GDVA 1JCXA 4ILSA 2GQ3A 2P3EA 3GRIA 4IMFA 2YX0A 5ECUA 2Y5JA 1UR4A 2EPHA 3PPCA 3CHFA 4MY9A 5GNZA 4JR5A 4MG4A 3B8IA 1V7YA 4JQ3A 5A8OA 2Z25A 1KM5A 2VXNA 2VVNA 4IPLA 1IXPA 1OZQA 2VWSA 2FTWA 3LPOA 2ADAA 4LX4A 1QNOA 2OGJA 1NDWA 1J4EA 4AY1A 4M0XA 1HGWA 2GQ8A 1TPUA 4CQDA 3EXTA 1W3HA 3L0GA 2E28A 2NQJA 2QAFA 4YWSA 2GVGA 3A3XA 2VX6A 4KFNA 4LVGA 1OFQA 2VGFA 5LNRA 1NWTA 1CYGA 3LHZA 2YCKX 1A5BA 2AL2A 4S3FA 1F74A 1W9UA 3BTNA 1M5WA 1ZP3A 3KLLA 1BAGA 2C6QA 2NV1A 1PIGA 3P62A 2TYSA 2ZDSA 5D8ZA 2VR4A 3BSGA 4L1WA 2F84A 2OO6A 3L9CA 3SR7A 1QU4A 4PR4A 4H9UA 3VO0A 2QJIA 2YKKA 2ZFAA 3U2CA 4EIVA 4MOZA 4ASTA 3ARSA 4XO6A 4GQGA 1OY0A 4GUFA 4Z0JA 3BMXA 2ONEA 3FDKA 3MO4A 1TWSA 4FHAA 1J93A 2C79A 3RR4A 1LRNA 4B5UA 4YYFA 2BMBA 2D69A 3B9AA 4Q6JA 1M7JA 3AYVA 3N3MA 4DUVA 2I9UA 1PTGA 3IGSA 4LVAA 1NWSA 1RR2A 3DFQA 3DAQA 2RDUA 3NNTA 1V6VA 1E9YB 3WUEA 4PYSA 4F48A 1OF8A 2WJDA 3FYYA 3T0TA 3R58A 3HURA 3VC6A 1ZCOA 4PTXA 1XPYA 1EC8A 4DO6A 4XSMA 2PCEA 3O3RA 5H2ZA 1MW0A 4W86A 3QN3A 3UZXA 4B16A 3ARYA 3UCCA 3NQ6A 4XKYB 3GG1A 3A5VA 2JGQA 5FF7A 2A3BA 1JYXA 3APYA 2V5DA 3MCOA 1Q6LA 4BQ2A 2CBJA 4AZ5A 4BS0A 1AW1A 1US0A 4YCPA 3NZ1A 5D4YA 4Z17A 1K8CA 1A80A 1W1YA 4P8XA 3WLHA 3PZVA 5E0KA 1W2VA 3IJ6A 4PRTA 4BY3A 4XZIA 4BZYA 3IUHA 1SW7A 3KRUA 2BGNE 3BAYA 1NVMA 2XWEA 2DUZA 3QVQA 4RE0A 2CLIA 4L9YA 3TXZA 3UG3A 2GJLA 1FH9A 2HBXA 1PWMA 5M2FX 1ME8A 2W67A 2Y8VA 4V27A 4PMXA 3WLJA 3GXPA 5BROA 4POCA 1G94A 2YLAA 1K3UA 5BNKA 1HX0A 2VTFA 1AFSA 4WRHA 1AA1B 4JTGA 3DHPA 2QT3A 2O4MA 1OCJA 3ARVA 4W5ZA 5DCBA 3UW6A 4B90A 2A3AA 1K4GA 1EPXA 3CWOX 2PRHA 2G95A 5FSEC 1VCVA 3FX4A 3OW1A 5FJPA 1GVEA 1E9LA 2RJHA 4PTDA 2Z0IA 4C1KA 3Q65A 3COTA 2CZEA 4QCFA 1W1PA 3PPFA 4WQ6A 4NAEA 1HO1A 3T0CA 3UY7A 5A6TC 3SADA 5CSYA 5F2MA 3H23A 2NQLA 1BGGA 3OHIA 4NG3A 3N73A 4UTTC 1WZMA 2PDNA 2WLZA 1UQZA 3MMDA 2VGIA 3CTTA 3NQAA 1G4PA 3CZLA 1XINA 2W4XA 4H01A 4RDZA 3NGJA 2QCEA 2BODX 4J40A 1ZHAA 4PBEA 2DT0A 2QCMA 1PHWA 2OZ0A 3R94A 1RCQA 4TUFA 4QSHA 3D3FA 3FEMA 1JNEA 4U28A 2GSEA 2OR2A 3CQJA 3FK4A 4UTWC 3WMCA 1RJRA 1TA3B 3DCPA 1Q2SA 2JALA 3GXIA 3Q67A 5HMSA 4HZ8A 5F1VA 1DQWA 1YW1A 1TWWA 4G8TA 3E0FA 3AWOA 2QZRA 3I7QA 1SVDA 3LDVA 4HHPA 4H6KA 1PPIA 2TSYA 3E12A 4GE8A 2Y85A 4M56A 4WDUA 3GIYA 3ZO9A 2E67A 1ECEA 3VU2A 1XYMA 4ZO8A 3M5XA 4FI4A 2OYKA 3AYRA 1WPCA 4BI7A 3KCLA 4UR9A 2AMXA 4RL3A 3EB2A 1TPWA 2POZA 3VMNA 2HZGA 3WL0A 2V5BA 5TF0A 1V5XA 3GY1A 2NQHA 5HK4A 3HQPA 3R8RA 4GWEA 3GNDA 4CEXC 2Q8ZA 3EKLA 3G8EA 1VJIA 1ESWA 3FDGA 3LENA 3WDIA 1RK5A 5EMMA 4YTRA 1YNYA 1YTKA 2ZZ6A 5EMYA 3S5ZA 4L80A 3VGHA 3H55A 2XTKA 3TOPA 4H2HA 4WKFA 2NX1A 2VGGA 4EWJA 5AHMA 2QS8A 1EX1A 2YLLA 4DO5A 3GZ3A 3Q2DA 2QMJA 1OX6A 5BWFA 5CZTA 2CNCA 2E1DA 1ZRQA 3BICA 1RP8A 4PTMA 2HTMA 3KBMA 3NM3A 3RDKA 1LTDA 1K03A 2GZXA 4PMYA 5CXPA 1J0JA 5E5CA 4GXWA 4BEQA 3QV8A 4JX5A 1MQQA 1E1EA 1JAKA 4DEFA 5IM51 2PZNA 2PDHA 6XIMA 3QR0A 4GK8A 4UFKA 3C2EA 5IFTA 1PV8A 3OZMA 4N6FA 5MKGB 