2ZWYA

Alpha-l-fucosidase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural Basis of alpha-Fucosidase Inhibition by Iminocyclitols with Ki Ranging from Micro- to Picomolar
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 155
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zwyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zwyA01
2DT2A 2WW5A 2CPUA 1VAHA 8CGTA 4WLCA 4H8UA 1UH3A 2EABA 2XVPA 4P8WA 4H8HA 1I75A 3VGGA 3CUHA 3CV5A 4QFUA 1K6AA 1KCKA 4LPCA 1GQLA 4XB3A 4CGTA 3PZGA 3VGEA 3APGA 4AD3A 1W9PA 3W53A 2WZEA 3G6MA 3WNMA 3IANA 1RD6A 5A6LA 1LWJA 1ZBKA 4H2CA 5A8OA 1US2A 3N1AA 4GZEA 1XD1A 2XWEA 1GCYA 2X1IA 2JF7A 2F7OA 5C71A 2W92A 1XCWA 3WMSA 1NWRA 1E4NA 2G8ZA 3F5KA 3K8LA 3AS0A 2DT1A 1HN1A 2ZUMA 2GDVA 5IXEA 1I1WA 1B30A 4CD5A 1J0YA 1JD7A 2D20A 1MXDA 1U33A 3THCA 1FP9A 2ZX7A 1JDAA 1PZ2A 1IV8A 2O9OA 3WD0A 6CGTA 4CUCA 4CU7A 1M01A 2HVMA 2VOTA 5D9MA 2GVYA 2J7BA 3ARUA 1CGUA 1QI4A 2V3EA 3WNPA 3HG5A 3KL0A 3VILA 1E6ZA 1OSEA 4FLQA 3WNOA 4JHOA 2W91A 1EGZA 1UKTA 2XGIA 2J74A 3WEOA 1E15A 3D5HA 4MPKA 4NF7A 1K9FA 5GNYA 1VEMA 3VOCA 5BXPA 3S6TA 1CGXA 1H0IA 1BHGA 4OOUA 3TTQA 2E9MA 4Z2IA 1HL9A 1HXJA 2CERA 1H49A 2ZX8A 1O7AA 3U7VA 3RMEA 1GOKA 3AMGA 1NWTA 3SCQA 3VMPA 1EIBA 3VGFA 2ZX9A 3OGRA 1WZMA 3POCA 2EPOA 3ZSTA 1LG1A 2BY1A 3GXTA 4LX4A 2G3MA 2OWXA 4R27A 1ZS2A 3H53A 3WENA 5E70A 2D22A 2WPGA 3MUIA 2HISA 3FN9A 1ECEA 4NSBA 1PJ9A 4AC1X 3WDJA 4M80A 3I3BA 1CXFA 5I0DA 3BC9A 4MNKA 1XSJA 3WY4A 1CGVA 1MXGA 5BXTA 4PRWA 1H3GA 1KXQA 3NSMA 4PMUA 4GO8A 1Q6DA 4WJXA 4CVUA 2EEXA 1DWJM 2D23A 2W5FA 3CHEA 1OGBA 1D7FA 1GJWA 2Y8VA 3SEPA 5A8QA 3MUAA 1NWUA 1WCGA 2VCBA 3POHA 3PZUA 1O7DC 1GZJA 2AAAA 2A3CA 1UR4A 3PTMA 1CDGA 1E3XA 1IZKA 2YDQA 4CCCA 4AISA 3DX2A 4HMDA 5A6JA 1OT2A 1H09A 1M03A 1X6NA 3WD3A 4P7RA 3HMCA 1LF1A 3JUGA 3N12A 4C7DA 2WVUA 4UQBA 5EBAA 5ABEA 3BAJA 2DIJA 4CCDA 2WLZA 2CBVA 1AQ0A 1CXKA 2G3JA 8A3HA 4AMXA 2VUYA 5CPSA 4DWSC 1W2PA 2X0YA 2G41A 1V6VA 4W5ZA 2GJPA 5JBFA 5DT7A 1XGZA 1V0NA 2WVSA 4K68A 3UR7A 2D0GA 3T2OA 1RP9A 2WCGA 1C7SA 1CBGA 1UD3A 2DGAA 1OGGA 4OBSA 1TQWA 1JYNA 3VGDA 1B3VA 2WVVA 5FCZA 1GOIA 1KCLA 1XC6A 4OBRA 3BLPX 5M03A 2PWGA 3GNPA 4PMNA 3VTRA 2VL4A 1GJUA 2Y24A 3DDGA 1Q6FA 1CZ1A 1VIWA 2EACA 2OSXA 5A6SA 1VF8A 1WNOA 3DYPA 3WDHA 2WCSA 3B9AA 3M7SA 1J12A 2BHYA 1V6YA 4HMCA 1V3HA 4U3AA 1XCXA 4FLRA 1EOKA 2E3ZA 1OT1A 4E8CA 2DSWA 2PB1A 4GPNA 1UH4A 1JYXA 5D9NA 2DDXA 1D3CA 4M29A 1QW9A 5A8PA 5EFFA 1GW1A 1F4HA 5A2CA 1B31A 2EADA 2DEPA 3EDKA 3A24A 3W4RA 2XVGA 4BQ5A 4Z2GA 1R8LA 1HJVA 4QLLA 4MNLA 1W91A 3L4UA 3AQUA 2PWDA 5E1QA 1DWHM 4NRSA 4HPGA 5JUVA 4AD0A 1W1TA 4KGLA 1HKJA 3GXIA 1E1EA 6TAAA 1CLXA 2CBUA 4OJYA 4AD2A 1N82A 2WXDM 3KLLA 1WDQA 5FOOA 1W32A 1US3A 4XZWA 4CN1A 3IGUA 3AHTA 2DIEA 3FAWA 1ISZA 1J11A 2XSBA 4U3CA 2XUCA 5D9PA 1KR1A 1Y7VA 5JIWA 1FFQA 2YDRA 4S3JA 5GQBA 4F66A 2YKKA 4UOQA 3MV11 1DTUA 1LL4A 1XSKA 4BA0A 7TAAA 3CHFA 2VRQA 3DHUA 3AIQA 3MO4A 4AW7A 3QHMA 3D50A 4WSJA 3FW6A 2XM1A 3EMQA 3VM7A 5A2AA 1MFVA 1WDSA 3RJXA 1MW2A 2YFNA 4TVUA 5FD0A 3ARPA 3ZT6A 4X0VA 4F9JA 2XHYA 1PX3A 5IDIA 2ZWZA 4D6IA 3EJSA 1WKYA 2EAEA 1SMAA 3PHAA 2Y2WA 4Z2LA 2IGTA 1ITXA 4MDPA 1CECA 3WELA 1JYWA 3OZPA 5M3WA 1HXKA 4D1JA 3BMVA 1QNSA 3WH7A 1EQPA 2BXYA 1FOBA 2EPLX 2VNCA 1UYQA 3N13A 3OLDA 4LQ1A 1PS3A 4ACZB 5A2BA 3HG2A 4CD6A 1E73M 4AZ7A 3OLEA 3BUBA 2ALWA 1GHRA 5I79A 1JZ3A 1K9DA 3FNDA 2BY2A 2YLLA 5I24A 1LQ0A 4RE3A 5CZKA 1V02E 1XH2A 3VMOA 1ZBCA 2YJQA 1W9VA 2XFRA 5FL0A 4UNIA 3CHCA 1CGWA 1W3HA 3RM9A 3QHOA 5DEZA 1UA7A 3OGVA 1VRXA 3WQWA 2WSPA 3BCFA 3MUY1 1H2JA 4HZ6A 4W87A 2YA0A 2ZX6A 2UY2A 4AD5A 5HPCA 3BUQA 3LX9A 2OWCA 5AY7A 4KRTA 4EK7A 4DUXA 4ATLA 2XVKA 4WIWA 3WNNA 3WY2A 2XJ7A 2OYKA 4DUVA 3PZIA 1OINA 1Z32X 1NWSA 2EPKX 1UWUA 3W6MA 1VFFA 5EMYA 4FK9A 4ACZA 4A4AA 1E70M 2XN0A 4KMQA 4AZ6A 3ZT5A 3EJUA 1S46A 2EXOA 4FNSA 4NX0A 2O9RA 3PZNA 3S2CA 2YDSA 1ZBVA 1EDQA 1NOWA 5CXPA 3VIOA 3LRMA 1DWAM 2CEQA 1QVBA 4J28A 3CC1A 4DO6A 4UFMA 5A1AA 4NZFA 1JFHA 1C8XA 4D6FA 3K4DA 3FHAA 3GH5A 2ZUVA 1ZU8A 1IZJA 1U30A 4RL3A 1GOWA 4IUGA 3QOKA 3HG4A 4UOJA 3VINA 3TOPA 3WQ8A 2A3AA 3VIMA 2X09A 1JNDA 3SCOA 3UESA 5LYRA 3W6LA 5CPTA 1FA2A 4IPLA 4WSKA 3D52A 1SZNA 3RIKA 1NP0A 5LA0A 2XPKA 5ABFB 2VZOA 2C0HA 4M56A 1QNPA 2VX7A 2O92A 2V3FA 2CKRA 5CSYA 1KGXA 2Z1KA 3ZM8A 4AZBA 3EDJA 3TTSA 2EPMX 1QX1A 2OW6A 2ZX5A 3WBEA 2WANA 4KGJA 1JYVA 3CBWA 3SUUA 1MW1A 1H5VA 1W3LA 2WWDA 2E9BA 2VCCA 1KGWA 3WY1A 3KZSA 1E71M 1MQRA 2VVSA 5CLTA 1MFUA 5CGTA 2J7EA 3UEQA 3SCSA 2JEPA 1O6IA 4QCEA 1UZ4A 3D4ZA 3WN6A 3ZR6A 2O9PA 2GSJA 2JIWA 1UR2A 3NDYA 1UR9A 3BAKA 4E2OA 1V3MA 1JI2A 1NP2A 3O2LA 5D8ZA 5IFPA 1LWHA 5ECUA 3VIGA 1BF2A 1V3JA 3W24A 4JCLA 2ESCA 1SMDA 2BHUA 2XG9A 9CGTA 3WQVA 5ABHA 2BVDA 2CHNA 4IM4A 1GOQA 2EBNA 1TG7A 5I2UA 2WAGA 4TTGA 3K8KA 3WSUA 4S3KA 2WC3A 2X2IA 1NARA 3MANA 7A3HA 3AMLA 2W61A 3CUGA 5HBFA 2VZTA 2G3NA 3EMCA 2BS9A 1YQ2A 3VIIA 3TONA 1RPKA 3TA9A 4F9DA 3EBVA 3LMYA 3NIYA 2GJXA 4GZIA 3K46A 3O9NA 1TFVA 1R7OA 1V3LA 3LPOA 2XTKA 1ZL1A 3OA5A 5I23A 3WMCA 1UQYA 4H04A 3MV01 2CBIA 2J77A 1HT6A 4UTFA 1W9XA 4ATWA 3MMUA 4DM1A 4F79A 3VIPA 1KBKA 1V08A 