2ZWYA

Alpha-l-fucosidase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of alpha-Fucosidase Inhibition by Iminocyclitols with Ki Ranging from Micro- to Picomolar
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 155
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zwyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zwyA01
1HL8A 4ZXLA 3AHYA 1ITCA 1BG9A 4LGXA 3ZT7A 2C7FA 2W63A 1WDSA 4R27A 4AIEA 2XYLA 4H04A 5CZKA 1TMQA 1IT0A 4IISA 1BVNP 3DECA 4U33A 3WD4A 5CG0A 3MUIA 2XIIA 4HMCA 5A69A 3CZJA 5D9PA 1KGWA 3B9DA 1TA3B 2VVNA 3WF3A 2EAEA 1GHRA 2CCRA 3NSMA 1NM9A 1E6PA 1O6IA 1FH7A 4U3AA 5ABFA 2J7BA 2WMFA 5BRQA 2V38A 1OINA 2BY2A 4PEEA 3EMQA 4MJ4A 1JNEA 1E5NA 2A3HA 2XSAA 4KH2A 3WY3A 2VO5A 3NDYA 3AMCA 2WCSA 5D8WA 1SMAA 2VL4A 1XCXA 4J27A 1OB0A 3GNOA 1KCLA 2BHZA 3T0BA 3ZT5A 3T2QA 3UESA 1D7FA 5A6AA 3PTMA 3WUBA 1GOWA 3CZGA 1G9HA 1BAGA 3ECQA 4P7OA 5E0CA 5FL0A 1EDQA 2QMJA 3BUPA 2VCBA 1VEPA 1GJUA 3O2LA 2VR5A 5I77A 3T2PA 4MB5A 1QVBA 5ABFB 3QOMA 2PB1A 1XSIA 2WMJA 1WZAA 1UR4A 1LLOA 3PZTA 3WY2A 4TTGA 1UD6A 3GH5A 4HPGA 1XYZA 3VO0A 4URIA 4YN5A 3ZJKA 4H8VA 3VDAA 3WQ5A 3PZUA 1UG6A 1JXKA 1QPKA 4MNMA 1N82A 2GDVA 2YFOA 4JCMA 4S3KA 3CHCA 1HVQA 4HZ6A 4XUYA 4MDPA 4FLQA 4PBGA 5D9OA 4QCFA 4FK9A 3WF4A 1E4MM 3EDEA 1HXKA 1UD2A 5CJ5A 3WELA 1BGGA 1J0KA 1BYAA 1UKSA 3KL0A 2PI6A 2Y4SA 4WJXA 2PC8A 4OJYA 1OGSA 3BVXA 3EDJA 1XSKA 2D1ZA 4KRUA 3SCQA 1PIFA 1ODZA 1ODUA 2BY0A 3H55A 3HG3A 4OBRA 1CYGA 1AQMA 2FE0A 3VIGA 2JFEX 1QI5A 4UFHA 4CVWA 4QLLA 2WKGA 2JALA 3ZQ9A 1UKQA 4JHZA 3NIYA 5KZ6A 4FMVA 2ZUNA 1LL6A 1V3MA 1F4AA 2GVYA 1DWAM 4F79A 1YQ2A 4JL1A 3II1A 2CNCA 1UWQA 1GONA 1RD6A 1JNDA 5BXRA 2YIHA 3AXIA 1C3FA 2VX7A 2XHYA 2QMKA 1CNVA 2OYKA 2J4GA 4UQBA 1H1NA 1SFSA 1GVIA 3K8LA 3KLKA 1MVYA 4FLOA 1E6RA 3BAXA 9CGTA 3ZSTA 2GK1B 1V6VA 1GOQA 1JAKA 4WF7A 2BHYA 4UQ9A 3I3EA 2XVLA 2FH6A 4ZE5A 4W5ZA 1UOKA 2W5FA 3I3DA 1MW1A 3VIIA 3D5HA 3QHMA 3WMCA 4UZSA 3THCA 5E1QA 4AMWA 3W29A 4EE9A 3PZMA 3WQ6A 1CXHA 4ACYA 3PTKA 4KWUA 5BROA 5C70A 2DT2A 4MB1A 3K1DA 1HJQA 4CD6A 3T0AA 2W61A 3J7HA 1UA7A 3DYPA 3MI6A 1HJSA 5BYWA 1GQKA 1GQIA 2V3DA 5ABHA 3AZSA 3HZ3A 4TTUA 2BV9A 3VIMA 1QHOA 2W4XA 3L2LA 2JIWA 1C8XA 3L4XA 3RJXA 1W1YA 3WDQA 4TUFA 3UG4A 1EHNA 1WPCA 1XSJA 2DSKA 4AD5A 1WDQA 1ISYA 2YOCA 4BA0A 2G8ZA 3H53A 2ZUUA 2BNJA 3WBAA 3NJ3A 4ATWA 1D2KA 1AQHA 4D6FA 5A94A 1V6XA 2J7GA 1EQPA 1FA2A 2W92A 4P7RA 3VIHA 2CBJA 1EHAA 3IGUA 2V3EA 4JCLA 1VJSA 1EOMA 3BAWA 1ZBWA 2UY4A 4P8VA 2TAAA 3PZIA 2WYSA 1MYRA 3CUHA 3VGGA 1CGUA 4B15A 1BG4A 4OZOA 2DDXA 2YLLA 1KR1A 1CBGA 3VDBA 5CQ1A 4HOXA 4ZFMA 1WDRA 3MO4A 1KWGA 3DYMA 2YDSA 4U3CA 1HF6A 2RGMA 1CGWA 1EO7A 2D3NA 3HMCA 4H41A 1UUQA 3AYRA 3BLBA 1E71M 4CU8A 5GQBA 2W67A 4AEFA 2F18A 5KEZA 3AS0A 2XTKA 1E1EA 2E8ZA 2J8GA 4DUVA 1WO2A 1B0IA 3W25A 1JI2A 1W9XA 2J7EA 2QV4A 1EDTA 1OGBA 1KTCA 3LRLA 2VC9A 1WB0A 1W2PA 3NSNA 2CBIA 4AD4A 3GXDA 4M80A 3IAQA 1H3GA 1V0LA 3SEPA 1LWHA 5I79A 4XV0A 1XHGA 3SCOA 4RE4A 4JFWA 2VT0A 2ZWZA 2OYLA 2OLHA 1TQVA 3ZO9A 3SUTA 2F7PA 5CLTA 1MXGA 3WH8A 5A1AA 1UR2A 1QNRA 4DO5A 5CGMA 1M01A 4PMNA 2D0GA 1FHLA 2GJXA 3WDHA 1PZ2A 3L2MA 3WBEA 3WNPA 5A3HA 4J3SA 1QWUA 1B3WA 4HA3A 5DT7A 2FYVA 3A4AA 1QI4A 4PMRA 5A6KA 3N15A 2CEQA 2E3ZA 3UG3A 2GJPA 4MAZA 4J3VA 3T09A 1JIBA 1CWYA 4WSJA 4MADA 5LYRA 3GXIA 4JKLA 3FAWA 3RMEA 2WZIA 3KL5A 4JZ5A 1WKYA 5C71A 5AYIA 1E3ZA 1GJWA 4UFKA 3EDDA 3CZEA 4OOZA 1BYDA 3CHDA 4B3LA 1R86A 4WKFA 4ACZA 4LYRA 4EAMA 4BQ5A 5CSUA 1QNSA 5A8OA 2G3NA 3PHAA 3BUQA 4W8BA 1HJWA 3CUIA 2J8FA 1E73M 2DT0A 2Q8XA 2XWEA 1QBAA 1UZ4A 3VIKA 5EMYA 1NP0A 2UY3A 4AY1A 1ISZA 1K9DA 4PSPA 2EQDA 2PBGA 3ALFA 3GXPA 2WSKA 3MS8A 5A95A 2ZICA 1UKOA 3AZRA 2XVNA 2ZUSA 5I6SA 1H49A 1E40A 1HIZA 3K8KA 1OIMA 5D9MA 4FNRA 4DUXA 4A3HA 2IXVA 3MV01 2CHNA 4W93A 3FXYA 2WVVB 2PWEA 2X2HA 3LRMA 1E5JA 1W1PA 3ZJ8A 4HA4A 2YDQA 4V28A 3WF2A 4F8XA 4ZXOA 3ARSA 3LXBA 3EJUA 5A8PA 1Q4NX 2WVSA 1WCGA 3ARPA 4PRWA 3VNZA 1W9UA 3WFZA 2ZXDA 4M1RA 2AOSA 4JAWA 4CCEA 1FFRA 1B9ZA 4HOWA 4P7NA 4AZIA 3WNNA 4FF5A 7CGTA 1KTBA 3EJQA 3VILA 3OIHA 5HPCA 2W62A 2QPSA 1ZJAA 3AI0A 1NOWA 1OT1A 4CVUA 1TVPA 1L0PA 3WNKA 3WEMA 4OBSA 3WH9A 3U57A 3VPLA 3WQ8A 1L8NA 2GJRA 1GOOA 2ZIDA 2WZEA 3WN6A 3VD5A 1VBRA 1XD1A 2J7FA 3FNDA 1KFWA 3OGRA 2VTFA 1W3HA 3CBWA 2WNWA 2CKSA 3GDBA 5CSYA 4R5EA 1JFXA 4AW7A 1MQPA 4GO9A 1HL9A 4KRTA 1TG7A 3GXFA 1VFOA 3CZNA 4M81A 4P7QA 2AAAA 3KLLA 3PZOA 3LRKA 4CCCA 1VFFA 1QNPA 1JZ2A 1HP4A 1AVAA 2CITA 2VJXA 2WC7A 2X2YA 2XVPA 2Y8VA 3CPUA 5D8ZA 4CD5A 3AMLA 3K8MA 3AIQA 2A3CA 3EMCA 4E4PA 1KBBA 5HBFA 2YA2A 4X0NA 2VZVA 3N11A 3CGTA 3CZSA 2F7QA 1NP2A 5ECUA 1LG1A 1V3JA 4TXEA 1T0OA 1PAMA 2BVDA 1JD7A 4AMCA 3L4YA 1IZKA 2G4FA 4UOJA 4UQDA 5I23A 3ZJ6A 2YL8A 5M5DA 1HP5A 4NXSA 2W66A 2D2OA 3OLEA 2J25A 4RL3A 2WWCA 3FW6A 1F4HA 1OSEA 1VAHA 1VENA 1V03A 1HKJA 5BRPA 2VMFA 2GFTA 1XH2A 3LXAA 3PBGA 4UOQA 3A47A 4UNIA 2J47A 1M53A 1R33A 2VX4A 4Q22A 2WW5A 3LPOA 5D4YA 4LXFA 4K68A 1RP8A 4OIFA 1ZBCA 2NT1A 3WD0A 3VSUA 1J0HA 1FH8A 1QX1A 4EANA 4NI3A 1BTCA 2WMGA 2YDRA 4U5IA 5I0DA 3LPPA 1XGZA 7TAAA 1MW0A 1KBKA 3CIVA 5JBDA 2JIEA 1J0YA 5HDRA 1HXJA 7A3HA 1VJZA 