3AXHA

Crystal structure of isomaltase in complex with isomaltose
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGAMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Steric hindrance by 2 amino acid residues determines the substrate specificity of isomaltase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase IMA1
total genus 229
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3axhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3axhA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3axhA02
1LL6A 3BAIA 4P8UA 5HPOA 1P6WA 4MAZA 3LRKA 4K68A 2WVVB 3NDYA 5C70A 2WBGA 4CU6A 4PEEA 3ECQA 1ESWA 4QCEA 2FDMA 3AHXA 3WEOA 2ZXAA 4PBGA 1HIZA 1T0OA 1UR1A 1OWQA 1VF8A 2X2IA 3H53A 4PMUA 2J7FA 3POHA 1JD7A 5FL0A 1V02A 3HG3A 1D2KA 4FLOA 1EXPA 4L4OA 1E0XA 4IISA 1E43A 1CEOA 1FA2A 3SCNA 4AZ6A 3D52A 2BNJA 3KLKA 1ITXA 1US2A 1JI1A 3ZQ9A 2XVNA 1AQ0A 1TZ7A 1XH0A 4WIWA 2ZWZA 3EJRA 1KCLA 1RP8A 3VILA 4A3YA 1G94A 1OBAA 2WC4A 1HT6A 3KL3A 3GXTA 1XYZA 2PWGA 2D73A 2G41A 3CC1A 4AC1X 1BSIA 1QI4A 4X9YA 2OSWA 3BVXA 4R27A 3WD3A 4MDOA 1H3GA 4AYSA 1FH7A 2X2YA 1HJVA 3EJUA 4NF7A 1BGAA 5EB8A 5CJ5A 4GIAA 1OD8A 1E72M 1QI3A 1EOMA 3PTKA 1B3VA 1CECA 1ODZA 2DT2A 5IFTA 3MUZ1 1JFXA 3MKKA 3HMCA 2BY3A 4EANA 5E1QA 2YFNA 3SCPA 3U5YA 3SURA 3M46A 1JI2A 1J01A 2YOCA 2VZTA 2VOTA 3L4TA 2WKLA 3WBAA 1C90A 2F7RA 2XUCA 5FIPA 2YFOA 4FLQA 4AIUA 4PMVA 3N13A 2J75A 1CWYA 4U3AA 3WMSA 3E1F1 3CZKA 3HZ3A 3J7HA 1GVIA 5BXSA 5GPRA 2MANA 1OINA 2DSKA 3AIWA 1HP4A 1NP0A 2ZX9A 3A23A 4JCMA 1WB0A 2YA2A 2XJ7A 1XRVA 3RM9A 4U5IA 3RM8A 4JCLA 3VNZA 3WQ8A 1UWIA 3MMWA 2VX4A 2FHBA 2VNCA 1E4MM 1TQSA 1EHAA 3VKKA 3H54A 3WY3A 1UWTA 3VD4A 2WHLA 2ZX5A 5ABEA 4LXFA 2D1ZA 4L4PA 1HKKA 2WKGA 5ECUA 3II1A 1UASA 3NSNA 1NH6A 3GM8A 5KEZA 3A21A 1OB0A 2ZOXA 4F66A 3AHVA 3N12A 1G5AA 5I78A 1CXKA 1H09A 1XSJA 1BFNA 4PCSA 1EH9A 3T2QA 2E4TA 1HXJA 3AMCA 3DECA 3W81A 1B2YA 3GDBA 2WMIA 5CPQA 1C7TA 1E73M 1UR0A 4U2ZA 1M03A 4PSPA 2J79A 1R8LA 4D6HA 5BYWA 4AZGA 3IJ8A 4CD5A 3MMDA 1W9UA 3VM5A 3FXYA 1GNXA 3FAWA 3L4XA 1LJYA 2XVGA 1LL4A 1U2YA 1H5VA 1V0KA 4J28A 3KEHA 1JFHA 4AD2A 1EDGA 2PWHA 3NUKA 4RL3A 2DT3A 2WLYA 3BLKA 3WDJA 4OKDA 3PHAA 2BXZA 5AYBA 2EPMX 3VDBA 3VGGA 4LX4A 3VO0A 2CESA 5CGMA 1BVNP 5FL1A 1OIFA 3SUVA 3PZQA 1KFWA 4W7WA 2UY5A 2ZWYA 3PZNA 5F7UA 3HU7A 1JAEA 2DT1A 1R86A 3L4ZA 3MV01 4W5UA 1M01A 1M04A 1Q4NX 2A3CA 4N42A 2UY4A 1OM0A 8A3HA 3WF4A 1NM9A 3BAWA 3QOMA 4U2YA 1I75A 4KGJA 6TAAA 1JGIA 1KQYA 3VGDA 1AMYA 1TFVA 5DEZA 4D71A 2X2JA 3WY2A 3WH7A 1XH2A 5EMYA 4OOZA 5JBFA 1H0IA 2CNCA 1QHZA 2WYSA 4QCFA 2DH2A 3VSUA 2WMGA 2X0YA 3WMCA 1TE1A 2EACA 1UG6A 5BRPA 2O9OA 4PTXA 2VMFA 3HG4A 2E40A 1RP9A 3CZSA 4CD4A 4MPKA 4HTYA 1BLIA 4MJ4A 1FP8A 3THDA 4JFSA 3CZEA 4DO4A 1QNPA 4AD3A 1XHGA 3WBEA 4AEEA 3VINA 3MUAA 2QLYA 1U33A 1EDTA 3AIRA 2CXGA 3VUPA 1OIMA 4CUCA 3WY1A 1TMQA 1UHVA 1UH2A 2JF6A 3BLBA 7TAAA 2W67A 3AS1A 1IV8A 1PJ9A 1FFRA 4W88A 4ZEPA 5D9PA 3ZT6A 1J18A 3VDHA 2VI0A 1KTCA 3WDPP 1G1YA 3CPUA 4MAVA 4FLRA 3VD3A 4GQRA 1V6UA 3BVWA 2VZSA 2C7FA 1E0VA 3GXNA 3BSHA 3TTYA 3GNOA 2WAGA 2DDXA 2QHAA 3K8LA 2VQUA 2J4GA 1TUXA 3ARUA 4YPJA 1E0WA 3WFZA 3ALFA 3WNOA 2G3IA 3GH5A 4CCEA 1JYVA 4PN2A 1BPLB 2OWWA 1QBBA 3OIHA 3WUBA 4CVUA 1XYFA 1JNDA 4AZHA 4D6CA 1W1TA 1H0GA 2DH3A 2VRQA 2BY0A 2HVMA 3B9EA 2XM2A 1Z32X 2A3HA 1VEPA 4AW7A 3NSXA 4J3TA 1HVQA 4WSKA 2F18A 2E3ZA 1DWIM 3WD4A 1MXGA 3A4XA 4MNJA 2CYGA 1WZMA 2PF0A 1W9XA 3W4RA 1OT2A 4AZ7A 2WSKA 1MWOA 3BCFA 2PWDA 2E8ZA 3FNDA 4PTWA 4JIEA 1WDQA 1LG2A 1DEDA 1XD1A 3WDHA 1M7XA 5EFFA 3W53A 4UCFA 1J0YA 1GOOA 1QHOA 3VTRA 4AY1A 3WN6A 1K9FA 3UERA 1QPKA 4FNRA 1C8QA 1CXHA 3VSTA 1UD3A 4BCEA 4QAWA 3SCRA 3S5ZA 2VURA 3PBGA 1UZ1A 2Z1KA 5JUVA 3B8SA 1VAHA 3VIIA 2EQDA 3ZSSA 2WVVA 3VD5A 3DYOA 3CGTA 4PYSA 4JKLA 1W9DM 1KXHA 3DHPA 3K4DA 1QW8A 3UG3A 3D4YA 1S46A 2FHFA 3KLLA 4S3JA 4F9JA 1E4NA 3HG5A 5BXRA 1KR0A 4M82A 4JL2A 1ECEA 4D6IA 2ZICA 1H11A 1LG1A 1CGVA 2BVTA 3S6TA 2YL5A 4UTFA 1VFOA 3OGSA 1BF2A 5M17A 3AHTA 2Y8KA 3DYMA 4IUGA 4AISA 3T08A 2YIHA 3CO4A 1JZ3A 3UEQA 4HOZA 3CV5A 4H2CA 4NZCA 3VIOA 4JL1A 4WJXA 4GZEA 3RM4A 1XV8A 1E1EA 3PZIA 2FH8A 1PEZA 2DGAA 4F79A 1KTBA 4FNUA 1W3JA 1ZBVA 4B9ZA 3WUEA 2F1AA 1CXEA 3G6MA 4HMCA 3SIMA 2WMHA 4NZFA 3CZGA 3EDFA 3VDCA 1QX1A 2XN0A 2O9RA 3LPOA 3RO8A 3A6OA 5FD0A 5LA2A 5CLWA 4WK9A 4PCTA 2W66A 4UNIA 2EO7A 5BXTA 5CZKA 3ZJ7A 1FOBA 1UR8A 3EMCA 3CUIA 3VGEA 1F4HA 3VIHA 2GJRA 4J3VA 2EXOA 3SCUA 3NIYA 3FN9A 6A3HA 4ZFMA 5HPCA 1VFUA 4TVCA 1CTNA 3DC0A 4PUDA 2XGIA 3F5LA 2QV4A 1EOKA 3LMYA 3BMVA 3AI0A 3RDKA 2JEQA 4FF5A 2G8ZA 2ZXQA 5A8NA 1MQRA 2OSXA 1NARA 3IJ9A 1QWNA 3T0BA 5CGTA 1VFMA 3SUTA 1WO2A 2J25A 2J7GA 4UOJA 1EQCA 4W8LA 1BTCA 1OSEA 4BQ2A 3SEPA 4Q22A 1FFQA 1V6VA 3OLEA 2EPOA 3WNPA 4JFTA 2JALA 3AFBA 1UWQA 2NSXA 3WEMA 3VD7A 2F7QA 5M5DA 3AMKA 2QF8A 1ZL1A 4KWUA 3W82A 2C0HA 1HN1A 2F8QA 2XFFA 3GNPA 3MSDA 1GOWA 1LQ0A 4LYQA 3AXXA 3K46A 2GUYA 4PMOA 3ZMRA 3F5JA 3W26A 4D72A 1QW9A 5I2UA 1W9VA 2RGMA 3CHFA 4QLJA 1GQIA 1L0PA 4H04A 1UWUA 3VIFA 3EYPA 2A3AA 1C8XA 2WW5A 1XCXA 4GZIA 1X1NA 3MUIA 1JDDA 3BVVA 1DWGM 2D3LA 2CITA 2YBUA 4AZ5A 4M29A 3FHAA 5CSYA 1R7AA 1YQ2A 