2ZWYA

Alpha-l-fucosidase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural Basis of alpha-Fucosidase Inhibition by Iminocyclitols with Ki Ranging from Micro- to Picomolar
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 155
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zwyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zwyA01
4HA1A 1PX8A 1QI4A 3M46A 3T08A 2DPEA 1JYWA 4W93A 3WKZA 5I6SA 1HXJA 2BFGA 1ECEA 2CBUA 2PBGA 3AHXA 3NJ3A 3MI6A 3SCPA 1JZ8A 2AAAA 3WEMA 2VZVA 1UR2A 4B16A 2QF8A 1XRVA 4AZ5A 4W8BA 3HG5A 1JD9A 1B2YA 3VSUA 4UQ9A 1RD6A 1E0WA 3GXIA 5E6YA 1FP9A 3VD4A 1V3HA 1E9LA 3L4TA 1NP0A 1QI0A 3IJ9A 3F5KA 1UWUA 1HWWA 2OYLA 3S6TA 4D6DA 4OGZA 1UD3A 3B9DA 1D2KA 4PMVA 5FL0A 1XSIA 3WD2A 1V0NA 4D6JA 3MV01 1TFVA 3VGDA 2WMFA 2VR4A 4JFSA 3AIRA 1YQ2A 4D6IA 4PSRA 3I3EA 4JKMA 5IHRA 4TX6A 2Y8VA 3DHUA 1ISZA 1N82A 3TONA 2Y8KA 5CGTA 4UTFA 1MW1A 2HVMA 2X05A 4A3YA 4D1JA 3AMGA 3ZMRA 5A8QA 5A2BA 3OBAA 3ZT7A 1US3A 3MO4A 2C7FA 1J12A 1ZBKA 4AXNA 2WCSA 4W7WA 4S3JA 1XCWA 2YA1A 4F9DA 4KWUA 1QNRA 3PN8A 5I79A 5CQ1A 1K9FA 1ITCA 2YFOA 2PBOA 1K9DA 2RGLA 2G8ZA 4BCEA 4OUEA 1IV8A 4PMXA 5BCAA 3A22A 3BVTA 5E09A 4ATLA 1ODZA 3KZSA 1BVNP 1CGTA 2VX4A 4RE4A 5A94A 1H41A 5CSUA 3MKKA 1V3KA 1JIBA 4DO6A 5I77A 5CGMA 3WY1A 1MXDA 1JF6A 3WD4A 2WZEA 1ZBCA 2DT2A 5CPTA 3ZT5A 1LQ0A 1KR1A 5CZKA 3A4AA 3W6LA 3WH5A 4M8UA 3N17A 4AD3A 2CITA 1WDSA 1JZ5A 1WZMA 3GXPA 1XCXA 3S5ZA 3L2MA 4WSKA 4P8WA 5M17A 1TQUA 3VX1A 4HOXA 4AC1X 2WXDM 4A4AA 3WF0A 2GFTA 2PWDA 1HIZA 2D22A 2CKRA 2D1ZA 1DWGM 4L4OA 1E72M 3SUSA 1V0MA 3I3BA 1JG9A 8CGTA 2G3NA 3GXFA 1WO2A 1RP9A 1QWUA 4IISA 1SYTA 1I1XA 3EMZA 1OINA 1NOFA 1B9ZA 1JDDA 1UD8A 1R85A 5A1AA 3T0AA 4QAWA 1E4NA 4A3HA 5EB8A 1UWTA 1E40A 4NZCA 1QNSA 1QBAA 1UUQA 4S3KA 3VGBA 1V3IA 4Z2GA 1QI2A 1OD0A 4KGJA 4GI6A 1VBUA 3VVGA 4L4PA 3D4YA 3UR7A 5CSYA 4OBRA 3WY3A 3L4UA 3VIOA 1AVAA 1CXIA 3SCTA 1RP8A 1GCYA 1X6LA 3VD7A 3N18A 4ZXOA 2VI0A 2X0HA 3W25A 3HU7A 3AXXA 2XSAA 3CZJA 2WVSA 2CBIA 1UZ1A 3CBWA 2V3DA 3A5VA 4AIEA 4ACZB 3RCNA 1OT2A 4ZFMA 4DO4A 1H0GA 2ZWYA 2J4GA 2W62A 4NF7A 2FGZA 1CXFA 3VTRA 3ZQ9A 4B9ZA 3VMPA 3CZNA 2VT0A 1AQHA 2ZWZA 4X0VA 2IXUA 1H1NA 1E15A 3EYPA 5M03A 1VIWA 1I75A 1PJ9A 5DT7A 3AHTA 1X6NA 5JIWA 5CLTA 3PZGA 4GXPA 1FHLA 2DH3A 2GVYA 2WSPA 2PWGA 3D50A 4PMOA 4NZJA 2VURA 1M7XA 4J3UA 4QDMA 3L2LA 3GH5A 4J3XA 5A69A 1V6UA 3VKKA 4GI8A 2EACA 3BAJA 1K9TA 3HJEA 3L4ZA 3VDBA 1EDQA 1H0IA 3U5YA 2W4XA 2OWCA 1B0IA 3ARTA 1V6YA 3K46A 5CLWA 5I78A 1B31A 1WCGA 3D3AA 1WAWA 3A4WA 4W8LA 3TP4A 1E56A 2E40A 3AZTA 3HZ3A 3GYCA 1HF6A 4OOUA 1YHTA 3IK2A 3PHAA 3A23A 2X2IA 1JDAA 3N9KA 4J27A 2E0PA 1CTNA 4CD6A 4FNSA 5AC5A 5JUVA 3H55A 1WDPA 3UCQA 4EAMA 4FLQA 1X1NA 3FY1A 1LWHA 1L8NA 3EJTA 1HVXA 4M56A 1CECA 4TVUA 1GOOA 3UG3A 1HP5A 4HMDA 2WKLA 3UEQA 1C92A 2EPNA 3AS2A 4D72A 1VF8A 1WDQA 3ZM8A 3WDPP 4PTMA 3A47A 3MUY1 1FFRA 2ZE0A 3VIKA 4GZEA 2BS9A 1CIUA 4LYRA 1J01A 2W5FA 2DSUA 3IAQA 1G5AA 2VVSA 2OLHA 4YN5A 1E4MM 3RJYA 1EXPA 2BXZA 4FNRA 4FNPA 3VO0A 3LMYA 4DUXA 5JBFA 1JYXA 2EJ1A 1QNOA 3OGVA 1CXKA 3O9NA 4JAWA 1JF5A 1HJXA 2FDMA 3QHOA 1WKYA 1AMYA 4Q7NA 1ESWA 2PI6A 3I3DA 2NW0A 2DH2A 1BYCA 4Z2JA 3MS8A 3GXNA 5BWFA 1W3KA 2DGAA 4CD7A 4HPGA 2WMIA 4AEFA 1PPIA 2J7DA 3HMCA 1B1YA 3RM9A 2Q8XA 5A2CA 5ABEA 1H4PA 2BNJA 2F7RA 1BGAA 3L4YA 3LX9A 1DWAM 1G01A 2VO5A 5D9PA 4AZ6A 2EXOA 4IPLA 3OLDA 3W38A 4H8HA 3OZPA 1OBAA 3CZ8A 1CPUA 5A6AA 2UY5A 4GO9A 4HA3A 2BVDA 4Z2IA 2CNCA 1IT0A 1VJSA 3RILA 3AOFA 3OGSA 1H2JA 1TR1A 4CKQA 3ALGA 3CZKA 3GZAA 1QW8A 3M7SA 4C7FA 4MTVA 1EO5A 1W1VA 2AMGA 4IM4A 1J0YA 2J7GA 2DQXA 1ISXA 4C7DA 1HXKA 5EBAA 1QBBA 1BYDA 5BROA 3BVWA 5HPCA 1DWJM 4E2OA 4UFJA 1GHSA 4CGTA 5BRPA 4DWSC 1OSEA 2WNWA 3WBEA 3WUFA 3WF1A 4V2XA 4KH2A 5AYIA 4D71A 2VUYA 2V3EA 1DTUA 3OLIA 3W28A 2GSJA 2BHYA 3WEOA 3VUPA 1B3XA 1ISWA 1V0KA 4QFUA 4NRRA 2ZUVA 4Z2KA 4YHEA 1CGYA 4CCDA 1HL9A 1BYBA 5FL1A 1QNPA 3VX0A 3BAXA 1A47A 4UQAA 3WQ8A 2EPMX 2WHJA 3VINA 4U31A 3DC0A 1LWJA 2YA0A 1Q6DA 4AZBA 2RGMA 3PTQA 3DX4A 2EAEA 2J79A 3CIVA 1QHPA 1C7SA 4UOJA 4H41A 1KWKA 2A3AA 1PEZA 2GK1A 2VX6A 2FH6A 4YHGA 3AIBA 4AIUA 1E73M 4BQ5A 5D8ZA 1JFXA 4DWSA 3BCDA 2WPGA 1JZ7A 1CLXA 4UQEA 1E1FA 2BHZA 5D9OA 4MB3A 3LRMA 1H5VA 1HP4A 3NSXA 4P8UA 1MWOA 2YDSA 3GXMA 1D7FA 4MB4A 4AZGA 3ZJKA 3VSTA 2WM0A 3VNYA 4HPHA 2XM2A 3UETA 1US2A 2CXGA 2PWHA 3GBDA 4TUFA 3EMCA 4NRSA 4TOQA 2DDXA 3SCQA 3WQ5A 2OW7A 2W63A 3UR8A 3GH7A 5F7UA 1VFMA 4PUDA 1U33A 4JZ5A 3W37A 3ARXA 4HZ7A 2XIIA 1E6QM 3WY4A 3A4XA 3AMKA 4GIAA 1UWSA 3N12A 3AFBA 1UD2A 1EDTA 3AS0A 1WE5A 1MQPA 2JEPA 3W82A 1FH8A 2WW5A 3ARSA 3VIHA 2Z1SA 4QLLA 3OLEA 2VZSA 2QPUA 3VIGA 2NSXA 3PTMA 2X09A 1JYVA 5AY7A 5M5DA 4PMZA 1AQ0A 3IANA 1R47A 5TD4A 5C70A 1EA9C 2OYMA 3BC9A 1KQYA 1OIMA 1R46A 2J78A 5A3HA 5BXTA 3VGHA 1W9UA 4B3LA 4UFKA 2JF6A 1PX4A 3BMVA 3ZO9A 3WDHA 4P7LA 4AZHA 3LPFA 1ODUA 3BVUA 1UR8A 1QW9A 2TAAA 4D6GA 1R8LA 4TX8A 3AISA 5I23A 2XVNA 5A6KA 1TCMA 5EMYA 3WUEA 2PB1A 1XHGA 1FA2A 3RMEA 3TTYA 4CCEA 1VEOA 4AZCB 2VTFA 2WMKA 4CCCA 5DMYA 1Q6FA 4TTUA 1UWQA 2YJQA 1W32A 3WNMA 4ZEPA 5KZ6A 4UQCA 5IDIA 4EKJA 3UERA 5IHSA 3PZNA 2BY0A 