2ZUNA 3U5YA 5BCAA 3A4WA 4HZ8A 1R75A 3AS1A 4MJ2A 3ECQA 3AHZA 3CPUA 1E4IA 5D8WA 3ZO9A 3H55A 5E6YA 2X8RA 1WZAA 1B1YA 4YN5A 1UWRA 1SYTA 4AZ5A 4BZYA 1HP4A 3PZQA 3HZ3A 1KR0A 1J0HA 1EDTA 2IUZA 3D4YA 2J47A 1QI3A 1H41A 3UG3A 1BLIA 1G1YA 2D0HA 3M46A 5BYWA 2OW7A 5CSUA 1E6XM 3WY3A 4JFVA 4XUYA 3CIVA 2PWFA 4BQ2A 5BXSA 4QLKA 4UQDA 2X2YA 3N11A 4W5UA 3WNLA 4HU8A 3VU2A 3DYMA 4E4PA 1V03A 4MAZA 4D6DA 3B9DA 4U5KA 4HA4A 3F4VA 1HVQA 4AWEA 3L4VA 1B90A 2W62A 2XWDA 1E9LA 3SCUA 2J4GA 4JAWA 3HG3A 4M82A 3VSTA 2BY0A 4XV0A 3OLGA 2J7HA 4GXPA 2DQXA 2XM2A 2VX4A 2W67A 4MB4A 1OIFA 4PMXA 1OGSA 1NQ6A 4U2ZA 2VT0A 4C7GA 1QNQA 3A22A 4KH2A 2CETA 3CHDA 4UCFA 5D9OA 1RP8A 3T0BA 2D1ZA 2VZVA 2WVVB 4YHGA 3WUGA 1UZ1A 1ESWA 2UY4A 4MJ4A 1TQSA 3WUBA 2WCAA 3ALFA 4GI8A 3PZOA 2J79A 3GXPA 3WIJA 1RH9A 3IJ9A 2VQUA 2BXZA 2XN2A 1UWSA 3EJRA 7CGTA 4LYPA 1E0WA 4CN4A 1C8QA 3CUIA 1KFWA 4ZFMA 2NT0A 3VIKA 5I5RA 3BLKA 1FH9A 4AZCA 3I3EA 3N15A 2ZUTA 1JDDA 2ZXBA 3DYOA 1UWIA 3S5YA 4ZXOA 3VD3A 4V28A 2CNCA 2GFTA 3WDRA 4PMDA 2WMKA 4LYRA 3KLKA 3O6AA 1J9YA 3CO4A 3WL1A 3VDCA 3AIEA 3AHYA 3UG4A 2QHAA 2WKLA 4FNTA 1WDRA 1HX0A 1E4MM 4PTXA 3WD1A 5I77A 2WMIB 2YL8A 4Q7NA 3VNYA 2YBUA 4GQQA 1PZ3A 1GVYA 1VENA 1BAGA 1CXIA 2ZUWA 1DEDA 3K8MA 5BXRA 1E5NA 1E0VA 2QF8A 2WMHA 3MKKA 4AEEA 5DO8A 1HJUA 1XYZA 1K9TA 2XGBA 1UKQA 4MB1A 2WK2A 3W82A 4HA3A 3NCOA 4PMRA 2E9LA 1R47A 4Y7EA 1GONA 4PSPA 1E5JA 3G6LA 1SFSA 5HOSA 2C8NA 1BFNA 3VD5A 3A21A 2PBGA 2WMGA 4ZE4A 1JL8A 3CZSA 4RE2A 1C7TA 1VBRA 4D6JA 1QHZA 4QP0A 4OGZA 3AHXA 3A23A 4CU8A 4D71A 3AYRA 3W81A 1R85A 1R86A 2ZWYA 3GYCA 1HVXA 3CZEA 2WSKA 3IJ7A 4UQAA 4PTWA 2WMIA 1TMQA 4YHEA 3WF2A 4MDOA 5A6AA 2CHOA 1UKPA 2VX5A 1UH2A 4W7UA 3N04A 1PX4A 3ZJ6A 1WP6A 3BVUA 3PBGA 2QMJA 4BS0A 3VSUA 3LPPA 3MMWA 1EXPA 2NSXA 2PF0A 3DX0A 4C7FA 4F8XA 3LPFA 4GO9A 3L2MA 3EJQA 4B9ZA 1V0MA 4PTVA 3UR8A 3DX4A 1KWGA 2CKSA 1CWYA 1UR8A 1EDGA 1OD0A 3BVVA 1R87A 2E40A 1V6UA 2F7QA 1E55A 4HOWA 4QCFA 2VC9A 3W29A 1FFRA 4DUWA 3L4TA 3A47A 2ZOXA 4RE4A 4PEEA 4TTUA 5DMYA 4FF5A 2DPEA 3NJ3A 2WWCA 2D73A 1JAEA 1E6QM 3PZ9A 3W27A 1E3ZA 2FGZA 1G94A 1LJYA 1CTNA 4ZENA 3WFZA 4LGXA 2PI6A 2WZIA 1XH1A 3WDIA 2OWWA 1B9ZA 1JF6A 5CPQA 2D3LA 1X1NA 2FE0A 3WBAA 1QHOA 3T0AA 4AD4A 4NRRA 4GINA 3BUPA 4MADA 1GOMA 3RPMA 3WUEA 1EH9A 4HTYA 3AYSA 3S5ZA 4Z2KA 2X0HA 5E09A 1ITCA 3AICA 1CLVA 2FHFA 1XRVA 2Y4SA 4X9YA 2DSVA 3HU7A 1C92A 5A8MA 4BF7A 1OBAA 4IPNB 3CTTA 1VJSA 3DDFA 3BVXA 1E6SM 1C93A 2VCAA 2F18A 4UFHA 4W85A 3QR3A 3SCWA 4BCEA 4CKQA 3OIHA 1V3KA 3VPLA 3AMCA 4JHZA 4UFLA 3WD4A 3EDDA 2VR5A 1BGAA 2V3DA 3ARZA 2IXUA 3L4WA 2FDMA 3AOFA 1BG9A 4FMVA 2XVNA 1PAMA 5BROA 3W37A 3KEHA 2XN1A 5AYBA 1JIBA 3TP4A 4HA1A 3VUPA 4AZGA 2JF6A 1TVNA 3BAYA 2WM0A 2O9TA 2GK1B 2J78A 3FY1A 4XX6A 1E6NA 1JZ6A 2YOCA 1B0IA 2V5DA 2W63A 2X05A 3WL0A 5CQ1A 3NSXA 3ARYA 1M7XA 4MB3A 3GXDA 3VX0A 1J0KA 4P8VA 3VGBA 1CPUA 1JZ2A 3D51A 2F8QA 4P8UA 4PSRA 3B8SA 4BQ3A 2DH3A 3BUDA 4Z2HA 1QPKA 5I78A 4OIFA 1UD6A 1MQQA 1XHGA 3J7HA 3A4XA 5M17A 1BG4A 1CGTA 3WD2A 4P7LA 4R5EA 2DSKA 3F5JA 3AIWA 3NDZA 1PBGA 5IHRA 1JZ7A 3ZOAA 5LA1A 2WHMA 1CNVA 4JFSA 2BVYA 4GKLA 5BRQA 1UG6A 2CIPA 5A8NA 1ODZA 3II1A 1PPIA 3KL5A 1A47A 1XSIA 3SUTA 1V02A 3W26A 4KRUA 1B2YA 3WEMA 4WF7A 1E6PA 4L4OA 1QOXA 1TQVA 1UWTA 2ZXAA 2GK1A 2PC8A 3AZRA 4JFTA 1HKIA 2CESA 4MB5A 3SIMA 2VURA 1G01A 3HJEA 5D4YA 2OLHA 3BAWA 5ABGA 3DX1A 3CZGA 3AS2A 2EJ1A 4CU6A 3EDFA 3OLIA 3MMDA 3VDHA 3W25A 3ZIZA 3VIJA 4HOXA 2QV4A 1FH8A 5GNZA 4J3XA 1OD8A 2NW0A 4E8DA 4EAMA 2JEQA 2F1AA 3VDBA 4V27A 3AXXA 1ODUA 1TCMA 3AJ7A 3AI0A 4W86A 1VB9A 2WBKA 3CUJA 1E72M 3AZTA 1M04A 4EANA 3OGSA 5HNNA 4ACYA 4WK9A 2GJXB 3BXWA 4U31A 1C90A 3GM8A 1KQZA 4JKLA 1V3IA 2XIBA 1V0LA 1VFMA 1W1YA 3BSHA 1AMYA 5HXMA 1GNXA 3ARWA 1D2KA 3NSNA 3SUVA 3BCDA 3PZVA 1EHNA 1PIGA 3U57A 3ARXA 5A94A 1GORA 2WMJA 1QBBA 3GTNA 5A69A 4CN6A 2RGMA 3MUZ1 3VVGA 1PIFA 3AMDA 3EDEA 1JZ5A 2J25A 4NZCA 1W1VA 1LL6A 1EO7A 4TVDA 1KTCA 5DFAA 1JI1A 2WC4A 1HJQA 2ZE0A 3VKKA 2OYMA 1JD9A 4WKHA 1JXKA 4P7NA 4URIA 1E4LA 1JDCA 1G0CA 1UHVA 5JIPA 3SCTA 1A3HA 3SURA 4B3KA 4GI9A 3EYPA 1OB0A 3PZMA 1HJWA 1W2VA 4GIAA 2NT1A 1AVAA 4GQRA 4P7QA 1UR1A 4B16A 4Z2JA 4N0RA 4TVCA 2F61A 3MS8A 2F7RA 3AXHA 3BAIA 3K1DA 3WQ4A 3EJTA 4W8AA 4AIUA 2YL6A 2WMFA 2VZUA 1MW0A 4AMWA 1JXJA 3CZNA 3EMZA 3H54A 4AD1A 5GPRA 4J7RA 3PTQA 2BNJA 1V6XA 2IXVA 4FNQA 4W7VA 2D0FA 2FH8A 1UA3A 3L4XA 4NZJA 4QDMA 1ZJAA 2CXGA 1HJXA 1CXLA 5JBDA 2VJXA 1WZLA 1JZ8A 4J27A 4UQCA 1L8NA 1Q6GA 1LG2A 3VIFA 3A3HA 1HL8A 4AIOA 1JFXA 2A3BA 3AHVA 1UD2A 1R33A 3CMJA 3IAPA 3A6OA 2Y5EA 2QPSA 3U7BA 3WEZA 1E43A 1TA3B 1QI0A 1XH0A 2E0PA 3W38A 4ZE5A 3D3AA 1QBAA 3CMGA 1XD0A 3GXNA 4PUEA 4JKMA 3W0KA 4TXEA 1CIUA 1ZBWA 1IT0A 3SCPA 3LPGA 2B31A 2BFGA 4JL1A 5CG0A 1QW8A 3WDPP 4QLJA 2WBGA 3A4AA 3UETA 4M81A 3GNOA 3ZJKA 5JBEA 4W7WA 1GQIA 3BVTA 1KXVA 3WDQA 4BQ4A 3EJPA 2X2HA 4A3HA 2OYLA 3GNRA 3T2QA 4J3VA 1DWFM 1G9HA 2D24A 4V2XA 1NM9A 1WB0A 4MTVA 5EB8A 3L4ZA 3OBAA 3AIUA 4L4PA 1DWGM 5DF0A 5A6KA 4DWSD 4HP5A 4AZCB 1W9BM 5E6ZA 1HTYA 4UOZA 2XVLA 1KXHA 5GNXA 1BVZA 1UD8A 4WKFA 4JIEA 5A6MA 4GZJA 2CCRA 4NXKA 1WZKA 1J01A 2G3IA 2V3GA 4NI3A 1HIZA 