2ZWYA

Alpha-l-fucosidase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
publication title Structural Basis of alpha-Fucosidase Inhibition by Iminocyclitols with Ki Ranging from Micro- to Picomolar
rcsb
source organism Thermotoga maritima
total genus 155
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zwyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zwyA01
1XCWA 1B30A 3CZSA 3VSTA 3ZO9A 2WLYA 3I3DA 4XB3A 4D71A 1B90A 1QW8A 2D0FA 2XVLA 1E6ZA 3OLIA 3O2LA 3HMCA 3CBWA 3QR3A 1WDRA 1TZ7A 1I1WA 3RM8A 4D6IA 2Y5EA 4GIAA 4HU0A 5C8BB 1HKMA 3OLGA 3PN8A 4WJXA 1TQUA 4W85A 1E6NA 5TD4A 4AD3A 4YHGA 4PTMA 4GI6A 1D3CA 1CZ1A 1EA9C 3RCNA 4P8UA 1MWOA 2XFYA 5DFAA 1GVYA 1ISZA 5DF0A 4UOQA 1BGAA 3T0BA 3JUGA 2W62A 1EQCA 3SUVA 3VX0A 1BYDA 3WBAA 1V3LA 1R33A 5IFPA 4QDMA 5I0DA 4WKAA 4TX6A 2QF8A 4CN4A 4NF7A 3A22A 1EGZA 4CU8A 3NSMA 2F1AA 1XD0A 1MW1A 1V02E 3VVGA 1VEOA 4M24A 4MJ4A 1CPUA 2VRKA 1GQJA 5CZKA 5FL0A 3EJUA 4YPJA 2UY5A 3W81A 3FAWA 3WDJA 1K9FA 1XH2A 3BVWA 3OZPA 4UOZA 1W9DM 3L4YA 2JEPA 1MW3A 3MSGA 3UR8A 3GH7A 1WKYA 4UQ9A 3AOFA 1J10A 1FH8A 4FNQA 2QHAA 3H54A 2VX4A 5HPOA 1UWSA 5HDRA 1B1YA 3QHMA 1U2YA 2ZUUA 1MFVA 1UR0A 1CGTA 3WF3A 1B0IA 3ZR5A 3LRKA 1WAWA 1V0LA 1DP0A 2VUYA 2WC3A 4B16A 4EK7A 2PBGA 2DQXA 1V03A 1HIZA 3L4WA 1XSIA 2BY1A 3WUGA 2GJPA 1CGWA 3VNZA 1R86A 4GZJA 5D9OA 3BUQA 1E56A 3ALFA 2OLHA 4XX6A 3H53A 2GVYA 3RO8A 1M53A 1UD6A 3QHOA 3L4XA 2ESCA 3VDBA 3SCPA 3WFLA 2W92A 4JHOA 1E0WA 2VQUA 5LYRA 1E4IA 2NW0A 4H8UA 4D6JA 5BWFA 3EDJA 4H8HA 3CUFA 4JL2A 2E8YA 1HWWA 3CLWA 1LJYA 1WPCA 1UR8A 2YBUA 4DUWA 1GOIA 5CG0A 1QNOA 2WVVA 3VM5A 1VENA 4E8CA 2E9MA 1W2PA 3WQ6A 2J75A 3BUPA 4MB4A 3MS8A 4W84A 5A3HA 5I2UA 1CECA 3DX2A 1FHDA 3WNLA 3I3BA 4GQRA 1RPKA 1GOWA 3VD7A 4ZEPA 3IK2A 5DEZA 4BQ2A 5F7UA 3W38A 1J0KA 3A6OA 3WD1A 2PWGA 2HISA 4PMQA 5ABHA 3DX4A 3CC1A 3WD0A 1UWTA 3ZOAA 1XH0A 1UG6A 2JF6A 3M07A 3SCTA 4C7GA 1NOFA 4JKKA 3WY3A 4R5EA 1Q6DA 3UG5A 1HKJA 4MPKA 1HNYA 3W6MA 2UWFA 2J7GA 4PMNA 2J25A 1VFUA 5HNNA 1UZ1A 7TAAA 4BCEA 2VRJA 1HVQA 1R46A 1E43A 1M04A 2D2OA 3DDFA 1H09A 3L2LA 2XYLA 4AWEA 3OGSA 1UWQA 2WYSA 3A21A 3BC9A 5EBAA 5DMYA 1E0XA 3MU7A 3L4TA 4FLSA 3F5KA 4P7OA 4M80A 2X0YA 4HU8A 2DIEA 4PCTA 5E0CA 1OWQA 4W86A 6A3HA 2BXZA 4TTUA 1SR0A 5GNYA 1HJXA 1KFWA 5A6LA 3L4UA 3ARSA 4KGLA 4Z2HA 1NWSA 4AD1A 3EYPA 4AZCA 3VGBA 1BYBA 4CU6A 3D52A 2UY3A 4Z2GA 3EJQA 2XN2A 4PMVA 1C90A 1ZJAA 3WMSA 2O92A 3WF1A 2EXOA 1C7TA 1ODZA 2CEQA 1X1NA 1UOKA 3T2QA 2OSWA 4RE2A 5JIPA 4LPCA 2ZX7A 4Q7NA 1XC6A 5GPRA 4WSKA 4AMWA 4M81A 1B2YA 2JIEA 1OB0A 2ZWYA 4GI9A 3MUAA 1NWTA 2GFTA 2WMJA 2D24A 3VD3A 1H5VA 1C91A 1RP8A 1TR1A 2IUZA 4NXSA 4ZFMA 4V28A 3THDA 4M29A 3WY1A 3VIOA 3VSVA 2AAAA 3VGDA 3EJRA 3BSGA 5FCZA 1E71M 2WAGA 1HP5A 2QPUA 3MKKA 3WKZA 2V38A 2VX6A 2EPKX 1QI0A 4W88A 1JD9A 5DT5A 1BSIA 4WIWA 3AIVA 1KB3A 2JIWA 2PWHA 3PTQA 1UH4A 3LRLA 4GQQA 3ARZA 1XHGA 4N0RA 2XIBA 1R7OA 4W5UA 5IHSA 3ZM8A 2BNJA 1UA7A 1ZS2A 4W7VA 3ZSTA 1W9PA 4M1RA 1QI2A 4FNTA 2WHJA 3OGVA 1CIUA 2B31A 3VIKA 2DIJA 4WLCA 2J7HA 2VT0A 2VMFA 3VD4A 1JZ7A 1KBKA 1JF6A 3BSHA 1B3XA 1C3FA 1Q6GA 3ZT5A 4URIA 1GUVA 4UR9A 4CD6A 4UZUA 1C92A 2J79A 4CUCA 5CPQA 2GDVA 4J3TA 1H1NA 4JFUA 1R8LA 5GQBA 3GM8A 3VIMA 3HG3A 3VKKA 1KQYA 1GNXA 1RP9A 2WZEA 1VFOA 4ATWA 2VZUA 3EMCA 3K4AA 1OT2A 3WY4A 4YHEA 2AMGA 2XN0A 3BAWA 1V3KA 3WY2A 1XGZA 2WWDA 4DWSC 2VX5A 1LWHA 5FIPA 4BQ3A 2YL5A 4CD8A 2F1BA 2XN1A 5A2CA 2GK1A 3GZAA 3KL3A 1H0IA 1Y7VA 3WD4A 2XVPA 1V6VA 1JGIA 4MTVA 5D9PA 1HT6A 1V3JA 2VOTA 3CUJA 2X2IA 1BF2A 4P7NA 1QBAA 5A6AA 2VQTA 4EKJA 3CV5A 3AYRA 4PMYA 1CDGA 3BAYA 1OSEA 5HPCA 1PZ3A 3VGGA 4FK9A 1VEPA 4HA1A 4UQDA 5IDIA 4DM1A 1JD7A 1B31A 2OWWA 1B3WA 2J7BA 3FHQA 4PCSA 1C8XA 3CIVA 2YL6A 2XFRA 1E4LA 2DT3A 1BPLB 1MW2A 2IXVA 3BVXA 4UOJA 3U7VA 4U5KA 2V3FA 5CPTA 3UG3A 2WZHA 5CJ5A 1ESWA 3SUSA 4ATDA 3PZQA 3DHPA 2DH2A 4LXFA 3WF0A 1T0OA 3IANA 3ZSSA 1HP4A 2YOCA 1AQHA 1QOXA 4MADA 3BCFA 5JBEA 5BXPA 2FH6A 4CD7A 4ATLA 4GKLA 1E6SM 4JL1A 1OGSA 3D4ZA 3WENA 1GCYA 1CGXA 4OOZA 2G3MA 1W9UA 2V3DA 5AYIA 4J27A 3WNKA 2F7PA 2PWFA 2F18A 1VAHA 2F2HA 2O9PA 4M8UA 2ZUVA 3SCWA 1PIFA 5I23A 3N1AA 1DWHM 1UKTA 1QHPA 2W66A 4BZYA 2OYKA 4FNUA 2E0PA 3WH6A 3BGAA 4ACZB 3FY1A 1NH6A 3EBVA 5E9AA 4D1JA 2WC4A 2FDMA 2JALA 4P7LA 1UR4A 4JFWA 4LX4A 4F8XA 3BMVA 2YBTA 2WPGA 3SURA 2XJ7A 1G5AA 3T09A 2W61A 2WNWA 4FNRA 5E09A 3EMZA 3OLEA 3MMUA 3OZOA 1AVAA 2AOSA 4GO9A 3VIFA 3VIIA 1HXJA 2PWEA 3D51A 4EAMA 5HOSA 2PI6A 3CZEA 2VX7A 3PZGA 3LRMA 5BROA 3RM4A 2F8QA 5A8NA 4ZXOA 1BFNA 1W32A 3OG2A 3IAPA 1ZB5A 2DT0A 1ZBWA 4AIOA 3B9AA 1XRVA 3N13A 1TA3B 3APGA 1E3XA 5A8MA 1SMDA 1QNQA 4DWSB 1FHLA 1JNEA 3BVVA 4PMZA 1OD8A 4WKFA 1WP6A 3FW6A 2EPMX 2GJXA 1UYQA 1HJWA 2G8ZA 3QHNA 1PAMA 5I6SA 1PIGA 5D9NA 4NXKA 2G4FA 2EQDA 1G01A 2VTFA 3VNYA 2ZX5A 4CU7A 1D7FA 1XH1A 4U3CA 2DSVA 3T0AA 1SMAA 3AI0A 3A24A 3BAXA 4Z2JA 1I75A 5BXRA 4J3XA 4HP5A 2WXDM 1CEOA 2XTKA 2E9BA 1E1EA 5I24A 3WH8A 2E9LA 4AD4A 4PMOA 4W8LA 4D6CA 3PZ9A 2WZIA 2F7QA 1W9VA 2OYMA 2V5DA 2EADA 1UD8A 3CMJA 4J3WA 3UG4A 1UWIA 5M5DA 1JDCA 4W89A 3SCSA 3W0KA 1O7AA 4ACYA 1M03A 1BVNP 1VRXA 4P7QA 4W8AA 4CVUA 