2V5DA 1J0KA 1KQZA 3FXYA 4LPCA 4MNMA 1HJUA 4JKLA 2V3GA 3G6MA 1UHVA 2EO7A 4RL3A 4PMQA 5BXSA 2J8FA 4PCSA 3GDBA 4AZIA 3WDQA 1R7OA 2G3MA 2Y4SA 2BV9A 2BHUA 1J11A 4B3KA 3VD5A 3WF4A 3N15A 3SCSA 2VQTA 1GOMA 1E4LA 1JDCA 4WIWA 1UKQA 3CZLA 2OW6A 5I24A 3CUIA 4PBGA 5ABFA 1SZNA 3VILA 4CU8A 4NZFA 3BAIA 5GPRA 5EFFA 3BSGA 1EHAA 3QOMA 5FOOA 4UQDA 3CUHA 3APGA 5CXPA 1M04A 1OGGA 3BLBA 3BSHA 3WQ6A 5HNNA 3ARZA 1CBGA 1BYAA 2X2JA 3AIVA 1M03A 2WB5A 3OLGA 2X8RA 5E70A 1CGVA 1GORA 1D3CA 3AROA 1KWGA 1UG6A 2OYKA 1C7TA 3ZJ6A 3BAWA 4P8XA 2ZUTA 3F4VA 3WL1A 2WBGA 2CBJA 1HKKA 1PIFA 2XJ7A 3VDAA 2D20A 3NSMA 1HVQA 3F5JA 3BH4A 2BY2A 3MSDA 5EFDA 1KXTA 1OWQA 3RPMA 3ARPA 2GDVA 3SURA 4MJ4A 3LXBA 4M24A 2WZHA 1XSJA 2W67A 2CIPA 2GJXA 1V3LA 4XV0A 3BUQA 4RE3A 1H3GA 1C3FA 3BLKA 1QI5A 4GQRA 2EQDA 3CC1A 2ZUMA 1AQMA 2QLYA 3ECQA 4DWSD 1JZ6A 1E55A 3AHYA 1HL8A 4H7VA 2WKGA 4PMYA 3CUGA 4KMQA 2CYGA 1V6VA 1KR0A 3IAPA 1BPLB 1R34A 3CLWA 4ACZA 2J7EA 4W88A 3AIEA 5D9NA 2D23A 3KL0A 3W4RA 1HKMA 3W29A 2WVVA 3D52A 2VCAA 2WK2A 4CD5A 3GXTA 2XM1A 3TTSA 1VRXA 4JCLA 4PTXA 5M3WA 3WMBA 1UZ4A 4U2YA 4WF7A 4MNLA 3TOPA 1MQQA 2Y5EA 1JI1A 1GOKA 2VCBA 4BS0A 4F9JA 4H2CA 1J18A 2QPSA 3PZUA 1W9VA 5CPQA 3WH9A 4X9YA 1EH9A 2DEPA 4HU0A 2AOSA 4W8AA 3GBEA 4ACYA 3ZR6A 5IXEA 3VIPA 1B3VA 4UNIA 5KEZA 3NUKA 4PRWA 3TV8A 1OGBA 4LX4A 4WK9A 1VBRA 3IJ8A 1LG1A 3L4WA 2XN1A 1W3LA 3KWXA 5ABHA 2D0GA 3ZSTA 3K4AA 2ZIDA 2O9OA 3SUVA 2D0HA 3NDZA 4UCFA 2DT0A 4AD0A 3AXHA 1V02E 2BVTA 5A6BD 2CCRA 4AEEA 1E6XM 3WL0A 1MFVA 1W9DM 1R33A 3DX1A 5GNZA 1HKJA 1CEOA 4E8CA 2VZTA 3VDHA 1NWUA 4M29A 4WKHA 2XUCA 4DM1A 2WMGA 1DWHM 1K6AA 4JL1A 2E9MA 3WENA 3WELA 4AMWA 3GNPA 1OT1A 3W53A 5FKYA 2FHCA 3WMCA 4PCTA 2O9PA 1J0JA 1XD0A 1GW1A 2QMKA 4UZUA 3WEZA 3CTTA 1W91A 1WPCA 1JFHA 2J8GA 4W87A 2ZXQA 2XWDA 3W6MA 2CEQA 4WLCA 4OJYA 2YFNA 1VFOA 2EPOA 2E3ZA 1GUVA 1EHNA 3VM7A 3AS1A 3W0KA 4D6CA 4J3WA 4P8VA 3ALFA 3L4XA 4NI3A 5I0DA 3AIUA 4AD4A 4BF7A 3KL5A 4FMVA 1XSKA 4CU7A 1SMAA 1SR0A 2WVTA 3RDKA 2XN2A 1W3JA 3VMNA 4TVCA 3RO8A 1F4AA 1T0OA 1MFUA 1JYNA 1E43A 4CVUA 2FHBA 2O9RA 3BUIA 1E6RA 1UYQA 1LL7A 1HJQA 1V6WA 2C8NA 1XH0A 1V08A 2XGIA 1TA3B 3BMWA 3A3HA 4P7OA 1XYZA 2VNCA 2X0YA 4BQ4A 3WFZA 3WNLA 1VFFA 4K68A 4PSPA 1R7AA 4JFWA 7CGTA 3KL3A 1UQYA 1E71M 3H54A 3A24A 4JCMA 3ARRA 3DX3A 1KCKA 2X1IA 3SUUA 4BQ2A 2J7HA 2MANA 4OOZA 4BZYA 3N11A 3HG4A 3T09A 3LPGA 4W7VA 2HISA 1GQLA 2WYSA 1MW2A 2ZUUA 3F5LA 3VGGA 1OD8A 4JHOA 5FD0A 2ESCA 2VZUA 3U5UA 2XN0A 3BXWA 1KGWA 4PTWA 2ZUNA 1XV8A 2DT1A 4J3SA 1TUXA 1XD1A 4CN6A 3VGEA 1SFSA 1ZL1A 1W1YA 3EJRA 4AYGA 3OG2A 1TG7A 2E8ZA 2A3HA 3ZIZA 3BLPX 2J47A 3MUIA 1UA3A 3VIFA 1Y7VA 3QOKA 2W61A 1GPFA 3D51A 1P6WA 3WBAA 1WDRA 3KE0A 2YA2A 1PIGA 3QGVA 2YBTA 2FYVA 1UWIA 1WZAA 1KTBA 3OIHA 1NQ6A 3E1F1 4UFMA 4J28A 2YOCA 4PMRA 2DSVA 3WF3A 5I2UA 4AD2A 4PMNA 2DSZA 5E9AA 1HT6A 1UOKA 2E9BA 5HDRA 3O2LA 3EBVA 1BVZA 4W89A 3T2QA 3W26A 2X2YA 1UKOA 1LG2A 3D5HA 4ATWA 3AQUA 4R27A 1CXHA 1QPKA 4QCFA 2YLLA 4URIA 1UD5A 4PEEA 1EQPA 3AICA 2VQUA 1DWFM 3THDA 4CD4A 1UKTA 4AWEA 2JEQA 3PZQA 4ATDA 4OIFA 1SMDA 2YL9A 5C71A 3MMWA 3K4DA 3GNRA 2DT3A 3SCWA 2XIBA 2VX5A 1K9EA 3DYPA 5DEZA 3AMCA 4F8XA 3FHQA 3MUAA 4B15A 3AZRA 4Y7EA 2WWDA 3FN9A 5A8NA 1EDGA 4W86A 3RIKA 1GNXA 1E6NA 2VCCA 1UH4A 5HBFA 1GOWA 1TQWA 1VJZA 4DUVA 1WB0A 4H04A 3EDFA 1CXEA 4U33A 1H49A 3WNPA 1J0ZA 2VL4A 2WMIB 2CHOA 1MXGA 3EDKA 4AW7A 3CZGA 2VRKA 3AHZA 1UR0A 2BXYA 4FLRA 2IGTA 2WWCA 3BVVA 1FP8A 1R86A 2NT0A 1W1TA 4PUEA 2ZXAA 4F66A 3N04A 1G1YA 4GZIA 4W7UA 5FIPA 3CO4A 1VAHA 1C8QA 4D6FA 8A3HA 4HMEA 1EO7A 1BG9A 2FHFA 1B3WA 2OSYA 1DP0A 1VENA 4QLJA 4C7GA 3RJXA 4WKAA 1V0LA 2PWEA 5C8BB 4BQ3A 4J3VA 1ISYA 4MAZA 2JIWA 1QWNA 1LLOA 5E1QA 1GJUA 2BVYA 2W92A 4U2ZA 1E6PA 2YKKA 3LRKA 1V3MA 3EDJA 1GQIA 3ARVA 4JL2A 2A3CA 2JF7A 2W66A 2YLAA 3M6DA 5LA2A 5GNYA 3CUJA 3WF2A 5JIPA 1C93A 1WZKA 2ZUSA 2V38A 4AD1A 1QHZA 3W27A 3W24A 4HTYA 5IFPA 5DT5A 1C8YA 2PWFA 4JKKA 2ZX6A 4AIOA 2XVPA 2BY3A 1OGSA 3WDJA 1HTYA 1VB9A 1CXLA 2G3IA 3AIQA 5JBDA 4FLOA 1BFNA 1GZJA 3W81A 5JBEA 1FOBA 1HNYA 2ZXDA 2CBVA 1JNEA 1ZB5A 1U2YA 2VR5A 4AZCA 3WY2A 2EADA 3PBGA 2CPUA 3AXIA 1BHGA 3PZIA 3A6OA 2F1AA 2E9LA 1O7AA 1KXHA 1J0IA 2ZX5A 2XSBA 3SUTA 3ZJ8A 2XTKA 2G41A 3EMQA 3N13A 3ARQA 4NX0A 1UD4A 1BSIA 3T2PA 1J10A 1TE1A 3VD3A 1JGIA 3B8SA 1MVYA 3K8LA 2UY3A 3POHA 5FCZA 5LA0A 1TQVA 4KRUA 4ZXLA 3DDFA 3KLKA 1JD7A 2WLZA 3ZOAA 3WNNA 3TTQA 4TVDA 3WDRA 1UD6A 5A6BA 3T0DA 4PN2A 2VMFA 2D24A 2J25A 3KEHA 3VNZA 1EQCA 1VFUA 1HX0A 3WH7A 3EDDA 1FFQA 4U5KA 5AYBA 5A6MA 5E0FA 1E0XA 3VGFA 1C90A 3QHMA 1QNQA 1NP2A 4Z2HA 4W85A 1EGZA 2W91A 4UFHA 1J0HA 1CGXA 4B9YA 1GVYA 4PMUA 3LXCA 2WHMA 3FAXA 4H8VA 4E4PA 1QX1A 3OZOA 5E6ZA 4NXSA 6CGTA 4U5IA 2WZIA 5AC4A 1O7DC 2YL8A 4HOZA 4W5UA 1M01A 3LRLA 1V3JA 3AHVA 3CHEA 1PZ2A 3WIJA 3U7VA 1EOKA 4CN4A 1IZJA 1KCLA 1UASA 3WUBA 3SCNA 4CVWA 2VRJA 2VRQA 4FLSA 1NARA 4J7RA 2D0FA 1W2VA 4YPJA 1A3HA 4NSBA 1ZJBA 3UG4A 3MMDA 3N1AA 3BAKA 1XH1A 3A21A 3WNKA 3AIWA 1CYGA 4EK7A 3CMGA 3ARYA 3II1A 1GONA 4GPNA 4PYSA 4Z2LA 1KXQA 2VC9A 4OBSA 3CV5A 3HG3A 1B3YA 1G9HA 1PBGA 4FNUA 4IUGA 2J7BA 4P7NA 5D9MA 1MW0A 1LL4A 1UWRA 