4OGZA 3OLGA 4W85A 2DT1A 2XJ7A 3TONA 1H09A 1P6WA 3SCWA 4CKQA 4HMEA 1FFQA 4JKMA 3GXTA 2ZOXA 2XVKA 4DM1A 4OOUA 5LA1A 2VRJA 1NOUA 2XPKA 2EABA 3LXCA 3AIBA 2CETA 4WIWA 2D0FA 1IZJA 1BHGA 2F8QA 2VOTA 3SUWA 1PBGA 1PPIA 4NSBA 4AIOA 2WHMA 1ZBVA 3WUFA 4W86A 4FNSA 4M56A 4E2OA 4GPNA 4U31A 5FKYA 2OWWA 2VQTA 1WE5A 3GH7A 1GCYA 4AD2A 4J28A 1UA3A 4QLJA 3VVGA 3CH9A 1KXVA 2ZUMA 4D1JA 3ARQA 3ARYA 3ZR6A 2Z1SA 1JYVA 2J75A 3PZQA 3O9NA 6TAAA 4A4AA 2CESA 2C0HA 3RCNA 1SZNA 1E3XA 1E56A 5AC5A 1UWRA 3AMKA 2DSZA 3N18A 2NSXA 3BUBA 1AMYA 1CLVA 5IHRA 4DO6A 3GTNA 4AYGA 1GUVA 3CZKA 1FOBA 2WKLA 2XN2A 3BC9A 4F66A 2BVYA 1SYTA 4D6EA 3LPGA 4CU6A 3LX9A 1V02E 3B9AA 3A22A 4KGJA 1A3HA 3HG2A 1NWUA 4HTYA 3RILA 1MW2A 5E6ZA 3T2OA 1RH9A 2DSUA 4CU7A 2YL5A 2YBUA 5DEZA 4UTFA 4JFUA 1TE1A 4TX8A 5DFAA 2WANA 1CXIA 4ACZB 4J3XA 2CXGA 2E0PA 1RPKA 1TFVA 3W27A 3WQWA 1CECA 4MJ2A 3TOPA 2A3EA 1CPUA 2DIEA 1E6NA 3RO8A 4UR9A 1V6UA 1DP0A 3UG5A 2JF7A 1UASA 1NWSA 4Z2HA 1SMDA 1C7TA 1CLXA 2IUZA 1J0JA 1CEOA 5A8MA 1E0WA 1JDCA 3B8SA 1HTYA 4AC1X 4L4PA 3AXHA 5E0FA 1EA9C 1NQ6A 1QI0A 3SUSA 4MTVA 3W81A 4CD8A 2UY5A 1FP9A 3MKKA 3S6TA 1GOKA 1UH4A 2YLAA 1CXLA 4PSRA 4M82A 3BMWA 3WUGA 4M29A 1QW8A 2VCCA 1Y7VA 1FP8A 4HPHA 5I24A 1HKMA 4UFLA 1GW1A 3ARRA 2Y24A 4MB4A 3ZSSA 2E9MA 3GM8A 1EXPA 1KQYA 5GNZA 3CV5A 3GNRA 3L4WA 2D20A 1A47A 1GNXA 3GYCA 3GNPA 3AZTA 3CZ8A 4ZE4A 3KWXA 2W91A 3MSDA 2QF8A 1HT6A 1E70M 4XX6A 4W87A 2E8YA 2WMIB 1KR0A 3VNYA 3BVTA 2ZXQA 1O7AA 2VCAA 2QPUA 5FOOA 2WMHA 1HJVA 2WCGA 3U7VA 1VFUA 2VZUA 1O7DC 3A4WA 3PZNA 4LYPA 5JIPA 2F1AA 1QHPA 1J9YA 4Z2IA 1R7AA 1XD0A 1B31A 1HJXA 3APGA 2EPMX 2XSBA 4QCEA 4D6CA 4RE3A 1H4PA 1GQJA 4AWEA 1V6WA 2EPKX 3OZPA 1BFNA 3WY1A 4BF7A 3WEOA 3BSHA 3B9EA 3K4AA 5ABEA 1JZ5A 2J79A 5CPQA 5IFTA 3BXWA 3OZOA 1B3ZA 4TVDA 1TCMA 3WKZA 2FGZA 1QNOA 1PJ9A 1VRXA 2X0YA 1UWTA 4PTXA 1E4LA 2VZSA 3ARXA 3ZIZA 3W6LA 5AC4A 5A2CA 3HJEA 3GH4A 3NDZA 1V6YA 3WL0A 3PN8A 1VEOA 3M7SA 4JIEA 4XZWA 4ZEPA 1IV8A 2D73A 2BFGA 2E9LA 4B9ZA 3N9KA 2WB5A 1EGZA 2XVGA 1H11A 4XZBA 3W4RA 4GZJA 4UZUA 2ZX6A 3U5YA 3SCNA 2HVMA 1TQUA 3WH5A 1CGTA 2FHFA 1OBAA 2PWDA 4NRSA 4GZEA 3BMVA 4AZCB 2E9BA 1J18A 4S3JA 4U5KA 5I3DA 1CIUA 2YL6A 2X2JA 1C93A 1JDDA 3LPFA 1UHVA 1HKIA 1JL8A 2OYMA 2WZHA 4D6JA 5HOSA 3TA9A 4EKJA 1W9DM 2XFFA 4P8UA 5E70A 4Y7EA 3SUUA 4AIUA 1I75A 4AZ5A 4J3TA 1MQRA 1US2A 4CD4A 1UR8A 2ZUTA 3VGEA 1QWNA 4GINA 2XG9A 1E6ZA 2D23A 5DF0A 1OIFA 3OLIA 1ZS2A 4NRRA 5I5RA 3IK2A 3TTQA 5CPSA 4TVCA 5EFFA 2EADA 3VOCA 4D1IA 3LMYA 2DSWA 1BGAA 2WHJA 3CLWA 1V02A 3VSTA 3RPMA 4DWSD 1TZ7A 4M8UA 1K6AA 5DT5A 1R8LA 1M7XA 4GXPA 4P7LA 5IHSA 1W32A 2D22A 3TTYA 2CPUA 1GOMA 1X6NA 1ZBKA 4B3KA 5A6JA 4W5UA 4CN6A 4IPLA 1BPLB 3MANA 2DH3A 3ARWA 3S5ZA 3QGVA 2EEXA 4F9JA 1R34A 1ISXA 2XM2A 1ZU8A 3N1AA 5BXPA 4GKLA 4OKDA 1E4IA 4FLRA 4UOZA 2IXUA 2J74A 3W38A 3AIVA 3EDFA 4DUWA 2D0HA 5CXPA 4W7UA 1E43A 1VEMA 1W3KA 3CC1A 1E0XA 1UYQA 4AD1A 3WDIA 1J0ZA 4W84A 1QI3A 4NX0A 3ZR5A 1OT2A 4PMQA 1KGUA 4PUEA 1CXFA 3AJ7A 1V08A 3KZSA 2XFYA 3VGHA 1B1YA 3VD9A 3ARUA 1TR1A 2G3JA 1YHTA 3AXXA 3NCOA 3SCTA 3T0DA 1E9LA 1B30A 4CGTA 3WENA 3WL1A 1J12A 3OB8A 1U2YA 3VMNA 2BY1A 2Y2WA 3W82A 5BCAA 2PWFA 2DSVA 4PCSA 1W3JA 2WXDM 4M24A 2E4TA 3ZMRA 1DHKA 2UY2A 1K9EA 4MNLA 4FNQA 3F5LA 2XUCA 1UWUA 3U7BA 3SCVA 3ARZA 2D24A 3W28A 1GORA 3BLKA 3BUDA 3DDFA 4HA1A 3AROA 3RIKA 2DQXA 3KEHA 4D71A 3MU7A 5JBEA 1UH2A 1QBBA 1WZMA 1MFUA 3UETA 3W24A 4YHGA 4E8CA 2WK2A 4Z2LA 4PMYA 5GNXA 3VIPA 3QR3A 4H2CA 2V5CA 3ALGA 2GSJA 3A3HA 3BAKA 4PN2A 4PTVA 4W8LA 5C8BB 3VTRA 1JD9A 4PTWA 3A6OA 2O92A 3WQ4A 4HMDA 4AZBA 4WKHA 1K9TA 4AD3A 4BCEA 3OGVA 1EH9A 1DWIM 2F7RA 4PMDA 2EPOA 3AIUA 3WH7A 5JBFA 1C7SA 2WWDA 3A4XA 1ITXA 3FHAA 4DO4A 4AZHA 3T08A 5EFDA 1UKPA 1OM0A 2X0HA 4LQ1A 3BVUA 2OW7A 2Y5EA 4PCTA 4PMZA 5ABGA 1RP9A 3BUIA 4LX4A 2ZX7A 1LQ0A 2YFNA 1GHSA 3EDKA 4WKAA 1Q6FA 4IPNB 3CUFA 1JYXA 1JFHA 4JL2A 1ZJBA 2VRQA 3AIWA 1MQQA 3L4VA 3DC0A 3CHFA 1B3YA 1UD3A 2WLZA 3VINA 3HG4A 1PX3A 2XN0A 3SURA 2EACA 4C7FA 1ZB5A 3K46A 1MW3A 1W2VA 2NT0A 1SR0A 4HU0A 1UD5A 1UD8A 3F5JA 1J01A 5FCZA 5A6BD 2CERA 1C92A 4F9DA 4PMXA 4ATLA 3IAPA 1DTUA 1JXJA 4P8WA 4LPCA 2V5DA 3I3BA 1VIWA 2PBOA 1E4NA 4NF7A 3WUEA 4MNJA 1QOXA 3OG2A 1KQZA 4HU8A 1HX0A 2J7CA 1EO5A 3WNMA 3UCQA 2ZWYA 3BCFA 1GZJA 2QLYA 3WY4A 4BQ2A 2ZUWA 3NUKA 4PYSA 4CN4A 3VKKA 4ATDA 5CGTA 2CBUA 4GQQA 2WLYA 1E72M 4PMOA 5BXSA 1HJUA 1E6XM 1CXEA 3AQUA 4TX6A 4N0RA 3OLDA 1E0VA 3ARVA 3UR7A 4DM2A 2MANA 2YA0A 4RE2A 3SCPA 2WBGA 5BXTA 1HWWA 4IM4A 4FNTA 1CGXA 3WD2A 1XCWA 8A3HA 5JIWA 3MMWA 3N04A 4WK9A 2ESCA 3TP4A 1BF2A 1WDPA 2XN1A 5LA2A 3WFLA 2HISA 1TQWA 3VSVA 3D3AA 3WF1A 4AZGA 2WPGA 1JZ3A 4GQRA 4B16A 1XH0A 2YBTA 1BLIA 4DWSA 2O9PA 3AS2A 4KGLA 2DIJA 1WZLA 1NOFA 1LL4A 1XV8A 4W8AA 3DX1A 1TVNA 5HXMA 1X1NA 2WSPA 1QNQA 4V2XA 2WCAA 3IJ8A 1HN1A 4GI8A 3VMPA 4FLSA 4UFIA 2DEPA 1W9VA 4PMUA 1FH9A 3RM4A 3L4ZA 2WHLA 1OGGA 3M46A 2J62A 4MNKA 3DX2A 3BAIA 3DX0A 3KL3A 5A2BA 3BLPX 3EJPA 1WAWA 4QAWA 4MAVA 4W89A 1UH3A 1CENA 3ZT6A 4Z2KA 2FH8A 3GXNA 5I78A 4EK7A 2F7OA 1E6QM 3AHXA 3M07A 2D3LA 1B3VA 4L4OA 4JFVA 4KMQA 3VIFA 3WF0A 2O9TA 2WMIA 1B3XA 2EO7A 