4TOQA 1TA3A 3VD7A 1KBBA 2J75A 1BYDA 4B3LA 2F1BA 2DSZA 1TQUA 1MYRA 1V6WA 3CZ8A 2XIIA 1MQPA 2XFFA 1KGUA 1F4AA 1UUQA 3PN8A 3WF3A 5I3DA 3N17A 3N9KA 4WKAA 4FNRA 1FHDA 2YLAA 1HJSA 4MAVA 4B15A 1ISVA 4D1IA 3VM5A 1QNOA 1W9UA 2VRKA 1J10A 2VQTA 2BY3A 2X2JA 3K4AA 2ZICA 1ZB5A 2FHCA 4JFUA 4AEFA 4TUFA 1CGYA 2J8GA 3WF4A 1TR1A 3FAXA 3VMNA 4FNUA 3CLWA 4CCEA 1VJZA 3WF0A 1CENA 2Z1SA 3KWXA 3WNKA 5A6BA 1R7AA 2C7FA 2VZSA 2A3EA 2F2HA 1JF5A 1EQCA 2DT0A 3GXFA 5AC5A 2E8YA 1ISYA 4P7OA 5I6SA 4AYGA 4ZEPA 3SUWA 2V38A 2PBOA 1WE5A 5FL1A 5CLWA 3B9EA 4PTMA 3BSGA 4JL2A 4H41A 5LA2A 2ZUSA 1AQMA 3VX1A 2CITA 4CVWA 1YHTA 1HP5A 2WYSA 1GVIA 4D6HA 2WKGA 4FLSA 3VD4A 3T2PA 3DX3A 3DHPA 3AIRA 2YFOA 1J18A 1BQCA 1QNRA 2DT3A 3TTOA 4ATDA 3TTYA 4HOZA 1E6RA 1B3YA 1UQZA 1DWIM 3GBDA 2UWFA 1B3WA 4NXSA 2EPNA 4PN2A 3VSVA 4PBGA 2JFEX 4N42A 2WHLA 3AROA 3N18A 1CXHA 2VRJA 5AC4A 2JALA 3U5UA 1MWOA 4HZ7A 1J0IA 2WB5A 2WHJA 2Q8XA 1BTCA 3BH4A 3NYDA 3SUSA 4FLOA 4JFWA 1WDPA 2BV9A 3ARRA 4OUEA 2E8ZA 3ZT7A 5KZ6A 3WH6A 1NH6A 1CYGA 1WO2A 3UG5A 4J3UA 3ARQA 3WF1A 3SCRA 2VO5A 1WPCA 4PMYA 2J62A 1H4PA 2FHBA 3AZSA 2A3HA 2D2OA 4ML4A 3LRKA 4J3TA 3CZLA 1KB3A 3BGAA 4UR9A 4U5IA 2ZUUA 3IAQA 3A5VA 2W4XA 5C70A 1Q6CA 3VNZA 3L4YA 1XYFA 3M07A 4D6GA 3ARSA 4CD7A 5BWFA 2OSWA 1GUVA 2UY5A 4M24A 2QLYA 3BMWA 4UQ9A 3DECA 5FKYA 4JZ5A 2FGLA 2J8FA 1BYBA 3CH9A 3PTKA 1GHSA 3LXBA 2VR4A 1C91A 1VEPA 4PUDA 1GPFA 3GDBA 6A3HA 1M53A 2XFYA 2DH2A 1EOMA 2DSUA 2F7PA 1L0PA 1FHLA 2BHZA 3VD9A 4AXNA 3AFBA 4M8UA 4UFJA 1UKSA 1R46A 1B3ZA 5A6BD 4W8BA 4EE9A 3MI6A 1W9DM 4AMCA 5A95A 4UFKA 4OKDA 1E0XA 3RJYA 2J7DA 3KE0A 3GXMA 3E1F1 4H8VA 4IISA 4MNJA 3T08A 1J0JA 1BGGA 1NOUA 4D6CA 2FH6A 2PWEA 1Q4NX 1BPLB 4LXFA 1SR0A 2EO7A 4UQEA 2UY3A 2WZHA 2WC7A 3ALGA 1T0OA 1H11A 2VTFA 2PWHA 3RM8A 3RDKA 2RGLA 1BSIA 3WH8A 3GZAA 1VFOA 1KWKA 2JIEA 1P6WA 2BVTA 3CZJA 1UKOA 3WUFA 4CD4A 2CYGA 3CZKA 2YBTA 3ZQ9A 4P8XA 2WLYA 2VMFA 3OZOA 4YPJA 3BUIA 5BRPA 2XSAA 4XZBA 5IHSA 3RCNA 3UCQA 4A3YA 3AS3A 3NUKA 3T0DA 1VEOA 1G5AA 1HKKA 1NOFA 3IK2A 2TAAA 2ZXQA 4FNPA 4TX8A 2G4FA 3T09A 1OIMA 2QMKA 1Q6EA 4W84A 3MSDA 1KQYA 1V0KA 3THDA 4U2YA 2WVTA 1DHKA 1C3FA 5AYIA 5E0FA 4PMOA 3W28A 3GH7A 4UFIA 4PCTA 3HN3A 4DM2A 1HKMA 1TQTA 3WFLA 3BAXA 1WAWA 1U2YA 4Q22A 1JZ4A 2WNWA 1CXEA 3RILA 1MVYA 2ZIDA 1ZJBA 1H0GA 1E56A 3ZJ7A 3QHNA 4EKJA 5IFTA 1MW3A 3VO0A 3SCVA 3KL3A 4ZXLA 3F5LA 2J7GA 1UD5A 5CGMA 3AMKA 5E0CA 2YL9A 1R34A 2YL5A 5FIPA 3LXCA 3WKZA 3ZMRA 3VGHA 3ZR5A 1QI5A 3IJ8A 3LXAA 4PYSA 2AMGA 1QHPA 2D3NA 4GI6A 2GJRA 1PX8A 1X6LA 4DWSB 2YA1A 1HWWA 3BLBA 1C8YA 1FH7A 4OZOA 1W1PA 5HPOA 3OG2A 5HDRA 3ZJ8A 5CJ5A 1EHAA 1BYCA 4HMEA 1UD4A 1VFUA 1ISXA 1UWQA 3MU7A 3SCNA 3OB8A 4HPHA 2VI0A 1W3JA 4AZHA 1AQHA 4DO4A 1UR0A 1QWNA 4DO5A 2JE8A 4J3WA 3WH5A 3WH9A 2VX6A 3GBEA 4PMZA 1QI2A 1I1XA 4CD8A 3QOMA 5E9AA 3FXYA 1BVNP 4AZIA 1CEOA 2CBJA 2MANA 1OWQA 1XV8A 1K9EA 2XYLA 3MSGA 1QWUA 2Y8KA 3RM4A 3LRLA 4X0NA 1TZ7A 4JKKA 1W3KA 4AIEA 1JGIA 3AISA 4TX6A 5F7UA 4J3SA 2ZXDA 4D72A 1E40A 3TV8A 1LL7A 4PMVA 1EO5A 4UZSA 1JAKA 1LLOA 4D6EA 5C8BB 3RO8A 4KWUA 2WHKA 4LYQA 4DWSA 1BYAA 3CGTA 1GOOA 4OOZA 4W8LA 5KEZA 5TD4A 4U33A 2V5CA 3ARVA 4W88A 3UERA 4B9YA 1E1FA 3WQ6A 1ISWA 1OM0A 3AIBA 1HF6A 3WMBA 3L2LA 4JCMA 1TVPA 4AY1A 3M6DA 1H1NA 1GQJA 4PCSA 2QPUA 3AXIA 1JNEA 4H7VA 2J7FA 4QAWA 4PMQA 2GUYA 4M1RA 5DT5A 4MNMA 2YA2A 1B3XA 2J7CA 4W89A 3QGVA 3GH4A 2E4TA 1J0ZA 1UOKA 1PEZA 3FHQA 1KTBA 2GDUA 3I3DA 3PZTA 3AIVA 1GQKA 4AYSA 2OSYA 3VDAA 5ABFA 1DP0A 5A3HA 3ARTA 1KXTA 2YIHA 3VIHA 3WQ5A 4W93A 2W66A 2AOSA 1EA9C 1TE1A 1FP8A 3DC0A 1JG9A 1OCQA 4UZUA 2VVNA 1UASA 1TUXA 3CUFA 3ZSSA 3BVWA 4HU0A 1HNYA 5M5DA 2EQDA 2FYVA 5EFDA 1VBUA
chains in the Genus database with same CATH superfamily
1RBAA 5DFVC 2GQHA 2XSXA 3CV5A 3S8GB 4YAQA 2H2PC 4K2UL 3ALPA 4XP5L 2YCIX 1DLFL 1J79A 1W9PA 5EY5A 3NGFA 1DHPA 5E1GA 3DI1A 3UZVB 3WIIH 1US2A 2VELA 2RD0A 5EN2B 2BWDA 4X5QA 3FN0H 3L9CA 1UOLA 4ZFGL 3HS8A 3ILQD 4FFYA 4M6NH 3G5ZA 3TO4D 3BPOB 4GT0A 2Z93A 3KBMA 4Z3FA 4OGXH 4B96A 1QLFB 5D9MA 1F4XL 5LAXB 4FIRA 4YJ5A 3S3GA 9PCYA 3EX1A 5TFSL 1P0SE 1IM9D 1H5BB 4NUQA 1I8UA 2N7SA 4IGBD 3O41B 1GOKA 4YXLL 2UZIL 4E9LA 2ZX9A 4LCIL 4FXGB 3ZYJA 3H53A 5RUBA 2WPGA 3C6LB 3CE1A 3K72A 5F6IC 4QHMB 3VJ6B 5GZNC 1G4TA 3UJTH 1UPMB 1NIFA 2X4SA 1CXFA 3BC9A 4YIQA 1E4XH 3IBOA 2CLZA 2Z31A 5IBXC 4WJXA 3CHQA 3VFMA 2Y8VA 3SEPA 3SBWC 4HLZG 3FBQA 5FV2A 2FIKA 4XX1G 3T04D 4HCFA 1R19A 1FFOA 4AH2B 4BI7A 1BX2A 1YYLH 1E3XA 4JFYA 4X5WA 5EZJB 3TO2A 3OHXB 5GJSH 1K70A 4Z5RA 3N12A 3QS2A 3OKDB 2HFGH 1EBHA 2PS2A 5KSUA 5J1AA 3G9VA 3EGDA 3HB3C 5DC2A 4TQEL 1V0NA 4N2IA 4FN0A 4GAYA 1NOLA 3MV8A 1I7TB 2WCGA 2DWYA 1K8XA 1CBGA 1I3GH 4LW7A 1DVUA 1RULH 4KAQL 4DGUA 4JANB 2IMMA 2BVUA 2NUWA 2MNWA 4G9DB 3W56A 3DRQA 1BVOA 3D05A 3ME0A 1Q94B 1JJUA 5CU5A 3LHTA 2YB1A 2FEEL 1LDPL 1V6YA 1OD9A 1A1OB 1V3HA 2GOUA 3G3DA 3UTTD 3JV4B 4R7NA 2ICSA 3W39B 1F3RB 4OM1L 3DGRA 2XVGA 4JEJA 3L4UA 3UPBA 3JV6A 1BZOA 1ME9A 3CT7A 5GGRB 1BJ1H 3HC4L 3VRIA 3ULVL 5HHXL 1Z9NA 7TIMA 2WXDM 1IT9H 2RH0A 1XGYL 2IBBA 4GI4A 1QBLH 1QFUL 1IM3D 1F1GA 4ZO7A 4GIOA 1KTRL 4KX9A 4U1KB 3T6VA 3BZGA 1KRAC 