5LYRA 1GVIA 1XIGA 3QMRA 5AYBA 1S2TA 1ZP4A 4J3ZA 4HOZA 1BWKA 4DRSA 3QSTA 2AQWA 2J8TA 2IUZA 3E0VA 3II1A 1G4SA 4Q32A 1V4YA 4CU8A 3M6YA 2QKFA 4L9XA 4J7RA 3MUXA 2A4AA 5KITA 1HGYA 3MCNA 3VOCA 1UB3A 3UVIA 3UJEA 1Q6DA 4RJEA 4DHGA 2VENA 1H7OA 1RALA 3NQVA 1EP3A 1MSSA 3M0LA 3A13A 3E0LA 3HMCA 5C9WA 1OK4A 3W22A 1L6YA 1QJWA 2WZIA 3D6NA 3R0UA 3DBNA 3KTXA 3EWYA 2CXGA 1OEPA 1K02A 4IOTA 2INFA 3KUMA 4CVWA 3RXZA 3GXNA 3HG5A 2DVTA 1E51A 4YVXA 3AICA 1O1HA 3VMOA 4Q6XA 3HBLA 4QS6A 3VFLA 2ZA1A 4U4MA 1I2QA 4UOQA 3BAXA 2FVLA 1GVYA 2QUVA 3ABXA 3IJQA 1UKTA 1FDZA 4DBUA 4MGGA 5RUBA 3AZSA 4WY0A 2QUTA 1M68A 2XZ9A 2PE4A 1V6TA 4RZBA 2WPGA 5FJUA 1JZ6A 4TVDA 3EB3A 1BXCA 3W01A 4JTLA 3VKBA 1GYNA 5B7ZA 1LQ0A 3GUWA 4JQ4A 4XISA 5KZ6A 5K2ZA 3N2XA 3TR2A 2BZNA 3A6OA 3B9NA 1RVGA 1SR9A 5JH2A 4IGHA 5DT5A 5I23A 4FSAA 3BG9A 3WDPP 2ZX6A 4S3DA 3GNXA 6REQA 1R3VA 1XLKA 3R43A 1JULA 1ZBVA 2Z2BA 5REQB 3W26A 1OFPA 1ICSA 2OX4A 3GXFA 3E5PA 4I90A 4GOAA 3LY0A 3H70A 2EQDA 3WKZA 1JZ8A 2Z2AA 4E3VA 1QHZA 4DYEA 1S5WA 1EF3A 3VD4A 4LCRA 1T99A 4XBJA 3NXLA 4HSHA 1HG3A 2CHRA 3LHWA 1AH3A 1KRAC 1XI3A 4A4AA 1N8FA 2E77A 1XYFA 3GAYA 3T8QA 1XIBA 4W84A 3UWQA 4PMNA 1JZ4A 2H9AA 1TPEA 1RBOB 3GDTA 1R6WA 3M7SA 5CJ5A 3APTA 4OOUA 3WF4A 3L12A 2YCJA 4X9YA 4UZUA 4QLKA 1GVQA 3A47A 4E2VA 4NP7A 1W1ZA 3KVJA 3EX1A 3CQHA 1VRXA 1FFQA 3M16A 4BQ4A 3SB0A 1GOMA 4GISA 3T07A 1EP2A 1G5AA 3ORWA 3W86A 1EXBA 1QNVA 2ISDA 1AG1O 3D5HA 1UKSA 1XLDA 1DJGA 3T81A 1PYMA 1E5NA 3BLKA 2X0YA 1LYXA 2CBVA 2R6OA 3ARXA 2Y8UA 4F0HA 3QOMA 4FALA 3OZPA 1ZBCA 4C1LA 4W93A 2NXHA 4JIQA 1Q45A 4RPPA 3TFCA 5I79A 2XGZA 4EVZA 3QMSA 3DFYA 1EJWC 2RDTA 3S5NA 1MQPA 1BG9A 1R87A 2WSYA 4MHBA 4ZQNA 4CQAA 5HNNA 1RPKA 4GUIA 3QLDA 2ZRVA 3H4GA 4L1GA 4MAVA 1E4MM 1LWIA 2OOFA 3OYXA 3VOHA 4UTUA 5J5RA 2D2JA 4XZ9A 5ABGA 4GUHA 2IPWA 2GGHA 5LIKX 4PRRA 3S5SA 1DJIA 3IVUA 2X0SA 1M04A 3NPVA 4O52A 3EWZA 3ARTA 4KIEA 3C61A 5ABEA 5I24A 4XKMA 4D8ZA 3HQ1A 2O9OA 2RKXA 2X1UA 3B0XA 3ARWA 2XIIA 1VBUA 4Z1AA 3BLOA 4DWSA 1X1OA 2FLIA 1ZS2A 4Q8PA 1ZLPA 5HR6A 1X96A 3VUSA 2GVLA 2FPYA 3BW3A 4GJ1A 2VELA 1KV8A 2FTPA 4IZGA 4PRWA 1NP2A 3WD0A 3VVGA 4INFA 4HMDA 3ABSA 4ZE4A 2NVCA 1GGOA 3USBA 1GEHA 1HN1A 1I2OA 2Y24A 3W1MA 1FWFC 3URBA 2JIWA 4RNJA 4LCQA 1HP4A 1VEMA 3CO8A 1QWKA 3MWCA 1EB3A 3OBEA 2KX9A 2A6LA 4KCWA 2Q71A 4GLEA 3E6EA 2I9EA 1V02E 3CUJA 4K38A 4GZJA 3M47A 1GOWA 3MZNA 1FWGC 3BH4A 3ZXWA 4CCEA 3ZM8A 8CGTA 1VFSA 2F8QA 3W7EA 3AMDA 5HULA 1IGSA 4HN8A 1PX8A 1TJ0A 4LUSB 2VDHA 4NJIA 1XGEA 3GFYA 4E8CA 5ABFA 3BMVA 3VOFA 3KRSA 5A6JA 3TN3A 2VFIA 1DWHM 1VKFA 1VLWA 3QHNA 4FS9A 2HE8A 4LNCA 2WYSA 4W5UA 1UWAA 1XBYA 4JTUA 2YA0A 3MANA 5BCAA 3T44A 4A3HA 3LERA 2D1ZA 3U5YA 3AUOA 2WJFA 3AIVA 3OU8A 4O19A 2Q01A 5DBUA 1LOLA 3B8WA 3S83A 1EPVA 3E1F1 4LS1A 2YBTA 4PULA 1EKOA 1MYRA 3VAVA 3QXBA 2QXWA 2PCQA 4O8AA 4TX9A 3PK7A 3BSMA 2V3DA 1FXQA 4QG9A 1DTNA 5FI8A 4IICA 2ZZ1A 4M1BA 5AN7A 4GACA 2BVDA 4X3ZA 1PCKA 4UTIA 