1CDGA 3BCDA 1HVXA 5A6SA 5E09A 4CUCA 3QOKA 1DWGM 3W6MA 1ESWA 1GVYA 2X8RA 3HN3A 3RM8A 3VM7A 2EJ1A 4BZYA 4DWSC 3AFBA 4A3YA 3AOFA 3N12A 3CUJA 1NWTA 3A23A 1V0KA 3S5YA 3EMZA 3N13A 4D6IA 2O9OA 3H54A 1W91A 3VD7A 4BQ3A 1VBUA 1QHZA 3AISA 5I2UA 3POHA 4Z2GA 2VUYA 5FL1A 2DPEA 3TTSA 3F4VA 4GZIA 3BSGA 3WNOA 2VZOA 1VFMA 1Q6CA 1UKTA 1E1FA 5A8NA 2NW0A 3WH6A 3WDJA 1FHDA 4NZCA 4PUDA 3WDRA 1G0CA 1V0NA 1R85A 3WD3A 2X05A 4UCFA 3A24A 3O6AA 3U5UA 1JG9A 3PZVA 1KXHA 2XIBA 1CXKA 2ZXBA 2FHCA 3WMSA 4GI6A 1R87A 1BQCA 1Q6GA 1MXDA 1E6SM 4J3WA 4V27A 3BAJA 1XH1A 1H41A 4BS0A 4MDOA 2PWHA 1KCKA 2BY3A 2QHAA 1BSIA 8CGTA 1W1TA 3ZOAA 2GJXB 4P8XA 2JEPA 4B9YA 2VNCA 1B90A 1V3HA 5AY7A 3DHUA 2WHKA 4GI9A 3SCUA 4C7DA 1U30A 3ZM8A 3TV8A 3QHOA 3MMUA 2F1BA 3CMJA 4MB3A 1CTNA 3CUGA 3UEQA 2FHBA 3IANA 1EOKA 3VIOA 5DO8A 4AEEA 3WEZA 3AS3A 1I1XA 3PZ9A 3F5KA 3DX4A 4X9YA 2ZX8A 5E9AA 2IGTA 2EPLX 1ECEA 2F2HA 2PWGA 2DGAA 5IXEA 4UQEA 3VGBA 1R47A 2J78A 1W1VA 3VD4A 3M6DA 4AD0A 1EDGA 3MUAA 2JF6A 3EBVA 2O9RA 3VGFA 2CHOA 3W0KA 5EBAA 4QLKA 1PX8A 4TVUA 2X09A 4W88A 1OD0A 2CBVA 4XB3A 3W37A 1NWRA 2VI0A 3NSXA 2WMKA 3GBDA 5M03A 5D9NA 3UR8A 1DWJM 4E8DA 2BHUA 1GOIA 1TA3A 1K9FA 2CIPA 3FAXA 1VB9A 3OBAA 2GDUA 5JUVA 1J0IA 3FHQA 1UD4A 3VX0A 2XWDA 2WAGA 4CCDA 2GK1A 4AXNA 1NH6A 1HKKA 3D51A 1UQZA 1XRVA 4AZ7A 2WM0A 3G6MA 4YPJA 2OSXA 4UFMA 1GQLA 3MUY1 3VDCA 1X6LA 1LWJA 1PIGA 3D50A 2UWFA 2G3IA 2ZX5A 3EJSA 1H2JA 2BVTA 1KXQA 3ARTA 3RDKA 1PS3A 2OSWA 2AMGA 1PEZA 3BAYA 2VX5A 1BVZA 2PF0A 2XM1A 3L4UA 3MV11 4FNUA 5A6LA 2J7DA 4U2ZA 1R46A 1ISVA 1NARA 4GIAA 2WC4A 1V3KA 2OWXA 1BYCA 1QI2A 3JUGA 3D4YA 3RJYA 4PTMA 3WQVA 5A8QA 3HG5A 2J7HA 3E1F1 3CMGA 1C90A 3W53A 5LA0A 3EJTA 1VF8A 2X1IA 1G01A 1OD8A 1D3CA 2OWCA 3BGAA 3ZJ7A 4Q7NA 2G41A 1EQCA 3WSUA 6CGTA 2WVTA 1US3A 2XFRA 1HNYA 3SUVA 2A3AA 4AISA 3VM5A 4TOQA 1UWSA 2J77A 2ZX9A 1WP6A 1V0MA 1E15A 1J11A 3A21A 2BXZA 3AHTA 1J10A 4FNPA 1JF6A 4HP5A 3VUPA 2FDMA 4DWSB 3CTTA 3NYDA 2YKKA 1MFVA 3TTOA 1QW9A 1Z32X 4J3UA 1KB3A 1Q6DA 1JDAA 3DDGA 1CGYA 1C91A 2WVUA 2CKRA 2EXOA 2Z1KA 1M03A 3DYOA 5F7UA 2JEQA 4HZ7A 5HNNA 3WMBA 1UQYA 1W9PA 2FGLA 1JF5A 2ALWA 1TQTA 2DH2A 1E55A 3WD1A 2ZXAA 3DHPA 3FN9A 5GNYA 1Q6EA 3HU7A 3DX3A 4YHEA 1H0IA 4D6HA 3EYPA 3VIJA 1JYWA 3IJ9A 3SIMA 4JFTA 2WBKA 3SCRA 4Z2JA 3VD3A 4C7GA 3THDA 3AS1A 3GZAA 2EPNA 5A6MA 1GPFA 4ZENA 3VDHA 2C8NA 2V3FA 1I1WA 2VURA 4UQAA 1KXTA 2A3BA 4N42A 2VX6A 1M04A 2YL9A 3VX1A 1S46A 1DEDA 3MMDA 2CYGA 3QHNA 3W26A 6A3HA 2VR4A 1R75A 5DMYA 3A5VA 2XGIA 1R7OA 4CN1A 1JAEA 4HOZA 1B2YA 1UZ1A 1TQSA 5IFPA 3KE0A 3BVVA 2BXYA 5HPOA 4HZ8A 1KWKA 3BH4A 5FIPA 1DWFM 4CD7A 1JGIA 1TUXA 3K4DA 3IJ7A 3D52A 3OGSA 1LF1A 3N17A 1JZ7A 1XYFA 1G5AA 2VRKA 2ZE0A 4AZ6A 1OCQA 1XC6A 2VVSA 2EBNA 3EJRA 2X2IA 1CZ1A 3CZLA 4WLCA 1KGXA 5CPTA 1EIBA 5M17A 1UR0A 5FD0A 3WIJA 3AIEA 1JZ6A 3CHEA 1C8QA 2GUYA 4AZCA 2JE8A 4QP0A 1AQ0A 4ML4A 2OSYA 4NZFA 3AYSA 2B31A 3AIRA 4WSKA 4D6GA 4NZJA 2ZUVA 1G1YA 2OW6A 1V3IA 4QDMA 1UR1A 5TD4A 4D72A 2F61A 4NXKA 4AMXA 4UFJA 1V3LA 1WNOA 3GBEA 2YJQA 3S2CA 5E6YA 2YA1A 1JZ8A 1G94A 1ISWA 5GPRA 5AYBA 1LJYA 4W7WA 1JYNA 2XGBA 2WVVA 1UR9A 4H8UA 4PMVA 3POCA 3GXMA 3OA5A 3WNLA 1W3LA 2Y8KA 3AICA 3L4TA 2G3MA 3RM9A 1MWOA 3VGDA 4OUEA 5M3WA 1H0GA 1PX4A 3BVWA 4U2YA 3AHZA 4UQCA 2E40A 3AHVA 1LL7A 4H8HA 4LYQA 5A2AA 1ZL1A 3MSGA 2WC3A 4GO8A 3G6LA 1U33A 3WDPP 3AMDA 4AYSA 3MUZ1 2DT3A 5IDIA 2VQUA 1WZKA 3CO4A 3D4ZA 4D6DA 5BWFA 1C8YA 1UWIA 2BS9A 1BYBA 5A6BA 1CGVA 4JFSA 4BQ4A 3VU2A 1LG2A 4H7VA 1H5VA 5EB8A 2V3GA 1JI1A 1DWHM 2RGLA 4QFUA 4W7VA 1PZ3A 1OWQA 2VZTA 4J7RA 4JKKA 3SCSA 4MPKA 5CLWA 4X0VA 3VMOA 1JZ4A 3UERA 3PZGA 3PTQA 4IUGA 3FY1A 3AMGA 1W9BM 4JHOA
chains in the Genus database with same CATH superfamily
4IGNA 2PPEA 3QUXD 3LBOA 4HK6A 4O1CA 1Z6JT 3BZDA 2MOQA 4Y9PA 1T4KB 4EJ1C 1RZ8A 1S3KL 1U3HD 2CKBL 4LCIL 4V15A 2W63A 3G1AA 1XKJA 1HOCA 3PNUA 3JZUA 4R84A 4OTXH 1DXEA 4RZBA 2ZYIA 3NNTA 2C9UA 2BSCA 3QUMA 4R90H 5CZKA 2X41A 4AQOA 2XIJA 1JNNH 1GZHA 1BVNP 3FMGH 3GJFA 5KVGE 2CZ5A 1OB1B 2X4RA 4A7SA 2QKIB 2MCPH 3BGJA 1EDHA 2XQYK 4HMCA 2P0OA 4KTYA 3G1YA 4RGMB 4OUUB 3QXWA 2ICWJ 3UTZB 3UA4A 1CB2A 1E5YA 4PJFE 4RW5A 5J04A 1EAOA 1F73A 1P1ZA 1TA3B 1F0LA 3VC6A 3W56A 1YBQA 4XN5A 4PYGA 4ZOAA 3ZTCC 2EAEA 1BW8A 4FFTA 1LP9A 2H2PC 3EKCA 4F92B 2PWVA 5G2HA 3TT3H 2W80C 5J5DA 1T5XA 3F7PC 1E6PA 2X4NB 1SZRA 4YDLB 2F84A 1FH7A 1MUMA 5EU6D 4U3AA 3NIGE 3ITYA 5EPDA 4H40A 5GSVB 4TSBH 3ZKMC 1DIOA 1CO1A 4WXZA 3WCYA 3ESUF 4AT6B 4TQTA 1DQDH 1GIGL 2IV8A 1ZQ5A 1ZANH 5AAMA 3D3FA 2NNRA 2HLFC 4PEEA 4NAQA 1LOSA 1ZSXA 2JKAA 1MSPA 4GUPA 4P5TD 3WY3A 2WCSA 2ICES 1BFVL 3HVNA 5LXVA 1VCVA 2VL4A 3CXOA 2G5RA 3CQHA 4JBRA 2K78A 4L5FL 4TNVK 4J27A 3SDDB 4Y1AA 2I16A 4K3EH 1BAWA 1OAUL 5ENWA 3G5XA 4PLKD 4KXCA 1W5PA 4X6CE 2YPLE 3DVGB 4JFZL 4IJ3B 1D7FA 5GISL 1DJNA 4RSVA 2R94A 2YLKA 3TWCL 4AM0Q 3ULSB 4F7EA 4O12A 1NWPA 3O8XB 1G9HA 4BCYA 1BAGA 3ECQA 2DZVA 4K5PA 5EUKA 1OM3H 3W86A 1WA3A 3TEUA 4OQTA 3CXHK 5FL0A 2BC4B 1EDQA 1Y1DA 4Z77B 3BUPA 4U6XB 4MSSA 2VCBA 3KM1A 4LSTL 1AHWB 2CHXA 1N2VA 1LMIA 1F3RB 2VMDA 3GSNA 4AIXA 1R3YA 2R24A 3APTA 4LBAA 3OKDB 2Y62A 4WW2C 4PS3A 