3AXHA

Crystal structure of isomaltase in complex with isomaltose
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
586
structure length
586
Chain Sequence
b'SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGAMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase IMA1
publication title Steric hindrance by 2 amino acid residues determines the substrate specificity of isomaltase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 229
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3axhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3axhA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3axhA02
5A6JA 4JL1A 2VZVA 3VGHA 1OIMA 2VUYA 4W86A 4W89A 1ZBCA 1X6NA 3NCOA 5HNNA 5A3HA 1FFRA 3AIWA 1J0ZA 1JD9A 1AMYA 3WBAA 1R7OA 3WY1A 2PBOA 3WUGA 2CKRA 1M03A 1QNRA 3W38A 3RJYA 2VX6A 1J11A 3BSGA 1VAHA 3AZSA 3DX1A 1D2KA 3A47A 1MXDA 4ZE4A 5HPCA 3EJTA 3I3BA 1WO2A 1H0GA 4AMCA 1TVNA 4DO6A 3I3DA 3GH7A 1JZ4A 2XWEA 2GUYA 1W91A 3N12A 3MV01 4EKJA 3CUHA 1JZ3A 2PWHA 3HG3A 4NZFA 4QFUA 2WM0A 3JUGA 1G1YA 1BVNP 2XN2A 2WC3A 4AZ6A 1VBUA 2VRJA 4XV0A 4HZ8A 1W3HA 3H55A 1HJSA 4AD3A 5A6LA 1DWAM 3RPMA 5ABFB 1XHGA 4U5KA 1VEPA 3K8LA 1IZJA 1XCWA 3CUFA 2UWFA 1OIFA 3TTQA 4Z2HA 3PTKA 1IV8A 1BPLB 1FFQA 2V5CA 4D6GA 3EJQA 1E72M 5LA1A 5F7UA 1QI2A 1QNQA 1BFNA 3WH5A 4ATWA 5A2AA 1E6NA 1LG2A 1GNXA 1R33A 1K9EA 3HG4A 1HKJA 3HG2A 4ZEPA 1UG6A 1D3CA 2D0FA 1GHSA 3WH9A 1K9DA 2E0PA 4P8WA 3A4WA 4D72A 3T0AA 1CGWA 2W91A 4ZXLA 3WF0A 5ABFA 1FH9A 3VIMA 3K1DA 1ECEA 2XPKA 3GBDA 1XD0A 3AS3A 3SCQA 3DYMA 4FLSA 1UR2A 4FF5A 1UWUA 1KTBA 4W7UA 3AIBA 1XD1A 2ZUVA 4UNIA 4WF7A 3DX0A 2GJPA 1V0MA 2G3JA 3AS1A 1H0IA 4TUFA 1KBBA 4L4OA 1GQJA 2OLHA 4TTGA 4CN6A 3L2MA 1TUXA 1CXIA 1C8XA 2C8NA 2DT2A 1NP2A 2XVKA 4E8CA 5FIPA 2ZX7A 1NOFA 1NH6A 2WBKA 5DFAA 2VVNA 3ARZA 1HJXA 2ZUTA 5IDIA 5DMYA 4YPJA 1J0KA 3W37A 4PMXA 1SZNA 3AIQA 1QW9A 2CESA 3A22A 1CLXA 2NT0A 1OGBA 2CCRA 5CPTA 5GQBA 1KGWA 4CD7A 5ABEA 4WKHA 1J01A 3MSGA 2W67A 2VT0A 3ZO9A 2PWGA 5A6SA 1GONA 4D71A 2IUZA 1XC6A 4FNRA 5GPRA 4GO8A 2CKSA 4E8DA 3MSDA 2J8FA 5I5RA 2GJXB 2WHJA 4OIFA 2D2OA 4X0VA 3VGBA 4B15A 1HJUA 3OG2A 3VX0A 5FCZA 4AZ5A 1HP5A 4AMWA 2VQUA 2WYSA 3EMZA 2VZUA 1DEDA 3WNMA 3SCNA 4A3HA 5HBFA 1T0OA 1ZS2A 1E70M 1CGTA 5JBFA 3LPOA 3FXYA 2AAAA 2X0HA 3U7VA 5I6SA 3OLIA 3VMPA 1TA3A 1V3HA 1W32A 1E5NA 1VBRA 4GIAA 1UKPA 2ZUSA 1K9TA 3CUIA 5I3DA 4H41A 1JYXA 3T2PA 3AS2A 4PUEA 5EB8A 2V3DA 4HOWA 5DO8A 1L8NA 3CTTA 2E40A 4AEEA 3GXNA 3A23A 3PZNA 4NXSA 1V6VA 3AYSA 2D23A 1R8LA 4S3KA 3WF1A 3AI0A 3GM8A 1GHRA 1VJSA 2CBVA 4UQBA 2D0GA 3NDZA 3PBGA 5BXRA 1NQ6A 3AMLA 2NSXA 3WDPP 3BUBA 3U5UA 1HIZA 1VB9A 3WNNA 2BY2A 3KZSA 2ZXDA 1MW1A 2DPEA 3OBAA 2XM2A 1HF6A 1TG7A 1V3LA 1C92A 1H49A 3BUPA 3L4TA 3VDBA 4JIEA 3BXWA 1HJVA 1AQHA 2X8RA 5IFPA 1W1PA 2VX4A 4BS0A 3WUEA 1GUVA 1B30A 1DTUA 4UOZA 3SCTA 6TAAA 2EPNA 5IHSA 1JI1A 5CLWA 4IM4A 3SEPA 3MU7A 1EO7A 3WUBA 4D6DA 3F5KA 1X6LA 5A69A 1PPIA 2J74A 5AY7A 4WLCA 1WP6A 3BLBA 1BTCA 1ZU8A 3PZGA 2XSBA 1MWOA 4TVDA 2E4TA 4U3CA 3QOKA 1GZJA 2ZUWA 3AHZA 3ZJ6A 3ZR5A 4UOJA 5EFFA 5JBDA 4AIUA 4BF7A 1JXJA 4NF7A 4D6JA 4OOUA 3W29A 2QMJA 1GJWA 3FAXA 5BCAA 3LRKA 3SCOA 1OSEA 2ZXBA 5FOOA 1XSIA 7CGTA 1NOWA 3IAPA 3WF3A 3OGVA 4HPGA 2WKGA 1VIWA 2ZOXA 1E6QM 1YHTA 5IXEA 2X2JA 4FNUA 4H8HA 2EO7A 2V3FA 3NIYA 1BAGA 1RH9A 3WN6A 4D6CA 4OBSA 2D73A 1C7TA 4MAVA 4CU7A 1GJUA 1WDPA 4DWSB 1W3JA 2WK2A 1TMQA 2F7OA 1X1NA 1MW3A 2E8ZA 2YBTA 1BGGA 3CZKA 1E1FA 3CUGA 4HMDA 1ZJBA 2JALA 3WELA 3ZSSA 1EQCA 4YN5A 3AQUA 5IFTA 5KZ6A 3POHA 3CV5A 1A3HA 2DT3A 2WSPA 2ESCA 4DWSC 3ZJ7A 3BVXA 3M46A 4J27A 3WNOA 1W9VA 5EMYA 2G3NA 1VEMA 2QLYA 3VMNA 1H09A 2GFTA 1B0IA 2X09A 1O7DC 3EDEA 4UFJA 1LQ0A 2VQTA 1J0HA 3BAYA 3U5YA 3L4UA 3RM9A 4MNKA 4WIWA 3VIGA 3A5VA 3HZ3A 1UD3A 2CERA 1CPUA 3BVWA 1CXHA 4NSBA 1UD6A 1MXGA 3GH5A 4HA4A 1CGYA 1EDTA 3UESA 1DWIM 3T0DA 4M56A 2WCSA 1PAMA 1JF6A 5ABGA 1UH2A 1B3ZA 4AZHA 1BYAA 4M81A 4AZGA 1CLVA 1BLIA 2W92A 4OZOA 3FNDA 3MI6A 3MMUA 1J0JA 4UZSA 1UKOA 2FHFA 1EDGA 1NARA 3UR8A 3WUFA 2AMGA 3ALFA 3EMCA 1JAEA 2VX7A 1C7SA 2EPOA 1BYBA 1LL7A 3HG5A 4XUYA 1HKKA 1UUQA 4PMQA 5HOSA 2A3BA 1E4MM 2YA0A 2XN1A 4CD5A 2WC7A 3IJ9A 1ISZA 1IT0A 1M7XA 2FGLA 3VDHA 2D0HA 4W84A 3FY1A 2O9RA 2EACA 5FKYA 2F1AA 4WSKA 3POCA 4Y7EA 2J79A 3OZPA 1GOWA 5E09A 4PCSA 4LYRA 1U33A 4J3XA 1JZ7A 2FGZA 4NXKA 1H41A 4CU8A 5JIWA 3J7HA 2EABA 5C70A 1CENA 1GPFA 4Z2GA 4CN1A 4AXNA 4W5UA 2WXDM 1HJQA 4LYPA 1B2YA 3VX1A 4CU6A 1TE1A 3S6TA 1G5AA 1XGZA 2WW5A 2RGMA 4GZEA 4D1JA 3AOFA 1JF5A 3OGRA 2DH3A 2ZXAA 4D6HA 3EDJA 3G6MA 3B8SA 1TZ7A 3GYCA 3WEMA 3CZ8A 2WCAA 3GZAA 1BYDA 3NJ3A 5M17A 1W9DM 4R27A 4QAWA 1LWHA 2WAGA 1QBBA 5E70A 1C8QA 2ZXQA 2ALWA 5A8MA 1H11A 1UYQA 3W0KA 5LYRA 1WDRA 2X05A 1QBAA 5DF0A 4BQ3A 3CZGA 3VD3A 5HDRA 1FP9A 3L4ZA 3WBEA 4EAMA 3GBEA 3THDA 1V6YA 5DEZA 1JNEA 3W81A 2Y8KA 4KRUA 3LX9A 4JZ5A 2XGBA 4PYSA 2JF7A 1DHKA 3AIUA 3ARRA 1JYVA 2WSKA 4J3WA 5A6BD 2DSWA 2XM1A 1K6AA 3MO4A 2ZX6A 3RO8A 3AXIA 3THCA 2WWDA 1RPKA 1R86A 4URIA 3WNPA 1LL4A 1SYTA 3KE0A 1F4HA 2OSXA 1PZ3A 5BWFA 5BXTA 1VFMA 1GQIA 1WZMA 1B3YA 1MQQA 2J7FA 2J77A 4D6FA 4DUWA 3WMBA 3UCQA 3BLPX 1WKYA 