4AW7A 5ABFB 2Y24A 3MUY1 2CITA 3EJTA 1PX3A 1UWRA 1DWIM 2VCCA 5AY7A 3W26A 1V6XA 4H8VA 1V3MA 4UQCA 3QOMA 4P8XA 1EIBA 1U30A 1OD0A 3BVTA 3WEZA 4MB3A 2PF0A 4NI3A 1HX0A 1TQSA 2XWEA 1V0KA 4RL3A 3WBEA 2XUCA 8A3HA 3AFBA 3WNPA 3ARQA 5LA0A 1KWGA 1E6XM 5FKYA 1Z32X 2OYLA 1G94A 1JF5A 5FL1A 5JBFA 1ITCA 4XZWA 2DSUA 7A3HA 1XSKA 3CHCA 1G9HA 3AHZA 4PMUA 4D72A 4LYPA 2EPLX 1YQ2A 1WE5A 1VBRA 4JCLA 2J7DA 4PN2A 2V5CA 3VDAA 4QCEA 3CHEA 4U2ZA 2F7RA 4HOWA 3BXWA 4JHZA 3EDKA 3WEOA 3WUEA 1FP9A 1JZ5A 3U7BA 3VO0A 1H41A 1KXHA 1E5JA 4BQ4A 2WCSA 2UY2A 2CKRA 4AXNA 1HN1A 5CLTA 3ARTA 4QFUA 2ZE0A 4XUYA 5EFDA 3AMCA 2BVDA 3ARUA 4UFHA 3VILA 1TMQA 4XZBA 1BG9A 1ZJBA 4N42A 1WZAA 5A95A 1UR9A 1W2VA 5A8QA 5GNXA 4DM2A 2WWCA 3W24A 3EJPA 4CCDA 2J77A 1E72M 3AJ7A 4HTYA 4CD4A 4CN6A 1R7AA 2CYGA 3LPOA 5A8OA 4AEEA 4OIFA 3TONA 1EDGA 4V27A 5CPSA 2J74A 4OGZA 3AZTA 2WHKA 1HF6A 1OM0A 3EDEA 4UNIA 4DUVA 2VC9A 3EDFA 3WMCA 1LG1A 4HMDA 3N11A 3ZMRA 2WMHA 3FN9A 2Q8XA 1UA3A 2TAAA 3A47A 3SCUA 1JI2A 5M03A 3ARXA 3RM9A 4RE3A 3NUKA 3POCA 4NZCA 4H41A 1BTCA 3VGFA 4OBSA 2A3CA 1E1FA 2WW5A 3TV8A 4MNMA 1C8YA 3GXTA 3WF2A 2XGBA 3W27A 2YA2A 1Q6FA 1X6LA 1EOKA 1J9YA 3WEMA 1Q4NX 1TCMA 1J0IA 1JXJA 1FH9A 4F66A 3W25A 3VMOA 1TA3A 5M17A 1H2JA 1EOMA 4BF7A 1EQPA 1DEDA 1CBGA 3AHVA 4Z2KA 5E1QA 4C7DA 1CXKA 3RDKA 1UZ4A 4ZXLA 2O9OA 3FAXA 4QCFA 1W1TA 2VJXA 1UQZA 2PC8A 4W8BA 2E8ZA 1OINA 5FOOA 1KXTA 1K9DA 1WB0A 3AYSA 4AD2A 1TQVA 2XVNA 5I77A 3AIWA 2E4TA 2ZXAA 3S2CA 1KBBA 1SYTA 1B3VA 3WSUA 3CHFA 2A3BA 2JF7A 1O7DC 4U3AA 3WQ4A 1BYAA 4H7VA 4JZ5A 4D6DA 1H4PA 3ZIZA 2YFNA 5CSYA 4JFTA 3II1A 1TG7A 1QHZA 3CPUA 1GHSA 4MB5A 1HKIA 4B15A 5FD0A 2G41A 4JKMA 1CGVA 1DWFM 3GXIA 4UQEA 2XPKA 4GPNA 5A8PA 1W1YA 1N82A 1ISVA 3CUGA 5ABFA 3EMQA 3DYPA 1B9ZA 2A3HA 2XSBA 2YL9A 4MB1A 3AMLA 4J7RA 4JCMA 4JFSA 2D1ZA 3HG2A 2C8NA 2A3AA 1JIBA 1OGBA 1E5NA 3WUBA 3D5HA 3WUFA 2WHMA 1W3LA 3WELA 1EXPA 2F7OA 3ZJKA 2ZUSA 4U5IA 1GVIA 3GDBA 4Z2IA 1CXHA 3ALGA 4AMCA 4IPNB 4PBGA 3BCDA 1E4MM 2CHNA 3VU2A 1EHNA 1EH9A 5AC5A 3IGUA 3MANA 2NSXA 4P7RA 2XFFA 1PX8A 1ECEA 4X0VA 3DHUA 1JZ4A 5ECUA 2XG9A 5CXPA 1VB9A 5CGMA 5KZ6A 1GJWA 2CIPA 3N17A 3CHDA 4PYSA 2YDRA 2DPEA 1HVXA 1E6PA 3DYMA 3AMGA 5C70A 4F79A 1UQYA 3TTYA 1PX4A 2XM2A 5IFTA 4BS0A 4WF7A 1JZ6A 4HZ7A 3D3AA 4Q22A 3D4YA 2VZVA 1V08A 2ALWA 2GUYA 1V6YA 3SCOA 2WANA 2CESA 3VDHA 1MQQA 2WC7A 2YA0A 3PZOA 1IT0A 1J0HA 2VCAA 4TXEA 3ZQ9A 4PMDA 3N04A 3RIKA 3MO4A 3LXBA 4EANA 3GXPA 1UWUA 4W87A 2W4XA 1MW0A 4NRRA 2BXYA 2X2JA 4D6FA 2ZX6A 2VO5A 1IZJA 1DWAM 3ARYA 3CO4A 2X8RA 3EDDA 1C8QA 1RD6A 3GXDA 4MDOA 2ZIDA 4AZBA 2WVSA 3LPPA 3U5YA 1NWUA 2Y2WA 1DWGM 2W63A 4R27A 3WH5A 3N15A 2IGTA 3ARVA 3AIEA 3DX3A 3CUHA 3A3HA 3LXAA 3AS3A 4LQ1A 4U31A 3UEQA 2GJRA 4PEEA 3AROA 1UR1A 1CWYA 1D2KA 1R75A 1GQLA 3T2PA 4OZOA 3MUIA 3UCQA 4EE9A 2VZTA 1E3ZA 2YKKA 1E4NA 4KRUA 3A4WA 3CGTA 1HJQA 3ARPA 4OBRA 5I78A 4HOXA 1GZJA 3POHA 4UQAA 1IV8A 1R85A 2V3GA 3T2OA 1VBUA 2OSYA 1CLXA 4OOUA 5JUVA 2FGZA 3ZJ8A 1OIMA 4UCFA 5DO8A 3A5VA 5LA1A 3ZT7A 1XCXA 1WZKA 1V02A 1OGGA 4D6HA 1F4AA 3UERA 4D6EA 3WD3A 4DO6A 2PWDA 4DUXA 4UFJA 1I1XA 2QLYA 2JEQA 1WZMA 4KMQA 2WKLA 4GINA 2UY4A 2D3LA 5EMYA 3HG4A 4TX8A 3TP4A 4KGJA 1PZ2A 4B9YA 3S6TA 2RGMA 1J18A 3SCRA 1JNDA 4TVCA 4JAWA 1MQRA 2ZUMA 4X9YA 1KWKA 2F61A 1UASA 4HMEA 6CGTA 3GNOA 2EO7A 1C7SA 3WIJA 3MV11 2YJQA 5JIWA 1MXDA 1AMYA 1FFQA 3DYOA 2D20A 1KTCA 4AY1A 1W9XA 2DH3A 2OW6A 1J0YA 3W6LA 3VD9A 1GQIA 1A47A 2D73A 2EAEA 1NM9A 2CERA 3LPGA 1BVZA 3VMNA 1KGUA 2FE0A 2IXUA 4AISA 4TTGA 2ZUNA 2Z1SA 5D8ZA 3SUTA 4UFLA 1IZKA 3ZR6A 3B9EA 2J7CA 3CZLA 1DWJM 3GH4A 5BXSA 3W53A 2EJ1A 3DX0A 3U5UA 3L4VA 1DHKA 2X2HA 3WDPP 3FHAA 5D9MA 1GORA 2BV9A 1X6NA 3TA9A 2ZXBA 1TUXA 4CN1A 3PZNA 1J0JA 1JAKA 1M7XA 1WZLA 2ZICA 3AMDA 3MMDA 2BS9A 3VUPA 3T0DA 1S46A 2XIIA 4E4PA 1GOMA 2DSWA 3OLDA 1TVNA 2YIHA 3N12A 2WVVB 3ARWA 3VIGA 1EO5A 1TVPA 4PSRA 1NOWA 2EABA 1YHTA 5E6YA 3NDZA 3WL0A 4PTXA 2FGLA 2DT1A 1JL8A 1L0PA 4PRWA 5AYBA 3CTTA 1V0MA 2RGLA 2BY2A 4V2XA 1AQ0A 3WQWA 4HA4A 3PZIA 1WO2A 4UFMA 2DT2A 2W5FA 2WMFA 1ODUA 3KLKA 2X1IA 1PEZA 2X05A 4AD5A 3BLBA 5I3DA 3DECA 4QAWA 4YN5A 2G3JA 2V3EA 1V6WA 4U2YA 1KGWA 2FHBA 3BUIA 4DWSD 3W4RA 1UKPA 3AIQA 2DSKA 1CGUA 4X0NA 3IJ8A 3S5YA 1MYRA 2EBNA 3QOKA 4P8VA 2XSAA 1K9EA 4MNLA 4LGXA 3NCOA 3OGRA 2VL4A 3SCVA 1PS3A 1HL8A 4KRTA 4A4AA 4AMXA 1NARA 3BLKA 2WMIB 1ZBKA 3AICA 4AZCB 3WD2A 1QPKA 4OJYA 4AZGA 4HZ8A 3VTRA 4D6GA 2PB1A 2X0HA 3SIMA 3CZKA 4Y7EA 3VDCA 2OW7A 2WB5A 3AS2A 1UD4A 5CSUA 3DX1A 3VX1A 2CNCA 2WHLA 1JYVA 4U33A 3VGHA 1GQKA 4C7FA 1HTYA 3WN6A 1FH7A 1E70M 2WKGA 3VIHA 4KWUA 4HA3A 3K4DA 3AXHA 4JKLA 3M7SA 4PUDA 1G0CA 4NSBA 3TTOA 1W1PA 1SZNA 4QLLA 4XV0A 1GPFA 4AYGA 1CXEA 4W93A 1JDAA 2EPNA 4JFVA 4J3VA 2E40A 1W9BM 1TQTA 1KR1A 2JE8A 3A23A 1JZ8A 3FXYA 1E55A 2VR4A 3WL1A 2GDUA 3O9NA 5A2AA 1OCQA 3MV01 1P6WA 1UKSA 1J01A 3OB8A 3CH9A 3WDQA 1W1VA 5ABEA 3CZJA 3D50A 2BY3A 4AZ5A 2YFOA 1LG2A 1OIFA 3HZ3A 2OWXA 5C71A 1CXLA 3AZRA 1BG4A 5A6SA 1QI3A 3W29A 3T08A 3WF4A 1U33A 3O6AA 1BHGA 3BAKA 3PBGA 2BHUA 3WNMA 4ACZA 2D0GA 1CGYA 3AIUA 4S3JA 1WDSA 4AZIA 4ZE5A 4AZ7A 3MUZ1 3LXCA 3H55A 1QNRA 5CQ1A 3AIBA 