3AXHA

Crystal structure of isomaltase in complex with isomaltose
Total Genus 229
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
229
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGAMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase IMA1
publication title Steric hindrance by 2 amino acid residues determines the substrate specificity of isomaltase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 229
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2011-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3axhA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3axhA01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3axhA02
3KZSA 1G5AA 5C8BB 3QHOA 1VEOA 3GXFA 1W32A 2WHKA 1JAEA 4OZOA 1X1NA 3WIJA 1TE1A 3W53A 3NSMA 1DTUA 1C90A 1K9FA 3VPLA 3W24A 4CKQA 4WSKA 3W29A 3EJUA 2OLHA 3HU7A 2GJXB 1JXKA 3WDRA 2BHYA 2X0HA 2F7PA 4WK9A 1B30A 2PWEA 4W88A 1B0IA 3SCQA 1U30A 1VBUA 2WMGA 1V3LA 1OT2A 2G8ZA 3MMUA 1ZBVA 3OGVA 2DT3A 5LA1A 1UWIA 4AIEA 3VTRA 1QW8A 3M07A 1GZJA 2VZVA 2E9BA 3KEHA 1EH9A 4AYGA 3CUFA 5M5DA 1TVNA 1ISXA 2JIWA 2OWCA 1E6SM 1UQZA 3BVTA 1KTCA 4MAZA 5BYWA 1XD1A 2Q8XA 5DEZA 1JZ3A 3BMWA 1TG7A 5E6YA 4UQBA 4OUEA 4HZ6A 3CC1A 2X2HA 1H11A 2XN2A 1HKMA 5CPSA 1LG2A 3T2PA 3GXIA 3FAWA 5HXMA 5CPTA 3DX0A 4WKFA 5A8OA 1BQCA 2E8YA 2TAAA 2D73A 4C7DA 2E0PA 3AZTA 4J28A 2ZUUA 3SUVA 5IHSA 4HZ8A 3G6MA 2WANA 2XGIA 4UZSA 4AEEA 3TP4A 3SUWA 3DDFA 4MB4A 3WMCA 1QHPA 4CD4A 1KXQA 4PUEA 2QPSA 4TX8A 4P7QA 3OZOA 1XHGA 4NRRA 1WZKA 1RD6A 2ZIDA 4ACYA 2WW5A 1WB0A 2DPEA 1OIMA 3ARTA 3PZNA 2G3MA 4XUYA 2OYLA 4V28A 2JIEA 1BF2A 3BAKA 4U3AA 3AI0A 1KQYA 2W67A 1FP9A 3N17A 5EBAA 3L4YA 1W9PA 3QOKA 2GJXA 1DEDA 4ZEPA 4OOZA 3POHA 1DWGM 2OSYA 1R85A 2NT0A 5HPCA 4UFLA 7A3HA 1H2JA 1LQ0A 2VRJA 1J18A 1J0JA 2XGBA 3GNPA 2EADA 3L4ZA 4D6JA 2DH3A 1ESWA 1BYDA 3TTOA 2WMIB 2J7FA 1Q6FA 1EQCA 4NX0A 1UUQA 1E73M 1H4PA 1XYZA 4F9JA 1QWUA 1BGAA 5DFAA 6CGTA 4KH2A 3N04A 4NZJA 3LPPA 2DSVA 4HMDA 3THCA 5GQBA 1HXKA 3ZMRA 5AC5A 2DEPA 2XJ7A 2W61A 2GSJA 1W9UA 2EAEA 4L4PA 4UFMA 5D9PA 1NM9A 4HMEA 4F66A 3ZSTA 2PF0A 3WSUA 1VFFA 3MUY1 4ZE4A 3M46A 1E56A 1DWIM 1ISZA 4S3JA 2JEQA 1CZ1A 2CPUA 2XVNA 1V6UA 1E9LA 5KZ6A 4GO9A 4P7NA 4YHEA 5I5RA 2EO7A 2BS9A 3VIPA 3S2CA 5HDRA 1CXLA 3BLBA 1DWJM 3BAIA 1V0KA 3ZJKA 4W86A 1ZJBA 3CMGA 4E2OA 3LRLA 1UWRA 3EJTA 4KRTA 1GVYA 2JEPA 4NI3A 3NIYA 4BQ2A 4FF5A 2YDSA 1E0WA 1EDTA 5BXSA 1W1TA 3VM5A 3VVGA 5A2CA 3JUGA 4J3VA 4ZXLA 2QMKA 9CGTA 2CIPA 3ARWA 5FL1A 3BVXA 3PBGA 2XSAA 2YBTA 3WY2A 2AAAA 5A95A 3LRKA 3DYMA 1HT6A 2WAGA 4CD5A 3K8MA 4FLOA 5AYIA 2XFFA 1XC6A 1M03A 1JI2A 1DWHM 3GBEA 3GNRA 2CNCA 1KBKA 4W89A 2VI0A 4UTFA 4X9YA 1AQHA 3LXAA 3K8KA 2WMHA 2WZHA 2WMIA 4NSBA 4CVUA 2UWFA 4OBRA 4AC1X 1V0MA 2VUYA 1ZS2A 1CEOA 1DWAM 4JHZA 2FYVA 1UR2A 3AS0A 5CGMA 4ZXOA 5ABFB 2WB5A 3N18A 1IV8A 5CG0A 1A47A 1CECA 1V08A 4UCFA 3UG4A 2X05A 1JZ4A 5A6BD 2WSKA 4DWSC 1OB0A 1TUXA 5DMYA 2C7FA 1UG6A 1R86A 1WPCA 2G3JA 3MMDA 1UOKA 4AD3A 3BVWA 3CZJA 2J7HA 3CV5A 2F8QA 4P8VA 4H2CA 2FDMA 3MUZ1 4AISA 5A8QA 1KR0A 1TCMA 3H54A 3W6LA 4WIWA 3TTYA 2J47A 1PBGA 3AHTA 1B3ZA 1E6QM 1R33A 5FL0A 1ZU8A 1ITCA 1U2YA 1QNRA 1KGWA 1CNVA 4QLKA 3MKKA 4EAMA 3WL0A 1G0CA 3WNKA 4AYSA 4F9DA 3MANA 3BAXA 1EOKA 1UR0A 1B1YA 1M04A 3SEPA 3FY1A 2DH2A 2AMGA 3TV8A 2X2JA 2ZX5A 2VZSA 1HNYA 2BVYA 4AW7A 1M7XA 4CD8A 1US2A 1CLVA 3AMGA 4M8UA 4D6IA 1QI4A 1QW9A 4M56A 2YL5A 2WVSA 4W7WA 1EDGA 1GHSA 5ABEA 1W1YA 2YLLA 3IK2A 3KL5A 2XM1A 4AD4A 5CQ1A 1OSEA 3W25A 3WF2A 2IGTA 4MNMA 4GO8A 1UKOA 2EPNA 2CYGA 2VRQA 1NWUA 2W63A 4W7VA 3A4XA 3PZIA 1ZBCA 4M82A 3WUBA 1OGSA 1JIBA 2WLYA 1V02A 5GNXA 2A3AA 5BXTA 1B31A 8CGTA 1CGVA 2IXVA 1QI2A 5ABFA 1JZ8A 3WDJA 5JUVA 4PTMA 1J9YA 4MDOA 2GVYA 3WEZA 1FHLA 1MXGA 4B9ZA 3L4VA 1W9XA 2Y8VA 3MI6A 1W2VA 5M17A 5D9MA 1LG1A 4QLLA 4A3YA 4PSRA 4EANA 2J7DA 3ARRA 3BUQA 3MU7A 1GQIA 1HKIA 1BG4A 1E71M 3HMCA 2WHJA 5BROA 3THDA 1K9DA 3KLKA 4W5ZA 4EE9A 5JBFA 2XHYA 2FHBA 1HKJA 5HNNA 2WVTA 3PZOA 3PTMA 1FH7A 2WC7A 4FNPA 2CKSA 4H8UA 4PTVA 4AZ6A 3FAXA 2PI6A 4DUXA 1HL8A 1CGWA 5I24A 1HTYA 3ZOAA 1VFOA 1M53A 1FHDA 5A6KA 4PTWA 4GKLA 3KLLA 3T0DA 2Z1SA 4CCDA 4AZBA 3IJ7A 3UERA 2D22A 3AZRA 4H04A 5CXPA 2J78A 4GPNA 1ZL1A 1NQ6A 3PZQA 4MTVA 1PZ2A 1E5NA 1HP5A 1QNOA 2WZIA 4CN4A 1VRXA 4JKKA 4UOZA 4LPCA 3LXBA 1WDSA 2VVNA 1PX4A 2YJQA 5GNYA 4W84A 3OLGA 1E1FA 1YHTA 1XGZA 3AROA 3QGVA 3HG2A 4TVCA 1H3GA 2OYKA 2OW6A 1HXJA 5HBFA 2D2OA 4MNKA 3BAJA 2D3NA 2J77A 1Q6CA 3A3HA 1O6IA 3AIRA 3BGAA 3WN6A 1BYAA 3QHMA 3BSHA 3N11A 1TMQA 1MVYA 1WKYA 4BF7A 3L4TA 2YL8A 4C7GA 4OJYA 1EOMA 3T0BA 1CXIA 1EXPA 3CH9A 4JKMA 4P7LA 1CIUA 5CJ5A 1KB3A 3OA5A 4JL2A 2CKRA 2O9PA 1FA2A 5A6SA 4JFWA 4W85A 4V2XA 4TX6A 3CGTA 4J3SA 1V6YA 3PTQA 1K9TA 3VIKA 4JCMA 1UD8A 4WKAA 4XV0A 4JFSA 2VOTA 2ZX9A 1H1NA 5A6AA 4PEEA 3EDFA 3LX9A 3EYPA 1KXHA 5I6SA 3AIQA 2ZUSA 2ESCA 1BLIA 1PX3A 3L4XA 3AXHA 3T09A 1E70M 2J25A 1DWFM 3EDEA 5E70A 3SCTA 2V3DA 2WWCA 1KCLA 4KWUA 3WNOA 3WF3A 1GOMA 3NCOA 4JZ5A 3AMCA 3WQWA 3WH7A 2PC8A 1KXTA 2EPLX 1TQWA 4RL3A 4B16A 1IZJA 2GDVA 4QCEA 4QLJA 3FXYA 2PB1A 4PN2A 2G3NA 1B3VA 3WELA 3HG5A 2DQXA 4AZ5A 4UOJA 1GQLA 1D7FA 3BCDA 4Z2IA 