4QBXA 4PRIE 4LGPB 3R06A 1A49A 1FE8H 4HHMA 1DTUA 5I30L 1QPQA 1TZIA 5D7IB 1PTAA 1CZ8H 4N2KA 2QGDA 3QHMA 1ZVNA 2DQHL 4Y9MA 4PJEE 1MW2A 3GKWL 1KCUL 2OTDA 4F0RA 4HJ0C 3SGDH 2ZCLH 2QCMA 1J8HD 5JHDE 1U8IB 2H3NA 2BFVH 4NUMA 2VM8A 1BVNT 1CECA 4HCDA 3D34A 3NH7H 1IQDB 2DKSA 5D5MF 3FQUB 4FXRA 1NAMA 3O6ML 4LRSA 5T5NG 3GZ3A 4P2QD 1F41A 5AD0B 4TOYL 1IIHA 1XIBA 2BVPB 4F7PA 3VMOA 1G7JA 4HWBH 3KDNA 2ZUYA 2VIRA 4MDRA 2WSPA 4Y5XC 4IBUA 4EK7A 2FVNA 2NY4D 4J3OF 1KTJA 3WNNA 3VFOA 1HXYA 1G7LB 3M0VA 3VNJA 5ECVA 4UTIA 3Q8AA 1BYOA 5K4ZA 2Z1PA 1XFCA 1YMYA 1TPEA 4F0KA 3IFPA 5DD1H 8FABA 3NDYE 5EH1A 4IOIA 2VC2H 5LG1A 2PUQT 2GGHA 3VH8A 2P5EE 5HGDA 1BZQK 1U0QA 2HJKA 2HPTA 4PJ6A 1YC8A 1JNLH 5D72L 3HG4A 1C08B 2NLIA 1R3WA 2RQ8A 1Y1UA 4LLVA 3RKPA 4L3EB 1LDSA 4LSRH 5I1EH 4IZGA 3L0NA 3LKRA 1NP0A 2W80C 4JGJA 2GFBA 4KROB 4C60A 1ZHBA 2OT0A 3X17A 5CC6A 2V3FA 2CKRA 1Q9OA 2VXQL 5EBWA 1KGXA 1NBYB 2EXWD 1CLZL 4OE7A 4G56A 5TNVA 2WANA 4ZSTA 4OZIF 1W3LA 4AVHA 3LGEA 4MJJA 1TPC1 1A6UL 2J7EA 1Z89A 1LL1A 4Y8FA 3DA0A 3MRJA 1XTMA 4UMAA 3Q44A 1DE6A 3D4CA 1NP2A 4HUVB 1U58B 1LWHA 1ZCRA 3N2JA 4JYDA 3WOVA 1TTCA 4TL5A 5LWYL 3MRQB 3MRNB 1KZQA 3WSUA 5BZWB 1WDWA 4L1XA 1RBLA 4A3RA 2W0LA 4BZ2A 2J6WA 3OA5A 4Q4OA 2A6JB 2MNJB 2CBIA 4R83A 2EKJA 3B3BA 4S0SD 3FCTB 3H7LA 4HIEA 4GRWE 4GZ7A 1AA1B 2C6QA 2EDFA 5BCAA 3LN3A 4MCZB 5E9DE 3F65A 4MJ2A 3AHZA 3DO4A 2W07B 3ZO9A 2C1PA 3B4UA 2KPWA 5J11B 2GUOB 3K1KC 3NOIA 4YE0A 2EYRA 2X3BA 4NT6A 4XNBA 3MFFB 2H5UA 3JWDL 3UAJD 4C6OA 3PWNB 5FS5A 1WFOA 2CLKA 1OAZL 2AP2A 2X2YA 4L65A 4JPIB 5LDSA 2DZXA 5KTEL 2AQWA 3VU2A 1JDFA 2R24A 3GI9L 4LFYA 4U5KA 1EFXD 4XBGB 3HQPA 3JZEA 1X4XA 2XNAA 2VITA 3S4SB 3PWGA 6REQA 2DQGL 2J4GA 3F7JA 4X6BB 1A7PH 1TTAA 1KBPA 5GZOC 4MZ8A 5D7LA 5TE4L 3KLHC 3P8IA 3SKNB 3GSWB 3V6OC 1PAZA 3W1MA 1X8CA 3MWAA 3MLYH 4ZMAT 3VXUD 3MTWA 3C5XA 4YHGA 4GQ9L 2HMID 1AW2A 5KMYA 4ELKA 3WJXA 5JIIA 2X4TA 4F33A 2XN2A 4LPYA 1MCQA 1T21B 5H6HA 3RTQA 1E0WA 3QARA 2YSSA 3R0UA 2D3JA 3GNDA 1FH9A 3VKCA 4AZCA 4P9ML 3G8RA 4ZD3L 4YXKH 3VABA 4XAYA 1GYCA 3HE6A 1P4BH 1MCWM 1HKLH 4XNYL 3II3A 4QTFA 1PZ3A 3EBHA 1UC4A 2O4MA 3G0XA 3K8MA 4PV9A 4MY1A 2IH1B 3ZMEA 3BAEL 1CFTB 1DJIA 3TN0A 9XIAA 3QORC 4WTWA 5IB4B 1FUNA 2EYSB 2EEDA 3V4PA 3O3EA 1VCFA 3TEXA 1YEKL 2R91A 3GVQA 3LD8B 4OVXA 2NUPB 1C5BL 3HUJB 5F4XA 2OJPA 1H7RA 1AZCA 5AEAA 2CO7A 4FYQA 4IBVA 4OGZA 3AHXA 1FNGB 2UXTA 4CMMA 5H2BA 1R86A 3U9WA 4ODVL 1OT4A 3VFRA 1XF1A 3ESNA 3UP6A 1BW8A 4DETA 4M7TA 1TMQA 1RXLA 4FYTA 5LNDA 2FYYA 4O1FA 1AE6L 1JGEA 4XXCC 2Y0FA 1L6PA 2XQ0A 1NBCA 4AY7A 3N44F 1MI3A 1R5VB 4MWAA 4JGDA 4ILDA 1IEXA 2F2KA 5ESAB 1UENA 2PDMA 4JIPA 2K45A 5IVXB 1QFHA 2V7NA 4L9ZA 3LN5B 4ALAH 4HOWA 3RTLA 4EQ3A 1FFRA 4DUWA 3C56A 3MQTA 1CTNA 3WDIA 4M3HA 4MJHA 3F4DA 2AQ2A 1C9WA 2BHFA 3WUEA 3BDXA 4UAOB 4GKTA 1BFOA 2OEKA 1SYVB 4NQEB 4L4TD 3IJYA 1TMCB 35C8H 3L5XL 4JZJA 3ARBC 2ZWLT 4WWKB 1UQSB 2VKWA 3G5VB 5DUBB 3MWCA 2XKSA 1BG9A 1T99A 4S2BA 3FK4A 2XN1A 1HKWA 3MOAH 1R1CA 4ONHB 4Z18A 2W79A 3VUPA 3DEQA 4FR6A 3QTPA 1D9KB 2HTKD 3NDOA 3HMWH 3FY1A 1A4CA 1MUWA 2V5DA 1LM8V 3NAVA 4DBSA 3DXAE 4UZGA 5IMMA 2QDHA 3K6SA 1L6YA 1CPUA 4CQBA 3QY7A 2QNEA 3NNTA 3MX0B 4PAZA 5AYYA 2GT9B 3NIGB 2XFXB 3WD2A 1OPGL 3V5DB 1NMCB 1IWPA 2WGNB 1QEWA 3BLIA 3CFNA 1OGTA 2UZXA 8RUCA 3N50A 2CIPA 2JLLA 4DOHE 4YHPB 3RJDA 4L3CB 1A47A 3A6CH 4U0QB 3L5AA 3PS7A 3SJ3A 4KRUA 4EE2A 1ZCCA 3C5ZC 2H4EA 1TRDA 4JO3H 1F11B 3R79A 4HGMA 3OLIA 2V9RA 3T0CA 4ZTPL 1ZXKA 4XXDA 4L9DA 3N4AA 2GSHA 3H7BA 3OZLA 3LCXA 4PJ8B 3UH8A 4K37A 1Q13A 2NYYD 3F5WA 2BNQA 1D2KA 1YDNA 1KB5L 2VABB 1KCSL 3C5SB 4HJGA 5C9RA 3APDA 2J25A 3OAZK 2D4FA 3ECVA 3VFGL 3NYKA 4MNHA 2HE8A 3NEHA 1YLVA 1XG4A 2VFEA 2WQPA 4X2PA 4FQQB 4P2AA 3KHQA 1ZS8B 3PBWA 1NBVL 1MCLA 3V4VL 4OWGA 4WHDA 3WX7A 2JIXA 3A6BL 4WTZG 1GZHC 5EC1B 4JM2B 1FQ9C 3ATZA 2O7QA 5IRPA 1BM3H 4Z7WB 2F74A 4TVCA 1F6PA 2RAGA 3D9AH 1JPEA 3S37H 1OFBA 3WTYA 3MLVH 1HQ4A 1JV2A 4ADSA 1DVTA 4US5D 4OD1L 2XPGB 4S3DA 2ITDB 4YDVB 2X70B 2ITEA 1OKEA 1UA3A 5EBGA 4LKXB 3R1GH 4U7MA 3X1FA 5IK3B 3NXFA 1ROWA 3A3HA 3ZR4A 2VLLB 3WTWA 1BBDL 4ZUTA 4JVPA 4O2FA 4UQIM 1XX9C 4J1UB 3U7BA 1XH0A 4JQIH 4UNUA 25C8L 3ZVHB 3IRPX 4MLIA 1A0DA 5CG0A 4RMUA 4EUPG 1SJHA 3A4AA 3WS3B 4Q32A 4O50A 2VN7A 4K7FA 5EU5B 3G5EA 1GQIA 1KXVA 2JGYA 4PC8A 4KV5F 1KFAH 3CYVA 1WB0A 4L9LA 4JY4B 4DWSD 3ARGA 3RVXD 3PXHA 1HTYA 2OCFD 2YAPA 1MI5D 1F74A 2XU2A 4OLWL 3PF3A 3NN8B 1WWWX 4EZMA 5CCZA 3SGKC 1HIZA 1L0YA 1DBML 3CVHH 3QDMB 2C71A 1KBBA 2AJZB 3N0PB 4ZXBA 3Q2WA 4B3LA 3WJZA 2CKBB 5KSBB 4O2CA 5DQ9B 3IWPA 4H8PA 2HT3C 1UUQA 5IG7B 4LIQE 1WHPA 1NEZB 3N55A 5FKAB 4YHYB 1ORQA 3L9EA 2VQTA 4DP9X 2ZICA 4Q74A 4GC3A 4V1XA 2KZWA 2Q6ZA 4RV8A 1UADC 2J8GA 2QHLA 2QSQA 4AITA 4NNPH 4A6YL 5MHSE 3AUWB 2PR4H 4M4PA 3WF0A 4MA8H 2Z1SA 3PBUA 2VE6B 3WNKA 3GIQA 3QLLA 4A22A 5T3XL 3WN5C 1NCDH 1Z3NA 4F9PC 4JX0A 2OELA 4N9OB 2EVFA 1FG9C 1IGJB 1AQMA 2DN7A 3EA3A 4MG4A 1IXNA 2LVCA 1EC7A 2I85A 4GY0A 3STPA 2JK5A 4PRAB 4R3SA 4D6HA 2L5HA 5LBSH 2H32B 4AQZA 4AGOA 3IDNB 1MWAA 4DZ5A 4M5YL 3S34H 3UWVA 1SJBA 4HJUA 1FO0B 1NGPH 4Y1AD 4O58H 3CWNA 3M0MA 1OK8A 3BKJL 3H9SA 1SJVA 1P84J 