3TV8A 4J3XA 1XD0A 4GKLA 1SR0A 2EADA 1JZ8A 4KH2A 2J78A 1TCMA 7CGTA 5E0FA 2YL6A 1UUQA 4D6DA 2WPGA 5JIWA 1QVBA 1UH3A 4CGTA 4OBRA 2XIBA 3AXIA 1B31A 1ISXA 1SYTA 1VB9A 3N15A 1O6IA 2GJXA 2E8YA 2VCCA 1OCQA 3PTQA 4P7QA 1CLVA 1J0HA 3KWXA 5A2BA 1UWSA 1VEMA 2VJXA 1VBUA 3EBVA 5D8WA 4W8AA 4FNPA 4ATWA 3WQ4A 2J74A 1JZ2A 2XG9A 3WIJA 4UFIA 3L4VA 4ATDA 5A6LA 3SCSA 5HNNA 2X1IA 2G3MA 4W93A 4KRTA 1ZBKA 3GXMA 2QMJA 3SCTA 3WQVA 1JXKA 1QNQA 2IUZA 4TX8A 4MADA 4RE2A 1UD5A 4HOWA 4JFWA 3SUWA 5FCZA 1UKPA 3DYPA 1EIBA 4QLLA 1HF6A 2WM0A 2JF7A 4V28A 3M7SA 1UD2A 2EBNA 3WL0A 4BF7A 1QWUA 1ZJAA 2ZX6A 3BAXA 1K6AA 2DSUA 5D4YA 1PIGA 4D6JA 1JZ4A 3RPMA 4GI9A 3VNYA 4M80A 5A6KA 3MMUA 2F7PA 4TX6A 4TTGA 3AJ7A 1JYNA 3PZMA 3QHNA 2EAEA 3WUFA 4BA0A 3VIJA 2VX7A 2ZE0A 4U31A 2VZOA 3ARYA 4TTUA 1HL8A 1HJUA 1MVYA 1R7OA 2Y5EA 1MFUA 5A6JA 1FP9A 5EBAA 3VVGA 2V3GA 1SMDA 2ZX7A 1MQPA 3VIGA 3TA9A 4WKAA 1CGUA 4UFKA 4GINA 4M24A 2PC8A 4HMDA 2BY1A 1B30A 5JIPA 1O7DC 3ARZA 2IXVA 4DO6A 4BQ5A 1B3ZA 4YHGA 4QFUA 1JDCA 3WH6A 1WDSA 3GXPA 1R47A 3I3EA 5IHRA 1J0KA 3WELA 3AIUA 4EE9A 4HZ8A 4AD5A 1E4IA 3EMZA 3GH4A 2O9TA 1CGWA 4NXSA 5A8OA 4FK9A 2OW7A 5E09A 2Q8XA 3MI6A 1X6LA 5BRQA 4W8BA 1ZB5A 2CHOA 3AMLA 1UD4A 2WC7A 5A8QA 5AC5A 2TAAA 2OW6A 1E6RA 3H55A 1UH4A 3EJSA 2J77A 2WLZA 1QBAA 1WCGA 1GONA 3ARTA 3DDFA 4UZUA 4M1RA 1IZKA 3BVTA 2WVUA 1WZLA 2WMFA 1LF1A 2BFGA 5A8MA 5IFPA 1VRXA 3W6LA 3T09A 3SCQA 4LYPA 3MUY1 1MYRA 3A3HA 3WFLA 3CUJA 4P7OA 3OGVA 3PZGA 4MDPA 2VUYA 2VT0A 1OT1A 3DX3A 2WWDA 1PX4A 3CHDA 3MO4A 3GXFA 1UA7A 3CUHA 1QNOA 2D22A 2XVKA 2GSJA 2CBIA 4P8WA 2EEXA 1BYBA 1WNOA 3POCA 3WH5A 3GBDA 1K9EA 4AD0A 1VEOA 5DT7A 1GJUA 4JHZA 7A3HA 4JFVA 3WF2A 5C71A 3CZNA 2V3EA 2OWXA 1HKJA 1H4PA 1MFVA 1ZU8A 4GI8A 1GOMA 4WSJA 1H2JA 2QPSA 1CZ1A 3EDJA 3ZR5A 3PZVA 4HPHA 1KWGA 2WANA 1MW3A 4UR9A 1AQMA 4DWSC 5C8BB 3N17A 3ARWA 4PTVA 2WCSA 3WL1A 4FMVA 1ISVA 1F4AA 2F7OA 1E56A 1ZBCA 3A24A 3ARSA 3U57A 2ZUWA 2D23A 2Y4SA 5BCAA 4HU0A 4DWSD 4J27A 3IANA 1B1YA 2CHNA 3T0AA 1GQLA 1W2PA 1GJWA 1Q6FA 3WQ5A 3AZTA 5LA0A 2X2HA 4N0RA 2GDVA 2Y2WA 2JIWA 3CTTA 4RE3A 5E6ZA 2OYLA 2OYMA 5LA1A 1AVAA 3QR3A 1NOWA 2VO5A 2CIPA 2X0HA 1HKIA 5A94A 2GDUA 5DF0A 2OWCA 4P7RA 3GYCA 5D8ZA 1JNEA 4AEFA 3WENA 2ZUUA 2WZEA 3FHQA 2C8NA 3JUGA 4V2XA 4OZOA 3OB8A 4D6GA 2NT0A 2YJQA 4BQ3A 4NRRA 5BROA 1Q6CA 4ZXOA 3QOKA 1KBBA 2YL9A 4NXKA 1B0IA 1J0JA 3AIBA 3THCA 3WQ6A 3WDRA 1PIFA 4XB3A 3TOPA 2J47A 1HJWA 1MW2A 3SUSA 1UKQA 1Q6EA 4UOQA 2YDRA 1JXJA 4OIFA 4EK7A 3RIKA 3U7BA 5E0CA 3A4WA 3VU2A 1ISYA 4IM4A 5I0DA 4AZCB 5IXEA 1KGUA 1WZAA 1CGYA 1XSIA 4TUFA 4ZXLA 4Z2IA 1MXDA 1V6WA 4UOZA 3BUPA 2CBUA 3QHMA 5HXMA 3DX0A 4V27A 1EDQA 1BAGA 1Q6DA 4W7UA 5I24A 2DSWA 3WNLA 4MNKA 5AC4A 1W3LA 3I3DA 3VIPA 2A3EA 2GK1A 3NJ3A 2WMJA 1O7AA 3G6LA 2Y24A 2X09A 4B9YA 3B9AA 4Z2GA 2V3DA 3VX1A 1C7SA 1IT0A 5HOSA 1A3HA 5CG0A 5HBFA 4DUWA 3O9NA 1GOKA 3FY1A 1ODUA 4EAMA 3VM7A 4URIA 1HX0A 2XTKA 1V3MA 2D24A 2VVNA 3OBAA 2WHKA 2GJPA 1R33A 3LXCA 4HZ6A 4H7VA 4AIEA 2PB1A 1E6PA 3OLDA 1LL7A 3VX0A 3VMNA 4HPGA 3UR7A 1HJSA 3OLGA 5DT5A 1BG4A 1IZJA 2BXYA 4JFUA 2O9PA 3VPLA 5M3WA 3SUUA 4YN5A 2ZXBA 1GVYA 1DWJM 1CDGA 1GCYA 3T0DA 3BAYA 4DO5A 3BAKA 5CSUA 1MQQA 3N04A 1V3HA 1C91A 4TOQA 2GFTA 3HG2A 4CN4A 1J10A 3DX4A 1KCKA 3HJEA 3LXAA 1UR9A 1HVXA 2AOSA 2DT0A 4JAWA 4Y7EA 3A47A 1C92A 3VIKA 5D9OA 3N9KA 4KMQA 5A2AA 1HL9A 1V3IA 4H8UA 1RH9A 1QI0A 2XVLA 5EFDA 3CHEA 5DFAA 2EPNA 1V3LA 3EJPA 3AMDA 2VL4A 2JFEX 3OZPA 4TVUA 4MNMA 1QNSA 3AZRA 4PMDA 4MTVA 1BHGA 1H1NA 2VVSA 1E3XA 2OLHA 1R34A 3W27A 4J3WA 1FH9A 1PZ2A 1US3A 1NWSA 4P7LA 4WLCA 2VZUA 1HP5A 3GZAA 3L2MA 3WEZA 4OOUA 1I1WA 1SMAA 1LWHA 4E8CA 3A22A 2ZUVA 5JBEA 4AZCA 2D0GA 1PPIA 5KZ6A 1FHLA 2WMIB 1E3ZA 1QHPA 1GQKA 4XZBA 1E1FA 2OSYA 1CPUA 1VIWA 3BGAA 1WPCA 1EQPA 2YDQA 2FGLA 3UESA 3D3AA 3BH4A 1WZKA 3K8KA 1OD0A 4X0NA 1CXIA 4DWSB 3LRLA 3WY4A 2CETA 3WMBA 2WWCA 1CXFA 4KRUA 3NSMA 2VCAA 4B3KA 4DM1A 1CENA 4S3KA 5TD4A 3IJ7A 1WKYA 1V3JA 1HWWA 1KGXA 4LQ1A 1BYCA 3UCQA 2PI6A 4D1JA 1JL8A 2W91A 4PMNA 1R75A 1GZJA 2VX6A 5JBDA 2EPLX 4BQ4A 2E0PA 4WKHA 1CIUA 5CLTA 1FHDA 2PBOA 2XVPA 3NCOA 3VIMA 8CGTA 2BVDA 4JHOA 3F4VA 2AMGA 5IDIA 3GTNA 2VRJA 3ZJKA 2CPUA 3VD9A 1MW1A 5CPTA 2BHYA 4NX0A 4CU8A 1HTYA 1PBGA 3EJTA 2W61A 1VFFA 2Y8VA 2EABA 2CCRA 1ZBWA 1V0LA 3PZTA 4D1IA 4AD1A 2CBJA 2E9LA 4FNTA 3VMPA 3WF3A 1ISWA 3U5UA 1TVNA 5ABFB 1PZ3A 3IGUA 1XGZA 2FH6A 3VSVA 1B3YA 4R5EA 3UETA 3AXHA 3TONA 3PN8A 2NT1A 2ALWA 4XX6A 5A6SA 3AQUA 1E6ZA 1EHNA 3MS8A 3ALGA 2E9MA 3WUGA 1TQVA 3TP4A 3WNKA 2W5FA 2J7DA 2J8FA 1EO5A 1YHTA 4H41A 3ZM8A 1UKSA 3AIEA 4A3HA 4Z2LA 2WXDM 1NWRA 1TVPA 4CVWA 2NW0A 4OUEA 3ARRA 2ZX8A 1JG9A 3ZOAA 4MJ2A 3ZSTA 1J0IA 2ZUTA 3M6DA 5E6YA 1JF5A 1LLOA 5A6MA 1JDAA 1UR2A 3ARVA 1D7FA 3AIQA 1JZ5A 2G4FA 3N11A 1W1YA 3ZO9A 1NQ6A 4Z2KA 2JEPA 4ACZA 2ZXDA 1V03A 3CZJA 2XN1A 3W28A 1VJSA 4CD8A 3TTSA 4RE4A 1WE5A 4AWEA 4Z2JA 3M07A 1EA9C 1DWHM 3K1DA 1W9PA 1JAKA 1NP2A 3CHCA 2XWDA 2WNWA 3BXWA 4W89A 4CN1A 4LYRA 2PWFA 4BS0A 5IHSA 1WDRA 2WCAA 3OGRA 4M81A 1AQHA 1J11A 1V02E 4XV0A 4M8UA 9CGTA 4NI3A 3AYSA 2WC3A 4GO9A 2VTFA 4X0VA 4UFLA 1JIBA 1UD6A 5CPSA 3RILA 1K9TA 3BVUA 4UQ9A 2DSVA 