1GOKA 2BHYA 3NYDA 4P8WA 2BVTA 4NZFA 4RE4A 2VRQA 3LX9A 2CBIA 3A4XA 1UH2A 4WKHA 3NIYA 3SUWA 2WK2A 4DO5A 2WSKA 3WMBA 3UETA 3AZSA 4MNKA 5A6JA 4PUEA 2EACA 2YLLA 2ZX9A 4D1IA 3ZT6A 1UKOA 4NZJA 2OWCA 3K1DA 1E9LA 3KE0A 3OIHA 1H11A 2EEXA 5IHRA 3AQUA 2VCBA 2J62A 3GBEA 4LYQA 4CCCA 1PPIA 2D22A 2WMGA 1ISWA 2GK1B 8CGTA 4AYSA 3BUDA 2VVSA 2W91A 3VD5A 3PTMA 1JI1A 1ISXA 2O9RA 4DWSA 2A3EA 2WCGA 5JBDA 3IJ7A 1MVYA 3UR7A 3GBDA 2ZUTA 4IISA 4AD0A 1CXFA 1E73M 4GO8A 4HPGA 3PHAA 3WH7A 3TTQA 4AZ6A 1JYXA 2G3NA 5ABGA 3WDRA 1JAEA 3RJYA 2J8FA 3KL0A 4MNJA 2DGAA 3WNOA 5HXMA 3VPLA 1V0NA 2ZXQA 5LA2A 4PMRA 2WMKA 5EB8A 1KR0A 1FFRA 1QI5A 2CBUA 5A69A 2NT0A 2CCRA 1QWUA 2Z1KA 1MQPA 4A3YA 3HJEA 1GJUA 3TTSA 3SUUA 1E6RA 3GTNA 1NWRA 1BLIA 4LYRA 2BHZA 4KH2A 2XWDA 1TFVA 3GH5A 2WMIA 1UD3A 3THCA 4CVWA 3PZTA 2QV4A 2YA1A 5D8WA 4TVDA 4GI8A 1CTNA 1O6IA 2J7FA 3B8SA 2G3IA 4PTWA 2FYVA 1JYWA 1XD1A 1J12A 2X09A 4UQBA 2WLZA 1QHOA 1K6AA 5GNZA 4PSPA 3J7HA 2ZXDA 1R34A 1LQ0A 3VM7A 4HPHA 5A6BD 1KXVA 4MJ2A 1M01A 1ITXA 4AEFA 5BRQA 3HU7A 2FHFA 2D3NA 4NX0A 2YDQA 4QLKA 1TE1A 4OUEA 3HN3A 4AIEA 1E0VA 3MMWA 3PZVA 1CLVA 3G6LA 1WDPA 1EDTA 2VR5A 1Q6CA 1UR2A 2PBOA 4L4OA 1NOUA 5I79A 2CETA 4TUFA 4M82A 1KXQA 3ARRA 1JXKA 2WSPA 4Z2LA 2QMJA 1BGGA 1QWNA 3W82A 1LL7A 3GXNA 3NDYA 1W3JA 5BRPA 1UUQA 3FNDA 3NSXA 1H0GA 4TOQA 1GOOA 3G6MA 3RILA 3CZGA 3NSNA 1NP2A 2WBKA 4HMCA 4CCEA 1LL6A 1QVBA 4W7WA 1ZBVA 1VF8A 4GZEA 4FLQA 5CGTA 1WCGA 3BUBA 4UZSA 3QGVA 1EO7A 2XVGA 4E2OA 3SCQA 1OBAA 3KZSA 2GJXB 3MI6A 1DTUA 2HVMA 2E3ZA 3S5ZA 1BAGA 3BLPX 2DEPA 2J47A 3AISA 4GXPA 4B3KA 1V3HA 6TAAA 1HKKA 1LL4A 4B9ZA 1Q6EA 4J28A 4J3SA 4AZHA 2WBGA 1FA2A 3GNRA 4FMVA 2O9TA 1C93A 4H04A 3WFZA 2BFGA 2VZOA 3KEHA 4CGTA 5BYWA 3GXMA 4S3KA 1PJ9A 3AHYA 1MFUA 1JG9A 3AXIA 1LLOA 1TQWA 1US2A 4WK9A 5A2BA 3WDIA 5D4YA 2OSXA 3VOCA 1CXIA 3AXXA 4B3LA 3N18A 3GXFA 1V6UA 5A6MA 2VI0A 4HZ6A 4AC1X 4CD5A 2CPUA 1VJSA 3I3EA 1EDQA 5BCAA 3SEPA 4K68A 3BH4A 2J4GA 4NRSA 4TVUA 3WQVA 1QBBA 3WNNA 1US3A 2DDXA 1VFFA 1HL9A 4JIEA 1NQ6A 1GW1A 2WVUA 4WSJA 5EFFA 5KEZA 3SCNA 3TOPA 1SFSA 3M6DA 3RMEA 2ZX8A 1QNPA 4UFIA 5DT7A 5I5RA 4QLJA 3BAIA 3VINA 1CYGA 1W3KA 3E1F1 2D23A 4BQ5A 4MAVA 4ML4A 1WNOA 3LMYA 4H2CA 2X2YA 4HOZA 3ZJ7A 2YLAA 3RJXA 5A1AA 2FH8A 4QP0A 4F9JA 1UD2A 2W67A 4DO4A 3L2MA 1MXGA 1B3ZA 1LF1A 3DDGA 4PMXA 5AC4A 1JZ3A 1FP8A 1VIWA 3PZMA 4W7UA 3A4AA 5A6KA 2Y8VA 3CMGA 1GOQA 3MSDA 4ZE4A 4IUGA 4J3UA 3B9DA 4FNPA 3WH9A 3WDHA 3DC0A 4IPLA 3KWXA 3M46A 2EPOA 1E40A 4UFKA 2WM0A 2Y8KA 4M56A 2VNCA 1XYZA 2XGIA 3N9KA 3VIJA 3AS0A 3VMPA 4F9DA 3K8KA 1F4HA 3K46A 1B3YA 1H49A 3KLLA 5A6BA 5CLWA 2J7EA 4IM4A 1PBGA 1UHVA 3HG5A 2DSZA 3BMWA 3WQ5A 3AIRA 1GONA 1UH3A 3KL5A 3OA5A 2GSJA 2VZSA 4OKDA 3CZ8A 3PTKA 2YL8A 1OT1A 3AS1A 3PZUA 2CKSA 2VVNA 1AQMA 5E70A 3VSUA 1E6QM 1QX1A 1HJVA 2WCAA 1UKQA 3F5JA 4CKQA 2CHOA 1R87A 3L4ZA 3CZNA 3AHTA 1UD5A 3LPFA 1ISYA 1L8NA 1RH9A 3GYCA 3UESA 2D0HA 1ZL1A 2ZOXA 1XSJA 3VGEA 3AHXA 3F5LA 1HJSA 2MANA 2ZWZA 1VFMA 1NP0A 1ZBCA 5HBFA 2C7FA 3BAJA 3IJ9A 2Y4SA 1XYFA 2VURA 1QNSA 1KQZA 4MDPA 4E8DA 3U57A 3W37A 1R47A 1BQCA 4AIUA 4A3HA 3EJSA 3IAQA 2XM1A 1VEMA 1J11A 2C0HA 2YDSA 4MAZA 4PTVA 4UTFA 1GHRA 9CGTA 3RPMA 1ZU8A 7CGTA 1CNVA 3BVUA 3GNPA 1CENA 1J0ZA 2QMKA 3CUIA 1HJUA 3ECQA 1KCKA 1FOBA 1G1YA 3VIPA 4ZENA 3K8LA 2ZUWA 2J8GA 2FHCA 1QI4A 3OBAA 5BXTA 1JFXA 3WQ8A 2CXGA 4GZIA 1WDQA 2BY0A 3K8MA 1BYCA 2J78A 3ZJ6A 1JFHA 5E6ZA 4FLOA 1K9TA 1JYNA 1W91A 1JDDA 2WVTA 1LWJA 2XHYA 1HXKA 2QPSA 1H3GA 1QW9A 3W28A 4L4PA 5E0FA 2BVYA 1XV8A 4BA0A 1A3HA 5A94A 2XVKA 2CBVA 5IXEA 1VJZA 3AMKA 1JZ2A 4W5ZA 1KCLA 5M3WA 1EHAA 1KGXA 1E15A 1KTBA 2NT1A 1V3IA 4FLRA 3NJ3A 1W3HA 3F4VA 2CBJA 2JFEX 4FF5A 4FNSA
chains in the Genus database with same CATH superfamily
5HVGB 5ILTH 4ABQA 3UIYA 1QWGA 3O2LA 3AVEA 4IMDA 4HC1H 1XGRB 1VFTA 4EZKA 1I1WA 4GIAA 4HU0A 2J1KA 4Z1BA 4M62L 4XZIA 3OAYH 3EZ8A 2OTDA 1TFPA 3T0BA 5FYJH 4QXUH 2PYFB 5SX5K 3TA3D 3A3XA 4AEOA 4R97C 1B3OA 2QF8A 3N2BA 1XD0A 3DURA 4NCC2 3MMTA 1WBZB 1ZLVH 5L0QB 4P3WA 1NWPA 4DKEL 4XXWC 4NBXB 2F7FA 1IBHA 1VBHA 5L6YH 2MOQA 3S83A 3R1GH 1RK5A 3CAKA 4DLFA 2WYHA 1RZFH 3U0HA 2APTA 4QRFA 1I1YA 3V4LA 1M05A 1L3WA 3HW7A 1E0TA 3GHBL 3W84A 4OB5H 1OFAA 1UM5L 4N2YA 2XBDA 4G80B 4K55A 3S3SA 5HBBA 4RCXA 2R2HB 3CXHJ 3QHOA 1U3HB 4X7FC 3E6FB 3QDJA 4PJ6A 3CUFA 1Z9OA 3NGBB 1IGML 5D72L 5B21A 5HYJA 5CG0A 4K8EA 2WVVA 4L64A 4G56A 3O6KL 5HANA 4LSTH 4P5SA 4QAMB 1IGIH 4CEXC 2NYYC 1ZHBA 1S9WA 5I8KL 1F42A 2AANA 4RAUA 4GAJH 3SKJH 1VBGA 3IJHB 5D96C 4FXGB 4OUUA 1WFOA 4QE1A 8PAZA 4CQCA 3FF7A 2J25A 1BM3H 4TUJB 4WU5A 5EUOA 1PB0A 4JFXB 4ODHL 2PU0A 3Q01A 5F8RC 3CM4A 4WCYL 5J5EA 2EIEA 3FCSB 1DVFB 2MCPH 1A7OL 4F7MA 3PPGA 5CD3B 3WGUB 4AD1A 1FO0L 4PMVA 4NJHA 5GJTL 1TJ2A 2PN5A 2NNAB 4B41A 4CRPA 5BOOA 4NNCA 6XIAA 3O9WB 1SXSA 5J3HD 1QYGL 5MP6H 3ZN6A 1RAMA 1MFBH 2Z24A 3HPSA 4G6MH 1OB0A 4CNIA 4IS6B 2GUBA 2V5LA 2Y89A 3LY6A 4MYWB 2YXFA 4GRLD 4N5EC 4GRWF 3SGZA 4L1HA 4M29A 4S39A 3VSVA 4EZMA 3SD5A 3SGGA 1XEDA 4WWKB 4WDWA 3H6JA 3WKZA 1K03A 1WC7B 1BSIA 2D7TH 4JIPA 1W8OA 2AS5M 2NNRA 1OY0A 4A2FA 2ZT9C 1XGQA 3APFA 3QUMH 5KVEE 1HYSC 1UA7A 