2WHJA 2Z64C 4HDIB 4KCUA 4QAMB 4IU2B 1MAKA 3SCMA 2BC4A 3PIQB 4J4PA 2R0LL 2WQSA 3WUWA 1A65A 2Q3XA 3NZGA 4K7PY 2V8ZA 3H7UA 2NY3D 1A3XA 3QFJA 3T6WA 2H8PA 3MYJA 1M7PA 3TH2T 5IESH 2PDJA 3MKVA 1G7PB 4GY4A 1P5UB 5EOCH 3KPMA 4D3CL 3AWFA 5I73B 4U5IA 4ZMVA 3UPWA 3MP4A 2E9JA 5DRXA 2X4OB 3KOWA 1F3EA 3TMQA 3NEVA 3MLUH 4IIGA 4DKTA 1O66A 3DUSB 2G37A 4UINL 5D7IE 3EA1A 4OFKA 1CD0A 1EGJA 4Y16A 4MZ3A 5BVJB 3LEYL 1PZAA 3IU3B 2ZCGA 4Z08A 3RGVD 3TBSA 1UKSA 4LB3A 2YD3A 3HZKA 2HA1A 1IQWL 1YMMA 3V3WA 4PMEA 1DQJB 3DUUB 4C1LA 5T5NF 1T0OA 2MNRA 2YSTA 2YD2A 3A4EA 3F7PC 3ABXA 2GOKA 1EWDA 4M1GH 3NWRA 5F1VA 4AHQA 1EJWC 3OKLA 2FD6L 4G11A 2BVTA 5KS9A 4BY3A 1IC7L 3ID7A 4YL4A 3TJLA 2UY6B 2DEYX 3OZOA 4BR1A 1TPXC 1AC0A 4ELMB 1URIA 2PDUA 3RCNA 4JIHA 1AOZA 3UCQA 3BKYL 5CPNA 4GUOA 3SE4C 3B43A 1NCGA 1XTLA 3CLMA 1PY4A 2DLHA 4PUUA 3DKLA 4TX8A 1K03A 2R69L 1OIMA 3ZTJH 2OO6A 4YDJB 4N0FB 4Y2DA 1AUSL 3DMMC 3WLOA 2PXYA 2X6BA 4PCTA 4Q8WA 4OLVH 3HN8A 5AZ2H 3T3PF 4Z1DA 3CHOA 5KVGE 4FJZA 1S5WA 1QW7A 1O1HA 1TE6A 5DGQA 1GYNA 2NR6D 1U92A 4IP7A 3SDCD 1UD5A 3MSPA 2L3BA 3MUUA 4C65A 3MV7D 2YX0A 1VFAA 1R24A 2WWMD 5IFHH 3TW6A 3BLBA 2CLVA 4YOKA 5IMKB 4N6EA 1CF8L 4B92A 4L3EE 2O6DA 3G24A 3L48A 1BV8A 1L0QA 1DBBL 1H7XA 1QMUA 4YS1A 1AQHA 2E27L 4KJQC 5D1QD 2NX5B 5JQ6L 5J8LA 2MCPH 4UNTA 4LMQE 3LEXB 3MY9A 1I1XA 4YCOA 1WISA 3ITYA 4LVEA 3FU5A 4ANUA 1W1IE 5FGBC 4GXUM 4C6EA 1U83A 1E5UI 3RL1A 1TEYA 1MREL 4M3PA 3BKML 1O7VA 5D1ZC 1U93B 2XSKA 3B9KA 4OJCA 4W8LA 4DH2A 5IY5B 4M5TA 4ZYKA 2DM4A 2CWRA 1DUZA 4S38A 4LCYA 3WEAA 1F3XA 3NFNA 4WNQB 3UPRB 5F1KC 1SFLA 2DZWA 1P7TA 2AI0L 2E4TA 4YLBA 1MZRA 2ZCHH 5CU9A 2WO5A 3RFRA 4DT2A 3R8QA 1XLKA 2ODHA 4FAAB 4V15A 3GRWL 3MBFA 1IL1A 3OAYK 4NAJA 4M7LH 3QEHA 1IAKB 2XIMA 4KPHH 1RUML 2FYVA 1BZ9B 5E2JA 5F44A 5I0WA 4XN9A 1ZEAL 3SE8L 5DJ6A 2CLFA 1I75A 3U7WL 3A4FA 3N42B 3DFNA 3MUXA 3HFMH 2DQUL 3GT6A 5JXED 5BV7C 3HAEA 3RVTC 4Y19A 1OM9A 1I2QA 5KN5A 1XD1A 3FH8A 3ZJAA 3TFXA 3KW3A 2VKZG 1DQDH 1YEYA 2VDGA 5C71A 1R5IB 4YO0B 2Y5TB 3JTSA 4GG6B 4OUUA 5G1TA 1TQBC 3B4NA 1MXDA 3NGBB 3FRUA 5CSBA 3THCA 5E51A 3G7TA 5MENA 3DROA 1ZTXL 2HVMA 3PDGA 4NKQB 1BKHA 1PLCA 2Q86B 3PUEA 2G0KA 3FVMA 3FB5B 2FX9H 1Z48A 5ALBL 4FEIA 3DETD 3WI9A 4P2VA 1HXJA 2OLDA 4BFJA 3N4FA 4LPWA 4TR9A 2J9YA 5TF0A 1F8TL 4XVOA 3SFKA 1NWTA 4JG1L 1V54B 3HA1A 1ECEA 5HYSB 3I3BA 4RBPH 5KTLA 2VO8A 3ZK0A 1CGVA 5IROA 4PRWA 2N0KA 5CZRA 3W3OA 4QNWA 4DLFA 3QEQB 5DJAB 1LBMA 2D23A 3CHEA 1HL2A 3MV9A 5A8QA 1WCGA 2PE4A 3SSJA 3D39A 3DUGA 4B27A 3PWLA 3U2SA 5CD5D 3V7PA 1XC4A 5C0BD 2D31B 4QIRA 2QXWA 3WJJC 5IHUH 3LUTA 4W4OC 3IJEA 5B1BB 2EE9A 2O7SA 1J8RA 4QF1B 4MDIB 1SN2A 5I75B 4ODHL 1L6WA 2V6AA 4YZWA 3UCDA 2VKXA 4W5ZA 4L9YA 4Y5VB 4QG8A 3R2GA 3F7YB 1M7DB 4IW4C 3QXVA 2CLRA 4QGCA 3KCPB 3VGDA 1K3ZA 4Z77A 5AC8A 2PGWA 2J4WH 3QRHA 4D0DB 3LZRA 1Q6FA 2X3CA 5A43C 1GOGA 3B8DA 3SDOA 3HUJE 1S9WA 1G0DA 3TZVD 5ABAA 4DK6A 4DZIA 1W6WA 3OSVA 1ZDQA 4M29A 4OZGB 3MJ9H 5D6CB 3OD3A 4JR5A 2BBFA 3ZKND 4WZHA 4ORIA 2DICA 4YU1A 4XPHL 3CAFA 3QQ9C 4ZZKA 1T96A 4JDTL 1BF8A 1Y5VA 1FH2A 2AJUH 4XAKD 2XGZA 4UTTC 4GS7C 4MSWB 4IP4A 4Z23A 2G5BA 4FA6A 2I5GA 4HJJH 4ZGYA 5IVXE 3GFXA 2DQWA 4PFMA 4KDVA 1KF9B 3JQOB 1KFCA 4UTLA 2OO0A 4BXVA 2YCLB 1EEZB 2VGIA 2B1AH 1IYXA 3QI9C 2CLMA 5CEZH 4MF4A 3AIQA 3W9DA 4WSJA 3B0YA 3MUCA 4L8CB 1YUHA 3M41A 4NQEE 3TC7A 2BCKB 1NINA 1HH6B 4HHAA 4L8SB 3C0QA 1G6RL 2ACQA 1CICC 1UWAA 1TR7A 2NQ5A 5BNKA 5DUMH 2VAAB 1S2VA 3PK7A 1F73A 4C90A 1UM4H 4YSEA 3TLRA 2L7QA 3QXBA 3OJVC 2ISVA 5A2BA 1UZGA 7PAZA 3P60A 5IP4A 2DY2A 3TIDB 3FNDA 1MNZA 4XVDA 5F6IB 3SDAC 2H8XA 3VG0H 4N9CA 3L8QA 1Y0LA 2BSTB 2OMTB 2X4UA 4KI5D 1RIHH 1EC9A 1DJSA 4IBZA 5I1IH 3QFDB 3FYIB 3L3IA 3UJJL 4P3CL 1IKFL 7FABL 3E6EA 3FQTA 1QSFD 4X42A 4F7MB 3NIGE 2HH0L 2EPKX 4JKNA 3QPQD 4KEZA 5EOCJ 3UW6A 5L7XL 3ZT5A 1T1YA 1S46A 4EKXA 1OE1A 2K9FB 5C6TL 3UIZA 3KXQA 1P0NA 4QYOA 4C5ZA 1CDHA 3TYFA 4DWDA 1GMIA 1JK9B 4L37A 4HK0A 4BI6A 3GH5A 4MMYB 4ML9A 5C6WH 3VE0A 1D5ZA 1KIQA 1VR6A 4OZFG 2DBJA 1NDGB 1I7UB 2K6YA 2KZBA 5K9JL 4JR9L 2V9QA 1RJYA 1R3YA 2YB4A 5F9JA 4WK2B 5BW7A 2C3VB 2EC9T 2ZVIA 4FFYH 2UX6A 3K6DA 3X3GH 4EPKA 4WI5A 3QJXA 4KHXL 1WAPA 1V6TA 3VKBA 5AW7B 1NFIB 4RSVA 4I6KA 1KGWA 5FJRA 3GC2A 2OZ8A 3VOGA 1GZQA 1FJ1B 5B22A 2X4QA 4N6RB 3Q1SL 4AM0A 3OKMA 1AZ2A 1IFHL 2QADC 1JI2A 1TJHL 2PRMA 1XFPA 4UT9H 3MPGA 2HN7B 2WJDA 1H6TA 3QE5A 4FI8A 5E6IA 1J1PH 4IMCA 4NRYB 2BGQA 5FSDC 4JFOB 2JKTM 3BN9C 4WI3A 4Z7WE 4DXKA 1RVKA 1B0RB 3MANA 4Q8PA 2RHEA 1ETZB 5C97A 3NQIA 2QDDA 5L2KA 1HILA 5B4MC 2AZAA 4LLDA 3V5KA 1R5WB 4G3YL 3NIYA 1ZZMA 3EYSL 3SE6A 3U9PL 4XX5A 5LQBH 1EXBA 2DKUA 4XNZB 2EDKA 1XB8A 1S3KL 2XIQA 1RJCA 2XWTA 1WFJA 3FFCB 4J39A 4ZUSA 3BW9B 3GKFA 4QT5A 3X1GA 3FIGA 1U8QB 1WOAA 1UIPA 2H41A 1KG0B 4FZ8H 2WYHA 3CXHJ 1BEUA 3QN3A 4YC2C 3I02B 3LK6A 3RCMA 3WO4C 5IMLB 3UG3A 3B0PA 5A2KH 2D0HA 3FEMA 1OCBA 3T2LA 1W6TA 5PAZA 4JFVA 4Y5XB 4Z1AA 2AL2B 5I1LA 2PWFA 2F6AA 4TNFA 4UQDA 3N11A 2ERJB 4E4PA 3B9DA 3TUUA 4JB9L 2QS8A 1V5JA 5HI5C 3Q45A 3QDME 1BQ5A 4YHML 3TIEB 4ECLA 3T07A 3HG3A 5KSBE 4PJXF 4IEFB 4PJ7A 2XM2A 2K78A 2VEKA 1XGEA 1BMZA 5J6SA 3O2WH 