4DZ5A 3AQUA 1IEQA 2J62A 4LYPA 2JF6A 3BPWA 4DUXA 4O4VA 1LJYA 1QTWA 4L6DA 3SBFA 3G1FA 4TV6A 3NOEA 4QP0A 3WQDA 1G7UA 3W84A 4LAMA 3UZ5A 3TA6A 3N14A 1OBAA 2ATSA 3GH5A 3QV9A 1JQVA 4KRZA 2YR1A 3N6QA 3W88A 1VC4A 1Q6RA 3NM1A 5AVNA 1VFLA 1UD2A 2BS9A 3N4FA 5MKGA 1ZAHA 4GZIA 1UMYA 5LIYX 5CLWA 1X7IA 3K2GA 1BQCA 2W5FA 3VC5A 3SRFA 4M19A 4V33A 5KEZA 1XSJA 2TMDA 1ZBWA 1O6IA 3LMYA 5AC5A 3FNDA 1NWRA 4OKDA 4C60A 1FHLA 3KOWA 4D8LA 2WAGA 4O12A 2ZRXA 2RFGA 2VUYA 3C0QA 3VZZA 4JTJA 3BQ6A 3H4XA 2R14A 4Q8OA 1YE6A 3GKAA 4PMQA 3PZ9A 2QDDA 3RLVA 1HJXA 5DQPA 1BSLA 2HVOA 2XH4A 3BOLA 3MMTA 5TAOA 4UFLA 3JR2A 1K70A 3ZSSA 2F7FA 3MYPA 3EOOA 1SO3A 2W92A 3EGJA 3GU9A 1NU5A 1EIXA 1LOSA 3G22A 2DY3A 4J3UA 4F66A 3LEPA 4NVTA 3W24A 4K36A 2XHYA 4LRTA 4WXZA 4I5XA 3UZYA 3GC5A 3ITXA 1EDGA 4D6IA 3G2GA 3GM8A 4UTHA 1YDVA 3GFZA 3LNPA 4IGNA 4GXPA 4M6QA 3S1XA 1IGWA 3CUHA 2E5DA 3LXAA 3U2EA 4GVIA 1BWLA 2NT1A 3M0IA 4EAMA 3KCOA 1HVQA 1WP6A 4MWAB 3VKAA 3SN0A 4O18A 4DJFC 1UMLA 4AHQA 2PDFA 3C0LA 4GYPA 2OXNA 3E2RA 4LQ1A 1X38A 3MP4A 3REQA 3VD7A 1CNVA 4MNJA 1WNOA 4L4LA 3LZ3A 3PUGA 3CT7A 1SM9A 4J3TA 2BY0A 3ABQA 4YIWA 3LGGA 2O7SA 1ZFJA 3SN4A 4ZE5A 1V02A 4P7NA 2NSOA 4MWAC 3GNPA 1V3LA 2WCSA 1VLIA 1IWBA 3ME3A 1JDFA 7TAAA 4W9TA 3R13A 1C90A 3RRAA 2VOTA 3ECQA 1R3TA 2QV4A 3VCRA 2ASHA 5KTLA 4L4MA 2ZUMA 4V2XA 2VZUA 2ISWA 1ITQA 3LMZA 1SFSA 4NAFA 1J6OA 2J7GA 4DF2A 1AD4A 4YPJA 2B7PA 3THCA 1ZL1A 2X40A 1XC6A 4HSOA 4K3ZA 5U4NA 1XH1A 2E9BA 2PDJA 1CXKA 1H60A 1OF6A 5CPLA 3GO2A 3P82A 1CGUA 1P0BA 1HW6A 4C6PA 2A79A 1EJXC 2RGMA 4JEJA 2VYOA 1WKEA 4TVUA 4HK6A 3F4DA 1S38A 2YCLA 2X8RA 3CAWA 5I02A 2C3ZA 1G6CA 4C6CA 1YXDA 5FF0A 4JPGA 3VYLA 3NQFA 2I16A 4DQWA 3J7HA 4CCZA 3R2GA 4O17A 4EP8C 2Z24A 5CPOA 3VKCA 3S6OA 4B4HA 3NL3A 4UNLA 5H8MA 4I7UA 3CJPA 4DWSD 6PTDA 1FOBA 1LZOA 4W8LA 1J01A 3K1GA 5AB3A 5A95A 2PLCA 4AWUA 2CITA 2ZX7A 3SY8A 4TTUA 2AQOA 3N34A 3CBWA 4O11A 4KCVA 3H21A 3EZ4A 4XKYA 2ABBA 1TV3A 1O5KA 4HMNA 1B90A 5HQLA 3N04A 1XV8A 3KEHA 2QUMA 4O4WA 4UTFA 4OU1A 1XRVA 1DTUA 3CK5A 4JYDA 1Q4WA 1J10A 3GNRA 3E2QA 3N9SA 3PFRA 4N9CA 1V0LA 2OQYA 3AIUA 1J9YA 4O1DA 4YL2A 3TN4A 3QQ1A 1HJWA 4DLMA 1O5RA 4J27A 2OEKA 3FAXA 4UTKA 4AC7C 5IHSA 1K7EA 3QV7A 1US2A 2J6VA 1JL8A 3UCDA 4PUUA 1QDSA 5D03A 1LORA 1SZGA 3CMFA 2D24A 5M5DA 1LWJA 1PTDA 3N25A 1UPMB 3B0PA 1ZQ5A 4NZCA 1GJUA 4IQEA 2YCLB 3SURA 4ZSTA 4OUIA 4HPHA 1ZCCA 3UF9A 3WD3A 4XAYA 1LQAA 3FYPA 4H19A 4Q8QA 3VM7A 1XQKA 1QBAA 1QFEA 7XIMA 2ZUVA 5JBDA 3CV1A 4JDYA 4QSFA 3TTSA 2VJXA 3WLKX 1A0DA 2EKGA 2E6AA 2XFYA 3IIPA 4R7JA 1GW1A 4CNTA 4LY8A 4DO4A 2YOCA 1PDYA 3CWNA 1R86A 4G56A 4D9PA 4R33A 1E4NA 3UXAA 3ZT7A 2C1IA 3RU6A 1LP6A 3UJ2A 1WBJA 4JIRA 3KFTA 3T9PA 2NZLA 4RE3A 2ZUUA 3CMGA 3FSUA 3S1VA 1XC4A 4O1CA 2OWXA 3PF3A 4RW3A 5H91A 5G4HC 1OFOA 5CPMA 1BWVA 1F4HA 1CGYA 2FJKA 2NXGA 4LS0A 2BWGA 3AS2A 3KAOA 3AIRA 3W7QA 3VIKA 4K7VA 1CECA 1BVZA 1F3XA 3U48A 3W1AA 3S9IA 2G8ZA 3CAKA 2WC3A 3F2BA 