1ID5I 2ZZ2A 3FB8A 4JX0A 4BH7B 3QSTA 2B14A 4NZDA 3R13A 1JZ7A 1IILE 4P2VA 4KDWA 1IGYA 1SXBA 2X0WA 4EDWH 4GAYB 3GKWH 1HJBC 2A9MH 2CZEA 1WWWX 1A5AA 4XPBL 3LD5A 1OT2A 3WY4A 2R29H 2L8AA 2PLMA 4MD4B 2FWSA 2CRMA 5BO1H 1FYTD 1XZWA 5DVLA 1GVOA 1U42A 1A9EA 3ITYA 2XVPA 4FEZA 1QDSA 1JP5A 2BNQE 1Y07A 2W9MA 4OZHE 1TWSA 3AYRA 4PMYA 3ITVA 3MCLH 3BAYA 1WUEA 1XRSA 2F54D 1JRHH 4I5BB 4U3XA 5C0BE 3KS6A 3WIFB 3RQ3A 4L2YA 1LRTA 2PKDA 5ACLA 4KCTA 4C1NA 1THAA 5L9DL 2F15A 3FOKA 1X7FA 4JFEB 1GW6A 3D4ZA 4H3DA 1PSCA 5HHMD 5AOIA 5GS0D 3BJTA 4GCAA 2GK0B 4XBPB 2ROYA 3ATZA 4KROC 4F0HA 1V7ML 4BZYA 2OYKA 3VXPB 4UUIA 2OL3H 2V2CA 5D6DA 1EDHA 1NH6A 2DRUA 4PJXE 4PJEB 4JTSA 1SVDA 1WITA 5AVVB 2W65B 3W7OA 3OAUH 3PJSB 2BOBA 2FEDC 3HUJB 3VK5A 4EAMA 4LSVL 3ITCA 4J6IA 3FQ4A 3J27A 1P0BA 1CICA 3CASA 2H26A 5DBTA 5A8NA 4NRXA 5ERWB 3EWDA 4FQCH 5LXGL 2C3GA 3B9AA 4HIJA 3TXZA 4QEGA 2EXWC 4K7PL 1ZLEA 4F15B 3AREA 2HPIA 4MVBD 4G7YL 3DGCR 3RWIA 4KTEL 1VCBC 3FW6A 3IVTA 3B3IB 5EO1B 3VWJD 1OQFA 5E6IB 5ICUA 1A66A 1QK2A 1G9ML 2P5PA 4L8SC 3ZYOA 3I7QA 3QC3A 3QORC 1XH1A 5GGVL 4PRDA 5CCHE 3A24A 1I75A 3DC8A 1BJ8A 2MOVA 1SJXA 4TNWF 4YCPA 5I24A 3E1ZA 2F7QA 5EF3A 2V5DA 1TJMA 4WCJA 5TE4H 2BSSB 2OXHB 4GA8A 1T66D 5CSRA 1IKOP 3EJTA 1H5BC 3RYMA 1X1OA 1PKLA 2UZIH 1DWIM 1MRFL 5EKYA 2RUSA 2X42A 3FKUS 1R24B 4F7PB 4P2OD 1M1XA 2PF0A 2R8WA 4ONGH 4XNBA 1ACZA 1QUMA 4PJ8B 5AOZA 5KVDE 2OMZA 1QNZL 4MCMA 1J9QA 4PMUA 1SZGA 4ZTYA 3FIGA 4D72A 1OAKH 4GXVH 2EH8H 3TAOA 1QOPA 1PHQA 2P4AB 1UXWB 3RUGB 3TNMA 4BELD 3TFKD 3ZKSD 3HA1A 5I8EA 3SI9A 5FEWA 3UPCA 4R4FH 1RURH 5IVZB 1FNEA 5FJOA 2CIKA 4PGEA 4MNGE 3QVQA 5IMLB 1AHWA 1BG9A 2Q76B 4G1MA 2EYSB 4U1NA 1UR9A 3D3FA 4LOCA 4JEJA 1EJTC 1YNLH 1EZUA 4M6NH 1YTKA 1N9PA 2NX3A 1DQDH 2DVTA 4XI5C 4KMTL 1BXNA 4IGBA 4R8WH 2A5UA 4XNXH 1KCRH 5SX4I 4OCWL 1I3VA 4B90A 2Q8XA 2TAAA 4Y5YA 2JIXB 3W22A 3ETBF 5EC1A 2ENSA 5F93C 1R5WA 4GQ9L 3GZKA 5CG7A 1N5YH 4PRIE 5D1QC 4YX2H 1WUNT 3TEYA 3VH8B 1Q4NX 2VYOA 4GYBA 4WTWA 4F1SA 4GKSB 5T9BG 3M17B 1W8SA 3BH8A 3GGWB 1IAOA 3QJXA 2A99A 2ENYA 1QLFA 3MX0A 1AXTL 3FCPA 2J13A 3OC5A 1T7ZA 4YHOL 5LKNA 3PGCB 2Z2BA 3V2AR 5KUMA 3BVDB 2VDLB 1R5IB 4D6DA 4S3CA 2KZWA 1LOQA 1J7VR 3KGSA 3GSUB 4N8CL 5BJTB 5T1DL 1H15B 2DWEB 4B15A 1NGXA 3MAWA 1KRCC 2HSIA 5G4OA 3UF9A 3VFWB 3FO2A 2VSCA 4JFZH 2LLEA 1DVFD 4Y9MA 4PYHA 4DN3L 1W3LA 5CZVL 2WYZA 3ZJKA 1MNUH 2K9UA 3FBKA 1M41A 3BCDA 2KC0A 1E4MM 1EHNA 2FZ3B 5AC5A 1UURA 4LRNL 4ELKB 2ADFH 3O9WD 5FHAH 3N17A 4JB9H 4XVDA 3FK3A 1HVXA 4XOCA 1E6PA 4P3CH 4K3ZA 1JWSA 2R59A 3S2JA 1H9VA 3DMMB 3F85A 2DBLL 1FBAA 4BRJA 1BOYA 3D4YA 4NAJA 1UJPA 3A64A 4MA7H 1XIEA 1TLMA 3KH3A 1F07A 1IQ8A 2ITDB 3SJVA 2BVPA 3X2QB 4BKLB 3H7BA 3DSFL 1X6UA 5L2KA 3CU1A 3O0RH 2QVHA 5E4AA 3LVEA 3BQVA 4PD4K 1K5NB 3VFNA 1GKPA 5EV7A 1PQZB 2VO5A 1DDTA 3CT7A 2G5WA 4K8HA 3JTSB 3WN5C 4RMBA 3V0UA 1OTTC 2I1OA 3QAZC 4LQ1A 4BXVA 1NDWA 3MRPB 1XGPA 4XMUA 3KDNA 4NGHL 4AEIH 3UZWA 4G8EB 5D9SA 4KWWA 4KRUA 3FA5A 5J89A 3I9IA 3MROA 5IVXF 4X9IA 4DF2A 2JXMB 5IB1B 3DHJA 4G1KA 1X7QA 5AC8A 5DYOA 2EYRB 3UC0H 2HRWA 4O1DA 2B8OT 5LA1A 1HXYA 3ZMEA 2XFXB 2IEPA 4ZMZA 1A4MA 5E8EA 4DO6A 1I1XA 4JX6A 3FQXA 4U0RB 3QXAB 1OK6A 4M61A 1JN6B 4WKZB 3FT9A 1CX9A 2H4EA 3KWSA 1RCXB 4GJTB 2V5BA 2LR4A 1S2WA 3IV3A 3S35X 2JV6A 3LBOA 4NHVA 2FDSA 3N0AA 2Y3AA 3QUXA 3GJFH 1CU4H 3IDXH 1YLVA 3HNVL 4GSRA 4PTTA 5E5MB 4O19A 1YY9C 4AQOA 5CAYB 5K39A 1L0YA 4XO9A 5E94A 2XQBL 5K9OB 3ULVF 3OQRA 2V2DA 4QRBA 3CZLA 4ODUB 2P53A 1YX1A 1DHKA 4LOFA 1JNHB 1S7TB 3U0WH 4KJYA 4DX3A 1H8NA 2BNQB 3RFZA 3MRHB 1MZYA 2Z6IA 2BS9A 4O52A 4OZHB 3MACL 2YC1B 5DRWA 2WLJA 3A4FA 2WIMA 3DSNB 4CVXB 3RBSA 5D05A 1RJZB 2A6DA 2FWOA 3TX9A 5IROC 3GTTA 5TK4A 5F9OH 2OP4L 3BYYA 5C0IA 1LUCA 2WLKA 3MJ8B 1I8UA 2AXFB 2W0KA 2RQEA 1KZYA 2G95A 4Q2ZA 3OXSB 1E9PB 2P8LB 4GP8B 4ZMLA 3MV8A 1AYOA 4LDEB 3BEVB 3ZDXE 3ZZ1A 2QDDA 2V33A 2OPCA 3FH5A 2D2GA 4I9MA 1DQXA 4Q8WA 1PDKB 3BYTA 3EJYC 3QR0A 4PV8B 2CWXA 4EIZC 1EGJA 4PJXB 3RF9A 2MQ3A 4OGQC 1NDMB 4FP8L 3FO0H 2H9AB 1S7VB 4M6UA 3RGHA 1OB1B 1IM3B 3SKMB 4FKEA 2B16A 2P80D 3HZVB 2X0HA 3DCPA 5I7GA 5JZ7D 3RIFF 4H9XA 4H8NA 3AU6A 4WQOA 3AS2A 4F2ME 1UD4A 5CSUA 1XGUA 5DHVA 4RFNC 4F2UA 3WLKX 1PZCA 2E5CA 2RAGA 3LHTA 1VIZA 2EDJA 4BQBA 1FH7A 4E42A 3WTSA 4TYUA 2WKGA 1KFJA 4JKLA 4CW1A 3F01A 1JCJA 4YJ5A 3GK8L 2IO5A 3O8XC 2YYTA 1UMYA 3SGKA 2EPNA 2PD9A 1WA3A 2K45A 5JHLL 5FF0A 2YEZA 3GRBA 3CWHA 2MQGA 2GDUA 2WV3A 1C5BL 2EVFA 3O9NA 5BU9A 4BZ2H 2QV5A 4YHNB 3JYBA 1WJ3A 3DO4A 1EVTC 2R8SL 1MCQA 3AZRA 3TPKA 4XNYH 4U1JB 4DGYL 4E0RA 2GC4C 3VXSA 2WLIA 4GS7C 3C08H 2LE9A 3MLXL 3W86A 4PS8A 1DBBL 4Y4FB 1PKNA 1BFOA 5ACMA 3ITGA 3S37X 1F6KA 5HGAA 2ZKYA 1TMHA 3A4XA 3QR1A 3ABXA 3R06B 1DUYB 4FCHA 1QEWB 4HUXB 5EN2B 2WSKA 4D1IA 2B9AA 3G6DL 1IAIM 2YCEA 5FJJA 3R8GA 3IGSA 4ZTPL 1OKEA 3T05A 1OP3H 1PBYA 1ETB1 4WEBL 3N43B 4H26A 1YG9A 5E9DE 2JIXD 4KUZH 1HINL 1Q9KB 4M0XA 2WBWB 1FL5B 4JHBA 3C6EA 1T8QA 3AFLA 1ICTA 5E1AA 4XCEB 4HWBA 4MNGB 4CADA 2FTYA 3W7PA 5C9WA 5TH2B 5HXMA 3KCJA 1V0NA 2ZXQA 1FCGA 4F2EA 4DEPC 4Q9QH 2OTPA 3MGTA 1YMMB 4KFZC 5AYYA 4Y6GA 2Z1KA 5AZUA 1U5JA 3EWYA 1E6RA 1LEGB 4G7EA 5JR1L 