3SCSA 2FGZA 2D0HA 1GOIA 3ARZA 3RJYA 4V27A 2PWHA 1TA3B 4AD2A 5GPRA 1VF8A 3WY3A 1H49A 3AYRA 3AHVA 4KGLA 3AJ7A 4UR9A 5FD0A 1TQUA 3CUIA 2JALA 1R7AA 1TZ7A 4HMCA 2F7OA 3ZIZA 3K1DA 4DO4A 1CPUA 4Q22A 3S6TA 2YA2A 1HVXA 3CZLA 1CENA 3VIIA 1QI3A 2F1BA 5IDIA 1J0IA 1E43A 3WDQA 4MADA 1G01A 2QF8A 3AMDA 3VMNA 5FCZA 3BC9A 1JF6A 3BUPA 2G41A 5ABGA 1HIZA 4E8DA 2WKGA 1UD3A 2YFNA 1W91A 4MJ2A 4ZFMA 3BAWA 1UKQA 3AIBA 5IXEA 2J79A 1CTNA 3KE0A 4QFUA 1V03A 3GXPA 4LXFA 4N0RA 1UD5A 1B3WA 1DHKA 2WNWA 3CPUA 2D1ZA 2BHZA 4UQCA 4H41A 3EJSA 1HP4A 5DT5A 5A2BA 5E1QA 5LA2A 4GI9A 2J7CA 2WKLA 1NP0A 1OD8A 1ISYA 5A6LA 2Y2WA 2D23A 2YIHA 4AZIA 4PMYA 4MB5A 3VIMA 4OIFA 3L2MA 4B3KA 1CXKA 1E4MM 3GM8A 1Z32X 4TUFA 1LJYA 1XYFA 5BXPA 4GI8A 3VD7A 4FLRA 4DO5A 5C70A 3ARVA 1E3ZA 3U7VA 3GXMA 1J0ZA 4AEFA 5BCAA 3VDCA 4QP0A 4E8CA 2CBUA 5EB8A 1LLOA 1W1PA 3CIVA 1ITXA 3MS8A 4BQ3A 3RJXA 2BY0A 1UR8A 4XX6A 1BG9A 2B31A 1V02E 3N13A 2Y8KA 3GH7A 2EJ1A 3WQ4A 1JDAA 4MNLA 1GJUA 1CLXA 1HJVA 1FH9A 2YBUA 2FHCA 4URIA 1TA3A 4JIEA 1C92A 1GORA 1JYNA 2GK1B 1JL8A 4AZ7A 4MDPA 3VIFA 1G1YA 4AIOA 5KEZA 4C7FA 3VGFA 1HJXA 1BGGA 1HJSA 3WQ6A 2J75A 3VSTA 3II1A 2ZUTA 3NDZA 4GZIA 3MUAA 3I3DA 2XFYA 1EGZA 3LXCA 4TVDA 2YFOA 4M80A 1SMDA 2UY4A 1FOBA 3H55A 2J7EA 4S3KA 4D71A 2Y5EA 2W4XA 1Y7VA 2NSXA 3GDBA 2J8FA 2YL6A 4TOQA 3EDJA 1HF6A 5IHRA 2CBJA 2XG9A 3VX1A 5CPQA 3LPOA 2WHLA 2VURA 3VX0A 3GXDA 2PWDA 2GUYA 1SFSA 4NXKA 1VEMA 4Z2HA 3O6AA 4HU8A 1RP8A 1RH9A 3WD3A 2YA1A 2BV9A 3AZSA 3VD3A 3L4UA 4M29A 2J74A 1MW3A 2D3LA 1R34A 1QHOA 2A3BA 4D6EA 3RDKA 2FE0A 5D9NA 5JBEA 2VQTA 3CUGA 3PZVA 1I1WA 2EXOA 3DDGA 3DHPA 5AYBA 3FW6A 4A3HA 4IPLA 2VRKA 3AS1A 5D8ZA 4CD7A 5IFTA 4J3UA 3S5ZA 3GNOA 3EDKA 3PZGA 2ZWZA 3U5UA 3PZMA 1LF1A 1GQKA 4ATLA 4R5EA 3VGGA 1F4HA 4CU8A 1QBAA 1J0KA 1QNPA 1MQQA 3AIUA 3ZJ7A 4MNJA 1GQJA 1CXHA 3VDBA 4HP5A 3VNZA 1C8XA 5FKYA 1GOWA 2VCAA 2BY3A 1JYWA 4NXSA 2WVUA 1SYTA 3BUBA 2J8GA 4ML4A 1OCQA 4PMNA 3H53A 1R75A 3WH6A 3ZJ6A 1HN1A 4AWEA 4GXPA 4WF7A 3WFZA 1GOKA 1M01A 2JE8A 1E72M 5ABHA 4J3WA 2GK1A 3D51A 3B9AA 1WNOA 5CGTA 1C7SA 3LPFA 4P8UA 4AD5A 1E1EA 1W9DM 4J27A 3SURA 2HISA 2OW7A 3CUJA 2PWFA 4UFKA 1NWRA 3RMEA 3HG4A 1QHZA 2QHAA 4OBSA 3NSNA 1NWSA 3J7HA 4AZHA 2WBGA 1SMAA 4GZEA 1UD2A 2VZUA 3MV01 1VJSA 1BTCA 4P7OA 3FNDA 3WD0A 1JGIA 4MB3A 1VJZA 4U33A 3W81A 2CEQA 4IM4A 3GXTA 4W5UA 4CCEA 3LRMA 3ARPA 2GJRA 2XVPA 2X2IA 5A6JA 2XPKA 1QWNA 4JFUA 3S5YA 3WF1A 1PZ3A 1UA7A 2WLZA 3UG3A 4RE4A 5LYRA 1QPKA 7TAAA 4D6CA 1OGBA 3D3AA 3T2OA 5HOSA 1UZ1A 2F18A 1X6NA 1E40A 2WMFA 2Y24A 4J3TA 2ZX6A 3VOCA 1V3KA 2CBVA 1XSJA 1CGYA 3BLPX 1EIBA 4PRWA 1LL7A 3CHDA 2BVTA 3CZEA 2VX7A 4PMDA 2WCAA 2VVSA 2VMFA 3AS3A 4HOWA 3A6OA 1JNEA 4ACZB 2O9OA 4PCTA 3BUDA 1K9EA 1MQRA 4D72A 1VFUA 4RE2A 2V3FA 1UWTA 3RPMA 5F7UA 2E40A 4P7RA 4Z2GA 5JIWA 1EDQA 1ODZA 1L8NA 2DIEA 2WXDM 2UY2A 3WMBA 4QAWA 3BXWA 3VGHA 8A3HA 3WNMA 2V38A 3CZ8A 1WZMA 4B9YA 1OIFA 3SCOA 2VJXA 3AXIA 3W37A 1QOXA 1KGXA 1PX8A 4LX4A 2EBNA 3AQUA 1BVNP 4H8VA 1JYXA 2NT1A 1H41A 3AHZA 1O7DC 1GVIA 3WD2A 3IANA 1PIFA 3PN8A 3MO4A 3VD5A 1LL6A 2C0HA 3OB8A 2ZXBA 4HOXA 5D8WA 3AIEA 3AMKA 1LWJA 1NP2A 3WD1A 5I3DA 1W3HA 3PZUA 3VNYA 3HZ3A 2JF7A 1WDRA 3AIWA 1ISWA 1JG9A 1HKKA 2VX6A 1H5VA 1HWWA 1A3HA 3A23A 2QLYA 3WMSA 4U2YA 3NUKA 1GJWA 3RM8A 5CZKA 1B3XA 1GHRA 1GONA 2X2YA 3DYOA 1NOWA 1JF5A 5A6BA 2A3CA 4UQAA 2DGAA 3IJ8A 4R27A 1UH4A 1BYBA 1E5JA 1PEZA 3K8LA 2BXYA 4B3LA 1WZAA 3BCFA 2BY1A 2DIJA 3KL3A 4JL1A 4PYSA 4UOQA 3WUEA 3WQVA 2OWXA 3VD9A 3DC0A 1GNXA 4DM2A 4HA3A 1L0PA 5DT7A 4ACZA 1ISVA 3BMVA 5HPOA 4GQRA 4UQEA 4ZE5A 1QI5A 1E4NA 1XH1A 1XCWA 3ARSA 3VKKA 4QCFA 1JFXA 3W28A 3T2QA 1TVPA 2WMJA 2X0YA 2E9MA 2ZUMA 5A8NA 4PBGA 2DSKA 2WBKA 1NOUA 1QNSA 3CZNA 3HJEA 2ZUVA 1EHAA 3ALFA 2QPUA 1XRVA 2DT0A 4PMZA 1VB9A 3WFLA 3W38A 2RGLA 3WY1A 3A24A 3RO8A 4CN1A 3WEOA 2XVLA 1ZJAA 1JDCA 3E1F1 1UR9A 3POCA 1UR4A 2XN0A 2DT2A 2MANA 4PMVA 1GW1A 1E3XA 1E15A 5FIPA 3VMPA 2BFGA 1R8LA 3MUIA 2QV4A 1NOFA 4J3XA 3EMZA 3EJPA 1WP6A 3WF4A 3GZAA 1JZ6A 4YN5A 3AXXA 1XCXA 1B2YA 2DSZA 1Q6EA 3FHQA 4FNSA 4E4PA 1BVZA 2WPGA 2YA0A 3VM7A 6A3HA 1HL9A 3AISA 3T0AA 2W91A 2E3ZA 1UH3A 4D1IA 1JZ7A 1WE5A 2VR4A 2VTFA 1B9ZA 1V3MA 2VL4A 2YOCA 4GQQA 1C93A 2V5CA 4X0NA 2WM0A 1AMYA 5A2AA 1TR1A 5AC4A 3F5JA 3KL0A 2XVKA 2GJPA 5M3WA 3CHEA 5I0DA 2NW0A 2E8ZA 3WENA 3BVVA 4H7VA 1WCGA 1NH6A 3A22A 4WLCA 3TONA 3ARQA 1V6VA 2J4GA 5BXRA 3U57A 4BQ5A 2CHNA 4K68A 1WDPA 3VMOA 1JAKA 2J7BA 3A47A 2WWDA 3VIOA 1CBGA 2RGMA 3VD4A 3SCWA 1W3LA 2YLAA 3BH4A 1ZBKA 1BFNA 2BXZA 1EHNA 5E9AA 1KQZA 3QR3A 4HU0A 3I3EA 4LGXA 1ECEA 4RE3A 1VFMA 4ZENA 4P8WA 2XWEA 4D6FA 5FOOA 4FNUA 2OSWA 1HJQA 4JCLA 3OG2A 4JFVA 1TFVA 3WBAA 4IISA 3B8SA 1LL4A 5CSYA 3EMQA 4CU7A 3F4VA 4HA1A 1X6LA 1JZ5A 5BRPA 4Z2JA 2HVMA 3VGBA 2W92A 2JFEX 4NF7A 4IPNB 3ZM8A 1XSKA 1UASA 3SCRA 3OZPA 4U5IA 4FNQA 4LYPA 1BPLB 1BYCA 3WF0A 3VDHA 3EMCA 5D9OA 2ALWA 3DYPA 4MJ4A 1CYGA 4PCSA 4XZBA 2D20A 2C8NA 2WCSA 2ZXDA 2BNJA 2EACA 1JYVA 2EPKX 3AS2A 1MFUA 3U5YA 1E6RA 2O92A 1YQ2A 1XH2A 2EQDA 4PTXA 2XFRA 1UKSA 4PUDA 4PMXA 4X0VA 3ZR5A 1V3JA 3IAPA 1JNDA 3OLDA 3VGEA 1H0GA 5I78A 2XVGA 4UNIA 3AOFA 1WAWA 2EPMX 4Z2LA 3BSGA 1Q4NX 3FHAA 2DSWA 