4A2SA 1ZHKA 1NQ6A 3BHBB 2VT0A 4JHWL 1A5BA 3FT2B 1XBYA 5E8OA 4O0ZA 5FYKH 2W1NA 2GAZB 4GFXA 5JR1L 1PNDA 3W7IA 1M2VA 2WBJA 3D08A 3WTTA 1ESWA 2DMCA 4NFDA 3ALFA 4KT2A 4WI7A 4LLYB 1XZ0B 4L9XA 1DE4A 2AQQA 3QCUH 1VLXA 2B77A 3V36A 3KPQA 3VFVB 4RKAA 1SQ7A 3OAUH 4ROQA 1AS8A 4IIZA 1A1MA 1P9MC 5FJTA 1YEDA 4LOUC 1ZRUA 2V5JA 3KZ8A 2VDNB 1RZ7H 4QRRB 3IS0X 1NCAH 2QR6A 4KKXA 4R4FH 4YLWA 4F8LA 3URQA 2W9EH 1W5OA 2NQCA 3G1XA 2Q3ZA 2YR1A 3MKKA 1HJUA 2OX4A 1MLBB 4L8BA 5CSSA 4FX7A 1EEQA 3BGJA 4DP5X 4O8RA 1NAMH 3BWUC 5C92A 2W0PA 3GNXA 2CR6A 3RXZA 5HOSA 2J43A 3R4DA 4B5UA 3Q05A 4F7EB 4NASA 2XETA 3OXSB 1U42A 4B9GA 4GABA 4XN4A 3QGAC 1DORA 5FOJA 5I8EB 2FECI 1FWDC 3KVPA 1XKJA 5HI3C 5TBOA 1YN7A 4JFZL 3IM1A 5DXWA 5A6AA 2VX5A 2H3DA 1WP6A 5DCCA 2QMJA 1KC7A 3GSQB 1EJ8A 3QB7C 4F1ZA 1YNTB 1ONEA 2CFFA 4JTJA 5J7CC 5D2XA 3EJQA 4FA7B 4DFIA 2QDWA 1CLOH 2V7HB 1V6UA 1DFBL 4NQDA 3E2HC 1RLDA 4M8QA 4PEEA 4TPRH 1F4WL 2DIKA 2V2XB 4ZQCA 2XZQL 2BNRB 1E6QM 4A7VA 3GNML 4MA7H 3RYSA 1DXEA 4JW3A 2Q3AA 4HS3A 3K81A 2YGYA 3SE3A 4HEPA 2CW6A 1X1NA 3WBAA 4JKPH 4ANXA 2B7OA 4AIXA 4ABWA 1FKXA 4H9TA 2UWEF 4FA8A 3W11D 3VAEA 5CPMA 2CO6B 3VFWB 2FHFA 4MNQD 2Y4SA 4ELME 3CXDL 2NTFA 1VJSA 1MH5B 5B3JE 3UBXB 3A64A 2Y2YA 2IDSA 2JJTC 4WNJA 2E77A 2VEIA 4XVJH 2DLFH 1BGAA 2V3DA 4RAVB 4F7CA 2FNBA 4LSQH 3TYGL 4AZGA 4W68A 3ETSA 3KPPA 1OP9A 4XX6A 3WIFA 1KEGL 4JTSA 2AEOA 4FFZL 1BRLB 3QZLA 1QKZL 3DV4B 1EV2E 1M7OA 3ISIX 5CC5A 4PSRA 2DH3A 3ARFD 4DESA 1OZTG 5KINA 2OQJB 3AUVA 2E7DA 1I2NA 5EPMA 2DYRB 3I6KB 3SODB 4E3TA 4BZ2H 2NX5E 4WGHA 4GAAA 2BVYA 3QZMA 4LQFL 3TCLB 2X1WL 4ZL1A 1HS6A 5ABDE 3SUTA 4ZAKC 1MELA 1L6SA 4FHBD 1E6PA 1OF8A 1G7MB 3P0YL 3QORB 2OKMA 2TSBA 1KJ2B 3BAWA 2IAMC 3SBPA 3L21A 2EJ1A 1NMAL 5CN1A 3QIWC 3W25A 1OCRB 2C9XA 2WXIA 4C54A 4QRQA 4EAMA 2KDYA 2PF6A 2F1AA 4N25A 4ICNA 4G6AC 1RQEA 3XINA 4WCYL 4CAGA 5LHEA 2TRYA 4HVBA 1FSKB 4EI5C 1OTUD 3UYCA 3RUBL 1PKNA 3WFEL 3C86A 3MGOB 1PB0A 1OF2A 4DP7X 4GYPA 2WMJA 1ZT1A 1BQLL 3T77A 4QISA 3GDLA 4EPEC 1YRKA 1LL6A 3TOYA 2R82A 1JRCA 3OJMB 5AVTB 5IHBA 5L4JA 4S1QH 2QPFA 2ESVB 2QKIC 3TAKA 4Q6JA 5JIPA 3PU7A 4GE8A 2H9AB 1WKFA 1Z6KA 4UQ2B 3JBG7 4JRXD 4YXGA 2H6PA 3GRIA 4LAQL 1KPVB 4W8AA 5FSEC 2IBZY 3IJDA 4OU1A 3W7QA 5GS3A 5F9OH 4U1LA 2FH8A 2Z34A 3C2AL 2VDRB 1BXBA 4HJFA 2PTVA 4GG6E 2LFGA 4FP8H 1W5MA 1OK4A 5B39A 5E8DL 4R7JA 1UD2A 5E4AA 1S3TC 3PJWA 3TBYB 3ARBB 3WSQL 1K4CB 1UJQA 2CDFA 3MLSL 1BDYA 1CX9A 1C1EL 3HHRB 1QSED 1BOGB 5H94A 2YAFA 2ZKHL 3UOAB 3QO1B 2RACA 2WWKT 3PABA 4X7SH 1ZANL 2P5NA 2DYPA 1IC5H 4NP9A 2DQFA 5DJ8A 3T2QA 1A9EA 4MFDA 1RZ8A 3LXUX 1DWGM 3V4PH 1IEAA 4BCXA 5AYUL 4JCWA 5GNXA 4JIEA 3SDDA 4X4XB 1KLZA 3QIUA 3VAVA 4R88A 4NXKA 1OZUA 1ZNNA 1TA3A 3U4EB 3DIDA 3DX7A 1M56B 5IJVB 5I8CA 1V6WA 3QEQE 2J6EL 2V2HA 3TWCH 4MAVA 4PGEB 4RFEA 4P2RB 4A3UA 4RA3A 2YC1A 3FUMA 4R4BB 1BXXA 1ETB1 5HYJD 4AEFA 4ODTL 1S8DA 3KWXA 1OFEA 4JQXA 4WSGA 3P77B 5AC5A 4QHRA 1GL4B 4Z7IA 2YYTA 2GY5A 1TELA 2XY2A 3L3DB 1WE5A 4Z78A 3KPOA 4X99B 1XGDA 4Y4HC 3FT3B 2CITA 4FL4C 2P0OA 4U1MB 4G9FB 3I50H 3ABRA 4REQA 5I74C 2EXTA 1KFEA 2F58H 3NEEA 2HKHH 3WLBB 1PDKB 4DVRH 1Z9PA 1OGAD 5ILTH 1JWUB 4IMLA 2E6FA 2JMRA 3PP4H 2YGNA 1K02A 1DDHB 3TTYA 4UDUB 4FDWA 4G80B 1GKRA 3CQPA 5FA5A 4OZGE 3QZWB 1WBZA 3G6DH 4NC1E 1CXHA 5MF5A 3WXWH 5BOPA 1H50A 2XN9A 1R5YA 4MQTB 3DUHA 2GIXA 5D2NC 1OK0A 5C08A 2P5WA 1QSVA 3LM7A 2PP3A 4OVVA 3S9DB 4PW4A 4M51A 5IVOA 4UR9A 5EF1A 2GSIA 3GDRA 2W59A 1R38A 5T3ZD 5EF0A 4N4YB 4YEFA 1LNUA 4JZ5A 2F5BL 2L4OA 2NY6C 4G6JH 4IICA 3NA8A 4HWZB 2G9HA 1GPFA 4OI8A 1KENL 1TPFA 4PV8A 2FFIA 4OF3A 2WSRA 4UFJA 4EF8A 3X1NA 2FJGA 5AB0A 4XGZA 3TVMC 3M5VA 1C5CH 4UQEA 2H3BA 3UJIL 2P1YA 2WC7A 1JK8B 3CSYA 1IBYA 1NGQH 3K4WA 3BIAX 3HM7A 1E9YB 5L2JB 3PWPB 1KWKA 2O5ZL 3WJMB 1MHPL 4Y2OA 4TNVF 1N8IA 3ZQ9A 2ICEC 2WLYA 4YLQT 5AOLA 2PDNA 3TNMA 3LYEA 5CHNB 5FF7A 4FNPA 1LEKB 5JORA 4APQC 5AAWC 2MHAA 2QMKA 5KVFH 4DAIA 2Y88A 5EO1B 3SPGA 3QQ3A 2J1XA 4I1NB 4PMOA 4Y8EA 3W28A 1JGLL 5E4OA 1C12A 4GIYA 3RILA 1LUCB 1IWBA 3MYOA 2HLEB 5L4MA 3VOJA 4QHUA 1YTDA 3HMJG 1XIWA 2Q7YA 1QI5A 2Q87A 3V0WL 5EU6B 2YA1A 1E8YA 3W71A 5HPOA 3LV3A 1GRWA 3OKOB 2HSIA 4WEBL 3ZJ8A 1NBZB 4AQOA 5ESVB 5FW6A 3WL9A 4HPHA 3CQHA 4TLKA 3IFLH 1AL8A 1X96A 5EA0L 3ITCA 4ZW7A 4HETA 1X4YA 4S1RL 3N1QC 1CU4H 2B4GA 3BRDA 5CCJA 3LS5L 5DZAA 5HYQA 3UA4A 4YMPA 3OBEA 2VDLH 3TA3D 3E2QA 1UXWA 4HG4K 2EIZB 1BVLA 4GW1A 4LLQB 3QH2A 3HZMA 1A14H 3O3AB 2VDOB 1A3RH 4NZUL 3HPJB 5IQ9B 1IR1A 3RVWD 3VA2C 1A5SA 3CK0H 5DO2D 5CSGA 1T7YA 3RPKA 1HTIA 3QPXH 4EN3A 4ICCX 4MXWL 1MN4A 4W89A 3QDGB 2APVA 1R2TA 2PUZA 2XBDA 3BVJA 1SVBA 2EDHA 1DUYB 3VDAA 4GH3A 2EC9U 1P4IH 1WVZA 3BH9B 3RU8X 1KEMH 2OCCB 4KCVA 4AIZB 3RN6A 1QO3A 1YNLL 1GTEA 4OTXH 1YG9A 3LS4H 4KU1A 2J57A 3LV5A 5TE6H 1VFSA 4HAKA 2Z8VC 1TEGA 1XP3A 2XVPA 3FFCE 4LPCA 1AJ7H 1WX0A 4Z7OB 4E42B 3KM1A 4I7WA 2NVDA 1WA0X 3W2MA 1UWYA 3FQRA 4JJOA 4FXKC 2JF7A 1XCWA 5HWNA 4X9BA 1S2AA 1FZOA 1FL3B 3T0WA 2KBGA 3QWQB 2GBTA 1UM5L 2XKNA 3BH8A 2W88A 4OF5A 4G70B 4NCC1 3EB3A 6CGTA 4D9LH 1FNAA 1EEUA 3DMMB 2F6KA 1TSIA 1I1RA 3VILA 1OSEA 3EBGA 1MWAH 3BOLA 3WEOA 1QTSA 1E15A 4OCSH 