3L67A 1GZJA 1QR7A 2EPNA 3TLLA 3T05A 4G1KA 5FCZA 3SQMA 4BA0A 3E74A 3LGDA 4K1GA 3PWAA 5D2WA 3T78A 1S5VA 4H9TA 2ZXAA 4QJ1A 3TNBA 2ZTJA 2PU0A 4JICA 2A21A 1RJQA 3D46A 1E6QM 4B5SA 3UVAA 4MDOA 3R5EA 5KINA 3PB2A 2ZYFA 4B5TA 5D2TA 3PZOA 3MI3A 4LANA 2JQXA 4AWEA 2VL4A 3C2RA 2WQPA 2C0AA 1FCQA 3LUTA 3DN5A 1F07A 1YPFA 4DBSA 2GOUA 4U33A 4ZOCA 2WMFA 3ITGA 3VMPA 3LM3A 4M5PA 3MWAA 3GDLA 3WIJA 5FJIA 3W29A 4IG2B 4Q8WA 1EYEA 5JH1A 2ZX5A 1W6TA 1KFCA 2P10A 1KFLA 5AY7A 1JI2A 4ZOBA 3CHDA 4U10A 1ISXA 2QF8A 5BXRA 1BTCA 3KRZA 1YE4A 3RN6A 2RDWA 1KV5A 2Y7EA 2O9PA 1Q6OA 1H7NA 1IF2A 1KTBA 1XLEA 5I3KA 2BGSA 1SW0A 1FCVA 5AYIA 2VEFA 2JKAA 5K9XA 3RLHA 3G1HA 5FAJA 5G4EA 5JVLA 4HZ7A 3RX4A 2DVXA 2PGWA 5LZLA 3V5CA 3WQPA 4BR1A 4DXVA 3TZFA 4JCMA 1O60A 1DQXA 4QQ3A 5IRPA 1UR8A 1QPQA 3W1QA 3HN3A 4HA3A 2QCDA 2ZA2A 1KFKA 2CKSA 4A2RA 1S39A 3VX1A 1MUMA 1ZJHA 2AQVA 1R85A 2VZVA 3W0KA 2YFNA 4L56A 3MVTA 4H8HA 2OCZA 4C7GA 2OZ3A 2PTDA 1X39A 3T40A 3MHUA 3WDJA 1XLIA 1JDEA 4QAWA 4CD5A 1XW8A 1X1NA 1WBHA 3FJ6A 3KBJA 3WCZA 4KRTA 2V67A 3W9ZA 1CB7B 3W2KA 5MHBA 3FYOA 3IGXA 1AK5A 1HP5A 3MBFA 1UA3A 5FF2A 1AD1A 2HISA 4NNAA 2VGBA 4KWVA 1GCYA 2Y4SA 4KRUA 1E0UA 1XM3A 1VJZA 1TR1A 3AOFA 3N9RA 1XF0A 5EB8A 1G1YA 1SJBA 3GKFA 2GSJA 3MV01 5CBBA 1UZHA 4BQ5A 1WDPA 3WLLA 4JBRA 4WDXA 3KE0A 4PL2A 3ATYA 4IFOA 3HPXA 4I9JA 4ACYA 4GVGA 5DT7A 1E5JA 3LCWA 3NGFA 2PD9A 1PE1A 1SMAA 1AQMA 2DJLA 2CLHA 3PG9A 4Q8MA 4NYUA 3IAQA 3ITOA 2PF8A 4NT0A 4MJZA 1QW8A 4WF7A 1YNQA 3M0HA 3QJAA 2XJ7A 2CLPA 3CLWA 1UKQA 1T6MA 3W6MA 2VHLA 2A1YA 3QSRA 4A29A 2VDIA 4H8UA 1I0BA 2QF7A 3DERA 1JGIA 2CZVA 3VE9A 3TIMA 1DWJM 2PA6A 1O95A 1EGMA 4OECA 3A4JA 3GVVA 3AAMA 3IJLA 4K39A 2PTXA 1ME7A 3DZ1A 1AZ2A 4B9YA 3LS9A 2YZ5A 3I3DA 2CLLA 3BWWA 2J7CA 3GHSA 2CWXA 5AZ1A 4DN1A 4UTMA 4GFIA 1FWJC 3AJ7A 2C1GA 3O63A 2B31A 2ZVIA 2BHZA 3DI1A 1JUKA 2JEPA 1IZCA 2AKMA 3WEZA 4TU1A 3PVFA 3D0CA 2Z2UA 2ACSA 2OB3A 1XUZA 4JTSA 3WK1A 2F2KA 3GLCA 2OLAA 2VZSA 2F6KA 5I3HA 1E4LA 4CN1A 2J9XA 2FZBA 3G1DA 1CEOA 4FXRA 4S39A 4XG1A 3ZZ1A 2CESA 3NPUA 3KVMA 3HGSA 1GOXA 1DOSA 3QTGA 4PTWA 3IS4A 1RQBA 4Y8EA 3B0UX 5G4WA 4IMGA 1D8CA 4HPJA 9CGTA 1TQXA 3B40A 1OT1A 3AHVA 3HGOA 4A3RA 2PDMA 5IDZA 3TJ4A 4IFKB 1NDVA 3THAA 3UWEA 2Y7FA 2YA2A 4O0ZA 4R88A 5D38A 3SCWA 2OEMA 1GTEA 4CD7A 3HJZA 4TO8A 1KKOA 5A8MA 4WY0F 4C6JA 1A3WA 2HPIA 3S1GA 3R79A 3QF0A 1PXGA 3FCPA 1TV4A 3N11A 3RHGA 5BU9A 1TCDA 4UOZA 4GKTA 4JFUA 3BLLA 4Q8UA 2BB0A 1TSIA 3AIWA 1EOMA 2XVKA 4NRRA 4PA8A 3PTMA 1VPXA 2CLEA 1NFBA 4XZWA 3OJGA 4AZBA 2W27A 1F05A 2Q3RA 2ZRUA 1B4KA 4UFJA 1E0WA 3MQTA 3QZEA 3DUGA 3PWGA 2OELA 3WO8A 4AH7A 4DJFA 3M46A 3DYPA 4MFEA 1FDYA 5CZ0A 4QE5A 3WF1A 1OX4B 1DIOA 2OKOA 2WC7A 5F2GA 3QR3A 3AHYA 3ARZA 4Q22A 3ZFHA 2BXVA 1OQFA 5DXXA 4HPXA 4GVHA 2WWCA 3CUFA 1YDYA 3IJ9A 3F4VA 1XFBA 1THFD 1EIBA 1TTPA 3RPTA 5I2UA 1KRBC 1IXQA 2BNJA 3P5YA 3BCDA 2RUSA 2D23A 2E9LA 1KA9F 1UC5A 2WO5A 1UYQA 1VHNA 2P0OA 2NV9A 4C1NB 