1KR1A 2WCGA 3VDAA 3D50A 3ZT6A 5A8MA 2G3IA 3LMYA 3CBWA 2VR5A 4TTUA 2IXUA 1BAGA 1V0NA 3SIMA 3RIKA 1CXEA 3T08A 4FMVA 4CN6A 1HJWA 3CHFA 5JBDA 1HX0A 1N82A 5JIPA 3OGSA 4HOZA 4U31A 3VIJA 4D6HA 4OKDA 3GYCA 3VO0A 3F5KA 1GOQA 2XWDA 5I23A 4CD6A 1UWQA 1OWQA 3CO4A 1JXJA 2IUZA 4AIUA 3RILA 3UR8A 2WYSA 3VSVA 2XTKA 3ECQA 5AY7A 1OT1A 3ALGA 1HVQA 1I75A 3AIVA 4UQDA 3SUUA 2VX4A 3UETA 1MW1A 2WMKA 4HA4A 2XSBA 4XZWA 3WBEA 1G9HA 2OYMA 3ZQ9A 1J11A 1R7OA 3MMWA 2EABA 3NDYA 3RM4A 1MW0A 4JKLA 2FGLA 4KMQA 2OSXA 4MB1A 1QVBA 2UY5A 4CVWA 1C91A 2O9TA 1AQMA 4AXNA 4KRUA 3MSGA 2V3GA 4TXEA 1FH8A 2QMJA 3CZSA 4GZJA 1K6AA 4JFTA 2ZWYA 3EDDA 3A4WA 3MV11 2AOSA 1UQYA 4UFIA 3VIGA 3WUGA 2V3EA 5IFPA 3WNPA 3WDHA 4F79A 4OGZA 2ZXAA 1E55A 3UEQA 5E6ZA 2CHOA 4DWSD 1FFRA 1RPKA 4AZGA 1R47A 1I1XA 3ZO9A 4N42A 2O9RA 3WNLA 3L4WA 3UR7A 3O9NA 4M81A 3WKZA 3K4AA 3A4AA 4GIAA 4UQ9A 4XB3A 3SCNA 2F7QA 1QI0A 3F5LA 3W27A 2A3EA 4PMRA 4AD1A 4U2ZA 2VCCA 4PMUA 4DWSB 3ARUA 1VBRA 4AMXA 2PBGA 1KTBA 1UWUA 3ZJ8A 4FNRA 3B9DA 3VUPA 5GNZA 2CERA 1VIWA 3O2LA 4AZCB 3D4YA 5A1AA 4HPHA 2EEXA 1KGUA 1V3HA 4EK7A 2WC3A 4KGJA 1P6WA 4B15A 1Q6DA 4AMWA 2DT1A 4DO6A 1V0LA 3HN3A 1B3YA 1W9VA 2YDQA 2EPOA 2PBOA 4PSPA 1G94A 2X1IA 3PHAA 2WC4A 3MSDA 4QDMA 1J0HA 2ZE0A 5CLTA 2JF6A 1E4LA 1JDDA 3DX4A 4NRSA 4L4OA 3BUIA 1MYRA 4CU6A 4CUCA 2BVDA 4GINA 3EBVA 2VZOA 5I2UA 2W5FA 3IGUA 2ZUNA 4D6DA 3IJ9A 2ZICA 1CGXA 2VNCA 1EO5A 1EA9C 5TD4A 2D24A 2OWWA 1IZKA 4HPGA 2E4TA 1TQTA 3APGA 1XD0A 1KWKA 4W8AA 1C3FA 3LPGA 1QNQA 3VU2A 4GI6A 3QHNA 2XUCA 2XIBA 1ZB5A 1PAMA 3GH4A 1US3A 2CCRA 1RP9A 1TQSA 2CETA 3BVUA 4TTGA 2W62A 1O7AA 1EO7A 3CZGA 4HTYA 2D0FA 3ZSSA 4U5KA 2ZX7A 1B90A 2VQUA 5EFFA 4YPJA 1JZ2A 7CGTA 4WSJA 1OBAA 4M24A 1OD0A 3N15A 3ZR6A 3UCQA 3W26A 3DX2A 1MFVA 2XYLA 1OINA 2Y4SA 2W66A 1KBBA 1UR1A 1V6XA 3OIHA 3ARXA 4DM1A 3UG5A 5E0FA 3N9KA 2Z1KA 1W9BM 4PMOA 4WJXA 3DHUA 1F4AA 5DO8A 1J12A 3GXNA 3CTTA 4W8BA 2VZTA 2BHUA 3ARYA 4DWSA 4UZUA 1W3KA 4DUWA 5A69A 1KFWA 2ZOXA 3TTSA 2ZX8A 2WVVB 1QX1A 4H8HA 1UD6A 4AZCA 3EJQA 1C8QA 2WK2A 5E09A 1PS3A 3VINA 2D0GA 1KWGA 1S46A 2XIIA 5DF0A 3WQ8A 1HJUA 4PMQA 4Q7NA 3ZT7A 1PIGA 3B9EA 1ZBWA 2G4FA 4WKHA 1W2PA 2VT0A 2BY2A 4M1RA 2VC9A 3GH5A 1WZLA 3DECA 4NZFA 3I3BA 2J62A 2YDRA 2FH8A 1DP0A 3RM9A 1UH2A 1C7TA 3WD4A 3GBDA 4JAWA 5CSUA 5BWFA 3D5HA 4A4AA 5CLWA 1XH0A 2VO5A 4J7RA 3PTKA 2VCBA 5E0CA 4BA0A 4EKJA 5M03A 1MQPA 3IAQA 2CESA 2X09A 2DDXA 1Q6GA 4F8XA 1H0IA 1CWYA 3A5VA 2CXGA 3WNNA 4ATDA 4Y7EA 4P8XA 1E6PA 4D6GA 3N1AA 3PZTA 2CBIA 3CLWA 3OBAA 3A21A 1BSIA 2GFTA 2WHMA 2F7RA 1FFQA 5D4YA 5I77A 3AFBA 3SUSA 5BRQA 2FHFA 1VENA 1VAHA 2J7GA 3D4ZA 3NJ3A 3CMJA 4YHGA 3RCNA 3PZ9A 3FN9A 2DSUA 4TVUA 3GTNA 5C71A 3WDIA 3K4DA 4W93A 3WH8A 1D2KA 1GOOA 1UWSA 4W87A 4D1JA 3D52A 4LYRA 3L2LA 4U3CA 4FLSA 4BCEA 1W3JA 1C8YA 1T0OA 3AHXA 1CXFA 2PWGA 1J0YA 2X8RA 4DUVA 1UZ4A 3N12A 1GUVA 3CHCA 1R87A 2WVVA 3CZKA 1EQPA 3K46A 4AD0A 2F61A 1GPFA 4MPKA 2F1AA 4FNTA 3W4RA 3TA9A 1H09A 1V3IA 4IUGA 1AQ0A 2FH6A 1J10A 3M6DA 4CGTA 1E0XA 1VEPA 1E0VA 4BS0A 3SUTA 2UY3A 4AY1A 3OLIA 3SCUA 1XSIA 5EFDA 2F2HA 3KWXA 3M7SA 3ZT5A 2XN1A 1E6XM 4NZCA 5A94A 1MW2A 1QBBA 2VX5A 1OGGA 3NYDA 4OOUA 3W0KA 3DX3A 2ZXQA 3HG3A 3WEMA 3EJRA 3G6LA 3NSXA 1NWTA 1W1VA 3AMLA 3WH9A 1MWOA 3WDPP 1SR0A 1GCYA 4ATWA 3AYSA 5LA0A 4FK9A 3TOPA 1D3CA 4UFJA 4Z2KA 3OLEA 4W7UA 3WQ5A 3VIHA 1OM0A 3WY4A 2XM2A 1JD9A 1J01A 1UYQA 6TAAA 1IT0A 5A3HA 1UD4A 1XV8A 1UHVA 2CITA 1TQVA 2V5DA 4LYQA 4FLQA 4LQ1A 2YKKA 1UKPA 3VGDA 2GDUA 2WZEA 3BLKA 3QOMA 1SZNA 1CGUA 1CGTA 3W6MA 1KXVA 5A8PA 1UKTA 1WDQA 4MAVA 1KCKA 3OGRA 1R46A 1AVAA 3DX1A 1E6NA 5EMYA 4UFHA 1WO2A 3U7BA 2E9LA 5A6MA 2WSPA 3W82A 5ECUA 3BAYA 1UA3A 1NARA 4JHOA 3VSUA 1JFHA 3SCPA 3CUHA 3UESA 1ODUA 1BHGA 2A3HA 4AMCA 1JD7A 1MXDA 4BQ4A 3AHYA 3SCVA 2ZUWA 2YL9A 1E6ZA 3TTQA 3VILA 1PPIA 1LWHA 4W8LA 5I79A 3WH5A 3WL1A 3WUFA 1JI1A 4HZ7A 1V6WA 4CCCA 1U33A 3AICA 1FP8A 1PJ9A 1CDGA 1E4IA 4BZYA
chains in the Genus database with same CATH superfamily
4DJFD 1CL7H 5DUBA 3RPKA 2ICWI 4UB0L 2ZZ7A 3WIJA 1NC2B 4LBUA 2NY6C 3GTXA 5AKVA 3QJTB 2WD0A 2MKWA 3ECUA 3O3AB 3GG0A 4OH2A 3EJUA 1P6CA 3UC2A 5DS1A 3TC6A 1UPPA 5I1GH 4W88A 3JBG7 3EXJA 3NQ7A 1W54A 4CNIA 3OYXA 4GXUM 4UV7L 3SQLA 5H6HA 4AYGA 1GT8A 2P1YA 1QRNA 4P2QD 2PETA 4AUJA 4IMGA 3MNDA 3ZU8A 1DXIA 1QPQA 3WO3B 1IM9D 4QG6A 1HILB 4UAOB 3ZYIA 1V27A 2BNUB 4AH7A 2QGHA 4E41B 5CPTA 1K8YA 3P3UA 5FV2A 1FYTB 4M5PA 5FGSA 3C60B 4B3EA 4GW4B 3DRTA 2HP4A 5IOKA 1TKWB 5PAZA 2V9QA 2QXWA 4GYBA 3WKNA 2HXTA 1IL1A 3Q8BA 5KYYA 5CZXD 4QXTA 3QJFA 3IUDA 1SOXA 3EYQD 4PJCE 1RZJC 1G6CA 3MRHB 3PZNA 5T3ZH 2JIEA 1BF2A 2RJMA 1K02A 4NUMA 5FUOL 1D6VH 1DQQB 3P30H 1FPTL 2GIXA 4PGDB 2DQGL 3FZUD 3KWWB 3RWGB 3WQOA 3FFCD 3UTSB 1XZ0B 4N0UE 3IV8A 5EU3B 2J1YA 4QHNA 3FTXA 3LNIA 4YHYB 1QFPA 3ZGIA 3Q6FA 4FEMA 3THCA 4ZS7L 5BVPL 1TPH1 1CQYA 2XJ7A 1QUMA 3L5WA 4I0PD 3QUYC 3U4EB 1MPAL 4GD0A 3GTTA 4L9LB 4JKPL 1TJRA 1N7MH 1ZT7B 4HK5A 5E4EC 4HIJA 4KTYA 1BWWA 1QTSA 5KZ6A 1AGDA 1AKJB 4P7NA 2BM3A 3H9SB 5B39A 2V2TB 1DWJM 3MC0A 3LKSB 1S5MA 1S3RA 4NO0B 3T6WA 3FYYA 4NI3A 2EE3A 1AS6A 1EXGA 1EERB 1A7RH 3HKZA 5TE7L 4ZO6A 3M0XA 1G7IB 3QPQD 3EXTA 3B2VH 3OG6B 