3TP4A 1UQZA 4CVUA 2J75A 1H2JA 4FNSA 3AMGA 5I78A 1ZJAA 5A6AA 1UWIA 4XZWA 4AC1X 4CD6A 1BQCA 1XH1A 2EJ1A 3D51A 2W4XA 2YL5A 1M53A 3KL5A 1EIBA 2PC8A 1UWTA 3UR7A 1KQYA 4W7WA 4H2CA 5AC4A 4F9DA 1V6UA 3O2LA 1GOQA 3VU2A 3GH4A 1Q6DA 3WEOA 3VO0A 4A3YA 2DT0A 4TX6A 4C7FA 3B9DA 2VI0A 4QCEA 1BG4A 3N04A 2CNCA 1HTYA 3RCNA 5AYIA 1S46A 1DWJM 3S2CA 1P6WA 3GXIA 5CQ1A 2QF8A 5ECUA 4QCFA 4M29A 2Y5EA 4D6EA 3HN3A 5IHRA 2OYLA 4WKFA 5JUVA 1LWJA 1UD5A 3FHQA 2W66A 4UFKA 2WZEA 2WMIA 4PBGA 3GXPA 1K9FA 1E40A 1E4NA 4LQ1A 2YA2A 4BA0A 2WZHA 1KR0A 1XRVA 5FL0A 1E6XM 1EHNA 1QWNA 1CBGA 1BGAA 1H4PA 3LXAA 1ZBWA 5A2BA 2A3CA 2OSYA 4J28A 3WFLA 2D24A 2WNWA 4U3AA 1KWKA 2DSZA 1J18A 1TVPA 1JAKA 1UA3A 4YHEA 4P7NA 1PZ2A 1JDAA 3VVGA 2BXYA 1KB3A 3KEHA 1UOKA 2Z1KA 4MNJA 1OD8A 4DWSD 3ALGA 1HKMA 4QLJA 1E6SM 4AD2A 4TXEA 1WDQA 1PX4A 4NZJA 3SURA 4C7DA 1J12A 1VFUA 1JZ6A 2Y2WA 3LXBA 1OCQA 2VX5A 4FNQA 1W3KA 7A3HA 1TCMA 1H1NA 3IK2A 4W8LA 1OB0A 5A94A 2OW6A 1Q6CA 3AZTA 4LYQA 2BXZA 3AIEA 1CXLA 3QHOA 1UWRA 2FDMA 3E1F1 4AIEA 2CETA 4CKQA 1LL6A 1WCGA 2EPKX 1KGXA 2F61A 1HXJA 2WWCA 2VRKA 3FHAA 3MMDA 3WQVA 2EPMX 8CGTA 4AD4A 3DHPA 3ARPA 1NWSA 1TR1A 4P7LA 2WPGA 5E6YA 4MB5A 4P7QA 4FMVA 4H04A 3N17A 3WFZA 1MW2A 4Q7NA 2NW0A 1CDGA 2DDXA 1MFUA 3B9AA 2IXUA 3VIFA 1KQZA 2XVGA 3PZQA 4PMUA 1EOMA 1JGIA 4V27A 2J47A 2DIEA 1R47A 4W87A 2GJRA 1I75A 2B31A 1OINA 1TA3B 1E0XA 1W1YA 4RL3A 3OIHA 1UKTA 3KL0A 3WDHA 2QPSA 4TTUA 1ODUA 4ZFMA 2FYVA 1QPKA 1NWRA 1UR8A 1LF1A 1J0YA 2BVDA 2WMKA 3LRLA 2XN0A 3QGVA 5A8NA 2JFEX 3BUDA 2BY0A 1UWSA 4MNLA 4ATLA 4XX6A 3SCPA 5I0DA 1V02E 3PZ9A 4PTVA 1ZL1A 1BVZA 1HL8A 2FHBA 1CXKA 3WH8A 3CC1A 1FA2A 2Z1SA 4MB3A 3BMVA 2GDVA 3T2QA 1C3FA 2HVMA 1CZ1A 1PJ9A 2E9BA 1IZKA 1CWYA 1OT1A 2DIJA 4B9ZA 4UQ9A 2PWFA 3II1A 1EH9A 3K46A 5LA2A 3BC9A 2ZE0A 2WMGA 5D9MA 4FNPA 4OKDA 3W26A 3WNKA 1MVYA 3VIHA 1WZKA 1QNOA 4V28A 4GO9A 2Y24A 3VM5A 1WPCA 2EADA 3WD1A 1E15A 3PZOA 4PMOA 3CGTA 2WLYA 3A4AA 4GI6A 1ITCA 2OWCA 1EDQA 4Z2IA 4CVWA 1XSKA 2O92A 4OJYA 2WVSA 1R7AA 1UR0A 1E5JA 3WH7A 2BVYA 4HOXA 4CD4A 1E3XA 1GOIA 5E1QA 1JG9A 3SUTA 4MJ4A 1EXPA 4UR9A 4PUDA 1JYWA 1UR4A 4J3UA 2VO5A 3AHYA 1V6XA 3W25A 4CCCA 4W88A 2CITA 1G9HA 2OWXA 3GNRA 2VZSA 1RP8A 1HNYA 2G41A 6CGTA 4AMXA 3VD5A 3PN8A 4U33A 5BROA 3HMCA 4HU0A 3AROA 4RE4A 3EJSA 2ZIDA 3VGFA 1UD8A 3AISA 1PS3A 1VEOA 2FE0A 2G3IA 1HKIA 3WQWA 2ZWYA 5E0CA 4P8VA 3CIVA 5AYBA 4CN4A 4JHOA 3CHDA 4UQEA 3RM4A 1V3KA 3DDGA 3T09A 3WD4A 1UZ4A 3N9KA 3VSVA 3RMEA 3WH6A 1E71M 4JFTA 5AC5A 3VDAA 4KGJA 4N0RA 3VGEA 5HXMA 5D8WA 2IXVA 4QP0A 1V02A 4XB3A 3W4RA 3ZSTA 3F5LA 1E56A 4ZE5A 1J10A 3GNOA 4JHZA 4AEFA 4V2XA 3TA9A 3AS0A 1H5VA 2VCAA 5I77A 4HTYA 2WMJA 3ARXA 5ABHA 3DYPA 3CZLA 3EDFA 3AIVA 2F18A 4AYGA 1V0NA 5EFDA 3B9EA 3TTSA 4F66A 1KGUA 3EYPA 4U5IA 3W27A 4UOQA 3NSMA 3SCSA 2ZWZA 1Q6FA 5E6ZA 4DUVA 2VC9A 3OLEA 2F8QA 3MUZ1 3NDYA 2W5FA 1W1TA 3ECQA 1QOXA 1KBKA 3ZJ8A 3LMYA 5E9AA 1WAWA 1Q4NX 5A6MA 1GOMA 2CIPA 2GVYA 4A4AA 1R87A 2VRQA 4LGXA 3AMCA 1RD6A 5BYWA 4U31A 3AHVA 1EA9C 2WHMA 4H8VA 1U30A 1AQMA 1UKSA 4D1IA 3VGDA 2DH2A 4LPCA 4FNTA 3AHTA 5BRQA 2J4GA 1Y7VA 2J8GA 4PSRA 2G4FA 2D20A 2F1BA 1FOBA 1MQRA 2WBGA 2RGLA 3VILA 5D9OA 3D5HA 3BGAA 1XYFA 3BSHA 4BQ2A 3EDKA 1E0WA 2XG9A 4XZBA 1FH7A 5DT5A 1HVQA 3SCWA 2X0YA 1KCLA 4AD0A 2WVVA 1Z32X 1H3GA 1BSIA 1EQPA 4UZUA 4W8BA 3VSUA 3A24A 3HU7A 1QHOA 2O9TA 1SR0A 2WVTA 2D3NA 1VENA 4JFUA 1GOOA 3O9NA 3OZOA 1V6WA 2X2IA 1EGZA 2Y8VA 1TFVA 4E2OA 3CO4A 1V3IA 4AW7A 4JFWA 1E6RA 3OLGA 2ZUNA 3AHXA 1KWGA 9CGTA 4ACZA 2J7HA 2EAEA 1D7FA 4OUEA 1GORA 1NOUA 2YLAA 4AZCA 3CHCA 1QHPA 1E55A 2X1IA 2VR5A 3BVUA 2WZIA 1G01A 1MFVA 1UH3A 1ZB5A 2VOTA 3SUUA 2W62A 1LLOA 1RP9A 5JIPA 4JKKA 2GK1B 3SUVA 4MJ2A 1R46A 4RE2A 4W8AA 4RE3A 5I23A 3PZUA 1UD4A 3SCRA 1OT2A 1JD7A 2VCCA 2VVSA 2VURA 5TD4A 1MQPA 3FAWA 1U2YA 4NZCA 4J3SA 4NRSA 1TQTA 3WD0A 3PZMA 4OGZA 5CSYA 4PSPA 2E3ZA 1V0KA 3AICA 4IPNB 3GXTA 4UFLA 4AISA 1KCKA 5FD0A 3VKKA 4PTMA 3A21A 1EOKA 2J7BA 4IISA 5I24A 1JFHA 1B90A 4PRWA 3DYOA 4JKMA 1OM0A 3LPGA 3KL3A 3VNZA 4UTFA 3VD7A 2GK1A 3N18A 2YL6A 2E8YA 2XVLA 1OD0A 5M3WA 2OYMA 2YLLA 3UG3A 3A3HA 3WIJA 1DWHM 4CGTA 3CHEA 4GQQA 2PI6A 1UHVA 1PX3A 3M6DA 3GXFA 4ATDA 3L2LA 3DX3A 1KXHA 1HT6A 7TAAA 4GXPA 1WNOA 4B16A 2F7QA 5A8OA 4JFVA 3VIOA 4UFHA 3QR3A 3G6LA 1V3JA 1XH2A 3T2OA 4Q22A 5CPSA 1GQKA 5A2CA 4GZIA 3RIKA 4GQRA 1E0VA 2G3MA 1ZBVA 4EANA 3CUJA 1BHGA 1FHLA 4QDMA 5CLTA 3VUPA 3RILA 2O9PA 3TTYA 2OWWA 3BUQA 2A3EA 3W28A 3BH4A 1JL8A 3WY4A 3CZJA 3CZNA 4FLOA 3N1AA 1XCXA 4AZBA 2BVTA 4JL2A 4QLKA 3VIPA 2XVNA 3D4ZA 4J3VA 1E9LA 2GDUA 4HA1A 2EXOA 2YIHA 3DDFA 1BF2A 4ZENA 3PHAA 3WDJA 3DX2A 3FN9A 2V38A 1CNVA 1MYRA 2XFFA 3VDCA 4R5EA 2ZX5A 1OWQA 2WMIB 2BY3A 1KTCA 1JDDA 2DSKA 2JIEA 3ARTA 3BVVA 4EE9A 1WZAA 1A47A 3CH9A 2ZX9A 4N42A 3VPLA 1OBAA 3WDIA 3BAKA 5BXSA 2CHOA 5D9NA 1QNPA 5CGTA 3U7BA 5C71A 4IPLA 2UY4A 1AVAA 1V08A 4MB1A 3VIIA 1NM9A 2DEPA 4BCEA 5I2UA 2WC4A 3WQ5A 3DX4A 3TV8A 2VZOA 1JNDA 4K68A 1NP0A 2XUCA 1KR1A 4HP5A 4PN2A 3WL0A 2CBIA 3WMSA 4WK9A 4PMNA 4MPKA 3SCVA 4CD8A 3F4VA 1QI3A 3PTMA 3ARUA 3ZM8A 4DM2A 5HPOA 4FLRA 4H8UA 4ML4A 3ZT6A 2UY3A 2EBNA 1AQ0A 4HOZA 2XFRA 3ZOAA 3WSUA 4CCEA 2Y4SA 