3L2LA 4UQAA 1TA3A 3A4AA 1QNRA 1V6YA 3HN3A 3BC9A 1TG7A 4HMEA 2RGLA 4U33A 3CZ8A 6CGTA 2VQTA 3WD0A 2A3BA 4F8XA 1U30A 4M56A 4PRWA 2Z1SA 2DSZA 3WH8A 3MV11 1VBRA 2BV9A 3EJQA 1BYAA 1RPKA 5ABGA 1GOIA 1DWAM 1E4LA 1UQZA 3WDIA 3BLPX 3MU7A 4TVDA 4QDMA 3IAQA 2YL8A 3O6AA 1E5NA 4NZJA 2YDSA 1DTUA 4ZENA 1W9BM 4PMZA 2VR5A 1QI2A 3K8MA 2WK2A 4AIOA 2G3JA 3AZSA 4ACZB 3AOFA 3GXDA 1B9ZA 2QPUA 3CUGA 2J7CA 2J7EA 3RJXA 3ZT5A 4HA4A 3WD1A 4C7DA 2WVSA 2XPKA 3GNRA 1E40A 3WD2A 1GW1A 3WH9A 4AYGA 1SZNA 2WHJA 2PBGA 1E71M 4EKJA 1B3WA 4MNLA 1JYXA 4GZJA 3EDDA 1ISZA 5I5RA 2BS9A 1E5JA 4W86A 4W87A 4P7NA 1JD9A 3GXIA 3UR8A 1OGGA 5CQ1A 3T2OA 1UKTA 4GO8A 3ZT7A 1CXLA 1PX8A 2VX5A 1ZS2A 2UWFA 3TTOA 5BWFA 2YA0A 3WF1A 3F5KA 1UOKA 2WHMA 2BY2A 3CZLA 5BXPA 3EDKA 4IPNB 3AHYA 4OBSA 4P8XA 5A69A 3AS3A 1QI5A 2DPEA 3VGHA 1NOFA 1HJXA 3I3BA 2DEPA 3N18A 1W2VA 4OGZA 1HNYA 2V5DA 1EO7A 3VDAA 4PMYA 1HXKA 2J62A 1CGXA 1KXVA 1XCWA 2DQXA 4WF7A 4ACYA 4P8VA 4CU7A 1TQTA 1J12A 2XN2A 3IAPA 1FH8A 1G01A 2D20A 1C3FA 1CLXA 3WSUA 3QHOA 4GI6A 3OLIA 1GQJA 3BUIA 3VGFA 4AD4A 3S2CA 3CBWA 4IPLA 4DUVA 1J9YA 2DIEA 4FLSA 1GOQA 3N1AA 4HZ7A 4J3SA 3DX1A 1B3XA 2D0FA 1OGBA 1W91A 2CERA 3KL5A 4HA3A 4W5ZA 1LWJA 2F2HA 2X05A 3ZIZA 2D3NA 4AXNA 1KGWA 2ZUNA 2V38A 1KXQA 3KL0A 5A8PA 2GVYA 4D6FA 4MB3A 3S5YA 1TR1A 1GHSA 2QMKA 5GNYA 4DWSA 1E6SM 1G0CA 4KGLA 4H8VA 2B31A 3PZ9A 1E6XM 1W1VA 4AMWA 3AISA 3TTQA 5A1AA 2CKRA 3W24A 1KBKA 2WB5A 1M53A 1VJZA 1JZ6A 4H8HA 2JIEA 2DIJA 4A4AA 4BZYA 2O92A 2WZHA 4ZE4A 1V6XA 2UY2A 1W1PA 1UKOA 2XGBA 1BGGA 4E8DA 2XIIA 1V08A 3VMOA 2J7BA 3K4AA 2W4XA 3D50A 1UD8A 4PSRA 4MB5A 3GBEA 2YBTA 1PX3A 3W6MA 4E4PA 1TQWA 3UG5A 4B3LA 2X8RA 3AS2A 3IK2A 1JYWA 3L4WA 2D0HA 3CMGA 2YKKA 4Z2HA 1Y7VA 4QLKA 4CD6A 1E9LA 4UFJA 2VC9A 2WVTA 2ZIDA 1GUVA 3W29A 2E9BA 3AICA 3W25A 4PMQA 4HOXA 3KE0A 1ITCA 3D51A 1CNVA 3L4UA 5GNXA 2FYVA 4JZ5A 4YHEA 4UQCA 2XYLA 3A5VA 2ZUSA 4U5KA 4UZSA 3AYRA 3EDEA 2BHZA 3BUDA 1NWTA 3W0KA 3LPFA 1BYDA 1I1XA 4GPNA 1J0ZA 1WAWA 4MB4A 3ARXA 4W84A 1E70M 4AMCA 3BMWA 2VR4A 4UFMA 5CXPA 5I23A 3NDZA 5ABFA 4HA1A 3PZUA 2WBKA 1XH1A 2W62A 1DWFM 5HDRA 3LRMA 3WNMA 4LPCA 3SCOA 2F61A 1E6NA 1NWUA 1H49A 5FOOA 2D2OA 1R85A 2XSAA 1W32A 1GPFA 1WP6A 5E9AA 4XZWA 3WQWA 5A3HA 2AAAA 1VENA 3WDQA 2EJ1A 5I6SA 3BUQA 4ML4A 3CUFA 3VGBA 3OA5A 4CN6A 1R46A 4C7FA 3CLWA 4ATLA 3OZOA 3RMEA 3MSGA 4JKMA 2JE8A 4FNQA 2XHYA 3LX9A 1CGTA 2WCGA 3SCWA 4E2OA 4TXEA 4HU8A 5I3DA 1DP0A 1G9HA 2PWEA 2ESCA 5GQBA 4Q7NA 1MW0A 5A6BD 4HP5A 1QOXA 2VRKA 5DMYA 2VZVA 3CMJA 2YLAA 3O2LA 2YLLA 3AIVA 3WKZA 4J7RA 1BG9A 3RJYA 1TQUA 5LYRA 2W63A 4NSBA 2F1BA 4UQBA 3CIVA 4GXPA 4XUYA 3DX2A 4B16A 4AZIA 4B15A 1V0NA 5GNZA 1A47A 3WNNA 1E15A 2WSPA 4AZBA 1JZ7A 4DUXA 4AMXA 4F9DA 1L8NA 3D5HA 4DM2A 1DHKA 1PS3A 1HKMA 4ZE5A 2VCBA 2J7HA 1JF6A 3T2PA 1UYQA 3GH7A 2GK1B 4GQQA 1CYGA 2IGTA 4QP0A 1X6NA 1UQYA 1KWKA 1E6QM 2FHCA 3AMGA 3FW6A 4CD7A 1N82A 5M03A 3PZOA 5I79A 2XFYA 2W92A 3BUBA 1B90A 3U7VA 2HISA 1H41A 5E70A 1R87A 3LPGA 2YA1A 4W85A 5A6AA 4UQEA 3CH9A 2WZIA 4MB1A 1E55A 2J8GA 3LXBA 3FAXA 3BAJA 1UR4A 2XSBA 1C8YA 4NRSA 5A6BA 4D6EA 1PAMA 4PMXA 4FNSA 2BHUA 3MANA 5FKYA 3LPPA 2WMKA 3AHZA 4UFHA 1CBGA 3W37A 5AYIA 3D4ZA 1KB3A 3OG2A 5I77A 4LGXA 3RCNA 2XFRA 2FE0A 1UZ4A 4C7GA 2EPKX 1TA3B 2V3FA 4J3UA 3ZJ8A 2CEQA 3KZSA 3BCDA 3DDGA 1UA3A 3APGA 2XWEA 3AS0A 1C93A 1GHRA 3QGVA 3UG4A 4JKKA 1K9DA 2BVYA 2CKSA 1HJQA 2UY3A 4PMRA 4CKQA 2GJXB 5D9NA 4OJYA 1OGSA 4UQDA 1WDPA 5ABHA 1KR1A 3ZR6A 1BQCA 5DO8A 5A95A 2V5CA 3NYDA 2IXUA 1BVZA 1RD6A 1NOUA 4W7VA 1XSKA 2OYKA 3ZJ6A 1SFSA 3BSGA 3WF0A 1XC6A 2XM1A 1GORA 4CCCA 4CCDA 4PUEA 2FGZA 3DHUA 2CBVA 3VOCA 4WKFA 1KQZA 3EMQA 1W3HA 3ARQA 1D3CA 3W38A 1ZJBA 1EGZA 3B9DA 4U3CA 1W3KA 3ARPA 1KXTA 3L4YA 3SCVA 5A2CA 3PTMA 1UWRA 1V3KA 5D9MA 1Q6GA 1V0MA 2G3NA 4PTMA 3AROA 5AY7A 2ZUMA
chains in the Genus database with same CATH superfamily
4KPHL 1LL6A 1BVWA 1T0NB 3QIWC 4PVMA 3T0CA 3BAIA 3GGWA 3T3PF 1LP9F 5CF3A 3M44A 3EYFB 5HPOA 3UACA 2YPIA 4P8UA 4MAZA 4JDEA 3LRKA 4FMKA 5KAQF 1KTDA 2C4XA 3FRUB 3RVTD 5LNGA 3Q58A 4GIYA 4LVGA 2XZCH 3KLSA 1R3QA 2HCVA 2KI6A 3D39A 3SN0A 4PEEA 1ESWA 1ACYL 4IW4C 2PDKA 1G4TA 3DK2A 1NQBA 4HH8A 5IG7A 3SE9H 1M68A 2ZXAA 4PBGA 5DVNA 1P9MA 4M7LL 4I3GA 4DLFA 3B34A 3EF7A 4F57L 1FG2A 1S38A 1WA3A 4UT9L 5G1TA 3L5MA 1OWQA 4N2BA 1VF8A 4G1NA 2P5WE 5HDBF 1CBVL 1S2EA 3F7JA 4LRNH 3FU0A 2Y61A 3TBVA 5D1XD 4PMUA 3AY2A 3D25A 2QR0B 1N7MH 3B7RL 1XEUA 4YN3A 5IKCA 3QAQA 2EDEA 2Z7GA 4RE0A 3S1GA 4R5XA 3U9UA 1POJA 3QCVL 2XIMA 2VERN 3ZN6A 4IISA 4MGGA 1CEOA 1ENUA 4X63A 1Z0MA 2CGZA 3NOEA 3HQPA 1BIIB 3D52A 2BNJA 2OS7A 4JFXB 1JI1A 1L6GA 4YZWA 2KL6A 5B8CB 4Q8VA 5F6HJ 4BM7A 2NX5D 5D70H 1FE8L 2ZWZA 3HE6C 3QDAA 4Z42C 3SGJC 1YDYA 1RP8A 3VILA 3ARGC 3P2VA 1OBAA 5IFHH 4X4MA 1HT6A 3KL3A 3U7AA 2QUMA 4XX1G 3MZNA 4IGNA 1OP5K 5LNDA 1TVDA 1Z7JA 2IEPA 2NX1A 3QMRA 1AE6L 1CBVH 4UNVA 3REQA 4D2JA 1IKNC 1A02N 1LO2L 2MQCA 3GS7A 4XOAA 2F7IA 3KCPB 4YWGL 2XFWA 3GTTA 3IMVA 2QJNA 4G7VH 4X60A 1D5BB 4MDOA 3OG6B 1ECZA 4PTDA 1H3GA 2G0KA 1PKYA 4FHJA 5CLXA 4WR3A 2X2YA 4R90L 3U4BH 2HTKD 5JXEC 1FH7A 2QDDA 3ABQA 2PGRA 4NF7A 4HK3J 1KBJA 4XAYA 4PJXA 1U8PA 