4L0PB 4BZ2A 4DN3H 2DJLA 3VDGA 4QWWD 1NBZB 5GGVY 1G4PA 5JHDE 3KPPB 5ABFB 1MLCB 5I71B 1JK9B 1MRDH 1T1WA 2Y3NA 3N40F 4GLRI 4EUPG 2PB1A 4WQ6A 3GO1L 4CSPA 3PZTA 2TRHA 3M45A 2VDQB 3D0VB 3W7PA 5E2VL 1NPUA 2FQEA 4H8VA 3OVGA 5EWIH 3TIEA 3VDAA 3IRPX 2JFCA 5KS9B 5DDHA 1L7IH 3R5EA 3AY4A 1QPKA 1SUHA 4MNGB 4YXKH 4LTSA 5AECA 4WHBA 4MNMA 3E3QC 5K5YA 4ICCX 4YXHH 1XR8B 4S3KA 5D2LE 3V5DB 2EGZA 2KQMA 2OL3B 5IVXB 2VR2A 1E8WA 3OR7A 3S35H 4US5A 5CN1A 4HIQA 4L18A 2R7EB 1EZSA 4XZ4A 1DHPA 4H83A 1MCOH 4N4PA 3FULA 3I2CL 4AY7A 35C8L 3KPSE 4PBGA 3FRPA 5L8LB 3DMMD 1SR9A 1TT6A 2BW5A 2ATAA 1TPWA 1EF2A 2PDUA 4GCAA 3TIMA 5DJ0B 2PTZA 1OAJA 1TPUA 4P2YA 5AOUA 2PW2A 2P8BA 4A35A 5CJ5A 1E2ZA 3L9RB 3HM7A 4HHPA 3NRPA 3G3MA 3TCLA 3U9PH 1IXPA 1P43A 3SJVB 4JHUA 2WJ5A 1S9WB 2K3TA 3GSOB 5E5LA 2AQQA 1KJMA 4PY8J 3CVHB 3RGVB 1EDYA 3NRQA 1ZLUH 2D1ZA 2J88A 5TIMA 2PDPA 3CSYA 5FOJA 3QEQB 4UT7L 1O95A 3PWIA 3V8OA 1W0WA 4B9JA 1R0AL 4NO5A 1IE5A 3H55A 2JI1A 3HG3A 4X9HA 2C1OA 4AMKH 4P46A 3EPNA 5JOFB 3BH8B 1E4WL 1AQMA 1JPMA 2R1NA 2FYYB 1K8ZA 4N8VG 5I6NA 2XPZA 3GSNB 3KBEA 4H20H 4KKPA 2X1PA 4AV0A 1VD6A 2O4MA 3CLFH 4WDIA 1HYSD 3T71A 1OPOA 3U30B 2JALA 4UXDA 4B2DA 5KZMA 4R8WL 4PRDA 3W71A 1ZS8B 5HUPA 1OF8A 2PYFA 3D18A 1B2WH 1FO0H 4HUUA 4MA3B 2AJ3A 3BURA 4GW5A 1S5TA 3EXRA 4OT1H 3FK4A 3F83A 4I48A 1AE6H 1KIUB 4G42A 5CHNB 4YIQB 3T2LA 4F7PA 2IPGA 3REQB 3ROLA 3L3GA 4YX2L 1UCTA 2LQRA 1F4AA 2GVYA 4EVNA 2QDHA 3D85A 3MRIA 4O11A 3REWA 5CIPB 3ML8A 4FADA 5CBIA 3QZAA 1EAJA 5MERA 2WJEA 3E0FA 1GGYA 2YGPA 4L8SB 5HVFB 5DHVA 1QPNA 3SFWA 4DGVH 5JDJA 4IFRA 2QMKA 4G6FB 1MRCL 3QE5A 3S2AA 3T4AA 2OYKA 1YYML 3MV7E 3WE6A 4H13C 1E6JH 2WGNB 3K8LA 2HFEA 3ASWA 3OKKB 4FLOA 1E6RA 1PKLA 3LGEA 4MJMA 1R3WA 1C5CH 4L4TA 2H0FA 5D7JC 5D96C 3U0TB 1LE9B 3IIOA 4F5CE 2W94A 2ZP0T 4JRXE 3ZSTA 4RCXA 5FF0A 3EAKA 1UVQB 1IEVA 2OTUB 1GOQA 1BAFL 4EOWL 1JAKA 5HTSA 3N14A 5ECVA 3BN3B 3KPSA 2DRUA 2NXZD 4GSDL 4MFDA 5GJSH 1PKNA 1Q9WA 4DGVL 2X3CA 4UB0L 4N2EA 3PWUA 4H6EA 4ZE5A 3QJXA 1MWAB 1AQKH 3PBYA 1NFBA 3SQSA 2YWZA 3MRNA 3D5HA 3QY6A 3O8AA 5JW5B 1RHHA 3KW8A 5T1KB 1Q9OB 5JNYA 4R88A 2TRSA 1TPVA 2NUXA 5HYFA 3QAZC 1QQDB 3G1SA 1YY8B 5FYJE 4XZMX 1PQZA 5E1QA 3GPSA 1J1XH 3AM8C 3SYPA 2C7UA 1AOHA 3QRBA 2YXWA 1A0DA 5U7SA 3UFYA 1L6YA 3WQ6A 4QTIH 3WZ0E 3V95A 4ZTPH 4KWUA 1MEXL 3L5AA 1MN4A 2QKIC 3DX9B 3LUTA 5BROA 5CCHE 1H8OA 4NUMA 3TEVA 5F8QC 5A2JH 1NZRA 2FJFA 4QE5A 3GHPA 3T0AA 2W61A 4WFED 4ZO6A 3IJHB 2OT1A 5CP3H 3DYPA 2G4JA 3CK0H 4M1CD 2PDCA 3HPXA 2A0NA 2FJUB 3R2GA 4XMPL 3UQNA 4Q7DA 2EP6A 3TQVA 5GSRA 2V3DA 1R2TA 2WNGA 5FV1L 1YMYA 4ZMXA 1B3JA 3WO3B 2C14A 4H88L 4L8SA 4JPGA 1VA9A 4FOMA 2UZYB 4LEBA 4N8CH 5BUPA 1WUEA 2IH9A 2AV1B 3I02A 5DLLA 2W4XA 1NEZA 4JZJC 1GK8A 2X5PA 5DU7A 3TNOA 4ZMPA 4HH9B 3CD4A 2VLLA 1OFQA 1M9SA 4PV8B 2BWGA 1EHNA 1W6LA 1XQ4A 3BUTA 3T04D 2UXTA 3UG4A 4KCWA 4HT3A 3DFYA 3GVGA 4XAYA 1CCWB 4AD5A 4KQNA 2X6BA 3LHWA 1NCWL 3NJVA 1A65A 1ISYA 3AQYA 1W8OA 4HS6A 4BA0A 2G8ZA 4HQVA 2R1PA 1QPOA 4NUWA 3UWVA 1VCBC 4W1TA 4DJED 1CDJA 2O4EA 4M1DH 4NNPH 3AYVA 4WI2A 3DOHA 5T3ZH 4JE0A 3MOQA 1D2KA 4O4VA 2J71A 1Q1JL 2NY6B 1BFOA 3U2SB 1V6XA 1FA2A 2J55A 1C16B 1CWVA 2L7EA 3GEWB 2JV6A 3QIUD 3VXMB 2DW5A 4G7VH 4P7RA 3NL5A 3DEQA 1F3DJ 5DBUA 2Y5JA 2R29A 1BOYA 4KKNA 5C9RA 3ZHNA 2I9EA 2V3EA 3K72A 1CC3A 1NEZG 3FDGA 1N6QH 4XNYH 3BAWA 1EX0A 4AEHL 4UMCA 2PLCA 4P8VA 3W07A 7ODCA 2R23B 3ZU8A 1F8MA 3QPXH 5JW4M 4ESKA 1I7UA 3L3OB 4HPOH 2UXVA 5JUEL 1MYRA 9RUBA 1TQJA 4NNPL 5BVJA 2CW6A 3CZFB 4FN0A 2BSLA 2HKAA 5E99L 4BIKA 4RV3A 1RZQA 3TBWB 3VXTA 3R13A 4RBPH 5CJXC 1IIHA 4WXYA 3PAYA 1S5HA 2PPFA 4I4WB 3QW3A 4UTWA 2NY7L 1Z3GH 1JPTH 2WWKO 4GKZA 4M1GH 1Q65A 4ZFMA 4TNFA 4RLIA 5T1DH 1WDRA 2DBLH 2XETA 2BSED 5H4ZA 3T3ME 3FS9A 4KKLC 3CHOA 1VLWA 5GS2D 3DYMA 4QOKD 3OJDA 3O3UN 1G6RH 3EB3A 1NCGA 2YLHA 5H8DA 1HGYA 1TX0A 4DSYA 2RGMA 5T26A 4IBYA 4JFZH 3SKOA 1EO7A 3HMCA 1FCUA 1WDWA 2FL5B 3SY0A 4X99B 3OHMB 1EUTA 3MDWA 1PHWA 1OTSC 5TBOA 3BLBA 3VW3L 2J88L 3M8OL 2OCCB 4WNJA 3NO5A 5GQBA 3DFPA 5HPMB 4KK5C 2W67A 3MA8A 2AEPL 2YMXL 3LYRA 5D93C 4LLVB 4O58L 1AGEB 2A38A 1TZOA 1CFVL 4EDXB 2E8ZA 3GNDA 1XYCA 4DYKA 5LCVL 5IVZA 2X0WA 3NZ8B 4ELMA 3QUZA 4UM9D 3IDNB 3O11A 5FF6A 4ODXB 2QV4A 3GNML 1GKRA 3PAUA 4UDUB 4DKAA 3FTSA 4DBDA 2AQ1A 1A6ZA 5I15H 3D2UA 5KW9H 4DZ8B 2IEPA 5E2VH 4OCLC 4JLRB 4FXLA 3IJLA 3WK2A 3UAJD 1BMZA 1KTKE 5BU6A 3VZYA 1SXCA 1CE1H 4LSQH 4XOAA 3S37X 3GWJA 3QCUH 2NY2C 3RPKA 4LUYA 5FSDC 1KXTB 4YDVB 2VD9A 3GU2A 2VKZG 4I7VA 2XKNB 5E5CA 4G8TA 2VC5A 3NQGA 3SUTA 1IL1B 1U8QB 1MXGA 2F7PA 3CN1A 3MLYL 4Y1SA 5CLTA 5ANMA 4GS7B 4P46B 3RZCD 5KOVC 3I75B 1QNRA 1OZQA 1PCXA 4HPYL 2HCVA 4HGMA 3AALA 3X3FH 3WDHA 3I6EA 1LD9A 4AV4A 3W7GA 1G9MC 4H1LA 4J2MA 1WTLA 2Z27A 2HS8A 3N6YA 2CHDA 1LMKA 1QWUA 4X6DE 2DP3A 2X1TA 3QTGA 4D8LA 4N0YL 4HA3A 4EX4A 4Y19D 4BWTA 5E4AA 5E8PA 1AG1O 1AO7D 1OVDA 2X16A 4AH2A 1U3ZA 4IQDA 1QD0A 1QI4A 2BIPA 4DLFA 2WQSA 5L4JA 2YDAA 1XAUA 1D5BB 1JV2B 3N15A 4LW7A 4TPRH 1UTDA 1RVGA 4OZ4B 5I6LA 5EPMB 2FUQA 1DORA 2F6KA 3QFJE 3FOKA 2HFGL 3ROLB 5DD3H 4FQXB 3Q94A 1QPPA 5T3XH 1I9CB 3PB2A 3TCSA 1CWYA 1XW8A 4MADA 3EYUH 