3AXHA

Crystal structure of isomaltase in complex with isomaltose
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGAMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Steric hindrance by 2 amino acid residues determines the substrate specificity of isomaltase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase IMA1
total genus 229
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3axhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3axhA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3axhA02
3W38A 3ZJKA 4B16A 3GBDA 1TA3B 5BROA 4AZ7A 3WH9A 2IGTA 2VX4A 4ACYA 5HPCA 3WQ5A 1M01A 3U7BA 1G0CA 3WQ6A 5D9OA 1NWSA 3GTNA 3CH9A 1EDTA 2V3EA 5HBFA 2CBIA 4QFUA 3CPUA 1ISWA 3T0AA 3NCOA 2NW0A 3D50A 1XGZA 1ZB5A 3BVUA 3T2PA 1WKYA 3GBEA 3BH4A 4MB5A 4OUEA 3FXYA 2J75A 2WPGA 1J9YA 4XZBA 1E40A 1TFVA 3GH4A 3VIIA 2WHJA 2CNCA 3GXPA 3WNLA 4AZGA 4H8VA 1UKQA 4H8UA 3WL0A 3ZQ9A 2BXYA 2YKKA 4J3TA 2UY3A 1D3CA 2V3GA 3KEHA 1EHNA 4HZ8A 2UY5A 3EDDA 2VUYA 1UZ4A 1OT1A 2F1AA 3MUIA 4W7VA 1XV8A 2J7GA 2EADA 3WNMA 3BUBA 3FNDA 3EJTA 3ALGA 3SCWA 4M8UA 1GOQA 5FCZA 4CN1A 3IAPA 1PPIA 2QPUA 2X2HA 3B9DA 1PIFA 3GDBA 2ZXDA 3ZR5A 2ZXBA 2WZIA 1JD9A 2WVSA 1NP2A 1PZ3A 1H5VA 1TR1A 1UR0A 1U33A 1C7TA 1M04A 5BWFA 3LXAA 4ZENA 2WWCA 3HU7A 2JFEX 1XYZA 3N12A 4XB3A 4PEEA 3EJUA 3BVVA 2FDMA 3VMPA 1R87A 3CUFA 3LPGA 1W1YA 1DWFM 1V03A 1J11A 1ZL1A 1JZ3A 1VJSA 2WNWA 2VR5A 4W8AA 2JALA 1MW2A 3LRLA 2J74A 3MMDA 1H41A 2EABA 3CBWA 4PSPA 3WL1A 3BMWA 4KMQA 4TVDA 5CPQA 5CJ5A 4R5EA 5I77A 2GDVA 2XSAA 3AZRA 2RGMA 3SIMA 5IXEA 4AMCA 3K8LA 1H2JA 1NP0A 1JYNA 2UY2A 2CBUA 2EACA 1B1YA 2YDRA 5IHRA 5ABFB 4WSKA 3PZQA 3WDQA 4CU8A 2CBVA 4DM2A 5ABHA 4P7LA 1HVQA 1IV8A 3CZEA 4EAMA 1W9PA 5CQ1A 2BVYA 4DO5A 4LYQA 1TUXA 1NM9A 4P8XA 3M07A 1HP5A 3T08A 1UD2A 3MMUA 3KLLA 1GUVA 2WLYA 2BY1A 1FA2A 5C8BB 1CLXA 3WQVA 2DT3A 3VUPA 1CGWA 3VIGA 4C7GA 2DEPA 3ARSA 1M53A 1I1XA 2WBGA 3SUSA 1GPFA 2CIPA 1B9ZA 1F4HA 1K9FA 1V6XA 3BUIA 3CTTA 4PMXA 4WKHA 3ZR6A 3OGRA 1PX8A 1KXTA 1CGXA 1QWNA 1V3LA 2ZX9A 3PZUA 1OBAA 3WF1A 4UZSA 4ZE4A 4JCLA 3VD7A 1HJQA 2VX6A 4PBGA 5IFPA 2ZE0A 4X9YA 5AC4A 4S3JA 1CBGA 3VD3A 3APGA 5A2CA 4TOQA 4UOQA 1DWIM 3L4UA 1EXPA 3ZO9A 5EFFA 3BMVA 3KWXA 2OSXA 1R7AA 3OGSA 1ITCA 3FAWA 1ZBKA 3A3HA 1QBAA 3QHOA 1HWWA 3EDKA 3A6OA 5FL0A 3AJ7A 4WK9A 2OWXA 3PZTA 3ECQA 2WCGA 3WF3A 4AZIA 3L2LA 3AYSA 3MUAA 3SCQA 2XN1A 1R47A 5A3HA 1KQZA 4U5KA 8CGTA 1KQYA 1J12A 4CD5A 2Z1SA 3ZJ6A 4BF7A 2ZWYA 2D24A 1UR8A 5FIPA 4B3KA 1R34A 1B0IA 3CZKA 3I3BA 3CUIA 1BFNA 4MTVA 1LF1A 5A69A 2PB1A 1K9EA 3F5LA 1C8QA 5AY7A 2OWCA 4C7DA 2PWDA 3AMLA 1QBBA 2J7BA 2QHAA 4FNTA 1CXFA 1V6YA 4D6FA 1PAMA 1TQWA 1JI2A 3AIBA 3OZPA 3EYPA 2J62A 4U2ZA 4UQCA 4AXNA 3PZIA 4JIEA 1JGIA 2F7RA 1QNSA 2YJQA 5CZKA 4M56A 5IDIA 2J8FA 1TQUA 4J3VA 2O9RA 1KR1A 5GQBA 1A47A 1UKTA 2D0HA 4AMXA 5LA1A 5CGTA 4D6JA 1W9UA 2V5DA 1XYFA 4PCTA 5A6LA 1ISZA 4HA1A 1W2PA 3N04A 4HPHA 5I0DA 1H09A 2WBKA 1EOMA 4M1RA 1UWUA 2FE0A 1V08A 3GH5A 4D6EA 2WC4A 1U2YA 4UFIA 4YPJA 1R75A 3WQ4A 5GNZA 3WUGA 4FNRA 2XYLA 1UOKA 3AS0A 3T2QA 3WDIA 1OCQA 5A6BD 3DDGA 3WY3A 3WD0A 4JFVA 1XSIA 3LPPA 3BSGA 3DHPA 3EMQA 5A8QA 4D71A 3CO4A 1E0XA 2ZIDA 7A3HA 4HA3A 1ITXA 2WAGA 4Z2JA 1CNVA 4B15A 4B3LA 1V6VA 3MO4A 3BAXA 2ALWA 3WEMA 3AISA 3HMCA 3NDYA 4RE3A 1JZ7A 2PWGA 2WXDM 1LL6A 4U3AA 4PMVA 3U57A 3K4AA 4HP5A 1HKJA 5BXTA 4GINA 4GZIA 3OLEA 4ATWA 1JYVA 3OB8A 3W28A 1UR2A 1E3ZA 2D1ZA 2JEPA 2FYVA 4FNPA 3RM8A 2G4FA 3A23A 3RMEA 3W4RA 5LA0A 1WNOA 1W3LA 3GXIA 2D22A 4PMYA 3WFLA 2WM0A 4TTGA 1E6NA 5GNYA 5HDRA 3OLDA 2JF7A 2BS9A 1CDGA 1KTBA 3NSMA 3UR7A 3AMCA 1MQQA 1TCMA 2EPLX 4QLKA 1QOXA 3AZSA 2J77A 1J0HA 1DWAM 2XHYA 3W6LA 3ARPA 1BAGA 2WHMA 2CYGA 4MAZA 2D3LA 1JDCA 1UWRA 1HXJA 2F18A 1HP4A 4D6CA 5A6KA 5BXSA 2GJXB 4MNMA 1OGBA 2A3CA 2IUZA 1V3JA 1WCGA 4AIEA 1E4NA 2WMKA 3BVXA 2W5FA 1QNRA 2D0FA 3WUEA 2OW7A 3WN6A 1HJWA 3CZJA 2DGAA 1W3HA 1RP8A 1D7FA 2XVLA 4HPGA 1JNEA 4F66A 2E3ZA 2PF0A 3PZMA 5CPTA 5A94A 3UG5A 2O9PA 3WD4A 1SFSA 1MXDA 1UZ1A 3N11A 3VGBA 1UKOA 1HTYA 2DT0A 5JBEA 1EGZA 1V02E 1KGWA 5I24A 3MANA 2X8RA 1MXGA 2BFGA 1B3WA 2FGLA 1P6WA 1J0JA 3K4DA 2WMIA 2VQTA 1E73M 4P7QA 5I2UA 3EJSA 1NH6A 4D6DA 1KXQA 1B3ZA 2W4XA 4PN2A 2CXGA 3KLKA 2VCBA 4LQ1A 4CU6A 2YBUA 4OIFA 1OIFA 2DSZA 1UH4A 2DT2A 5CLTA 3ARUA 4OBSA 3D52A 4UZUA 2BY0A 3WD2A 2ZOXA 5A6BA 2OYLA 4P7RA 4QCFA 5IHSA 3D5HA 2PBOA 4PCSA 3W25A 3ZT6A 3EMCA 2XGBA 1KR0A 3MUZ1 4M81A 1CPUA 2YLLA 3BCDA 4GI6A 3B9AA 3VM7A 1DWJM 3FY1A 1PX4A 1K9DA 4IPNB 4W89A 1QNOA 2Y8VA 2VZVA 1FHDA 4W8LA 1UA7A 4X0NA 3VIFA 4CN4A 1E43A 2WMHA 4MPKA 1CIUA 4HMEA 1MFVA 1KWKA 2XTKA 2ZUMA 3T0DA 1WPCA 3AROA 2BVDA 5E0CA 1QPKA 3OLGA 4XX6A 4M80A 4MAVA 4JKKA 1BQCA 3W29A 1VFOA 2YA2A 1CGYA 2W67A 3GYCA 3JUGA 2FH8A 1VBRA 4HZ7A 2VQUA 3L4VA 4FNSA 4H2CA 1E6ZA 1Q6DA 1E5NA 1V3IA 3LPOA 1XSKA 1RD6A 3SCTA 3UCQA 1E6QM 3CV5A 1GQLA 3VSTA 1RPKA 3LRMA 4UOJA 2D0GA 2PWHA 2F7PA 5HXMA 4WSJA 1HVXA 1Y7VA 2OYMA 3B8SA 4MB3A 1GORA 2YL5A 3CZLA 3WY4A 1W3KA 3SUWA 1TZ7A 4ACZA 4JAWA 5E09A 2XUCA 5D4YA 5A6JA 3L4TA 1UQYA 3CZSA 4P7NA 3PTQA 2DQXA 3S5YA 4NZCA 2XVGA 1XHGA 3L4YA 1HXKA 1JFHA 1V0MA 2EPNA 5M17A 