3TW6A 2YBTA 5CBAA 1XW8A 3BZJA 2F38A 4NNYA 2CJSA 2XFFA 3GNRA 1YEGH 2BIQA 2ZKYA 4OGQC 3H9ZA 2A5HA 3F64A 2PCXA 2WB5A 3ZIYA 4HETA 1CECA 3KTSA 3ABKB 4KK9D 4GW5A 2YW3A 4WW2C 4DWSC 2EYSA 4Q8WA 2H2SC 2C7FA 3IXAB 1W17A 5F3BB 4GJJA 2V37A 5DVMA 1D5XA 3RWIB 2KBGA 2F8QA 4A68A 1UFUA 1E1CB 4TSCH 1PBGA 3WXVL 3AHTA 4H8QA 1P5UB 1B3ZA 4S3GA 4Q8VA 3IRCA 4KRPC 3WQEA 1M7IB 4PR5B 3QYQA 3AWFA 4LHJB 2QQNL 1OTUD 1ZLWK 2P53A 4RRPA 2XBTA 5J57B 3SFWA 3V1PA 3DO7A 3RVXD 3RJOA 5LXGH 1F4WH 4P04A 4AWSA 1VHCA 4PB4A 1IB5A 2YL5A 4JZOA 1F6KA 2FB4L 2CKBH 4PCKA 1BXCA 3IK2A 3VVVA 1LJMA 1BD2B 1J9QA 2G75B 4OQTH 4U10A 1AFSA 1E4JA 2W63A 4W7VA 4FXJA 2HROA 4GXMA 3P3YA 8CGTA 1RIUH 3PAUA 2QS8A 3TN0A 4MCYB 5C92A 1FHLA 1AHMA 1QEWA 3L4VA 2X4QA 4CNPA 1ZAIA 1H0DA 3C0LA 3HS8A 2FT6A 3HC4H 1XDLA 1OQXA 1A0EA 5FJIA 2IXQA 1G7VA 1HKIA 4MJIE 4OGYH 1QUNA 3OXRB 5FW8A 3NL6A 2F58H 1U8IB 3NEOA 5DVOA 1UC5A 1JP5A 2WXRA 4YZFF 5DCEA 2XWJA 5HHPB 3VKBA 1Q8JA 2PDKA 3VOHA 2IMMA 3ARGA 4JVUA 3L9RA 1A7QL 4JTFA 4U1JA 5I24A 5FJUA 1XR8B 4IHOB 3FUNA 1JGDA 4JQ2A 4K7PL 2BVUA 4ADTA 4XH2B 1A3LL 1ZL1A 2HUEA 1IGYB 4IHCA 1KYDA 2IOIA 3WIAA 1G4EA 4NAEA 3ITLA 2VGBA 4BI7A 1E1FA 1HZLA 1CZ8L 2OYKA 3GUTA 5B39G 1I0DA 3FT0A 3BAJA 4PH8A 1OHQA 1R5IB 3A3HA 2WJZA 4DKDC 5GZNC 4GKZB 3BQUB 3MJ6A 3OKMB 3OVQA 1KB5L 1X7SA 4JKMA 4D0CB 4G70B 4M6UA 2ZRXA 1FA2A 5C0JA 1N5AB 4WFFE 2QUVA 5FUCC 3PTQA 4K3DL 3SQBB 4JPWH 5I6XC 1G7JA 3PL6C 4XC3L 4HFWB 4JFSA 3DUHA 5ICYB 4ODXB 3AIQA 2K7QA 1LLAA 2UXFA 5T3XH 3E6HB 3GKAA 4WEBH 4XPAH 5MEOA 2WWCA 2CK0H 2NUXA 1YN6B 4C56B 2PLMA 1M6UA 3SDOA 5ICXA 3HG5A 4Y4KA 5TQ2H 4AZ5A 4UOJA 1YAIA 2PD5A 1GOIA 3ARZA 3QE5A 5MHSE 5GXBB 4GXVL 4UR9A 2E9WA 4P57A 5E6IB 1AJ0A 3MBXH 1AZCA 3FCUB 3VFTB 3FFDB 4BHYA 4FTVE 2EILB 2GLKA 4KT2A 2HVNA 3VIIA 2JJWA 5JA9A 1WT5C 5CS7A 4RRPG 4JJOA 1ETZB 3GR8A 4AL8H 3V4LA 2A7NA 3O45A 1G4SA 2YFNA 4N0FB 4JYEA 4UV4L 3AIBA 2VLKD 3FN3A 2KQNA 2HE8A 4LOCA 4EF9A 4MASA 4BR1A 4LRSA 2BHZA 1O1ZA 4O51B 1GYAA 4H8WH 4QGCA 5LA2A 3GBNH 2C71A 4JXCA 2FWLB 2CJUL 1NP0A 3TCEA 3BLFA 3IU4L 3QVQA 4PJAB 4Z23A 5AAWC 3AAZB 1Z0NA 2C79A 1HKLH 1UJTA 4IU3A 3I4EA 1B3OA 1BA9A 3VD7A 2DM7A 3D4CA 4FP8L 3P5YA 5CJQH 3WCZA 1JWUB 1Z5LB 2XA3A 2CBUA 3S97C 4KK6C 5I09A 3P3BA 1LP9F 2WV3A 1JDAA 3ATFA 3VFMA 3QCTH 1RUAL 1HJVA 2BNQA 2E6AA 4K1GA 1G1YA 4C7FA 2TSBA 1M65A 3JTBA 2NW3A 1EMTH 4O5LH 3BSZL 4JY9A 3GZPA 5AVQB 4K3EH 2UUDH 4MBOA 2KZ1B 3H55A 2EYSB 3QJRB 4R5VA 4XBSA 1DVQA 1SF5A 1FTXA 2PWDA 2GUYA 1SFSA 2A3TA 3F5WB 2JJSC 3VI2A 2FLIA 3EBAA 3FJ4A 1URLA 3EBGA 3ME0A 3KPQB 1WBYB 1VFLA 3WFCH 3IRSA 3V5DA 5FCUH 5FHBL 2IIJA 4TVPD 1OAZL 5D8ZA 5AZ2L 4OCLC 2OR8A 4W9HC 4ATLA 3VGGA 2ED8A 1QNPA 2CIIA 1Y6KR 2YK1L 4NBZB 1L7TH 5IG7A 1L0XA 3OB0H 3WLBB 2RALA 3PUGA 4WI3A 2WVUA 2ZG2A 4OIAA 4DAFA 3U83A 3L08A 4JZNA 5MENA 1NCGA 3RFZA 1JGLL 2RKXA 5DJ0A 3MRMA 2DQHH 1EXUB 2AI0H 2XU9A 4HLEA 4NQEA 3WZ0E 3GRWL 4PG2A 1MRFH 4LAJH 5CPNA 4HK3J 1PWLA 5FOBB 1Y0EA 1VJSA 3A9IA 5LZLA 3FUDA 1KEML 2CEQA 1JUKA 3EKLA 4W5UA 3M5YA 3ARPA 4Y16D 3L3JB 3XINA 4RIRB 3MZGB 4UTKA 3BK0A 2J4WL 3QUXB 1P9MC 1K6QL 2R39A 4Y5VA 3MRPA 5INDB 2X2GA 3CZEA 3UAAA 2VX7A 1V05A 3CFQA 3GEFA 1TZHA 3LLDA 4O54A 1BMWA 2O9OA 5JQ9A 2V3FA 3VGAB 2ENPA 2FEEI 1ODZA 1OXYA 4RFNC 3CVHH 3O6CA 4PJGB 4YE4L 4Z7UF 1NLBL 3EOEA 5C2UB 1XDMA 1KGXA 2VWTA 3OQRA 2P45B 1BVNP 1JYXA 5IQ7H 4G7RB 3ROLA 4NX5A 4PUBH 4J6RL 2M83A 3CK0H 3DBPA 1AD9A 4QYOA 3BW9A 3QT2A 3B9NA 3ZZ1A 4EZMA 3L0NA 3GNXA 2G3FA 4ZUVB 5BMFH 1SRDA 1ZHNA 1JF1B 2NSMA 5J1AB 5BO1L 4QRRE 2LU4A 1BYBA 1PEZA 3B5HA 4I3SH 4L29A 2NQDA 1FNLA 2K4WA 4AVHA 2ZXCA 4UOQA 4PY7B 1BMZA 1JPTH 4Q14A 3OA3A 1IBHA 1L0PA 5DT7A 2AP2A 3D2UA 3BMVA 1BXBA 1QI5A 3V6ZB 3F7YB 4JHWL 4I18B 3W2DH 4KY2A 1ID2A 4HX1B 3THUA 4IK6A 4HK7A 4KZDL 1NOUA 3BGFB 1LOSA 4XD6A 4LY4A 1JPEA 2ZWKA 2DVTA 1I8IB 3N9GH 1HZKA 3NM3A 2HRWA 2HRLA 3R1GH 1FO0A 2EG7A 4PMVA 1OP3K 2Z4GA 3MRCA 4TVSa 3ZO0A 4PG9A 3IVKA 3D25A 3IVTA 2IMRA 2R2EB 4ZZKA 1KFKA 4Z78B 2Q8AH 4ODSH 3C8NA 5AQ0A 3AXXA 1C08A 3GSQA 4E4PA 4JX4A 4RW5A 5DDHB 3OZYA 5I1DA 2VRAA 2BOFX 1YMMA 3H6AA 4JTCA 2VL4A 4BUGA 4GQQA 2XOTA 2PYED 4KJYB 1L7IH 3RY5A 3V36A 3EO1A 3L9CA 4MWAE 3GMOA 3QFGA 4Z0XA 5FYLL 4AQLA 3T2LA 1JAKA 2PYEB 5JW3H 3VIOA 4WU7A 3L3DB 3LBCA 3CFBB 5G4EA 3VABA 4YLQT 4H9ZA 3SGJA 1DE5A 4QE1A 4NLAA 1AZRA 2HVJB 4X5PA 3TN5A 2R69A 3IE4A 4PJHA 2LFGA 3EMQA 3JYCA 5C0FA 5SWQB 3MOAL 3WJLA 4HT1H 3B2DC 4AK2A 2RR3A 4JX0A 4MJ4A 4AV5A 5IB4B 1DO5A 4QIUA 3Q48A 3C86A 1TPXC 4ZMYA 1GZQB 4M48L 2O92A 2EQDA 2VHLA 1JTPA 2X4UB 1NEYA 3D69B 1T5XB 3F8UB 4QDPA 3HF3A 1TQBC 4JDZB 4GBUA 2WTOA 5DQJA 1F5ZA 1OWRM 3W7GA 2KAUC 4YDKL 2V2XA 3QO1B 3LMYA 2EC9U 3VI4A 3WEXB 5GS1B 2V8ZA 3MCMA 1CICD 1JZEA 4CN6A 3DHDA 2REQB 4PJBF 3JTTA 1TJHH 3GS7A 2QSCH 4WFFD 1EX5A 1YY8A 4M7TA 3CD4A 1CB7B 4FSAA 4XNQB 3P74A 2JI3A 2X4OB 4DKTA 1L9OA 5CEXA 1CICB 2PO6A 1I45A 5HY9A 3N42B 2PF8A 4L64A 3PY2A 3ECQA 4NQSA 5IMKB 1OT1A 4IBUA 2WJ5A 4PULA 4JZNB 3WAJA 1Q6QA 4UQDA 2MTAA 1MW1A 3RFZB 3GSWA 4W6WB 3NWRA 4FX6M 3U6RA 3KPLA 3SO5A 2KZKA 4PI0A 2O9TA 4AZUA 4AJWA 1PLGH 4M4RA 3TXAA 2VDQH 2GCYB 1FH8A 4GZJA 5MHSD 3MQTA 4NQDB 2D7TH 4P3DB 1K8IB 3LGGA 3GLCA 3F7KA 5KANI 3HNVH 