4TTGA 3J7HA 2F2HA 1CENA 3S2CA 1OB0A 2PF0A 1KXVA 4M81A 4U3AA 2WC4A 3TA9A 3U57A 2XPKA 3VDCA 1DHKA 4DM2A 2FH8A 1HJVA 4MJ2A 4XZWA 2NT1A 3LPOA 1E1EA 4E8DA 3MV11 2O9TA 4HP5A 4UZSA 4MPKA 3FW6A 2ZICA 4UFLA 1L0PA 3GNOA 3T2OA 5HOSA 1GOIA 1NWSA 1PS3A 1C91A 3SCRA 3BUDA 5GNXA 2VVNA 4UFIA 2XWEA 1EIBA 2WANA 2F7PA 1CWYA 4HZ6A 1NOUA 2ZXBA 4LXFA 1BTCA 3WD3A 5ABFB 3WD1A 1NH6A 1UKSA 2VX7A 3AYRA 3SCUA 2OSWA 3MSGA 3AYSA 4Q22A 1LL6A 1WZLA 1G94A 2D3NA 3TTOA 1GQJA 1S46A 1XC6A 4LQ1A 1EOMA 3B9EA 5CPSA 1TMQA 1UR4A 2XVGA 3MUZ1 1KB3A 3CZSA 3L4VA 2J7CA 5CJ5A 4GO8A 2JFEX 4N0RA 6A3HA 1CZ1A 1QOXA 3GXDA 5ABGA 4HU8A 1V03A 4QLKA 2QMJA 2F1BA 2IUZA 4KGLA 1B30A 3VD9A 4JFTA 4ZE4A 2ZOXA 3DECA 4ML4A 4BA0A 1TQSA 2B31A 2F7QA 1ISVA 4OZOA 3THCA 4DUWA 1ZBWA 4MB5A 4CD8A 1ZS2A 1LF1A 1W1PA 2UY4A 3WQVA 2YDQA 2OWXA 1KGXA 3OA5A 5BRQA 5BXRA 2XHYA 2VJXA 1FH9A 4W84A 3BUPA 3QHNA 3LXAA 3UESA 1JL8A 3WD0A 5A6LA 1R87A 3MU7A 4U3CA 3WUGA 3CH9A 3AS3A 7A3HA 2DSKA 2YDRA 2GJXB 2Y24A 5GQBA 3JUGA 1Z32X 1UH2A 2WLYA 5A8OA 1Q6CA 4M1RA 4HMCA 4AZ7A 2XVLA 1PX3A 2O92A 2WCAA 3S5YA 4UOZA 2XFRA 4W5ZA 1BQCA 3CHDA 3K8KA 2WVVB 2YL5A 2F7OA 1NWRA 3OB8A 4JIEA 3WH8A 2G3JA 1JNDA 1LJYA 3LPPA 3CMJA 1VEPA 3WQ4A 5A6SA 1QHOA 1E70M 2CKSA 2WMHA 3O6AA 1QI3A 1NOWA 1TA3A 1QVBA 1UH3A 1H11A 3VIIA 1OCQA 2GDUA 1JZ4A 1ZJAA 3AMLA 4P7RA 2EPLX 4GINA 3OGRA 4F79A 1JZ3A 1OIFA 3M07A 2J77A 3WMSA 5LA1A 4PTVA 1TVNA 4QCEA 2WSKA 4RE2A 3VSVA 5ECUA 4MDOA 1W9XA 3POCA 2F61A 1E6SM 4MAVA 1CLVA 2X2HA 3VM5A 3GM8A 4CN1A 1FHDA 2IXVA 3MMUA 4JFVA 5A6JA 2Y2WA 4X0NA 2A3BA 1B3ZA 2XFFA 4QP0A 3SUWA 4EANA 5HPOA 4V27A 1KBBA 4PMDA 5D8WA 4XZBA 1RPKA 3SEPA 2WMJA 2ALWA 1HJSA 1JAEA 5DF0A 4MNKA 2J74A 1Q4NX 1Q6GA 3BVXA 4TXEA 4UQBA 2QV4A 2WC7A 4XB3A 1HKIA 3WDIA 4GZJA 3HN3A 3CZEA 2PC8A 4V28A 4FF5A 3FHAA 4M80A 4XX6A 2CESA 3CGTA 2GJPA 1WP6A 3RM4A 3VIMA 3CUFA 2EEXA 1W2PA 3PTKA 2J75A 1NM9A 3EJQA 2YL6A 1VEMA 1O6IA 2CHNA 1V6XA 1W3HA 2C0HA 4FK9A 1BAGA 4UR9A 1E6ZA 4CU6A 1E5JA 3VPLA 1E3ZA 3DDGA 3IJ7A 1GHRA 2UWFA 1OM0A 3WNOA 1TQTA 2QHAA 2WCGA 3WSUA 3H53A 2JE8A 3WQWA 3DYOA 4N42A 2E8YA 3PZ9A 3U7BA 1PAMA 4WJXA 5A8PA 6TAAA 1W9PA 3IGUA 3PZMA 3UG5A 4D1IA 2XVKA 3CHCA 2GUYA 4D6EA 2V3FA 1J9YA 3SIMA 5E0CA 2Z1KA 1UA7A 1GOQA 2BY1A 2A3EA 2E4TA 4MDPA 2OWWA 3RM8A 4AYSA 3AZSA 9CGTA 3ARUA 2WC3A 1XGZA 2DIEA 4ZENA 5DO8A 1F4HA 2FE0A 2GJRA 3BAYA 1KFWA 5BXPA 4XUYA 3FNDA 2EABA 1M53A 4GI9A 2WAGA 3DYMA 1CGUA 1E5NA 3K1DA 3K8MA 3ZR5A 1GQKA 7TAAA 1MQRA 3EDEA 4MNJA 2J7FA 4MADA 3BCFA 1DEDA 3NDYA 4HZ8A 3VU2A 5I5RA 5IFTA 3B9AA 2ZX9A 1KGUA 4HA4A 3ZT6A 1E4IA 2WVUA 3VOCA 2D3LA 2YIHA 4LYQA 1GJWA 1RH9A 4P7QA 2G4FA 1HJWA 4AY1A 1BF2A 3DX0A 1Q6EA 2JALA 2WHKA 4EE9A 2XFYA 1E3XA 3NYDA 4AMCA 2EPKX 1JXJA 1ZU8A 2ZX7A 2CERA 1TZ7A 4MB1A 2DIJA 2F18A 1CDGA 1CGWA 4FNQA 3CPUA 4UOQA 1V02A 5HXMA 1C8XA 1FH7A 2EBNA 1IZKA 2D73A 4HOWA 1BLIA 5A95A 1NWTA 2XGBA 1HN1A 3ZJ7A 2VOTA 1H09A 3SCVA 2UY2A 3BUBA 4D6HA 1MYRA 3EJPA 3G6LA 1E0VA 1R75A 5LYRA 1CNVA 1XYFA 1MW3A 2JIEA 1WNOA 2XG9A 3NSNA 4OKDA 3PZVA 4LGXA 1GVIA 5A2AA 3ARWA 4CUCA 1I1WA 1PZ3A 5BYWA 4GKLA 1JZ2A 1KBKA 4AMXA 4IPNB 5I3DA 3EJUA 3AI0A 2CETA 4ZE5A 4JFUA 3VIJA 3WFLA 3SCOA 2XYLA 1UQZA 3NCOA 5A8MA 3PZOA 3QR3A 1ITXA 3D4ZA 4M82A 1ZBVA 2D2OA 2J62A 4KRTA 4NXKA 1W9BM 4GQQA 4WSJA 2WHLA 1JAKA 3DHPA 3HG2A 3GH4A 5DFAA 2F8QA 1UR1A 2WBKA 1UKPA 1B90A 4FNTA 1JI2A 4AISA 2YBUA 3PZTA 3FAWA 2ZUWA 3VMOA 1JXKA 3AMDA 4H8UA 3KLLA 5CG0A 2GK1B 4WKFA 2DSWA 1UR9A 2V5CA 3DX2A 2OSXA 3GTNA 1BG4A 3WH6A 3ZSSA 3NIYA 4DWSB 3AJ7A 3EJSA 5D4YA 4J3TA 2VZOA 1G0CA 4DO5A 1XH2A 1U30A 3BGAA 3MANA 4AD5A 4LYPA 1TVPA 4R5EA 3T0BA 1KTCA 2ZX8A 2FGLA 4JHZA 1BGGA 1DWIM 3WN6A 3CHFA
chains in the Genus database with same CATH superfamily
1OV8A 5JW3L 2KLRA 1NLDL 2DM3A 5IFAL 4R7OA 2F8XC 1WAEA 2IPTL 1WUNT 5E5LA 2YKLL 2OYLA 4MQTB 4MFEA 4KUZL 4NOBA 2PTWA 3HAEG 2I27N 2WMFA 5F1UA 4RV3A 3NIFE 3M4HA 5CEZH 4NN5B 5A43C 2F5BH 4JFYA 1W0VA 4FA6A 1H61A 1FL3A 3ZMRA 4UQ2A 4BK5C 3QI9A 1US3A 4G7SB 3DMMB 3KPPB 4PYHA 5LBSA 3CXDH 4ACTA 2EECA 4GSUA 3SOTA 4RISL 3PFUA 1IGCL 3S7GA 5BCAA 5ANHA 2YPKA 4OM1L 4QGCA 2VM8A 1P4BL 3UXDA 1GKRA 3KZSA 1BVNP 1T03L 2AMXA 3W7CA 3QV6A 3WD4A 2E7LC 5BXFB 4TSCH 1NCGA 3D30A 1UP3A 3RU6A 3HE7A 1OAXH 5EOQL 3EYQD 4QX4A 2N4IA 1FFPA 2XQ0A 3NJFA 2WXDM 3EWXA 5GZOA 3D39E 4AYID 2GCYB 4BA8A 1EYWA 3QKZA 1RP9A 2L7QA 5JR1H 1IVLA 1EQWA 4JKPH 1JDDA 5EH1A 4M6QA 3VFTB 1Q13A 1UWTA 4K3EH 4XAZA 3IDYC 1UC4A 1ASOA 2Y7NA 2ICES 3BVNA 1SJDA 3MO1A 4IW4C 2J8OA 4OBRA 3CC5A 1EZVY 3TJIA 1FFNB 2C13A 3SZ6A 1CXIA 1VESA 2PYEB 4MNHB 5LHDA 5J11C 4N2CA 3II3A 1O7SA 1XGRB 1JCKA 3EFFA 4PTNA 1IAIH 4L8SB 4NZUH 5DS8B 4GAJL 4PB0L 5DS2A 3ZDXB 2A1WL 3EX6A 3ZQ9A 1BPVA 3HA1A 3CFIC 4WZHA 5DUMH 2DW6A 5M03A 3PBYA 1DQUA 4HUNB 2GVYA 2SFPA 5CKSA 3FFDB 4XH2A 2RQEA 1JHLL 4MMYA 2FJHA 5DK0B 1OW0A 1T5XA 1O94A 1MFEH 1CI5A 3O2WH 2OWCA 4NYUA 3WUWB 3I50L 2R2BA 4FERA 5I78A 2XFWA 1V79A 4U7MA 3RP1A 1TPDA 4JEJA 3P7YA 4E3TA 1QFWI 1YNLL 4RDQF 4PJ7E 4I85A 3HJZA 4NZTH 3FTWA 2I7GA 1FO0A 1Q72H 4HGMA 5JUVA 3VI4A 2VGIA 1OTSD 1T21B 1WAUA 4FLQA 3FY1A 5GJSH 3HHSB 3GTFA 1KLFA 5EUKB 4LHQB 4A3UA 