3F5JA 5BXPA 2VX7A 3BUPA 1L8NA 2GJPA 2VI0A 1MW3A 4GZJA 1WDRA 3TTOA 3ZMRA 1B3YA 1J0KA 1BSIA 6TAAA 4EANA 5E70A 3EDEA 2DSWA 2AMGA 3DHUA 1UWIA 2DT1A 2O92A 4PRWA 5EB8A 3RJYA 1J0YA 1E1FA 1BG4A 3WDPP 1CXLA 5JIWA 4F9JA 5M03A 4OJYA 1JIBA 1ISYA 3DYMA 4TXEA 4UFJA 2BY2A 4PTXA 3S5ZA 3GNRA 1R46A 2XSBA 3A4XA 1LL4A 2WVVB 4OGZA 1RH9A 4DWSA 3WH5A 1ZJBA 4TVCA 3HG5A 2PC8A 4WKFA 2WANA 3H53A 1X6LA 4AZHA 4AMWA 4IISA 3VGFA 1QI5A 2XIIA 2XG9A 3VINA 3E1F1 3AXHA 2G41A 4B9ZA 3HZ3A 2GSJA 3VMNA 1R86A 1VB9A 1X6NA 1DHKA 2ZX8A 4GXPA 2C0HA 1WB0A 1JAEA 4D1IA 4D6HA 1UR4A 4AD2A 4FMVA 4NRSA 2X09A 4W7UA 3W82A 1FFQA 1OSEA 3BAJA 1CGUA 5DT5A 4FNUA 5I6SA 3WUFA 1DEDA 2AOSA 1H1NA 4E4PA 3EJPA 1SZNA 3A4AA 3J7HA 3WD3A 1TA3A 4UFLA 3ARZA 3EJRA 3L4XA 2F61A 3HJEA 2VRJA 5A1AA 1JXJA 1VFMA 3WY1A 5CGMA 3WH8A 4J3XA 1BG9A 1MVYA 4J3WA 4NI3A 1GJUA 2OLHA 1GZJA 4WLCA 1QX1A 3AMDA 2DIJA 1KCKA 1ECEA 3AIQA 1GOOA 1V02A 4U5IA 1N82A 1UG6A 5A95A 3ARYA 3CZGA 3A21A 2HVMA 2JEQA 3ARRA 4A4AA 4JHOA 2YIHA 3VTRA 5A6AA 2TAAA 3UG3A 1JNDA 1R33A 1EDQA 1WDQA 2DSUA 4KGJA 1OGGA 1NWUA 4J28A 1AQMA 3N1AA 1H11A 2YL9A 3D3AA 2BXZA 5HOSA 2CKSA 3ZSSA 3AS2A 1V6WA 4N0RA 3CHEA 5A2BA 2JF6A 5M5DA 2XJ7A 3PTMA 2G8ZA 2CITA 3QOKA 1W1VA 4AZCB 4JFUA 4UFMA 1ZU8A 4DUVA 1GONA 2ZXQA 4TTUA 2OSWA 4BA0A 1HKIA 3EMZA 4N42A 1WZLA 3SUVA 2WZEA 1HIZA 2WCAA 3WEZA 3AHZA 2XPKA 1YQ2A 2W61A 1LWHA 5I79A 4WIWA 2WLZA 3CMGA 2VOTA 1MQPA 3BLKA 2CERA 2G3NA 1UUQA 3B9EA 1G1YA 3PHAA 1VENA 2VCAA 1UQZA 3U7VA 1JZ5A 1IZKA 4Z2KA 3QHNA 3BLBA 3K8MA 2F2HA 2XM1A 3ZM8A 4P8UA 3A47A 3KL5A 3D51A 3N13A 3MMWA 4KRUA 2JE8A 2BHZA 4BZYA 1AMYA 4Z2GA 2FH6A 1V0LA 1CXHA 3PTKA 3ARXA 4W8BA 2Q8XA 1JYXA 1WDSA 1TVPA 4CD4A 3RCNA 1KCLA 1OT2A 3VSUA 2PBGA 3WMCA 1NOFA 3H54A 6A3HA 2J4GA 3HN3A 1DP0A 3VIMA 1H0GA 1E6PA 2WVUA 1LG1A 1TQTA 4PSRA 4PMRA 2O9TA 2G3IA 5D9PA 3WF0A 3AFBA 4A3YA 1W2VA 3MSDA 1V0NA 4J7RA 4GZEA 1DTUA 5AC5A 3RPMA 4CVUA 1E70M 3VU2A 3CZ8A 4UQ9A 3MI6A 4JKMA 4NXKA 3W27A 1HL9A 2XWEA 5E1QA 4IM4A 4NSBA 5D9MA 2W63A 2E8YA 1NWRA 2VC9A 3BAWA 3CIVA 4PUEA 5FL1A 3VGDA 1V0KA 2RGLA 4U2YA 4CUCA 3GXTA 1BTCA 1C8XA 1MWOA 2DH2A 4CGTA 1YHTA 3OBAA 3QOMA 3IJ8A 3DX3A 3UR8A 5ABGA 3WELA 4AYSA 5JBFA 2E8ZA 1PS3A 2WWDA 3BLPX 4HMCA 3CLWA 1BYBA 4KRTA 3UESA 2ZX6A 3NDZA 3SCNA 1W1TA 1KBBA 3CUHA 3D4YA 4NXSA 2WSPA 2DDXA 2PI6A 3M7SA 1QI4A 4U3CA 3VM5A 4IPLA 3ARWA 3M46A 3GXNA 1SYTA 3BGAA 1O7DC 1V3KA 3VIKA 2CESA 2X2IA 4LYRA 3WNKA 5BRPA 2DSVA 1TQSA 1BHGA 4D6IA 1DWHM 3U5YA 5M3WA 1JZ2A 1ZJAA 3VIHA 3N15A 4HTYA 2A3BA 5BXRA 1QW8A 2ESCA 3VX0A 4QP0A 4TUFA 2ZUWA 3A22A 3VIPA 5TD4A 3ALFA 1HJXA 4U31A 2W92A 4GIAA 2YDQA 4BQ5A 4M82A 2X05A 1E55A 2BHYA 1HKKA 2WYSA 2EJ1A 1UD4A 1CXKA 3WH7A 1AQ0A 3AMGA 2D73A 2VZTA 3WBEA 4AD1A 3FW6A 1KFWA 2EPKX 4UFKA 1DWGM 4UQBA 2D20A 4ATLA 1GHSA 3W37A 1E0VA 3WMBA 4QAWA 3EDFA 1SMAA 2X0HA 1KXVA 3AOFA 4CU7A 1JZ4A 3W6MA 3AHTA 1BGAA 2VT0A 1CZ1A 3MUY1 4RE2A 1PIGA 5KZ6A 4HOWA 3IK2A 2DIEA 3BUQA 4FF5A 1R7OA 3UEQA 2QMJA 1PEZA 1AQHA 1HX0A 4OKDA 3HG2A 3SCOA 1WZKA 2WKLA 2ZUSA 4GI8A 1PBGA 1MW1A 4BS0A 4R27A 1RP9A 4MNKA 1EIBA 1HF6A 4Q7NA 1PJ9A 1QI3A 1B3XA 1FH9A 2BV9A 4BQ3A 4H7VA 1UKPA 1FP9A 2XVNA 3GM8A 4RL3A 4AD5A 2J7EA 4W85A 1I1WA 4RE4A 3CMJA 4L4PA 3MSGA 1UASA 3PZ9A 1KB3A 5E6ZA 1EO7A 5BYWA 3S2CA 3POHA 2XFYA 3NSXA 2V3DA 5HNNA 5C71A 1V3HA 4DO6A 3VDCA 5BCAA 3ARTA 4V27A 3UETA 4CCDA 2AAAA 4LX4A 3L4WA 1GOMA 4KGLA 1MFUA 2WCSA 2X2YA 4FLRA 1ZBWA 2XWDA 1W9BM 2EBNA 3TTQA 2VZOA 3NJ3A 3ZOAA 3EDJA 1GOIA 4CCCA 2J78A 3AXIA 1H49A 4CVWA 2VVSA 1CXIA 3PN8A 1JL8A 2UWFA 4HU8A 3VGHA 4GQRA 1XD1A 4A3HA 2Y2WA 5I78A 2J25A 3CZNA 4MJ2A 1V6UA 3A5VA 3WQ8A 5I23A 4EE9A 1QW9A 3WIJA 1VJZA 1UA3A 2ZUUA 3KE0A 4OBRA 5DFAA 3PZGA 1JG9A 2E0PA 2ZXAA 3AIRA 3IAQA 3VSVA 3RDKA 1AVAA 4NZFA 4TVUA 4GPNA 4JFSA 2E40A 3AICA 3MU7A 5FOOA 2O9OA 3UERA 2BY3A 1G01A 1XRVA 1ISVA 4PTWA 1HNYA 1B31A 3MKKA 1W9XA 1F4AA 4JZ5A 1HJSA 3WY2A 3W0KA 3WBAA 2A3AA 3K1DA 4JFTA 3VD5A 2QPSA 3DX4A 3RO8A 3CHCA 2CCRA 4ZE5A 2D23A 3O2LA 1OB0A 3AS3A 4PMQA 3WF2A 3SCPA 4QCEA 3ARVA 3THCA 4AZ6A 1MQRA 5D9NA 3RIKA 1E6RA 1FP8A 1BF2A 5CLWA 1BGGA 2XN0A 1OINA 2CEQA 3IANA 4ZEPA 4M24A 2EAEA 4TX6A 3LMYA 1K6AA 3O6AA 1NQ6A 2J47A 3DECA 4UQEA 7TAAA 5IFTA 1CYGA 1EOKA 3MS8A 2FHCA 1CLVA 4CD8A 5LYRA 2OYKA 1GQKA 2VURA 2NSXA 1WZAA 1FH7A 1VFUA 1NARA 1E4IA 1B30A 1C7SA 1UR9A 3UG4A 3SCUA 1PX3A 1FH8A 2CBJA 4DWSD 3NIYA 2MANA 1HKMA 1C92A 1QNPA 1HJVA 2UY4A 3W81A 3DX1A 4FLOA 4CD7A 1HJUA 1WE5A 2XM2A 5ECUA 4AD3A 1EHAA 1GOKA 1R8LA 4ZXLA 2WMGA 1R85A 2A3HA 3QR3A 3G6MA 4HU0A 3H55A 1C91A 1C3FA 4U33A 1CENA 4HOXA 4GQQA 2WHLA 1LQ0A 2JIEA 2CETA 4QLLA 2BHUA 1QI2A 3HG3A 3RM9A 1W1PA 2VZUA 4WF7A 2YBTA 2XFFA 1ZBCA 2VJXA 1EO5A 5BRQA 1H4PA 4K68A 3CUJA 1E4LA 1JXKA 3VKKA 4M29A 4FK9A 4JKLA 4MB1A 2Y4SA 2CHOA 1X1NA 2YL8A 5FD0A 1LJYA 4JHZA 5JIPA 1JYWA 1I75A 1TVNA 4F79A 1KGUA 1UWQA 1LWJA 1ESWA 3FN9A 1HL8A 2Y8KA 4HOZA 1GQJA 2EQDA 4DUWA 4AD0A 5A8NA 4S3KA 4YHGA 2WC7A 5EMYA 2Y24A 2WW5A 3OZOA 3T09A 4AZCA 2WVTA 3OA5A 1JZ8A 1J0IA 4AY1A 4MADA 3DX0A 4NX0A 1E1EA 2E9MA 4HZ6A 4ZFMA 1UWTA 4OOUA 5A8PA 5CSUA 4Z2HA 3SCVA 1OGSA 4MJ4A 4YHEA 1JD7A 4CKQA 2IXVA 4D6GA 4Q22A 5E6YA 