2DT1A 2F7PA 1QI5A 2FHCA 3QHMA 2XIBA 2OSWA 3NUKA 1JFXA 3S5ZA 2DQXA 1KXTA 1FHDA 4WSJA 2X2YA 4NI3A 3MKKA 2CBUA 3ZIZA 2JEQA 2FH8A 3OLDA 1JZ5A 3UG5A 2UY2A 3BAIA 1CXEA 2BNJA 4F79A 3EJRA 2WCGA 2VTFA 3RDKA 2C7FA 2E9MA 1JZ8A 5CGMA 2J7DA 3EJPA 5JBEA 5D9PA 4Z2LA 3WF4A 3VD4A 3AMKA 1W1VA 2CHNA 3F5JA 1V3MA 4PMZA 3CMGA 5CZKA 4P8XA 4CUCA 4LXFA 1BYCA 3ARSA 5E0FA 1E73M 4GKLA 4ZXOA 2UY5A 2XSAA 4CCDA 1HN1A 1VRXA 3PZTA 3PZVA 1XYZA 4MB4A 2YDQA 3VIKA 3ARQA 1I1WA 2J7EA 1HXKA 3WQ6A 3WQ8A 1DP0A 2D3LA 3SUSA 1UH4A 1VJZA 1UASA 1E3ZA 3AZRA 3DHUA 4HA3A 2WKLA 1ITXA 5CG0A 1FP8A 1QVBA 3HJEA 4UFIA 3CZEA 4E4PA 3VSTA 1C8YA 1EO5A 3WDRA 3WKZA 4EK7A 5A8QA 3BCDA 4W85A 2PF0A 3T08A 1XV8A 3KWXA 1PIFA 4KGLA 3ZT5A 3LPFA 4UQCA 1HJWA 3NYDA 3WQ4A 1LG1A 3EBVA 5BRPA 3D50A 2D1ZA 2JF6A 1ISXA 2YDRA 3BLKA 1M01A 3EMQA 2ZUUA 3ARYA 4WKAA 3DC0A 3ZJKA 2YL9A 4DM1A 3WENA 3VGGA 2C0HA 3ZMRA 3NSXA 5LA0A 1EHAA 4GI9A 3K4DA 4AY1A 2CYGA 3TTOA 5D4YA 4GPNA 4PEEA 1JI2A 2BHYA 3TONA 3IANA 1Q6EA 1CGXA 3UERA 1ISYA 3GNPA 3BMWA 5GNXA 3MMWA 3IJ7A 1CYGA 3M7SA 2WHLA 4MTVA 3OGSA 1R75A 2QV4A 2XHYA 2XIIA 2DSVA 3OB8A 3K4AA 2EPLX 1W9UA 5A95A 3D52A 4P8UA 4AIOA 4MDPA 1W9BM 4AD1A 2GJXA 1HVXA 2JIWA 2YOCA 1DWGM 4B3LA 2YKKA 4AZ7A 4UQDA 2XYLA 4F9JA 1PBGA 2J7CA 1B9ZA 1KXVA 4KMQA 4DUXA 3S5YA 5GNZA 1GQLA 2PB1A 3A6OA 1TQWA 1ZBKA 3W6LA 3CMJA 3H54A 1VFFA 3WD3A 4DO5A 3ZR6A 5M5DA 1UR1A 2EQDA 3W24A 4DO4A 2Q8XA 2BV9A 4HPHA 4C7GA 4M24A 2ZX8A 2WVUA 1ESWA 1BG9A 1E6PA 3MV11 1PX8A 2XGIA 5A6BA 1B1YA 2DGAA 3VTRA 1HWWA 3MUIA 2XJ7A 3N15A 4FLQA 1KFWA 2QHAA 4NX0A 2D22A 3CHFA 3SCUA 1YQ2A 3W53A 3QOMA 4PMRA 3QHNA 5A8PA 4BZYA 1OGSA 5C8BB 1N82A 8A3HA 3WD2A 4LX4A 4AZIA 3GTNA 1PIGA 4UFMA 3CBWA 1E6ZA 3ZQ9A 1VF8A 3D4YA 5CPQA 4M82A 4PMYA 1HP4A 1B31A 2WHKA 1LJYA 4W5ZA 2PBGA 2F2HA 1SFSA 1WB0A 4FK9A 1QX1A 1OGGA 3W6MA 3KLLA 1HX0A 3EDDA 4HZ6A 3FW6A 4PTWA 5FL1A 3SUWA 5M03A 1CIUA 3RM8A 2V3EA 3WL1A 1G0CA 2WMHA 3WY2A 3D3AA 2MANA 1C91A 1R85A 3VIJA 1R34A 1L0PA 3BCFA 3VM7A 4Z2KA 3M07A 3CZSA 2J78A 2WMFA 1JZ2A 5DT7A 3BVTA 1QW8A 1UQYA 3MANA 2YJQA 1M04A 1C90A 2VNCA 2W63A 4OBRA 2GSJA 1O6IA 3VOCA 2WVVB 4NRRA 4AYSA 3MUAA 2YBUA 1KXQA 2YFNA 2CEQA 4JKLA 2VMFA 2QMKA 1GOKA 1VFOA 2V5DA 4TVCA 4MDOA 1B3VA 1XSJA 4W93A 5A6KA 1GW1A 4PMDA 1QNSA 2YL8A 3L4XA 3PTQA 1CEOA 2FH6A 1UZ1A 4UCFA 3NSNA 2VCBA 4GINA 1B3XA 2ZICA 6A3HA 4B3KA 2VL4A 4J3TA 3UG4A 1Q6GA 3TOPA 1XH0A 4MADA 4ACZB 4JFSA 5CXPA 3DECA 1FH8A 2CBJA 3IAQA 4DWSA 3T0BA 1UKQA 4J7RA 4AZCB 4TOQA 1JIBA 3GXDA 2JE8A 2TAAA 3LRMA 4JCMA 3UEQA 1UD2A 3RJXA 5I79A 2WANA 1CGVA 3MS8A 4JAWA 3WMCA 3GDBA 2OYKA 1C93A 3L4YA 4UQAA 1UWQA 4BQ4A 4U2ZA 2ZUMA 4P7OA 3IJ8A 1W9XA 3AFBA 3N13A 3VD9A 1F4AA 3VNYA 2WB5A 5A1AA 4HZ7A 5GNYA 1PEZA 4M80A 4U2YA 2CPUA 4H7VA 1DWFM 3BAXA 3AYRA 1TQVA 3WF2A 3ZT7A 1HL9A 1CGUA 2J62A 2VJXA 2HISA 3KLKA 1US3A 4GZJA 3MUY1 2F7RA 2PWDA 2W61A 5BXPA 4JCLA 1JXKA 1O7AA 4MNMA 2BHZA 1JYNA 1GCYA 4KH2A 2XFYA 4P7RA 5KEZA 2BS9A 3AMDA 1TQSA 4GI8A 1SMAA 2BY1A 2AOSA 2VR4A 1GVIA 2V3GA 1W2PA 4HU8A 2QPUA 1NWTA 1G94A 2YDSA 1WE5A 5EBAA 3SIMA 1NWUA 3H53A 4F8XA 3EJUA 4YHGA 3AJ7A 4Z2JA 1QI4A 3BAJA 1SMDA 2VZTA 4B9YA 3AXXA 3O6AA 1GVYA 1US2A 4WJXA 5CSUA 2A3AA 2DSUA 3OA5A 3VMOA 3L4VA 3N11A 4IUGA 3APGA 1E1EA 2J25A 4HMCA 1V0LA 4M8UA 1CECA 2NT1A 3LPPA 2BFGA 4MAZA 4AD5A 2YA1A 2WLZA 1I1XA 1J0IA 1J9YA 3AIRA 3WDQA 3WEZA 4X9YA 2G8ZA 3PZIA 4OOZA 1E4IA 1W9PA 1TQUA 3IGUA 1UA7A 2XVPA 1E43A 4HMEA 1WZLA 3K8KA 3WNLA 4L4PA 1QI0A 1ODZA 1B3WA 3ARVA 1JDCA 3CLWA 1V03A 3U57A 3CPUA 4PMVA 4PTXA 4ACYA 4D6IA 3ARWA 1ISWA 3LXCA 3BAWA 4TVUA 2J7GA 1E4LA 2XTKA 1W3LA 3WY3A 3A4XA 2IGTA 2X2HA 4QLLA 1UR9A 4M1RA 4TX8A 1WDSA 4X0NA 4AWEA 4KRTA 5D8ZA 2A3HA 3UETA 2YFOA 3AXHA 2BHUA 3VINA 3BUIA 2XWDA 3L4WA 3I3EA 3GXMA 1CXFA 4BQ5A 4KWUA 1CTNA 2OW7A 1MW0A 2E9LA 1ISVA 1QHZA 1W2VA 4S3JA 4W7VA 3W82A 2JEPA 2CXGA 4PCTA 3K8MA 2O9OA 5CJ5A 2EEXA 2PWEA 1QWUA
chains in the Genus database with same CATH superfamily
5BRZE 5A6JA 5ISZD 1PHQA 4PGBA 3FQTB 4AZ8A 3E9TA 2GSIB 3F12B 2CKRA 3UJRA 2ENYA 4WTZG 3BSGA 1BD2E 3LTYA 1N64L 5F1OB 3DBSA 5D2TA 2J9ZA 3TO2B 3HS8A 4IP7A 2I07B 5GS2H 1OSPL 2ED6A 1W3HA 2PPDA 1WTGT 4IRZA 4JG1H 5F1IB 1RZFL 2ARJB 3DTDA 4U5KA 1UPPA 1ZTXE 1OIFA 5C3IA 3WK1A 2GCYA 2NV2A 3O3UN 1PVHA 4B4FA 1AYRA 4Z7QB 3OZYA 4F4RA 3K0YA 1JZHA 2FVKA 1FZJB 4ZXLA 3WTSA 4HTBA 1N6UA 1J6OA 3SCQA 1EF2A 4FLSA 1O66A 1UR2A 1T1YA 2AL2A 4Z7UB 3C3UA 3MRKA 3FTGA 4AQ8A 5DJ6B 1H0IA 1NCDL 2KDGA 4CN6A 1CXIA 3GMOB 5F89A 1I7RA 5T1KB 1FG9C 1SFLA 4LCUB 1MWAL 4XAWH 2PR4H 3MCMA 3SPHA 1ZV5A 4L3ED 4OI8A 3TFKD 3VZXA 4PRTA 3MDWA 3DMMD 1M71B 3VXRB 1EWHA 4HPXA 2O61A 1GY1A 5ILTL 1XLEA 2CCRA 2NY3B 1YADA 2IUZA 5AG8A 2QDGA 5JOPE 2OZ3A 3U30B 3QM3A 1AS8A 3MV7D 4QRPA 3CB8A 5D7LA 4ONVA 4YHYC 3E5PA 3NOYA 1IIGA 3VXTA 3BHBB 2EDHA 2QVTA 3T3MF 1R3QA 2XN9D 2OMYB 1HEZB 4YK4C 1QR7A 4DPRA 5C6PB 2E7MA 2VSKB 3JTSA 3U1SL 1XJBA 4MDJB 5K9OB 1I8UA 1YPIA 1V3HA 3VFWA 3UZXA 4QIRA 4XAKE 4PUEA 3FSVA 1CN4A 2NUXA 5C0IB 5T3ZD 3MN8A 4B92A 2I26N 3MRDA 2VKXA 3U6XA 1AD1A 5DK2B 2NV1A 4UQBA 1LVEA 2JGYA 3FS2A 4F0RA 3T2LA 3K2UL 1AD0B 2DYPB 5TFSH 5ALCL 3JZYA 4FQLL 4DP1X 3LZNA 1E90A 1FZOB 3OZMA 