1ZA3B 5L2KE 3GXIA 5AD0B 2R83A 1DJZA 3I6KA 2BO0A 3EUUA 4JKLA 2PSNA 3IXAA 1QW7A 4IU2A 2IGFH 3MLWH 3RMEA 3B2VL 3PRZA 1OX6A 2AZAA 3ETSA 3KL5A 4R8WH 3GPEA 1ZALA 5EN3A 4AW4A 5EF1A 1HDMB 1NGZB 3CLFL 3FQ4A 2JJVA 1KV7A 1GJWA 2B9BA 4LCRA 1QDSA 1GGBH 3EADA 5C0JB 3CZEA 1UADC 3Q48A 3RGBA 5C0FB 2VR7A 3KXFA 3WTXA 1BYDA 5AW7B 3CHDA 4WKFA 5D8JL 1CBJA 4N7QA 1NL0H 4XC3H 4P5MA 4C6BA 4EAMA 4HHWA 4MCNA 1QNSA 5CSUA 2C5DC 4PJEB 4IGMA 5IW6A 5CR8A 2NOYA 4WEMB 4M48L 4A8NA 3NSFA 3ARBB 2H1LM 4W8BA 4E6MA 4TLKA 4K71B 5GJPA 1MWAA 4XP9H 3SGUA 2OR9L 4HLJA 4TTDC 5I28A 1E73M 2DT0A 5LZLA 5HQMA 4ZPVA 1UWEH 2NNAA 4XVUD 5L4IA 2V5RA 3TBVB 1UZ4A 3TA3D 2WXNA 4Q6JA 2GQHA 4WW2F 2UY3A 2WPBA 1T7WA 4PJ5B 4UZGA 2PBGA 2GSIB 2VIRA 2KPWA 5AC6A 3QDHA 4LHUD 1UKOA 1QBML 1ILSA 1HI6A 1WBYA 2XVNA 1RZFL 2NQ3A 4HDIB 1H49A 5EOCJ 3OYXA 1E40A 2QVMA 4MQ7A 3NJLA 3RLSA 1H15B 2LOEA 1NKGA 1G43A 3K8KA 2R8SH 1OIMA 4L1WA 3MO1A 3DKJA 4KC3B 2CLLA 4GFSA 4UR8A 3ABZA 2RDTA 4GRLB 5K4ZA 3LH2L 3MV01 3T07A 4Z5RB 3ABQA 2IKIA 1SYVB 4KT2A 4PJGB 1MHEA 2EKSA 4W81A 4Z7VB 1UP2A 3P54A 3UR2A 1MY7A 4JVWA 1OIOA 5ALBH 1SJXA 4D0DB 5I6XC 4O53A 4UNKA 3PJLA 1OQXA 4BCXA 4NUPA 3FH5A 1IEXA 5DCEA 3C5SB 1OPGH 3N4EA 1IB5A 1FWIC 1W1PA 4QCIA 2WZ0A 5LN8A 1DSFH 5G4WA 2YDQA 3ABMB 3DZ1A 3L3JB 1NGXA 3FT1A 1A7BA 5F93C 4S2SA 5J6HB 3ARGD 1BOGB 3VXQB 2IQ9H 2BVPB 5ADPL 3IDGA 4ZXOA 4XVEA 4NP9A 4GG6E 1NJ9A 3EJUA 4X9IA 3V0FA 3MHFA 3SE3A 5HD8D 4KTEH 3O6FC 2WVSA 1PYFA 2WYTA 2E67A 2ZVIA 1A64A 1YAZA 2EC9T 3FKKA 3KW7A 4JDVA 1HZYA 1GGTA 1I7RA 3ARGC 3F64A 2ZXDA 4R9HA 5GRWA 3WFZA 4AQAA 5JORA 2NY5C 1RLDA 2DVUA 4KETA 2JI3A 2VWEC 4HEPG 4M1RA 2Z93A 2LVEA 1S7VB 3LEXB 4J3BA 3W1MA 1KCRL 5XIAA 3QPZA 3Q6GL 3HGRA 4AG4L 2NY1C 2Q86A 2NY3D 1SO4A 4A2RA 1A1MA 5HVHC 2KL6A 1SW3A 2NY5L 3IJQA 4NHUA 4XCYB 4ZTOH 3MACL 5AENA 3RFZC 3SSGA 3ABLB 4P7NA 4XAKD 4EZMA 4PRRA 4S2BA 2Y7QA 4KQ3L 3MC5A 2ITFA 3EJQA 3MV8E 3RL1B 1KPRB 1EFZA 2G60H 2IG2H 3OSKA 2NTFB 5HPCA 1D5RA 4LCWB 5HWJA 2AABL 4ZMVA 3AI0A 1NOWA 4XIMA 4CVUA 3SRDA 1TVPA 1VBGA 4MMZC 3NIGF 3B2UD 4ILDA 3ETBJ 3UWUA 5CM1A 4HWEH 4OQ1A 1TTGA 1EGJL 1LVEA 3TT3L 3CPLA 1LWIA 3WQ8A 1RIVL 4UM9A 7TIMA 1JHLH 4GRLA 5FYJH 1GOOA 3GIZH 3C6LB 5I30L 3HG0A 1MDTA 5D55A 5F97E 3IJ6A 2XKSA 5DJ8A 3P9LB 3WN6A 4B27A 4HTBA 3C08L 1DVJA 3CPGA 1CD8A 3QNYA 1I7UB 1ZXQA 3D1MC 3L3OA 4AVHA 2UY6B 3FNDA 3LS5L 1Y18A 1E28B 1PF3A 5EG6C 1QZNA 4O2EA 3EFOB 4BBWA 3U1QA 2MSPA 4NZTL 1ZTXE 2FRGP 3BPCB 2NR6D 4KU1A 5L2KA 4A7GA 3WQGA 2WNWA 1LDCA 3ZZLA 1BKHA 4FYRA 3GDBA 4HKZA 3S8WA 2VDGA 2RALA 1BOGA 3NQFA 1JPTL 2D7NA 3QIBC 4AW7A 5HJLA 5AW3B 4AF0A 5EIQA 4ZFQA 2JCWA 1AGEA 2GTZB 3LS4H 4Q9CA 4KRTA 1KBWA 4C6FA 1IAIH 2IMRA 3UJJL 1KB9J 1VERA 4X7TB 1M1XA 2X42A 3IBOA 5E1AB 1SW7A 2B8OT 3TWCH 3H22A 5LNWA 1QUNA 3CZNA 3L5IA 5IHZA 3H70A 3QGAC 4S1SL 4XP9L 3ZYIA 3LGDA 5E8DL 3PZOA 4FSAA 5CJNA 1BM7A 1J8HD 4JX5A 5AAMC 5I1EL 3WAJA 1VFFA 4S39A 1OYBA 3MV7B 4YFDB 3KCOA 3THUA 2C91A 1AVAA 4X6DB 1VKXA 4PREB 2GAZA 3EBGA 3ZLGA 5KSVB 5D8ZA 3CPUA 4CD5A 5F71A 4JFDD 4NNBA 4Z1YA 5D7JD 3LB0A 3K8MA 2IALB 3AU1B 4YJZL 2A3CA 3LTPA 4TR9A 3NP4A 4LYKA 4HFWA 1R9XA 2QCCA 4ZFGH 1SVZA 3EMCA 1QRKA 1OEPA 1ELSA 3TYZA 12E8H 5EBWB 4UU9A 1B57A 4LY4A 4NJGA 4HIHB 4Q6IB 4LNVA 4TULH 1P1XA 3BFOA 2YAMA 2MNUA 2F7QA 2TSAA 3CZSA 4JPWH 5GRVK 1XLCA 5D2WA 2YAHA 1JPGB 4LSPL 3W9DA 3HO8A 1I1CA 5DDHB 1PAMA 1BQUA 3BDYL 3GIVA 4MA7H 2VDRL 3X17A 1KRMA 3C5QA 4AMCA 4N2MA 4UOJA 5DWPA 1KBGH 1OTUC 1VESA 2YL8A 4KJYA 3G9AB 5T3XL 4NXSA 1BTMA 2UWEA 3ZE1B 2VITA 3AAZA 2DWYA 3UROR 4LUSB 5G5DA 3BK0A 1JGEA 3K5RA 4RL3A 1UACH 2ERJC 3O6LH 1QPRA 2AV7B 1MHCB 5E5MB 4EPDC 4TUJA 3WJJA 1LP9F 1VAHA 1VENA 4Y5YC 4N90E 1ML1A 4YHLH 2XQYG 3VG9B 3HI1A 4MJIB 1V03A 5REQA 4XX1G 3RWJA 3CXFA 2VMFA 3MRQA 1Q3NA 3BAEL 4KMTH 5JO5A 4HUWB 3PANA 1OE1A 4UOQA 1MJ8H 1R33A 4UNIA 3FB7A 4W6XB 1H7PA 3MVIA 1SM3L 3OKMA 4S38A 1L6PA 1BF8A 2AAMA 2ISFA 2FLMA 4OIFA 3SB3A 3TJHD 3MCOA 1ZBCA 2NT1A 4YYFA 3N40P 4BR1A 1JTTA 5AFAA 1QX1A 5F6IC 1M7PA 2NY2B 3MCKA 4KHXH 1I2NA 4HUKB 4MCYA 5JPMA 4YS1A 2E7CA 1NCHA 4MJHA 3I6LD 3SD5A 3JVFC 2X30A 3CIVA 1WKDA 2Y85A 4ROQA 5JIDA 2WXLA 4D7BA 3VI2A 3SE6A 4FQXA 1PG7W 3PS7A 3YPIA 1WT5A 4FB7A 3WX7A 4HB7A 3HCVB 3QFJA 5E8NB 3OXSA 4KZDL 1KLZA 7A3HA 1BBDH 3OLGA 4YGAB 2F54A 1TO5A 4NUJA 5IGXH 2AL1A 2BGQA 4C1NA 2E56A 1RVKA 5AWNL 3S4TA 3SCWA 1P6WA 5D5MA 4CKQA 5D38A 3MLVL 1RK0A 3K6NA 3MXVH 4N5EC 3X11A 5KUMA 2NXYB 1K4CA 3UYCA 3WLTA 3UBGA 1OANA 1CJYA 1GTNA 3W22A 2ZOXA 3T8VA 4CNPA 3QDMD 4W9IC 3RTQD 3FH7A 2OWCA 4Z8FL 4KFZC 2OMTB 2YO3A 4NHCL 2NPLX 2ZZ2A 2VRJA 4MNHA 3P4OA 4XOBA 5F88B 3VXRE 2VLJA 4D8OA 1FNEB 5INDB 5MERB 3WK1A 2D0FA 2AQ3A 1EANA 4TRPH 1EEZB 3D6GA 4GXWA 1PLAA 4G1EB 1KZQA 3P9MA 1RLWA 2APTA 1PPIA 2B59B 2JH2A 4JYDA 2IDFA 2WHMA 4WGHA 5BOZG 3WUFA 2DIKA 1XXFC 4GRMA 2W27A 1RLBA 1K3ZA 1XO8A 2XG5A 4E2OA 4L4TB 4QWWC 4U31A 3BT2L 2ADFL 4WU5B 1RURH 4X6DF 1G0DA 4XP6L 5KJ4A 5TH2B 2PS2A 1WE5A 2YZ5A 3GW0A 3ITTA 3ME3A 4PN6A 1KELH 2HX7A 1GCYA 3MNVB 3V6OC 4DP0X 1JZDC 1LORA 1PDZA 3SPVA 4AD2A 3QJSB 4PJGA 3GMRB 7ENLA 1UA3A 4IBZA 1M7DB 2L04A 4Q89A 3WS6A 1RBOB 3QDJD 4PTTA 1JJUA 3VVGA 