4JGNA 4MA1B 5D4IA 4NAQA 2V5JA 2A2QT 3MRKB 4MJHA 4ZW5A 4I3SL 1EOMA 1B3VA 2GSHA 2DT2A 2OT0A 5IFTA 4IBZA 1N6QH 4BFOA 1NPUA 4G71B 4IKLA 3WOVA 4XZMX 3RZWA 4GW4B 2Q10A 3VI3B 2MTAA 1YLVA 2QCFA 4QG9A 2GABA 4EANA 3ZE2E 4QGCA 3SADA 2EEBA 3WFEL 5DMGD 2IH1B 3LKRB 1DV7A 3QFWA 3SCPA 3P3TA 3ZZQA 4GFSA 3E49A 4HCIA 1TT6A 2ADFL 2WINA 4N2HA 4ZUVA 5JHAA 1BVOA 2YOCA 4QXIA 5DEGA 1FCQA 4Z23A 5B1KA 1XLFA 5E51A 5EU6B 4X9FA 4M8VA 5CUSL 1YCSA 3C60A 4OD1L 3SE4C 1ZA6B 3WBDA 2HAZA 2YFOA 4FLQA 1YKWA 5FIPA 4AIUA 3SY6A 3JBG7 1Y6MR 5J0BA 2J75A 2GVGA 4QDPA 4XWGH 1AD9B 3UMTA 1CWYA 1FWHC 4U3AA 1MEHA 1B4EA 5D7SH 4ZW3A 4B3VA 2E75C 4I2XE 4BA8A 3FCUB 4S1QL 4FX6M 5CC7A 1R3HB 3VD1A 1VZIA 3ZDWA 5D4QA 5FHBH 2XQBH 4GUIA 1FVPA 4XPTL 3U25A 3QMTA 4RV8A 1N7KA 4KWWA 4FA6A 1NANI 3FHEA 4NYLA 2A9DA 4B7IA 5BRZD 5MP6L 3DENA 3TYAA 1F97A 4LESA 4J5VA 2ZX9A 3A23A 4JVWA 4LCIH 1U5HA 1WB0A 3CFEB 4ZX5A 1MI5D 3S4SA 3QORC 5PAZA 4YO0A 5DD1L 4DJMA 4F91B 1FY6A 2B77A 2HG0A 3QPZA 1XH3B 2V68A 4U5IA 1EGJH 1MVUA 2EF9A 1YNLH 4H9YA 4XPTH 3TH2T 2K0RA 4TVSa 4MVAA 1I7RA 3VC5A 1CFQA 1ZHBB 2R82A 4NAEA 3U0HA 3KM1A 3LV3A 3NFPB 3NCXA 1V7AA 3ANYA 1EHAA 3K1KC 5I73C 3JU2A 3H54A 2YPVL 1K7FA 4MJMA 3WY3A 1GK8A 1UWTA 1PL9A 3BHBB 5D7SL 4N42A 3PXJA 4NZ5A 4XMXA 2ZX5A 4K8RL 5ABEA 4OV9A 5GVJA 1FYTB 2D1ZA 3W1PA 1XHHA 5HJYA 4O2FA 1HKKA 2WKGA 3GX9A 1E5UI 1X44A 1V8HA 3TU9A 4RFEA 4OCSH 4HXAL 4TPRH 3EGSB 3RUBL 1HXYB 2O30A 2NY2C 2DZXA 3GVRA 4XBJA 1H8LA 1ZVSA 5I8CA 3GM8A 4J3OG 1XJBA 2D4FA 1OB0A 1WFJA 1E9IA 4ECLA 1KIPA 4NQED 2H7WA 1FV1B 2FFCA 1QKZL 3N12A 1OF0A 1G5AA 5B38G 4WCJA 1CXKA 2ZCKL 2HS6A 4JDEB 2DQIH 2OMZB 1DVYA 4RSVA 4US6A 5BO1L 1NFIA 4X61A 3V0VA 3UO8B 4N0YL 2PYEA 4C91A 5ABGA 1OGTA 1HXJA 1XZ0B 2YMXH 5BMXA 1KB9J 2H6OA 3GDBA 1E0TA 2COQA 1IVLA 2IANB 4KV5E 2Q01A 4JTGA 5TQ0H 4HGWA 2OAAA 3GIPA 1UR0A 3BURA 4AMAA 4JX0A 1M03A 5AN7A 2VSKB 1KCRH 3EUUA 4HH9B 3BXNA 3B8IA 3M17A 3X13B 1A6UL 2DQFA 3N1FC 3VFMA 4KQ0A 2J6EL 1SPQA 3GDTA 2HB0A 4C6FA 4PRHA 5BYWA 3OSVA 4CD5A 3MMDA 1W9UA 1F58L 2PXYD 4LSPL 3B8DA 3PC0A 3ASOB 1H63A 2WQUA 5IQ9B 3FXYA 4HUMB 3L4XA 1DQDL 1LJYA 1Q65A 3GMRA 4YQXL 1EVTC 2FWLB 5ISZD 2INFA 1FPTL 2XVGA 3ONCA 2JJUA 1Z7AA 4HIIA 4JS3A 5EEXA 2PDLA 3WL9A 3WQEA 1I9IH 1YYMH 2AJUL 1J9CT 4RMQA 4HALA 1TWSA 3L3IA 3JTSA 5EOCH 1SXAA 3QJZA 4ILDA 1YEFH 4IL2A 4Q8BA 4G8AC 4L8SC 3NEXA 4ZXBC 3H24A 2BS8A 2EDTA 3BLKA 3LV3B 1D5MA 4W70A 5F7LB 2Q8AL 4WUUD 5I3GA 4YHNA 3DRTB 4MAUH 3PHAA 2BXZA 2F15A 1OAKL 3ZKQD 2CESA 4UQ2A 5CGMA 3MRGB 2V17H 4NOFA 3P9LA 4HHMA 3VCNA 4GJJA 2WZ0A 2AQQA 2WBJD 3SUVA 4JX4A 1N8OE 1W0WB 3EFFA 4ERSL 3FKKA 4DO7A 2KLSA 5AVRB 3X1GA 2QSVA 2CLOA 2OZ4L 1MCOH 1HCVA 2OMVB 3OAYK 4K07A 4MD0A 5DD6A 3VTAA 1M01A 2A3CA 4UTJA 4Y8EA 4K3GA 5FF3A 3QZPA 3RFZC 2UY4A 3IE4A 2VO8A 4XP9L 1FZMA 1CT8A 1NPNA 2PW2A 1BVKA 4UZGA 3HQNA 3OJVC 2BVQB 4EIZC 2EE9A 2GIYA 3N29A 3OO2A 4R9XA 3WXVL 5KVDL 4F2EA 3O1NA 3A67L 2ZZ3A 3KHOA 2VN3A 3T8QA 4M93B 5C9ZA 3QOMA 1A0QL 2OCZA 3NJVA 2A1YA 1I75A 4KGJA 1OOAA 3RGVB 3GUTB 4WI0A 5JIMA 4XI5C 2YPLB 4R7NA 3VGDA 3DJSA 3AQYA 5FGBC 2OB3A 1R3IL 3BVDB 3HTLX 4YBHA 4GVGA 3GSOA 2VXTL 1MFDH 2RB8A 3LKSA 3O9WD 2X2JA 4E9LA 3QO0A 3FA5A 3N4EA 4GY7A 1BAFL 2X16A 3DAQA 3OAZK 4XNMA 4S38A 4DFIA 4GT7A 4PCNA 3BH9A 3GI8L 4LLQB 5D1QE 1K8DB 3W56A 1T20A 3ZRSA 3U4EB 5BZDB 1QHZA 5FYLE 3TH3T 3QN3A 5D7JC 4JXCA 6TIMA 1S7RB 5GGRB 1AKJB 4OQ1A 4P9HL 4XPGL 4XWGL 1AC6A 2X0YA 3MA9H 3WMCA 5ID0B 1VGEL 4PTXA 2X4UA 1BAFH 3HG4A 1CD1B 3G5XA 1UXSB 2DQHL 3N50A 2HRHA 3STBA 1SW7A 4Q8MA 2PA6A 1RZJL 1BLIA 3HE7B 2Y2YA 3DXAA 4Z78B 4N1HB 1FP8A 3GMQB 3KZPA 3G9AB 4DO4A 1JPEA 5I28A 1NICA 2QUNA 4HNLA 1ET7A 4NBXB 3RTQA 1F42A 1J5OH 4G8IA 4A2EA 1AY1L 3MLWL 1TJHH 1ZIAA 2V9RA 4PJIB 4KCWA 5ECJE 5D7IE 1QFHA 3MUAA 3LKOB 43CAA 5IB2A 1TG8A 3N3EA 1RERA 2JK5B 2SEBA 3C3UA 4LVFA 3AIRA 1XL9A 5FEPA 4R8WL 4PJ8C 5FFOA 2WMPB 1C16B 1G69A 1AQFA 1OIMA 1UH2A 4PY8I 4K94C 2I5YL 4GX8A 3QNZA 3DFOA 3TBVB 5ECGA 2QEJA 1NUDA 1L0QA 4YSDA 3VDHA 3FQUB 1KTCA 2BNRB 3GYEA 3QC0A 3CPUA 1MLCA 1I4FB 2C18A 3BX7C 4PI2A 3VD3A 4NHUB 4DFHA 2X9WA 3V6BR 1UBSA 3NQ2A 4DN4L 2R4RH 3BVWA 2JELH 5KVEL 2EUWA 3GM0A 1V6UA 3U9IA 3C86A 5F6HI 1VCGA 5AVNA 2ZUXA 4TULL 3BSHA 3GNOA 1AG1O 3C2YA 4TNVF 4N2NA 3BDYL 1SJEB 2OK0H 4U0RB 2YUVA 3GO2A 3PUCA 2CO3A 4KRPC 3JWNH 5B7MA 4L1SA 3MB9A 2IDCA 1FZJB 4OI9A 3QDJE 1A66A 1E9PB 2XX1A 3O6KL 1J05B 1FIGL 4HIHA 1TUXA 1GZHA 4G6AC 3WFZA 3LCYA 3B9KA 5A3ID 3VDGA 3FRUA 3QJFA 5C9XA 5HDBB 4APQA 3T8LA 3QDGB 2OL3H 3E6FB 4PN2A 4YXHL 1ZXQA 5C0EA 1ML0A 2C9SA 2ATKB 4F7CB 5EBGA 1J9RA 3IDGA 3E2HC 5IMMA 3L0GA 4JO1L 3NFSH 3KVLA 3NOYA 2NDGA 1L3NA 2I24N 4Q7BA 5BXFB 3LEXA 4FYSA 3GLEA 3P40A 3FYIB 4IGMA 3VE9A 5E6SB 4FC3E 2E7BA 1W1TA 1EEZA 4Z7UA 4KFNA 3VFUA 4M7JL 3SPGA 1TLKA 1QR1A 2XH7A 4J2MA 3W86A 5I1HL 2XM2A 3NVQA 4XHJD 4IT1A 2PZ0A 3T4WA 2VHLA 3L9BA 1LYQA 4HHWA 4LOUD 4GBXC 4CDHA 1E5CA 1KJ2A 3WQOA 2F18A 3CX5K 4HMNA 1KBIA 4QXTB 2E3ZA 1DWIM 1RZ7H 4YAQB 4RMWA 3WIFB 3R2GA 1RCYA 1VGAA 3Q44A 2I14A 4F0RA 4RBPH 4U3SA 1RXLA 2VE6B 3WG7B 1WZMA 2YN5A 4ZOAA 3K6SB 2PF0A 3NQGA 4LB4A 3BKMH 1CFTA 2DQJH 4JZJB 4Z8FL 2QYGA 4Z1DA 3H9HA 2ZZ7A 4GG6F 1MWOA 