3VVGA 9CGTA 2WB5A 3AS1A 2PWEA 2Y5EA 4LXFA 4PMOA 5E9AA 4AIUA 1VF8A 5CSYA 2YOCA 3QGVA 1E0WA 2WC3A 5JUVA 5KEZA 3I3EA 3AIWA 4W87A 5HPOA 3AHXA 3AHVA 3OGVA 2J7FA 3N18A 2J8GA 1U30A 2VTFA 5I5RA 4AIOA 2A3EA 3VIOA 1OD8A 1ZBVA 2XVKA 3W53A 1A3HA 2PWFA 4QLJA 1E71M 3THDA 3WH6A 1M03A 4UQDA 1E3XA 1KWGA 3GXMA 4IUGA 3PZOA 4X0VA 2J7HA 2WK2A 1PZ2A 2XVPA 2GJRA 1QHZA 2FHBA 3ARQA 3CHDA 2QV4A 3VDBA 2CHNA 3DDFA 2IXUA 5D8ZA 5AYIA 2CPUA 4PMZA 3L4ZA 3LRKA 3VMOA 4W93A 4PYSA 2C7FA 4D72A 2CKRA 4XV0A 1K9TA 2OW6A 3LXBA 3SCSA 1LLOA 4PMUA 4Z2IA 4LGXA 3VX1A 3O9NA 4DWSB 2NT1A 4AISA 1CGVA 4B9YA 4W5UA 1J18A 1WAWA 2EO7A 3TV8A 1OM0A 3T2OA 1CWYA 2D3NA 3QHMA 1BLIA 2WHKA 3T0BA 5D8WA 3W26A 3BAYA 1VFFA 1Q6GA 5E0FA 2V38A 5A8MA 3WNPA 1FFRA 1UKSA 1XH2A 4BQ4A 4V28A 4AEFA 3TONA 2JIWA 1UD5A 4PTVA 4AYGA 2EPOA 1GHRA 1BVNP 3MV01 4DO4A 3RM4A 4OZOA 5CXPA 2VCCA 5CPSA 3AI0A 3A24A 2GUYA 2YA1A 5ABEA 3WMSA 1FOBA 3BAKA 3AIUA 4HMDA 3D4ZA 5EFDA 1UD6A 4Z2LA 3KZSA 3GXDA 2EEXA 4LYPA 2VMFA 2V3FA 3WEOA 2VR4A 1CECA 3VDAA 3VD4A 2E4TA 1JZ6A 1BYDA 5ABFA 1HN1A 4AEEA 3ZJ7A 4TX8A 1JDAA 2GK1B 2J7DA 2F7OA 3IJ9A 2WMFA 3MV11 3AIVA 4CCEA 4F9DA 3EBVA 2QLYA 3WQWA 2X2JA 1G9HA 4J27A 1Q6FA 3CC1A 2VNCA 3AIEA 5FKYA 3I3DA 3FHQA 3GNOA 2F1BA 3HG4A 3VILA 3WD1A 3KL0A 4UNIA 5DF0A 3PZNA 1W9VA 1UWSA 1M7XA 2W62A 1XH1A 4AZBA 1UH3A 1VIWA 3KL3A 1E9LA 2XN2A 1XH0A 1CGTA 1G5AA 1BYAA 2X0YA 2E9LA 5A6SA 2GJXA 3SEPA 1GNXA 1T0OA 3WENA 2J7CA 1QHOA 4JL2A 1EDGA 3WNNA 1J01A 1MYRA 4W88A 4BQ2A 3A4WA 3DX2A 4ATDA 4H04A 4UQAA 1D2KA 2XIBA 3WDJA 2W66A 2WVVA 1KTCA 4KWUA 2QMKA 3IGUA 8A3HA 1GOWA 3POCA 4UTFA 3RJXA 1TG7A 1XSJA 4FLSA 3WDHA 1MW0A 5F7UA 1US2A 3IJ7A 2YFOA 5A6MA 1JF5A 1Z32X 4XUYA 3LX9A 4BCEA 3CHFA 4EKJA 4URIA 1GW1A 1LL7A 3TTSA 4NRRA 1CTNA 3DC0A 4AW7A 5JBDA 2DH3A 4UOZA 1WZMA 1BYCA 4ZXOA 3NUKA 3VDHA 1J10A 2VO5A 2J79A 3VNYA 3ZJ8A 1ISXA 7CGTA 1VEPA 3VIJA 4E2OA 2ZICA 4PMNA 2FHFA 1IZJA 2YLAA 2VX5A 4E8CA 2EPMX 3VGEA 3TTYA 2VRKA 3GXFA 4LPCA 2WZHA 1B3VA 2E9BA 5AYBA 1C93A 4JCMA 2YL6A 1EH9A 3SCRA 2ZWZA 2X1IA 2VRQA 1UHVA 4MNJA 3L2MA 4AZ5A 4MDPA 3VPLA 1GJWA 3BAIA 3WNOA 1GVYA 3VNZA 3NYDA 3BC9A 1E6SM 5DT7A 1W91A 1VBUA 1H0IA 2WMJA 2ZUTA 1LG2A 3CUGA 4C7FA 3FAXA 1UYQA 3S6TA 3SUTA 3ZT7A 2GFTA 3CGTA 1WP6A 3AXXA 4HA4A 1OIMA 3NSNA 2ZX7A 5A2AA 2OSYA 1OD0A 2W91A 4DUXA 3VGGA 5LA2A 5CG0A 1L0PA 3PZVA 4DM1A 1E5JA 1O7AA 5C70A 4E8DA 4QDMA 3OIHA 3ZIZA 3N17A 1QWUA 1E6XM 3AHYA 3WKZA 1QNQA 3DYOA 4PMDA 2ZX5A 1UR1A 2GDUA 4KH2A 4GI9A 2B31A 5A8OA 1TE1A 1W32A 3WUBA 2VVNA 1GQIA 3GNPA 4H41A 4F8XA 1BVZA 3TOPA 3M6DA 3K8KA 1GCYA 1B90A 1JAKA 4NF7A 2G3JA 4CN6A 1GVIA 1E4MM 1Q6CA 3AQUA 3LPFA 2ZUVA 4GKLA 2GK1A 4ACZB 1KXHA 2WSKA 1VAHA 4W86A 3II1A 1EA9C 1OWQA 2F8QA 1XCXA 4NZJA 4CD6A 1BPLB 3LXCA 3AZTA 3N9KA 3GH7A 1C90A 3BXWA 2YDSA 5GPRA 3OG2A 3W24A 1J0ZA 3SUUA 4EK7A 3WSUA 3F5KA 1NOWA 3WFZA 1EQPA 4Y7EA 3BSHA 2VZSA 6CGTA 2GVYA 4YN5A 4AD4A 3U5UA 1E15A 1S46A 1Q6EA 3WF4A 1XC6A 1V3MA 3WDRA 4ML4A 4MDOA 3FHAA 4PTMA 2BVTA 2DSKA 2ZUNA 1XCWA 1XD0A 1E56A 3AMKA 3BUDA 3TP4A 3OLIA 4L4OA 4W5ZA 4P8WA 3AYRA 1ODUA 2VL4A 2FGZA 3PBGA 4W84A 1JI1A 1FHLA 4AWEA 4V2XA 2HISA 2WMIB 4GO8A 1TQVA 2NT0A 4OOZA 1B2YA 2WKGA 5DMYA 2G3MA 1WO2A 3ZT5A 3GZAA 4DWSC 2XFRA 3EJQA 4UFHA 1O6IA 4FNQA 4AC1X 1US3A 1IT0A 4WKAA 2YA0A 1CXEA 2Z1KA 3F4VA 1NOUA 1SR0A 5GNXA 4MNLA 4UR9A 1QI0A 2D2OA 5I3DA 4JFWA 1EQCA 1C8YA 5DEZA 4P7OA 5EBAA 3VO0A 3VOCA 4WJXA 2QF8A 4GO9A 1KBKA 4P8VA 1TMQA 1ZS2A 3BCFA 1WDPA 4W7WA 4XZWA 2C8NA 3SURA 1G94A 1UD8A 3BVWA 3VD9A 3TA9A 1H3GA 1VEOA 2DPEA 1VRXA 1VEMA 1JDDA 3K46A 1W9DM 1ODZA 1E72M 3G6LA 1CEOA 1W3JA 4FLQA 5DO8A 3ZSTA 2V5CA 4UCFA 4H8HA 2BNJA 4J3UA 2XGIA 1SMDA 1JFXA 3BVTA 1HT6A 1JF6A 1UD3A 4MB4A 4D1JA 1KGXA 4JL1A 1Q4NX 1QVBA 1QHPA 2YFNA 2F7QA 4PUDA 2OWWA 1UH2A 4J3SA 3RILA 1NWTA 3DYPA 2EXOA
chains in the Genus database with same CATH superfamily
1MI5D 3HF3A 5BMXA 1G6CA 2CGRH 2I69A 1EK3A 4OUUB 1MCDA 2Z2AA 2YC1A 3S5LA 3LCXA 4HHPA 4LVBA 5I1HL 5E8NB 1IBDA 2YEQA 2GJ6D 3WTSA 4BRJA 1VD6A 2IGTA 3IMRA 1Z7AA 2P0OA 5T9CE 4ACYA 3V6ZB 4ZFGH 3WQ5A 3S3BB 1PKLA 4MDJB 5D9OA 3HE6B 1AG6A 4WSHA 5DA0B 5H8UA 4IDJL 3EJJX 1EDTA 3CH9A 4C6JA 1INEL 3QVQA 1ZPLA 2CBIA 1DFXA 1GS7A 1I7TA 3MOAH 5KS9A 2NYYC 1N64H 2R1XB 3HFFA 5IHWA 2LU7A 2R8SL 5FF3A 1QLFA 3HBQA 5FUZL 3S1VA 4IIGA 1EJXC 3ZWSA 4TQEL 1S5WA 1MI5E 3CXFA 1A7PH 3D50A 1OVDA 1TX0A 3LHAA 5T3XE 3C8KB 3BVUA 3EO9H 4YDIH 1FIEA 4AV5A 5J6HB 4XNXH 1CT5A 4PLJC 2DYPA 4X6CE 3H9HA 4KBXA 4MB5A 2UZIH 5T3XL 1OALA 4HH9B 1CURA 4OUEA 3NZ8B 1E4XL 4LL4A 4U10A 4WGHA 4Y96A 4EUPG 12E8H 2BCKB 4EUPA 2CDGA 4NQXB 1HCYA 1UUSA 3MRJB 2J75A 1RIVL 2MH4A 1XLBA 5BVPH 4PS3A 3B2VL 3D6GA 4XZBA 4JJ5B 3GMRA 2XVBA 2Z6FA 4YZWA 1JCLA 4D8ZA 3ZHNA 2DJLA 2TPSA 4IS6A 4JYDA 1UOWA 1LLAA 4BSWA 2QPXA 2ZZ5A 1MFBH 4O2FA 3WFEL 4IMAA 1IEWA 4J4PD 1Z8AA 4KHXL 1TTGA 2QF7A 3BIAX 3S47A 4IX2A 3WLQA 1NC4A 1CI5A 4FIQA 4L6DA 2R8SH 4QRPE 1D3CA 3N43B 1R17A 4EAEA 2FBJH 3IXAB 1T96A 1AO7E 5DMJB 1A1OA 3GMQB 4OCWL 2VWEE 4UT7H 5C0AB 4F8TA 2A7PA 2JQXA 3WQPA 2ICWA 3IS1X 4Z7UB 2X1RA 1J8HE 4HUXB 1KGIA 3GQYA 5F0PB 3G3LA 3UACA 3WLBB 2ISWA 2PGFA 3MR9A 3LB0A 2BLEA 4O14A 