2ZWLT 4KH2A 3K1KC 2ZSWA 4UAOB 4H0IA 3V5HB 1RVGA 3FU7B 3J7HA 2NY3B 5F1SA 2QDEA 2QKSA 1AXIB 1CF8H 3WO8A 4ZQKB 2WLMA 3Q0HA 2ALRA 1LZOA 4ZX5A 1X5HA 4HKJA 5DC4B 5FFLA 4BKSC 5DRNB 2NW2B 4L4OA 3QRLA 4AM0A 1LROA 4Z2LA 2QMJA 5DY2A 4MZ2A 3LZPA 3OKLB 5HJ3A 2Z65C 4GH1A 3DXIA 5DJ8A 2ZTBA 1P4CA 4MNQE 3ECBB 4DB7A 4TV3A 3DFSA 3P81A 3W3BA 4CMHC 2INFA 3HPJA 5IW3A 3DMMD 4RNHA 4QJ4B 1Z3GH 4S0HA 1Q6EA 3RAJL 5EBMA 3EBHA 4FQQB 4K5NA 5BYWA 3QULB 2EPHA 3CL7A 3VOCA 1U8MB 5D03A 4GXUN 3SE9H 1AIFB 4PHZA 3T65A 3GHTA 1SQ2N 3A67L 1QBBA 2DDXA 2YZRA 3G7TA 5F3HB 1GW1A 3KRZA 3HOGA 4FQXA 4NZUL 2I7SA 5DT7A 2EDBA 1Z5HA 1JHTB 3OA3A 4PUNA 2NTFA 3SPJA 4Q4MA 2UWEF 2J72A 3INOA 4POYA 4E5XB 5HGGS 4O1EA 4OCXH 2DOCA 2QADB 4RQQA 5A6KA 3M0MA 4C55A 1CTOA 2Q09A 4IJ3B 5U4NA 4ZE4A 5F97E 3SQBB 3U0TB 4NZ3A 3M5ZA 5INCA 2EPOA 4IDJH 2WM0A 2EG7A 4M56A 4ZXBA 2WNKA 3MJ9L 5DD6A 1F4HA 2X0SA 5FYKD 4UCGA 1T6WA 1PBGA 3HNTH 3FO1A 4WDXA 3VA2C 5C2GA 1HCVA 4KJWD 43C9A 3KLDA 2CDFB 3ATYA 1ZVSA 3KDPB 4L3ED 3SQMA 1U0QA 5EU6E 3Q5OA 1VFMA 4HB7A 4D7BA 3GMQB 2E7FA 3SO7A 2QUMA 1AMXA 1R47A 4MTMA 4K5MA 5C0FB 3KEDA 1WEJL 4PTVA 5DEGB 4N0UE 4YHKH 4DTGH 3E3QE 3P9WB 4HHLA 4N8VA 4PY7A 2QMKA 4TV6A 3QMRA 3LQMA 2ZP8A 2ZF8A 5JMOC 2VGIA 3MLVL 3D39A 2WWNA 3K8LA 4MDRA 4AGQA 4K5PA 5GRUH 4Y2LA 4APQB 1XINA 4I13B 5A3IC 1F2QA 3EYOA 3QYNA 4WK0B 1HXKA 2EC9U 3U30B 2XKNB 3HJ0A 1A5FH 3Q8EA 1FAIL 5IXEA 4MWAC 4NZ4A 1JZ2A 4RXFA 1QU4A 2DEWX 1KGXA 4QKXB 2K3HA 5I16B 1KTBA 3O3RA 2NT1A 3WO4B 1WH0A 2A21A 5ESVA 4JDEB 4ELDA 3W1AA 1U91B 2ICES 1CVSC 1KT2B 3BZEA 3CFKA 5DRZB 1Q66A 4OT1H 1VERA 1I7UB 3EHBC 3WLIA 1D3CA 3SADA 2QT6A 3KPPB 4AXWB 3DFNA 2ISVA 2AGJL 1IM3D 3RCNA 4P8UA 5ITBL 5EPDA 1I85C 2IH1A 4HEPA 5CEXB 3O6FD 2H9GA 1XWYA 1FVPA 4LZKA 1MJUH 4H9TA 4F2FA 3QR2A 3QC6X 1HSBA 1I2QA 4NF7A 3W87A 4JFFE 5J0BA 1VEOA 4YDVA 4FQHA 1XT5A 3TYGH 4JG9A 3QSRA 1LK3L 1YEHH 3ZDXB 3EYSH 5DVOA 3CB3A 3QWRD 3BVWA 2JEPA 1HOCB 3GSRB 1RZMA 4NP4L 3FOLB 1T1YB 4PLKD 1OAXH 1NFKA 1WIPA 4NJ9L 2ZUUA 3DUUB 3SFWA 3UAJA 1N3NB 2RD0A 1EFZA 4QHUB 2PBGA 3P0GB 1HIZA 3TJPA 2L7QA 1IXNA 4J3OC 3VNZA 4GZJA 4FO4A 1NCWL 4WENB 4MUPA 2DW5A 3NSJA 2HFEB 4F2MB 3SCPA 4Y4FD 3HMWL 3IGHX 1CFSB 4HXBL 4L3AA 3K5SA 4XKYA 2JTYA 4KIEA 5BMFH 2Z92B 3QRHA 4PGLA 4U6HA 4WDUA 1YPZF 2FX8L 4XWOD 3DV6A 5IB5A 3PGDB 1QPQA 3ZIYA 4X5LA 1MWAL 2B7NA 4LVHB 2W0FA 4WD0A 3DX4A 4UC5A 1XH0A 5GS1A 4ONFH 5LNWA 4YZWA 2CG9X 2CZFA 3LKPB 1NLDH 2B59A 1JWUB 3SYPA 2J7GA 3O15A 3ME0B 4ZODA 5F1KC 2VO8A 1E5CA 2FL5A 1RHCA 2BVUA 2UWEA 1QR4A 3VCRA 3UMTA 5FYJE 1T04B 4QYAA 2ANUA 1EJ7L 5KS9E 3O6LH 2PW2A 4W9LC 4HJGA 2R2CA 2DWDA 4O16A 5FUOL 1YMMD 3BFQG 3SGEH 5AVHA 4PBXA 3Q6FA 1GZHA 4A67A 3G3DA 4BSWA 3CDGA 1N8ZB 2HXTA 1O7DE 1INEL 3U1SL 4Y2DB 5DUML 1CR9L 2WB1A 2IUZA 3JV6B 4JHWL 4DPPA 1AQKH 4F8LA 5TQLA 2NY3D 5E9DB 1KV3A 2MIZA 3FRPG 4P61A 4S1QL 2QPUA 1JHKH 1HAUA 4XPTL 2OXNA 1S7RB 4OGXL 2J3SA 4H1LH 6ALDA 3CFJB 1NGWB 4N4YB 4N0RA 3V0EA 1FA4A 1SJAA 5AVUB 3AU2A 3W88A 1FRGL 3SOBL 4H2AA 2WJFA 1W9PA 4M1RA 1QI2A 5C97A 4A2HA 4LEOA 1JPSL 3D0CA 3UTPD 3AUWB 1GUVA 1L7TH 4UZUA 4OCRH 4PP1C 3DKJA 1H1NA 2VGFA 4X6DF 2A83A 8XIMA 3TEXA 1OZTG 4M03A 3EBAA 4V15A 3RR4A 4PUUA 3TZVC 1V3KA 5CSGA 3ZE2E 4GX9A 3O2VL 2QGEA 3CH0A 2E4FA 5KVMC 3KPTA 2GVGA 1HUVA 2GQHA 4LF3A 2WP3O 4OUOA 2CKBH 1V6VA 3HEIB 4K8RC 4LEBA 4RGMC 4P7NA 4K23H 1YNTA 4E41B 3FB5B 3JR2A 4M51A 1M9HA 3M7WA 3CVHH 5IDIA 1R9FA 4MNQB 4YDLB 2WYIA 3R0NA 4Q56A 4LXFA 2AEQH 2YOCA 3VFOB 1XRTA 5DJDA 1X9QA 4AY8A 3D18A 2ON3A 4OOZA 1JPFA 5HGHB 2AK1L 4UT7L 2V3DA 3P77A 2QADD 4P2RE 3GINA 4LLYB 4FX7A 7FABL 4OLZL 1QAPA 3CFMA 3IACA 5AUMB 4QYOB 5E9AA 3IAGC 4G7FA 2DZEA 1I3UA 3FTXA 3TEUA 3MCMA 3G1YA 1H6FA 3MMUA 1AVAA 2AOSA 1X5ZA 2PDWA 1R3TA 2IQ0A 3D51A 2J1ZA 1LP9A 1NBVL 4NWTH 5FEPA 4JQ1A 3QDMA 1QMUA 3RVTD 2JJWA 1RK0B 1MAKA 5J5DA 2QZ5A 4AH7A 1FHLA 2ZKWA 3QFJD 3FDWA 4R5TA 1X7IA 3MRFA 1EFXD 1XLKA 5D9NA 3MVSA 1ENUA 2EQDA 2VTFA 1AD0A 4F1ZA 1RHFA 1YPZA 2AFNA 2LFEA 4PJBF 3QTPA 5F2IA 1ONQA 3FB7B 1F3DH 4APQD 4OD2B 2BO0A 3UG4A 4CQ8A 2YPKB 2Z4QA 3RTQC 2VGBA 3LK6A 3QJHA 4CVUA 5KSAD 1XBYA 1CFNB 3HE7A 3O45A 5EU6B 3ZKXC 2IWEA 2V6AA 5DJAB 2JQZA 5AY7A 4ZZKA 4K3JH 5HSFA 1OD0A 1OP9A 3QCVH 2OR2A 2DJLA 4N24A 1CW2A 2PDHA 2FB2A 1A9BB 3Q44A 3OKNB 4P46B 2AKMA 4CJ0A 2QCFA 4O18A 2C1OB 4A21A 1L2QA 1IE4A 3WUWB 2G2RA 2PDYA 1BZDA 3ULUL 1JZ5A 4N2GA 4C6BA 3TO4C 3P3SA 1OP5H 3QYSA 3HFTA 3VILA 3Q8CA 1D5MB 2CLZB 4XZBA 2QCNA 3QWOB 3IMUA 2H2SC 2C1PB 1KTRL 4MKMA 3SDXA 2K6WA 3EYQD 4CCDA 2J77A 3AWFA 4LESA 2QKIA 2KKQA 2X4NA 1KEGL 2HVJB 1LCOA 3H26A 4JZNA 4W9GC 4V27A 4YSOA 3FTYA 1BREA 3ZTCC 2BNRD 3O06A 2CGRL 3KTCA 4XIMA 1FCVA 4Y4KC 2X6MA 4PJIF 4FJ6A 2YQ2A 5KYUA 5AAWA 2OZ4A 5ABAA 3QIUA 3NPZB 3NUKA 1IT7A 4FOUA 1NGPH 2WW5A 3B8TA 2F6XA 1GIGL 4WV1B 4K15A 3QIWA 4L1GA 4NRYA 3ILPB 1OFPA 5IV2A 3OJGA 1H2JA 2OJZH 4JFFB 4ZQNA 2NY6B 1K4CA 3BSZL 4B9IA 4O0QA 4NQEE 4GGBA 5D1ZB 3DO3A 1KXTA 4CLMA 1K9DA 3EWZA 1M6UA 2JKSA 4XCNA 4BQCA 1SYSB 3E8UH 1TTBA 4XODA 5E03A 4US5A 5J5RA 3LLDA 4XP9H 3S3CB 4X50A 3ML8A 1FWIC 3BLLA 2MHAB 3FNKA 2YFNA 3C60D 4KERA 4LVFA 4NUJA 4TX9A 1KLFA 3GIVB 4AT6A 3FRPB 2D7OA 