4UYPA 4L4VA 5MENE 4LUTB 1PD6A 1Z2KA 2E8ZA 3VFVA 1XGUA 5JPNC 2BODX 2HN7A 4BCYA 1LG2A 3E9TA 2YK1H 1DEDA 2BHFA 2JKPA 5T1KA 2GHZA 1FSKC 2EE2A 1RURH 3MRCB 3QIUC 4MDIA 3WDHA 1WUEA 3W53A 2ZYRA 1M1BA 2EH8L 3QQXA 2VGGA 2CKBL 1NKGA 2CLRA 4FZ8H 4JRXE 3VTRA 1REQB 5F4SA 3VAVA 2HSIA 4PJ6A 5EV7A 1NBVH 4GK8A 5ESVB 4TV5A 1QPKA 2DM2A 1GGIL 2Y69B 2VYOA 5GJTH 3UP1A 1VHNA 1UD3A 1QBML 1DQML 1PLCA 3L3GB 2W3ZA 4PJDF 2VURA 3DUSA 1ZCRA 4X7TA 3VC6A 1JWUA 1NSNH 1RHHB 2Z1KA 1EFXB 5IROC 4F9PC 5JPMA 2J1WA 1BREA 1WRFA 2R0ZH 5EO9B 3C2AH 1EF2A 2QJHA 3G1DA 1PD1A 4GIRA 1KIRA 4K94L 2ARJB 1TWZA 2A9ML 3VI4B 3UZYA 1OQOA 4OM0L 2CU9A 4H1LH 3VIIA 4ISVA 3NZUA 4JY6A 2BVWA 3C09B 3CN2A 5D72L 4C1NB 1JERA 5AYQA 5KBNC 5HY9B 4FEIA 2AL2A 3CGTA 4QS6A 1FNSH 3DHPA 4F58L 1XF5A 3UG3A 5IR1B 5J3HC 1ZOXA 3SDDD 3KLLA 2FHFA 5IQ7H 1FYTE 4PBDA 1LLZA 2RACA 1Q9LA 1E4NA 3I4KA 4UV7L 5BXRA 1KR0A 4CA4A 1S7SB 2X53A 2HFEB 4AENB 3O6MH 3D69A 2H41A 4D6IA 3QC6X 2MKWA 3MRQA 4AIXA 1DVJA 2FUTA 4PR4A 3QV9A 1VFOA 3ABKB 3U7YL 1AO7B 1XXDC 2YD0A 5I82A 3ZL4L 4KITB 4MCZB 1EXGA 2HDJA 1DO6A 3DYMA 1TZIB 2Y8KA 3TN4A 4AISA 2YIHA 5IFJA 2J66A 5B4MC 3TZVA 3N0AA 4HOZA 1GVQA 4Q6YA 1PDYA 5B7FA 1WXZA 3BUYB 1R5IB 1BGGA 4P4KD 3VWJC 3ATYA 2XJLA 3TMQA 1TNNA 3LKOA 4QHMB 2IANE 3BW3A 3FPYA 2W0UA 4WJXA 3GYRA 3NPZB 4GZEA 1XV8A 3PZIA 4ZMGA 2MHAB 3LMJH 5C08D 1KTBA 4LLMB 4OTKA 2YEZB 2X89D 8XIAA 5JOFA 5F7WC 3QYSA 1FFNB 3TO4A 1FLRL 4FNUA 3REQB 2G30A 3IFPB 2WGXA 4B9ZA 1I0DA 2Y7SA 4BEIA 2W38A 4E9TA 1CXEA 1OLZA 2DJMA 4YXKH 4IPJA 4P5TD 4AF0B 4AV5A 3CAWA 1R17A 5C0BD 3BKYL 1ASPA 1OT4A 2Q6WA 3RUGA 2P8MA 4XN9A 1RULH 2P43B 1A6WH 5AOUA 3P54A 1OQXA 2F5AH 3Q9PA 1ID2A 5I8KL 3L3OA 2OXHA 4JN2B 3UFYA 2XN0A 4DI9A 3LPOA 3EX6A 5EO9A 5LA2A 5CZXD 4BFEA 1I1FB 5C07A 1S5HB 1NDYA 4WK9A 2EVHA 5C0AA 4PCTA 4ALAC 1P5BA 4HT1H 3GSOB 4UNIA 1XCTB 2C3GA 4N4YB 4W9IC 5KITA 3V6OA 4X6DA 5EN2A 2EO7A 1PKNA 3D25B 5CZKA 3FKRA 3UY8A 2DYSB 1XINA 3EMCA 2BP0B 5T8IA 3VGEA 4IZGA 1OAXL 2ROXA 3UAEA 1RIVH 2B1AL 5B3JE 1GZ1A 1XR9B 3C4UA 4F2TA 4LCCC 4I7VA 1MZYA 1QSEB 1MIMH 4XNQA 2BDNH 2PR4L 4L5FL 4YBQD 2DYPA 3RAJL 5HHXH 1TPH1 4R9HA 1A7RL 1M1XB 4NN7B 2NY7H 3OYZA 3W71A 5HPCA 3RX2A 4JFHE 4Y89A 3WU1A 2QQKL 4KXCA 4E41E 3DC0A 3HR5A 1CMOA 4ZO7A 2EXWC 3UBPC 4TLUA 4WO0A 4Y8FA 1NUNB 1EOKA 3HCVB 1OLLA 2VABB 3J27A 3AI0A 3CPRA 1JGVL 4WVRA 2JEQA 2PCQA 4FF5A 3DBPA 3FN3A 1IFHL 1O5RA 4W9JC 1YSOA 1W72B 3DI2B 4L8CB 1ZHKB 3IGXA 5TDOB 2OSXA 4Y2DA 3A3WA 3V0UA 4UNUA 4HKZB 2A6DB 2CMRH 1I8AA 5J8LA 2N1KA 4KTYA 5T1JA 1TIWA 1UATA 2OZ4A 2OVLA 7FABL 4H7CA 2G97A 1MCRA 1X5HA 1QA9B 1MJUL 2I85A 4Z7QB 2PE4A 3IRCA 2XWTA 4LC6A 1YDPA 2WZ6A 2H3NB 3V5HB 2J7GA 3AGWA 3NTYA 1OPGH 4UOJA 1G7IB 3IM1A 4W8LA 2Z92A 3RRQA 4BQ2A 4PCPA 3SDAC 4M1GH 3BHBA 1UJTA 3HZMB 1FFQA 5F21B 1AP2B 1IM9A 3C6LC 1JDFA 1KLZA 2DQGH 3FT4B 1IXPA 1R6WA 3OLEA 1LRQA 2TODA 2EPOA 1N10A 3NIDB 1INQB 2NY0C 3WNPA 4YX2H 2APVA 2ICEC 4FFTA 3STZA 4JRYE 5HJDA 1IU1A 4FHAA 1T20B 1ZMYA 2D7OA 4POCA 3OGOE 4TV6A 4UIKH 3MUJA 1LLWA 3MI2A 4M7ZB 3KBEA 4DBDA 4YLCA 1XDMA 2FX7L 4L8DB 5EO1A 3PP3H 2F8VA 2QKSA 3CFJB 1F45A 5KVGL 4E41A 3VD7A 5HHQA 3RPKA 3P0VH 2ADJB 2F7QA 5M5DA 3AMKA 1WUFA 3AXLB 1RLWA 1U4FA 3HS0A 2LU7A 4JTJA 5BZZA 3C5ZB 2PDJA 4ONGL 4KKBD 3GMPB 3BESR 3GBNH 8PAZA 2F8QA 3GNPA 2XFFA 3MSDA 4Y9AA 1GG0A 5IVNA 4D8LA 3QDJD 2XVBA 5EF1A 3WHXA 1QTWA 1LQ0A 5IB5A 4BH8B 2BVQA 4LYQA 1CE6B 3FH7A 5TF1L 1ZT4A 4G7YL 4H8WH 4WEBL 4XWOD 3MRHB 5B8CC 1R0AH 1WV2A 2ZQ0A 5B38B 4LOVA 1N7ML 2QCCA 2WMPA 4PMOA 4DEFA 2DDQH 3ZMRA 4E4FA 4NJ9L 3TJIA 5F3HA 4PY8J 4EN2A 4NNXA 1GA2A 5ECVA 2OEMA 3F65A 1EDHA 2AEPH 3NN8A 2OKTA 4CNTA 3HHSA 1FCVA 3MUHL 1L6YA 3USBA 3TLLA 3ICJA 1A21A 4P2OD 1V5XA 1EZSA 1UWUA 2WQVA 2X40A 3FJLA 1BECA 3KD4A 3DHMA 1TQJA 3OR7A 5DMGC 1WV7T 1OD9A 1Q9WA 3N06B 1XEDA 5F1IB 1NC2B 1X7SA 4WK4B 3B5TA 5FECA 1X1NA 3PWJB 1MRCH 2DQTL 4I2XB 2CLKA 3WFDL 1VD6A 4S2BA 4H9VA 4LS2A 4DJDA 4NQTA 4Q52A 5DHYA 2PCXA 2N0MA 2JKNA 3KPNB 4PVNA 4HXBH 2MQGA 3HLKA 5F7DB 4Q4PA 5DZAA 4EVZA 2XYBA 4TLTA 1JPST 1F13A 1CQKA 3N55A 4PRPD 2J9XA 4C6QA 1FI8C 4QIRA 3B8VA 1Z9SA 4PJ5A 1AK5A 1ETA1 4X9BA 4J3ZA 2Y25A 3HB3D 3IFLH 5DD5H 5EHFA 2W59A 3ISRA 2GJNA 1YQ2A 3FK4A 1ADQA 5I0WA 4BCXA 4N2IA 4JKPL 2AJSL 3HFYA 3DFQA 1HL4A 3QULA 3QPQC 1DUYB 4GKLA 3BUTA 1P7QD 4LEEA 2J78A 2WLIA 1IBDA 3KGRA 2YL6A 3LS5H 4OU3A 4UC5A 4OCWL 2J3SA 3R94A 4C54A 4JN2A 3LZQA 3VXUD 1FC1A 5D5ME 2OODA 5CMAB 2RAGA 3Q5TA 4S3DA 1YNPA 3QDHA 3AXIA 1LE9A 3M0IA 2X1QA 3QUYA 3E5PA 2Y5SA 2H5UA 3VFMB 5DEFA 1OTTC 3AREB 1I7ZA 4L3CA 3U82B 4F1ZA 3HHRB 4KK6D 1FRBA 1FWTA 2YPKA 1J0HA 1OAUL 4F0HA 1D5XA 3LIZL 1EHLL 5A2BA 1RL1A 3E0GA 4OAWB 3ULUE 4LRSA 2ARJQ 1LWRA 1UB5A 4YNYA 2VKXA 1YRRA 1RZKL 6A3HA 4JKWA 1UA6L 2BG5A 2AV7B 1P0NA 3O0RH 4W9CC 1QT1A 2KLRA 4PV1C 3BPOC 2DQTH 4O2EA 2WAQA 4RRPA 1MAKA 1OAQH 1Q6LA 1EJSC 1SYVB 1WDDA 4UFIA 2P0IA 4NNXB 1OTUC 2ZF9A 1PYWA 3SE8L 1LBFA 3TYCA 1NCBL 3L4VA 4GSXA 4HJ0D 4NUGL 2W95A 4WNQB 5A6LA 1BSLA 1QPQA 5HVGB 4WVXA 4ATDA 4UTWC 3SKNB 4YSEA 2D03H 2VC7A 2X1IA 2G3MA 3PWAA 1WA2X 3GXMA 3SCTA 3T4CA 3WQVA 3LG3A 1RK0B 3UZ5A 1G6RH 4HZAA 1W5MA 4LU5L 2PD5A 2PTTB 3N0PB 2J2ZB 3OKDA 3H4GA 