1SBSH 4IFRA 4QE5A 4OCMC 3ZKMC 3ZHFA 1AQHA 3QO0B 4OLYH 1JI1A 5CLWA 4IM4A 4IBSA 4Z42C 5A69A 5CWSA 4GH3A 1OPGH 5CCHE 1S6NA 2J74A 3EFFA 2PW1B 1S7QA 3T77A 3C5ZD 3BGMA 5G1TA 3QOKA 2ZCKH 5EC2B 2E5EA 1Z8AA 5T8IA 3FSUA 1PDYA 2P76A 4OSUH 1BZQK 1MO0A 2C14A 4N2GA 2AKMA 1X3DA 3CFKA 4WCYH 3BZ4B 3QUXA 3TQPA 4PJAA 3IF1A 4P5KA 3T0ED 2EO7A 1S7XA 4FSAA 2COVD 2WK2A 3G1RA 4BWTA 2ZP9A 3CZKA 2Q7AA 4Q56A 1ZJBA 2PCFA 4GH1A 1RK7A 2VABB 5F0MB 3O6YX 3JT0A 2Q8LA 1C08A 4AEOA 3R4RA 1E6JL 2Z7UA 4J27A 3OGCB 3JZEA 5B3NA 4FXLA 3CHRA 4N2OA 3K6FA 1VEMA 1R3SA 3ZE0E 5IF0A 3L65A 2K9UA 1A1MB 4RSYA 3ZJAA 4G43B 3O05A 4MNKA 4Q8QA 2XTJC 3Q2LA 2OT0A 1WEJL 4AIBA 1KN2H 3QQXA 5B3JE 4WTXA 1TVHA 1J86A 3F3HA 3FT4A 1ZY9A 4D0CB 3AWNA 1GTHA 4Y2DC 1OGAB 1N3NA 3LU2A 1A0DA 4GRWE 1GGCH 3VVWA 5DS1A 1UADC 2FGLA 2EGZA 5FA3B 4AV4A 4R4FL 5FKYA 4WSKA 5EKYA 2D7TH 1U8JB 2Q8AH 4OCXL 1WA3A 5LAXA 1RALA 3DOPA 4BH8A 4GJIA 4LV4A 4IU3A 5C55A 1FLTX 2F74B 5I3IA 2PUQT 4B5WA 4XC3H 4S3FA 3FA4A 1O1ZA 2ONEA 4QF1A 5L0QC 2IOMA 1G5AA 2YLKA 1IMHC 5A3IC 4PJIE 3EDJA 3G6MA 3B8SA 4IS6B 4ZQKB 4PB4A 4Y6GA 1YN7A 2ICEA 4AF0B 4IBYA 3S97C 5I71C 4PD4J 2IWKA 4EDWH 1PTAA 4PJ9D 4KRNA 2HVJA 3NL2A 1NFIB 2J12B 1TZ8A 4L3AA 4ERAA 3D9AH 1XWVA 1PCKA 2XGBA 1DHKA 1F2JA 4YO0A 3UTQA 2FSEA 1MUJA 3THCA 4OIBA 5GJNA 5AB0A 1KNOB 1WKEA 2IH9A 1ZRUA 1KTLB 1VFMA 3QUZD 3TPUA 2AS5M 4LALA 4TNVF 1SGJA 5AFDA 4JDEB 2YL5A 5CSGA 4OI7A 2X6BA 3F83A 2KQMA 1AH4A 3FHEA 5BOEA 2EE0A 1PWLA 2VFEA 1GOQA 1NDZA 4HHPA 1R17A 4Y7OC 4NI8A 4AL8H 4X7CC 2VWSA 5FACA 5FGBC 2KPNA 2OJPA 3CXHJ 2PDKA 4XTRD 5DMIH 2I9TA 2QF8A 1TZGH 2HWZH 1PCWA 4N8VA 2A79A 3CXOA 3U36B 5EPDA 3AW5A 3DBPA 4KRPC 4UNVA 2PP8A 4AYFB 3MGAA 3ZKXB 3LDBB 4FXTA 1TJMA 1E40A 5E1GA 3HB3C 1GH7A 1E6XM 1THCA 1IR1A 3LXAA 3U0PB 1E7VA 3SI9A 4UCGA 2XZ7A 3QZWG 3DJSA 3PWUA 2BP1A 3TA3D 4NZ4A 2DSZA 2EIEA 3P4OB 3IGKA 3H9HA 5FAGA 3KJ4C 4NZRL 1BCIA 4YDLB 2X4QB 4TXEA 3QDGA 4GXUN 3UAAA 5BXFB 7A3HA 4MQ7A 1S2VA 2CIIB 3VTMA 4JLRB 3BRDA 2Z7YA 1SEBA 1R3IL 1PKNA 3VAEA 4GYPA 1KCUL 3NCYP 3BWAA 3ARPA 3DHPA 1NWSA 4FMVA 1IQWH 2VKZG 3BCJA 5E2TL 4B0MB 2YZ5A 2P26A 4HWBL 3EG9B 5KYNA 5EFIB 4ZPTB 5GGTL 2G50A 1KQZA 1XIWB 3HE7A 1HH9B 3V36A 5HMDA 1EOMA 1JGIA 3OGOE 4E41E 3O8XC 1R9XA 2WXOA 2G2NA 1QSFB 4PA8A 2CLZB 1ODUA 2HVOA 4HETA 4NG3A 2I85A 2G4GA 5KVFL 3ROLA 5ISZE 3GMRB 4WKZA 4K94H 4Y4HC 2Q8BL 2Z1XA 3WJZA 5LBGA 1RZ7L 1PJ9A 4QE1A 1AG6A 5BO1L 1OT1A 1XMWA 5JHDA 3CDCA 3SDDD 4UQ9A 2WM1A 1PLCA 2ZE0A 3EOAA 4HNUA 3MCYA 2AJ3A 1WPCA 3NIDE 2P5EB 1AXTH 3DXAD 1FCBA 4MS8D 4X4MA 1G9NL 2CIKA 1H6UA 2ZOKA 3WFDH 3VI4E 1YZZA 1NBZA 4DVRL 1CFVH 4B27A 1PG7X 2BVYA 3EFDL 4ZO6A 4IGSA 4N1CA 3GPSA 5GZOD 1GOIA 3SUTA 4MJ4A 4UR9A 3CIXA 5AKRA 1OB1B 4LBAA 4M5TA 4YXLL 3GNRA 1FHGA 3VFOB 3PFRA 2G41A 3EXRA 4XPBL 4XODA 4DXVA 4PS3A 2ZOOA 1Q8MA 3I4KA 1BFOB 2QSCH 3DIVA 4LF2A 4TTDC 4LSPH 4RGNC 1XGPB 1YCSA 2V2XA 1ADOA 3CHDA 2LLNA 1OTTC 5CILH 2AABH 3FH8A 3PWAA 5I0YA 2GUUA 4QEEA 5JH2A 1AZCA 4UTWC 3UYCA 3GVQA 1FY6A 5SV3A 1SFJA 4ZW3A 5AECA 2VCAA 1OFRA 3PCYA 3ILEA 4L3EE 1OT4A 3OO2A 4JZNA 3CZLA 4QRRA 4NERA 3KPLA 4Y16C 1MFEH 4RQQB 1ZHLA 2ZWZA 4ZSTA 3DGGA 1Q6FA 1QOQA 5JW5A 3IDGA 3VD0A 3G04A 1UIPA 3CT2A 3SKOB 3CFJB 3ZJ8A 4F7MB 1RUQH 2Y9RT 3MV7E 1HIML 1KKOA 1FHUA 3QISA 3CMOL 3B1TA 1RIUH 3HCVB 5HK4A 3ULVD 4X7SL 3E3HA 2XN9E 5J11C 5I1AB 5KN5B 3TC9A 3AHTA 4KUZH 1GS7A 5BRQA 2J4GA 5CEXB 3L08A 3WMPA 5LIKX 3KP1A 1RCOB 2V8ZA 3UBFA 5I18H 3BE1L 1Q9WA 4BFBD 2DI7A 4WNSA 4WWOA 1E0WA 3RCYA 1J5TA 1KMGA 5GRVK 5T3ZE 3VI3F 5E4EC 1DSWA 4PTUB 1PZAA 1JWSB 3N42F 3QYNA 2VC5A 1D9EA 1D9KA 2BP0B 4JKPL 4E38A 1D7KA 4XNUH 3IMUA 5CFHA 2K4AA 2NQ9A 3DHFA 3IFOB 1CLYH 3GMMB 2AQVA 1DXIA 2HB0A 4OUEA 2YPKB 3O6ML 3VW3L 4YL9A 1E55A 5DQJB 5IMMA 2EDQA 2WZIA 1MKFA 1PZ0A 4P9HC 1BAWA 2NR6A 2VUNA 3M1BA 3VXRD 3MNVA 4PGLA 2VUOA 43C9B 4JO4H 2RFXA 2R1YB 1M7DB 2CWRA 5I1HH 1WAAE 1BZDA 3D5OF 1KCSH 1BRLB 1DQJB 4F80A 2NY0C 4AISA 3VKKA 3PL6D 1JHKL 4ONOA 4NQXA 1T2QL 5DRWA 4DKDC 3KL3A 1TNNA 1IVLA 3VD7A 3V7MA 5KW9H 5E9DA 2RKXA 2XVLA 1A6WH 3T0EE 1F97A 4KTEL 2J56A 5FYJL 3CAKA 3FH7A 1MAKA 4GWEA 2XICA 1KNWA 1NKRA 1WD9A 3ZTNL 2AKRA 4KO5A 1EC9A 3V9EA 4DERA 4WI0B 4ZMQA 3HR6A 3QXVA 1QT1A 1PDKA 1BM3H 3N91A 3MCLH 4S1RL 3HF3A 2XVNA 4HA1A 4J12A 2O30A 1PU0A 3FTWA 1NA8A 5EUOB 3SBQA 3VDCA 3ARTA 2DSKA 4EE9A 1ES0A 5BZDA 1A47A 2HG0A 5FC9A 1KDJA 1OBAA 2VXVL 4DZBB 1QNPA 1RZMA 2WQUA 2QULA 2YS4A 2UBPC 1SUHA 3RIFK 1XRFA 4Y5VA 1V08A 3VIIA 2Z8WC 1Z6JT 2DEPA 2MEJB 4GAYB 1VQTA 4WUKL 5MI0C 3WL0A 3Q3GA 1OK6A 4J8RA 3WCZA 4EAYA 4XD5A 3N3MA 4M43L 1YE6A 1XQKA 4XVSL 2AEWA 5SWZB 1XCQB 3MHUA 3NPSB 3EJYC 4Z08A 4RH4A 2I1OA 3G6AA 4JFFD 4UOW0 4FA8A 4RNRA 1VFBA 2E9JA 4WY0B 1JE6A 3OLDA 4L8CA 1YMHA 4L4TD 3ZZ1A 2HJPA 1JZJA 4FIQA 3GC3A 2AITA 3RGBA 4EE2A 1ZT1B 3TBYB 2BWGA 1AOZA 5JBEA 4FFVC 3L3OC 3SDXB 5HHQB 1QNZH 4APXA 3KPTA 4D9PA 4WHYH 4E6MA 3TA4D 1Q8AA 1XLHA 5EBGA 1A5AA 3SIKA 2JKAA 1NCGA 3WQ8A 3ULUL 3U6RB 2VDPH 1P5UB 5AN7A 3VD1A 4N9GA 3MZ2A 1CS6A 2J1XA 4BZ2H 5EEVA 2DQMA 1POKA 5E56A 2FX8H 4H6EA 2R4SL 1BF5A 4U3HA 5F88A 1OPOA 2Y22A 1FL5B 3EBVA 1T2XA 2D1ZA 3GI9H 3H9SA 3EO9L 3FA3A 4WKAA 1CFSA 1X8FA 4CMMB 4X6EB 5D7HA 