3W74A 3VDHA 4LBRA 4IIDA 3RJYA 1MRQA 5ABTA 4QBXA 1XBXA 5HATA 4UR7A 3KRBA 4GYKA 2E8ZA 4D6FA 4C65A 3KBNA 3I65A 2NUWA 3CIVA 2C91A 1QW9A 2DW6A 5ECVA 4EF9A 4HYRA 3KL3A 1GVSA 2VCBA 2A85A 3H53A 5EYWA 2F6UA 3R89A 4EACA 4CU6A 2QULA 2PGRA 1UP3A 4ADTA 4NUWA 2ATMA 1A5AA 5I3DA 4PEEA 2XPKA 3SECA 3OO2A 2A3LA 2ZUSA 3PSWA 1K9EA 5TQLA 4YMZA 1QI5A 4ZEPA 1RHCA 4GNKB 4F79A 4GI9A 5T91A 3SM0A 8XIAA 2NV2A 1HO4A 4F0LA 3QYSA 3W1TA 2FZDA 2BTMA 3VNYA 1XIJA 1SYTA 1NFGA 2VC9A 4NNCA 3FFSA 3F5KA 4FX7A 4ZVJA 3GIPA 2YB1A 2ZUNA 5LIUX 3LTYA 3PULA 3F4NA 1Q8AA 3ALFA 3EWCA 3GTXA 2EHHA 3GVGA 2O9TA 4Y2WA 5L9FA 2D0HA 4ORIA 1UD5A 5D32A 2QGHA 4AD4A 5LXXA 2WSPA 1ZJBA 3FXYA 1OFBA 1W3JA 3TCEA 3QY7A 4LCSA 4MB4A 1KFJA 3L2MA 4X0VA 2W9MA 5EPDA 3RUBL 1CWYA 2QJMA 1RCXB 3U4AA 2PC8A 2G5WA 1N7KA 1T8QA 4LAUA 1ONXA 5CPSA 3JZEA 1I1WA 1Q7QA 1WKYA 4DJDA 4GGBA 3ZR6A 1PZ3A 2QVNA 2CPUA 2Y62A 3BXWA 3LCGA 3QTPA 4KF1A 4W88A 3NO5A 1IEVA 3HPZA 4R7OA 1FCBA 3NPXA 4AHPA 5A6BD 4QRNA 5AHNA 2BY1A 2X7WA 4EPEC 4ZFCA 3EB4A 2G50A 3MC5A 3T0DA 2CLMA 3QRHA 1BKHA 4FOUA 4LUSA 4CN4A 3F4WA 1UD6A 5LGXA 4ZO7A 4OGZA 4EE9A 2EPLX 4QDWA 3C0JA 1YEYA 1RPXA 1ZSXA 3F5LA 7CGTA 5GPRA 1X7FA 3EBVA 2GFTA 3QYQA 2FMOA 1TQJA 4H9ZA 2D0FA 3HM7A 2OZ8A 3TVAA 3SCTA 1WQ5A 3BMWA 3TWBA 4QG8A 1HJVA 3K4DA 3M0XA 1KGWA 4Q4RA 3VIPA 4UTLA 2QCDB 1W5MA 3NEVA 1XIMA 3R25A 1N82A 2GGJA 1SJCA 3PB0A 1UKOA 3PAOA 5LA1A 3B0VC 4LYKA 5SWUA 1KB3A 5FEZA 1M03A 1QI3A 1VEPA 4HNCA 4NX5A 2JK2A 3S47A 3EX6A 2G4JA 3UG8A 4H7CA 5BXTA 1H4PA 5EMJA 2VOMA 2WNQA 1AQHA 2VC6A 3OLEA 3UU0A 4F3HA 4H9MA 1WE5A 3CTLA 3RG6A 1FHVA 2Y7GA 4S3EA 4A3QA 3HF3A 1OVDA 1ITUA 2J47A 2PP1A 3EWBX 4FXSA 2QJNA 4FEZA 4TMCA 1P0EA 2VEGA 5J5DA 4QITA 3R12A 2DZVA 4LALA 3TYDA 1KM6A 5AHIA 3DFOA 3UZJA 1V0NA 5DANA 2PPGA 4P7OA 3L5AA 4LH8A 2Z4GA 2YL9A 3GBEA 3TA9A 4ECLA 1E3XA 4CNUA 1BRLA 1M9HA 3TH6A 1ZB5A 4BKNA 4ZFMA 1U5JA 3LXBA 1MQRA 1UOZA 2ISFA 5F4SA 2CHOA 1S1RA 5EY5A 5BYWA 2P3ZA 3T2QA 3GQYA 1EJSC 2B0MA 2DSUA 3IK2A 2RJGA 1JZ3A 1G67A 1GKPA 4ROQA 3IGUA 2G41A 5FJOA 4ZSUA 1W9DM 4H04A 4XAGA 3AXMA 4MSSA 2X1RA 1QO5A 1F3EA 1F3TA 1RP9A 4KPLA 4JNMA 1F61A 4JX6A 4GUGA 3FA4A 2FFCA 1K4HA 4Q4QA 3BW2A 3QZAA 1GT8A 3IJDA 1DJYA 1KR0A 1GG0A 2GJPA 1FWIC 3AHXA 4H6RA 4C6NA 3K5XA 1SMDA 2QCLA 2PEVA 1PIFA 1PZ2A 4LW7A 3KTSA 2JFEX 4KQNA 4AZIA 3W7PA 2C16A 1JD7A 2AKZA 3WQEA 1SPQA 2DIJA 1B3OA 1ADSA 3UXDA 2O92A 1H11A 1TZ7A 4W85A 3EWUA 2W63A 1ALDA 4WXYA 3NSNA 3S0CA 1DXEA 3SY1A 1G4EA 4UMBA 3LQLA 1FXPA 4O57A 3TQPA 4GO9A 2W66A 1DJZA 3P0WA 3AMLA 3AXIA 4ACZB 4RV3A 3WK3A 3SGUA 4I5RA 4OIFA 3GHUA 2EGZA 3NTYA 3M07A 4KIRA 5AYYA 5C54A 1D2KA 1W9VA 5H8UA 3M0YA 4WLCA 3VNZA 3NAVA 1Y5WA 1H1ZA 3IACA 3SO7A 4M6UA 3FGCA 3R6IA 3M0VA 2Q09A 1OZMA 2HNEA 4XZMX 4OZOA 3OODA 4MYAA 3AU6A 4OHQA 1K8XA 1JQXA 1H3GA 4Z2GA 1YKWA 1E9IA 1T7LA 5JXQA 4F0KA 4AX6A 3VIOA 5HDRA 5B7YA 4V15A 4I5UA 4JTRA 1KCKA 3VOIA 1P4CA 4JFVA 4IQJA 3SCOA 3DECA 3ZVHB 2ZWZA 2BVWA 