2X4SB 3CVBA 4P2OB 2X70B 2X9YA 2YPLD 4FTDA 5JDSA 1KBIA 4JM4L 1M7JA 4KBXA 2ZE0A 3H4FA 3WN5A 4GZEA 3TPUA 2DLTA 4Z1AA 1DUYA 2OL3A 1N10A 1KRAC 3QQ1A 5D6CA 4Y90A 2EJ1A 4X80H 1GZHA 3K2IA 3QQDA 1VCAA 1RULH 5EN3A 3M41A 4FI7A 5DRNB 4Z2JA 3V7PA 3PHOB 3WIAA 1H7PA 1WA2X 2C0AA 1H4PA 2XWRA 2BNJA 1YA5A 4F3HA 2HJKA 1G01A 5FJUA 2N7BA 3W57A 3TA3A 3K0YA 2JJTA 5F7YC 5FFLA 1QLFB 3L5HA 1TR1A 2AW2A 4HUMB 1ZS8B 2J5LC 3E5BA 2QFRA 5CP3H 1HOEA 3B3IB 2R1YA 5KJ7E 1NGXB 3QXAA 3BVWA 2E76C 4FL4C 4NC1E 1IC7H 5HPCA 4E2OA 3O0RL 3TO4A 2B39A 4D71A 1LQ2A 4R85A 2R7EA 3D39B 3VUPA 1GHFL 4AC7C 4G42A 2IALA 4Z0XB 4EXBA 3S5LA 2WHJA 3WNJA 3U46B 3PTQA 2YW3A 3JZYA 3UROR 5DD1H 4YHZH 3FCBA 4ENED 2FL5B 3BCDA 1JZ7A 3BUYB 4XAGA 4JGNA 4UQEA 3DSNA 2BHZA 1AO7B 3MRQB 1C5DA 3PPSA 2DL9A 3U2SA 5IMLB 4LARH 1G7PA 3D09A 4AK2A 4JIPA 3W71A 5K2ZA 3QZWG 5DMLA 4KO5A 4HHAB 5AZ0A 3JV4B 3RGTA 4JS3A 1K2DB 3GH7A 2CRIA 3RX8A 1UD2A 1DDTA 3UWQA 3NPZB 5FAGA 4Q0XL 1TVDA 3AT0A 5AY7A 3NTYA 5CBAA 3TNMB 4OIAA 3SE3C 3QPZA 2J1KA 1I1FA 3UPRB 4ZOEA 3TBYB 1TCDA 3LPWA 5C54A 2VN5A 3IDXH 3S5NA 2P10A 1LE9A 1RHCA 3F2LA 5L2JA 3GIVA 1QW9A 1OTTD 3QXDB 3VXTA 4E3VA 3IVKA 3WLIA 1VPOL 2WYTA 3WBYA 5DJDA 2ALRA 4PJ7B 1F2JA 5C6WH 3V0GA 3W75A 3UTQA 4HH9B 3O4LE 5IHSA 1D5BA 4ZQTA 2PRLA 3WHE1 3SGZA 4HEPA 2PPGA 4QSHA 3HKFA 2WQXA 4AZIA 3M45A 4NEHB 5IBUG 1AGDB 2Y7EA 3ILPA 3BZJA 12E8H 4NGHL 1B88A 3LCLA 1KJMB 1Z5LA 4CSTA 1SZNA 4JHAL 4I5XA 4WI8A 1H63A 4IH3A 4O11A 4PGBB 4JIHA 2DUZA 2BW5A 3E80A 4Q4KA 4S1DC 4FZ8H 3TURA 2PDCA 1DTNA 2QUVA 5I1GH 1W31A 3B8UA 2RQ8A 4BEQA 5BRBA 2OYKA 1C7TA 4PBWD 4H8WL 4KITB 3QVAA 3QSKB 1ZE3C 2GFBB 1HKKA 1W1ZA 3VDAA 1JV5B 1F97A 3ZZLA 1RQBA 1KELH 2QPXA 4G7EA 5C7VA 3C8HA 1ZLSL 4Q14A 4GS7C 3S3BB 1MFBL 3L1GA 2F54D 3HOJA 2EQDA 4X42A 2Q8BH 4ODWB 4TS6A 1BPLB 1WAAE 3U4EB 4HWBA 4HJUA 2RD0A 3RWDB 3QCVH 4AUJA 5H6HA 2B9BA 2VCAA 1TTCA 4GRWF 4F8NA 3FO0H 1J5CA 4NYYA 5EEVA 1IC4L 1J5SA 1JQXA 2ERJB 1Z48A 2OODA 2ZYIA 4U2YA 2CE6A 3GIPA 5KW9H 5IMKB 3MODH 1A6WL 2VCBA 4XPAL 1QFEA 4O13A 4IOFD 1CQYA 1T2JA 4M62H 4W9ZA 4AH7A 3PG9A 4IIHA 1U8HB 5IXEA 1XDJA 3D0CA 5I16B 2V5LA 4WR3A 2Z6FA 3WJYA 4PBVC 1S1PA 4FEMA 4ZOCA 4P4KA 4NLAA 4KO9A 5I03A 3C09C 4MNGA 2CCRA 4ZQPA 1MZZA 4UDTB 5T3XL 2ORBH 4P2QD 4O2EA 2WIIA 4O1BA 1HKJA 2NVDA 2XKNB 2EDYA 3R4RA 1ZENA 3C5ZA 1U8OA 3U7YH 2HX9A 3FKUS 4HBCL 4G9PA 5E4IA 3GNPA 3OVUB 2OMWB 3WMCA 3WNIA 3HE6D 4DZIA 2DL2A 1DVZA 3L3OB 2MNUA 3KOZA 4QQUA 1SXAA 1YE4A 5E8PA 3AABA 4Q8VA 4L3CB 3QJVB 1UURA 6PAZA 1DFBH 4Z7OE 1T5KA 5MERB 2APBA 4LF1A 3MY9A 3W7RA 5HDWA 4U7KA 4I9MA 3CVHH 4LVHC 2B4CH 4UTAA 3WJJC 1FNEB 3PRZA 5DEGA 3A3HA 4LSBA 3D06A 3MPGA 2QV5A 2AHIA 4UTLA 2FTWA 4HCGA 2PD5A 4LCYB 4MDRA 3SRFA 1Z9SA 4W9LC 2X1IA 4LRSA 4CQDA 2J1XA 2CFFA 2I57A 3MRCB 5C9UA 4YLBA 3T04D 2WYSA 3O4LB 4APXA 2CLZB 5F9OL 3VGGA 2A5UA 1ANUA 5E51A 4O52A 3RNQB 1S7QB 4CKVX 2A3HA 1DUZA 1A3ZA 2AKMA 2PPAA 4Q58C 2B0SH 2YA2A 3QGVA 2QJDA 4PMRA 1A21A 1JGVL 4KJWD 5I2UA 2D7MA 1CFVH 4XNMB 1HT6A 2E9BA 4R5VA 3EFDL 3C08H 1PB0A 3LH2H 3SIZA 2VEGA 5G4NA 2QQQA 5EN2A 1NANH 3ITTA 1U1UA 4M9PA 1KTKE 5EZJB 2OZ3A 3F2BA 4IU2A 3ZY7A 5T5FL 3KYMA 2PTXA 1AH4A 2YD5A 5FC9A 3TWCL 3LV5A 2PWUA 4F8XA 4AITA 4J35A 4RX4D 5EGRA 4Y7EA 3QPQD 4Z7NF 1F4XL 2Q71A 5B1AB 1YPIA 2QUNA 4BH8A 5HI4C 3QDMA 1GOWA 2IBZX 1TUPA 3U79A 4PWGA 2WMIB 2IBZY 3EZJB 2Z0UA 3EDKA 4AW7A 2X7LB 1Z66A 1UR0A 4HAFA 1OEZW 4D9LL 3QWOB 3EFOB 3NXFA 2NUTB 3SBWA 1K77A 3B8IA 1RPUA 3KGTA 4G43B 1WUFA 1PTZA 3SQMA 1T5WA 2OSYA 4WKAA 1J87A 1P4LB 5D7JC 4L4TE 3QTPA 1DORA 2W9EH 1E28A 1A4MA 5GGSY 1CZ8L 1JGLH 2FWUA 1IUZA 3CQFA 3IJYA 4RZKA 3JWOC 1YMHA 3I9PA 2DIAA 2JF1A 2A4CA 5DMIL 1C93A 3EKLA 3W27A 1OF8A 1KJ2B 3DBPA 1PKLA 1J4EA 3UZQA 4Q2ZA 1GOGA 5JBEA 3UBXG 4YE4H 2CBVA 3O6YX 3ITYA 4AZCA 3CUPB 2QGCA 1DVFD 3A6OA 2VDQL 1EX1A 1WCBB 4NX0A 2F8IA 1BSIA 5MENE 3KBHE 3L67A 4DNLA 1EJXC 3T40A 3QFJE 3R79A 4F8OA 3ZOAA 4FQQA 4JK0D 1A9VA 1T20A 1S7RB 3UJIH 4Y8EA 2GUOB 5A6MA 3D8MA 4NT6B 4O53A 2EXWD 4WO4B 5DC4B 2RDXA 4B7LA 3FGCB 4RMRA 3N1QC 4Z7OB 3AJXA 3ATBA 1X38A 3OJDA 3Q3GA 3UGRA 1MCFA 1UCTA 2EC8A 1PD6A 1BYPA 3VKJA 5C0AD 5LNGA 4J3ZA 1BYOA 4HGWB 4WFFE 1XIHA 1I8MA 3L6FB 4R84A 5DJ2B 4AGMA 2A6LA 4M7JH 5AWNL 1F4YH 4S3DA 4FLSA 3HZMB 4Y16A 4QITA 1VKXA 3PGDB 3GBLA 1X7SA 1H3XA 3V4PH 4JQAA 1EO8H 1TV4A 3HG3A 2INZA 5AVWB 4FP8L 1BKSA 4JFPB 1WFNA 3WMQA 1KXVA 5E24E 3UY7A 3WHE0 3BG3A 1I9JH 1FWEC 2JKNA 4LV9A 1R3IL 4GX8A 2TSAA 1E8YA 1AKPA 3TBTA 5HOSA 3AWNA 4RX0A 4HIEA 3S3JA 3F04A 4WDIA 3N6HA 4EX4A 1MRAA 2YSSA 1GGCH 4MZIA 2OZNA 1E9ZB 4IU3A 2D3NA 4PRPE 4AXWA 2UXTA 4KKNA 1VPYA 2OCZA 2Y63A 2F6AA 3MYJB 3ZKXB 4BH7A 2FIRT 2MSPA 1QOXA 4V2BA 5K9QI 1REIA 1CICA 1DV7A 3DBXA 3KPOB 4GKZA 5C0IB 2XQYG 5E9XA 1KGXA 5IRPA 2IAND 4H8QA 4L3EA 4GPVA 4UM9B 1KCXA 4EEEA 1HZLA 3PPFA 5BVPH 3U8GA 3LXAA 1T66C 3DOSB 5I30L 3HPAA 3TA4D 1WEJL 1J9QA 5MI0B 4Z1CA 1XGQB 4S11A 2VENA 1ZGDA 1O9WA 2BLFA 1K6QL 1I7RB 5GGQL 2OXGA 4L4TB 2C16A 1PX3A 5CLYA 4NZDA 3AT9A 4FQHA 2H9GA 3D85D 4GG6E 3NQMA 3IGXA 1VA9A 4FOJA 3WQ4A 2VISB 4DEUA 2MFNA 2YC1B 5I71C 2WN3A 4LCCA 1UH3A 5I3JA 3EGDB 1XSOA 4OFIA 4NJHA 2NY1B 4AVHA 3QHFL 