4ORGA 5C7ZA 1W0VB 3RKDC 2DI9A 3D5HA 4B5WA 3CX5J 1Z66A 1RUML 4RNJA 2Y23A 3UQNA 3QEUA 4H6RA 2OJEA 5DBUA 1UA6L 1V5JA 3FRUB 4DVOA 2CHNA 3KJ4C 1EAJA 5IHUL 3NYKA 3QT2A 4I18B 2V5MA 1J8HA 1NAKH 3AXLB 3GFUA 2G3FA 3UTSA 3BJSA 1L0QA 5EEWA 4JQXA 3BPLC 3CSFA 1XG4A 5C2BL 1MF2L 3QBTB 4HJIA 3NCMA 5I3IA 1A7QL 4Y2DD 5GZOD 2DLFH 4PD4J 5M94B 2HFFA 1UR3M 1V08A 1U95A 5E9DD 3MMEB 2CESA 1EXHA 2YBRB 1S6NA 2DVUA 3PPHA 3UTTE 3FUMA 2E75C 4A6YB 1TUPA 2J66A 3UNTA 1SQ7A 5HI5C 2GYIA 4IMAA 4WI0A 5KSUB 3QRFM 3IFNL 4AQ1A 2EUZA 4XZMX 3SE8H 5JIIA 4WGHA 3G18A 2WVSA 4J4PA 5KS9B 3N29A 1GZPB 4L29B 4Z7UB 1ZLVK 4XBGA 5EOCL 3ARVA 3AIEA 4ODWA 2NY2B 3QQ9C 5LNEA 3GC4A 3WJZA 4LCIL 4A8LA 3T2PA 4NUQA 1QQDB 3BQ6A 4NC1C 1A1MB 3GBLA 3P67A 2QCDB 1E3ZA 5ICXB 1TMLA 2HT4C 4NAEA 1U93B 3LSBA 4YL9A 1ZDSA 3NK3A 3PGFH 2P88A 5K9KA 4MWFA 1ANUA 1KC5H 3X12B 5IEKA 4MYAA 2FGZA 2IDFA 3LNMA 3GC3A 1WYJA 3KDMB 3T3PE 2DQJL 4HIQA 3STCA 1RVFL 2OMYB 3MLYH 2FR4A 1XCXA 1KFKA 4MG4A 2EIMB 1TZZA 3H4FA 4NQVB 2C71A 2G30A 3U4BL 4E41D 4GVGA 1VLWA 3MT1A 1OD7A 1OGTB 4NIKB 4NSKB 5LGHH 4WHTB 5C9XA 4KQ4L 1W6WA 1PZ2A 4F33B 1FL6B 3TT3L 2F61A 4PBEA 5CU5A 4L1WA 3C5ZA 4NNBA 1YNPA 4DIAA 5EO9B 2WQPA 4KXBA 5D2VA 4D0DB 3TN6A 4OJAA 3PLYA 2WBJC 4YHLL 2EAEA 2IXUA 2FE0A 4IOIB 4W9DC 4IMCA 1IZKA 3K2UH 4Q0XL 5JXAL 1QLRB 3MYJB 3ZE2B 3DX0A 3QJRB 5HI4C 3CLEL 3KLHC 5AG9A 3CL6A 3BV4A 2BV9A 3W7CA 3L16A 3WG6A 3VI4A 5E51A 3ZTJH 3OHXB 1DZBA 4XPGL 3IVUA 3MMDA 5IEHB 5IIEA 4P2QE 3WE6A 2PYED 4QRSB 4B97A 4E4PA 2AEPL 2BW5A 4AYMC 4JHUA 4IU3A 5GHWL 1EO5A 4PR5B 1VKXB 1Q85A 2F84A 4PJIA 3WI9A 1VFSA 4DWHA 4N20A 4A3QA 1MFEL 1LLAA 2GSHA 3I4KA 5IHLB 4KU1A 2V5RA 3J07A 1KLGA 1PEZA 4Q52A 2A0LD 4WEMB 2IOOA 3HF3A 4OJDH 2WTOA 2V3EA 3GSWA 1GPOL 2Y69B 4NEHB 3CFDB 4JMXA 4P2RB 3C2EA 1KGWA 2CXEA 4BUGA 2VXUL 3W4RA 2GG1A 1QPRA 4HEMA 4GK8A 2VDKB 4HQVA 5I2IA 2MUCA 3CQKA 3EF4A 1K8CA 1HL8A 4KRTA 4NZTL 4Y1AA 1OFEA 3PJWA 2X1UA 2VDNH 4GQGA 1A22B 3D9AL 5E8NB 3LNGA 3WD2A 4LAUA 4RV3A 4E9RA 3INPA 3SSJA 3RWEB 3SDCC 1A8JH 4O14A 5BW6A 1UQSA 4MHBA 4EF3A 4AX6A 1MUJB 5LQBL 4DFIA 4HHWA 1RIHL 1L2UA 1TWIA 1ED3A 1SZNA 2FNBA 4IRJB 3MCKB 1DLHA 3W1MA 4K71C 3ZKQD 4U1LA 3UYOD 4DPBX 5HVHC 3LVTA 1E28B 3KTXA 5C0DA 1UKSA 1E50A 2DW6A 1FWFC 2XWXA 4C6QA 1UB5A 1BQGA 2VXVL 3H24A 4G1EA 2GY5A 4YHPA 2XINA 5DFVD 1TPVA 4WFHE 1E90A 3N50A 2HLEB 4MNHB 1HEZA 1IYXA 2ZRWA 4CJ1A 2Y7QB 3B2VL 2IPFA 4NZFA 1BOGB 4FR1A 5FYKU 2WZAA 1P1ZA 5JIDA 1URZA 4WU7B 2HWZL 3UR2A 5F96L 2WWKO 3TYAA 5A6TC 1H11A 3RPKA 1A5OC 2QQKL 2E7CA 1QFHA 1ZT1B 5I1JH 3EAUA 1JNNH 1ISXA 2RTTA 2Y7MA 3IJ7A 5CINH 4IISA 5F71A 3HHRB 4JKPL 3VFMB 3P14A 4PRRA 4ZMAT 1CDHA 2OTUB 3B5GA 2D03L 3T9PA 3EPMA 1MY7A 1IL1A 3RL2B 3KL0A 4MNJA 2ZCHH 2BVQB 4UBDD 3ATFA 2H8ZA 4L3CB 2H6RA 4JFFD 4I7ZC 4QTHB 4Y89A 2YPVH 2Y1HA 5IWLA 4AMKH 4HQQH 1U58A 1GJUA 4HS3B 4HPNA 2AVFA 4TQTA 4GLRI 1IBBA 1RK6A 3P9LA 1XF0A 1HSAA 4NKIH 1AS7A 4PI0A 5LDSA 4DZ5A 1AY1L 1A3XA 2G3IA 4PTWA 1S7QB 1JYWA 1CE6B 5BVPH 1SW0A 3ONBA 1Z6KA 2BS71 5C3TA 1IF2A 4DNLA 4X9BA 4R7JA 1GGIL 2HMID 2EG6A 2Z1WA 2EE3A 3CLFH 4X9HA 1LJMA 2KDGA 5C2CA 4QTIH 4YZFE 2Z28A 3MW7A 1EAPB 3FF8A 1TVDA 3UZVA 2A6KA 1OE2A 1N8OE 1KXQA 1R0AL 1Q2SA 2PTZA 5C8JA 4XOEA 2V82A 3C5SA 2B39A 1XLFA 4HN4A 4NQEB 3G6MA 3H2PA 3HI5H 3TAKA 3NL5A 1JVOA 2NCEA 2QSQA 3R7QA 4GJIA 4GUGA 5J57B 4RUBA 2OQHA 2WWKT 4KY2A 3B43A 1IKFH 4S3DA 3AAZB 3TDFA 5D7IF 3DHFA 1CN4A 4GXPA 4HSQA 2AQOA 5D1XE 4N1EA 4AZHA 4XAWH 3WTUA 6REQB 1HKLH 3RR1A 3GXMA 1PJ9A 4ZSTA 1B88A 4PGBA 3D0VA 2Y7SA 3INUH 1IGCH 2VI0A 4FB7A 3I3EA 4PMEA 2Q3RA 3M1ZA 4OF3A 4OF6A 2NW3B 2NY2D 4NRSA 5H4ZA 4KXDA 2RJGA 4OCYH 5IP4A 4AQLA 2HX8A 2E77A 2GPTA 1Z9SB 4H4NA 4JR9H 4OZFH 3VINA 3M1BA 1KBGL 2GL5A 2PDQA 4XZLX 3OKMB 4G9DB 3VJ6B 5IW1B 3NQBA 1UZ6F 4BQ6A 3WMQA 1EERB 3B40A 4J35A 4L9DA 3WXWH 3TCXA 5C6PB 3CHVA 2DPKA 3LZOA 5HATA 3IUIA 2Z31A 3RX3A 3QKZA 4PI2A 1Q9LB 5AHNA 5KVGE 4BWTA 4HIBA 3ERXA 1DVZA 1JNLL 3WQ5A 4H2HA 3CMFA 2QUTA 1UH3A 1YRKA 3BZDA 3MA9L 2CKSA 2PMQA 2IKIA 1X9UA 4J3ZA 3O0KA 1Q1JL 5JDSA 3KOZA 1IRAY 3COTA 1MOEA 2CXKA 4JRWA 1L8NA 3UZ5A 2LABA 1F6AB 1DIKA 2K3TA 4M6AA 1NMCB 3TBYA 2DZUA 4H1ZA 3GBML 3N42B 2PP1A 5AC6A 1P4IH 3T3PB 2Z8VC 3W1RA 5M7QA 4PPTA 2CU0A 4NAMA 4NHCL 2G0LA 4IRZL 4GP4B 2WUCH 4PJ7E 3N85L 1FOBA 1ZVYA 4HZLA 1AGEA 4DJDC 3CG8A 4KVCL 5BZWB 1FHGA 4RMUA 3VWKC 2BY0A 2OMAA 4FLOA 1RY7B 2XKUA 3P4OB 1HXMB 2WVTA 2UV8G 5ETUA 4WR3A 5IJBC 4KI1A 1T21B 5CMAA 3SO5A 3F12B 1XFBA 1YUHB 1XGEA 2FBJH 1IC4H 4NIYE 2J1WA 4J3OH 4FF5A 4P2RD 1V55B 3LBMA 5HWJA 1BRLA 4HH9A 5I1CH 1OM3L 3VNKA 4ZX3A 5FPIA 3LV3B 2G2NA 4OFPA 4M00A 3OLIA 3ZUNC 5CO1A 1T6MA 1PYWA 2I5YL 1YEKL 3NJHA 3TJXA 1E6NA 5DJZA 4P2QB 1HHJA 2GWNA 3NIDE 4D8ZA 4G8FA 4YCOA 2XFYA 1UCBL 1PVHA 1KOAA 3DIPA 4FG6D 4U6YB 3GU1A 3GBNH 2QJHA 2W62A 3MBWA 4N86A 3A22A 2ZAGA 3VVGA 2ROXA 2F58L 3BEWA 2OSLA 1CFTB 4O0ZA 4UM9A 1Y5WA 2EIJB 1GQJA 3AB0B 1Z5LB 4L4TE 2HS6A 4OJEH 4ERAA 1XH2A 1DL7L 2X3BA 5T3XL 4AWJC 1BFVL 1UUSA 3E9UA 4JDTL 1WKYA 4MYPA 2V7HA 1CK0L 4DGUA 1E27A 3ZR5A 4TULL 4AYFA 4B5VA 1GOXA 1LO5A 4MUZA 3KYMA 3STLB 3B37A 3K6SB 5ADOH 5FV1L 3AGVA 3GJFK 5CZXD 3L4XA 4OBTA 5I1KH 