4NJ9H 2BRQA 5HYSG 2GK0B 3MJWA 3IJ7A 3UO8B 1TKKA 3MFFA 2XIIA 3PWIA 4HXBL 1HILA 1WA2X 5JIKA 4KVNL 3T2NH 4AIOA 4P59L 5EU4A 1H0DB 1NANI 2FTAA 3OX8A 5HR7A 3SQOL 1EJTC 3T4AA 2K3TA 3ARDA 1VFAB 4DUXA 2OOFA 1ZBKA 3LMJL 1HHGB 4DO5A 1T66D 1JPIA 3Q13A 2VXUH 1KZYA 3T6VA 1Z42A 2PD9A 4IIBA 3D3FA 4M24A 1ZAGA 1ZGLA 4OF3A 3PYCA 5CN3A 4U4BA 1YEKH 3BL3A 5CEZL 1ZTXL 1AIFB 3W53A 1WICA 4PMRA 3U9IA 2WZTA 3Q37A 3B56A 3A6BH 2B16A 2IALB 1G69A 4U1JB 1GYNA 4LPXA 1Q1PA 3D4YA 4MRBA 3F4NA 1V77A 5F3BB 4LSDA 3K80A 1ZK9A 1RZIA 1X1ZA 5BVJB 5ECVA 1IBGH 4UTKA 3CJPA 3PWNA 2J78A 5IB4A 2C1PA 5DT7A 1EHKB 4QDPA 2H9AA 3BVNB 3QI9A 4QR7A 1YY9D 5DANA 1JGVH 4NRRA 1X5HA 2JB5H 3B7UX 3BD4A 1EVTC 3F5WB 2CKBA 3BSZL 1VFOA 4Q4SA 3R1ZA 2VXQL 5D8JL 4PV9A 4UT9H 3NO5A 4UM9D 5FJTA 3VGAB 6REQB 2QQLL 3AM8A 3RI5K 3RKDD 4J3TA 3IXTA 3T44A 5AVZB 1FQ9C 3P0GB 4JFSA 1TWDA 3W1RA 2B7QA 3DXAE 1S5IH 3NP3A 3LRMA 1DDHB 4K8RC 3L0NA 3ONCA 2OYKA 4R7XA 2XJKA 1RIHH 3UNTA 2IH1A 4P7OA 2UY6A 4J6RH 3PLYA 2QVMA 1YJDH 1CF1A 2CDGA 1ZSDA 3MRIB 2XUWA 2NWRA 2J62A 1P4CA 3MUY1 1MCHA 3FXIC 2DWDB 1JXKA 3RVXD 3HLAB 2BIPA 1ED3B 5A2FA 4ABVA 1W80A 4U1HB 3UWVA 4BFAA 5I6KA 3VWJD 2DYRB 1A6UH 4A04A 1WE5A 2DAVA 3QEHA 1T7VA 4R7LA 2HCVA 5D5ME 3WN5B 4B9YA 6FABH 1R0AL 1UM6H 4GCAA 4HJSA 1QSFD 3KVQA 2G9HA 3SQRA 4QHLA 4JIPA 4GK8A 3QXDA 3APGA 3KPQA 3LPPA 3SO5A 1C5CH 5MHBA 4C90A 3WFBH 3OMNB 1RULL 1VGEL 4JQ4A 1JGUH 1FDLL 5TDNA 4LDEB 3ENEA 3VFMA 5IGXH 3F64A 4R90L 3FU7B 4BFGA 3DO3A 3APFA 4NUWA 4PMVA 1LROA 5CZSA 2NPLX 1PF3A 1IAKA 1W8EA 4TVUA 3ASNB 2VMEA 3ULVE 2XTKA 3GSWA 4PI0A 2ZUYA 1IEAA 1AP2A 1WDSA 1KRBC 3VINA 1BQLL 3WLWD 5J3HD 4XAYA 2OW7A 1KTDA 4A6YL 4F9LA 1ISVA 1JCYA 4QMEA 5HTSA 3BGJA 4XO4A 4MBOA 4WWID 1W8GA 3VNMA 3KDMA 3VGHA 5BMFL 3DESA 3V16A 3MLVH 2CRYA 4YS1A 1T0PB 5A2JH 1OCBA 3KBNA 3LLFA 1ZSHA 2VX6A 2ICES 4O1CA 3KBVA 3REWB 4QG9A 4G8IB 3IFPA 4Z7UE 4BCZA 4MD5A 3TBTB 2Y3NA 2EDMA 4JHWL 4R26H 3PWJA 1FL3A 3FO1A 4RUBA 1UXWB 1A6PA 2EZ0D 3UU0A 2UXFA 2VE6B 3I9AA 2IDQA 4YQXL 4HZ8A 5CAKA 4P46C 2NNFA 4PHZA 1OE3A 1ROWA 5CBAA 2Q2EB 3VXRE 4MRCA 1DJZA 3K8LA 4KJQD 3OF6A 1XCWA 2UWFA 2QBWA 2LFGA 1DSFH 1CR9L 2P28B 2BS71 3NA8A 3EJQA 2GQHA 2XY2A 2HV5A 4HIJA 3M7WA 2Z1BA 2XWBB 5IQOA 1JV5A 3VXMA 4WDIB 2W91A 1ONWA 4KEMA 2EYTB 3AS3A 2UZXA 5IQ7L 3MRBB 4UI2A 4TQPA 4W7UA 3L23A 1LLAA 5G4OA 1T0NB 3SRDA 3U2ZA 2GYSA 3QQ1A 2G3JA 3K5SA 3FKUS 1GQJA 1TUXA 4ZS7H 4JHAH 4F8QA 4CSPA 1DJGA 4QISA 2WHVA 3KHQA 3IVTA 1A7OH 3MI3A 1WKFA 1S2CA 2JSFA 1TZAA 1KM0A 4C83A 3TBBA 3RTQD 1L0QA 4A29A 5FYJD 4LLMA 3KWWA 4P5MB 2CESA 1I45A 3V0WL 1AXSA 1O6SA 1DQUA 5L6YH 1D5IH 5IROC 3VZZA 1TR9A 4JK0D 5BZZA 2H6OA 1GTEA 4TL4A 4O28A 4LVHB 4OV5B 1HP5A 3RPIA 1B2WL 1I1AC 3KLAA 3CXFA 2R15A 5JBFA 4ODTH 3KGRA 2R56L 1G43A 4XHJD 4QGYA 3IXAA 5F1NB 3LRGA 3FLUA 3C6SB 4GIAA 4JJ5A 1QUPA 1OQOA 3FBQA 3C2AH 1HKFA 1PWMA 2B4CC 5C0EA 3IRSA 1DHPA 2X16A 2XV0A 1VJSA 2CBVA 4FXGA 3IU3B 2J9XA 4D8OA 2C9RA 2J20A 3WKNA 1EIXA 1V79A 3TC7A 4GUJA 3VFNA 1HS6A 1B4JH 1I3RB 1NDVA 2D7OA 3K72B 4IBQA 4PJXA 3HS0A 1Q72L 3KPRA 4ZYKA 5F9OL 4G59C 2EPNA 3LNHA 1TJ1A 2XXGA 4ICCX 5JORA 3MP3A 3RVVC 3TSMA 1IKNA 2Z9TA 3Q43A 5D1ZC 5B8CB 3WEXB 4ZO9A 4TIMA 1BD0A 2E9WA 1MCKA 4JGDA 3A4JA 5HGGS 1JXJA 4I2XA 4GIPD 4LY8A 4K37A 3QIWA 1B54A 5FOOA 3DX9B 3IAPA 1VZHA 3CEUA 2X2JA 4HFUH 1PY4A 1MRCL 2Q76A 3N4EA 1MW3A 1BGGA 3ZTEA 2JALA 2BVOB 1RUAL 1R9YA 5IFTA 1F11A 5SWZD 5CJXA 3ZJ7A 3LN5A 4MAUL 2HT3C 4UT7H 4PJ5B 1VLXA 3VABA 3L68A 4B3ZA 4RZCA 4DOHB 1LDPH 4D2JA 1BZ9B 4HALA 3ZU8A 1ZENA 4HUVB 3BVWA 4EF8A 1UP2A 2Z7WA 3GDMA 1AO7B 2WCSA 1PLBA 4XBSA 1JF6A 4M81A 4AZGA 4DGUA 4N0UA 5F4WA 3L5LA 4N6EA 5EU3A 1J0JA 4UZSA 2FHFA 1IEHA 1D2OA 1ID2A 1ZEAL 1WBJA 3UZVB 5BMWA 4KOBA 1BD2D 4LLYB 1OOAA 4E42B 4PMQA 3STCA 2A3BA 2CJUH 5EOQH 2YRBA 4KI5C 1IM3B 2F1AA 4F37K 4UT6A 5M94B 1RHCA 1U33A 4DAGH 1JZ7A 2FGZA 1XF3B 4AY7A 4W9ZA 3CG8A 2Z1PA 2GAZA 4LSSL 3FB8B 2XH7A 3QYCA 5F93C 4JZOA 4HKBB 3VX1A 3GQYA 2UY7A 4IJTA 4LVGA 1MLCB 3SKMA 5IEKA 4BQ6A 3MROA 2I25N 4JY4A 4BK5A 4NASA 2VC6A 1OF0A 5EIIB 1O9VA 5LB1A 3PHQA 5HDRA 2Y8KA 1KBGL 3LX9A 5D37A 5LNGA 3W22A 1QPRA 4NNPL 3BD5A 3SAZA 4GMSH 4X4XB 3QQ4B 5JPNB 3WNPA 3EX2A 2BPBA 3QAZC 3QR1A 4IRZH 3U2SB 2WXQA 3EOLA 1CG9B 2TODA 1A5KC 4DUWA 2J77A 3WMBA 5K69A 3CFMA 3VKBA 4Z0SA 4JGUA 5A6AA 1RPQA 2WBJB 5INCB 1M53A 1YEFH 5IWLA 3ITCA 5JOPD 4X5XA 4OZGF 1DQMH 4HJUA 3CV1A 5D1XA 1I1CA 2F54B 1RAMA 3L2IA 5FB8B 2ZRYA 4G71B 5T3ZL 3RCNA 3OPUA 3S2CA 3WE6A 4LEBA 3LS5H 3UXDA 4AXWA 4LBUA 2FMOA 1H8NA 3T71A 3OXSA 2EVHA 1U42A 1E4NA 1MG3C 2ACSA 3UPWA 1JPSL 5I1LB 1VGKB 2CK0L 5AW7B 2V5TA 5IHUL 4IL0A 3N0PB 3VFSA 1LNUA 1QSFE 2P1FA 4GXWA 1PZ2A 2P5WD 1XIGA 4JDZA 1XQ4A 2MOVA 5AUMA 2Z1KA 1MJ8L 1HKMA 1VYRA 2C3HA 2FDSA 1KPVB 3NQMA 5ABZA 4AD2A 3PP4H 3H42L 2QUVA 4KDTA 3S4SG 1S39A 4F2BA 3W7PA 7ENLA 4LC8A 3N43B 4NZTH 4LO9A 1TG8A 1UWRA 1A4CA 5EG6C 3NVTA 5DZLA 2CETA 3W2LA 4R83A 3BDYL 3GY1A 3WLSA 5TE7L 2EPMX 2G95A 4P7LA 2NUPA 2A9CA 2LQRA 3GO1H 3VIFA 5JO5B 35C8L 4MIMA 3BQUB 3BW9B 4KI5F 1TA3B 1P6CA 1E0XA 4KJWD 1X4YA 5C2XA 2QPSA 2DYSB 1UR8A 4JM2B 1ASOA 1G1CA 5EU6B 1PD6A 3OAUH 4NAMA 2C91A 5IHZA 5DD1H 5LCVH 1CICC 3N0AA 4AVHA 3DFYA 