5FHBL 1Y6KR 1W9XA 3EO1A 1NBCA 5CBEB 4V15A 1N6VA 2GEEA 1VCFA 5MENB 3WK2A 2HKFH 3T77B 4FX8A 2DWDB 3H6OA 4P3DA 3S3GA 3AQXA 2H3NA 4ERAA 1U3JA 5CD5C 1I8IB 3TLQA 4PJ8B 4X8JB 1E5AA 2Q6WA 5HGHB 3G77A 1S9YB 1GYWA 2CESA 3CT7A 1GS7A 4DJEA 1J8HA 4RDZA 3KGSA 4QNPE 3FOKA 4P2AA 1NOLA 4FK9A 4IGSA 3HBZA 4XCEA 3MV8D 2NLIA 4M1CD 5AUMA 1LDCA 1OCRB 1F9CA 2A85A 4M00A 4U3SB 3RY6C 2AJVL 1Z9LA 1XX1A 2HMIC 3QMSA 4WCYL 3QPXL 3CDCA 5CZVL 5A8PA 1KBJA 4X63A 1EHXA 2F1EA 4OCLC 3TYFB 1NGWA 1GOFA 4BWLC 4LASL 3TIDA 1VF5C 1AY1H 2E56A 3NQAA 1H9DA 5MEOB 2I16A 4ATTA 3GBMH 2GJRA 1XTLA 3VQ2C 4XO3A 4XUYA 5AFDA 3L3JA 2YAEA 2UUDK 3DYMA 1LM8V 4DJFD 5K9JL 4OE7A 3W0WD 3S42A 3FTUA 2ZRXA 1OXYA 4PTTA 5HJXA 1TRIA 4JBRA 3B9AA 2IKHA 1DIOA 2FSDA 3VFOB 5EOCJ 4Q9RL 2WZ5A 1BBJA 3DFTA 4P7QA 1ETZB 3QUZC 1MCKA 3ORJA 2Z35B 2ZG1A 1RVFH 4PRPB 4OD1L 3FYYA 2R4RL 5E9DD 3FUHA 3TEVA 3K80A 1REQB 3QXTA 1N67A 1N59A 3BOLA 3OKMA 1NCNA 2VDQB 4ZD3H 4LLQA 1P5VB 4H1ZA 4HPJA 4ES8A 1G4SA 3ZVHA 1X5HA 1EEYB 3EJPA 3G6LA 2ZWLT 5IB5A 1QSFA 3CQKA 4KWSA 1AUSL 3U2CA 1TYRA 3G1YA 3P0WA 4NHCL 4JFUA 3WJSA 3ARDC 2W79A 5BQ7B 1M3UA 3MO7A 3P5ZA 4KRTA 5HGAA 3ZDXF 3QS3A 3DHPA 3GG8A 2AK4D 2NY6D 3M1BA 5FFOA 3PXJA 5BZDA 1LD9B 1MHHB 3PABB 2BNRD 3UTPE 2ZJSH 2X87A 1OB1B 3VMOA 4FQ2L 3H2AA 2W9LA 4K5PA 3MTRA 5JZ7C 4DK5A 2A6IB 5D4YA 4RMSA 1U30A 3BGAA 4IFKA 3T0EE 3CV1A 2X30A 4XBPB 2DBLL 1FAIL 3SPJA 1XGYH 1OWWA 3RL2A 3DIFB 4ZCWA 4Y4HA 3MUXA 5KS9A 3TJEH 3BRDA 1YDVA 3G3LA 5EMKA 4XNXH 1RV8A 3MNZB 3VXUD 2AEPL 1P5UC 4M1DH 1L8PA 1A49A 5G4EA 3DTUB 1DBBL 1AL7A 4QY8B 1J5IA 1O9VA 2K3TA 3VD1A 2C9XA 1S7VB 1QASA 3B9DA 4PMVA 4D6JA 4K9EC 5LO7A 3QEGL 3S88L 4N02A 3TW9A 3IJQA 2ZP0T 1Z0MA 2TRYA 5E23A 4TUOB 2I9LB 4OH2A 1JWSA 1TTIA 3MXWL 4MAYD 4GP4B 2RGLA 3NIFF 3BE1H 2BDNL 3A22A 5CIPA 5A94A 1DBML 2PP0A 3WS6C 1UEYA 1JF1A 2VLME 3WY1A 1A1OB 1EEQA 1ZXKA 5IW6A 4C59B 4XVEA 3BZ4B 3R13A 4J4PD 3QF0A 1X96A 3AREB 3TXVA 3TJHD 2CITA 2ROXA 3OB0H 3NP4A 4ADTA 4UTBA 1YEHH 1G1OA 1U3HD 3RLVA 4GRWE 4BFOA 3PV7A 4PLOB 3D3VD 5KVMC 3WLMA 1HH9A 2OMZB 1UUSA 5BOPA 3KYKH 2BG5A 1XR8A 4H25B 1JG9A 2POZA 3GXFA 4R0LC 3WKNA 3NP3A 1SYTA 3P0YL 1B9ZA 1GTNA 3T0AA 1D5XA 5EB8A 1SEQL 3BTNA 4NZCA 3SQSA 4ZX3A 1CLZH 2GUBA 3S2LA 3F8UB 3VGBA 4Z2GA 4KGJA 3VVGA 4RZCA 3ABOA 3EPMA 1U8NB 5D2YA 2YOAA 1WBXA 2YN3A 3LEXA 5INCB 4UOW1 1U8MB 5AZ2H 3SCTA 5AVSB 1W5PA 2IMMA 1PAZA 35C8H 1AZNA 3HQNA 4ZPTA 4FFVC 1J1OH 3KBVA 2Z7KA 3VFUA 3UL4A 2WTPA 3FB8A 5FUCC 5EORL 1P6FA 1CXFA 3C8DA 1NIBA 2FEEI 3VE0B 4JNYA 4LBRA 1Y0EA 3VB9A 1XGTA 3EYPA 5AVHA 2FLIA 2C3WA 1JWMA 3AM8A 1AANA 5DHYB 4ZUUB 1FIGH 3ECVA 5KJ4A 5F88A 2GL5A 1NOAA 3MRJA 3NCEB 2W65B 4TL5A 3UT0A 2YGPA 5ACLA 1KGJA 4PL1A 5CSGA 3RDJA 3WI9A 2EUXA 2LW3A 4I9WE 4CNTA 5EG6C 3SFKA 3A12A 3O11A 2R0KH 4OTXL 3TZNA 1HF6A 3T0EB 4W6YB 1H7XA 3N9KA 5B7FA 2G60H 1MIEL 1AW2A 3LKPB 5D4QA 4LKCB 2OK0L 4LANA 2E7FA 1YO4A 1TJHH 4HS3A 5IIEB 1AG0A 1ZV9A 3QP3A 1UB6B 1TNNA 4ZMLA 3VRJA 2BS9A 2K0RA 2DSUA 2FJKA 5T1LB 4LEXL 2DB8A 5DI8B 3WLOA 2BRRL 2VEKA 4Z23A 3GSRB 2PI6A 1JUFB 2J8UA 4H9YA 2X4QB 4KTDL 1IIKA 1KCUL 3P3SA 1P9MC 2O0TA 3BQUB 3GMQB 3OKEA 4L48A 5KZDA 4O5LL 5KVEE 2D2JA 3K2GA 3HIZA 3L4YA 1DWAM 1SOQA 3SJVA 3FOLA 3SYOA 3CFDA 4GO9A 3MU3A 2A0LD 4J5NA 2CNCA 4NZRH 2ZXEB 4US5A 4IM4A 2AJ3B 4GRMB 1HXKA 4LNCA 2CHWA 1DE5A 1H9VA 4G1EB 4QD2E 3CXFA 3KS0J 4GRWB 3FKRA 2GBVA 1PVNA 3UABA 1FE8H 4KCWA 4XZIA 3H42H 3A3XA 2VYOA 4OJFH 1KV7A 4BCXA 4C83B 4G7YL 3TTEA 3DC0A 5C2GA 4TNEA 4JN8A 4LCRA 2L3BA 1YXYA 3D05A 1LROA 4CSPA 1L5GA 1WBZA 3TKFA 4H41A 2K6ZA 1L9TA 4C6MA 2FH6A 2NXHA 4DWSA 3UR5A 1VQTA 4Y5YB 4E0RA 3DX6A 4JO8A 1DJHA 1KIPB 1LM1A 3THML 2G4GA 4JPWL 2W0FB 5D02A 2QQLL 4CQ9A 1IKOP 3MBEC 3ZKSD 1NJJA 2OU4A 1A7PH 3B9KC 1E6QM 2R82A 3C60D 3AFBA 2ZYRA 32C2B 2JGQA 1QLEB 2JEPA 1BJ1H 4OGYL 3VFVA 2MWCA 3EOAA 4RGMB 4Z0SA 4ZMZA 4PMZA 3QN3A 5DVNA 1TMCB 4TVSa 3VGHA 3IDIB 3Q06A 2ZTBA 3M88A 3TMLA 1QOKA 1RZKC 4GIEA 4GI4A 1PEWA 5D2TA 4CDGC 3CPGA 4OQ1A 2HG5A 3PBMA 3RAOA 3LTSA 4TTUA 2VEMA 3MNMA 3N2JA 2H9AB 4PE8A 3G8RA 3VUAA 1AZZC 2E67A 2V5DA 2Y5TA 3X3FL 1UHVA 5BXSA 4W9CC 1XGEA 1P0BA 4IRJC 2BHUA 4P59H 2P50A 3SCSA 2VMEA 3CUIA 1Y18A 5EFFA 4BQ8A 2RH0A 1TQJA 5XIAA 1QRQA 3T42A 3IFPB 3WXWH 5FJIA 2KZHA 1FNSL 2N0KA 3RVUD 3SBFA 1KWGA 3JUZA 1NELA 3L3GB 4NO3A 4JOMA 5FF4A 2EDMA 3HC3H 2JB6B 4QO1B 4G6AD 1JERA 4AVOA 2LVEA 3LLFA 1YJDC 4KJQC 1DQQB 3CH8A 4B5NA 2Z31A 4XPGH 3AYVA 4X9IA 1FLRH 1VCVA 1G6RH 2DEXX 4QEGA 4WUUA 3BLKA 1LRTA 4QM1A 3CC1A 1I8LA 3KCPB 1HEZB 3JVGC 1JZ6A 1TKWA 2CJUH 5HDLA 2DM7A 4CNPA 4ACZA 3ZHKA 2YLKA 4ODXA 3PQYA 2DZSA 2X1RA 1T3FA 3FQWB 1P1ZA 4EI5C 1BQHB 4BCZA 3FULA 4I87A 5KYNA 3V0VA 1YIXA 2A74B 3L3HA 4M8VA 4NM8H 2GC4C 2AKRA 4NWTH 3LRSA 3UAAA 2ZRUA 4FFTA 4J8QA 1UWXK 3DV6B 1SDAB 1IM3A 2JWYA 1WAAF 4JY6A 1JHKH 4GKSB 4HSQA 1WBHA 4MWAC 4L6OA 4K6AA 1GJPA 5IQOA 3NUKA 4YQXH 4CVZA 2H4EA 2QHRL 1U93A 2OT1A 3HNVH 5FKPB 2Q09A 3ZDYE 1VFAA 2JJSC 3DTDA 3DMMD 3WL0A 3MROA 4R26H 1PXGA 1JUBA 4KY1L 1R0AL 3H4HA 4AMWA 3BPCB 1XD0A 3L0GA 1IF2A 1JFHA 4M1GL 5L6YL 1UPMB 5FM5O 4XVTL 4R7NB 3FSAA 4JJ5B 4NNPL 5LNEA 3QDJA 4WFGD 4XVJH 3L4XA 1G7JB 4L37B 