5FCZA 4RE2A 1AHWC 1LO5B 5B7EA 3RKDD 1GOHA 3IPWA 1GW9A 4G7YH 1WCBA 5TGBB 4JM0A 5IBLC 5TF1H 3DXAE 1HF6A 4IS6A 5HI5D 4JTDA 5LIUX 2WP3O 3P0VL 4X8XA 3HRZC 1F6LL 3TZNA 3WL0A 3TH6A 3G08A 3ETTA 3ZMNA 2ZX6A 1EP3A 9XIMA 1JTOA 2HT4D 5D4YA 1F11A 3H4WA 3HG1B 4GQGA 2XWTB 5C92A 2JIXD 1ILSA 3U2SA 5IEKB 4YLQT 1DOSA 1NDGA 5H35A 5A6KA 1YY8B 4B5XA 2BOLA 2VYRE 5T3XL 2J5LC 2F7PA 4M48H 5CZXC 3CMFA 3ZW3A 3XIMA 4HCRH 1D6VH 3QUKA 4B0MM 2OJEA 4G9PA 2DZUA 3QHNA 3HKZA 1HO1A 3WUFA 5SX4H 3UWUA 5JNYA 1LJMA 2F54B 1JK9A 1YYLL 3M88A 4IRSC 4YDLC 4CVXB 5ITBL 3N4FA 3NPVA 2C1IA 2VX7A 1P1ZB 2ZE0A 1YEJH 4N22A 2IWGA 3RIAF 3MO1A 2EUZA 1EIXA 4Q8UA 2Z7UA 3SDOA 3Q65A 3HN8A 4S2SB 2XRAL 4L8DA 2BNUA 3UJJH 4EDXA 1X5GA 4H88L 3OODA 2WWOA 2ARWA 3DPBB 3GSWA 3NG5A 4KK8C 5G2HA 2PDXA 1YYLH 3P14A 3ZHDA 3VIGA 5CJXC 3RVXD 3D3VA 4V1DA 2OMBA 3HRPA 1XT5A 3WLIA 3GLDA 4YK4C 5HVWA 5G5IA 3TA9A 4UB0H 5DUBB 5DELA 2IKJA 3IDNA 2OMUB 5FFLA 4UFKA 4KNUA 2PC8A 2ADIA 3D2UA 3QEQD 4I6KA 3MFFA 2I5GA 2BY1A 1TTCA 4GBXD 5JIPA 3WJYA 2Q2EB 3CLFH 2Z7WA 1O7DC 1A5CA 2P48B 1X5LA 4YDNA 2MPAL 2V2TB 4MY9A 5C0BA 1DQIA 4FQLL 5ANMB 2HS8A 5C0IA 4GCAA 5DFWH 1B3ZA 1XF0A 4HCDA 2NR6C 4BZ2H 1JDCA 2JB6B 4AC7C 3DV4A 5I07A 1CDUA 2F53B 2C15A 3NCCB 4L8SA 4ZXBA 4PWKA 5FYJU 3V0GA 3WO4B 3QO1B 1Y07A 2XV3A 4JTUA 3EGJA 4PB4A 4WZHA 2ZADA 4GXMA 3IDYB 5DHMC 3WELA 3AIUA 3QSRA 3IU4L 4EE9A 5MKGA 5CD3A 3EMZA 3DJ9A 1KG0A 3PP4H 1XL4A 5JW3H 2O9TA 5D2TA 1MUJA 3NT0A 1FO0A 1A3ZA 3RI5F 4W68A 4UWQB 5E09A 2Q8XA 4XNUH 2Z6FA 1AZCA 4POUB 5LQBL 3A5FA 3DO3A 4H9MA 2R9HC 4WGWB 3B1UA 1PDKA 3QZBA 5IROD 1ZB5A 2CW6A 1QYGL 2FBRA 1JNNH 4NO0D 2AS5M 2R0KH 1IEAB 2PABA 3AMLA 3GDKA 5LBGA 4ABWA 2WC7A 1WBYB 5I8CB 4GZ7A 5AC5A 4PEKA 1MNUH 1TVHA 2JCCB 2TAAA 2BIMA 1TUPA 1YE6A 3MO1B 3B8TA 4OZFH 1E6RA 5EMMA 4P49A 5BOEA 5D7IB 3CHRA 1LOLA 3EJSA 4ZUWA 4RDVA 4YXLL 3WLPA 2CK0H 3FUKA 4NJGA 2FO8A 3R12A 4DGIH 4HHAA 1WCGA 2VDLH 3OZLA 1DJGA 4XWOC 4IOIA 4PRPE 4WWKA 3RWGA 3AWFA 5KS9B 3CWHA 5IHSA 2ITDA 1EKOA 3GK8H 3VFOB 1YX1A 1IZKA 2PS2A 1SLXA 4GISA 2WVUA 2AGJH 2WMFA 3NZQA 4F33B 3WMLA 1Y1DA 1UUNA 4MZ8A 7XIMA 3BT0A 4F93B 6REQB 4WWPA 1PZ1A 3W6LA 2BP3A 1HDMA 3ILQC 3T09A 2FWUA 2IGFH 3MKGA 4AQEA 1W3IA 1MYRA 4I48A 4LYPA 3TFCA 1JVOA 2CK2A 4MLIA 3A3HA 3MRFA 4NCC2 1S3HA 4OGXH 4PUMA 4LVOC 2ZCLL 5H94B 1JZDC 3IS1X 2X42A 3ZL4H 4MDPA 1DL7L 2OKOA 2VUYA 1QFWI 3IMRA 4GOSA 4IRZL 3IXAA 4F8TA 3SKMB 3AVEA 2EDJA 5IESH 3WFAA 4L4TD 2HQAA 1YEGL 1XO8A 3UTPD 1GG1A 1IEBA 3MO4A 3GXFA 1AH4A 1BFOB 1PZ0A 3L68A 4CNUA 4MMZC 1A3LL 4N2DA 5F1OB 2CBIA 1E7VA 3BYTA 4IP5A 3LHPL 3FO9A 5B3JF 3PJUA 4LLQA 3KXFB 5EO0A 1BYBA 5D7LE 3URBA 4XP9H 3DOSA 1WNOA 4N90E 4RV3A 1SN0A 3DUHA 3WH5A 4HHGA 4E2DA 2BZDA 2I7GA 4LAQL 4UNKA 2NUPA 2F2KA 2NX3A 1KNOA 4Y19B 4KO6A 5DT7A 2VMCA 5ABZA 1OF6A 3RLVA 3GSNA 2KPNA 1GJUA 3WLKX 3LV5A 2G0LA 1YW1A 4JPIB 3UYPB 4ZI8A 7A3HA 5I3JA 1DE4B 3URAA 4AEOA 1OE3A 4WDXA 4PCFA 2AQPA 3C75A 4G2AA 4WFGE 2OWXA 4X5XB 2EINB 1LEIB 1I8MA 1RZGB 1PYMA 1AO7E 3BIKB 4MLSA 1BYPA 3UZWA 3VI4A 2A83A 2EC9T 1G43A 4MS6A 4PYHA 1XXXA 3T6VA 4C5ZA 1AZZC 3KYKL 1FZMB 1MFVA 4IMKC 2DKUA 3UYOD 4CGUB 1H4PA 2C91A 4GC3A 4RPQA 5C0FB 4HGWB 4G9FB 1UJ3C 4EXPX 5L6YL 1H2JA 1LGVA 4W1TA 3TA3D 4Z0JA 1E4WH 3NH7H 1HH6B 3LS4H 4QHKI 3UNDA 4YHZL 4EBQL 2HG5B 4HPHA 1ZY9A 4ANXA 3RHWF 3PDOA 1VS1A 3CIXA 5HANA 3QG6B 4HS8L 3W0WB 2IAAC 3ELFA 1W5NA 4O0QA 4UR9A 4MXQD 1S5HA 2FZMA 4PJBB 5L9FA 2AK1H 2P42B 3BWAB 3H2EA 3I6LE 2CAKA 4DWSC 1C12A 5KTEL 4Z7VA 1AC0A 1I82A 4FMFA 4DXXA 4LF3A 5C2BL 2OCCB 1K6QH 2NX5E 2WCSA 3OU8A 3PBMA 4H9XA 4FMVA 3F64A 5CINH 5H37G 2YMTA 1GYCA 1Z9LA 2COVD 1U2HA 3BN9D 2Y2TA 3PPHA 3A24A 5J6HA 3LNIA 1GQNA 1SJEA 2DBLH 4UTAL 4KHTL 5IBLD 3ATEA 2DM7A 1AGCA 1XG3A 3NIFF 1LRNA 1JTTA 1DJZA 4MSWB 3ARDB 4V33A 5CSRA 2WZ5A 5TGBA 3GIVA 1PWMA 2C9VA 2FLIA 4E38A 2POTA 3QBUA 3WI9A 1EA0A 4G70B 2E6DA 5IF0B 1E8XA 3LI1A 3HMXA 4CMMA 1GJWA 5K7JA 3WQ5A 1ZANH 4U1LB 4KESA 2HVBA 4QT5A 4ANWA 3AZTA 4DAFA 1A4KB 1BFSA 2X2HA 3L3HB 3Q2VA 3KJ4C 2E74C 4EXKA 3O8XA 2JIWA 1MJ7H 1JCYA 2M83A 3CV1A 1MJJA 3BW9B 4U1GB 5DT1L 2X0HA 4KZDH 2JELL 4MAYC 4PLJC 4WI7A 4Y2DB 2V8LA 2WKOA 5I66A 1HKIA 5AWNH 4WDIB 3AUVA 4P7RA 5DMKB 1BFOA 1DZBA 5IVXA 1USQA 1I9RH 4P46D 3FHQA 3T6CA 4CJ0A 3B6SA 4OZOA 3QNZB 5KJ4A 2NT0A 3REVA 2ZTKA 3B43A 4BFRA 4DN4H 5JORA 5BROA 3EOYG 3E0IA 2FJHB 2XIJA 3H2PA 3BZEA 3QUMB 3TBTB 1XYMA 5FJJA 4DPBX 3BWUC 4I9WE 3QOKA 1K8CA 4MNGA 3CSTA 4NXKA 4OR1A 4UQ3B 1B0IA 1OSPL 4PB0L 4Z1YA 2Z8VC 2Q3RA 1X5JA 4XB3A 4QX4A 1CU4H 5A6JA 3NJIA 2GQHA 1A53A 4D8PA 4BSWB 4DZIA 4XAKD 3SUSA 4IFKB 2V69A 1GVOA 3INPA 3OSKA 4EK7A 3LSOA 3GD6A 2GKIA 1VBHA 1K8IA 5DQ9A 3MPCA 4HX1A 4JRXB 3ARFD 4LSVH 3WLMA 3V55A 3HPXA 5EU9A 3W11D 4WEMB 2NZLA 1XSIA 4X5RA 4X99B 3FB8B 1FA4A 1BJ8A 3LHZA 2H32H 4CL7A 3IDUA 4KQ4H 4MZ3A 1V6WA 4NU7A 3DA0A 4A2RA 4OF7A 1KF9B 2A9NH 5CEYA 4YHPA 2GK2A 2UWEE 4Z7QE 3QHMA 1DBJL 4QAMB 1X5KA 3VQMA 2HE8A 3IGAA 1NFAA 1Z5YD 3MODL 5F0LB 2YLKA 3CDGA 2JF1A 5JO5B 1EGVA 4XKMA 3QEHB 5KSBF 5FXCH 3X1NA 4W7UA 1DVFD 1QJWA 4MZIA 2DSWA 4AI7A 4LNCA 2VDKB 1YAIA 1HHJA 2VR6A 2WOBA 2Q86B 1W3LA 3C8DA 2YO3A 4LV9A 3EXLA 3U7YH 3UT0A 4X6FB 3VIPA 