4FTVD 3AYVA 1KIRB 1KLYA 4AZGA 1JE6A 1R47A 3ZO9A 3KNBA 3WNLA 1U1JA 3KBNA 5IF0B 1YZZA 4GIAA 4AYMC 1KULA 1SJDA 4Y4HD 1H19A 4TQ8A 1GZPA 5CF3A 4PMRA 1TJGH 3PNRB 4XMWA 3STZB 4OLZH 3C2YA 4RUBA 5HVWA 2EYTB 5D1ZD 1XDJA 3C2EA 1SHMA 3JWNC 1KCUH 4O02B 5SWZE 3ZKQD 3OSKA 5FDWA 1BVNT 1P6WA 1XGPA 2R1XA 3W73A 2JCCF 3HN3A 3HV9A 5G4MA 3CV7A 5DFVD 4FQLL 5EMLA 2G5UA 4HJWA 3SCMD 4PB9L 4O00A 3FO0H 3BUIA 2GJ6D 2ZNWA 5I17B 3KXFD 3OBEA 4D8OA 4NQ1A 2Z64C 4TULH 3CFEA 4XMVA 1P0KA 3SCMB 5TD4A 3BXNB 4NJAH 1SR9A 3HIJA 2GJ6B 2NXYC 3S46A 5L8KB 2L7EA 2VDNL 2VENA 4D7BA 2AQ2A 3KHOA 4H00A 2OVLA 3KOFA 4HAKA 3PDOA 2F8IA 1FL6B 1PY4A 3XISA 2YMXH 4REQB 4JHUA 1OOWA 2VQUA 4FMKA 1NUDA 5KSAC 3MXVL 4JS7A 1UR1A 3FULA 4LCSA 1G0DA 2B1AL 4QHUA 1DORA 2OI9C 4LH8A 5DY2A 1G6RB 4HJGA 4MY9A 3FS9A 1MCWW 1JCLA 4BSVB 1FG2B 3S48A 5INCB 3D3VD 3IMWA 1FAKT 5DRCA 3HUJA 3VFOA 1A3QA 2ADJA 4JREC 4ANWA 1BVKB 3D3VB 1U8CA 1W2PA 1ZP3A 1G7MA 5FYLE 2QV2A 4NZFA 4JE4B 5MERA 1XLEA 4L5FH 4G56A 1TWWA 3DUGA 3I7RA 1FWEC 5GRWA 5BWFA 4HS3A 3N85L 4ASTA 3BJFA 2VO5A 4J7RA 3PTKA 4KZ0A 3NN8B 2DQMA 2V8LA 5HYFA 1NANI 3SYAA 4OV5A 1OFQA 2XWBB 1MCDA 1J88A 2NX5D 5G4WA 3PWGA 2CFFA 1PZ5B 5B1JC 1OC7A 2X4PA 1BSIA 4HPOH 3UYPA 3VXSA 1OAXL 1DXFA 5CC5A 2NX5B 3SUSA 3RI5K 5L9FA 2WQVA 5CNHA 3WSQL 3UZXA 4NJJA 2R1YA 4GEJA 1FWXA 4S3EA 1H7PA 5CN3A 1PQZB 3E8VA 5HJDA 3KYMB 4QRTB 2BP0A 3DO4A 4BFJA 5C71A 4Y9BA 3V4PB 4DELA 4QRQA 3WH8A 3RBGA 1GVFA 3UWEA 2Q86A 3KW3A 2VFGA 3D12B 4FLSA 1DKWA 3APTA 4FZIA 3TQKA 1EQPA 2IANE 1S7VA 2A21A 3WJMA 2DV0A 2DB8A 2IQAA 1ZHLA 5D71L 3QJSB 4FADA 5F8RC 5CUSH 4LLYB 1TPEA 5E5RB 1W2KT 3ZGHA 5DMLA 1CE1H 4I1NB 1IIKA 5BV7C 3B0VC 4J40A 4AT6A 1YYMH 3O15A 3TJXA 3EBHA 3VIHA 2QCDB 4AY0A 2XWZA 2KI6A 4PUJA 3CHQA 5BNXD 1AGBA 4KWVA 1E9OA 3A4JA 2PDHA 4MDRA 5H2BB 3HZYA 2EDNA 3NVTA 2OZ3A 1DIEA 3ZN6A 2GDUA 3H2CA 3GC2A 6FABH 2YD6A 3B8IA 5KZCD 5EMYA 3IGLA 3MYJB 1QABA 2Z7KA 1I7TB 4UUIA 3BLIA 4GBXB 1DUYA 1ZHBB 3SCPA 3CUHA 5KZCB 5F4XA 8XIMA 4TYUA 5D7LB 2YD4A 4O9HL 1UEYA 3S88L 2AEOA 2ERJC 1OOAA 2FO4A 3BAEH 3HPJB 4J3ZA 4QDWA 3VZXA 2FZ3A 2PO6B 4QRRD 3K0WA 2N3JA 2W9DL 1S9VA 3GXFA 3RVWC 2WHKA 4PJXB 1X1NA 4QHKJ 3ZL4L 4F7PA 3BOLA 2GC7C 1LD9A 1Z5YD 4TL4A 3NM1A 2VQ1B 3VPLA 3O6LL 2KZBA 3UP6A 3O9WA 3U6RB 3KPLB 4ZBCA 1MWAH 3QLLA 1JGMA 2WXMA 4YQXH 4TNWF 1W0MA 1T2XA 3O3EB 1CLCA 4JB9L 2OZNA 5IJCC 4G8IA 1A1OA 2APSA 5K9OB 5KYWB 5AHNA 5D2YA 1JRHL 4M5ZH 2WXQA 5MI0B 2ZZ2A 3BMWA 1IQ8A 1EGMA 4I9WD 4YDMA 3HZVB 1T1XA 4HZ6A 2I5IA 1SXBA 1NEZB 2VITA 3GIQA 1GZPB 1BREA 4WKFA 1BQCA 1MF2H 2D73A 1A2YA 1R24A 3BW3A 4X5WA 2NY5L 4G7QB 1OC6A 4JJHA 4RAVB 3DDFA 1KBGH 3WL9A 4AJ0A 2BC4B 3KM2A 4QRSB 3MJYA 1WZKA 4YFEA 4M00A 2J27A 1D9KB 2XA8L 4MWAD 3MLRL 3W56A 1F1GA 4H26B 4FYTA 3SKOA 3UW6A 4GW1B 2H47C 4D94A 3UGXA 3W2LA 3CSBA 1I1YA 3VG0L 1DEDA 5GGQH 4YHKH 4KIRA 2OSYA 1ME7A 4UQ2B 5HPCA 1JS4A 3H4WA 3MHZA 1S7WA 4LEOA 1J18A 3WTTA 3EX3A 3WLOA 5K2ZA 1YNLH 3SN6N 1KF9B 1SYVA 4MRBA 7ODCA 4DK3A 5IFAH 3LB0A 3PWVB 3DIFB 4IICA 4PWGA 1BGAA 5JQHC 3P80A 4YEEA 2HAZA 2C9PA 4OLVL 2CE6A 3ZXAC 8TIMA 1HESA 2EAEA 4G83A 5HYSB 4HMEA 1RAMA 4LCCA 1X44A 2NNAA 3FU8A 5LAXB 2OPJA 2R2HA 2EYRB 3KPSB 4A8RA 4I87A 2OB3A 1NC4D 1SFDA 4FXSA 5D6CA 4YBLB 3BPOB 4J5VA 2BS9A 1XINA 4U1LB 1PV8A 3GPEA 4NQXB 4GMTL 4JO4L 3FDGA 4I5RA 1KB9K 4ZUUB 5LHDA 2A9ML 2PFHA 5FI8A 1D5IH 2IH1A 1ZAHA 3BEWA 3O2DL 4WJ5A 2P46B 3HOGA 3BVXA 4HBCH 5D6DC 3V0TA 2XSAA 1VADB 5EA9A 3RP1A 5AHIA 2ZWLT 4LMQE 4P5UA 2Z7YA 3K6SB 2GBTA 4M62L 3OZLA 1AQHA 3VXSB 3C5JA 3Q9PA 5HDWA 3UIZA 1R3RA 2OMBA 5KINA 1JK9B 5D1ZI 1M6OA 1TMHA 2BP0B 1QDSA 3SDXF 5C2BL 1T22A 4B3VA 2XKNA 4AD3A 1BBDL 3BVWA 4PRAB 5EUOA 4H2CA 1T2QH 4MA7H 3EA2A 1HKFA 3C6LD 4JIPA 1CE6A 5CIPB 1V51A 1EUNA 3WG6A 1CDUA 4FXGB 1UVQA 4F7MB 3TYDA 3LZFH 2CWRA 3ULVF 3UYIA 2DH2A 4AQ8A 1XIEA 2AMGA 5D1QA 1JWSB 4H25B 5SWZD 3VB8A 3M8OH 3PRZA 1TYJA 4K71B 3TOYA 5A8GA 2DVXA 1T3FA 3ZHLA 1FDYA 2YLLA 4BKSC 1J9CT 3E0LA 2ZPKL 2TMDA 3THMH 2Q76A 1KJMB 4DI8A 3VXRA 3LEYH 5CJXC 5LNEA 3T3PE 3O41A 1JV2B 4QI3A 4UNUA 4J2MA 1TWIA 1NBCA 1OM9A 3DI3B 4TQTA 3IJSA 2OXGA 3QG7L 3NPWA 5ABFA 4LOFA 2OTPA 4IJCA 1BZDA 1CCWB 5EBMB 3HA0A 3R89A 4WJEA 2XSXA 4C4BA 1LG1A 4U6HA 3DPDA 4N2BA 3FUFA 3KLKA 3RWCA 2WLNA 3BP4B 3W2NA 2HKFL 1NGXB 2IALB 4TNVK 2HNHA 1PKNA 1O4UA 2OSLB 4PTVA 4S0SD 4XB8A 2QZ5A 4FG0A 3EX2A 1OAJA 4MZ8A 3QEGH 4FHKA 4KI5C 5E2JA 3T81A 3TR2A 1DVXA 4B50A 3VFGH 1FZOB 5CPLA 2YGPA 1HHJB 2VH5L 3GUWA 3NQ6A 5I73C 4JKKA 4LPCA 2VVNA 3GU9A 1F3WA 4XAFA 4E41E 3WFEH 2FYMA 5ANMB 3WUWB 5AW6B 2YZ8A 1FYTE 3B8VA 2ZRZA 1KCSL 2X1WL 1ZUAX 2F8VA 3WN6A 3SPCA 2QDHA 1K4CB 3DZ1A 3GC5A 2GJLA 4ONFH 3LB6D 4X2RA 1Z9SA 3C08H 4P7LA 4Q7DA 1K1DA 4ERAA 3T3MF 1UYWH 2DZEA 4NAMA 1BZ9B 1EL3A 4OIBA 4LNVA 3LKRA 3LX9A 1QPNA 4P3CH 3TWCL 3GTIA 4GGBA 2FFIA 3MROB 1QSVA 3KCJA 3SCTA 3UTSE 3T4AB 3W9EA 4WDXA 1T0PB 4N2EA 1GOMA 2NY0D 4I6KA 4LCWB 4RL3A 2IAND 3WELA 1OP4A 5I1IL 2Y3NA 3QXAA 3UT0A 4DF0A 4FG6C 2NY0B 1UWXK 1B54A 3DG3A 1AO7A 4RMVA 4I48B 4I7WA 5DJYA 4TSAL 3ZIZA 2MCPH 1CX9A 3V0HA 4JMXA 4C6JA 2ZP8A 1VACA 1BAFL 3F4DA 1YEEL 3S1WA 4GAGH 3GSNB 4MADA 2W65B 4G3YL 4PPTA 3H9SE 1NVMA 1PCWA 4Q6JA 4WTWA 3VNKA 3V6FA 