1TREA 3G5XA 2LABA 2OMUA 2PN5A 3U4BL 5JOFB 3BC9A 5ALBH 5T3XH 4MLSA 4GO9A 2XX1A 3PWPA 1GPOH 1O95A 2DF3A 3TQKA 2HKFH 3VA6A 4KK6C 3TV3H 2O92A 4GG6B 1DQKA 4KXZI 4DFHA 1E5JA 3UZEC 4ZUWA 4X7TB 4CQBA 3DJZA 5EORH 2I9UA 2N7BA 3W25A 3O6FD 4YYCA 4W88A 5DJYA 3C6LB 4R7DA 5J6SA 3DBXA 3ASOB 4Z7NE 3CXDH 4MJ6B 2FB4H 3V4UL 3VGFA 3THQA 2PURA 1SGKA 1OVZA 3S2JA 2R1XA 3K6NA 3WQWA 4YNYB 2CXEA 2RDWA 2UV3A 1YMMD 4O4VA 1UZ4A 1ZHNA 3N9KA 1B5TA 3KBJA 3CL7A 5IV2A 1PTDA 2Z65C 5AC5A 4GUCA 2Q3AA 5E6SB 1F3JA 4YTSA 2DM7A 4C6KA 1V02A 4KPHH 5CUSL 1J10A 1ODAA 1EUAA 4XMKL 3F7JA 5I77A 4HTYA 4AG4L 4QIUA 4OF6A 2Z7GA 3FKKA 1CD8A 4FTVB 3MLRH 1TRIA 1AQFA 1Q9KB 3NK4A 4LUYA 3B9KC 4NZ8A 4U5IA 1S9XB 3ESOA 4JN2A 1GY2A 4IH3A 4QJ1A 3QHZH 3NYKA 1QOXA 2YD6A 4IJ3C 3OKNA 3B8UA 3LSBA 1IBFA 3P77A 3BMXA 5L4IA 2IANA 4I4WB 1OLZA 2BERA 2UZYB 4D1IA 4CADB 1R3VA 4PRBA 1KUMA 3P9MB 3UFIA 3QF0A 4JRXA 4RXFA 3VILA 1XVSA 2WWMC 4ZL1A 1H3GA 2VGLM 2PDWA 2OXNA 2WUBH 4QRSA 3LMZA 3B8IA 2H0EA 4CDGC 4N4PA 2WVTA 2IMRA 3SECA 4OLWL 1Z3GH 1GOOA 3BIKB 3T6CA 3RFRA 1FE8H 5AHLA 3I6LD 3B9OA 3P67A 1QTSA 4B0MM 1S5TA 1JTOA 5MKGA 1KWGA 3UG8A 2YCJA 3DOSB 2IH3B 1PY9A 2AEPH 1I1YB 2RQ8A 3LCFA 1AGFA 3QUMH 4LBRA 3BVUA 4KVCL 4RE0A 2JKWA 5HJ3B 1SSGA 1F73A 4RE2A 2EAWA 4XVJH 2VVSA 5HJXA 3M47A 3QEQA 1MQPA 1MEXH 3U2JA 3UC2A 1L9PA 4J3SA 1K8YA 4NT6A 5EUOE 3TEYA 4QX4A 1DJYA 2AV7B 3ROOB 3UDWA 3GBML 2WGNB 3W9DB 1BWVA 1A4JB 1NMCC 1P0DA 1XIEA 4QYOB 4XCNB 5DUPL 4C6JA 1UCBL 4LU0A 2XACC 4JZJA 5I7GA 1FX6A 1P5VB 5A8OA 3QQ3B 3VIOA 3CFBA 3NFSH 2PXYA 3KPPB 1HZKA 3EW3B 3X12B 4HB7A 1JV2A 1BX2A 1I2RA 5SWZE 4GQRA 1HHIB 4EANA 1BHGA 3CVDA 5TK2A 2YD8A 2PSNA 1SN0A 2YKLL 3BH4A 3UVIA 4FKHA 2V2TA 2FNWA 4TSAL 3R0MA 5TBOA 3HJ0A 2GDUA 1NC2B 3AWEA 1BQHA 4H1LG 1S7RA 4HQQL 4QRUB 3MNWB 3VPLA 2YSTA 3WJSA 1QBLH 2B20A 3IDIB 1I8IB 3PP7A 4LSTL 4ZQRA 4DZIA 1USZA 5DLMH 5DURB 3RL2A 3WJJA 5HVHC 1S2AA 2PGWA 1CI5A 3HM7A 1CMOA 1CK0H 3TC3A 2Y62A 1PKOA 3TVMD 1T7YA 3PJNA 5L7XH 1KLZA 4ML4A 1E6OH 3V5CA 2XSXA 5I19L 1SYVA 1AQ0A 1CL7L 2R1LA 5EWIL 4UV4L 4AVKA 3BH8B 3RVTC 2XIBA 1WDWA 3S5ZA 3LHUA 4WSJA 3RHWK 1TPC1 4HUXB 2R27A 2XYBA 4R2GD 2DQHH 2IBZX 4JPWL 3V0UA 4PR5A 2DBJA 4NM4L 5CGMA 1YNTA 1ALDA 3B8DA 2CLOA 4EWJA 2CLRA 1NU5A 4JKWA 2QJDA 3O1NA 4CLMA 4PJ5D 4G6FB 5I9QB 3FRPA 3PWVB 1R19A 2A1WL 4WI3A 2R83A 3G2GA 2BZDA 5J4MA 1GC1L 3PZTA 4MMXA 1L6FA 3PBUA 1HXKA 3TBSA 3H85A 4ZMOA 1VJZA 3KEDA 4AWJC 4YE4L 4IBVA 5INDA 3B6SB 4B5UA 1MZYA 5J6GB 1M41A 1ZHBA 4JFQB 3NVDA 1C5BH 4P23A 4KNTA 3CZEA 5F96H 4EK7A 3ULVL 2W9DH 5C0FB 2JJWA 3ZT5A 5LGXA 4O2EA 5HGAA 3TMQA 3CSPA 3W75A 1IM3D 3M9YA 4DN3H 3INUL 4DM1A 3LQMA 5KVGE 4HNTA 4XO8A 2GABA 2J2ZA 4LE8A 3IWPA 1ISYA 1SVBA 3BZ5A 4MD0A 1FC1A 4TF4A 4PRPB 2QV4A 1KTJA 4XAFA 1JNHA 3AU0A 3HNVL 1KXVC 2GJ6B 2GBAA 2GJXA 1DWGM 1PJWA 4KMQA 9XIMA 4HJJH 1LP9F 5ETUB 2UYLA 3RWIA 2TPSA 5E5CA 1UR1A 3P11H 2ZCZA 1DJIA 2P5WE 3LS4L 4HKXA 2PW2A 2YEZB 1ZCCA 4L0PB 1BG9A 1E6PA 4XVEA 3MV11 5BQDA 3KRZA 2CO7A 4NX0A 1WGOA 3HHRB 3QOMA 2EDFA 4XZMX 2BZNA 5AAMC 4R5TA 5A8PA 4PBFA 2OQYA 4X4YA 2EIZB 1P1XA 2XZQL 4XZIA 1VKFA 2MCAA 1E6ZA 4OFCA 3RWDB 2H7WA 5T5FA 1LJYA 2WBJD 3BN3B 4MUPA 4TLTA 4Y9GA 1RJZB 4ZGYA 5F1SA 1A7QL 4IRSB 4GG8A 2UWEA 2DS4A 8XIMA 4F0MA 3C0JA 2VGIA 1CLKA 1S4IA 4RNJA 4MHBA 2F54D 4XXCC 3NO1A 4MKNA 4ODUA 1AHWB 3P4NA 3I4EA 5CZVL 4NAEA 4Y9FA 1QOPA 4MCYB 3IU4H 1MFAL 5I6OA 4XCYB 2YAQA 2VRAA 5A6KA 1WXYA 1GW1A 2OQJB 1NDMA 5LO7A 3CFCL 3W0WD 3L3KA 5GRXG 1MY5A 2I5YL 4NAQA 5B39B 3QULA 4Q9BA 2ZICA 3LKRB 4HHAA 4JFDA 1XH0A 4H26B 4ZBJA 3FK3A 4A38A 1WGVA 5E94B 3KH4A 3NFPA 4UIMB 1I9JL 2DFAA 5GGUB 4XNZC 3BK0A 4LHUD 1OX5A 5K39A 3LI1A 1G7VA 4KZEH 4PJFA 1FVDA 2FJGB 4NC1C 4HPOH 3CAWA 3HFYA 4YDVA 3KOXA 2DJLA 4XB8A 2CLVA 4NPYA 2XFYA 1UW9A 5AENA 2OKMA 1TX2A 1W2PA 2ZSWB 4FQPA 3ME0A 4E4UA 3CWNA 1K8DB 4L1GA 1EZLA 3MZNA 3EJUA 3IAGC 4MXWH 1EX5A 4GQ0A 1SMDA 1YMME 5HQEA 1QCWA 4QAIA 4GXVH 4FXKB 3BP4A 5CSUA 2IADB 3B9NA 1B3JA 3JVAA 4HMCA 4XX1G 2OP4L 3QUMB 1CYXA 5EU6D 4TVPH 4BH7B 3VKCA 1QQDA 5A7EA 3FIGA 3FPYA 1RZJH 4HS6A 5E8PA 4YOKA 3IJHA 4FQCH 3MLUH 4G7VL 3TX4A 1F74A 3BDXA 4Q6XA 3BLLA 2WZPD 2ZVIA 3ZW3A 1G9ML 2FO1A 3IGUA 1UA7A 4CGUB 3P1VA 2RFGA 4KJPD 3K8KA 4FG0A 4N9BA 4D9LL 3U57A 3TROA 1U92A 4YX2H 3PNWB 3SB3A 2ZXGA 2X4RB 1G5GA 4D0DA 5DGQA 4TULH 3C2SA 1TZIB 4LCYB 3N1MC 1PKLA 4WEBL 1W3LA 1HESA 2ZCLH 3HPXA 5GGRY 4X0NA 3NTYA 4YDNA 5TF0A 4KIEA 5B38A 4KHXL 4G7RB 3MV8A 1HHKB 3O8AA 3ARBA 3EJZD 2BOEX 4PCTA 2PYFA 5I6PA 1RHFA 4G6KH 1CB4A 3FB6B 2VUYA 3TLQA 4DQOL 4WW2B 4U4MA 2FJSA 2PDXA 1XLMA 5IB5A 1Z5LB 1H5BB 1NDTA 3W38A 5EGRA 2JV6A 2G3FA 5I82A 1EEXA 3DX1A 3MNDA 2HT4C 3I6LE 4OCYL 2HSIA 4WGVB 3W9EA 4K9EL 4L7ZA 1CQYA 5FM4A 2R1MA 4U1NB 4A39A 6ALDA 3HC3H 4AYBA 3K5XA 4HV8B 4QFUA 3D0LA 4D8AA 4K2SA 4B4HA 3H55A 5DJ8A 2QSVA 1F76A 2FO4B 4GKZB 1TQCB 3P73A 1XHGA 1RJLB 1IZJA 1NSNL 2ALDA 4PS7A 1N4XL 4M1BA 1BPLB 3UAJD 1AKJA 2YN3A 4Q4IA 1FNGA 5TE6H 3DI2B 1XGUB 2H5UA 5DFWH 3NEHA 1G7LB 4OZFH 4Y2OA 2GSEA 5H94B 1DBBL 1A4LA 4WV1C 3K1DA 3HB9A 4BM7A 4L1SA 1IAIL 4DGIH 4TLUA 2C9VA 1E0UA 4EN3B 4TUFA 2P8PB 1JJKA 5EA0L 4PB0H 4DBDA 4LVAA 4JTUA 4C1LA 4JPVH 4O9HH 3V9FA 3MA7B 