5CJNA 5T9CE 4AXKA 5C2GA 3O6DA 3RX2A 3VIMA 3LLXA 4V1XA 4DM1A 3V1HA 2FB3A 3TOYA 3V5FA 1QCWA 3WUGA 1VFOA 5HJYA 3PTKA 1RQHA 2DP3A 3NQMA 3W2UA 3VKDA 1Z89A 4FLSA 4JQ1A 3BVJA 4H8NA 4NZ5A 3CL8A 4HNVA 1ISWA 1KO0A 1DHKA 4KMQA 1UHVA 3PTDA 1L6WA 3CC1A 4GPNA 3ENLA 3W07A 1A5UA 3DFPA 2EG6A 1RUSA 2HSAA 3DGRA 2RHGA 2BHYA 3LGEA 2G3MA 4MWAD 4RDVA 4JTEA 1TX0A 1OK6A 3ZS4A 4YWIA 1QATA 1ZNNA 4MUPA 4C6IA 3DESA 2LLEA 2VX4A 3BZJA 3T1GA 5EBAA 4HTBA 3WQVA 2OODA 3PAJA 1QMLA 1K1DA 1DORA 1WDWA 1IEIA 3N15A 2Z1BA 1HTIA 4IUOA 5A6KA 1F2JA 2QCNA 3ZQ9A 1OT2A 2WM0A 3RPDA 2I5QA 3L2IA 4MLJA 4B92A 5E1QA 2Z00A 4GNJA 1NQKA 3MSGA 3PY2A 3ATZA 3RIKA 1ONRA 4GYFA 1XPGA 3WNLA 4UMAA 3PBUA 4E5TA 4WEVX 1SW3A 3BZGA 3URAA 1UJPA 2V8ZA 1J11A 4G7EA 1J2WA 4HJFA 4J3XA 2G96A 1MWOA 4UQAA 1UW9A 3CZEA 1RY0A 3OEXA 3WQGA 3XIMA 3G3MA 2CZFA 3TU9A 8XIMA 5EFDA 3WF2A 3L7RA 1FA2A 1XSKA 1CXEA 3T8LA 3GTNA 4I7WA 2I17A 1P7TA 3N4AA 4O0QA 3LNMA 1BVNP 3K13A 4RXFA 3SQLA 5AFDA 4A35A 5CG0A 5HR7A 1KBIA 3OB8A 4OTKA 1MNZA 1LG2A 2PS2A 3R10A 4UQEA 5IDIA 3GVRA 3QC3A 3DHUA 3EMQA 4LUIA 1LLOA 4DY1A 1QWGA 2GVYA 4GZ7A 1J5SA 4MY8A 3OYZA 3MU7A 4J4KA 4JHOA 4R9XA 4BF9A 1ZJIA 1W3KA 4KWSA 1J0YA 3GW0A 4WD0A 1MMFA 2VRQA 2HQAA 4YJ5A 3OBAA 1EOKA 1KM0A 5LIXX 3B0YA 1J79A 2CLKA 5CPQA 4JKKA 1QHOA 5KZMA 2P0IA 4AZ6A 4CKQA 1ZALA 4FPSA 3T2PA 1K7FA 3K4AA 3CL7A 3S2LA 3E38A 1J0IA 4C5YA 2QLYA 1BYAA 2VFDA 1TPB1 4ICNA 1MDRA 1CGVA 4PB4A 2X1SA 2X05A 1YYAA 1VRDA 4G7EB 3PPHA 3SCUA 3TTEA 4ZQOA 1A0EA 4I3GA 2VFHA 3UJRA 3VI2A 2GGEA 4JTCA 5CC3A 1Z42A 1EUAA 3W6YA 1V79A 1OG6A 3N2BA 4EX4A 1EO7A 4AG0A 3MI6A 3EMZA 4GCXA 3SAZA 3ABRA 1UUQA 1IT0A 3HG2A 3EWDA 4Z2LA 5LXEA 3DXIA 2ZZ2A 1ECQA 2OLHA 3L5LA 2IPJA 2GJRA 3GNOA 1GW9A 3AS0A 2E1WA 3ZJ8A 1QO2A 3E5BA 3RCYA 1NFPA 2YL6A 5A2BA 3C56A 3ERPA 3BURA 2Z1WA 1BGAA 1UZDA 3L4UA 5I09A 1WV2A 3MT1A 1FWAC 1P0NA 1A5LC 2XDFA 1L8PA 2CLFA 2HNHA 3SUSA 2W79A 1WOAA 3PBYA 3UFYA 5K7JA 3WX7A 5D2VA 3N19B 2WNNA 2DZAA 3LM7A 5TD4A 1XGZA 4US5D 1QOQA 3NCOA 4J28A 3U7BA 4IHCA 4NL1A 4LF1A 2PLKA 5CQ1A 3CUZA 1U33A 3UEQA 3I6EA 3OGSA 3PZQA 1E6RA 3H22A 1E70M 4GVFA 3W7KA 3L65A 5K3VA 1Z3NA 1QPOA 3CNYA 2Z7GA 5I3GA 4LF2A 2A7PA 2Z1KA 3FHQA 4KBXA 4RNHA 2JIEA 3NIYA 2J74A 4FAMA 4R27A 5TBOA 7ODCA 2PGFA 3OIXA 4ZXLA 3SSJA 4EOUA 1GZ1A 4Z2JA 3G18A 4QQUA 3VD3A 3PNUA 4K8GA 4BHYA 1VCGA 2J25A 5E70A 4GQRA 4ZO6A 1T0OA 1SGJA 1ITXA 3MKVA 1UWTA 3CYVA 3SGZA 3LCXA 5AHLA 3UZZA 2H3BA 3TP4A 3N2MA 1QOPA 2VX5A 3DKLA 4G5DA 4MJMA 4QX4A 3RO8A 4O10A 2V2CA 1OWQA 3MS8A 4PBFA 3MMUA 3EX2A 3EWXA 1B54A 3TW6A 1LBLA 2YCEA 1CI1A 5CEWA 4WSHA 1YDNA 4BCEA 1KNWA 2VP8A 3PUDA 2OMAA 2W0UA 4C6EA 2VNCA 3QC0A 1ENUA 4XD6A 4LFYA 3RM4A 3BLEA 5CBIA 4NI8A 3QM3A 1Q6GA 4JQAA 8RUCA 3WEMA 3P14A 2OWCA 1W1IE 4Z2IA 4JZ5A 4S23A 3BOXA 4RNIA 1MRAA 4W4QA 1VD6A 4B5VA 4GY0A 3SCVA 4U5IA 1ODZA 1F6PA 5G1TA 4PCTA 2ZUWA 2R24A 2YDRA 3GC4A 1H63A 3TCSA 1JYWA 3FXGA 4XIAA 4FLQA 4NNBA 4HNNA 1XYCA 2CFFA 