1ZIAA 3APYA 4HG4K 4LUTB 3GJFB 1KMGA 2OKMA 3DJTA 1NC2B 4BK8A 3JWDC 4QR7A 2VQ1A 4ODSH 5BNKA 4E8CA 3BUPA 4X98A 3TBTA 2LHAA 4XXCC 1A65A 4W84A 2BP5M 3DX6A 2UZYB 5F7UA 1U3HD 3RB7A 3NEEA 3NAAL 5AW4B 3TYCA 3BQ5A 1SJHB 4DJMA 4ZX4A 1TEFA 1EV2E 3NNTA 2EE0A 3SCTA 3U7YH 3WBWA 5EU3A 2RHEA 3W6MA 1VFUA 4BCEA 1CB4A 3OD3A 1PCKA 1OC7A 1KBPA 1NEZG 1UWQA 1K8XA 1ZLUH 3T77A 5E0CA 3QCTL 6A3HA 1YMHB 5GNYA 4KO6A 2RH0A 3ARSA 4Z2HA 2OMVA 3WTYA 5HGBB 1E8WA 3FU0A 2XN2A 3AO0A 1C90A 2ITCB 1H3WM 4IOSA 1UOKA 4K3DL 4AV0A 3TA3A 4ZTOL 3CFCH 2ZX7A 1HTIA 5KVFH 4AQAB 3FS2A 2BP3A 4K8RH 3BK0A 4C56E 2V9UA 5I8CB 3R8HA 2PTUA 2JI3A 3TK7A 1JPGB 2AAAA 5I17B 5DK3A 4K9EC 3ZDZF 1NGQL 4O2EA 1NEUA 1P1VA 4HYVA 1GMIA 1GS7A 1PG7L 4GZ7A 1HHKA 3UJEA 5H35A 4BI5A 1R7OA 4PJ9C 1IEBA 4O4YH 1EBAA 3BWZA 4G7RB 2VITB 4QITA 5CUSL 3QJTB 1PIIA 4NQED 3VD4A 4WWKD 4LNVA 3BSHA 2AL2B 1G7MA 1TDQA 4UTTC 5DMGC 1C8PA 1Z0MA 1RP9A 1NINA 2YSWA 3WMLA 3QG7H 3ZU8A 3EMCA 1DQML 2E59A 5EU5B 1NUDA 3GIZH 2BOGX 2TSAA 1BTMA 1LT8A 3QO1A 4QXTA 4CEUC 2GK1A 4PG2A 3TZNA 5I02A 3RY6C 1JGIA 1V3JA 3DIVA 3GWJA 3LKSB 4D3CL 1VEPA 3CQHA 5F8QC 1Q94A 1C8XA 1MCBA 4UWQB 1JEZA 3T2NH 5KJ7E 1XXFC 3FQRA 4OGAD 4FR6A 4RBPK 2CBMA 3D08A 1A1OB 1OP3K 4QRPE 2DORA 5FCSH 4EX4A 1QR7A 1MRDL 4M4RB 2VR2A 3NH7L 5D1XB 4YUEH 4M5YL 5EUKA 1OQOA 4KK9C 1A7PH 1TPUA 5GRYA 1DWHM 4XVUD 4FNUA 1EP1A 4IZGA 1ZSDA 2WJEA 4GRLA 4JFED 4ACZB 3ULSA 4R9XA 3T40A 3WLQA 3DG6A 3FT4A 1PF3A 3T09A 3UCCA 1X5YA 4WW2C 3ITLA 5CFAA 1NCHA 1JUBA 3QJFA 2Y7GA 4BQ9A 1FSKC 1FWXA 3UJJH 4F8OA 3VIFA 4YR6A 4OZGE 3T4YB 4XAGA 3W7HA 4P9MH 3AT0A 3DVFA 2NVAA 3GG1A 4KVNH 2DQCH 4GG8A 1J5TA 5B22A 4RETB 3CH8A 3Q6GH 3C75A 3PULA 1ZB5A 3EPOA 1E8XA 1OCCB 1G7LB 4JGMA 4X0KB 1DXEA 1R4XA 5C0BB 2X0UA 3U2JA 3QBUA 2DMCA 2EPMX 1VA9A 2ZKHH 3QHNA 4LAQH 5G5IA 1DJHA 2G4FA 3F7KA 3MDUA 1TSRA 3VYPA 1UT2A 1UM4H 4HP5A 1JV2A 2WXDM 4AD4A 4CILA 1FYTA 1IIHA 1DIDA 5E6ID 4N2MA 3RKPA 1E9QB 4P4KB 3CFBB 5JIQA 4XD5A 1TTPA 1JPEA 4P7QA 2XPGB 2HK1A 3LZFL 1DANU 4B53A 2BVOB 5DELA 3ABMB 4RZCA 4P3DB 2Y0FA 3RPDA 4H8VA 1DVUA 3BVNA 4P8XA 4NB7A 1LD9A 3S4TA 1E7VA 2XWEA 3V9EA 1YAIA 3QPEA 3VTMA 1OSPH 1KCSH 2GPZA 4JTQA 1FBIL 1F4XL 3P80A 1O6VA 4R5XA 4U1IA 3CHCA 1BZ7B 4P9HC 4Q6JA 4H1LG 5B38G 1KJVA 5A2LH 4JIIX 4PJ7B 1BEUA 4HJTA 4MAYB 2F7RA 4P2QD 2DB8A 2RJHA 4LVOB 1FP9A 4A3UA 1OHQA 4PJ8D 1ME7A 4QWWD 5J13C 1H7NA 3BP5A 1I1AB 3VRLE 3WFCH 5B39G 1KJ2A 3HR6A 2ADYA 3KYOB 4C4UA 1B0GA 3EH2A 1GTHA 1WV7T 4DUOA 2WSDA 1V10A 2ZNWA 4DYEA 3DU0A 4HTYA 3TE9A 3OGCB 5HJDA 1XL6A 3HOJA 1J1OH 3PJNA 2ODOA 1HZHH 1KBWA 4N2NA 4BYHA 2W95A 4V2BA 4A7TA 2DF3A 3CFQA 2LTQB 3L1GA 1BQRA 5M03A 1QFWH 3GSNB 5IF0B 2G5BB 5FDWA 4JRXE 1HIML 4LIQL 3UOAB 2DEXX 4FI8A 3GXUB 3MXVH 3U9PL 1T0NA 3UTZB 2ZQKA 5F88B 4BF7A 1NC2D 4P5KA 4IMLB 4V1YA 3VD2A 2AGTA 5TDPA 5AB0A 3L5JA 2X87A 1RIUH 2R1LA 1T4KB 3T4AB 4JVUA 3LEXB 3TNBA 5CILL 4I4WA 5IVXA 5RUBA 1TV5A 1ILUA 1CT8A 2DLIA 5I77A 3S2CA 1KBBA 3LU2A 4J2MA 5DLMH 4ZA0A 4P2OA 3SJ3A 1VRDA 2WNNA 3CIAA 3CSGA 2ZAIA 2C9PA 4J1OA 5I3GA 1QTYT 1P4BH 3MRJB 2IANE 4HF5L 4G6FB 3BH9B 1XGRA 4WFHD 3WNJA 3AMLA 5EOTB 4CSZA 2D1ZA 3HG2A 1KDJA 1JXDA 3GMPB 2ZUSA 3VZXA 3N41B 3S1VA 4HWEH 1V4YA 3TXVA 5BZAA 3RWHA 4HS6B 1EH9A 3F7PC 4P7RA 4ZR8A 4PRIB 4X5QA 3VYOA 1GJWA 4S1RL 3ES8A 3BX7C 4LLQB 4GRSA 1H3VA 4PJEF 3H0TA 3D3AA 2R94A 3UZJA 2XG5A 2ALWA 2OX1A 1CURA 4PJ5E 3OX8B 1J1XH 1QSFE 1RAKA 3W2DL 1CVRA 5L88L 1A4KA 5JW5B 3HUJF 4RJEA 3RUBL 4F9LC 3M47A 4UTBA 2XJLA 3ARYA 3FB6A 1TZGH 1MI5E 4B5UA 1E5UI 3WH5A 1XIDA 2A9BA 4Z7VE 2ED8A 1N26A 1QA9B 2UY6A 4UV4L 1KN4H 4Q8NA 3E6FA 2E6PA 3JTTA 4KKCC 3CZUB 1O9VA 3TWCL 3S35H 4HNLA 3NQGA 3NO1A 4QHMA 1P2CA 3RVUC 4C56B 1DDHB 5EEZA 1R3QA 5BNXD 1NFDE 5JUVA 3S42A 4JPWH 2BDNL 4OQVA 3V9CA 1EZWA 1XICA 1OAQL 4N26A 4M3JA 1UMLA 3IJHA 5JA8B 1LEIB 4FXGA 1S7SA 2F5AH 1FTXA 3EYFA 4P5MB 2E5BA 4UFJA 1TZ8A 3F7JA 4GINA 2O6EA 5EN3A 2FB3A 1P4LB 5JNYA 3SDYH 3HG4A 3BRFA 2W79A 4JFXA 2YPLE 4KGJA 4ZOAA 4MMYB 1DVFA 1S7UB 5D1ZI 2EO7A 2AHIA 3MV11 3DAQA 4UQIM 4XOAA 1N64H 4H20L 4ALAL 1S9YA 1BEXA 4MS6A 1OF0A 5H94A 2H6OA 4FQLH 2Q8BH 1ZJHA 1TTUA 4TTGA 1YEDA 4F9PA 5D1XD 4KK6D 3RUGF 3WLWD 5LGJB 2X4PB 4GW5A 3LQZB 4ILSA 2NLYA 3GO1H 5CCJA 1X6NA 2CFFA 2DZWA 5H6HA 3NWRA 2Y2YA 4RRPG 2HQAA 4GXFA 3URBA 2O30A 4HBCL 4N5UA 3UZEA 4B27A 4WJ5B 4XVJL 1OCBA 5E6YA 2IH3A 3QPKA 1MCFA 2AJYH 1WAPA 4NENB 2LOEA 1WGVA 1ZT4B 3BO9A 4XWGH 2BNQD 3NOIA 3EXSA 4LRIC 4E9VA 4J39A 4YSUA 2X05A 2F74A 1LNUB 5AKSA 4YN5A 3MBXL 1OPGH 4K7YA 4GAYA 3V5OA 2M83A 4TVPH 4W9FC 5C0BD 1BQHG 3HS0C 2DSKA 1RUAL 2XRAL 3Q2LA 4POZC 2ICWA 3P6LA 3L9YA 4AHOA 2DMKA 2C3VB 2K70A 4NO5A 3BLKA 3AAMA 3ZKMD 4DPAX 4KX7A 3IXTB 2VM8A 3T6CA 1W5OA 1SW7A 4JM2C 1NCCL 2DM7A 3KS0J 4M7ZC 5B39B 3WYRA 4OZGB 2NZLA 4X4ZA 3DX1A 5LN4A 4M7JH 4JFQA 1RL1A 2QHRL 4PH6A 3O3AB 4YVPA 2OAAA 4Y9EA 2C1IA 3U36A 3IIPA 1G0CA 1T20B 3S37H 1U8IB 4QLLA 4FIRA 3WIFA 4FZEL 5JPNB 3QVAA 1DJNA 2VCOA 4A2MA 3M1CA 3H2OA 2VR4A 5I1GH 3DUSA 2ATAA 1LHZA 2X4TB 1R17A 4BK9A 3D69B 4HUMB 1DCEA 4KKNA 4EI0A 4A2RA 4FCAA 3KVQA 3ECUA 5J04A 4AM0Q 2C7UB 5F9WC 2C9UA 1UUOA 2Y7OA 4YIWA 1DJIA 2JKJA 1BHGA 1ODAA 