4OQTA 3QFEA 2X4RA 5I09A 2A9NH 1PG7X 5FYJD 4DK5A 2EZ0C 1MCNA 5XIAA 3SKOB 3I9IA 1N5AA 2NYKA 2XRAL 2XPYA 5KVGL 3PGCB 3PAJA 3FT1A 2Y7DA 1NANI 3NQFA 4LSUL 3DHMA 3PF2A 1X97A 1JP5A 2KLSA 4EAEA 3EGXA 2E7BA 2P45B 4YE4H 3WY4A 1SHSA 1MXGA 3BI9X 1UB6B 3LTYA 5BXTA 5D1XC 4PMUA 2DQIH 3CU1A 4AGMA 5ADPL 3UABA 2VDMB 4HH8A 1GJWA 1YEFH 4ONVA 5ID1A 2R14A 3PHOA 3DGBA 3POHA 2XYBA 2AGJH 4ZSUA 4J3OC 5GGTA 2YDQA 4HKJB 4N5ED 1EGJH 3WD3A 4B3ZA 4IJRA 5KSVB 4UQBA 1GAFH 3HCVB 3NIDF 2NLJA 3WHXB 2E1DA 4QRRE 2Y1ZA 5CJOH 2CBVA 1AQ0A 2VUYA 1JPGA 3QUXA 2FR4A 1W2PA 4N02A 4W70A 3ZYZA 2D7TL 3KLDA 4DP0X 1KBGL 1IEBA 4NT0A 2JJSA 3UR7A 3PWVB 1MEXL 2BVQB 1EYWA 2EKSB 3CS2A 4K7PH 3S83A 4KKAD 4OAWA 2WVVA 1I0DA 4MA1C 1TCRB 2PWGA 3WLWD 1O6SB 5DI8A 3I9GL 2ICCA 3GKAA 4GG8A 4QRUB 1OPOA 1FCCA 3WDHA 1J12A 1R3KA 3EKZA 1KC5H 2FBJH 1V4YA 2DSWA 2HS6A 4HK7A 4JO1H 4WVRA 4DN4L 1R8LA 3F7VA 4GSXA 1H1ZA 3U4BL 1MIML 1HKJA 3GXIA 2CBUA 2QGEA 3U83A 3VI3F 4RNIA 1MZZA 1FVEA 3X14A 4N8VG 5ETUA 3C8HA 3W9EA 2Z31D 3BEWA 2HMCA 3VYLA 1DPMA 1F86A 1ZLUH 4RNRB 2BNRE 3RO6A 3ZDZB 4UOQA 1U8LB 1TQBB 2X4NB 4G2AA 1PE1A 5EMLA 5EL1A 2YPKB 2XG4A 1DIEA 4KZEH 1MFVA 1WDSA 4PR5B 5FEPA 4F9JA 2EAEA 1SYSA 3EX4A 4Z2LA 1CCZA 4LAMA 4LU0A 1S5IH 3F58L 1ITXA 4K39A 3IGAA 4NP7A 3MXVH 1KNWA 4JHAH 4WI4A 3WH7A 1EQPA 3UPMA 1DZBA 4KTDH 4DCQB 3TC6A 2FL5B 1JUFA 5KJ7E 1D3GA 3TYCA 3V7MA 4X7EC 1OFDA 4U1JA 1XRSA 3NCJH 1FCGA 4K3DL 2RFXA 2PDKA 1J05B 4AQ8C 4NRZA 3QT2A 4NM4H 3RA7L 1XMEB 3S88H 5E4IA 4BF9A 3VI4B 3MP3A 1AZBA 4KKCC 4Q56A 2XVKA 3AALA 2FDBP 4N3TA 1WZ1H 3KCOA 3JTTB 1T7VA 3F03K 1QAWA 5AYQA 1IBBA 3W6MA 3S1UA 5FYKD 3IYLW 3BJFA 5DEFB 4M02A 1OLLA 2IXQA 2O9RA 4ZODA 1QJWA 5KYUA 2DBLH 3BRGC 1NOWA 2ABBA 1A6VH 1D7CA 4QAIA 1C8XA 4X7DC 3MA7B 4R53A 1IZJA 3HR5B 3VK5A 1RUQL 2DS4A 5I7GA 4UOJA 4B9IA 2O72A 3HAEH 3FGCB 3LZFL 1A5OC 1DN0A 2Y7MA 4NO3B 1EF2A 4XCCL 3P9MB 4XOEA 4BSWB 1RIVH 3DTDA 3E8UH 1MSPA 5DBTA 3K6FA 4PJHF 1PVHA 5K59E 2BGSA 3I6LD 2DDQL 2OW6A 3QQ4B 3ULUF 4C6PA 2MWCA 4PJAA 2F53B 3PWUA 3KZSA 3WY1A 1H0DB 1WG3A 2YD0A 3QC3A 1O6IA 4GS7B 3H6AA 2PCPB 3SAZA 2O9PA 1MNNA 4IL0A 1NCOA 1PZ0A 2ESVE 1YA5A 4P5SA 5ECUA 2ZG3A 2JJWA 1BF2A 4WEMB 5GISH 4JCLA 4IL2A 2XG9A 3HMXL 2ISSA 1CT5A 1B4JH 2BVDA 4BFKA 1RLWA 3MRIA 1Y0EA 3QI9B 5I2UA 1YMHB 4AEIH 2QCDB 1MO0A 5LN4A 3MR9B 3ZL4H 3WV0A 3ETBF 5D71L 1YQ2A 1PY0A 4Q2ZB 4B3EA 1M57B 1N0LB 5HGAB 1X5FA 5ID0B 1CICB 2Q8ZA 1HT6A 4PWIA 5I8OL 3O8XC 2WLIB 3U0WL 4Y4FA 2WOBA 1JTTA 2ZYFA 2W9DL 1MCJA 3BE7A 3GAYA 4YZFE 3H55A 3NTYA 1WZAA 3QJTB 1YPZA 1E27A 1SUJA 5C07B 2C79A 4GYKA 2LLGA 3EIFA 1U9KA 2BP8B 3ZTNL 3VWJD 1TSHA 1F8IA 2CA4A 1G69A 3UWQA 5DJZA 4FALA 2FMNA 4DI9A 5SWZB 4L1HA 3KXFB 4Q9QH 1DQLL 1HCFX 2F5AH 3GU2A 1INEL 1OYCA 3MGAA 1IBHA 2A6DB 4AWEA 2W60B 3NT0A 3RWHB 1PL9A 4P23A 1CI3M 1BGXL 5EIIB 2W9MA 1DEEA 4U3HA 3VSTA 2I07A 4M1BA 5J5EA 3NA9H 3B7UX 5D70H 4P2RE 1AFVL 3EZ4A 1YEHH 1RPXA 4F57L 3KAAA 3REVB 4U6XB 4RZCB 1Q9KB 2ZZ7A 1ZAGA 1YE6A 5SWSB 5DLLA 5AHIA 3U7AA 1OAYH 3GXPA 2WLHA 4YSAA 4M7KH 3GIZH 3NJKA 1AYRA 2WZAA 2KPNA 3BDKA 1JDDA 1IJNA 4GQGA 3LVTA 1GS6X 4H9ZA 3CQ0A 2IGLA 4G9FE 4N2LA 1S7QA 4WUKH 4KVPA 1W17A 3AIEA 5DQDH 2WKLA 1OSPL 5E2TL 2WMIB 2YBUA 3W7HA 4KRMB 4BDVA 3GVRA 4ICMA 2X7LA 2QADB 4M93B 1UUSA 5C09A 2BRQA 4PI2A 1K9TA 1UKQA 1LEGA 4KK6D 1A53A 3V6ZA 3KPLA 2MOQA 4I5RA 2W3ZA 1OP3K 1DFXA 1X4ZA 3Q8CA 4MMZA 1JL8A 4PHXA 3ULUC 1C7TA 3KJ6H 1KLGB 2F84A 4O9HL 4D71A 1IBGH 3KPTA 3BT2L 1AH1A 1KT2A 3HC0B 3PHQA 4LUTA 3MRBB 4BEUA 1MCOH 4ZOEA 5JW4M 4GT7A 2FZDA 2XTLA 5E1AA 3REWB 4AVKA 1BZ7A 1HHGB 2ZYRA 3C8FA 3P82A 1DDTA 5BVPL 2FX7L 3L2MA 4QRAA 4NQQA 2I27N 4MOZA 3QO0B 1UR8A 2VXQA 3WO8A 3GD1C 1E55A 1DTNA 4G7RB 2YLHA 1HHIA 3F4CA 4ADGA 3RTQD 2QUNA 5TJWK 4RWHA 4NAQA 2Z0BA 1JGMA 4M43L 4NZTL 2OWWA 4YDKH 4XN2A 2CM6A 3O11A 3CV1A 2Y22A 4KTEH 4WVXA 3S5ZA 4QITA 4Z2KA 1H9VA 3BPLB 3KM2A 4ATTA 4AQ1B 4B3VA 5KZDA 1ZAIA 3RVUD 4BCEA 1T1WA 2VJ8A 4MAYC 1J1OL 2VR5A 2B14A 2CKBL 1L9MA 1FTXA 3S8FB 4MSSA 1GYUA 1L9NA 4F93B 2ARJB 2IKIA 3F05A 1AIFB 1EB3A 1XWYA 4BKTC 3AG2B 1WGVA 1QR4A 1MNUH 2WM0A 1O5DT 3GPEA 5IW3A 2GK1B 3JRKA 3USBA 2Y3AA 4QGTA 1U8MB 3O81A 5TIMA 1ZMYA 2INZA 1KIPB 1TU2B 3SPJA 2XX1A 2A1YA 5EU6E 1BZ8A 1NDZA 3O0FA 5I78A 2I14A 3CCHA 3J7HA 1GC1L 3C8KB 3V4UH 1JZFA 3CSBA 4MWAD 1QQDB 1D5MA 4LF2A 4GKLA 5IR1A 1XSIA 3L3JB 1I9RH 2KX9A 1MHCA 1HSBB 3W26A 2VLRD 1BF5A 1F58H 4PVBA 4MD4B 4BKLB 2GB2A 4N9EA 3HJEA 4F2MA 3GSNB 1X7IA 1JCLA 4J12A 2YUVA 1IXQA 2V5RA 3E5BA 1VACB 1FO0L 3PDOA 4K6AA 1U3HC 3GEFA 1JCMP 4Y4KC 2X12A 3AXXA 3AJ7A 4ODWA 4W86A 1KRBC 4RLIA 3AZTA 4X6DF 3P0VH 2Q8AL 4Q8MA 5KWYC 4JKLA 5GJTH 4A2GA 4KXZI 3SUVA 3GLEA 2KQNA 3QDGE 1S7VB 3UTQB 1RHHA 1ZALA 3PG9A 5BUPA 3G08A 3AWOA 4TVDA 3RVVD 4ODXB 4N8CL 5MEQA 3IPFA 1MOEA 4P7NA 4JJ5B 4PREA 4B6ZA 4HNOA 4RAUA 4E41A 2M26A 1HJWA 1NELA 4GUPA 4U1SB 4ZTOL 4KCWA 1GTFA 4PG2A 5D6DC 4Z7OE 2X4PA 5HJYA 2VZUA 1AK5A 1TPH1 3Q2LA 3WYZA 4AMWA 4P9HL 1FVPA 1LLWA 1GGCH 4EXQA 2V5YA 2D0FA 4L4VB 1XPGA 2GVLA 1WZLA 2AEQL 4LE8A 4EUPB 1LG2A 2OMZA 5AOIA 3AHVA 1R0AH 1VFLA 4DPRA 2ZOKB 4TXEA 4MXQC 1IEVA 4IKLA 1RK0B 4JO2H 1RHFA 4A05A 4K5NA 4YCPA 3NQEA 