1LCOA 4RDYA 1RK6A 4AYGA 4AU0A 1A4LA 3C52A 2OJPA 1J0HA 3QGAC 2IXVA 1DWAM 1YNPA 2PTYA 4ZOAA 3QR1A 2Z28A 3TKFA 2X1IA 4CGTA 4XZBA 3HPSA 2J7HA 3NL5A 2VZTA 3MO7A 1LM1A 2UY4A 1OABA 3UJSA 1EF2A 1PEZA 4ML4A 2CERA 1CXLA 2FZ8A 3GBDA 3V0TA 2PWVA 2V68A 5FESA 1RLDA 1EJTC 4S38A 1I2PA 2QPUA 4GI6A 1XLBA 3VGDA 4P61A 5D05A 2EO7A 1TE6A 3V7PA 5CC5A 1KCXA 1ZZMA 2TAAA 1TMLA 3EOLA 2OU4A 4IJBA 4AMAA 3DEQA 1UP2A 3P74A 3DC0A 1KFBA 4IISA 2WHJA 3T55A 1DVJA 1DJNA 1VBRA 3BUVA 1E6SM 3L66A 1T41A 4HZ6A 4TQTA 5AECA 4EAYA 3UZWA 3QPZA 1VEOA 3EPNA 4QE1A 3LX9A 3NDZA 4YTQA 4J3VA 1FWEC 3P6LA 2DSWA 2ZOXA 1D3CA 4I6KA 1PKMA 1M1BA 3H7UA 3JUGA 3PPGA 4JY9A 3PP7A 1GPFA 4OT7A 3SUVA 2Z26A 2V30A 2ZVRA 2NSXA 1RD5A 3KVLA 4E4FA 3KL0A 3AMKA 2NWRA 4S1FA 3ES7A 2PZ0A 2NVDA 1S2WA 4QDMA 4CNPA 3O2LA 4M6VA 4Y9MA 1AL7A 3I6RA 3P0XA 4IIBA 1KXQA 5E09A 2RAGA 4XAZA 3P3BA 4LAKA 1ISVA 1X98A 3WEOA 4JTTA 4NZ1A 3NEHA 3UQNA 1RY8A 3CO4A 4ZTYA 1C3FA 2DT1A 4UFMA 4AMCA 3GC2A 1EWDA 5C2CA 3V1PA 4RX0A 1H1YA 1Z41A 2DSVA 3GG7A 2XVPA 5D8WA 4AZ7A 4XZNX 4LOCA 2CIPA 1W91A 1R7AA 1UR9A 5JBFA 4CQ9A 4PUWA 3UGVA 4PSPA 4CN6A 4HJWA 4S3BA 1N55A 1E55A 2G3IA 3L2LA 4YLWA 4IIHA 3BGGA 3S9YA 5IXEA 3EX3A 3RLGA 3G77A 1IWPA 1OD8A 4Z1YA 1KRMA 3S5OA 3ZOAA 3NO3A 4EXQA 3WBXA 1WZAA 2WSQA 1ODUA 5FEXA 4AEOA 4B2DD 3I6TA 5D9OA 3RNDA 4E2OA 1WOBA 3NOYA 4FXJA 3TWAA 2YYTA 4G2DA 5FJRA 3RMEA 2C19A 1BXNA 1TYGA 3OGVA 3K8LA 4OBTA 1LL4A 3EKZA 3MJMA 4RV8A 1A4MA 4QFUA 3F2DA 3NQDA 4DIAA 5EMLA 4LVFA 4R53A 5ENLA 1C7SA 4XD4A 3LD5A 4JFSA 2GOKA 3BDKA 2V5CA 3W87A 3IJ8A 3VIJA 3ZLGA 4JYFA 1JFXA 2UV8G 4LT9A 4FP1A 1LT8A 4Z1CA 1US3A 3UWYA 4NKCA 5A6BA 1TA3A 2Q8LA 2C13A 2CXEA 4H3DA 3TJXA 2X09A 4FLRA 3WJWA 3ABZA 4R5EA 4GG9A 1W37A 4GQBA 4M7SA 5DELA 4Q8NA 1KXVA 4H83A 2DVUA 4HIBA 4H9XA 1T40A 1M7PA 5CCZA 3T09A 1Z9AA 3WBAA 3ZWSA 4DPPA 1EQPA 1P0KA 2DJXA 2OQHA 4PC8A 2W3ZA 3SCRA 3C6CA 3SCNA 3VM5A 3S6DA 4R85A 4WOQA 3LPPA 2A7RA 4IQDA 3QOKA 5M17A 1XJBA 3H2MA 1EZ2A 2UZ9A 2H3DA 2BP1A 5C5YA 3VPLA 5D37A 1GVFA 2ISVA 3LB0A 1JYVA 1UZ4A 4HBKA 3LOTA 3EDKA 4KCUA 3WMSA 2X7VA 2OPJA 3PS7A 2IPGA 3GDBA 4XUGA 3I7RA 1JXJA 5CC6A 3VFCA 1JPIA 3EPOA 3W02A 3GE7A 3LCHA 4Y9NA 3WFAA 3UG5A 3MZ2A 4ZQPA 3LHYA 3K8KA 2VEMA 3SZ8A 2XN1A 1HFBA 5F2LA 4NJGA 3TW9A 1XWYA 3UT0A 3I3EA 3IK4A 2QHAA 4AB4A 1BYDA 2FGLA 3W85A 3WD2A 2R1KA 2I5GA 3GK0A 1YQ2A 2ZICA 3NQ8A 3NJ3A 3FKRA 2DQXA 4HHHA 1BHGA 1LL6A 3WJXA 3WDRA 4GY1A 2QCGA 3OG2A 5GJPA 3TAOA 1EZWA 1Q13A 1ISYA 3MY9A 6ENLA 5EU9A 3CYJA 2O56A 2YYUA 3VNJA 4M80A 2V5JA 2VR2A 3M9YA 1I1XA 4E8GA 1CENA 1TMQA 2EJAA 3AHZA 3GDKA 1VYRA 3M4HA 1B31A 1AUSL 1OX4A 3N6HA 1VYPX 1OGGA 4MNMA 5I5RA 1RV8A 2JKEA 2Q8XA 4AF0B 4QNWA 2PRMA 1KBLA 4QJ4B 3PUEA 5HINA 3L23A 4UFHA 3VILA 1FWWA 1BSIA 4R3UA 2OOGA 2JKPA 4OUEA 3R8GA 2PDLA 5EL1A 5F4XA 1UWIA 3W7IA 1C29A 1SJDA 4DXXA 1HF6A 4MTVA 2OO0A 4P7LA 1VFMA 4E2DA 3O05A 1MXSA 4YCOA 3L4VA 5CH9A 4JKMA 1GQJA 3DG3A 5HANA 4DUWA 1XD1A 5U7SA 