3R19A 5DMYA 4ZSUA 4PU2A 3W37A 1EJOH 5GSRA 1CLXA 1DE4B 1OGBA 2N59A 5E4IA 5CO1A 2PWGA 5KSVA 4ZD3L 1XC6A 2GZXA 1UPMB 1SRDA 4JFPB 3OM3B 1LO2L 2WCPA 3IEBA 3TTEA 2KUTA 2QGCA 2ORBL 3P30L 1MRQA 2WNGA 2FQDA 2KZKA 3S96A 3ITXA 1VBRA 1ET5A 4JRYA 3K4ZA 4K5OA 2R0WL 3O3DB 1MREL 2FJKA 3S35L 3AYSA 2O56A 3SDCC 3GYEA 1AJ0A 2C16A 1NEZA 2RALA 3Q67A 1S9YB 3TA6A 1FZMB 4CVZA 3RY4A 3NDZA 2IBZY 3PBGA 4RMSA 2I32A 2JIXD 4XOAA 4M9PA 2AQRA 2K0RA 1ADSA 4LSRH 4HQVA 3MC5A 2CKBH 4L18A 3HZYB 4JHMA 4JIEA 1O7DE 1J4EA 3FN0L 3V5HB 3PHOB 1YDVA 4Y9CA 3MU7A 3WUBA 1G7QA 25C8H 1UZGA 4PJ5E 4K2UL 2ZRWA 4G1MB 1KTNA 4DOHE 2VLJB 2E4TA 4Q14A 1NC2D 5KAQG 3ZR5A 3FPXA 3OSKA 2ISSA 5ESQA 1K70A 4BF7A 4OOUA 3INPA 4X5WA 3FAXA 3WCYA 7CGTA 4L65A 4HHLA 4GJJA 1VRDA 4HVBA 1QEWB 4NM8H 4M7KL 4FA6A 4GABA 3IWVA 2WINA 5JXEA 1SOXA 1K03A 3TFCA 4DWSB 2A74A 1OV8A 4JY6B 1H15A 3H7BB 4DFIA 2DD8L 4MGGA 2ICWA 3DXIA 4FF7A 3WELA 3OQEA 1K5NB 1EQCA 1F1DA 2QAPA 3TYDA 4BR1A 4XMLH 5REQA 4NO2A 3AQYA 1A3HA 5I5IA 1U8LB 3O45A 3UABA 4IKLA 2DZEA 3D48R 4K3GA 4JG0L 3RJQB 1XIBA 1YEIH 4K1WA 5I8CA 4RRPA 2XWRA 4NSBA 2TRYA 4NHCH 1AZ2A 4M56A 3QGKC 4ATTA 3F7QA 1RA0A 1RJCA 3RGTA 3EWBX 5CGBA 4UF7C 1VH7A 4LGSB 4MXVF 4FN0A 2PRLA 4G6FD 1KFKA 1AGEA 3B7TA 2YAPA 3QN3A 4XVUC 1E4MM 2PLCA 5MEOB 1RIVH 4CD5A 3S2LA 5B80A 1TPFA 4NZ5A 4HT1L 5T1KD 1JVKA 4LNYA 5E09A 1JDFA 3S3GA 5I1KH 3BO8A 4WJKB 4J3XA 3XISA 4UIKL 3RA7L 4HZLA 4Y2WA 3GM0A 4ZW7A 3OAWA 1M1XB 3N14A 4W5UA 2J8UB 1EBAA 3QCVL 5BO0D 1HJQA 4HIHA 2XG4A 2A3LA 4CU6A 2I16A 4DNLA 5EYWA 2NY3D 5GS0D 3P7YA 3DU0A 4PJHB 4OB5L 3I6KA 4KFZC 4XZ4A 5LIXX 3WEMA 4NQTA 4BIKA 4R27A 1IIHA 4WKXA 1C8QA 1P7QB 2F54E 4LEEA 3RYMA 3EOUA 2ZXQA 4Q97A 3QIUC 1KJ2A 4PRPD 3BEWB 2GJ6D 1NLBH 1ACYL 3MO4A 5IEHA 1IT9H 2PMZA 4WJ5A 3W0WE 3R13A 1VGAA 2NXZB 4JQ3A 1JQXA 1RA5A 3TP4A 5DJAA 4BJHA 1UWIA 1ZPLA 3D51A 4F40A 4UAOB 2W4XA 3E2RA 4QNEA 2DYPD 3N2OA 1AXIB 3VRJB 2E6QA 4LLDA 3PGCB 5BV7H 1UWTA 5CBEB 1E27B 2DU2A 2C1GA 3WK3A 4WDWA 4LP4A 1MUCA 3VU2A 4KESA 5C2GA 4HIIA 4TX6A 5DUMH 3MU3A 3MO7A 1Z7AA 2DLFH 4KY1H 2WO3B 1WCBA 4PJGA 4M29A 4Q74A 4WXZA 3NQDA 2ZF9A 2NY2B 4JN1H 4QRBA 3L5WA 1K9FA 1K7FA 2WZHA 2X6UA 3EGDA 3WLRA 4IRSD 4PAZA 4B53A 1MY7A 2A3CA 2OSYA 4MKMA 4RMQA 2EUWA 3LHPH 1I2PA 5AD0A 3QDJA 4OF5A 4YCPA 1UOWA 5EU6E 1L9MA 4QLJA 1E6SM 4V11A 5E0QA 4XWGL 1PX4A 3SURA 1OYCA 3PUDA 4HNVA 2Y2WA 3P54A 1IIIA 5TNVA 1UYWH 1EHXA 1R4XA 3MQTA 3AZTA 3E0WA 5IOPA 4V33A 4XOBA 4QRAA 4LNRA 2Z6IA 1HXJA 1EHLL 2YQ2A 2HE5A 1I7UA 4KBXA 4MB5A 4OZFB 3O41B 1AQKH 1Q0YH 2FJHB 4XWOD 2IXUA 4X9SA 3DURB 3VNDA 3QJXA 4GG6E 1VYSX 2OEKA 5I1DA 3CQKA 1CL7I 1HKLH 1W5PA 2FQGA 1HI6B 4PTTA 1SR9A 4EXQA 4WW1A 2FUQA 4TO8A 2REQA 1OGAD 1KDIA 4FQIH 1J96A 2BVDA 2J88A 6XIAA 1CBVL 2VELA 3H12A 5E8EA 5FOBB 3UIZA 4LP8A 5CFAA 1P0KA 2EG6A 1JPHA 3V8CA 5ESAB 3D05A 3T2QA 4Z3GA 3FU5A 7FABL 1MCEA 2OMXB 2E68A 3VG9B 1ZLSL 3JWOC 4M7LH 3QRHA 4J4PC 1E9QA 1FWJC 4XP1H 5IBTH 5BZWA 3HNSH 2W9LA 2ZQKA 3H0TA 2ENPA 1INDH 4HOXA 3C8KB 5TF1H 2L04A 4Q6JA 4KFNA 1MQ8A 4FQXA 5E1AB 2X4UB 4P07A 4PJBA 4OTXH 2XI9A 1IGYB 3WLOA 1YXCA 3T0CA 3ABOA 1UD8A 2A6KA 2PCEA 3H22A 1SY6L 5E0CA 1U8KB 4GBXA 3UYPA 4EOWL 2A6LA 4YIWA 1KC5L 4JPIA 2GC7C 4BYHA 4W6YB 3VSVA 3IDMA 4W6WB 3MJ6A 3CUPB 1L9TA 1LT8A 4NN6C 1AODA 1DANT 2OFQA 3CBKB 1EWEA 2VCOA 1JGEA 3QNXB 4V2XA 2R29A 3TA9A 5E2VH 2VP8A 1H5VA 4WEMB 3ARXA 1L7TL 3WQPA 4HHGA 3UMNA 5IQNA 1YNLL 1YEHH 4UQ3B 2XINA 2XWJA 2CO6B 4DUVA 4AH2A 1M3UA 2W5FA 5GGVL 1R5IA 4UR8A 2I9EA 5C0GB 1Q8JA 5BYWA 2YUWA 4JB9H 5AVUB 3TR2A 4UT6H 4MJHA 1PG7W 1UKSA 1GZQB 5FUCC 4LLWB 3UBXA 5EZLB 5J5DA 3PR2A 4XSLA 5J04A 3HE6A 5EPMB 3FFDA 5KVGL 4OCRH 4ZK8A 4Y4FC 4KDVA 4AD0A 4K71C 3KOFA 3MLWH 4AEIL 3SQBA 4O2CB 1BYPA 5A2KH 4W8BA 3DGRA 3HU7A 4FP8L 4IXXA 5ICYA 3CAVA 4A66A 1K4DA 2B7OA 2YXWA 3H6JA 4Y2LA 1GVRA 1Q94B 4GHRA 5JU6A 3OLGA 3DSNB 5I15L 2PYEB 4EN3D 4MD4B 5FECB 2EAEA 4JMXA 4NRYB 2VLKA 4ANXA 1IGTA 1D3GA 4AZCA 5H35A 3VCLB 1QHPA 5LXVA 1BVKA 3AT9A 4FNLL 1XIWD 5F7WC 1AH3A 3VC6A 2Y36L 1IGSA 5AW4B 1MFBH 2GVGA 4M62H 4FFYL 2VCCA 4RDQG 3C5XA 1TQTA 3GHTA 5FCSH 1YTKA 2MNWA 2GITB 5IMLA 4Q8BA 4RCAA 1SN2A 1TITA 3K13A 4PRWA 5IKCA 2X53A 4HK3N 1CIDA 2WB7A 3M6YA 4JQIA 1E4WL 4CGTA 3U1QA 2OTUB 1YEDA 1MJUH 1HT6A 1WNOA 5CN1A 1ZAJA 5F70A 3VXNA 3QZMA 2P5ED 1EDYA 1ONQB 1T04B 5DC9B 1AZVA 1GSMA 2ATSA 3RILA 1MOEA 4TNWK 2OWWA 1DLFL 1XGQA 2BVTA 3FTYA 2IWFA 1MUWA 3KGTA 1MJ7H 4PB5A 3FN9A 3B7RL 1FJ1A 3FUMA 3BVVA 2R2BA 1FAIH 2Z91B 1JPFB 1F4YH 4Z7QE 5HHNB 3EWYA 4UAHA 2HPMA 4OIIL 4F0SA 4FJ6A 5HI3C 1DZBA 1KM1A 1RVFH 1V51A 2VLJD 4MPKA 5IREA 3P02A 5JW4Q 4GYKA 1SHSA 4JYEA 1YAIA 2HA1A 2ZC8A 4FLRA 2BOFX 1QPPA 5T1LA 1K7EA 4KZ0A 4HHHA 2XGZA 1IL1B 2A0LD 3T65A 2FHCA 1FH2A 4LC6A 2X2YA 1EDHA 2OR8A 4M5PA 2X38A 1CE6B 2BSSB 3C60B 2FH8A 2Q3RA 1BKSA 2WJZA 4IX2A 3GS0A 2HK1A 2BIMA 1LBLA 3DWTA 2SEBA 3MLYL 3JSSA 1HYSC 4ZDHB 2J7DA 2NYKA 1KIQB 1CT5A 2DDQL 4GIOA 3QRFM 4ICXA 2QGYA 3TF7C 1U6AL 2RH0A 4PMZA 5I5MA 4OZIA 1G4EA 3O11A 3Q1SL 4LCQA 2XSAA 4PRPE 5U7SA 1L6YA 4UTJA 3KDOA 1SHMA 2GJ6E 3SUSA 3AU2A 5DJ0B 2DKUA 3BW4A 4W1TA 4H8QA 5T3XE 4C4KT 1ONRA 3OXRA 4JG5A 2PF0A 4RFNC 1JHTB 4HJFA 4GKNA 5JHLH 3QG7L 