2MTAA 2VL5B 1IL1A 1XV8A 1PYMA 3GU1A 2VITB 4UIMB 3GDRA 2J7GA 1W1A1 1SFHA 1K8DB 3WNMA 3MNWB 3I6RA 4Y19D 3U36A 1JHTB 3FNDA 5AUMA 3L3JA 3IFOA 5C0EB 2ENQA 4M8UA 1MFDH 2EDOA 1R6VA 4P2VA 3FO9A 1KV3A 4PYHA 2YLKA 5I8EB 4CN1A 2H90A 1MCPL 2VN3A 4GVHA 4KQ4L 1WAAA 1X9QA 4L05A 5FHBL 4OFYA 1FTXA 3W83A 3STCA 3NZGA 1MPAH 2DLHA 2X12A 3FQXA 3K80A 5ICUA 4H13C 5C09A 5K59F 3S83A 2Q8AH 1UYWL 2WZIA 2HTKC 1FGNL 2LLEA 2G4GA 1TR1A 3HI1A 3FA3A 3LK6A 3CASA 2CAKA 3N6JA 4F20A 3CVDA 3CL6A 4ZENA 2J21A 2WWCA 3HU7A 2YCIX 3BQVA 4NKCA 3SJ3A 2X1WL 1K1DA 1RUPL 4MJID 3H22A 1U3NA 1LQSR 1UT9A 4XB3A 3STLA 2OLAA 3BOXA 3MYOA 2D31B 4XKMA 1MWAA 2PKDA 3D34A 5IZ7A 1LLZA 2EINB 2R82A 3SBWA 3BVVA 5KINA 2ADJB 4ODSL 4ZSTA 3AAZB 1FNGB 1R87A 2IDUA 5CBAB 4PJAB 3LPGA 2HLEB 1W1YA 1V03A 4WXYA 3ZVHA 1K8XA 4FLHA 4XX1E 3EKCA 1IBBA 2WNWA 3FFCD 4IFRA 4W8AA 1DVUA 2H9GA 2JALA 3LRLA 4JGUA 3MMDA 1H41A 1R2RA 2A9DA 3OOQA 4S3GA 2EABA 1MNUL 3MRBA 3BMWA 3MV8D 4KFMA 3EYSL 4D9QE 1MH5A 1J48A 1B4TA 2XWJB 5L4JA 1ZENA 3WZ0E 1E8XA 3DLQR 4JRLA 4TVDA 3W7KA 2W1NA 4BDVA 5CJ5A 5IMMA 4BFJA 5LXXA 4O1EA 4LOCA 3LS4H 5IXEA 3G5ZB 1I8LA 1BSLA 2CO7A 2SODB 1TTFA 3RFZB 1GVOA 3GG0A 4RR4A 1OARL 2C34A 5F1IB 3QJSB 2JLLA 2CLRB 2YGVA 1FFOA 4PCYA 4RGND 5DS8B 5I17A 3A4JA 3LS5L 1HEHC 1FDLL 3V6OA 4OF7A 1B1YA 5KYUA 2PDGA 2YDRA 4OCXL 1ZDQA 3I2CL 1PKQA 3UZQB 4YLCA 3TESA 3PZQA 5IHRA 2F1EA 3HHSA 3SPJA 1JULA 2CBVA 5ABHA 5EZIL 2QZQA 3I6TA 2AERT 2AQ2A 1AI1H 2NW2B 4QAMB 5EN2A 5H2BA 3IPEA 1IV8A 3GUTA 1AKPA 2R2EB 2BJML 2MQ3A 4LLDA 4PR4A 2PMQA 1W9PA 2CXKA 4Y2DC 4QHMA 2CGZA 4HUKB 3UTTB 2VFHA 3RJQB 4IRSA 4YGAB 2A99A 3M07A 3D12B 3SDYH 3VA2C 1O6TA 3N1MC 4PJCF 2BOBA 3MLUL 3VFMA 4UTAH 1PLCA 3D2UA 4ROPA 3KLLA 3UW6A 1NCWH 3TWAA 3CN2A 4TV6A 2BY1A 1SF5A 3VXMA 2R8WA 1E2WA 4X4MA 2Q8ZA 4H00A 1T20B 4Q4EA 2XI9A 2Q10A 4RIRA 1GYLA 1MRFH 2ADFH 2QJIA 3T4YB 1FPTL 3DOIA 5HI4D 2ZSVA 3UYPB 4YHYB 4A22A 1BQHG 1CO1A 4OBTA 2A1WL 4H20H 3TNMB 4YHML 2FZNA 4LHUD 1PQZB 3WI9A 3RZCB 3O6MH 1XBZA 2ZXWB 4PLKD 3WFCL 1SBSH 3TO2A 4QSHA 2XZZA 4Q6JA 5FV1L 2K0RA 3EJYD 3ZDYF 1QR1A 2WQAA 4IHCA 4Q8TA 2PZ0A 1FYTA 2CIPA 1AOHA 5I3FA 3U0TA 1DZ0A 4JRYE 1K9FA 4Q74A 2AL1A 2CO4A 1R3IH 3CTLA 2OZ0A 3RAOA 1GKQA 1SO6A 1OB1B 1XMEB 4Z7OB 3Q37A 1PX8A 1S7SA 4JN1L 4ERSL 5DN1A 1CS6A 3G04A 2ZX9A 4AW4A 3HHMA 2B77A 5DRNB 4E9QA 1E51A 3UPWA 3QO1A 3NFPB 1I3GH 1B0WA 2CIIA 4RX4A 43C9A 1PB0A 4PUKA 4R26H 3OKLA 5I30H 2VX6A 4ZW6A 2YYTA 4QCIA 2E6AA 4POZD 4GT7A 4A7GF 4CSSA 1U8KB 4YXGA 2P5EE 1H8OA 2QKSA 2UZYA 1G6RB 3TFXA 5EV7A 1CBGA 4K4KA 5KBDA 1X96A 5DRZB 1NWOA 3L4UA 3N40P 1EXPA 5IJKC 3COOA 2PDXA 1K6QH 3DN5A 3BHBB 3BMVA 3KWXA 2UWEB 4JFQB 4F33A 2IQ9L 2G37A 2FPVA 1T5XB 5DVKA 4JTSA 1ITCA 1UJ3A 4TXVB 3WIIH 1ZBKA 3CT2A 3QHOA 1Q2RA 5DJ2A 3A6OA 3EOOA 5FL0A 3AJ7A 4P4KD 5CFAA 2OWXA 4WK9A 2XPZA 1Q8AA 1JK9A 2WCGA 3RPIB 2ZTKA 3WF3A 3D85D 3GSQB 4ZOAA 2P76A 3BEVB 2BNQE 1SXBA 2XOTA 3KXFA 4GW1A 4M1CD 3GZQA 2DWXA 1NGQH 1ECYA 4ZTPH 1DQXA 1TPC1 2GTZA 1VZIA 3T71A 2CJ3A 3GJFH 2GB2A 5FPIA 5KITA 1DVZA 2ZQ0A 2KKQA 1DQLH 2NOYA 4W4NA 2WSRA 2W27A 2Q3ZA 5JPNB 2EIJB 2J8OA 4O53A 3RX4A 5I1IH 4UBDD 1TIWA 5FIPA 1QNIA 5BZWA 3S5NA 4P04A 3WXVH 4P46C 3I3BA 4NQDA 1SVDA 3CUIA 1BFNA 4UINL 1LF1A 2PB1A 3VCRA 1E8YA 1R9FA 4OV6F 1NJ9B 5FO2A 3DVFA 1IAOB 3CX5K 4PWHA 2EDFA 3W56A 5J06A 3VI2A 4IFOA 5BOJA 4CEXC 3WFHA 4ZQNA 1E3FA 1XR9B 4P5TA 5DEGB 5AY7A 4C7DA 2J1XA 5FJIA 2VEGA 3O4OC 2ZPKL 4OCYL 2YX0A 3SYAA 4UIKH 5J11C 1JCKA 4XMVA 2Z35B 1GGUA 2TRSA 4PS8A 1PZ0A 3WLIA 3CFKB 4K9EL 5TDOB 3V4UL 5J1SC 1UC5A 4ZJ9A 1CXFA 1LTDA 4G1KA 4O1BA 2C3VB 3PWUA 4AXWB 5HA7A 3ZKMC 3BZJA 4RV3A 3CK5A 2OMTB 1TQWA 1F4WH 1KRBC 1R1CA 3MRQA 3E6EA 2WLIB 1JPSH 4Y1TA 3BO8B 4XBEL 3QUKB 1NCIA 4GUOA 2J62A 4U2ZA 4OJFH 3ZKNC 4RFEA 1IVLA 1M3UA 1WCQA 3PZIA 3KGUA 4NENB 3G6JB 2O4QA 1QPOA 1RU9H 2F7RA 4MM1A 3N73A 2JKTM 4BFAA 3V6ZA 3WHXB 3MI2A 1QNSA 1INDH 4K07A 4OCLC 2F38A 5DQDL 1X9LA 2D7NA 2XWTB 1GGTA 2CHDA 4M56A 5E8DL 2NQHA 5JHMA 3T5WA 1TQUA 4J3VA 5EIIB 1LK2B 4GEIA 4AMXA 4Z08A 1C1EL 5LA1A 2OSLA 2IQAB 1K3IA 3DXAA 4Y1SA 3VXNA 2VZ1A 1K4CB 2Z31D 2IC2A 4GAJH 4GAFB 4M7KH 1AYRA 5DMKB 5IFAH 3FFCB 4JFZL 4D8PA 3N04A 1ASPA 1ZGLP 1ISZA 4HPHA 1ZVYA 5I0DA 4JBRA 3W1XA 5F3BB 4AF0A 2I9LA 4RDQF 4R7DA 4ANUA 5DJ8A 4A6YB 2OCFD 3ZFHA 2VUNA 2XPGB 5FAGA 2YRBA 4D6EA 5JMUA 1U2YA 1DBAL 2X44D 4LALA 2WNXA 4NNAA 5HATA 5GNZA 3M64A 3IJLA 1MCWW 1OC7A 1PTAA 4HWBL 3HGSA 3GTHA 4LBRA 3MA7B 3UAEA 2KDYA 2C15A 5CEXA 2YAOA 3DTXB 3D18B 4QG9A 4HCRL 3WY3A 2DFAA 4CNOA 4ENZA 5IHZB 5A6BD 3WD0A 3WK3A 5D7EA 1H9VA 3AAMA 3W73A 3MOQA 1XYAA 4CNTA 5FJUA 3NM3A 3SGZA 3TAOA 4B7IA 4E38A 1QLEH 3QZPA 1AZRA 4U6YB 4AX7A 3CO4A 5I6OA 2VGLM 4QO1A 1P84J 1CD1A 5ABAA 2G95A 2JKPA 2VLLB 3ZLGA 2KMWA 3BESR 1ITXA 5INCA 1KPUA 1VPXA 2EVFA 5D1XD 2NX1A 4OQTA 3W1NA 5C0JA 3KYNA 2JSFA 5DFVC 3AY4C 3K2UL 4M02A 3QT2A 1CNVA 4S3DA 4B92A 2R1PA 1ZT7B 5DEFB 2ALWA 4HIQA 3WEMA 3AISA 3G22A 3MKCA 3HMCA 4CQDA 2HXAA 3NDYA 2PRLA 1WYIA 1NAL1 3INPA 4R96B 2GSGB 4LT7A 2HEJA 4PMVA 3V0SA 2QDHA 3X13B 4JZNB 1YEFH 1HKJA 3BFQG 4DXKA 5MHSD 4GZIA 1SOKA 2ICES 5ILTH 1B3JA 5KOMC 3A4DA 1Q6LA 4N9EA 3OLEA 4YHKL 5DWUL 2OK0L 