4HJEA 1G9MH 2YPVH 4OZHB 2V17H 1A9BA 2Y1AA 3MKVA 3IV3A 4KROC 1OP9A 1U9KA 3THAA 2X6AA 2ICSA 1P84J 3K71A 1MFNA 1G69A 3N14A 2YIHA 2FDBP 3B8TA 2CC0A 1CXKA 4K8RD 5BXPA 2YD7A 3WLWC 4AEFA 1RPUA 4L8CA 4WJ5B 1P4LB 3C6EA 3LZ5A 4MNQB 4OFKA 3TH2T 3RJXA 2YO3A 3IWPA 1OF6A 3LEXA 3S34L 3K5XA 4YK4C 12E8H 1HJCA 1HTIA 3QFEA 1GORA 2A1WL 3LHZA 4PJ8B 3OKEB 1QEXA 3MZ2A 2IQTA 1S2VA 3FO9A 3RY4A 5LIUX 2NSXA 1IR2A 4JPSA 2C9AA 2O56A 1FHNA 5D05A 4TOQA 2PUZA 4G6FB 3DIPA 1GYUA 5JTWA 5HGHA 5CPQA 4QG9A 5ACZB 4RBPK 4IIQB 3CDYA 4YAQB 4LVAA 4AENB 1KLFA 2GGIA 2FX7L 3HKFA 4GOSA 3QS2A 1P4BH 2VQTA 2ZSWB 3DHPA 5IM7B 5FEPA 3U25A 4JUSA 2IDFA 2KZHA 2QKIB 3H70A 1BD2E 4M6OL 2FAUA 3WFBH 2BY3A 3QHZL 2WM1A 3ZL2A 2DIBA 3WS6C 3M44A 4DQOL 5B7EA 3X12B 3SGKA 3EJJX 3G5VB 3OF6D 3TYFB 4GXPA 3G3MA 2OTUA 2YN5A 4D3CL 4DXXA 1E6JL 2R29L 2VISA 1DQUA 3RNQB 5T26A 2Y7GA 5JU6A 5DO2D 1W31A 4UFKA 1EJ6A 1A25A 3UWUA 1KLUA 3UL4A 3UZVA 1O5RA 1KRCC 2VXUL 1PS9A 3RCMA 1F8IA 1DQLH 1VJZA 4TVPL 1Z9NA 3S3SA 4ZQCA 2ZAHA 2OMYB 4KVNL 3PABA 2BGSA 3AY4A 4ZO8A 1GVOA 2Z9TA 1W8GA 4K23L 4AGMA 1QO5A 4M4PA 3FF8A 4JY4A 3T2OA 1CI1A 2WMFA 1FLRL 3N0AA 4NUQA 3C09C 4IP5A 4EPEC 5DTFA 3HVNA 2PTWA 4X0KA 1WEJL 3GX9A 4QOKB 5F7UA 3Q8CA 5E5UB 4P5KB 4WO4C 1N0LA 3T0EA 4LRNH 4NRZB 4PTDA 3SD5A 2VJXA 3NGJA 3L65A 1DSFH 1MCOH 2R6OA 4OV6F 3CN2A 4UM9A 1MHEA 2Z7GA 4ZMOA 2V5KA 1Z89A 1XKJA 2V7NA 1FY6A 5TPWL 4HUWB 2NTFB 2H1LM 2DD8H 4G6AD 2CUHA 3HE7D 2ITDA 5G4HC 4HJJH 1VC4A 2JF7A 5IY5B 4MVAA 1I31A 1FXQA 5CFHA 5TE6H 1KFAH 43CAB 4ELMB 1I3UA 2IAMC 2QW5A 1NDMA 4MXWL 5HVHC 4C56E 4JRXB 3ESOA 5ECJE 1WTLA 1KZQA 2WKOF 4KXCA 3KL3A 3DESA 4WX2A 3J07A 1XYLA 2VLJA 4XXDB 3VCRA 3SQSA 1S8DB 4NJ9L 4PJFB 3BVDB 3UABA 4OLUH 4KEUA 4PGEB 1XCWA 3LIZL 4ODWB 1R3JB 1CFTA 4IPJA 5CZJA 4EF8A 3AT8A 3IUIA 4DEFA 2X0YA 5FKPA 2NVCA 1JXGA 4AXWA 1PKQB 4IRSC 4XO8A 1OW0A 3C9NA 4PMZA 3WY1A 1D6EA 3ARDC 5ILTH 3MOQA 3RVTC 2YYUA 3O8XD 4AH2B 4S11A 1EFQA 3VWJA 2BFGA 5DGQA 1ODAA 3ENEA 3O8XB 3WTSA 2YR1A 1VBHA 4KZEL 4YN5A 1A6UL 4PJAE 1XIGA 3V6FB 3RGVB 3H8AA 4ZX4A 1X9QA 1HL9A 3HB3B 2B39A 2BJMH 2W91A 3HCVA 4NPJA 3KPOA 1WE5A 4PU2A 3L45A 3UNDA 1AMYA 3CASA 2VDOH 4OAWB 1MCQA 2N01B 3HZMA 4OZ4B 4KVPA 3I75B 1YX1A 1WYIA 3A12A 1RZKC 2ZC8A 4Y19A 4G59C 4JDEA 1MCNA 1NC2D 3DN5A 4C91A 3SDAC 2X3CA 4Z0BL 1JRBA 2OXHA 3GSOB 3VYNA 4FZ8L 1W3LA 4FHAA 3BH4A 3EB2A 1Q1PA 3P3RA 4Z7WF 1A14H 3QGKC 4EDWH 3L1OH 1YE6A 1UZHA 4KNTA 4YZWA 4LTSA 3W7HA 1XBXA 1N18A 3VGBA 4EO5A 3DC8A 2OMAA 4ZTOL 3B40A 1IXNA 1DANU 5IB5B 1MUMA 3RU8X 1EP1A 3TJ4A 4BFIB 4NENB 1NAMA 2BSTB 1WC7A 4AEIL 1IAOA 3S8FB 4K8HA 3DVIA 5KW9L 2ZXDA 2BNJA 6PAZA 5KAQG 4PRRA 2JJTA 4IHBA 3IF1A 4E41D 1LBLA 3QUMH 3KBFA 3JR2A 1FYTD 1VKXA 1ZWIA 2PURA 4X0VA 1XL6A 1I1CA 3C60D 1SVCP 5KWYC 2YCLA 1JJKA 2EPMX 3GW0A 3VDAA 4JQVC 1TU2A 4TVPE 5B8CC 2VR5A 1FBIL 3SN4A 4Z6AT 2NYYC 4IQLA 4DERA 1MEWA 1KRMA 3T5WA 4ZXBC 4KKAC 4CVZA 1N82A 1L0QA 2QBWA 2Q20A 2UZPA 5C0DA 3F5KA 1X5XA 4LAOA 2BDNL 3JVGC 1OFBA 2ISVA 2FO8A 3PTDA 2KYIA 1HINH 3SDCC 3UTSD 1I75A 5BUAA 2OTUB 2J21A 1KD0A 4WW1A 3T4WA 2E47A 2WB7A 3L13A 3MMWA 4D0BA 2PS2A 2JK5B 4XCFH 3BLDA 5HDBF 1CLZH 3EXLA 4P9HH 3TYGH 2V3GA 3N3MA 6XIAA 4GNKB 1A6TA 3LCFA 3DOPA 3FOLA 3V5OA 3WDHA 2ZXAA 2YQ3A 4IMEA 2QVFB 1EX0A 5HQEA 3STCA 2W60B 2E6DA 3TYCA 5XINA 1AKJD 4R2GC 3ARUA 3E5BA 3H9SD 3S5NA 3LTPA 1I7UB 2GABA 4PJGE 3B9DA 1V7NL 3WOVA 5LGZA 1UOWA 3TZVA 3SE9H 7REQB 4B60A 4BFOA 4NO0D 2BOCB 3F2LA 2Z1WA 4LFHD 2FJSA 2EEXA 4M7ZB 1O5KA 1LLZA 1AL8A 3QRHA 4U1IB 3FGCA 3JTSA 2PW1B 1X5MA 2PBOA 1FKXA 3AXLB 4OZIA 3PHAA 4QDMA 4AGPA 4OLYL 3B03A 2HG5B 4XOCA 4CUCA 1OM3H 1SUXA 3GFXA 5DHYB 3PPFA 1MHEB 2GOUA 4IPIA 4OJAA 1EO5A 2Y36L 3INPA 2E4FA 2YD3A 2YWZA 2ZZ1A 4GI6A 4U05A 3R25A 4O02L 4BCXA 3WLTA 1GGBL 1WFTA 4P4KC 4AVKA 2VM3A 1OINA 3OD3A 1I9EA 1DBJH 3TU6A 5ID0A 3WQGA 2M26A 4HCRA 1DZBA 1EUAA 3ANVA 4LCYA 5C97A 3L4CA 4OCSH 4WJXA 4P9ML 1J12A 4UIOA 1CFNB 3SJVD 3QHTC 2A6NA 1CFBA 2OR9L 1A6AB 3WKYA 4GCXA 4FN0A 3ID7A 3SJVB 3EXSA 4MXVF 1EJUC 1KWGA 4CLMA 3C5SA 1RQHA 4MLRA 1UCWA 4ORIA 5JA8B 1HCZA 2I32A 2NVAA 4MSWA 3IDUA 1L5GA 5G1YA 4YX2L 1ZBWA 2BY2A 4E2DA 1VLIA 3DHJA 3A13A 5GZOC 32C2B 1T03H 5JPMB 4MHHI 3FB5B 1AJ2A 4IJBA 4JFYB 1H5YA 1G6RL 2XT1B 1BD2D 4YXHL 3W7RA 1ZT4B 5EUKB 3B05A 3RL2B 3KVMA 1MQPA 1KLGA 3K7UA 2X53A 3GTVA 4Y7EA 4P8XA 3ZXWA 2WXGA 1PZUB 5I77A 5BRQA 3IVUA 5CWSA 2Z8WC 3GWJA 2FK9A 4LYKA 2PYEE 3IFOA 3E2VA 4XWOC 3H2QA 1HI6A 4AVFA 1QBML 5IVZB 4HSCX 2DSUA 3K4DA 1R3VA 4E2BA 4W93A 1D2KA 1TJMA 5IT2H 4W87A 2JKRM 4GG8B 1SVBA 4PEKA 2NXZC 2BMKA 4OFYD 1R87A 1N3NA 5D2LA 3KYOB 4MPKA 1W0WA 1I2NA 3T0TA 4DW2H 5DUBB 4ZSTA 3ULUF 1I1AC 3OX8A 4N26A 5AL8A 4HD5A 1SUJA 3GO2A 2QL1A 3BPCA 3HG3A 1CLKA 4LMQI 1ZAGA 3AMLA 4ICWA 1MWOA 3WO4B 1MQ8A 2VXVL 4RSYA 5LA0A 3V4PL 4UFJA 1D3CA 1J8RA 2V9RA 1OGAA 4CNIB 3FBKA 1UZDA 2Y1VA 1F1DA 3CQIA 1QRNB 3BQUD 4XZNX 1X1OA 3W6MA 1KXVA 4HPXA 3RX2A 1A5CA 3DX1A 1MIML 1SVDA 1M41A 3VW3L 2PD9A 1UA3A 1NARA 4ZTYA 5DEGA 4JKNA 3EFDL 1U8KA 3GRIA 3DRTB 1XGYL 2Y3AA 2Q9OA 2FBJL 2NCMA 2VXTL 1IL1B 5KYYB 3AICA 4IW4C 4AFYA 4QXTB 2NV1A 3QJFB 5HI3D 4C56D 7FABH 1A7OL 4QRAA 1IBDA 5L6YL 5C8BB 1A4BA 5B22A 4HPJA 1Q4WA 