4XAKE 5HULA 2EZ0C 3L9YA 2QGCA 1VFSA 3OM3B 3FQUA 2BCKB 5EULV 4BELD 1UPMB 4LB3A 3ARQA 3CUPB 4NC1E 4ES4A 5HI3C 4XOCA 3F6LA 3QI9B 5C6MA 2XPYA 3R8HA 5T5FL 3O9NA 6TAAA 3FCPA 4U1KA 5BMFH 3ATFA 3L3JA 4G42B 5CHNA 4FI8A 3JWDC 4N0CD 5J3HC 3H4WA 1D5MA 4XAPA 5FJTA 3F2BA 2FZ3B 4A4AA 5HVHB 2MQCA 3NTCH 4QRTA 3HPJA 4M4RA 4Z5RA 1LWRA 5TF1L 2C0HA 1KRBC 2X9WA 2V2HA 4L8SC 5H2BB 5AC5A 2JQMA 4BKNA 4N87A 4UT7H 4WHCA 2DSZA 2JKNA 3NCJH 1U1HA 2WSYA 3EWDA 3OQEA 1KIPB 1QUPA 1H8NA 3BUBA 3PDGA 4URTB 4KAQL 5I6PA 1IM9D 1HKWA 4X4ME 3EOAA 4B9PA 4AYGA 4I5XA 1GSKA 1MCPH 2YD1A 2Z31C 4MD0B 1FOBA 2C1HA 2XN2A 3BC9A 1RUMH 4F66A 4D94A 1MNUH 3LKOB 4WI5A 2WP3O 4KITB 1TWZA 4EF3A 3LPGA 4U1LA 5CINH 4ENZA 4CU6A 2B4CC 3M86A 1V27A 2FLRT 3QXUA 3SOBH 7PAZA 1P7HL 2GKIA 5LHFA 1WXJA 5FYJL 3A22A 1BF6A 3EXJA 1EP2A 1EJTC 4OH2A 4HTYA 3FKRA 2H2SD 1LQSR 4BY3A 4FYSA 4NO0A 4JDBA 1NEZB 1JFQL 1V7NL 2LE9A 2NY2D 1MCHA 3PBWA 3ARGA 4CU7A 4G9PA 4Y8AA 4LY8A 3WLNA 1OHZA 1XCFA 2YBUA 4A6YB 4UTAH 4RIRB 3LEXA 3U3HA 5GHWL 3H2OA 5CCZA 4HZLB 4Z78B 3GMNB 3GK8H 4RZCA 5EC1A 5KBNC 3L5XL 4ADGA 3SBPA 4PH8A 2RHEA 1YDOA 3OMAB 2AHIA 4J3XA 3VRJA 5KVGL 1TUFA 2OMWB 1DBTA 5EMUA 4HC1H 2E0PA 4R53A 3NIDB 4IIQA 1UZ8B 1RPKA 4ZX5A 3GUTA 4MD5B 3UVAA 3W27A 2Z6IA 1CFNA 2P5ED 2LGNA 3TJHC 3WJMA 3WFCL 3FCGA 1H3UA 2C4FU 2IPTL 2EVGA 3FJLA 1AJ0A 1CPUA 1YEJH 3QPQD 1XG3A 1Q13A 1Y65A 4PJ5E 4G6JH 5C0BD 1VCAA 4X8CA 5MENE 5FSEC 5BV7B 1TUPA 3FU5A 4WKZA 5HGBA 1VYPX 3FU9A 1CS6A 3C5JB 1OK0A 2CCLA 1CB4A 4M7LL 3EXLA 2X1UA 4GGBA 4XAWL 2X28A 3JS3A 4LLYA 5LHDA 1JCKA 2JF7A 3NQ2A 3DAQA 1PYMA 4Z2HA 5F3HB 1QUNB 4X5QA 2PDHA 2H0PA 4NKOB 2N59A 1E42A 2YUWA 3O0RL 1JBJA 2PGEA 4K94L 4NYYA 3RGTA 2XX1A 3D0LB 3UCRA 2ED9A 2ZWLT 4OCSH 4ZMWA 1CEOA 1M7IA 3F12B 5IBUG 1OAYL 2AXFA 1JDCA 4UYPA 1IR1A 1E0WA 3U2CA 3B8SA 3CDCA 4HJ1A 3FQ1A 4Y9BA 4IGBD 1I3GL 2QBWA 3AXHA 4QDGA 4UIMA 2FEDC 1QI0A 3T8XB 1A6PA 3TYFA 3SUSA 4ODTL 3RPIA 4MNQD 4EBQH 3GDLA 4MTVA 1GGIH 4PJEE 4IIBA 5C07B 4P4RA 4WTWA 2WQUA 4UU9B 4UDTB 4XNXH 2FO4B 3IETA 4Y5XC 3C56A 3UGRA 1DQQB 2VXQH 4S1FA 3DG6A 3TQPA 3HHSA 5MP6L 4PJBB 2JELH 3TSBA 3WLQA 4RIRA 2B5IC 1E0UA 4K36A 4X80H 2ADJB 3N9SA 3QVAA 4E9VA 2GAZB 2CUMA 1A5FL 3U4KA 1A8JH 1KG0A 2HJLA 5KSVA 2EUXA 4S1QH 2W9EL 2NXHA 1FP8A 1R2RA 2J43A 3HG1B 3D3VA 2W9MA 1U8OB 5EOTA 3ARRA 4OSUH 5E03A 2CO6A 2BZCA 1TYRA 2YUZA 1MHCA 2CSPA 3LZNA 2F08A 4P2RE 3ZSSA 2I56A 3QPEA 4N9BA 4N2BA 5TDPB 2D7MA 1V4YA 3THQA 1HUVA 3W1XA 4KHTL 1IRAY 3MRKA 1AR1B 3BXNA 5GNZA 2DQMA 1JV5B 4Y2OB 5F3FA 4HKBB 4DZIA 5C0AB 5LGXA 3IKCB 1LNUA 2X4QA 5ELIA 1FRGL 3T1FA 3UZQB 5MI0B 2FWOA 5IOPB 1KNWA 4HPXA 1PVHA 4RDYA 3W9EB 4DNLA 1VADA 5IR1A 3HE7C 1S9XA 1CLCA 3F65A 4KJPC 1ND0A 1IEAA 3CWNA 3JTSB 1LHZA 2HG5A 5D7IA 2WXJA 4J2QA 4EXKA 4BEIA 1IC0A 2VLRB 3MSDA 3TNBA 3M5VA 3EOYG 5B3JE 1G4EA 3D3VD 4JW3A 3HOJA 4R4FH 3WFHA 4MHBA 4W87A 1BFTA 1J9RA 2EYSB 3BP7B 3GTVA 4MDRA 3BLLA 4Y4HA 4L9XA 3VNYA 3DHDA 3VIGA 2Z1WA 4N8UA 4DVOA 3MR9B 4PJ7A 1HQ4B 1VPOH 3S97C 1OCWH 6XIAA 3C2YA 4MYPA 2NQLA 2DWEB 3BVTA 4JNYA 5C0DA 2XFXB 1T0NB 5I1AB 1S7WA 3QIUA 2VCAA 3ZFHA 5FOOA 4GAJL 3U6RA 1J87A 3B04A 4HHAA 1A4BA 1ORQB 3KYNA 3BWSA 5CJQH 3MRRB 3S96A 4DEUA 2BVWA 4S3FA 1BG1A 2NYYC 1OCWL 1OXYA 5HP5A 1JXFA 1IARB 4RV8A 5JIPA 4FMFA 3Q2WA 5TE7L 2QQNL 2NCMA 4Y2DD 2TSBA 1INDH 3V16A 5BS0E 1NINA 3TV3L 1R7AA 1XD0A 4DJDC 2HKFH 2PTWA 5K1NA 4B90A 4PJIE 3BZJA 2RIKA 3PY2A 5C09B 2EPMX 3OPZL 2VYRE 4G8GD 3N2XA 4ZUTA 4ERSH 1E67A 1YA5A 4B7LA 1MCWM 5HAOA 2V2CA 4HSAC 1T5WA 1U8OA 2VEKA 3ANVA 3UWQA 1GQJA 2QJJA 3MWCA 4ZA0A 1W3IA 3PHQB 2ODHA 3V5HB 1QFHA 2Q8AH 4Z3GA 2H6OA 5AAPA 1I6NA 1RV8A 1VGAA 1EEUA 5TDPA 3OZPA 1A14L 1OK8A 3FJ4A 4PG9B 4GQ9H 3WLMA 3QYSA 2BDNH 5GGUB 3DV4A 4XTDA 3BSHA 4J3OC 4J8RB 1ED3A 1LNUB 2X4QB 2Z35A 4WHDA 4R83A 4U3SA 2PLKA 4JQIA 1VIZA 4GG8A 4LF1A 3TW6A 1AZRA 3NZHL 2CBOA 4ZUSB 4ILSA 5DURD 4TS6A 5L7XL 1TV8A 5HMEA 4CSZA 4D8PB 3CAVA 4GSUA 3EGXA 1KTDB 1ND0B 4TVDA 3HZKB 4L37A 3G22A 1QNOA 1UR3M 3REVA 4H19A 1UJPA 1T83A 2P8CA 3QJUB 5C9XA 4Q58C 4Y4HC 5T9BG 3RU8X 1NMAH 4DN4H 1N10A 1GQNA 3E0VA 2Z4QA 3LVEA 4TNVF 4JANA 1TWIA 5HYJE 3ZIZA 5L4FA 2Q8LA 3UTTB 4IBWA 1WUZA 5AC4A 1P53A 2F54D 3HJEA 3DJ9A 2W9DL 1MSSA 4XN4A 3HPFA 3ID7A 4KO9A 3N3MA 3P8IA 1TIUA 1S7TB 3NDZA 3EOTH 3W11C 1NIFA 4L8DA 3TM6A 3PN8A 2NUYA 3I6GA 4JPVL 4MJIE 3M7SA 4MX7B 4YDKH 1QA9B 4QTGA 1YEFH 4L9LC 1LEKB 1DQWA 4A3QA 3LEYL 4UB9A 4X42A 1YNKH 3RA7L 3WHE0 4PMFA 5DFWH 5TE4L 5A2IH 1TQXA 2E9LA 2I9UA 4LUIA 4OFYA 2HBVA 3N9KA 2WB5A 3CQQA 3KVKA 4YGVA 2Y1ZA 4XVOA 4U6YB 2FZ3A 1BGXL 4RISL 4XBEL 1TPC1 3L7FB 1T80A 1USQA 3RZCA 4XZBA 1XFPA 2ZXWB 4A6YL 5LHEA 2R1YA 5T3XE 4XO7A 3H3KA 1FYTE 1UXSB 2XV3A 2E5BA 1QTPA 2UZIL 2EIDA 1TQUA 3ARDD 4OGAD 2HVMA 1CGTA 2FHFA 1O4UA 2PCYA 2YBGA 3GB7B 2PWDA 1JP5A 3OKKA 3TOYA 3AWEA 2Z1XA 4GZEA 5KVDL 5J06A 4WW1A 3PHSA 4LT7A 2C4XA 3S36L 5AB3A 1QLFA 3TURA 4KJWC 4PRPB 1SEQH 1U8KB 3IGKA 1N6QL 4N2AA 1JCLA 3VFNA 1MRFH 3BN9D 4L5ZA 4B91A 3H7LA 4OZHB 4JFOA 2DQTL 3OMIB 1OX4A 3VABA 4G7VL 2WLLB 3DUHA 1OP3H 4XTRC 4ZNCD 1ZEAH 1VCFA 4IX0A 5HHXL 5KYXB 43C9B 3TXZA 2XFFA 2HKFL 2GEQA 1RSYA 4WTQA 3GRIA 1QSFB 