5MEND 1Q13A 2F9BT 5DO2C 5T33H 2HSAA 4BFNA 5EEXA 3QTGA 1FLRL 1HDMB 2OZ4L 6FABL 3O6LH 4LK4A 2Y62A 1C08A 2R69H 2VAAB 5IF0B 2OJ1A 4NT0A 3QQ9C 3R58A 3IGFA 1OX5A 3OPUA 3W28A 1UR2A 4X5LA 2PPDA 2JEPA 2JKXA 4PR5A 3B8UA 3CLFL 2ITCA 3UZVB 3WKML 1GGBL 4NZ4A 1KEML 3SDCD 1FWEC 5I5IA 2VM8A 3QSRA 2XQYK 1Z5HA 1BM3H 4KO7A 3QDHA 1W3LA 4KRPB 1XLCA 2D22A 3B7YA 3L3IA 3RL1B 2TSAA 2W8CA 2Y9RT 4Q3MA 5C0CB 5KVGL 1H50A 3TYZA 3G08A 2JF7A 1XIWC 4YDJA 2NYYD 4JE4B 4RZCA 3MPGA 2HVKB 1BXBA 2O6PA 5I6LA 5HYSA 4PP2A 3L9YA 3QUHA 5E1HB 1MQQA 4XNQA 2EPLX 5D37A 1EA0A 3MBWA 4XCCH 3DFYA 2WN2A 5EOCL 3V4VB 2J77A 2NQJA 4BQCA 3LN3A 4H6EA 3LG3A 4L4JA 5EPMB 4TV5A 3W6LA 1X97A 5DYFA 2V2TB 1T4KB 2R1YB 1ZHKA 1XLDA 5KBLA 2CYGA 2D3LA 2GJJA 3FNKA 4HEPA 1GVRA 5HGAB 4W9DC 1TLMA 2YCLA 3C8DA 2FO4B 2WXLA 2WKOF 4MJ5A 1KYAA 4NDMA 2XACC 2Q87A 1HP4A 2AJXH 5IROD 3GG8A 4A2FA 4J23A 3SDDD 5A6KA 4FADA 1CLYL 1ONRA 3JTTA 4Y5VA 3DVGB 4OJFL 1OGBA 3S37L 4MNMA 4EXPX 1BZ9B 2QQNH 4TVSa 3RVVC 3JWOH 3CCHA 4AIEA 4BUQA 4RZ6A 4L3CB 2J6EH 3FYIB 4BFEA 4XMXA 2EDHA 1KELL 1R30A 2GCYA 3BVXA 3DSNA 1HJWA 1R3HB 2EH7H 4JO4L 3RKDD 3V0WH 3S9IA 2O6FA 1U92A 2DV0A 2XVLA 2RDWA 3IU4H 5FHBH 4L5FH 5CH9A 3BXNB 4I90A 4UM8B 1QHQA 4YNYA 4AY0A 1EPVA 2GJZA 5AHMA 4F66A 1EJRC 5EY5A 1EDYA 3UBXI 1IM3B 5MEOA 5A94A 3OMAB 2DB8A 4OJEH 5AC8A 3UG5A 3TU6A 1BBDH 4PB9L 1DQML 3WD4A 3BDBA 4WFFE 1T3FB 1A4BA 1MXDA 1UZ1A 3VWJA 4ISVA 3TJPA 2D3JA 1UKOA 5FA3B 1HTYA 5F8RC 1QTPA 3RNDA 1NCAL 2QQNL 5JBEA 2Z9TA 4JPIB 1EGZA 2NY6B 2WLLB 4L2LA 5FCUL 4QXIA 3W39A 5BNXD 3P0VH 3QWRD 4AJVA 3VOJA 4PJXB 1MXGA 3MSPA 5FYLE 1O9ZA 2B2XL 3FU6A 4BWTA 5C3TA 1IIHA 2P8LB 1SN2A 4LGSB 2BFGA 1D5MB 2C1OB 2C4XA 3FONA 4UT9L 3WO3B 4KEVA 3UCCA 4XBGB 4PJ5A 3TEUA 5T1LD 5I1CH 2P0IA 4BWLC 5DK2A 4UILH 5DR5H 5AB9A 1EP2A 3W1UA 1JTOA 1Q85A 4HGMA 3R1ZA 2R51A 3RIFF 1KPVA 1E73M 4EZKA 2A2IA 4F7CA 2H1PH 2B4CL 1X98A 3VFUA 5IJVA 1T7XA 5I07A 3ULUD 5FECB 1DJQA 1PY4A 1OY0A 5KJ7E 2V6AA 4L3EE 1OAKL 3QXUA 1R3QA 4R5VA 2G60H 4Q4RA 5I00A 3JBG7 1S7SB 1AZCA 2BINA 4NO5B 2PXYB 3H2WA 4MSWA 4XHJC 3L65A 4U1GC 2CXGA 1OC6A 5C09D 2ZJSL 2NR6C 1BFVL 2VCBA 4F4RA 3I6KA 1AG0A 3ZL1A 3MLTB 4TL5A 4FG4A 2CIIB 1UH4A 1NCBH 2NY3B 4RVBA 5HQLA 1YDOA 3AWOA 4NJJA 4HALA 4HPYL 1U41A 2N7AA 3D52A 3A64A 3IBEA 1SNRA 3BKCL 5C0BD 1HZKA 1P1ZA 5EORH 1JRHH 1KRAC 1PIIA 4R4BB 1WKFA 1EWHA 1KJ2A 3RK8A 3ZL2A 3ULVD 4P7RA 4JN1H 4ERSH 4QCFA 5F8QC 3ZE0F 1XB3A 3D5HA 3CZFB 4TQEH 1FG2A 3QCUL 1N8IA 1QO2A 2FB2A 4HDIA 5JA9A 2RFGA 4QGYA 4PJ5E 1TT6A 2EHHA 1LDCA 3ZT6A 1MJUH 3WG7B 2YLLA 4RK8A 1D5ZA 2KQMA 3B9AA 3UL4A 1MNZA 2HN7A 1SLWA 2VR6A 2W94A 3RRQA 5CG7A 2A9CA 3EX3A 2DD8L 1WC7A 2HG5B 1T0NA 3BZEB 2DVXA 4A8IA 4JPKH 2VD8A 3Q0HA 1XUUA 3H42L 1MIEL 3O45A 5KAQF 5IWLA 4NIKB 4W8LA 5HI3D 3MZTA 4WDIA 5L2KA 4JY9A 4UTMA 3O6FC 1DL7L 1CFSA 3DMMA 4YHOL 3QHZL 4ILDA 3VIFA 4DTGL 1PSKL 2HCVA 2Q6WB 1E43A 2NV9A 3NZSA 4M7SA 1J87A 4CEUC 1SYSA 4X6DA 2WB1A 2VXSH 2DMCA 3BLOA 1KV8A 3FB8B 4Y90A 2NY0B 2UUDH 5TQ0H 4UMBA 4JFEB 5DJAB 3TM6A 5JOPE 1VPOL 4Z1DA 4JXCA 5AW1B 4QRNA 4IBLT 4XX6A 3LZNA 4JFOA 3ULSB 1QSEA 1NF7A 4X22A 5TQ2H 4TNVF 3W29A 1DBBH 2VW7A 4LLMA 2G5RA 1RHCA 2EYTA 3B56A 3CVIL 2ETWA 2Y70A 2HZGA 2FH8A 1CTMA 2BSDA 1FO0L 2OP4H 4KI5F 4HZ7A 5I1AA 3HR5B 5EF3A 1MCIA 2E7CA 3FRPG 3PWUB 4H88H 4O0KA 2VDKL 4UNKA 1E6ZA 4P3CL 4WJ5B 3UP6A 5LXGL 2WQSA 2AMXA 1HGYA 3S35H 2I9TB 2OZ8A 1GC1C 2WSYA 4IIFA 1Q9KA 1YYLL 1V3IA 4XBJA 3UA4A 2HKHL 3BYTA 2EJAA 3NO3A 3DETC 3OHXB 4Z76B 2FEJA 1D8CA 3PPFA 3MV7D 4GB9A 3UCQA 4ZZ9A 2RH0A 3CV5A 1I1FA 5JXQA 4DJEA 4QHLA 1KEMH 1BQKA 5LCVL 2ZNXA 3T0TA 1RPKA 3LRMA 5CWSB 1SO3A 3H2NA 4QUOA 5B4MD 4FEMA 4UOJA 5K39A 2W9MA 4LLWB 3LERA 4WO0A 3O8AA 2ZYIA 2X6VA 1IGWA 5HXMA 1XFBA 1Y7VA 4FNLH 1GOGA 4ZFOB 1A5SA 4HN8A 5I1DA 4ZA0A 1R5VB 3KJ4C 4NHUB 4MB3A 3K4ZA 2KHAA 4LP8A 5FA4A 4IGHA 1UWFA 2V5RA 3CZLA 1W3KA 5EOCH 2JKSA 5J57B 4NZ5A 3MO7A 5J6HA 2JCCB 3JTSB 4FHKA 1YPFA 4JAWA 5T1KA 1D5BB 3PP3K 5A6JA 5I8KH 4RDYA 4YL2A 3CZSA 5KSUB 1JJUA 1RFDH 2CDEA 3NSYA 3VXUE 4P4KC 1LQBC 1M1BA 1QPNA 2CDGB 2XVGA 2E6QA 3L4YA 4XB7A 2WZTA 1S7WA 1RZJL 4LUSA 3H24A 5HVHC 4HCHA 5M17A 3THUA 5BXPA 3QJRB 4HNVA 2UXFA 1QWGA 1MJUL 1RAMA 5F7FA 3ARBB 4Q6IB 4LSDA 3PPEA 3SE3C 4OZGA 3TTOA 4KESA 1OYCA 3PDOA 4HSOA 1FWFC 1NLDH 3IJQA 3KPQB 4PJAA 1J0KA 1HSAB 3SBPA 1TVLA 2H6OA 1X7TA 1MDTA 2N01B 4ODHH 3SZ8A 5KG9B 2KX9A 2ZRYA 5E70A 1MJJB 4Z0XA 4ALDA 3EDEA 1SFJA 3N1PC 1XLLA 2DSWA 3EWXA 4RGNB 4JO3L 4Y19B 1XG4A 4R4ND 2E6YA 5EB8A 2CZNA 2ZKXA 4NQVB 3QDMB 2NUTA 4AYFB 1AJZA 3M0IA 5FKPB 1AQ8A 3NSJA 5JR1L 2ZRUA 1DJWA 3I9PA 4WDUA 3WBXA 4CQCA 4R8WL 3R4DA 3WDPP 3T0EC 2FO1A 4G7QB 4IKKA 3BDYL 4MXQC 2CCVA 4YS4A 2IALA 4OJYA 1JIBA 4OV5B 3M0MA 3MI3A 3U0HA 2BY2A 3N14A 2HT4D 4OB5L 1KFBA 3S5ZA 3GNRA 1RUAH 4U1JA 4Z9KB 1LL4A 1K6QL 1WA2X 1W2KT 4PJCA 4WWID 2V9TA 2WXFA 2YD6A 4ZR8A 2WVVB 1NCJA 2DEXX 3DHJA 5E95B 3P73A 1QFOA 4HSAC 4F93B 4K8EA 1ZJBA 4A2EA 5I15L 3CFBB 3WH5A 1U83A 1CU4H 1T7VA 4X4XB 4M6MH 1E9QB 2F6UA 3VI4A 1FHGA 4IOIB 2DWDB 4PJDA 2NTFB 2EE3A 1AJ7H 3DOSB 5HMFA 4IISA 4ODWA 3HI1B 3BZ4B 3T6WA 2R59A 2XIIA 2XG9A 1CZ8H 3RFRA 4KK9D 2XWCA 2NLYA 1BYPA 3KVKA 4OZHE 4TQIA 