3F04A 4FABL 3TBSA 2Z8SA 2ZXEB 1MDLA 3RFZA 2YDAA 5B21A 3B0PA 2WMJA 5DXYA 4M7TA 4GS7B 3PJSA 4P5TB 3VX1A 2Y22A 3SO7A 3R10A 5FUCC 1IR1A 2Q1EA 4LV4A 1JEZA 4PFMA 3KDMB 5DK2A 4ICCX 4MJJA 3HMXL 3MLXL 4LVHB 4ZYKB 1XUZA 1GYVA 5CG0A 1A3RH 4R97C 4NJAL 4TVPL 1O6VA 3GRGA 3VGAB 3QUZB 2ZRWA 1AD1A 1ODUA 3PAVA 4IOFD 4MWAC 4EAMA 3MLRL 3ELAT 3B7YA 5D1ZA 3S88L 1ICSA 2DI7A 2MFNA 1WWWX 1MOEA 3D12B 12E8H 1LCOA 3EOEA 3TPKA 3L67A 3MDWA 1SN5A 2V63A 5HI5C 1NINA 5HAOA 1HX0A 4QXVA 2V2TA 3W7PA 4HDIB 2IAMC 3KGTA 4ONHB 1F4WH 2VVNA 4PJ9C 4GKSB 4U1JB 5T8GA 1S9YA 2J88L 3MLZH 1I8LA 5DMNA 1FVEA 5EEWA 4FL4C 2R1NA 4WUUA 4H7VA 1SJMA 4IXXA 3TW6A 4YDKL 2PB1A 3G6JE 3ZZSA 2DD8H 2I9LB 1E6PA 1FDZA 2OQLA 3DHFA 4FF7A 3V6ZA 3QS3A 4R2GC 5LNWA 2DV6A 4OKVA 4P5TC 3SDXA 2NZIA 3ZE1E 4PBWD 2YR3A 2A74C 3N1PC 5FOJA 2CLPA 1TUFA 3DVGB 3PS7A 1Q7QA 3T44A 1VKXB 4QOKA 2W9LA 3QFDA 4I3RL 1JV5A 3H7BA 4KK9C 3MP5A 4PODA 2F53D 3FSVA 3C9NA 1K4CA 4ZTOH 1MPAL 5ACLA 1CDGA 4XZUB 1LRTA 3T0DA 1Z42A 2FBJL 3KEDA 5AVSB 1AZRA 4BSJA 4O02A 4JDTL 4QCIB 1CLZH 5CSUA 4F8QA 3ZE2B 1FQ9C 2HZGA 3AXKA 5GS0C 4CW1A 5DVKA 5D2NB 4ANVA 3P9MA 4DHLA 2XTJB 4GUGA 4TOQA 1UOWA 2XNAB 3BQUC 3T0WA 3PFRA 3P0YH 4FNLL 2GZXA 1PIIA 3Q2WA 5DZLA 3BCJA 4LKCA 3EWWA 3MRMB 1EXUB 3I75B 3P3SA 3LXAA 4TUUA 1O75A 3SE9L 4ERIA 5BOZG 4HJWA 1C92A 4O58L 4XNYL 1EL3A 4HS8H 3L5IA 4Y4HC 1P6CA 2WJ5A 2XSXA 3N2BA 4M51A 1CR9L 3N9KA 3KR3L 1JPSH 2GSIB 3CN1A 2AERT 2ZCLH 1B9KA 3GD1C 4NUJA 4IS6B 5A2AA 2G95A 2AVFA 4OWGA 4LPTA 4DKDC 2VMDA 5T3XD 3ZK0A 5HJGA 1R5VA 4ZTOL 5DFAA 1UXSA 2EZ0D 2A6KA 2HKAA 4JG1H 1TPXB 4FG2A 4M6OL 4X4XB 2D8KA 4X2UA 5D1QC 2A1WL 3CAFA 3HAEA 2YGOA 4NPYB 1OSZB 4DERA 1V3LA 4F37F 1I9CB 2QDWA 3BIKA 3EJPA 4M4RA 1QSFE 1AR1D 5SX5K 4UMAA 2P24A 2JFEX 3FBKA 3CXDH 4BKSC 5DJYB 2PDHA 3MNDA 3UYRH 1UROA 4UNTA 4XP5L 3FO2B 2A7RA 4G1KA 1FVDB 3BQVA 3QR0A 2AEQH 3WN5A 2E7DA 4O19A 1BHGA 3KLDA 4OZGB 2WP3T 1BZ7A 3EJJX 4MX7A 2R8SH 1H1NA 1TQXA 3O9WB 4CBPA 4YXLH 3D0CA 3JV4B 3EYOA 2GVJA 4J3WA 3W27A 4F9PA 1QBLH 4Z3JA 1JJKA 4R88A 4GCXA 3T2NL 4DPPA 4UOW1 1ONRA 1I1FA 3FC8A 3QNXA 2PURA 1EHKB 1F02I 3QCTH 4D0BA 4ZFGL 4KJWC 4JW3A 4L9LB 4OKVB 2CRYA 3GMOB 3SN6N 4BR1A 4F2BA 3L2MA 1GSKA 3LNFA 1L5GB 2R7EB 3FQWA 1RLBA 3Q06A 5TQLA 5T33L 3WEZA 5BZWA 4NX5A 3IDMB 1LWHA 3RGHA 3CH1B 3A22A 1ZJHA 1DUZA 1KN4H 3PY9A 3CZFB 4N3UA 3IJ6A 5JBEA 4AZCA 1ZUAX 4XPHH 3WTUA 4JRFA 2BXVA 2VFEA 2KDGA 1SR9A 1U8HB 4NKDB 5IBTL 1N4XL 4U3SB 4CNIB 1KXVC 4K8GA 3QJTB 2NUTA 1F6PA 4R7DA 5D1XC 1SBBA 4N0UB 5TFSH 5FF6A 3H6AA 4L1XA 3CIAA 4P5UA 3Q48A 4GYKA 4KXBA 4G1EB 2E1DA 3LD8C 3SQBB 2BZ7A 1U6AH 3NM1A 3UGUA 3QW4B 2GIMA 2PMZA 3QHZH 3KWUA 1XGDA 2HWGA 4GE8A 3WYRA 2YDQA 4HUXB 3BH9B 3QQ0A 1SY6A 5IFJB 1EC9A 1EUAA 1OFEA 4B9CA 4ZBJA 4LAMA 3B8UA 4JG0L 3D3AA 3BH4A 3VXTA 4A3RA 3D8MA 3H2NA 2ZOKA 3OL2A 3K8KA 4H5SB 4WK0B 4L48A 3MBWA 4X0NA 3PNZA 2VLJD 3Q3GA 1JMZA 4OD1H 4RFNC 5C0EB 4DGUA 1QASA 1W6WA 4AL8L 1E50A 2EIDA 3L16A 3OMNB 3CQQA 4JJ5B 3TFKD 1ID5I 2H47C 3RWJB 2PDPA 1X5ZA 3LZ5A 1A5FH 4BK4A 5FESA 4ZB5A 3BFQG 3AFLA 5KVMC 5LXGL 1TMHA 3BP6B 4MPQA 1QSZA 2IW0A 1KCUL 3NESA 3UTTD 3QUZA 2CM5A 4EI5C 4I5RA 4OUUA 1OHZA 1W31A 1XIJA 3BOVA 4M7KL 2OV0A 1SDDA 1MFBH 3GZPA 4JNXA 5ESAA 3PWIA 3CHXA 3HURA 1R9YA 1XLEA 4ZQMA 4GVIA 2Y0FA 3YPIA 3QHFH 1U3NA 2C7UA 3WLWC 1T83C 4KTEL 5DWUH 4ZUSB 3H2MA 3T1GA 4JEGB 5ADPL 1RUQL 3GW3A 4A6YB 3ROLA 1IQ8A 1BWMA 3UCQA 3V0HA 2PI6A 4QTIH 5DDHB 2R1PA 1T66C 1JL8A 1LK2B 3O6FA 3GSNB 1HEJC 1EUUA 3FUIA 1VFBB 1R75A 3UJEA 2ERJB 5I3FA 2VX6A 1E0OB 5G5DB 3NNTA 1FHGA 4MCZA 5DJYA 2LLLA 3C5ZA 3C8KB 2EC8A 3R19A 1YUHA 3HC4L 4YTRA 5T1KD 4NNBA 4PJGF 5LWYL 1UJPA 4GJ1A 4JCWA 5HDWA 3VIMA 4PJXB 4S39A 2GUOB 4LCWD 5AQ0A 1JNJA 3DFHA 1ZENA 4GLRH 5SV4A 4LBRA 5IDIA 5KG9B 2E6AA 3DHDA 3PBVA 5FLVA 5FA5A 2CPUA 3VD9A 3FU9A 5T3ZL 1MW1A 3IMUA 4XBGB 4RSYA 5IQLA 4B27A 2CPCA 1TV2A 3P8IA 2BHYA 1NEZB 4NX0A 3KVQA 4NGHH 3VKBA 1O9ZA 4FX5A 1NAL1 3UXLA 1OEPA 2MMXA 5BU9A 5LHEA 3NABL 4S1DC 3SCMA 5LIWX 2BSED 1G7VA 1JUBA 2ACSA 2EH7H 3MRMA 2ENSA 3P4NB 2QCHA 3E96A 3HG1D 2H26A 5GSRB 1ZBWA 1BYNA 4LF2A 3VXOB 2KH2B 4PUBH 1DVFB 3LCFA 5IHUH 4M7LH 1RVFH 3BPCA 1FPTH 2QDGA 2NQ5A 4LLWA 3U30C 1TZZA 3VFUB 5D7JD 3QPQD 4FNTA 3MLUL 1HZHL 1ISWA 1KM3A 4P5RA 4APQC 4L37B 4FZIA 3LKNB 3U5UA 4P3CH 4DB7A 1TO5A 5ABFB 2Y1ZA 3L21A 1OWRM 3T07A 2EIZB 2IAMD 3IGUA 3MV7A 4OF3A 4U1NB 1M7UA 3V4PL 2CGRL 4YC2B 2MRYA 2I9TA 3HVNA 5EF3A 3UTSA 1B3YA 2HJKA 1XLMA 4XCNB 4YUEL 1M3IA 1Z9MA 2QJJA 3CE1A 1OFAA 1XGQB 4O11A 3WK3A 1JZEA 1RJYA 3AXHA 3LIZH 1OZMA 4ZQRA 4H88H 4TVPH 3BP4B 4ORMA 2ZJSH 1BVKB 2HN7B 4M1CC 2Y23A 3AQUA 4BF5A 1E6ZA 1T21A 4PGCB 4N7QA 2TRSA 1YEJL 1WLHA 2CUMA 4LNYA 1A7PL 4BFGA 5KYYA 5G1YA 2PMQA 3HFMH 1C8PA 1IKOP 3RB7A 3WNKA 3AUJA 3NTCL 1YVLA 2W5FA 3L3DB 5HMDA 2XT1B 3THQA 2YAPA 3RGTA 1R3KA 2K8QA 2VZ1A 2VWEC 3RYMA 3S3PA 1MNZA 3P30L 2PTUA 1KCXA 3LERA 4H41A 4HNNA 3ZM8A 1I4FA 1NBYA 1JCLA 4UBPC 2V0AA 3DI1A 4A3HA 4A6YH 4DZBB 2EH7L 4Z2LA 7PTDA 5IJKC 2A73A 2WUCL 4B5ZA 3RVWC 4FFVC 3TNMB 5I0YA 1TZHB 5IWLA 4JK0D 2R59A 4O52A 2C3HA 5GRWA 1E2ZA 1NF0A 3RPDA 3W07A 1QFEA 4OUEA 2ZXGA 4PI0A 3LN9A 1I7UB 3AACA 3QJSB 1DLHA 4G8EB 