4DY1A 3RDKA 2B2XH 2ED6A 3UFYA 3VWKC 1E43A 4WEMB 4PLJC 1PZDA 4AKPA 1OCOB 5FCSH 2ZCKL 3KCWA 2HFFA 3X12A 2K9UA 1UACH 7CGTA 4Z7OF 2BP3A 2YRZA 1UQYA 5DFTA 2BWQA 1SOSA 1GGIH 3HG4A 2N0MA 5HD8D 2JI2A 4XN5A 5DT1H 4IRSB 3FB7B 2HQAA 5FD0A 4MKMA 1BSLA 3HG1E 1BEYL 4Q8NA 2IPUG 4PVBA 4XTRD 1RUML 2PDFA 5HYJA 3E6HA 2PYED 3UC0L 4AKQA 2HH0L 2ZRZA 5EF3A 4JTTA 3W9EB 1PTDA 1C12B 3OMZA 1D7CA 3LHWA 4FXGA 3JS3A 1OSZB 4JANB 2X3BA 4XVUD 3EBVA 2ZE3A 3L1OL 4Y89A 5DJYA 1RK1A 4JZJB 4O28A 2CLFA 4E68A 1YEKL 1NBYA 4ATDA 1O7DE 4N9EA 2Q7NA 2W95A 4FNLH 4NIKB 5FECA 4L7ZA 3MUGB 3MUAA 3AZRA 4IM8A 1IC0A 1U5HA 5HUOA 5CU5A 5F0PB 1J0ZA 5A16B 4WTXA 5AB9A 1AMXA 2ZCGA 4XBEL 3QEHA 2YYTA 1PU0A 4P06A 3TXZA 4I9TA 1GKEA 1YYMH 2UZ9A 2Q8LA 4WFEE 5EMLA 5E1IA 5ETUB 4YN3A 3OMIB 2YB1A 3RJXA 2YD1A 3T78A 3QJQB 4P2OD 1KIUB 2C9PA 5KVDE 2VZ3A 4PM1A 5AG9A 2Z1BA 4KX9A 1W1A1 4AG4H 1JR1A 3M0ZA 3V4LA 2C79A 3IJHA 4XMWA 4RFOH 3M47A 4GX9A 3DWTA 4P4RB 2BO0A 5DD0L 1JV2B 2NV9A 3U6RB 1QHZA 4NAQA 2VITA 3RA7L 3JWNC 3ARFD 5IFJA 1PIIA 3U2JA 3O15A 3OGCB 3IJSA 3IUDA 3KLSA 3ZDYB 4A2DA 4TMCA 3AAZB 1KEML 3WEXB 1BHGA 1KXHA 1TYGA 2ZX5A 3K6OA 2OPJA 3SZ8A 4FTVA 1G7LA 4P07A 3UWUA 4IIEA 5LA0A 4HUXA 3DDFA 1MUJB 4XNQA 1PZ5A 2HE5A 3FU3A 2LV4A 3PBWA 1ZWIB 4WNSA 1HHGB 1UD6A 3S8WA 1M57B 3KEHA 3VXGA 1RCYA 3RGVB 2VN7A 1HX0A 2KQMA 3I9GL 5K4ZA 4MBOA 2ZCLL 1QA9A 1NFAA 4LB8A 4YYCA 4O50A 4AUBA 1FDYA 5HMFA 2OQJA 4XP5H 3H2WA 3SQOL 2WJEA 3VFMB 3LG3A 2BNQA 1ORSA 2GC7C 2WZIA 4XO5A 4HZAA 1S5VA 2ED8A 3MNVB 3HMWL 2A73B 1MLBB 3S35X 1EXGA 4Q6KA 4YHIB 4L0YA 4CVWA 4D8AA 3C8NA 2FEEL 3IDGB 2WBJC 3C2AH 3PVFA 3MMDA 3PB0A 5BJTB 4RMQA 3C6SA 1CYGA 4O4VA 5CD3A 1E4KA 3CV5A 3NZGA 1CR9H 1W1IE 1Q0YH 1AO7D 4JIRA 2OFJA 1IGTB 4XXWC 5KSBA 2VIRA 5D9MA 2ZRYA 3WV0A 4KT2A 1J1PL 4OFYA 4B53A 4ECNA 3NGFA 2YPIA 5I19H 2FH8A 3REWB 2X4TA 1NEZA 4HP5A 1MHPL 2FZNA 3GC4A 1LLWA 3LAFA 2LLEA 1KFBA 1LORA 2JKLA 2IAMC 3JVFC 2JH2A 4C6QA 4JJHA 1EIBA 2ESVA 5F7MC 2DQIL 1NY1A 1NCJA 1ZMYA 3X13B 1TTAA 4NL1A 4U6VL 3MSGA 5C08A 4UILL 5K9XA 1K8DB 3CZSA 3C6CA 3VAVA 1CZ1A 3MKGA 3VWJC 3GHEH 1QYGL 4Y9NA 2ZKWA 4Y4FB 5BZWB 3G08A 4LDLB 4HUWB 4JCWA 3QXWA 4G1NA 3RPIA 1J1XH 3WJXA 4YDNA 2DLEA 1TKKA 1PE1A 3QA3A 4L29B 1GZGA 4F15C 1LTDA 4UMAA 4R8WL 3BHBA 3H8AA 4Q52A 4N0YL 3QHNA 2P46B 3NG3A 1N5YL 5FV1L 4G7RB 5IROC 3NFPB 1UT2A 2FCBA 1TCRB 1JMXA 4UR7A 1RL1A 2BH0A 1W0MA 3CHRA 2X4RA 5CLZA 2JK5A 4JDEA 2XVLA 2FWOB 3E2RA 3CSPA 4AENA 1BZ8A 3FT1A 3WLQA 4UOZA 2HVJA 5FYKE 2A9AA 5IWLC 4W5ZA 4KK8C 3U0HA 5E2UH 5CJNA 4IGBB 4GA8A 1QHOA 2CKSA 1SF5A 3O6AA 1INQA 3BIAX 2AQNA 3S37L 1F45A 3PULA 2EPLX 1KB9K 5KBLA 3D18B 3U4BH 5B1CA 4GG6F 1FN4B 4XVDA 1G0XA 1Q7MA 3EGSA 4LLMB 3G5YB 5ESAA 3ROLA 4C65A 3EH4B 4MVBC 3MMUA 1IBHA 2QVNA 3TBWA 2NXIA 5JNYB 3TZFA 3PGCB 1KBBA 3QUML 3NQ7A 3GIZL 5DF0A 1HJSA 4MRBA 4D9QE 4X4YA 2DZBA 5LAPA 2EVHA 4UV4L 1RZ7H 4DF9A 4UC5A 3CXHJ 4H2HA 5L2KA 1P2CA 3N40P 3LV6A 4N2OA 1HKVA 2Z6IA 3BG9A 1H7WA 5KN5A 5I2IB 1PV8A 1AQKL 1GEQA 4BGLA 3L3KA 4YEEA 5LGJB 1A5FH 4AH2B 4XNBA 5HMDA 4YHKH 4F7EB 1E6ZA 4AC4A 1T7ZA 2JJUA 4UT6H 1I9IH 2QHAA 1JPHA 3BISA 1RQHA 43CAA 1TEYA 4WRHA 2HRLA 4QYOB 2NQDA 5D2NC 1LO0H 4PIRF 2QCNA 5EFIA 3NIFB 4QNPF 6TAAA 2B1HL 2CO6B 5LGHH 3MOBH 2DQGH 4NKIL 3EHBC 1PKOA 3HA0A 1G1KA 1GW0A 1R3VA 5JOFB 4POZC 5FOBA 3DKLA 5GS0C 2Z1KA 5DS1A 4M8RA 2ZF9A 1CG9B 4YXLH 9CGTA 3JYCA 2FE0A 4IOIB 2VP8A 3LHVA 3OAUL 1MJ7L 3KBEA 2B1AH 1GWJA 4AVJA 1M53A 5EEUA 1TPVA 4AJ0A 3BSZH 1CF8L 3K8MA 5D2LA 5KTLA 3AQDA 3MRMA 2FJFA 3QUGA 3D0LB 3NQ2A 3X11B 2V68A 1QVOB 2UWEF 3IPWA 1QPPA 2DZWA 5I1CH 2D3LA 1OGTB 1DE4A 4Z78A 1E3XA 2GHZA 3F65A 5CAHA 1U5VA 1NAKL 2PCQA 4P9HH 3DK0A 5E8NB 2DIJA 1RBLA 4JQ1A 2KZWA 2IC2A 2Z0BA 2E3VA 1AD4A 5LHEA 1JTTA 3DUHA 4O4YH 3UZEC 4P23B 2IXQA 1G4PA 2NY3C 1JZEA 1R75A 3Q5OA 1CNVA 4ZFCA 1BOYA 2PDMA 1WS8A 1T80A 1GPOH 3PZVA 2VXTL 3HMXL 1YE6A 1PD0A 1TJIH 1NMCC 3JWDH 3VU1A 3FFOA 4Z7QE 4C1LA 2EDNA 2P24A 3VA2C 3JV6A 3L48A 4F27A 3U1QA 2QQNH 1U8CA 1RU9L 4IJCA 3MHZA 3GEWB 2D8KA 2C7UA 2V8MA 3DN5A 4X6DE 3WIIH 1UR9A 3KOWA 1RK7A 1K3ZA 3NEOA 4QHKI 3V75A 3AFLA 4J3TA 2VZOA 1I9RL 4DO5A 4A2SA 2K1MA 4AVIA 1DQIA 4KK5D 1HOCA 2NMSA 1NCBH 3O3AB 2BP0A 2CMRH 1QI4A 2O6PA 4ZFGH 1KJ2L 1B2YA 3NCWA 1UXWA 5HHQB 1FP9A 5BV7H 3VD4A 2ZC1A 1AODA 1FNGA 5AHEA 1SLUA 1KTNA 2L04A 1QR1B 4AIZA 5I7GA 4K8RL 2VR4A 3AIRA 4Q6XA 4JTFA 2YD8A 3ZW3A 3SO3B 3IGLA 1NFPA 4A3YA 4ZTXA 5HHOD 3LHTA 1XGUA 4R7DA 5DD5L 2IW0A 4A67A 5L4FA 4XBGA 5CQ1A 1CLYH 1K9FA 4XWOC 1YDOA 1BMGA 4G5ZH 5IJKA 4FYQA 3C6LA 4XZUA 4E9XA 4GT7A 3DI1A 3WQGA 3QR1A 4A05A 3TSMA 5LIYX 4YDKL 2WXFA 4GAYB 4RMBA 3ZTJG 4P3CH 4BINA 4K8RD 4HJ0C 4HOMA 3WF0A 4GMEA 1SBSL 4U0RC 4GBXC 1KIQA 4BXSV 2Y1VA 3LGEA 1KNWA 4BHYA 5CEYB 1AIFB 2DVUA 4HEPG 1HCYA 1Z1WA 4WO4D 4M48L 1Z3GL 1DVTA 5FWRA 3QULB 5DELA 2NNFA 2QUMA 3MDUA 3E8UL 3RCMA 3VIOA 3FJ6A 4H5SA 5KZCB 1OK0A 2JB5L 4TOYH 5CSSA 2D9CA 4M43H 3WU1A 5EUOE 4YDJA 5CM1A 4LRNL 3G6DH 1R4XA 3CBWA 1F3WA 3WFEL 4OCNC 3KBFA 1QNIA 3RFZA 3T8XA 5HHPB 3QUMB 3IVTA 3FHEA 3GSNB 4QXUL 4XZLX 2JQAA 3IDJA 4Z8FL 3LKSA 4Z7QB 1XXXA 2YCJA 2A4EA 2PTDA 3HRZC 4N25A 2QS8A 1WITA 1ED3B 4LLWB 