3PBGA 1CCWB 2R9HC 1I1AD 1TSHA 2VDML 1U2CA 1WAUA 1KCZA 5EGRA 5CCZA 1QNRA 4ODXB 3OG4B 2BHYA 2ODHA 2QPEB 5DA0B 2W07B 1YECL 4DO5A 3WTVA 1ND0B 3DFOA 2EXYD 1SFLA 3C6SA 1WCQA 3QW3A 4CNPA 2HRPH 4JX5A 2OLAA 4I77H 4NZJA 4YSTA 4S2BA 2E6FA 3HCVA 4PBDA 3FQ1A 3AQUA 4I0PC 3NJJA 4KKPA 4CVZA 3IJ6A 3TV3L 2IWKA 2XU2A 4UBPC 3WHE1 4GY1A 2A85A 3MRIB 1B2WL 4L8CB 4UB9A 4L5FH 3B3IA 4N6QA 2I07A 3E0LA 2ICCA 4MMWA 2Q9OA 4AITA 2G3NA 3KAAA 2ZOTA 4DZIA 1ITUA 1NMBL 3UXLA 1I9IH 2XWBA 1BKHA 5DQPA 2H3XC 3F2DA 3KBVA 2P80A 3O0FA 5CGQA 1VZIA 4Z0XB 2NZIA 2OXHA 5LDUA 3P93A 3AXKA 1OSYA 4WEVX 4LLMB 4KZDL 1G7QB 2Y7LA 1HH9B 4AWUA 1E6OH 2I7OA 4HPOH 4F0KA 3RZCC 1Y0LA 1I7ZA 2DQIL 3ZTJG 2K78A 4XMVA 2E27H 4U1MB 4J9JA 2CLVA 4G6FD 5KJRL 2GSGA 2ZTKA 1TE1A 1VS1A 1UYWH 3VI3E 5SWZE 2YRZA 1QUNB 4DN1A 1UXWA 3LQAC 1BGGA 1YQVH 5DWUH 2R91A 3WJLA 5BRPA 1E9YB 3VTAA 4F58L 2E47A 4PRID 4B3ZA 3WKMH 3P84A 4AEHL 2EYSA 4YE4H 1OFOA 2XVGA 1JCMP 4TTDD 4QIUA 1N59B 2PMZA 4B3VA 4FXLA 4LOUC 2IOMA 1BWVA 3THML 4OZHF 4MFDA 3MLWH 4AE0A 2H6PB 3P4MB 2A2QT 2O9TA 3C8KB 2VZOA 1GHFH 5FECA 4NVTA 3EFDL 4MF4A 2IANB 4YFLI 1W1A1 1HQ4A 3LEYH 3AXXA 3PTDA 3H22A 5C9JA 2JIXA 3MOQA 2FZ8A 4RISL 3SGJC 5K59E 1FE8L 2O1AA 4F37F 1TVHA 4L18A 1NCIA 4GIRA 4LBRA 1ML0A 5GJMA 1TQXA 5CC5A 5EFFA 4WSJA 4ICCX 3MNVA 3TOPA 2FLBT 3DFTA 3M6DA 3AWGA 4N3UA 3NACH 4QLJA 1FFPA 3S8WA 4O5LH 4PLJC 3OR7A 4C83A 1S2VA 2CLPA 5FYLL 4H2CA 4AC7C 5DJYA 4GO6B 3EEZA 1MCNA 1DBKH 5A1AA 1M3UA 4C56D 4DO4A 4PJXF 4QRTB 5AAMA 1MXGA 1SVZA 2B9BA 4N28A 3H1ZA 1MXSA 2DJSA 4PJ5B 3P2DA 4ANVA 4J3UA 3T6XA 1QSFB 3TWBA 4C6IA 1TZIB 4NS0A 2F2KA 2XGIA 3VIJA 5BJTA 2Q01A 3CXOA 4LARL 1ZIBA 4Y4HC 1MI5B 4Z7VB 1FZOA 3BMWA 2F1EA 3AIRA 4O11A 5DS8B 4ISVA 1C1EH 1M3JA 1BBJA 3LS9A 4Q4QA 4Y16B 5SWUA 4LY8A 4ZB2A 4YSSA 2DQEH 2EDHA 3O6MH 3W7RA 3AHXA 4JBSA 1YDPB 1JCKA 5ADPL 5FV2A 5D71L 3BWSA 3VCNA 2D3VA 1NFDB 1OANA 3CFNA 3HGJA 2X4QB 4AH2A 3IAQA 4FNLL 4IIQB 3LCYA 2GFBA 2OO0A 4GAGH 4GG9A 3CCHA 3KFTA 2L7JA 3LA4A 1WFIA 2YD0A 1G1YA 1FWCC 3QTGA 2QULA 3HVDA 1JFXA 3MYPA 4BFIA 4L0PB 2YPLB 1BYCA 3CSTA 1ADQH 5DUPH 2UUDH 3FN3A 4CQDA 1B0WA 5ISZE 3B03A 3NQ7A 2Z8SA 1OY3B 4KESA 3MRPA 3N43F 2EILB 1R9XA 3S2MA 1V3IA 3E74A 2CBJA 3FSAA 2HT2D 3WJJC 4MAUL 5E4OA 4IBTA 5F89B 4APXB 2QJJA 2XVLA 5A2JH 4X80L 2Y5QA 3JWDH 3PNZA 3ES6B 3W70A 5BUPA 3S5LA 4MWAE 4C6OA 4HDIB 2R69H 4PCNA 3F6LA 2CPCA 1OZQA 4OY9A 2V0AA 1NDYA 1BGAA 4N0UB 3HBQA 5LIXX 2I57A 2A74B 1NCDL 3QXAA 4DESA 1Q1PA 3MLZH 4QQUA 1JN6A 4WKZA 1Z7AA 2B20A 2QELA 1HO4A 2ERJC 3TN0B 1PZ1A 5LAXA 3QV9A 2CLOA 1Q4WA 1YEJL 2OJPA 4N87A 4L3EA 2AJUL 2GI0A 4R96B 5E5MA 4HJUA 4NDMA 4X7TB 2QHAA 1T7YA 3SFKA 4XMKH 2OK0H 5K9OA 2HH0H 1Z6JT 1CGTA 4AQZA 3LRKA 1V0LA 3WSQH 3MODH 3WLNA 4ADUA 3T1GA 2X7WA 5IR1B 1ASOA 3EA3A 5LNDA 1MAML 3GD6A 1S7TA 4HUWB 4MQ7B 1XBXA 4P99A 5AOMA 2OLHA 3DX8B 3CTLA 4QHPA 2LAGB 1A3RH 1U5VA 2YC1A 4Q7BA 4H8UA 5BWFA 1G6VK 3AG4B 4PRNA 4NJKA 3HRZA 3WQ6A 1RJZA 3I3BA 2NQ5A 4UT9H 4X6DA 1YCSA 1YBQB 1O95A 4K9EH 5IB4A 2ZDSA 1I60A 1OAUL 1TB3A 4XP6H 3UYRL 3DVGB 2P8LA 3ZTEA 3EFOA 3PWUB 2DM3A 3SBWA 3BZ4B 5F1NA 2Q3AA 4MPKA 4K1GA 3GB7B 5FGCE 2J57A 5JORA 2VRJA 1E43A 1J9RA 1PDKA 1I1FA 4WY7H 4FLSA 4P7OA 4HU8A 4KEVA 3UY8A 4K2UL 1JFQH 1KGCE 1ZTXL 3B0VC 2H9AA 1FH2A 5A6LA 2QPXA 1IM3A 3SQLA 3N55A 2GGIA 1PZ0A 5CP3H 3UJTH 3EJQA 2Q7YB 3HZVA 3WF1A 3O6FA 3BPWA 1ZHNB 4F57L 4X2PA 1TVLA 1R3HA 4ORZC 3PFMA 2FUQA 4LPCA 1J4EA 4R7OA 3B9VA 4BF5A 2A9NH 2J43A 3MP3A 4M81A 3LIZH 4YHZL 3RPTA 4IBZA 2ZCGA 2Y7EA 2AJZB 1BLNA 4NXSA 3EWUA 4N2EA 5I6PA 3QO0B 3KZ8A 3QWRA 5HR6A 5FCZA 3D85B 5JPMB 4ZBJA 1F8TH 2CO7B 2Z8WC 1DIEA 3O7UA 2NQ3A 4WIWA 3IFPB 4LDCA 3LRSB 1U22A 5LIYX 3LRLA 2NNCA 2OOGA 3ARZA 2I16A 1XHGA 2CLLA 3OAYK 3FFSA 3ZM8A 5BV7L 5KG9B 2O61B 1M1SA 2WUBL 2VIRB 4J3OG 4GFSA 4Y4FA 2EHHA 3BIKB 4FD0A 3TIDA 3P9MB 1J8SA 3NZGA 3O1NA 2V0TA 2B7QA 1QEWA 4FOMA 4HUXA 4PJCE 1TV8A 4LLDA 5HA7A 5FSEC 1PUDA 3O3BA 3KCPA 5DU7A 3IMTA 2VZUA 5GZNC 3VE9A 4FHJA 5T3ZL 1IAII 2WWDA 3L1OH 4U1SA 4GT7A 3E49A 2BWGA 1N8IA 4BEIA 2FO4A 1EJWC 3P5ZA 1D5ZA 4PJBA 3GC2A 1Y7VA 12E8H 3VI3B 5SWZB 1HT6A 1BF2A 1GC1C 3KBMA 4EKJA 4MGXA 4PGCA 4PUWA 5D7JC 2O6CA 2DKUA 2QS8A 1B31A 3ZHFA 2XFRA 5AENA 2DT3A 4U5KA 3UG3A 4XCEA 1F3TA 5CJ5A 4W9TA 1W15A 2V63A 4OLWH 3QNYA 1HP4A 1AQHA 2NYKA 4RFOL 4KI5C 1F2JA 4O1CA 3TWAA 3G04B 2IQDA 1IC5H 1YMMA 2EKSA 4ONVA 4FFVC 3UPRB 5C86A 4L0ZA 4MNQD 4PJ5D 3WNKA 5LKYA 3F64A 5I15H 3V4VA 2G60L 3RDJA 4M8UA 5F72S 1QSFD 2OODA 4PUJA 1E6JH 3AYTA 2GSEA 2ESVE 3V5HA 1JCVA 2XWJA 3FU7A 4JANA 2HLFC 5EC2B 2P43B 1ET7A 5AVTB 2R39A 1T83C 4OIBA 2GTZB 5LBSH 3M4HA 2N7AA 4PIBA 2YPIA 3KR3L 3ZDXF 4E0CA 4Y16D 5DRNA 2PWEA 4H19A 5EH1A 2MCG1 1QASA 4HGKC 1E4XH 3PZGA 2X88A 3OKLA 3GMOB 3VE0B 4HH8A 5IREA 2NY5C 4LKCB 2O5XL 4C6EA 1RKRA 3RGBA 4V1DE 2TODA 4JNMA 4PRBB 5AW1B 4ONOA 5DQJB 3D47A 4N0FB 2EDXA 4DBUA 5K9JH 1T1XB 5EOQL 4F7CB 4HUUB 4FQQA 4QR6A 4JPVH 2YPLD 4BFRA 1S9XA 3RU8X 1ZE3C 2COVD 2DYPB 4DK5A 1SHXA 5FO9B 2P3ZA 5M5DA 3EWXA 4KKZA 35C8L 4W8AA 1LM1A 1YYMH 2K7QA 3AYVA 5F3HA 1NGZB 3QUMB 4D8AA 1U30A 2BSTB 1EO8L 4NKOA 2WO5A 3RLVA 4PS3A 1EGJL 1QZ1A 4RL3A 2Q8ZA 4YSDA</