3E0WA 2QKIC 1XL6A 4WI9A 5DJ0A 3H7VA 5E8PA 2NY5L 4JZNA 1DXIA 4WKXA 3ZHKA 4DN3L 3RO6A 5ESQB 2ZRXA 1CFSB 4LU5H 3AZUA 4J3BA 3ATAA 2Z1VA 4YL4A 1T4KA 4F48A 3SY0A 1G9NC 4GXUM 1L6SA 1D7FA 3ESUF 1JZ5A 3FU7A 2IGLA 4L61A 3DGCR 4RQQB 4HOMA 3ZVIA 5JHDA 2ZXDA 3O3DB 3OF6D 5AOIA 3RWEA 2GIXA 2XTJD 2XN1A 3ILDA 5DR5L 3V6OE 4F2MA 5F2IA 5ITFB 3KPLA 2ZUQC 1D6EA 4YFEA 1VJSA 2CE6A 3D9AH 1U21A 2WYIA 5F88B 4CD8A 2XH0A 1EA9C 4D9PA 4DETA 5HDBE 2GK1B 2ICSA 1KDIA 1JAKA 3KWWB 5HYJE 1J7VR 1KJ3H 1H8NA 2ERJC 3GHBH 3TVAA 3MJ9A 5F3BB 4XXDB 1F3DJ 2P1FA 2OLSA 4X9IA 4KROD 1NCWH 3MHZA 4KKCD 3CMOL 4JREC 2O61B 4AITA 3ULAB 4AQ8A 3OBEA 3LD8B 4CC4A 3H42H 3RNDA 1Q0XL 4H26B 4P46C 2CBTA 4JFZL 2DS4A 4GP5B 4WCYL 4Q4QA 1AQHA 4PUKA 2P47B 2YAMA 3APNA 1W8SA 1J9TA 2YPLA 2NXZB 2NPLX 4R7NB 4C4BA 3VXRA 3WEBA 4ZUSA 2AL1A 1HQRA 2Q87A 2CU0A 2GJ6E 1G7LB 1FL5B 4PJXF 4U1KB 2WC3A 3I7QA 4BWLA 5I3IA 1IKFH 2VTFA 1ME7A 1UD6A 1QSED 4L1WA 5HUPA 2J55A 3INOA 1TB3A 4UUJA 5I74C 3HN3A 5T1MB 1DJIA 3GSRA 3ML9A 4UDUB 1GZGA 4HNOA 2I07A 5L7XH 3ISIX 5F1IA 3MOBH 5FECB 5I76A 5DJZB 3BE1L 1G6RB 3CU1A 3M8OH 3GJEB 4DZAA 3ULVH 1M65A 1D5IL 4OIIL 1EFZA 2QVIA 4G8GE 5EZOL 2HPIA 4Z0XA 2MEJB 2XIQA 1EZUA 3CN4A 1UWYA 3WD0A 4LARL 4JMXA 3ZE0F 1WBHA 2DJXA 3PSVA 1K4DB 4F8XA 2I5QA 4PRWA 4OF5A 3WH8A 4JANB 3MACL 3MV11 3RTLA 3MRBB 4BFNA 5C2BH 4MS8C 3HS9A 2P0OA 5TE4L 3S5NA 4AJWA 3QIWD 4F33A 4AY0A 3Q8EA 4IOSD 1BYAA 3KUMA 4X50A 4ELME 4FTVB 1QSFD 2PPFA 5BQ7B 1YECL 5CGYD 4Q6KA 2YD1A 3DROB 3I74A 1AHWA 1UQZA 3BLPX 1HSAB 3U0WH 4QEEA 1D5ZB 2JXMA 3QDGE 4ALAL 3MU7A 4QDMA 3SFKA 1UXLA 2BSRA 3DHJA 3E8UH 3X3GL 2RJGA 1SEBB 3GG0A 1E5NA 5TDPB 3KRUA 4AJYV 4NZJA 1T6MA 3ZTDC 4XBEH 5LDSA 5A40E 1AR1B 3F8UB 3U1SH 3MHUA 4R9OA 3VUSA 4OJFH 3RPIA 5HMEA 4GP8B 3F58H 1VRSA 4FS9A 4ZENA 4JY5L 4EPEC 3AAZA 2R7EA 2VELA 3VE0B 2GPZA 3Q13A 3UTTE 4J4PA 1QI2A 2WK2A 1MF2L 3HGOA 3MY9A 4MYXA 4N2YA 1KA9F 2G3JA 4S2CA 1RY7B 1GY2A 1QLRA 1CICC 2HXUA 2Y7QB 2FVNA 3LKQB 4MD5B 4WKZA 3CXDL 3TEXA 3AOFA 3M43A 3QH2A 3GXDA 3O3AB 5KVGH 4MA7L 2J9YA 3OG3A 2XWRA 4PB3A 4EPDC 1OADA 1A49A 4ZMVA 3QQ4B 4HA4A 3MHGA 3WD1A 1HHGB 3WLTA 3W39A 1ACYH 4FQXD 2YQBA 2WWMD 2WVSA 3LVTA 1EFXA 4I88A 3Q0HA 4JKNA 5JPMB 2Z31A 3DVIA 2XPKA 1KM4A 3DH7A 3LGEA 3FUDA 2EYTA 4FEZA 3GNRA 2YXMA 1E40A 1UP3A 4DJDD 1HE8A 5HQMA 5F3BA 1KV7A 4MYPA 1SZNA 2I7SA 2RALA 3DO4A 2QV5A 1XB8A 3EO9L 4DGVH 4PMXA 4NI8A 1UM4H 1K70A 4EKJA 1QXLA 1J5OL 1R3LB 4MNLA 2HT3C 3FU6A 3RX9A 1F3RB 1JYXA 4FOJA 5I0XA 1QRNB 1DEEB 4KHXL 1IFHH 2ISDA 4TVPE 2X4SA 4P7NA 5DQDH 2YWZA 4B50A 3M9YA 2GFBA 2IIJA 3UR8A 2CHXA 4OZGF 4NZRL 1OGGA 2CMRL 5G2IA 1DL7H 4H25A 4HWEL 4OIBA 1UKTA 4R26L 5ABDE 4QRPE 3TWYA 2PDUA 3VZYA 1BWLA 4HIXH 1CXLA 2DL9A 5T5FA 4G6MH 2VX5A 4RDQF 3OA3A 4HZLA 4IRZA 3LK6A 3PL6C 4B6ZA 3HPJB 4JHWH 5K9KB 1FNAA 2YA0A 1NZRA 1YEDA 4KQ4L 4FTVA 5ETUB 5HULA 4CNSA 5AW0B 1D9KA 1P1VA 3EBAA 2HRWA 2PTXA 4PHZA 4JG0H 1D7BA 4KCVA 5BXPA 1KC7A 2F5BL 5GS3A 2VCOA 4WEUD 4CW1B 4MYWB 4R4FL 4WI2A 5F93C 4IPNB 4ODSH 3FA4A 5A69A 1GOXA 1VFLA 5IY5B 1KACB 1QI5A 3OKMB 2DN7A 3AB0C 4N85A 2DVTA 4ZFCA 1FNFA 4YDMA 2PDBA 4XSMA 1FBIH 3EW3B 5FHAH 4JQIH 4TSAH 5F7AA 4ZB0A 1T1WA 5FEXA 3O3BB 1L9SA 1RZ8B 1W2VA 3WS6A 5B39G 3SBRA 4MCYB 4ETQA 4MAYD 4PLJD 3KCOA 1KJVB 3BWSA 4F92B 5DVMA 3VDAA 4XPAL 3JVFC 4JO5A 5E1AA 3C0JA 2K1MA 4FHKA 2P8MB 3D47A 3P74A 1MLBB 4QRFA 2IBZY 4PREB 1UWXH 2IAMB 2R0KL 1MJ8H 3B2VH 2JQAA 2DQXA 2E5DA 3QZAA 4WWNA 2XC8A 4WF7A 4JFEB 2PC4A 2OL3B 1J12A 3MUCA 1L3WA 5C0DB 4ZFGH 3TE9A 4DF2A 3L4CA 4QRSA 4YR6A 1G01A 4EF9A 3PPCA 4DOHB 2JKJA 4XVTL 4XCEA 3DBXB 1C3FA 3QHOA 1OCWL 4YL2A 1PXGA 3WSUA 4GI6A 3TAOA 1GQJA 4XHJC 4DVBA 1F74A 1TPEA 3BUIA 4WW2B 1AY1H 1TPFA 3F00A 4E2BA 1NGXB 5HGHB 3FBQA 4DWDA 1X5FA 5AKVA 1WAEA 1FN4B 5JYLA 3US9A 3LM3A 2EH8H 3O11A 4DUVA 4HAFA 4GQ9L 3BPCB 4GS7C 1GOQA 4FIRA 5A8GA 1C5CH 4J3SA 3UC2A 3IFLL 1NKOA 2P3YA 2EIKB 5I75B 1E4KC 4JG5A 2EDFA 1IT8A 2PCPA 1JF1B 1ZA3B 4HSHA 1AO7A 5LLIC 5DHDA 3S1VA 3VXQA 2VWEE 4TF4A 3FSTA 1D7CA 3P02A 3W9EB 4KVNH 1QSVA 4GBXB 1DQQB 4LHQB 5EU7C 2VIRB 3O4LB 4ZGYA 3GMNA 3GNXA 2V7HB 5EUOA 4DKEL 5F8RC 4PUNA 4W5ZA 2BSSB 4XP4L 5AOZA 1V7NL 2YAFA 4XAWL 3O3DA 4LKXB 1IWBA 1ZDQA 1DDHA 4FQQB 1F1GA 1BMZA 4NZUL 4Q4OA 2VDRB 2VSDA 4I85A 2K9UA 4PJ7E 1XBVA 3L08A 1CD1A 2GUOA 2PLJA 1U3YA 3E12A 3R5EA 2G2RB 2DMGA 1QFUH 5KG9A 2Q8ZA 1MHHB 1TR1A 3UWVA 1XS2A 3ZKMC 1FUNA 1T5WA 3CJPA 4RMVA 4UTBA 3E9UA 3MPGA 3HBZA 1E6SM 2BIOA 3PWPE 1CIDA 4AW4A 2WNNA 2DDQL 1YIXA 2V30A 2XA8H 5KSVB 5AZ0A 1OCOB 3BJ91 3ZLFA 4JM2F 5DURD 1TELA 3OR7B 2B31A 1QU4A 1BZ9B 3AISA 3BWUF 4FOMA 5DK3A 1UQSA 4YAQA 2CKRA 3KYKH 4DJFD 5CP3H 1R6VA 1OTSC 3ULSB 1E1CB 1JRHH 2VLRD 3W84A 2BOFX 4XMLH 5KSAD 1ZLDA 2YRPA 3O6LL 4H8HA 2JIEA 3NCYS 3LCGA 2O56A 4ODTH 2DIJA 5FAJA 2FATL 5ESAB 2ZRVA 3IS4A 1UZGA 3I6GA 1IJ9A 3PREA 1JNLH 4N2KA 1F5ZA 2HVNA 2WZHA 3QSKB 4KERA 2IVFC 5J9PB 5J11B 3PGCA 3D3FA 5E8NB 3EKZA 2XGBA 5CC5A 4FRWA 2HX7A 1V08A 3IDMA 3KH3A 4N86A 3T3MF 3ID7A 2NNAB 1S7TB 5DS8A 3G0UA 4E42A 4J4KA 3LCXA 3O6LH 3OVGA 2ACUA 1RJYB 4MZ1A 4MBOA 4XBSA 1W17A 1JP5A 2VH5L 3NSDA 3Q6GH 4GIPD 2RQEA 4GUCA 2H9GA 5J7CC 3WS6C 6PAZA 5HYEA 3KJ4B 2DW7A