4LSTL 3B7TA 4RAHA 4QXIA 2W4XA 1J93A 1A14H 3OD3A 5L8KB 2Z24A 1JPGA 4ZTPH 5CLWA 4ORZC 3JTTA 1B31A 4X6DB 1WHPA 3D3AA 5DQPA 4URKA 3B56A 3HZ3A 2QJMA 3HUJE 4KFPA 4ZODA 4AHQA 3E2HC 1F6AB 3B2VL 4L9DA 4ELMF 4HN8A 4CNIB 9PCYA 4WGXA 1QR7A 1HVXA 5HQEA 3LHAA 4GQ0A 2HJFA 3AS2A 1N5AB 4DVBA 1RUPH 4LVNB 1DXFA 2EDHA 5HVHB 3LCGA 5T3XD 5G5DB 2H8ZA 4ODSH 4RH4A 2RHEA 1MJ8H 3K2KA 1UQSB 5HDBF 2QR0B 1TZIB 4X83A 4K5NA 4Z7WA 1QNOA 1IM9B 1CXKA 4UM9D 5I6XB 4OLWH 2BP8A 43C9A 1YY8B 1L0YA 5D2XA 1C29A 3NJJA 4TSAH 5DD3L 4CD7A 3TW7A 3PPCA 3WIFA 4L4TD 2J7DA 2RJMA 3ZYJA 2WO2B 4X6FB 1XLDA 3GRBA 4E41E 5KWYC 3R7MA 1BGAA 2GAZA 3OLDA 4GW5A 4O12A 2OX5B 3OZPA 4M4RB 3RZCA 2OZ4A 1DR9A 2XYBA 3IXAB 1VJSA 2KERA 1H6TA 5JW5A 3LIUA 5SWSE 4U6XB 3TFKD 2P76A 4GXFA 1RVGA 1EUTA 3TAKA 3ME0B 2VC7A 1EBGA 2NY1D 4Y19D 4NNXB 4LVOC 3WKPA 3GMRB 1GHSA 4JBSA 1A4KA 2YAMA 3KBSA 3L95A 5LAXB 4B2DA 5MEND 2IDQA 3OLIA 3QZWB 2QYGA 1B3XA 4QLWA 1V0KA 4YHEA 3MBWA 4QXTA 3O2DL 3MT1A 2D9QB 1A47A 4YBLB 3MJWA 5HVFB 4PJ8D 1POKA 1MWAB 1K72A 2YA0A 2HJLA 5D32A 1T7VA 2J79A 2JK2A 3DARA 5EU5A 4YHGA 5JPMC 1CFTA 2HA1A 4BQ5A 4Z7IA 4WEUD 1G0YR 4PWFA 4Y4KC 1AFSA 5SWZE 1XIWB 2RMNA 1EEPA 4NHUB 2OGYA 4E42B 5FLUA 2FO4B 4AEOA 5EUOB 3GZQA 2XWBA 1ZDSA 4IKKA 1VFMA 3QEQA 3ZIYA 2XIIA 3I6GA 3R89A 2CZFA 2X41A 1JE6A 4R97B 3SJNA 3LIZH 3AS0A 4ETYA 1TF4A 3DX9B 2KDYA 4QLLA 3SRDA 1KYOJ 2PE4A 2NX5E 4ZW5A 4K2UL 5C70A 5IBUB 2XN9A 1OP9A 2OYMA 4GLRI 4PJ9C 3S2MA 5C0GA 4TR9A 4UFKA 1A0EA 5LQBL 3P3BA 4L8CA 3BP5B 1ODUA 3BVUA 1R3YA 4LJ3A 1GCFA 5EA9A 5A6KA 1JPFA 1TCMA 3WUEA 5C0DA 4MAUL 4DP8X 4YSCA 4ONHA 1LYQA 3HUJB 3ZYIA 5FACA 3OKNA 1Q6FA 4HK3N 1SYSA 2HKHL 5I73C 2H32A 1IZCA 1FCUA 5JQ6H 5J1TC 5BOFA 4JKLA 2V3GA 4PRPD 3W7IA 3F03K 3SKJH 1WTGT 1SQ7A 3H0TB 1S5WA 5DLLA 4LP5A 4E38A 3WBDA 4L65A 4Q33A 5BUAA 1TQCB 5GZND 2VWEE 1CI1A 3RAJL 2PDLA 3SCMB 5JOPE 2NQ3A 2RGSA 3HC0A 2D2CC 2BASA 4NZ4A 4X7FC 3HF3A 2MTPA 1WX0A 3OLGA 1RK6A 2V9UA 4DBUA 4MD0A 1O1ZA 1QQDB 4PJEE 1H15B 3KAOA 1FWNA 5JW4N 3RL1B 2WBGA 1PWMA 4OZFH 3NJIA 2CKBB 2AI0H 1Q66A 4E41B 1A1NA 1JGEB 2AEOA 4HIPA 2DIBA 5B4MC 4FULA 1J7VR 2F7FA 3SAZA 4B9FA 4YFDB 5KZEA 4KRMB 2WYIA 1LO3L 1AQMA 1WBYA 1Z9PA 5SWSB 3IJ6A 4Q7BA 1EEUA 1X7FA 3PUCA 2E7LA 1R34A 1RHFA 3QJHB 4R4NC 2VFDA 1ZTMA 4HJGB 4PGCA 3FT9A 5DN1A 2WJ5A 1RSFA 3LV3A 1ECQA 3T65B 1I6NA 3NAAL 4PJ5A 2NR6C 3S1WA 2OPCA 3UTSA 1JI1A 3V6BR 1J18A 1VR6A 1H3PH 2BRQA 5E8DL 2AOSA 2B7PA 2FX8H 5DUPL 3G24A 2OMVB 4JE4B 2X6BA 3SGKC 4LCIL 1LO5B 3MB9A 2Y69B 2VD8A 5CC5A 1ZT1A 2VXNA 1NEPA 4HGXA 2BVTA 1LNUA 2R6OA 3MOAL 5FKAA 3QVQA 1E9OA 3UYIA 5GNZA 4XWUA 1CEOA 4E8CA 1QTPA 2H2SD 1SUXA 1F58L 4N26A 2F08A 1SGKA 6REQB 3H26A 3IMBA 1T04B 4CADA 3LQAC 2R2CA 3WE1A 3GHBL 2O9PA 2FB4H 3ZDYF 2IQ0A 4KJPC 3EOTH 4PZVA 1NCUA 2YDAA 2NTFB 3BP7A 3FTZA 4XZMX 2CEQA 1K8IB 3ZKND 2NX5B 2QVHA 2DQFB 3ARED 3QIUA 4N8VA 5I0DA 3RYSA 1JNHB 2R2HB 1SMAA 3QFJB 1KDIA 3VMNA 1MNUH 2OP4H 1ND0B 4XOAA 1JYNA 1A5NC 5DY3A 4UU9B 1JSYA 1KLGB 3BJLA 2R23A 4E4FA 1V6WA 2C8NA 1IEBA 4DYEA 4BQ4A 3WD5L 1B57A 5ILTL 1R7AA 3SQBB 1N8ZB 1BYNA 3ARRA 3RITA 1KCKA 2WZ0A 1FWHC 2VR7A 3NSFA 3MZNA 3NSDA 3S9ZA 4G71B 3B40A 2GI0A 2UY7B 3K5RA 2VZUA 2ESCA 1AKJA 3H4XA 3I2CH 4HKZB 3FVDA 1NIEA 4FQ1H 1NGZB 4QPEA 1SFSA 2AL1A 3K2UL 4WV1C 1GPFA 3AG4B 3QQ9C 4DGWC 3G0SA 1UM4H 1Q9LB 1L6YA 3WHXA 3CV7A 3EYUL 5EC2A 4KQ0A 4XX1G 4HETA 4UTCA 4OIIL 4W89A 1RMFH 4E9TA 3W26A 4K4KA 5SV3A 3TH3T 4NKQB 3P4MA 4PJEB 5E1AA 2UWEE 4FF9A 3BUVA 2YAQA 4AWEA 3NCYP 2ZKYA 5I17B 3TBBA 4PULA 3PP4L 5DEZA 5CMAA 3P6LA 4PP1C 3UPWA 3KP0A 2FUTA 2D3VA 3FN9A 2AITA 5A8NA 3G6AA 3UTPD 1RR2A 3WLRA 3PYCA 1TVBB 1TQWA 1AH3A 1KM0A 2ZVIA 4GQPH 3DROB 3T0ED 2IGTA 1GTHA 1NAMA 3UBXB 2XIQA 4P5UA 3N04A 8A3HA 3EO0B 3WSQL 3RTLA 3ARGC 4HZ1A 5I00A 2PXYB 1BGXH 2W92A 4KRPD 1BM3H 2DQUL 1S7XB 3FQNB 5T1LD 4XXDA 4X6BA 5IFPA 1D5ZB 1XYCA 1U3YA 4Z7VA 4D8OA 1I7ZA 4U1GC 3AIQA 2K7PA 3TZVC 3KW7A 5E4AA 3MYPA 1J0IA 5INDA 2XTKA 2ARJA 3BQUD 3M5VA 4GG6B 1TQVA 5DXWA 1NIUA 5L8JB 3BLIA 2P3YA 2A4ZA 3DUUA 3FC8A 2J25A 3MA7A 4G8EA 2RFGA 3W23A 2VLRE 3ZTNL 1VGKA 4KKAD 3TYZA 3GDMA 3C5SB 1G7QA 3MLYH 4P2RA 2OI9C 1OCWH 1GVYA 4L6DA 3LXCA 3FAXA 5EO9A 3SE3A 4HC1A 5E6ZA 1YEGH 1QLEL 3PL6B 4LBSA 2CJTA 3MLZL 1PZ2A 2HK1A 4PJDE 3WL9B 2LE9A 4H9UA 4JRLA 3RK8A 5E99L 4WWKC 1SJHA 1E9QB 2ZA1A 4BQBA 2QZ5A 3BAKA 2BCMA 3WNKA 3W2JA 2WWMC 3BWZA 1SFHA 3CMGA 3ARYA 2FZ3A 4QJ4B 3L7RA 2C9SA 3WK1A 3USZA 3BH8B 5D4JA 4IBQA 4IUGA 3J7HA 4Z3EA 1JQVA 1AMKA 2X4PA 1M7DA 4DM2A 5DJXA 3GNDA 3GNNA 4NM4H 3EGXA 3BW9B 4X9FA 2CLKA 4ZMWA 4Q7DA 1E1EA 4E8DA 4QOKA 4J40A 5JXED 4JZOB 4L9ZA 3BUDA 3VFPB 4LSPL 1H7OA 4HZ6A 1NLBL 3F84A 1ZQ5A 3EZ4A 2H1PL 3AYSA 2CXKA 3A4FA 2UWEB 1LL6A 4P5TA 1T6MA 3WBXA 2HCZX 3SN0A 1H5BC 3SHSA 3TIEB 3VI3A 1WCQA 1OHLA 3QUXA 5L9DL 2CDEA 3EJZD 2HPOA 4M7LT 3HNSH 4G8FB 2YR3A 2ZOXA 1SM3H 3DECA 4PH8A 2REQA 1TQSA 2F7QA 4XVSH 4X6EA 3W1RA 4KI5C 1PY0A 3I6LE 3QWRD 4PTUA 2HT3D 5KVEL 2OM5A 2POTA 4W84A 5DMJB 3ROOB 1ZP3A 3P30L 1F3JB 4KVNL 1TZ8A 2EIZB 2VM3A 1UH2A 2WLYA 3OA3A 4AZ7A 2Y9RT 5H2BA 3OHIA 3QNXA 2IOOA 5HGBA 1HGYA 5KYUA 3TLLA 2YWYA 3GMPB 4B5XA 2F7OA 3CDGA 4TULH 1JNDA 