1VRSA 1ZIBA 2VDPB 1UZDA 2EC9U 3WLHA 5DRNB 3GEWB 2IV9A 3ZMRA 3GMQB 3LEXB 1EMTH 2FL5B 3U6WA 3CH1B 1X4ZA 1IAII 3TO4C 1S5HA 4WK0B 5IBUB 1YQVH 2WJEA 2NQ5A 5F6IC 3AQZA 5JNYB 3ZKNC 5LGKA 4WHDA 1L7IH 2QPDB 2Q3OA 5GGSB 1PBGA 1IAOB 2OTWB 2P50A 4UOW1 3KBHE 5DJZA 3BWZA 4U3XA 3UJIH 2Y0SA 1SDDB 1I4FB 1I3GL 1E4HA 5I1CL 1XGTB 4WO0A 3UJTH 4NQVB 2H2SD 1Q4WA 5DRXB 2D31B 1YHPA 4QXTA 4OUOA 2QJMA 4J1UB 3DV6B 5AALA 3JWDL 1ICTA 3N3TA 1NGPL 4E0RA 5ITFA 4OBTA 3NQIA 5T33L 4JFZH 1A0QH 4PMYA 2XTSA 1J05A 5DVLA 3R1GH 2P24A 5AOKA 1RJPA 2OL3A 5M03A 1GXEA 1R85A 1J9TA 4G6CA 12E8H 1NDGA 5AVHA 3QHFH 3A9BA 2ZOWA 3PV6A 2NY7L 3S3BB 4M1DH 1RU9H 4I5RA 1OGAE 1A4KA 4LANA 3L9CA 2EXYD 2XXCB 4JDVA 2LVCA 4L9LB 3QEGH 1DO5A 1NCTA 4NZ1A 4W9KC 3DV4A 4WIQA 4TVCA 2NY2D 1UJTA 1O12A 1Z7JA 4Z1CA 4W93A 1WV2A 1OTUC 5I74B 3L4XA 4L37B 2RJMA 1CEOA 5J5EA 4DJEA 4NO0B 1TVBB 4AQEB 4MDRA 1AQ8A 1N7KA 1PTZA 2OMAA 4OQTH 3KJ6L 2XQ0A 4GY1A 4MCNA 2PDIA 3GXDA 4QWWC 2B7NA 3GRBA 3GVGA 2QKFA 1OANA 1CGVA 3BVDB 4Q4KA 5KBPA 1EA0A 1IM9B 2VAAB 1YUKB 2ZXWB 4BSVB 3REQB 2Y7LA 2KBGA 5MP6L 4HS8L 4R7JA 3B06A 5IFJA 1A6ZB 4IG2A 3QJSB 1SZGA 2HRHA 4XZLX 1ETZA 1ULVA 5CZXD 2F58L 3T8QA 3KD4A 2QADB 1QATA 2X4PA 1FWGC 1TQSA 1G7UA 2FGBA 3KVLA 1J5SA 2V3GA 5BW6A 3TT1H 1LM8V 5IJDC 3FC8A 2JK2A 1X8CA 3QO1B 1F86A 4ZNEE 4DKEH 1EJWC 1N6QH 1UZ6F 4N9CA 2PDJA 3B8VA 3HPAA 3RU6A 5D2LF 2C1OA 1RZGA 1VJIA 4JRFA 1MCCA 1P0EA 4X8JB 4LUSA 4N6RA 4AD5A 3SPCA 5EV7A 2DQTL 5KSAC 3ES8A 1DORA 4ERGA 1A6VL 1HZLA 5FJIA 4IZGA 5KBDA 1EK3A 2QPFA 3TYGH 2CUAA 1VKXA 3LAFA 3WKMH 5SX4I 4IGBB 2KKQA 4BFJA 2QZRA 3PULA 4RDWA 3KNBA 5J12B 2JTDA 3LKSB 2MQ3A 1HKWA 1MCDA 4IBZA 3FEQA 4LL9A 2X2HA 3S5NA 2WYTA 3G0UA 5DC4B 2QR6A 2CU0A 4KRTA 4GGHA 5L8KB 1CLCA 4O18A 4ZT1A 4L4MA 3RRQA 4ZTPH 2Y3AA 4LSQL 2BOBB 5HYQA 2Z7ZA 5CJ5A 2O9OA 1S8DB 4U6HA 2B2XL 3LBOA 1KG0B 5LQBH 4CQCA 3VFUA 1JRHH 2ED9A 3AIWA 1IE4A 2ZOLA 1ZA3A 3UTSA 3RJYA 4YBQC 4DZ5A 5I66A 1T0MB 2V2WA 5HI4D 2ISFA 5DR5H 2G4JA 1GGYA 1CZ8L 5CCZA 3REVA 3UXFA 3PJSA 5D70H 2W07B 3D2UA 5D6CA 2Y7EA 3D06A 4DJDD 5FKAA 1S3RA 4NQDB 3H3KA 1BVNP 4XIMA 4C5YA 3GVVA 3IPWA 3STZA 4I9TA 1PKYA 3RFZB 2C3VA 4GP8B 2VW4A 3BJSA 4U6TA 1EFXA 4PS8A 3W76A 4BSWB 1F58L 1CE1H 1DLHB 4UNTA 4HJWA 1BFNA 4IMEA 1LG2A 1GNXA 4PJDA 2YUVA 4KTDH 5D7IF 1ADQA 1FH9A 4OLXH 1TPWA 1VD6A 3DYMA 3STPA 1UWGL 4TOYL 2ADGB 1HQ4A 1KTBA 4LAOA 3QY8A 1LK2A 2Z31A 4OCLC 2NLYA 3DX0A 2O5YH 1EBGA 3AS1A 1QW7A 5LN8A 4PCFA 4L4OA 3RITA 2NYYC 1G9NC 3O2WH 1BMWA 3W1NA 5AW3B 5DBUA 5IVZA 4Z3JA 1NEPA 2D03L 4E8CA 4Z7VF 2P5EE 3SRKA 5CD5D 1KBLA 2JJTC 5DXXA 5LWYH 4NZ3A 3WO4C 2EKJA 3RWGA 2J73A 5CN2A 5C3LD 3IRCA 3IETA 1FWIC 5GQBA 3LY6A 1NFDF 5GRUL 1J01A 1BXNA 1FWCC 4JGMA 3ZKSD 2F9RA 2ATKA 4FNRA 1IGCL 2PYED 1OYAA 2J8FA 2E56A 3WMLA 1U5JA 4N2KA 3UTOA 3JR2A 5DZJA 3O4OC 3HO8A 5HBFA 1V8HA 1JXGA 4QRQB 2JQXA 2O6DA 3V52H 2QCLA 4LK4A 5AYZA 5I76B 3VXUA 5HR6A 3QORC 1BXXA 5TQ2H 5CINL 5T5FH 2HXAA 2VLJE 3AS2A 2WXRA 1XBDA 4XPGH 4YGAB 1EEUA 1OARH 4WO4C 4E2BA 4GFSA 3QG6A 2C7UA 3UGEA 1IWBA 1POJA 4L6OA 2OZ4A 1FWSA 3DPBB 4NP4H 1KBPA 5GJTL 1A3ZA 2XA8L 2C3ZA 4Z77B 2WQSA 1MCPH 2X3BA 3VXSB 4FQ1L 2O5NA 2WXHA 4JREC 4ELMA 2V82A 4GYJA 5J6HB 3MXWL 3WE1A 5BMXA 2VX4A 3B4UA 3WUEA 1B30A 1DTUA 3U0WH 2JKPA 1TJRA 1JP5A 1A1OB 1ZU8A 1YPZA 3W11D 3RWFA 3MV9B 4G42A 3ZJ6A 4OLZL 2XG5A 2X70A 3W29A 2J4WL 5ACZA 2IG2H 4HA0A 5E5MB 4JFHD 3OGVA 1DXFA 3MTXA 4CW1A 1B4LA 3ITOA 4HKZB 1DPMA 5DHYA 5EO1A 3WN6A 3S36X 2AK4A 1C7TA 2IQ9H 4KKBC 4PW3A 1P1VA 5XIMA 3UYRH 3NQ7A 4U10A 1XZ0B 3MR9A 1WH0A 3RZCC 2QJJA 4ZR8A 4F1SA 1GKOA 3W72A 1SO6A 2DT3A 1AW1A 1EZ2A 2VUKA 1IAMA 3S3DB 3ZK0A 4EUPA 4OM0H 3B3BA 2ITCB 3B5TA 3TN0C 4F8PA 3NPZB 3EDEA 3BISA 3VXOB 1P43A 1LDCA 3JVGA 1QD0A 2J8UE 3HZ3A 5E6IB 1XLBA 2VDML 1FHNA 1U8HA 5SX5K 3PAUA 3BXNA 4PLJD 2WSQA 2Y7NA 3DX8A 4PUNA 2X4NB 4RAVB 4WQOA 3G5WA 2ATPB 4PJHE 3V5KA 2NW3B 4OD2A 3CV7A 5FO8B 1LYXA 3TSBA 4XVDA 1EDGA 3GZOA 1RERA 4S11A 4EZKA 4A2DA 3HG1A 3E74A 2VR2A 1P4IH 4R53A 4TVPE 5HY9B 1TSRA 2XZ9A 3UMTA 2X0UA 3E2SA 5ANMB 4JUSA 4N7QA 1CU4H 4F2EA 2EACA 1F07A 3QNFA 4RNHA 2ITDA 2RMNA 1G9EA 1XXXA 1KN4H 1FG2B 1CENA 3HNTL 3V6OE 4HPYH 4LYPA 1PLGH 1DFXA 5DJDA 2VXSH 3RUGB 1FL6B 2W1NA 3QQWA 4L3FA 2QR0A 3NCMA 4FXSA 3UZYA 3O3BB 3USZA 2CO1A 1BYDA 1YKWA 4JICA 5EO0B 4AUJA 1LWHA 5J1AA 4EN2A 5E70A 3FN3A 5CMAB 2YWYA 4DLFA 3HN5A 5SX5H 1T89A 4UNLA 5CLXA 1FP9A 3L4ZA 3GBEA 3THDA 4PGBB 4ALAL 1ZANH 3ZY7A 4KERA 4AZ8B 4I77H 3VFVA 1UA6H 3RO8A 2VL5A 4AC2A 5EU5B 5JVLA 5JIDA 2A6JA 3KM8A 3UROR 1XAKA 2H8PA 2NZLA 2NY4C 4X9HA 1XLCA 3BG9A 1UB6B 3VOJA 3VWKC 4LW7A 1R2TA 5KSBA 1QZNA 1JDEA 2HMCA 5I78A 2K9FB 4XZWA 3DG3A 2PC4A 3WFCL 1EIBA 3WKYA 3C8NA 3OP2A 3I6GA 3L3JA 1U3HC 2JELL 4NZUL 4LF3A 3VO0A 2VI0A 2JKSA 2PR9A 4XN4A 1E2VA 2GCYB 3SDXE 5HSFA 4GAJL 2Y5EA 1MSPA 5LXEA 3ULUC 1N12A 5HI5C 5FUOH 1SO4A 2E5CA 5D1QA 1S78C 1QWNA 3S42A 1T1YB 2E59A 3G1DA 3MRKB 2D24A 3LBCA 2DJSA 1XBYA 1KWKA 5CIPA 4UTTC 1OGPA 4GUIA 1FRGL 3LQAL 2YEQA 4A35A 1DQTA 1M2VA 3GDKA 2O61B 4LCIL 1V7NL 5DD0L 2NVDA 4FFWD 4LYQA 4NO0D 1MCNA 4X60A 1OC7A 2WLIA 3BN9C 3MOQA 1UMYA 3TYAA 1H6FA 1VF5C 1KGXA 3FQWA 4QRPB 3B04A 3TJPA 4P7QA 3VXTB 1B4RA