3FT4A 2GFBA 3FCPA 3N43F 2XTSA 1V7AA 3KPTA 3EOTL 3EGSA 3MLUH 4NQDE 1F2QA 2JV6A 3EADA 4WK9A 5E6ID 1DVJA 2I9LA 3ANUA 4P5TA 5DD0L 4FIQA 4QHNB 5AKQA 2PP0A 4Z3JA 3I6EA 3Q6FB 3KPPA 3WKML 2AJVH 3QFWA 2G3ZA 4P0DA 3RDTC 4KJPC 4A3QA 1JRHI 2QHLA 4IG2A 1LEGA 2YGVA 3L5WB 2YSWA 5CPSA 4LPVA 4LRTA 3DX0A 5E2VH 1G9NL 1WFOA 1W6WA 4HXBH 2DQDL 2FIRT 3TZVB 5HGAA 3LYEA 3QNZA 4HIJB 2XGIA 2PXYC 3UXDA 1AGDB 5CCGE 3SKNA 5FF3A 3QAZB 4R0LA 2HLAA 5B39B 4Z7NB 1C9SA 2RA1A 5IROD 3ARTA 4ZQRA 4GJTB 2GJ6E 4X4YA 2L5HA 1X9UA 3KXFE 3C3UA 4XPTL 1FP9A 2GJXA 4K5LA 4OOZA 1N8FA 2P7TA 2XZCH 1DWGM 2R9RA 3M86A 1FNFA 5CBAB 2FQDA 4NNYB 3X3GL 1OTTD 3QRBA 1TZIA 1UB6A 1Q6FA 5JPNC 1RQBA 4A8NA 4BZ1A 1QWUA 3HE6A 3SBFA 2DSVA 1LDPH 3ZMRA 5AC5A 4GW5B 2BSLA 1QO3A 3BSMA 3W3OA 3L1GA 4FABL 3L3GA 4MMXC 1D5XB 1H15A 3D3VE 4M8RA 4KUZL 1E56A 4JM4L 3U79A 3FJ6A 2H0PA 8FABA 3M88A 5KYUA 1S7UA 4GO9A 3C5SB 1ECZA 1AZ2A 3MLVL 3VIPA 4MSWB 2PCPA 2DOCA 3MPCA 4UOW1 4OZFA 3CAWA 3KHJA 3IWVA 4P2OA 2B0MA 3DO7B 1E0WA 1OLZA 4MBRA 4EI6A 3U2JA 3MYOA 4R26H 4ERGA 3TLRA 4RQQA 2NX5E 1IJ9A 4JZOB 3X1FA 2V7HA 1URIA 2OZ0A 3F1QA 5A95A 1N6UA 3TZNA 1XC6A 1M03A 3W7EA 1T7YA 4W89A 1OGTA 1VBGA 1E4XL 1I9IH 5D7JC 5FSDC 2WGNB 4ZXOA 4YHZH 4BA8A 3TN0B 5T33L 2X05A 1JZ4A 3UDWC 1OB0A 3CHOA 1QEWB 2X4QB 2YD8A 1H0DB 1MVUA 2B7PA 3QUXD 1OCNA 2IXQB 2XIJA 1QUNB 5DA4A 1QFUL 4H0GA 1KR0A 2EIDA 5D2LB 4WIWA 2F6XA 2XWJB 4LAMA 1ZU8A 4R9OA 3OX8B 1MEXH 1KGWA 3ETBF 3ARGB 4ZQOA 1TTGA 2X42A 3IN0A 2CZNA 3TESA 3L9RB 5J5RA 3AB0B 4U1JB 3P62A 2O6EA 4Z7VF 2OLSA 4KWOA 4ZL1A 3TV8A 4EE2A 1JGDB 4LIQH 2E46A 1A6WL 5F6IC 4QNWA 2P49B 4QBXA 2WVSA 4W7WA 4NAEB 4LVHB 5ICUA 2XM1A 3BE7A 4PUKA 2CG9X 3HNSH 4ZX3A 3GUTB 2LTQB 3PZIA 1CCZA 1XUZA 3CYVA 5D7LE 5CD5C 2FDSA 2L7QA 3DG6A 5DHMC 1OYCA 1RI8A 4KKCD 2WZ6A 1UUOA 5C0JB 4HJSA 4WGXA 1RV6X 4KEMA 1RU9H 4PJXE 2ZZ5A 3ABLB 3VE0A 1G7JB 3BUQA 1SW7A 5LNUA 3RCYA 2PP1A 4XKMA 3NA9H 4DEPB 4EXPX 1KENL 5CGBA 1THFD 4XP1L 5MEOB 1IEWA 3PZOA 1DQWA 4Y4KD 3WYZA 1B0GA 5G2HA 1UOLA 5F96L 4LSUH 3P40A 5ICXB 3KLLA 4Y4KB 1PZ0A 1WV2A 5A2JH 4JVWA 5CXPA 1UT2A 4EXBA 5EZJA 3OAYH 4FOKA 1AQFA 3MI2A 1HP5A 1XF1A 3SQMA 5I1JH 2WZIA 3HRZC 3VFVA 3FS2A 4P57B 4Z9KB 3MVTA 3OLGA 3NZGA 1YHTA 4CDGC 1NCIA 4QJ1A 4G7EA 1AR1D 3E9AA 4I1PA 4I9WE 4FQXC 2OBGA 1QVOA 3D18A 3ZHFA 4MQXC 4OZFG 1TEFA 2CZFA 1AR1B 2JKXA 3O45B 4OJYA 5DJDA 4GUOA 4L6HA 4GS7B 2KQMA 4BI6A 3TJPA 1K4HA 2MQGA 5EIVA 5CEYA 1I3GL 3MTWA 4OT7A 1WISA 1RZGA 1AODA 5CJMA 5KS9A 3AC0A 3CXFA 4Z7OF 4N9EA 3NZ8A 4WSHA 4K94L 3H6JA 4IU3B 1QXLA 3UZZA 3MBEC 3TEXA 4W6XB 2XN9A 5B4MC 3QIBC 4IRZL 3KAOA 2BNQD 2V5LA 4YDIH 5BOFA 4XP6L 4X7SL 3O2WL 5J13B 3F62A 1RQEA 3VFMB 3APCA 2D0HA 3UWQA 1JK8A 4R8WL 2BNQB 3DI0A 5HULA 4G5AA 1YQVH 2E67A 4GISA 1R7AA 1TZ7A 5GS0H 3K1DA 5G2IA 2NW3B 4EBQL 1RJLA 3KPSE 1J0IA 1E43A 2ORBL 1G01A 2QF8A 1JPFA 1U58A 2BWDA 2FGWH 1KBWA 1H15B 3BAWA 4WUKH 5C7HA 1A5NC 3JWDC 5DMIH 1WAAF 3ECVA 2E75C 1S2UA 1YPXA 1XLDA 4F8PA 1DHKA 3R18A 4H8PA 3ME0B 2V2DA 1UM4L 1TPWA 3V95A 4M8VA 1FP5A 4P23C 1UWEL 1ISYA 3V5DB 4Z77A 3VCLA 1MIEH 4OF0A 1YJDC 1XYFA 3DARA 1OC5A 3U7VA 3NESA 1CR9H 3GSNL 5I8KH 3VDCA 2CIIB 4ZT1A 5MEND 3GU1A 5IG7B 4BQ3A 1KIUA 2FVKA 2V7HB 3UR5A 2W27A 1GJUA 5DRIA 5MENB 2WGXA 1PAZA 4IJ3C 5DJ0B 3MRMB 3QW9A 3V52L 2J43A 6ALDA 3Q45A 4NQEB 1F3RB 3CLEH 4NQDD 1NFDF 3UY7A 3QI9A 1HK6A 4ABVA 3LXCA 4TVDA 1JVKA 2ADGA 2J7EA 1PVHA 2W4XA 1FNHA 3IRPX 2WOQA 3ZKMC 3UR2A 5CJBA 2CBJA 4K8RL 1KJVA 3VX0A 3E7JA 2EH8H 3MLSL 2NY3B 4UTWA 4KXZI 4M29A 4A2FA 2ZG1A 1TYRA 2AQOA 4Y4FC 3WNJA 3I6TA 3BDBA 2ZZ4A 3FUIA 4Y5VB 3G1SA 3MRPB 3B0YA 2O1AA 1X5YA 2CKBA 5AYBA 5GJPA 2DLFH 1TZHB 2MQCA 1BFSA 4OQTA 3S5ZA 3GNOA 5LNWA 4YWGH 1QTWA 4UT9H 2DVUA 4CU8A 1GQJA 3HMJG 5EA0L 1CXHA 3MNZA 5C0EA 4PI2A 3ZYOA 3CS2A 1GY2A 5IR1A 3APFA 1XGDA 3LGDA 1KPRA 3CWHA 2APTA 3UZEC 2C9SA 1X7QA 1NKOA 3WFZA 3ROLB 2BGQA 4DBSA 4J3WA 2C9RA 3M4HA 5J11C 1VS1A 1KSRA 1HWHB 2FLRT 4AX7A 2QHAA 4OBSA 1AD9B 3FYOA 4QYOB 5LXVA 2ZE3A 1UD2A 3BW9B 3N25A 4MB3A 3UYCA 4Z8FH 2P5NA 3RB5A 4N9OB 2ISDA 3HR6A 4ANVA 1ZHNB 2C26A 3OHIA 3WF1A 2RFXA 5BU9A 2BMBA 4L29B 2H26A 2OA9A 3SPGA 3ZE2F 1BEYH 1VBJA 1RZ7L 2DIKA 1EIBA 1F3DJ 3MC5A 2HLEB 4U6VL 4Q32A 4GXUN 4D7PA 3WK1A 4J4PC 3D2UB 4ONGH 5CMAA 5F7MC 5CBEA 3CQPA 1L8NA 4LANA 1MRCL 5ANME 3F7PC 1GEQA 2AK1L 1SVZA 5TK4A 1FFOA 4R83A 1RURL 3EF4A 1I8MA 4A8LA 3EO0A 2EBNA 1ILSA 1ZNNA 2G4GA 1GVIA 4K2UL 3WD2A 1FO0B 3FCTA 1TVHA 1BZQK 1PIFA 3MW7A 3OB8A 3HHMA 3OZ9H 3MRCB 4PG9B 3IVKB 3D25B 4E4FA 1NP2A 1P0NA 5DJDB 2PW2A 3KHDA 1BQGA 2B20A 5LNSA 3AIWA 4LVNB 1C08B 1P7KA 3GSQB 3MLZH 1GGCH 3NUKA 2YRZA 2NWRA 5I1DB 4XPBH 1E9IA 3K1KC 4BKLA 3QUZC 1B3IA 3CSPA 1YMMB 3TEWA 5IBUG 4LCWE 3K8LA 2BXYA 1WZAA 4OLXL 3BCFA 1XYBA 3EO1B 3GMOB 4Z0XB 1QSZA 1GNXA 4GAJH 2DLIA 2DTMH 3MA7A 4WU7B 4FFVC 5J12C 5FO9A 1U3YA 5DMKA 2OMZA 4PGBA 2PR9A 4K73A 5F1SA 3ILPA 2H1PL 2DSKA 5IW6A 4PJHB 4W1TA 2WBKA 2DZPA 4X22A 1F45A 4D2JA 3VUAA 5C0FB 1N6QL 1A64A 4Y2WA 3S42A 2F8XC 1UR4A 4ZOCA 2IW0A 4L0YA 2NZ9D 3NURA 4OZHE 3HMWL 2QPDB 2L7JA 4GBXD 5FYKD 2DSZA 3UMNA 1A50A 3PAYA 2YAOA 4HH9A 5DQJB 5D7LD 4BKTC 2V2XB 5F1NA 4X83A 3C0QA 5AC4A 2PSNA 4MNQE 5K59F 3VI4B 4K5PA 3RF9A 