4B60A 1LJYA 1OFAA 2DQHH 5I8CA 4IL0A 1E70M 1LDPH 1IBFA 4L80A 4WWOA 3QFDB 1QVBA 1NUDA 3HZKA 4QRUA 3NBNA 1I7TA 5XINA 3WMSA 1EK3A 2D3JA 1TVNA 1KIRA 2FB2A 3NRQA 1P7HL 4YAQA 4ELME 4OCXL 4MAVA 3K1GA 3PWLB 3VM5A 4NQ1A 5H37G 1OFQA 1W72H 4E5XA 5H8UA 4HKBA 1NIAA 1XWYA 4NDMA 3UYPB 4A7GF 3DO7A 5I6PA 2ALWA 3P77B 5C7ZA 1RZFL 4KRNA 2R94A 5LVEA 1Q6GA 1NKGA 1TJXA 2FZDA 5I07A 1R3KB 3QQ4B 1JCNA 4NERA 1Q9WB 1LO4L 1KRBC 2PC8A 2VLRB 4QTHB 5HDBE 4YBHA 4WY0B 3RM4A 4JO4H 5AC6A 4MJZA 2FZ8A 3KS5A 5LB1A 3VZZA 4D0BA 4UQIM 4M5TA 3IKCA 1B3OA 4YNYA 3VPLA 1QBLH 2YPVA 4MKSA 4TF4A 4Q6IC 2F6KA 4GEJA 3MGTA 3SY6A 4PJDB 4DFHA 3WJJA 5ICUA 1RCXB 4C6LA 3EJYD 5A7BA 2PODA 2HNEA 4X0KB 4B5EA 1OQOA 2DMGA 5TE4H 2QXWA 2B5IB 4FIQA 4JX5A 3BKJH 3X1BA 4WKZA 5E2VH 4AYSA 5HHME 2ICWA 3ARUA 1H3WM 3S1XA 1F4HA 5LIUX 1PZ0A 2J88L 2CRMA 1JOIA 1GQKA 2VFEA 2BOFX 2VLJE 4Y2DB 5EMUA 3GUFA 2O6EA 3SRHA 4MY9A 3ZTCC 1KM6A 4Y8FA 4WW2C 1SGJA 3MGOA 2AQPA 3ZLHA 4DAGH 1TZOA 1FNAA 2PDJA 5ENWA 4JE0A 1DL3A 3LS5H 3BX7C 1DOSA 1RJPA 5D30A 4XWGL 1KTDA 2CNYA 3I6KA 3MRKA 4X3ZA 2VOTA 2C4XA 3WEBA 1A50A 3PP3H 4Y8AA 1CBVL 2A79A 4URTB 1BP3B 4RV8A 4NAFB 2LABA 4AMXA 4IRSD 3BE7A 4A2EA 4TUUA 1RZGB 5IMMB 1MQ8A 3FQTB 4NXKA 3FSVA 4GQQA 5KAQG 1HZYA 5D7JA 1KYUA 4ZVJA 4O14A 2BJML 1WFMA 3HR6A 1KB5H 3IE9A 4Z7QF 3DX2A 1M2OA 3NPSC 3WH6A 1H6FA 3FXIC 3ENLA 3AJ7A 4NKCA 2YQ2A 4ZBCA 1IJNA 2VWSA 4AM0A 3OHXC 4AMKH 1TWWA 3TVMC 1BWWA 2YSTA 2ZOKB 4X6DF 3H2QA 3RVXD 1YXCA 3WKZA 2OJZL 4ELMB 1L9QA 3AHXA 1IFRA 2VZVA 3WEMA 4JTHA 2DJLA 3VSUA 2DTSA 2BX5A 1A3LH 1LCOA 2QNEA 3B3BA 1SEBB 3C56A 1ZALA 1D2KA 1RUAL 1RJQA 1UJ3C 4QRRA 3NQBA 1GZQB 2W07B 3PJLA 5HDBB 3RX2A 3N2XA 2Z93A 4B90A 3AB0C 3TEXA 2CHXA 4IK6A 1F90H 5JUEL 3MNDA 3P11H 4YWGL 3P9MA 5EZPA 5D93C 3UGXA 1ZBKA 2WCSA 3MMEB 5C2BH 3VNIA 1PGRB 2WLNA 2VLLA 5FA4B 5PCYA 5U4NA 2FATH 1BBDL 1BJ8A 3P9WB 2I7SA 3GUWA 5FR3A 3WKQA 4AC2A 1ZBCA 2XZQL 4IKLA 1LQ0A 1T7LA 2QAFA 2P88A 3NFSH 4AVFA 1EJ7L 5HHMB 1QFUL 2GITB 3TNBA 4ODTL 5JYLA 3WE6A 4LLYA 1KPRA 4ZT1A 4TQPA 4X9BA 1QWUA 4M5ZL 4XCNB 1L6GA 4IISA 2HSIA 5LXGH 3RGVD 1NOFA 1ORQA 4W68A 2YRLA 1L2QA 2HDJA 3ZDWA 5IJVB 1H7RA 4R96A 2EDLA 2V37A 3OQ8A 4K7FA 2WINB 3PGFL 2GSIA 1UZDA 5K33A 5TJWK 3QUYC 1FTXA 4DN1A 1RP8A 4XO9A 4D8ZA 2ETWA 4KMTH 1PQZB 1BMZA 25C8L 1Z7JA 4HJWA 4I7UA 2OA9A 2V3DA 1EA0A 4LB4A 3LZ3A 1BVOA 3LGDA 1OT2A 4QSFA 4C90A 4YL9A 4DKFH 1E15A 4AY7A 3W76A 2FK9A 5EUOF 1YNTA 3ZL2A 1KPVA 1LBLA 2JLLA 3MRLA 3G3DA 1TPUA 3C9NA 4OECA 5F3HB 4TNWF 4MA8L 1ONQA 3WLHA 5BWAA 4UOW0 5ITBL 1S5HB 1P7BA 1H0IA 2OO0A 4HSCX 4XZNX 1GL4B 1DL7L 5F44A 1QTWA 4PJAA 4MMWA 2I60H 3DXAA 4XMUA 3RPDA 2AQVA 5B8CC 4HXBL 1SF3A 2DJXA 1XUUA 4KVPA 2E0PA 4HG4J 4YSEA 3H55A 2BSDA 5IMOB 4HJJH 5JIDA 1U3ZA 3B05A 1LWHA 1ZVHA 1YAIA 3P67A 5LCVA 3WOVA 4CSZA 5DEJA 3HUJF 2P5WE 5I9QB 4R34A 3Q1SL 4Y9CA 3SPVB 1BAFL 5F1IB 4FFWD 2CW6A 1NDTA 2P7TA 3SB0A 3PBUA 1MNNA 2C9AA 1JVOA 3VO0A 1XJBA 5JBFA 3V1PA 5KBMA 4N9BA 3NK4A 3MCKA 3M0IA 4M61A 1WKYA 4Q4EA 5TGBA 3PR2A 4MFDA 1VIZA 4ZBJA 4I77L 1CGSL 2DV0A 3N9GL 3UGEA 2E86A 3S35H 5FB8A 5A2CA 4ELKA 4DPRA 3IMSA 3VGAC 2UXGA 3O16A 4GBDA 1QFWH 4WNQA 2QCEA 4D9RD 1IGIL 2B4CC 2NY2C 5SX5H 3RY6A 1JRBA 2O5ZH 1QW8A 4C7FA 1LT8A 1XZWA 3GHUA 1VZHA 4HJ1A 2IDTA 5HULA 1OPOA 1DIDA 3PG8A 1AOHA 2O5YL 4CGTA 4OQVA 5LNVA 3WF1A 4KH2A 1N0LA 1DTUA 2OV0A 2FEDC 3DBNA 4GYKA 2CJSA 3TROA 2INFA 1EZ2A 4DVRL 3LZFH 5I6MA 2ABAA 1E9YB 3QCTL 1JWUB 4REQB 3ZKMD 3MP4A 1C7SA 2Q86B 1X7QA 4OLZL 3MLXH 1J05B 3UTTA 5H94A 3PG2A 2RA1A 3AIBA 4I2XE 2WW8A 3WO4C 2ATAA 5DRXB 3S2NA 1NWPA 3CO8A 3CMFA 2WWNA 1NMAH 3PWNA 3V4VA 1YW1A 4P8UA 1KZQA 3LTVA 3JZEA 4IEFB 3GS4A 2B14A 1S7UB 3EWZA 2XC8A 3BV7A 3P54A 3DTXA 3FUKA 1J9RA 3G5ZB 4LEOA 4WHYH 4DEWA 3FQXB 4G1MB 4LEBA 1D2PA 2CO7A 4HT1H 3W37A 3W5NA 1NPJA 3QY7A 2X53A 1L6SA 1K8XA 4QCIA 3V3WA 1BFVL 4YXHH 3OLEA 5D7SH 1I7UB 5DURB 2V2XA 3CASA 3O0FA 3HFMH 3FSWA 2KLSA 5AVVB 4ZFZA 3ARDA 4L9YA 3CHPA 5F7EL 5H35B 5BXTA 3VXQA 3DVNB 5JA8B 4N2FA 3U2ZA 4U1KB 4BWUA 4NCC2 3LERA 4EIBA 5CC7A 2ZNXA 2E6YA 2FDSA 1L6PA 1Q45A 1D6VL 1LE5B 2CWNA 5CPOA 3T4AC 1TO3A 5KZ6A 4H8NA 2IPKA 3LQZA 1FZKA 2QZQA 5FYKL 2GJ6A 1DQTA 3DESA 5CBJA 1HJUA 4ODUB 1MLCB 3D39D 2EKSA 2J8FA 3BEWB 2J4WL 4XN2A 3LZQA 2N56A 2P5WB 5BRZE 1J11A 2YK1H 2MOGA 3P4NB 1TJ0A 4P9ML 2FR4A 4K71C 4MM1A 2AQRA 3FQUA 4P23D 1GH7A 4TUJA 2W60A 4YE0A 4JO1H 4N3UA 1PLGL 2A7PA 4FI4A 3VKAA 5JXAL 2KPNA 5GJNA 4LNRA 4MD4A 5DMMA 3HG1B 2BVQB 4Z7UA 4DKEH 1M03A 4C91A 5JH2A 3BWAB 3MGAA 3AROA 1J6OA 1BLNA 3T4YA 2ID5A 1E4XH 2R69H 2EDQA 2PZNA 4P8XA 1R3WA 1A3XA 1XCQB 1R1CA 2GJLA 1GVSA 4C4KO 5EOTB 5GRWA 1HVQA 3F4DA 2EPHA 4J2XA 5AB0A 5FYKD 6ENLA 4MNQA 2HLEB 2XJKA 1ZPTA 4PJEF 3UBXI 3NFNA 2GJXA 1EHLL 1V3LA 1H3GA 4K3GA 1TZGH 4FJ6A 3US9A 1VYSX 4ZMAT 3NA8A 1PYWA 4MKVA 2WNQA 2XY2A 1J2WA 1A53A 1UMYA 4GUGA 1TPXC 2DP3A 4PJBE 4KTEL 2HEJA 3WX7A 3HM7A 3W3BA 4IG2A 1Q65A 3CEPA 2XH7A 3IETA 4MNLA 2M8XA 2Y5EA 4M6ML 1NKOA 4RZ6A 2DQMA 2WXQA 3ESVF 3PZUA 2NZ9D 3FLUA 5EZLB 2DM4A 1G4MA 4FQXB 4WI0B 4D9QD 2V33A 4Z77B 4R0LA 1YTKA 3FEQA 4OF3A 4PRWA 1J8RA 1TLMA 3LKNB 3EXJA 4N4QA 3O6LH 4JFEE 1UR3M 3KWXA 1XB3A