4LLUB 2G41A 2RALA 4YDJB 3Q48A 2G75A 4KO5A 5EH1A 3R12A 1O6VA 2E5DA 4Q4KA 4BY3A 1E2ZA 2ZJSH 2DQDL 5GSRA 3KP0A 5ECVA 1QNVA 4GGBA 2BWDA 4RMWA 1EKOA 2ERJC 3V7AE 5FJOA 4FQJL 1D8WA 4Y9GA 4NCC1 5DFWH 1LOSA 3BARA 3ETBF 1GXEA 1E30A 1DHKA 4G5DA 3LTVA 4HJJL 2R1YA 2ZX8A 3GEWB 1F00I 4FYTA 1WB0A 2DBLH 2WYIA 3BH8A 4XCNB 5F89A 8XIAA 2C91A 1F42A 1FFTB 4W7UA 2VSCA 4XO9A 5FA5A 4W9IC 3CFMA 4N86A 5EU4B 5F7WC 3W82A 2OTUB 5I1CL 1FFQA 2X4SB 5D1QD 1PV8A 4HIXH 5JHAA 4PGBA 5A3IC 2VGIA 4JNXA 2GKIA 3SDCC 1CGUA 2HFGL 4XI5D 4CADB 1GVFA 3GO2A 4G9FB 5FJTA 1TVHB 1EAPB 2NXZB 3CCHB 1HIMH 1HHIB 3IUIA 4HHAA 1S8DB 1DEDA 3RVTD 3OHMB 5CN2A 1A6VL 2BFVL 2VDMB 3EWUA 2P9RA 5LBGA 5T3ZH 2QGEA 1SZNA 3E5PA 4OECA 3WD3A 1A50A 3U8GA 3AIUA 1IAIH 1PKMA 1J5IA 1H62A 1C16B 2BVUA 2QSTA 4MD5A 2OZ4A 3S5LB 5HHNA 4AM0B 2VRJA 4J12A 3ZE0B 1BXXA 4LLDB 4NUWA 1BD2B 3WLJA 4DUOA 3P80A 1VS1A 2HRPH 1FZMA 4KKBC 5EOQL 4MDJA 5GRUH 4UB0H 1T40A 2CLIA 1T6VN 4O58L 4J3XA 3RZCD 3H8NA 4J3WA 3G3DA 1Z5YD 1A25A 4PGDA 2RTTA 1N4XH 1AD4A 2HTMA 3RLVA 4R0LA 1MCHA 2K78A 4GRMB 5JO5B 5IEHB 2QW5A 2TODA 3DFOA 2OLHA 1S5HB 3AB0B 3EWCA 1HXMA 3CHXA 2IH9A 1N2VA 1XLIA 1ZSHA 1KN2L 3D4CA 1DQLL 3BICA 1GOOA 3BVJA 2EC8A 5F7HA 1GYNA 1N82A 5GS0L 1V27A 1WOAA 5IHUL 3N4FA 1IGCL 3CZGA 4EDXB 2AQSA 1ZHLA 2AGJL 4G5ZH 1ZXKA 2VERA 3SZKC 3WD5H 2CFFA 2I16A 3DRTB 5CJXA 3O6LL 2FIQA 2A83B 3GMNA 1ZLVK 3HNVH 4F3FA 1RHHB 3N2TA 2YIHA 4JHOA 5F7KC 1JGVL 4PB0H 4XKYB 3UG3A 5E00A 1R33A 4GJIA 1EDQA 3KVDD 4JM0A 1M65A 2FWUA 4KDTC 1OGGA 1OX4B 4J28A 3BDYH 1TPFA 5HULA 4P0DA 2QQLL 2ADFL 5IBUG 5I8OH 1H11A 2XGBA 2YL9A 3UJSA 3TBBA 5K9DA 1EFXD 3GI9H 2OMYA 4LEBA 2Y72A 1Q7ZA 2V8ZA 3KBWA 1U91A 4N0RA 1OYBA 3CHEA 3VWKA 3QXWA 1BXUA 2EDWA 4HZLB 1LQ2A 1NFDB 4Z7NE 3QOKA 2NLJB 5TE6H 3IETA 4R4BA 1BECA 1ZU8A 3VZXA 4XZ9A 1RMFH 2YD9A 3QG6B 3ET9F 3M0JA 1I9JH 4HBQA 1ZHAA 2W65A 5FESA 4I5BA 3ROLB 1CDCA 4M6AA 1PHWA 1I8LC 3LDBB 4PRBB 1WZLA 4JCWA 2IAMA 3SDDC 4I3SH 5BV7H 3SUVA 1BREA 1JGDB 1QCWA 1LYQA 4PCPA 5E5CA 4N6EA 1Y6KR 2PDFA 2XPKA 4HJWA 4CQBA 4JDTL 4FKEA 1SZGA 3MV9E 1DFBH 3BG9A 1JK9B 1JRHL 1WIUA 3DSFL 3RPIA 3F7YB 4POYA 5EIIA 3WLOA 5FF0A 2CH8A 1U6AL 3TO4D 3ZZQA 3TDFA 1GY1A 4YNGA 2G3NA 4D9RE 1OG0A 1G1YA 4PJBB 1UUQA 4TMPA 3W74A 4B7LA 4MZIA 5L6YL 3U7VA 2R1XA 3CDFA 3V1PA 3S37X 3TIDA 1IZKA 3Q05A 3WFBL 2I5QA 5CM1A 5H1WA 3HPXA 3QHNA 1SVZA 2XPGA 3BLBA 1XCTA 5M95B 1MEHA 1VGKA 3E80A 4LOFA 3L7EA 2E25A 4FX6M 1BBJB 2DQTH 4NN7C 4JPKL 5BJTA 5CC5A 4A35A 1IB5A 3ZM8A 3QMTA 1A5NC 4ZO8A 1J8RA 4XPFL 1IAOA 3LCYA 4KJPD 1P2CB 3PV7A 4WW2A 1RULL 4ADGA 3W7IA 3VFSB 1XP3A 3KL5A 1CT8A 2NWSA 5I2IA 1LBMA 4KT2A 4Z3FA 1KB5L 3V4PL 3U4BL 2JE8A 5GHWH 4FQQB 1AMYA 5AYUL 5FEBA 4LJ3A 4MKVA 4JK0D 5E7BA 4JQIL 1QEWA 4XN2A 5PCYA 4APQC 3LSBA 4HJ1A 1KGJA 2Q8XA 1OGAD 4M1DL 4IGBC 5DK0A 2BB0A 3KWWB 4GY4A 1HQTA 1XDLA 3IGHX 1LEIA 2VIRB 3RCNA 1N8OE 1N6QH 1HSBA 2ICEA 2J73A 4OLXL 4WSGA 4JKPH 4FPSA 2BK8A 1NOFA 2WLHA 4IQEA 3W86A 4FB7A 5HQMA 4EOWL 4ALAH 2J4GA 3SQMA 2NX5E 4WK0B 5KSWA 3X14B 3MLPA 5I6XC 5LNRA 3BIBX 2RAMA 3D87B 2OR9H 4IMFA 4YYFA 3MRCB 1O5XA 4EN3A 2XXCB 3SM0A 1TQTA 2V4LA 3U83A 1H15A 3EPNA 1PXGA 5J3HD 4ODBD 4H5SA 1MUJA 3AQYA 2GOKA 4ZQRA 2G3IA 1CDHA 4ZTEA 1C9SA 2OU4A 3H7UA 5HGDB 3AQXA 1ZGLB 5IHLB 2XKNA 1I60A 3QJQB 3VXNB 3I9GH 1MDLA 1V0NA 4J7RA 5DXXA 4G8GE 5AG9A 1WAUA 4GZEA 2ZYRA 4NGHL 3FFCA 2XQYG 3IDNA 5JXAH 4LCWE 4M5PA 5AC5A 1K5NB 4R7DB 4UT9H 5F9WB 3IV8A 4WU7A 3PC0A 5LIUX 4HBCL 1I7RB 1LNUB 4HUWB 4KJWC 2QUMA 1F56A 1YEEH 4F8PA 1OEPA 3CZ8A 4HPXA 4QS5A 1T6WA 1RUPH 3TJEH 4MAYD 1GOHA 2BP5M 4MWFB 1TZOA 4NXKA 3E1ZA 4KEZA 2A38A 3W2LA 3EXJA 2RCSL 4WEBH 2XWEA 5E1QA 4HU2A 4HT1L 5D2XA 2ZAIA 3FDWA 4JN2A 2YD7A 1ZHNB 5FKAB 2BIQA 1XISA 1A7RL 3VXMB 5A6IA 1TPB1 5FL1A 3VGDA 1KA9F 4F3HA 3FTXA 4TN9A 4U2YA 4CUCA 1DSFH 4FFWD 3NSFA 1MWOA 2DH2A 4POUB 3MKGA 3OBAA 4XP9H 2GFBB 3SPGA 4BGLA 4XVSH 4JTJA 3T4CA 3FCSB 4WV1C 4WU5B 1NFBA 2VLKD 1AD9A 1SJHB 4BV1A 1Q3NA 2BDQA 4XK2A 3KS6A 4N0UB 5INDA 3UTPD 3IGSA 4AH2A 4EI5C 3S8FB 5LKNA 4MAUH 3EX4A 3NIFB 5KW9L 1RZGA 1S5TA 3UESA 2ZX6A 1YEHL 5DFVD 1H51A 3OAUL 1W1TA 3C5JB 4G9PA 1S7UA 1NCBL 3N0PB 4L8DA 4NQEB 5BOFA 4XMWA 2P5NA 5DRNA 2CA3A 2WSPA 2DUZA 2DDXA 3M5ZA 2PI6A 3M7SA 3M17A 1WBXA 4U6VL 4IPLA 4O8AA 3O63A 3WLRA 1ID5I 2D7PA 3M46A 2XIDA 5FV2A 1KB9J 5EOTB 1S9WB 4KO6A 3VIKA 3DSNB 1XIWA 2Z4QA 2G5BB 2OFJA 4YXKL 2WNQA 3OHIA 2HPTA 1QEXA 2H1PL 4MJ6B 3UZQA 3FBQA 3X3GH 4LYRA 1U21A 5E6ID 3CL7A 1PSKH 5KJ4A 3ZE1B 5HDBB 3GR4A 2PPCA 1GWJA 5C9XA 3BUYA 1I8UA 4NM8H 4L65A 2HXTA 5AVNA 5DHVB 4CVZA 3EG9B 3KPSB 1HO4A 2FKPA 4QIRA 3IARA 5GS0D 5FF2A 1JZ2A 4GSUA 4I4WB 1ZJAA 1CQYA 5F4WA 4FA8A 3VIHA 2XU2A 4JTCA 1OOWA 4N2EA 2ISDA 2BOBB 3GZ3A 2E67A 3V16A 4ZX5A 5BXRA 4U4BA 1QFWL 3IEAA 2HJFB 1G5GA 3ISYA 5EWIH 4K0OA 1QTYT 3A22A 1KDIA 3JWNC 1H3XA 4Y5VC 3ATDA 3U6XA 1G9ML 2C0AA 2PZNA 3QNYA 1ZK9A 4WJG3 1T0MA 3CLFH 3MBWB 4GXVL 4JW3A 1HJXA 5LWYH 4LVFA 4WHCA 1YEKL 2ZTJA 1BZ7A 3BWAB 3QUZC 4KAQL 3QQXA 4EI5B 2R7EB 5IVZB 2V2TA 3OZ9L 4HWZB 4WIQA 2VSMB 2X05A 3BKCH 4WR3A 5C9JB 1OCCB 2ADAA 1HZHH 3ZKXC 2WYSA 2HT3C 3OBEA 5DZLA 1CFNB 1G7HA 1CXKA 5E51A 4QSFA 2B4CC 2NY5L 2LFEA 