3OB0H 3QUHA 2HLFD 1FVCA 2V7HB 4JDTL 4FG2A 2FB3A 3GBNH 4AZ5A 4FHAA 2D4DA 1GS6X 3X3GL 1SPDA 2ZYHA 5TDOA 2V0TA 5AKQA 2JKWA 4QRSA 1RMFH 5AAWC 5KBDA 1AW5A 5ANME 1WHPA 3KM2A 4O1BA 4DWDA 5EIIB 5L9DL 4NM4H 2ZUTA 1OF2A 1QWNA 2OULB 3KCPB 4GINA 1KB5B 2XXCB 4PGCA 4Y16A 3DIFA 1E2VA 4AIZA 4UILL 1YEKL 3U7YH 1E6ZA 1HO4A 2QGHA 5DF0A 1UWEL 1TCRB 2VDLH 5DX7A 3OLIA 1ZS2A 4ODTH 5F3HA 4LFHD 4GQZA 1W0VB 5J5RA 3Q2CA 4B9IA 4A29A 1OSZB 4TVCA 1V7ML 3IE4A 1RULH 1EJ7L 4D1IA 4JO5A 1QR1B 1W56A 2B5IB 5D04C 2WHJA 3PP3H 1V02A 3VSTA 3ESVF 5LSMA 2V5LA 4IIHA 4L0ZA 1K6AA 3APNA 2HLAA 3WL9B 1T99A 4FNLH 4IOIA 5EU7E 1QNZL 3FQ2A 3V4PA 4BGLA 5T5NF 1R8LA 2NQZA 2NXIA 3TLRA 2WTRA 4IJTA 4XBPA 4IQEA 4G5AA 1W15A 2YD6A 4NPJA 4NQXB 4OGYH 1A1OB 3NQ7A 4FEMA 2J6VA 4XVJH 5DD1L 2D22A 5BMXA 4UUJA 5C2UB 3RHWK 3FTUA 4KX8A 1IBDA 2ITDB 3ECBB 4HV8A 1X6NA 1GW9A 4XUGA 4F3HA 1TMCB 3M0HA 5EMLA 4IK6A 1P0DA 3KBHE 1FL6B 5A6JA 5LQBL 5C6PB 2DYPB 4HLZH 3RGVD 1CD1B 2G0LA 3PPCA 1RD5A 4Y9OA 4TLSA 5G4EA 4CSSA 3F4WA 1PZBA 2DQHH 4TSCH 4NQEE 1T3FB 1AY1H 2D7TL 2IANA 2MQ0A 2P5WA 4IOFD 3S36X 5I1JL 1KFEA 4ZZKA 4Q3MA 5IB4B 1XF2A 3CL6A 4LVOC 1QACA 4MNGA 2EIMB 1PG7H 3OKLB 4KXZI 3UXFA 2ZOKA 5EMMA 1GJIA 1AGFA 3HZVA 2XM2A 3B9OA 1HKLL 4BFJA 5JW4N 3V4UH 3H9SD 1FZMB 2NUTA 1SNRA 3P4MB 5BXPA 4M8QB 2XKUA 3QDJE 4GKOA 4QMEA 4OLXH 4XMLH 3V4VH 1RZGA 4AVJA 1HL2A 4OKDA 1OK6A 5JHLL 1SZGA 1TPDA 1PD6A 2ABAA 3T6CA 1O9ZA 4GRWB 2YZRA 3TZFA 3AUWB 3GRWH 3HVDA 2J74A 3VI4F 3AIVA 2SODB 4DKFL 4JO3L 4YK4B 2AK4D 1NBQA 3FT4A 1MLBA 1VJIA 3DHFA 3PPGA 3IFLL 2Q6WB 3TZVC 4WFHD 3LA4A 3RRAA 3EA3A 3GMQB 4HIHA 1ZWIA 1IGIH 3NJIA 5SX5H 3H56A 3IMVA 4BFKA 4A7QA 1ZMYA 5J4MA 1I7TA 3W3OA 1J0ZA 5DRWB 4GXVH 3FRPB 3A4DA 4NX0A 4GO6B 4PMQA 1W16A 2JK5A 4KZEL 1ML0A 4PUEA 1LTXA 1RPQA 3KWWA 4N9OB 3GM0A 3IEAA 4DP2X 1JF1B 3VXMD 2NNXA 5AG9A 2P0IA 4F15C 5KG9A 3VGHA 4LSUH 3ZKQD 4EUPH 5CPLA 4DO7A 2YCLA 4IDLA 4WW2B 2K4AA 4UQ2B 1EWDA 4OB5L 5TJWK 2DFAA 4E5XG 4TUJB 3O0FA 3EYQD 1AL7A 2K9UA 4OCWL 5EO9B 5EDSA 4O1AA 2X6AA 3PJWA 4H4NA 5DJ2B 3SDXE 3NEHA 1N26A 3BP6A 3T0DA 1J5OL 3MRDA 3LKPB 3LY0A 1ZP3A 1NLDH 1V93A 3HAEA 3OKMB 4EI5D 1TIMA 1X8CA 3OVPA 2PLTA 4IBSA 1CR9L 3QNZB 7REQA 4I9XA 1J12A 1K4HA 3O4LA 3CN2A 3IMTA 3CV6A 2A6DA 2YBRA 4HWNA 3OB8A 1L0YA 4W70A 4BV1A 1SYSA 3HE7B 3KPRB 4F58L 4M3PA 2PWFA 2A7BA 2N0KA 2GY7B 1X5MA 4L9ZA 4AENB 5IIEA 1MEWA 1W3JA 3C09B 2WXDM 3MUJA 5AZEL 3IDJA 2VXTH 2HUHA 3QQ3A 3WKQA 4EVNB 4I2XB 4RMUA 2ISWA 4FNQA 2O5ZL 5B39A 4MNLA 5JDSA 4H26A 3IFPB 4R7XA 4CQ8A 2XQBL 3SZ6A 4JZNB 3N6HA 3U7BA 3W7DA 3ZJ7A 2D24A 1TJIH 3CV7A 1T5WB 2FQDA 3RURA 4Q7NA 3W28A 4LF3A 3BUDA 4PRPE 3CPRA 3T40A 3DDFA 3QRGL 1S9VB 5IFHH 1O60A 3LCYA 4OLZL 2AV7A 5E5MA 1QMUA 5GRJL 1A5BA 5JBEA 1UH2A 3L3KA 1X7TA 3L3HB 4WHYG 3KPRE 1TU2B 4Y4HD 3EZJB 2QIWA 1QR4A 3W24A 4G8GB 2HRLA 1WBZB 1NIBA 2Z4QB 4NHCH 2WK2A 3UZWA 1MG2C 1RHHB 4HKPA 4Z2LA 1ED3B 5GNXA 4OIBA 4YNGA 5HINA 5IB3A 2AQPA 5E4EB 3T1WA 3NFPB 5AVVB 3VIPA 4H2CA 4Z7OF 3G77A 3GO2A 3VA6A 4J6RH 4XP1H 4F2BA 2V5CA 3IXTB 1FWSA 3P81A 5F6IB 4O0ZA 2YCLB 4ZRGA 4OJDH 4OSUL 1JS4A 1ME8A 4FABL 4ZDHB 1SJBA 3LLFA 4GH1A 4C6LA 4DJFD 1ERNA 3BAKA 2EDEA 3I6GB 4NDMB 3AC0A 4NWUL 5TQ2L 3DX9A 5TPWH 1JD9A 4S1QL 1AW1A 2QNEA 3GC5A 2O92A 3UWWA 5EZOH 1D5BA 2YEZA 3R10A 3TL5A 1QOQA 4WKHA 3NJKA 3E12A 3TLLA 4AD3A 4ZB5A 4AY8A 1DVYA 5KSAA 4BCEA 1SJEA 2PDJA 5CZRA 1FH5L 1PQZB 2HMCA 1DWIM 2F7RA 4PLJD 4PMDA 3WH7A 3AIUA 1GA2A 5JBFA 3FRUB 2NLJB 2WKOA 1N2RB 5F7DA 2BJMH 2N3JA 1H3VA 3B3IB 2MTAA 3FHAA 5CEXA 1ITXA 4RRPG 1W31A 4FABH 4KF1A 1N0XH 4AZHA 2FTYA 2APBA 4LP4A 4X8JA 5EFDA 1Z2KA 3ULVC 1OM0A 2P8MA 2R59A 3GVQA 4YVVA 5A7EA 2A9CA 3FO9A 5IMLB 4AB4A 4OCRH 2IOIA 5CD5C 4DTGH 1EHLH 1IIKA 2OW7A 4YWIA 3TSMA 1NFDA 1EUNA 4PRHB 3O2VH 2EIEA 3UGEA 5H2BA 2VC2L 2HT4C 2CO3A 4XMPH 3RKPA 1V79A 4F9PC 3OJGA 4DGYH 3S0CA 5EBLA 4QRRB 2G3XA 2ZWSA 3K1KC 4YBQC 2G97A 2OB3A 2ZX7A 3BD4A 5EB9A 4OZIB 4GNKB 1LQ0A 2HDJA 1GHSA 3WIIL 3BSZH 4F20A 4XTRD 1RHFA 4IPNB 3ATDA 4Q2ZA 5CKGA 2G2NA 1MCCA 3TBYA 3CU2A 2XG5B 5DQDL 1KPVA 2LABA 4MDIB 4ZTPL 4J2XA 5FGCE 3NOEA 2CC0A 1F86A 4XC1L 4YAQA 4UINL 1KCWA 3QCTL 1OF2B 3KS6A 3FONA 4HJUA 4IMKA 4Q4IA 1X8FA 4L8BB 2A9ML 2XFWA 3C6CA 2M83A 4K37A 1AHKA 4FE9A 1U8LA 1I85A 3KVDD 3V8CA 2QR6A 2MUCA 5C0EA 4PJCF 5DQJB 3I7QA 1PX3A 3R0DA 1FC2D 2O6FA 1RBLA 2GQ3A 1FVCB 3PPFA 1Q2SA 1M1SA 1RQEA 3JZ7A 4EF9A 3PY9A 1MW3A 1KFBA 1PYWA 3BOVA 4PI0A 4I18C 5DJDB 1GTEA 1Q7ZA 3W2UA 2IPUK 2D8KA 4ABUA 2I24N 2C4FT 4IHOA 2Q76A 4PJ7F 4HU0A 4C56A 3UBPC 4B4HA 4EACA 3F5JA 2QS8A 4ZSOB 4P2OA 1P6FA 4DP5X 4Y16B 1U8MA 4R97B 2VXQA 4WUKH 4QO1B 2P80D 2IQAB 3VJ6A 5FCZA 2XJKA 1ZSDA 4IFKB 4PVNA 3VD0A 3NQBA 4E5TA 5A6BD 2V33A 1WCQA 3OPSA 4F8NA 2Y5QA 1S5HB 1F1GA 4KTGA 3C8NA 4IP7A 4PTNA 2NY6D 2PCFA 3OR6A 1L8PA 4ZXBC 4D9LL 3QWOA 1PGRB 3TBCA 1JXJA 2BVPA 4PV9B 5F70A 3RMJA 3I3BA 4LPCA 3NZ1A 5F89A 1LP9B 4KCUA 4YHYB 3MI2A 3QMRA 1TREA 1JCTA 5K9CA 2QAPA 4NQCE 2CJTA 3VXSB 1I7RB 3TFXA 4K8HA 1KXQE 3H3BC 3UBFA 4G9FD 3W3BA 4F0SA 1KQZA 4X6EB 4LVHB 1HX0A 4JJHA 4XCCL 2V63A 3B5HA 2J7CA 3V0VA 3HS0C 1A8ZA 2CBPA 3UCQA 4I3RL 1F42A 4C6JA 1BLNA 1RZFH 2ZUWA 