1TEGA 2PO6D 2HJLA 3M1OA 3JTTB 3TONA 1AZ1A 3M0VA 1YY8B 3INUH 1XO8A 4H88H 2AJ3A 5K9KA 1TRIA 5CEXB 4YSDA 5DC4B 5HY9B 3M9YA 5HDQH 1BFNA 3S2JA 4XMTA 2LU3A 4ETYA 4RE3A 4FOMA 4PP1C 4NQSB 3FQ4A 3C5ZC 4JCLA 4L9YA 3B8SA 5EN2A 3GSWB 4HMNA 3F4VA 1JZ5A 3LEVL 1F3DH 3TBWA 1JFQL 4OCXH 2IWFA 4BFKA 3URQA 2DMGA 2VR9A 3QI9B 1NMCB 3GZ3A 4ZNCD 1HC1A 1BYCA 3VKJA 3TN6A 2OMVA 1E3FA 2A9CA 4IGHA 3NZSA 4M4RB 3LI0A 2ZKMX 4FQCH 3QMRA 2D20A 5DU7A 4F9LA 1N10A 5JXAH 4JO1L 3MGTA 1UKSA 2Z26A 3KNBB 1ZLSL 4QNPE 2UZ9A 4HNOA 3FSUA 4F20A 1JMXA 2IS7A 1G7PA 3EO9H 3PFRA 4E3VA 4UILH 5G2WA 4GY0A 3BJSA 3M5VA 3RLGA 1N2RA 2XTJC 1XR2A 1D9KD 3SW6A 7PAZA 1U92A 1A80A 5FDWB 4S3AA 1S7SA 4MCZA 1XGPB 5KYNA 3GYCA 2R1XB 4Y5YC 4CD6A 2IUZA 3FSZA 3KHQA 5I6KA 2L04A 5CILH 3E2SA 3UNTA 4EOUA 3NIFF 4XRCA 3CFEB 2K45A 2X0WA 2VDPH 5F7EL 3PQYA 3V7PA 3V0EA 3NCYS 1I6NA 4ICXA 3GBMH 3FIGA 2DWYA 3RHWK 4POZC 4E42A 1MCPH 4HSNA 4TXEA 3PDOB 2Z28A 1K6AA 3E49A 2XZQH 3EDDA 4CRPA 2DI7A 2EP6A 3SZ6A 3FTGA 4Y6GA 4N5ED 3N44B 3UEQA 2HSAA 5E6ZA 1FFRA 4QHUB 3P14A 3KPSD 3E02A 2BIOA 2F54A 1MY7A 3CVHA 4HJGB 3RWEA 4QOKE 1YXCA 1EHKB 1KGYE 3NPUA 1K7EA 3KYNA 5I74B 2J9ZA 4TQPA 4QTFA 3HUJB 3VFOB 4KFMA 4Y9MA 1FCUA 2ADJB 1V3HA 3C5QA 3HI1A 1U8CB 3ULUH 1BJ8A 1B3YA 1G7MB 5LGYA 2VR3A 1D5BA 3H3PH 5EOCJ 5HTSA 5MERB 4E6MA 1ZANH 2X1IA 2WC4A 5EOQH 2OQYA 3TA4D 2OR2A 1PY0A 4PLNC 4KRLB 3WCYA 4HS3B 1G4MA 4HNNA 1TRDA 4GXWA 1YADA 3V0DA 1LQSR 5EEVA 4OV5B 4C6LA 3VXSD 5H37H 4GXFA 4JYDA 4ELME 2TYSA 4N8UA 1S1PA 2ZKXA 3V8OA 4JRXE 2X4PB 3L7FA 1NIDA 4HS8H 2CETA 3UYPB 5K5YA 1TSHA 5DT1H 3CZGA 3K3QA 4IQJA 1LP6A 1DBBL 1P4CA 7CGTA 2R1YB 3QZOA 1OD0A 3W26A 3UCQA 4RPQA 2NNFA 2W66A 1V6XA 2SEBA 4ALDA 4PJFE 4CC0A 4AMAA 5T1DH 2RD0A 4QRQB 1PSKH 4QGTA 5C9JA 3DGGA 2C5DC 2Q86B 3U1SL 1YNTA 1TPUA 2X9WA 1PKQE 1S7VB 4XN8A 3WJMB 2IQAB 1ZHLB 4AG4H 1GZHC 3V3WA 1WK0A 3VCCA 5DJ6A 3PXLA 5GGTL 3NZHH 4APQC 5HNUA 4QF1A 4CC4A 2X9ZA 2GVEA 4AMKH 2YDRA 1O5XA 4ZUSA 3GBDA 4Q74A 3IGAA 4TKWA 4AT6B 4M5YL 5DC0A 3SB3A 4KITB 1AGBB 4O16A 4DBUA 1H0IA 1E9OB 3RU8L 3UZJA 3HZYB 1I1FA 3SZ8A 3CLWA 1XH3A 3LH2H 2K6WA 1XG3A 1B88A 1ZS8A 3NGBB 4YDLC 4GUGA 3NO3A 1RY0A 2FHFA 5I71C 4KKZA 1DUYB 2ZZ6A 4MVBC 3LZPA 3OPZH 2CCVA 3ETBJ 1JZGA 5HHOA 4MUPA 1H6TA 3CTLA 3BWWA 1XIHA 4FI8A 1UWSA 2FEDC 1P6AB 4U3CA 2FO4B 1A0QL 2WVVA 5C0AA 2FZ3B 3IUHA 3QY6A 1OADA 3W1UA 4CGTA 1E0XA 1S9VB 1NCDH 5CJOH 3OLIA 4TM9A 3SCUA 3UJEA 4F7PB 2ZCLL 2VZ1A 1LD9B 3WLRA 5LNDA 3O9WD 3CHRA 4ECLA 1L9NA 3SJ3A 5K9JH 2HFFA 2I9EA 1NGWA 4NNXA 4Z1YA 1N59A 4LEFA 1A6VL 4DVBA 3CPRA 3WH9A 1PBYA 4F37K 3O9WB 2FATL 2R0KL 1IVTA 1TDQA 2KL6A 3TOPA 3K2IA 3U8GA 1I9RL 2OQJA 2Q3XA 4R53A 4HU3A 4G8IB 1EAOA 1A1OB 3P02A 2WZEA 3WN5A 1CGUA 1CGTA 1PTAA 5JORA 3BGJA 3MGTB 3V5KA 1T1XB 2YQBA 1KG0A 3LH9A 2E9LA 3LHPH 3R7RA 2VITB 4YEFA 2K0RA 5I26A 4YHOL 5DELA 5FIEA 3M47A 1KJ3H 1A2YB 1R24B 3TTQA 4X5WB 3W70A 2P52A 1ZLVH 1GTEA 3H9HA 4CNNA 3CFCL 3H85A 2O5YL 4TLUA 3WL9B 3O05A 2AABH 4LCWD 5GSVA 1YVLA 4GWEA 3DJSA 5A3ID 1ORQA 3DJZA 4ODVL 4RGNC 3SKOB 1KNWA 3W24A 2E7LC 3NABL 4WSKA 3BT2L 1I1YB 2OLHA 4G82A 2QPFA 3QS3A 4QXUH 4KK8C 1V3LA 1S7WB 4LEOB 2A73A 3VTRA 2FJFA 2OZ4L 4EUPA 1AH0A 1G84A 1ITQA 3JZUA 1SYVB 2DQEL 3S37H 2FX8H 1BQSA 1UENA 1L9TA 1ASPA 3CUFA 2OO6A 3NCCB 5ISZA 1XX1A 2GSHA 4OU3A 4MMZA 3GHEL 1JZ3A 3BZFA 3OJVC 1AFVL 4M03A 3ZKXC 2XN2A 4L0ZA 3T2PA 3FAWA 4LCCB 4DBEA 2NNAB 2R2HB 3TCSA 3QIUA 2VDMH 1QFWL 3VCNA 5IHSA 5D6CB 1LO3H 3MX0A 3ZDZB 4AEEA 1PVNA 1F6LL 1CT5A 4CD4A 3VRIA 4NJIA 3HI1B 1DQKA 2ZIDA 2RDUA 4MNQD 4OT1L 1DQDH 3ASOB 5KUKA 2IPKA 2CH8A 1U8HA 4A2MA 2IH1B 3BEWB 1USQA 3IKCA 4MUZA 3TH6A 3TFKC 4YSUA 3G1AA 4KCWA 3P73A 3P0YL 3G9VA 3F4NA 3VKDA 4PJ8D 1E4KA 4GCAA 4H0LC 4GC3A 2Y9RT 3C5JB 4NX0A 1RQ5A 1TETL 4KQ3H 5DYFA 5PTDA 4G6FD 3GIZL 4LCIH 4N4QA 2CBMA 3WV0A 1ASQA 1M6OB 3VOFA 1T22B 2GSJA 3SJVE 1NM9A 3N2OA 2XKNB 2PLKA 4RWYH 5EUOB 4HGKC 4HDIA 3NAVA 1DVFC 1CE6B 3P60A 5BMXA 3LKNA 2OLAA 3ALPA 3TVMA 5L6UA 3R19A 1XF5A 3RX4A 5D1QD 1R3SA 4TRPL 4TV5A 3ZJKA 1HCFX 4DN1A 1CU4H 4DN3L 1UVQB 4AHOA 4U4BA 1QFEA 2ADFH 4W4QA 5D1QB 1B57A 4V1DA 3U30C 4PJIF 3T4CA 3LQAL 2G5RA 3VXRD 3TSDA 1L6XA 2Y6TE 4HCGA 1T3FB 4IBQA 2AJSH 1HT6A 5JDSA 4JZJA 1JI2A 2Q76B 3JV5A 3VXRB 4L18A 4HEPA 3QZBA 4OVUA 3O41B 5E2WL 2WMIA 3OJMB 2VUYA 5KSWA 1E4XI 3IJSB 4IKNA 1DWAM 2OXGB 2B5IB 1PZCA 3AS0A 5FM4A 1YPIA 5ABFB 1E28A 1X39A 1ZCCA 5CN2A 4XBEL 1ZVNA 1GVRA 2YEQA 3F58L 4BFAA 1XB8A 1O0VA 3VXTA 4XZMX 1FAIL 2OU4A 3KS5A 1CG9A 1MG3C 2Y72A 4KJWD 3T40A 1SPQA 4U6HB 4N2DA 3N2BA 2AXJA 3RWCB 2AQSA 4EUPG 3C6CA 4UINH 5IGXL 3HQ1A 1PJWA 3M5XA 4QOKD 4HKBA 4DIXA 5DY3A 3PAZA 3QQ9C 3BLEA 3N29A 5A6IA 2WBXA 3OHXC 1QLFA 2DLEA 1EPVA 4PGLA 1QNZL 2X9YA 4N2CA 1QRNE 4EN3A 1BIHA 3C8KA 4CNTA 5I1AA 3OJGA 3HTLX 3IDGA 4F4RA 4AD4A 4NERA 3CEUA 1TZ9A 3BYYA 5C9XA 1ACZA 5AOMA 1LILA 1SO4A 3QEZA 4PTMA 1Z9SB 2XWRA 4H2AA 1WQVT 4YBQD 2JQMA 4LGSB 4JRXD 2Y8VA 2WUBH 4CA4A 4PA8A 3H4GA 4PWEA 4NRYA 2J7DA 35C8L 1UZGA 1Z9MA 2LR4A 3MU7A 4FX8A 3LKRB 4S3FA 5EH1A 2FT7A 2Z35A 3EWXA 1MWAA 5AW8B 2PODA 5EPMA 3W9EB 5GISH 4DZ8A 4DF2A 3WJYA 1E6OH 2W0FA 5A6KA 1SGJA 4X8GA 3QXAB 4YSPA 2R27A 1F00I 1KJ2H 2J6VA 1OSPH 1AO7B