3GZKA 1YYAA 1CB7B 3AMGA 3TO4B 4WKXA 1OFQA 1KC7A 1CTOA 3T07A 2ARJA 3TZFA 4L37B 1KBGL 5IDZA 2JKJA 4XVDA 1XF1A 5E6IA 3GU9A 4Q8PA 1E9PB 5ID0A 5HYJD 2XGZA 4Q8QA 4ATLA 1GHSA 1OQXA 2F08A 2X89D 2W3ZA 3N34A 4PTNA 5AZ1A 2XNAB 3G1DA 3WMBA 1IEIA 1ZEAH 2ATPA 5CIPH 3T4AB 1EVUA 5DDHB 1XGDA 2X0HA 5HUPA 1KXVA 1OGTA 4QKTA 1BJ8A 1UT1A 2BZ7A 4JFED 3HM7A 4DBDA 5C0FA 3OO2A 2ANUA 3RNKA 1EZ2A 3HAEH 4FOKA 2NY3D 3I65A 2FSEB 4EO5A 4GIYA 2VT0A 4HIBA 5E1AB 1A3LH 3MUY1 1U8IA 3AG1B 4OFIA 4Z7WB 1WKEA 3NDOA 5AECA 1CGSL 4PV9B 4XXWC 3IK2A 3ESVF 4JTDA 2ENSA 3K6DA 1M2VA 2CO6A 4XRCA 3VXSB 2G0WA 4F57L 1R7OA 3TWBA 1UXSA 4R0LB 2NZ9D 2XTJE 4XVOA 2X3CA 3NJGA 5A2LH 1A7PL 1AQHA 4D8PB 2FTAA 2WINA 2ZZ7A 3F1QA 4RPQA 2KH2B 2BW4A 4AF0B 1HHKB 2A9AA 3MACL 5EZLB 3HG2A 4PJ9A 4GUPA 4PJEF 3SCOA 5LG1A 2G3FA 3NJMA 3OJDB 1PBGA 4A6GA 5KVEH 4OZIB 2WXKA 2YUWA 3NQEA 2X4TB 2EEAA 1RP9A 2BNQB 3TU9A 4F7TA 1R2SA 3NVTA 4FZEL 2P47B 2PLMA 4AMKL 5TJWK 3VOIA 4JO4H 1IT9L 4O52A 4H7VA 1YLBB 4Q0XL 3EX1A 2ITFA 2XVNA 1Y07A 1AOZA 4S3EA 4W85A 1CD8A 4TRPH 5C0BB 4JQ2A 4LCSA 3UC2A 4RE4A 3GTFA 3JT0A 2LLGA 5JIQA 5C0RH 5GGTL 5FF4A 3UADA 1UASA 1RK1B 3SGGA 4MUPA 4ALAC 1GK8A 3CWNA 3VXRE 3S2NA 5TK4A 3VAVA 1OEZW 1QRNA 1DVQA 4A7TA 1F6PA 3UGUA 3POHA 3OJVC 4N0UE 4HZLA 4Z7VF 1S7XB 5BCAA 3NQVA 3KTXA 4PJGB 3QQ0A 4CCDA 3TT3L 2EDNA 4M62H 1LP9E 4WRLA 3C3NA 3L4WA 1MCKA 1T1WA 3EO0B 4KGLA 4CMMA 1D7CA 2WIMA 4OKVB 3X13A 3H2CA 4KFPA 2X7LB 4PJEE 5DHEA 2P8CA 2EBNA 2VOMA 1OPGH 2VZOA 3QCVL 5FDWB 3ZOAA 4WFGD 1P6CA 1ADQL 2NSOA 3N42B 1IM9D 2VR9A 2W0FB 4ELKB 3MNMA 5IB4B 3UC0L 3KGRA 1CXIA 3PN8A 3TN4A 2GY7B 4E42A 4N6FA 1E9YB 1ZXQA 2WWNA 1BMGA 3TCSA 4D2NA 1C5BH 3GSUB 4HQVA 3ECUA 3QW3A 4HCRH 2Y2WA 3GJFA 4JFEE 4OF5A 4TSAH 5FFLA 4ELMB 4PZVA 3WHE1 4PR5B 4MJ2A 2J8UA 1V6UA 4IZGA 3S1GA 3SQOH 3VFOA 3KDOA 2HT3D 4N2YA 4BWLA 2EE2A 4NYLB 2GSEA 2ON3A 4XO7A 5GZNA 4Q9RL 3KBHE 3MV7E 4YU1A 1MCWM 3IJDA 2COVD 5DFAA 3DGBA 1AIFA 2EH8H 1SHXA 2WBJA 2P49B 4HAKA 1F74A 3WTUA 5DQPA 3TYUA 3F2DA 3IAQA 3AIRA 3WN5C 1XRSA 2D69A 3VTTA 2INFA 1GEQA 3W7DA 2I7OA 4E36A 3QZWB 4UYQA 4L5ZA 4Z3IA 3NCJH 3ZZ1A 2FIRT 2A1WH 4YHMH 2BNUB 4L8SA 4LSUL 4NWTH 2E40A 3AICA 4AQ8A 3OAWA 35C8H 4QRBA 3FK4A 3MU7A 3D0LB 5C0AE 1XRVA 2PDIA 4QE1A 4QDGA 2VABA 1ISVA 3NVQA 2DW6A 4R8WH 1XYBA 3HR5A 1HNYA 1YEJL 3PGDB 3NL3A 2FR4B 2WZMA 1LEIB 3T65A 3VNMA 2QNEA 3P8IA 1V77A 1N10A 3B5GA 1T5AA 4JDEA 3W0KA 1HK6A 2G96A 3PWPE 2P43B 3KJ6L 4DN1A 2AGKA 3ZDXE 3IMSA 6PAZA 1B3OA 2ZA3A 1UACL 1S5VA 2O0TA 2NX3A 5BWAA 4XNXL 1YTKA 1QPPA 1LD9A 2QPSA 3CJJA 3OXRA 4ZMOA 1BEUA 5FF7A 2VXUL 4KY2A 1F3JA 3S3SA 2MHAB 3HUJE 1F6YA 3CHCA 3QDJA 5CPNA 1FZOB 1XC4A 4ZSUA 1NLBH 2CR6A 3LH9A 1T7WA 4FERA 5E08L 3D05A 2D23A 3PP7A 4L4VE 4ORZC 4PMQA 2YEZB 2H0PA 4RWYH 4JPWL 2EKGA 1NSNH 4FXFA 5IQ9B 1UB6B 3I4KA 5DYOB 5AQ0A 3THCA 8TIMA 3WFAA 4PY7B 5CEYA 5KYWB 1R5VA 1MQRA 1R3HA 4PW3A 1NAMB 3RIKA 4OFVA 4AWJC 3JZUA 2FWSA 3RTQC 3MDWA 4Q4SA 2C9RA 4TLTA 5D5ME 4ZSOB 1E5ZA 2V9RA 4CAGA 2NZIA 1LEKB 4ODTH 3ALXA 1FRBA 1H5YA 2VFEA 2OMVA 1LDPL 4AVIA 2NNCA 1AQFA 2AXGA 2R4SL 3QQ1A 4WV1B 3IANA 3RWFA 1D5BA 5AYTA 2NTFA 2LOEA 3BKYL 5GGVL 5BQ7A 2NQDA 2UZ9A 3LMYA 4N02A 4HKPA 2PTUA 4JO1H 4JHVA 1K6AA 2P8BA 1NQ6A 3FVDA 3QNXB 5D2NA 3RGTA 4NHVA 1NKOA 4UQEA 1M2OA 4KOBA 1T1ZB 1U8PA 3K2UH 4YL9A 2J5WA 3E9TA 1ZGDA 4O28A 2NSMA 5ALCL 3VFRB 3W71A 4RNRA 4CD8A 4LCCA 4B2DA 2BSED 4OU1A 1HZLA 1V6TA 4PL1A 1GQKA 4AHPA 5FHAH 4W9JC 5HWNA 4X4YB 4XBPB 15C8H 4TS6A 4HH8A 3STFA 4K9EC 2G9KA 3ME0B 1PVNA 3MYZA 3KPNA 4FFTA 1Q94A 4PG2C 1B30A 3U7WH 4B9FA 3KM8A 4X5XA 3H85A 3EFDH 5DZ9A 3G1XA 1S38A 1A1MB 4HUVB 1SM9A 2E9GA 4GMSL 4KY1L 5D6CB 1FH8A 3CQ0A 3CPRA 2KYIA 1SEQL 3HMWH 4AY7A 3G1RA 4CBPA 4DWSD 3B9KC 1C92A 1HJVA 3W81A 2UY4A 2ZC1A 4NZ1A 1FQ0A 4B5WA 1V7NH 1R3VA 4J6RH 5IP4A 1KO0A 4MWAD 3PL6A 1FC1A 4NM4H 43CAB 2FLMA 2ZCHH 3DUUA 1UTDA 2A5HA 3OYXA 3GKZA 3I75A 2C3HA 4V15A 1R3KB 3T6CA 1T03H 2YCJA 4UCGA 3DBSA 1U2CA 4LKCB 2Y23A 1QSFB 3SE4C 2BVEA 4CNIB 2YN3A 4IRZA 4RGNE 4M6NL 5AVSB 4S1SH 1JGEB 4HU0A 4C6BA 1FUYA 3EWWA 1I0BA 1A7OH 4ZFZA 4PTDA 4NKMA 1I8KA 1C3FA 2CLVA 3SADA 1KNOA 2R9HD 1U1JA 1FG2B 1XBYA 1T6BX 2FJGB 3MGOA 3H4FA 5D6DA 1UB5A 2JCCF 4C83A 1FZJA 1MAKA 5AZ2H 4U3SB 2JIEA 2WHLA 4KIRA 5CKSA 3NL6A 1WLHA 1IM3A 5K1VA 3QIBA 5MEOB 3EG9A 3KPSA 1CVRA 4XNAA 3TZVB 4QLLA 5CC7A 2VZUA 1JGUL 2HUHA 3OR7A 4JY6B 2GPZA 2VN7A 2X4RB 4F2MB 3AO0A 1NFPA 1AK5A 3TQKA 1EO5A 2VXNA 1D6VL 4GG6E 2DQCH 1CYXA 3TYGH 4AIZA 1D9KD 5C8JA 5C92A 1DEEB 3MKVA 1JXKA 1UM4L 2YBRA 2QGCA 5AW5B 3VKKA 4AG0A 4DJDA 4TSBH 5GRXG 4MB1A 4BUGA 3BURA 5CZJA 2FVNA 2V5MA 4IRSD 1TCRA 1M5WA 2I5YH 1AZVA 3QFJD 1RQHA 4XSMA 2QPDB 1H3TA 2BZCA 2R7EA 5IVZA 2ZCGA 5DI8B 1TJPA 1SBBA 1IE7C 3OQRA 1FWDC 1F3RB 5IY5B 4J9JA 1F1DA 3F7PC 3A3WA 1JYWA 4PJ8D 1Y8BA 4F7CB 3O11A 1BLNA 3B1TA 1KGUA 5AYQA 4B0MM 5B38A 4F3FB 4G80B 5IBLD 1UWQA 1OANA 2KLTA 3INUH 2NLIA 4ENLA 5C9UA 1DSYA 3SSJA 5MHBA 1U93B 2Q8BL 1W5NA 4PY8I 2XA8H 2EYTB 3Q43A 3VG9B 4PJHE 1V79A 4IBYA 2EQDA 3VACA 1AYOA 1U8QA 2W59A 5DBUA 2W9LA 3BEWB 3V9FA 3X17A 1T22A 1S8DA 4LARL 4U0RB 5CNHA 3UTSA 2GJNA 3GFXA 5EULV 5H35B 3VFNB 1B6DA 3IJEA 3VNDA 1A6UH 