2VUNA 3GTIA 3LPGA 1LLZA 4I9AA 1Q6EA 3P8JA 4LEQA 4EANA 3UPBA 1JCJA 2HV5A 5C55A 1PDZA 1W3TA 3O0FA 3ARPA 2PI6A 1U1HA 2HS8A 4IMCA 3O16A 1F6KA 4FO4A 2ZZ3A 2VC7A 1Z48A 1EX5A 5K9DA 2UY3A 1PHQA 2HDJA 5JBEA 1XH2A 4HQVA 1RLCL 1PSCA 2E5CA 4C6LA 1KTNA 1U1JA 4ACZA 4CNNA 1TREA 3UPWA 2PDIA 4MJ4A 4O28A 4XIMA 4GRSA 3KVKA 4A2SA 5A8PA 1GZGA 1R46A 4IL0A 4RE2A 1RQEA 1Q65A 3F03K 3WH8A 3PNZA 3OTRA 5I7GA 3BG3A 1EXPA 3W73A 4DB7A 3ZJ7A 3IANA 2YDQA 1ONWA 1I2NA 3S1UA 3CXOA 4GUJA 2A3EA 3WNOA 4R9OA 2BASA 4WUIA 3S2NA 5M03A 1VR6A 2YDSA 5CBJA 4WGXA 1OB0A 1LT7A 4HPNA 1GYMA 1NDZA 1Z8AA 1JPKA 4IIFA 3ARRA 4B4FA 4H9VA 1VF8A 3FA3A 4QNEA 5REQA 2ZUTA 1G7VA 3IWPA 1AL8A 2YGYA 4HK5A 4IP4A 1FP8A 2WJZA 2J6XA 3R1ZA 5FL0A 4Y9AA 2QR6A 2DZTA 4L6OA 1R3YA 4CVUA 2WSRA 4S2BA 4IX2A 1OCNA 3ELFA 3IIXA 3B9OA 1QRQA 1BVWA 1TPFA 1EJVC 2WHLA 3T7VA 1B3ZA 2W61A 2BY3A 1M53A 2Z1XA 4NXKA 2WBKA 3GR7A 1EHNA 4CEUC 1RBAA 1OCBA 5CC7A 2WW5A 3WDQA 5C8BB 4Z1BA 3AZTA 1NF0A 4YU1A 2NW0A 2DH2A 2JGYA 3FGCB 4B2DA 4KFPA 1GVOA 3VUPA 3GD6A 4H6EA 1JCTA 4BF7A 3PZUA 1TVPA 1TUXA 1XGDA 1JRCA 2DPEA 3NQEA 1AZ1A 3G0UA 3SJ3A 1ELSA 3DHFA 2VRKA 2ZQ0A 2PWFA 4FF5A 1WYIA 3T2OA 9RUBA 5DFAA 3F4CA 2WXDM 4JEQA 3AS1A 4MJ2A 3GZAA 1JZ5A 2WPBA 1HKKA 3WQ5A 2QCHA 4BWLA 2GUYA 1XUUA 3EOUA 3P80A 2PBGA 1W5PA 4AD1A 2NXIA 5AYZA 3S2JA 3AMCA 1EBGA 3VDAA 1QI2A 1IWAA 4JL1A 3AXHA 1PVNA 1I9CB 3D3AA 1MXDA 2B4GA 4HU4A 3AIBA 2XSBA 2VX7A 3LRMA 3CHVA 1WDSA 2D2HA 3LPFA 4ADSA 4F0MA 4A6GA 4FNSA 1FVPA 5I06A 1UD4A 2PTWA 3AWNA 1LBFA 3F5JA 2GUUA 1A5KC 2V69A 4NYYA 2H8ZA 4GJIA 2UBPC 2J9ZA 3KL5A 2E8YA 4HU3A 4MFDA 4OV4A 1TCMA 4DWSB 4WDWA 3CWHA 4AAJA 2QJGA 4M7TA 4JIPA 3LI0A 3S46A 3H6OA 1OCQA 2CBIA 2E6DA 5G5IA 4QM1A 2ON3A 3REQB 4GY7A 3TE9A 1D8WA 1CBGA 4HHLA 4DJEA 1MNSA 4FNTA 2WVTA 3UNDA 2WKLA 1X8CA 4GH1A 4UOJA 3WQ8A 2YBUA 5EKYA 3NR0A 1DWGM 1RCOB 1UOKA 4L7ZA 4ZXOA 4IP7A 3S4TA 3QGVA 5DX7A 4A8LA 2YPIA 5D09A 2D3NA 2QUNA 5A6SA 5I00A 1QK0A 2WVSA 2Y1HA 3PZIA 1V03A 3WN6A 1WXJA 4QXIA 3FJNA 1IEWA 5H6HA 3VNIA 2VDGA 2VO5A 1TIWA 2PC4A 3IEBA 3Q94A 2O4QA 4M6PA 2YBVA 5I6SA 4TIMA 4LAOA 2AMGA 3H2NA 1SZNA 3AXXA 4PTNA 1A5MC 3EDJA 1LDCA 4NAFB 1SFJA 2QDGA 2HROA 1MO0A 4JY8A 3CV6A 3GWQA 1VBHA 2NUYA 1V3MA 2PB1A 1X97A 3SRKA 3AC0A 3W7MA 2J24A 3L0KA 3WF0A 1X1ZA 4FMVA 4C90A 2NWSA 1F7BA 5A5WA 3V36A 1XX1A 1JCNA 3IGHX 1WCGA 3HIJA 1TELA 1GQKA 3M7WA 4UZSA 2IMRA 4DZIA 5FJTA 1PAMA 1VPYA 4KGJA 2FPVA 3TN6A 3CIXA 2J13A 2GJXA 4K2SA 4JTFA 1JIBA 4I7VA 4IXXA 2XGIA 3WFZA 3HB9A 3R0DA 1UR3M 2R9RA 3A23A 1UBSA 3TNOA 1RA0A 1ZBKA 4XV0A 5LIWX 1SU5A 1CDGA 1JPHA 5FJJA 2ZKMX 1AQ0A 5C9RA 3W3OA 1QNRA 1NELA 4JN6A 2E40A 1CCWB 4K8HA 5C7HA 1H62A 6REQB 1VFTA 2F38A 2PDKA 1R7OA 2CWNA 4PMDA 3G24A 3TQKA 1FWHC 4LEFA 1POKA 1H5VA 3VDCA 2GJNA 3ID7A 1HKWA 4UQBA 5CPTA 1EFZA 1JYNA 4ERIA 1E1FA 3AALA 5D04C 1W2PA 3TDFA 3WD4A 3AO0A 1FY6A 3CZ8A 2GUBA 1VGAA 4B15A 1JD9A 4JTKA 3C2VA 4WKHA 3CUGA 6A3HA 3L0NA 2FH8A 2C71A