4XHQA 4JFFA 3HTLX 3TU9A 3UW6A 4RNRB 3PAVA 5IV2B 2X2UA 1P48A 1F4WL 2EDWA 4M7KH 4POZD 1VYRA 1QBMH 2JXMB 3BVDB 3KPOA 4H8PA 3TN0C 4PJ6A 1HZKA 4CQDA 4I3RH 3R8QA 5C0QA 2OMYB 4KOCA 5C7VA 1NICA 3MYJB 2Z31D 2AJUH 1QLRA 4OV5A 2FO4A 2QPFA 3BEVA 3IETB 2CBUA 5DMLA 1KEML 3PUEA 5CINL 3OVRA 3GG1A 1OL0A 4P23C 4Q4PA 1FA4A 4XO8A 1YUKB 1TWSA 2XPKA 2OJZH 3QFGA 3GSWA 4O5LL 5E2JA 3S36H 4BFIB 4G5DA 1E6XM 2WMPA 1JULA 1CXEA 2OK0H 5BXSA 4L4VB 4CC0A 1SEQL 3MBEB 1MELA 4JR9L 5FYLH 5J89A 1E9OA 2VDNL 5IROC 1VR6A 2BC4A 2OZ3A 2V7NB 2V8ZA 4Z7UA 4P5TB 1IAOB 3JTBA 3UR7A 3AWGA 4HK3N 1KFAL 2VXVH 3TEWA 4M8VA 4RE2A 4RR4A 4XPHH 1JUBA 4AYBA 1AANA 1YDYA 5HJGA 3HC3H 3VYPA 2QCFA 3BIBX 4JO4L 1TV3A 1MCOL 1D8CA 4OGXL 4OIIH 1EWEA 4NU7A 4JS7A 1GRWA 4U1JB 2JGYA 2PZNA 4NN7B 3EJZD 4FXGC 2PE4A 4HCGA 1KEGH 5G4OA 4FG4A 1THFD 4YIWA 5JIWA 2PPAA 5AAWA 2CQVA 3WIFA 2ESCA 1JV2A 4NZRH 3LY6A 3TP4A 1SUXA 4JY5L 4ANKA 4R7DA 1E4XH 1VHNA 2HISA 1TQWA 2QTEA 1NIAA 3KPLB 1NIDA 4GKSA 3FN3A 1F61A 3D3AA 3VI3B 1BMGA 5AHNA 4AZGA 4ODBD 3ZE1E 3MZ2A 2LT9A 2VDLL 3IVKB 2ISSA 3LV3B 2KHAA 3GI8L 4MXVF 1E9IA 3ZWTA 2CAKA 4DIAA 2Y22A 4POCA 4L5FE 2YBTA 1BLIA 4IU2B 5F7AA 5EA0L 3ZKSD 4MLJA 4M7JL 3V0VB 3CFBB 4EKXA 4O13A 5C0ND 1NKRA 3F01A 3Q2VA 4NNYB 2Y5TA 2GVJA 2BOCB 1NOFA 2P8LA 3W75A 2MPVA 2HSAA 3IMRA 1MKFA 2AABH 4WX2A 1N3NB 1YPXA 4UTMA 3F05A 1PDKB 2KBGA 4E5XA 1Z89A 4GI8A 3ZDXF 2BZNA 3ZTEA 4JTLA 5I17B 1HHGB 4RFOL 1I1AD 1RQ5A 2F53A 2DEPA 3I68A 5D7LA 3MRGA 3VFGH 5LGJA 3VGAB 3GJEB 3CB8A 3FEMA 4BFBD 1XLAA 4X8GA 4ZQRA 3PAZA 3ITOA 3N5AA 3GEFA 4TU1A 3DX2A 4H0HB 1CCZA 1JZ6A 3V1HA 3RRQA 2I7SA 2VISA 2D2JA 3SCMB 1FQ0A 3T05A 4RFEA 4XHJC 2H0EA 4X7CC 4L9YA 3WLOA 3ZT6A 2FH8A 2LLGA 2R0KL 3TCLB 1U5VA 2QCGA 3U7AA 2KYIA 2J57A 2UY7B 3GXNA 4IRJC 5F7FA 4CQBA 1WOBA 4XNMA 1MI3A 1ODAA 2P3ZA 5EO1B 5DR5H 1SQ7A 2V69A 3O6MH 4IW4C 3VFGL 2DV6A 4ALAH 3PPHA 3HFTA 4L4VD 1IBGL 2UYLA 2VDIA 4UTWC 3EEZA 1QRND 3DMMC 3VIFA 4XSMA 4QRRE 4RDQG 3NIFB 5AVXB 2ZRUA 3H42L 3UBXI 5I03A 3RYSA 5FKAB 4ORMA 3MP4A 1DWGM 1IGSA 3B7YA 4AM0A 1K02A 5AZ2H 3US0A 1CI3M 2XFXA 3FRUA 4NI6A 3R7RA 3BVNB 4HJ0D 5A3IC 4P3CH 1F3WA 1WBYB 2YXVA 2X70A 4O58H 5DJCA 1NMBH 3IN2A 1GVYA 2P26A 1NUNB 1MG3C 1SM3H 3FZUD 3KNBA 5GVJA 3RM8A 2VR3A 1AKJA 1K85A 1GZ1A 4DWSC 3SCMD 3LKQB 5CJOL 3WMQA 2PP7A 3N12A 1NWTA 4MMYB 3A23A 3RDTB 3W1RA 4WWPA 5SX4I 2ENSA 4YZFF 1UC6A 1OCOB 2ZKHL 4UAOC 5IMLA 1DVSA 4UM8A 2DQJH 4OFIA 1IT7A 4G8IA 3TZNA 1AG0A 2YAEA 2MCMA 4EXBA 5DQDH 3QARA 4YUEL 4N5ED 5F9AC 1XC4A 5BXFB 3C6LC 1P6AB 1MF2L 1HOCB 3FBKA 4ODSH 1VBUA 1QHZA 1F4WH 4M7KL 3AISA 3VE7A 4K3JL 4Z7VA 5JMOC 1FDZA 5I2UA 3RN6A 3TCXA 3DN5A 3QXTA 1KENL 2RHGA 2QVTA 2DPEA 3LENA 3NQ8A 3RU6A 2DM3A 3TTSA 1LEIA 5C0BE 5EU4A 2I27N 3F4VA 2FX7H 2N56A 3PWJB 3WNOA 2VZOA 1GKQA 2A6NA 1JZHA 2XSKA 5KUKA 3R06B 4YH6A 3OAUH 1FCBA 1E1FA 2VISB 2EZ0D 2IIJA 2HBXA 2NW0A 1QFOA 1NBYB 4OCRL 1C5DA 1JN6B 3G5VB 3G5ZB 4RRPA 5JUEH 4I5UA 1JK8A 3VRLF 3BRFA 4GG9A 4QNWA 4PUDA 4G7RB 2E6DA 4NRYA 3LB6C 4PB9H 5E4OA 3P9MB 4Y0GA 4XNDA 5CZ0A 4LAZA 4G6AD 2KQNA 2Q7AA 4Z7WA 4XZNX 3P69A 1AZCA 2K0RA 2UUDK 5E1HB 5HHNB 1W1IE 3A24A 4Q2ZB 1FZOA 5LBSA 5I30H 3ULVE 1UJQA 5DUPL 3O6AA 4BFNA 1TENA 5B3NA 3MQTA 3RNDA 3N29A 4X6CF 2XIBA 1ZHKA 4KY1L 2XXFA 1T96A 4X61A 3FQWB 2ICWI 2I7OA 5KAQF 2PXYB 4WWKB 1JPKA 4ZMYA 1OCRB 3TT1L 3MV7D 3SDCC 3LRSA 1R17A 3RL1A 5HDQL 2NVAA 3OG6B 4EWJA 1I2PA 1R87A 3ZDYB 1BQCA 3NA4A 2AITA 4YNYB 3SDCA 5SWSE 3MBED 3BAJA 2X53A 4ZUUB 1MRQA 3OXRA 1XH1A 4YHZH 3B3DA 4UWMA 1P2CA 3QNFA 1EJ6A 1H41A 2QHRH 5MHSD 2AV1A 3N3EA 3V6ZA 5B38B 1UBPC 3C8FA 1ZCOA 4JTCA 4MDOA 3S1GA 3IK4A 3EGDA 3QYQA 5I3HA 2Y07H 1R19A 4PWHA 1AD9A 1NCDH 8CGTA 5T1JA 5E94B 5DJAB 4E0RB 1W1TA 3NN8A 3QJFB 2PF8A 5I9QC 5KVEE 32C2A 3QQ1A 2QEJA 3QJHA 4XZLX 4OCSL 2P1YA 2GJXB 3S2JA 5MEND 1NMAL 1HHKA 3VYOA 2DMGA 4UTCA 3BQUD 2VGIA 3QUXA 1VPQA 1SN2A 4OV4A 3EIFA 2Z0BA 1QO5A 3FCTB 3QWRD 4YS4A 4JG1H 3KYOA 3MT1A 3UR5A 3AADB 2WB7A 1U3HC 3SBRA 4PLNC 5KSUA 1U30A 4H0LC 4N1HB 4E2BA 3F4DA 5DK3A 1Z3GL 2VXTL 4KO7A 4RKAA 3QQDB 4XN8A 1JPEA 2NZ9D 5DQ9A 4TSAH 3MMUA 1ITQA 4JN6A 4ETQB 4O17A 4ZS6C 4I5BA 2YCIX 3WNJA 4DYEA 2HH0L 3SDXF 1K8IA 1ZPLA 4YPGB 1EKOA 1FFPA 5TFSL 3MFFB 1P84K 1M1XB 1Y0LB 2HTKC 2VL5A 3MYJA 1VLIA 1CF1A 4OV5B 4JTEA 4MUPA 1VHPA 1YNQA 1YPZE 4ZQPA 2W9EH 2APWA 5B1CA 4AEEA 2VDNB 1LBMA 5HHMB 4AQ1C 1D5ZA 1KIRA 3UTPE 4B5EA 4LC6A 1KN4H 2XWTA 4LV9A 4ZPTA 1RJQA 1YZZA 3DX4A 3W1QA 4A7UA 2A6JA 2ZX8A 2IQTA 5E9AA 4C4KT 4TSCL 1E9OB 4ZXBB 3GK8L 2A21A 3FO2A 1A6AB 4JX6A 1UP3A 1UOLA 4UQEA 1MREH 4AWTA 5LIUX 1Z8AA 3DESA 1CL7L 3QPQC 3SE9H 5D2NC 3EYOB 4V1YA 3SJVA 3GRWA 2J78A 1W1VA 3G5YB 3HQNA 3VD4A 4IIFA 4LLQB 3ZMEA 3LHUA 3LKNA 4OUIA 4AD0A 5CNHA 4LDOB 1EDGA 4U6TA 2Y9RT 2WBJC 3MUAA 3MGAA 2CO2A 3VYNA 3TA4D 1JGUL 4P59L 1YX1A 3LLDA 4ZSUA 2R1XB 2A73B 3TW9A 4O57A 4FG0A 2CHOA 4FIQA 2IH3B 2AI0L 2NYKA 3OKYA 5D9SA 2LFEA 4PWGA 1KF9B 3B9KC 1MLBB 3BH8A 4TVUA 5JOFA 1P4IH 3LH8A 2PTVA 5AALA 5K9OA 5DRNB 1OD0A 4LAMA 1HAWA 3U0PA 1MJ7H 3WUWB 3GAYA 3LSOA 3N3TA 3BW2A 2A4ZA 4I0PB 1SN5A 5M03A 1WWWX 2VEMA 2W07B 4PMJA 1EIXA 4PUKA 4NN5C 4E8DA 3NP3A 2KT6A 2DQ6A