2WVTA 3FB6B 5BUAA 3QPYA 4AQ1C 1KGCD 4HWEL 4F2TA 1FE8H 4HHWA 3PXHA 4NX0A 1EGVA 1AFVL 3B8YA 4JQXA 3K6SB 5BRZD 3LCWA 2ZXGA 3NSDA 3GLCA 3VKAA 4RETB 3V7PA 3RZWA 3ZRCC 4HV8A 4HC1H 2ZADA 4G71B 1E0UA 1FRGH 1BG1A 3P81A 3SCVA 3W7NA 5JVLA 3MX0B 2VUKA 2Z7WA 4CKQA 4EWJA 3W88A 2UV3A 2B2XH 1KJ3L 5SV3A 2IXVA 3B7SA 1E6OH 3NP3A 3VVGA 1KRCC 4G7SB 2WB5A 2CDFB 2ESVB 3U6RA 3F85A 1P0NA 1F86A 1G7MA 3GO1L 3UP8A 3ZZLA 5G1MA 4PMOA 1OF6A 3UZEA 3MP5A 4PWJA 1P6BA 4QY8B 3EJZD 4GUCA 4WI4A 2CWRA 3QGVA 1IGML 1S2UA 3MLVH 4PD4J 5HJ3A 4YXLH 4BINA 4DJED 1MI3A 2AQWA 2DKMA 4DETA 5TE7L 4PRIA 1CD0A 4BE6A 4F37K 5HPOA 4HTBA 4IG2A 4XBKA 2F54D 2YD5A 3HB3C 1EXHA 2ATKA 1EEZA 2R0LL 5CHNB 3V35A 1JNNH 3JV5A 1IUZA 1NAMH 2NCMA 4OT1L 4AIOA 3Q58A 1S7TB 4JFEA 1RZJC 5DJAA 3WFCH 1M7OA 4DIXA 2DI9A 3VXOA 3WLSA 1KRMA 2FIKB 3OL2A 2DPKA 4NEHB 5IBXC 3MLWH 4UQDA 2AXHA 3U25A 1ETZA 4JN7A 4KKXA 4DPCX 3L5LA 1NY1A 2ZYFA 3BIKA 1ZK5A 1AS6A 1MCFA 4YTSA 3WIFB 5IJKA 3HNTL 2XVPA 4Q7DA 1JK8A 2K8QA 4GPVA 5LDSA 3GBMH 4NU7A 2CLOA 3V55A 2REQA 3VDBA 1FFNB 2JJUA 3QWOA 4PRPD 5D7JB 2R0WL 4LPVA 4OKVA 1EJSC 2EEDA 5D2VA 5D8ZA 5AYIA 2CMRL 2J1ZA 3HNSL 3CXHJ 4FP8L 4Z7UE 2K9UA 4H9ZA 1RUMH 2VXTL 4NL1A 4GAAA 3HKZA 3QXDA 4H4IA 2FUTA 3BPLB 3MJ8B 1HILB 1CICB 1J05A 2YAFA 3SGJA 1UURA 2CBQA 4LIQE 3SKOA 5BUPA 1NIUA 4XV0A 3HE6A 1LO2L 1K2DA 4Z95H 4U6TA 3U30B 4H8PA 4MFHA 5TFSL 3SCSA 1WA1X 3NCYS 1QZNA 3HPLB 4QYOB 2W0KA 5HPMB 4A2MA 5I9QB 4Z2IA 3GAYA 3M4HA 5GJSL 4FXJA 1MQKH 5C0GA 4LGXA 2XX1A 2QR6A 4AH7A 1UCTA 5D7IB 3P73B 3O9NA 2PRHA 1UENA 1I2OA 4AISA 1ASOA 1RCYA 2OKMA 4AEIH 3VFTB 2R1LA 3T9PA 3CK0H 3TSBA 4LB3A 3TWYA 2JB6B 1EAQA 1Q72L 3SKJL 1WAWA 3ILQD 3B8WA 2QJGA 3UZJA 1B9BA 4TM9A 1BBJA 2YPKB 3SD5A 5JYLA 5IOPB 3ISIX 2Y5TA 1YNTF 4MVAA 1H5BC 1N64L 2FNBA 4RAVA 1V7YA 3MOAL 3SE8L 1X38A 4D8LA 4N9BA 4F1SA 2NZ9C 4K39A 1Q6GA 5C1MB 5E0FA 4EJ1C 4DBWA 3MRKB 3QC3A 1XB6A 3QIUA 2VABB 2Q86B 4L4VB 1P0DA 1ADQA 4FQQA 3WNPA 4UDTA 5HHXH 2RDXA 4FKHA 1I1YA 3FU3A 1VADB 4HK0B 4M5TA 1EC7A 3JW7A 4PTVA 3JZEA 1NC2B 5IGXH 3OGOE 3K6IA 4YSTA 1A21A 4QDWA 1EEUA 3V6FA 3MU3A 1SHSA 4H8WH 3EYQD 1G0XA 4QXGH 2BM3A 4P4KB 5CGBA 4OZOA 2ZAHA 3Q5OA 5CPSA 4J3OF 3UYIA 3L16A 3WLNA 2FVMA 2IH3B 3Q2NA 2X4SA 1SHMA 4FQ2L 1FOBA 3F7KA 3TBTA 3CBJB 4JQVC 5ICZB 1CLOH 2BSRA 2E5EA 1UD6A 1I85C 3N91A 3P54A 3VE0B 3QDMA 4AYFA 5F6IB 2VEFA 1M9SA 5D7KE 3UJJL 5C97A 5GGTA 3HLKA 4RMRA 2WAQA 3G1SA 2EEXA 1OCOB 1MQKL 4J4KA 3NK3A 1A4AA 1XF5A 3U0WL 2WNGA 5LQBH 5DK3A 1FZKB 5EOTA 3DKLA 3MC5A 5IROA 2GGJA 3VD4A 2E4TA 3L3GA 3WUWA 2Z4QB 1JWUA 1SLUA 4Z1YA 1TKWB 3IFOB 5B1JC 1WBYB 2GI7A 3DVNA 1HN1A 3K6NA 2E3VA 4AEEA 5IGXL 2H6RA 5ABFA 1FJ1A 4CSTA 1JDAA 1BVKB 3G5EA 4DYJA 2CLZB 4HUWA 4I0KA 2W80C 4MJMA 3GEFA 4PRAA 3L08A 2WUCL 2BVOB 1XL9A 3QIUD 1WZ1L 4GQ9L 4LV4A 2AABL 5F4SA 4CCEA 1J1XH 3DOSA 3PAUA 1EC8A 2VYOA 3IJIA 3LHZA 2X2JA 4XMTA 1Q6FA 4AHOA 3QIWB 3NQ6A 1TTCA 1G4EA 3WQFA 1G6RH 1DIEA 1M7DA 3AIEA 5FKYA 4TULH 4C90A 4YWIA 1B3IA 2XA8L 3I3DA 3VYNA 1KCRH 3QDJD 4K7FB 3QJVB 1BMWA 4CJ0A 3GNOA 3QNYB 3L1OH 3VILA 4GYJA 3FCSA 1R3TA 4JY5H 3SO3B 3BW4A 3QSTA 1VGEH 5CBAA 1BGXH 4IRZH 3PZNA 5T26A 3HC2A 2YGYA 1TTRA 1S7QA 2HFFA 3DPBB 1M7XA 4NP9A 1UWSA 2X28A 3VCLA 1VJIA 3C8HA 3DRTA 2V2HA 5FF6A 3QLLA 4AZBA 3B8DA 3UY7A 2EC9T 3BSZL 2AEWA 1ZLSL 3QM3A 3P11L 3CVBA 1ZPUA 1DQIA 1E9LA 4UTKA 1DJXA 2Z31B 1BYAA 4EN3C 4F15C 2X0YA 1EEQA 5A6SA 4U4IA 4IGBA 3TLLA 2HJLB 3BYYA 2ARJB 1GNXA 2W07A 3GIVB 3UO1L 3WENA 1MIMH 1QHOA 3IUDA 3CVHL 1P7KA 1FBIL 1JQVA 3HRZA 3SBRA 2VQ4A 4S1QH 4W88A 2XWZA 3JUYA 3IETB 4UTLA 2APVA 1K03A 4P2RB 1QFUL 3T4AA 2FATH 2Z8SA 3VXRB 2GABA 2OZTA 2PDLA 2I27N 4JFXB 3GSXB 4FGMA 1KTCA 3EOTH 5ANMA 4JY5L 1M3IA 1P9MA 5I1LB 2W66A 4F8QA 4UQ3B 3TCEA 1KC5H 2YQ2A 5IV2B 1GOWA 3OA3A 4UTFA 1HAUA 1EJUC 3AG3B 3O6FB 3NJFA 4N4PA 5G2HA 1YC8A 2KLRA 4I89A 1US2A 4XI5C 4N9GA 3VFPB 2V17H 3GS6A 5AFDA 3CDZB 3D06A 1Z32X 3RU8H 1JNLH 1MRCH 1K8IA 3UXDA 1HNFA 3D2UB 5FW7A 5ICYB 4XVEA 4BFKA 4LNRB 1LCOA 2ACSA 4I2XA 4PGDB 1F4YH 3A4EA 1GW1A 3BWWA 3TTSA 1KM5A 1MIML 5JO5A 4OTXH 4ZTOL 4NAFB 3V95A 4ZVJA 1SJEA 4XXCC 2ZZ3A 2QSCH 1EZVY 3DC0A 2IPJA 5KETA 3ARFA 5JBDA 4ZOEA 3NT0A 4WO4B 3LHVA 1VERA 3QPEA 3LAFA 1BYCA 4IGBD 1D2OA 3DJTA 3EYUH 3NUKA 2KBGA 2YSWA 5C9JA 3MRNA 5CJQH 5TDPA 1J10A 1EBGA 2PTXA 4O02L 1BLNB 1EJ8A 1NFDF 3V4VH 4EI0A 2A83A 4G8GA 3R1GH 4O4YL 4TLKA 2J79A 2XFGB 2IADA 1MAJA 1KJMA 1W54A 3EZJB 2ZQKA 4I8DA 3B97A 4JDYA 3ZLHA 3F5WA 2ZICA 3EZ4A 2C9UA 5ANME 2W38A 1V7ML 3N2MA 1GT8A 1P0SE 1ZHBB 4XXWA 3NEVA 2DZTA 5J0BA 3ZTCC 1AP2A 4FQ2H 4HS8L 1IZJA 4WNQB 4YXHH 1PHQA 3PV6A 4E8CA 1DJSA 3DKJA 4XD5A 3TCLB 4E0RB 3MRIB 1JDFA 1V8HA 5C07D 1Q0XH 3L5WB 2OFQA 5FYJH 3K4WA 2E9BA 4GY7A 1NCTA 1NDTA 4QRQB 1C93A 2DRUA 1L9QA 3MLWL 2QVHA 3BZDA 2YL6A 2OZ4H 4KEUA 1MJ8H 4MJIA 5I18L 4QQ3A 3SCRA 5HP5A 4OUUA 3URNA 3KBEA 3BVNB 5EEZA 4N85A 1UHVA 2VRQA 3MRCA 3IDXL 4ZUTB 4MWAC 5IM51 4PRBA 3S2JA 4H0GA 3PU7A 4DAIA 3UTQA 2VDRH 3A0OA 5E8NA 3GJEB 5EPDA 1MHEA 4GK8A 3WNOA 4UUJB 3VNZA 1GVYA 4LBEA 2H6PA 4GKOA 2DW7A 3GSQA 4AE0A 2BP1A 3RNQA 1DVTA 3IWUA 4KXBA 3IEBA 1Q1JH 5IMLA 1W91A 4HCFA 1VBUA 3H7VA 4PUUA 4OCRH 1GKRA 4X6BA 1G7UA