4XC1L 2E09A 1WDAA 2CMRH 4ZZ9A 1P2CB 3V18A 2Q8LA 1OQXA 2X2HA 5I2IB 3L17A 3OM3B 3IGXA 5K33A 5CCKL 4Z0XB 3ZRCC 1UD8A 2BNQD 3LMJH 3GNNA 1E90A 2E7CA 1J01A 4Q4SA 4LHUG 3BSMA 3KBJA 4NQSB 1WCBA 5IFJB 1QAPA 4WU5A 2F1BA 4YSSA 4C6KA 4S2SB 1U5JA 4ZAKB 3A67L 2JIXD 1AJ2A 3SYPA 1W9UA 4QDGA 1TNMA 1UC6A 5K1NA 1SBSL 4WTXA 3RUGB 5J1TC 1PZ5A 2A7RA 3QNXA 3CFKA 5F88A 1RUSA 3SKMB 1EAPA 3CLWA 1GCFA 5C5YA 2XJLA 2FB4H 1GWJA 1JF5A 1N2RA 3QV7A 5D09A 5J8OA 2WZ0A 2V38A 4Q7IA 3I6EA 5CEXA 3BSGA 2WKJA 4MJ5A 3FUIA 3GTIA 5BRZD 5CBEA 1YDVA 4HCRL 3MW7A 1YEWA 1NY1A 3VD4A 1GKOA 4WUUA 2GGIA 1CK0H 4PJ9D 1BQCA 1RSYA 5JPMC 5E7FA 3C5JA 4YFLF 3L5IA 1IKNC 3FQWA 3UZQA 3BH4A 3THQA 1RSFA 1O5XA 2H90A 3SHSA 2RDUA 4YSRA 5EBMA 4J3UA 1S7RB 3MDWA 4L5ZA 5LSMA 5EPDA 1EX0A 1XHHA 1T04B 2C4XA 4ZXBD 2ADJA 4MYWB 1GEQA 1Q8MA 3RGTA 1O0VA 3F64A 1HQTA 1W5QA 4X4YA 3M07A 3JZ7A 1EUNA 5BWFA 3ZDZE 2C19A 3VCLA 1GUVA 2ZAIA 4HBCH 2B2XL 4KWOA 1TVBA 4YBQD 2IG2H 2OMWA 1R3SA 1SDDA 4NWTH 2R7EA 2DZTA 5HNRA 4AXNA 1HYSD 4RIRA 4LRNL 3GU9A 3BWAB 4J5NA 2XWXA 1W9DM 4AMCA 4DAGL 4PVLA 4MXVE 1H6UA 1KB5A 1FV1A 3NZ8B 3UF9A 3VKDA 3WG7B 1MFDH 3WQFA 4QRPA 4I7UA 1IU1A 3UG8A 2K7PA 4IHOB 1IE7C 3QA3A 3GZAA 3H70A 4JN6A 2BIIA 1GTHA 4AT6A 2R1NA 1BQHB 3V4VA 3PHSA 4LRIA 2YK1H 5TPWH 1P5VB 3CH8A 1GGUA 4UT7L 3OR6B 4DIXA 3VI4E 2YCEA 4Z42C 3UWEA 3IK2A 3H9SD 3P02A 2W65A 1CMOA 4NX5A 4NZRH 3S8WA 4WJ5A 4J4PD 1J2BA 1O75A 3BAXA 1FLRL 3IDXL 3QFJD 3IKCA 5GIRA 3QCVL 5HDBB 4ISVB 3T1FA 4QCIB 1R9ZA 3IIXA 5DYOB 3LXCA 4XHJC 1TQCC 1YN6B 4WI0B 4K3ZA 1FNEA 2D3NA 1PX8A 3HB3B 1FH7A 4OLYH 3KYNA 4EQ2A 4XBKA 2QCEA 4IQEA 3ENEA 4F20A 3SCNA 4GEIA 4Y16D 5I74B 4ZBCA 3IN2A 4XPTH 4F0LA 5EC2A 2JE8A 3S2JA 4JN2B 1P7QA 2EG8A 2PDCA 3FA3A 3UMNA 3P6LA 3QXAB 3WXVL 4HKZB 5IF0B 3UP1A 1SO3A 2Y8KA 1CFSA 2ICWI 1TZ7A 4DEWA 4WEUD 1FFNB 4GBUA 1H3TA 4S1SH 3EYFA 2F53E 2A6IA 2WINA 4I77H 4N2OA 1U8KA 3WJLC 4X61A 5F3HB 4R3UA 1L3WA 2YKLL 1DZ0A 5D2NB 1GKEA 3FO0L 4GUJA 2D2CC 3ARVA 4NENA 3K5RA 3TYUA 3OF6D 3IDJA 1DSFL 5F97E 4FO4A 1H1NA 1FRGL 3FUEA 3WK1A 3PNWB 4NWUL 1QR7A 4QAWA 3BLDA 1IX2A 4RNFA 4HAFA 5DJXB 3SDXF 1SDYA 1HW6A 1J0ZA 4IG2A 1UOKA 1BD2A 4O53A 4N86A 3ITXA 1KFKA 2YGOA 4A6YA 2NY6B 2PW2A 1DP0A 4LUSA 3KCJA 3M8OH 1TFPA 4OCMC 1T4KA 4AYEC 4FSAA 2E56A 1C16A 1VAHA 3PY2A 1E28A 3I85A 3ARDC 1A1NB 4LSVL 4BXSV 2GCYA 3T0VA 2ZJSL 2X42A 4OZHF 5A6LA 1ZBKA 3CASA 3M0LA 4ZQNA 1YECH 4HIHA 3B6SA 3T4CA 4FKKA 5C07E 2ICEB 2ZKXA 1QFWM 5IEHA 4AZ8B 5T33H 2Y61A 1C5DB 1PZCA 3QJHB 5FEBA 3FJLA 5SWZE 5TDNA 4BGDA 3KXFE 5DS8B 2ZNXA 4APQB 1AR1C 1EO8L 2PRHA 3WD0A 4DJDD 3RWDA 1XGTA 3M0JA 2AK1L 4MMXC 1IR2A 2AXGA 3B9KD 2OPCA 2A7PA 2G50A 3ANVA 4OGAD 1EKOA 4NF7A 1PDZA 1IHIA 1EJRC 4U6HB 1OK6A 1CE6A 2ZWNA 5EU3A 5C8JA 3SCQA 1BEYL 1NC4A 1FIGH 1UGNA 1G7HA 4UUJA 2G3MA 5ACMA 5SWSE 4I6VA 1EUUA 5CBBA 1MG2C 2NQ3A 3EHBD 4M80A 2RDWA 1QUNB 2IGFH 5DJ0B 4RXFA 4X80L 4PRHA 5D7JA 3H9HA 2BLFA 4G7YL 1VA9A 5DHEA 5AB1A 2E68A 1D7FA 2VM4A 5JTWA 1YNYA 3MUAA 3JV0A 2VCBA 4XAFA 1X1ZA 2WYTA 4ENLA 2CZVA 3QKEA 3HIZA 2D7PA 2QSVA 2VWTA 2VN6A 4IWWA 1LF1A 3VNKA 3GU1A 5REQB 2Q76B 3DARA 1QR1B 4Y19D 3EEZA 1AJZA 3HPFA 1T66C 2R69A 3SY0A 1QTWA 3HJZA 5HWJA 4HCIA 3RF9A 1ME8A 1B3VA 1YXYA 4AYFA 3ZUNC 4NQCA 3QEGL 3GNPA 4X6CA 1B6DA 2GK0A 4LEQA 1VIWA 5IIEA 2EACA 3CVBA 3GWJA 3BPNC 5ALCH 3DYPA 3IVKB 5CO1A 1U8PA 3KYMB 5I1CH 3GINA 2NY5H 1F05A 1PIIA 5DJCB 4MX7B 3RWJB 5DN1A 2V5TA 3W4RA 4D9PA 2D8KA 1W0WA 3I7RA 4XNQB 2I7SA 4JGUA 4KGLA 6TAAA 1CLXA 4H1LB 4AG4H 4NKMB 5IV2B 3EJCA 3BKCH 1CFMA 5FAJA 4TVPH 2XDFA 2VH5H 4N2BA 3KLLA 5E99L 1JQXA 4QOKA 1WDQA 2KLRA 3EX2A 5IROD 1EHXA 3D0LA 2A6KA 3RWGA 1ZDSA 4CN1A 3V0UA 4KBXA 4FXKB 5HGBA 4POYA 3JVFC 4AW4A 3HGSA 2XXFA 4M62L 3EXLA 1WKEA 5GS1C 3WKPA 2Y36L 3D39D 1MIEL 7TAAA 3B7SA 5AN7A 3G6AB 2WP3O 2J2ZA 4JAMA 1H3PH 2YXMA 2R0ZL 2V5KA 4JFPA 2ATKA 1UACH 3QFGA 3ZQXA 5E6RB 2YFNA 5GS0C 4ZQOA 1UWEH 1PX3A 4TMBA 2YR3A 1CDCA 4F92B 5I0XA 4C4UA 2BWIA 3NM1A 3GK8H 1OAQH 3PFMA 1KOAA 4NAEA 4LSPL 2X2GA 5K9DA 5GGSB 3T2NL 1QO5A 1ACCA 1DQQA 4DKFL 3OZPA 1AD9A 4KK5D 5KVDE 1UYQA 2VMDA 4GG9A 4UTJA 5G1YA 4CD6A 5D5MB 3NK3A 2G5UA 4NHUA 1L7IL 1FYTD 1A3LH 3GRWA 4JZOA 4B5NA 2J21A 1KN2L 3SY6A 2YJQA 3QHOA 4PCNA 3DVNA 3G6JF 2OCZA 3EYVA 3VXMB 3NXLA 1H2JA 1TO5A 2J9XA 3P3TA 5IB5B 2ICWA 3L54A 3LX9A 4XN1A 4DVBA 5KYNA 5FW7A 1MRQA 2P8PB 5EEXA 1Z7JA 3MO1A 4MTMA 4UMGA 1AG6A 3QR0A 4XG1A 1OINA 1NWSA 1HUVA 1UWUA 3BGGA 4DGYH 5LLIC 5EZIL 4FK9A 2YARA 4KMQA 2AQNA 4AVNA 1TJ2A 4GRLD 3DFSA 3GR7A 1TPVA 4TUKL 3GIVA 4GIPD 5E2UL 2VDNL 4XMXA 4UWMA 4U6VL 3L1OH 1QWKA 1U30A 4MA1B 2G4GA 2EILB 3U9UB 3K0WA 3VIMA 1U2HA 4GQ0A 4WSKA 1FWCC 3MKGA 4YLCA 3H4WA 3G5YB 3X13A 4IMAA 4M56A 1QNPA 3UFYA 3R8GA 4JK0D 2O92A 5CSYA 3IU4L 2AKRA 1R3QA 1YZZA 3OG3A 4C83B 3EDJA 2HDJA 3GHEH 3BARA 4I7VA 5CH9A 5AZ0A 5E5LA 2W27A 3C08H 4U28A 2WO4A 1NF0A 1P4LB 4Y9BA 3DOSA 1W3IA 4OZIB 3HHSB 2IH8A 5I6MA 1OLZA 2ZYHA 3CLFL 1QYGH 1UZ4A 3WTSA 5B38B 4OQTH 3FRPA 3LAFA 3IGLA 2OK0L 2HK0A 5AVUB 2O26U 4M5ZH 1MJUH 5K9QI 4OUIA 1TTIA 3PL6A 1BG1A 4RPPA 2NXZD 4HD9A 4EAYA 2SEBB 5FO7B 5AZ1A 3QUMB 3W7NA 3LHUA 3CVDA 4I8YA 1TV3A 5G2NA 2EDOA