2ZWYA

Alpha-l-fucosidase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of alpha-Fucosidase Inhibition by Iminocyclitols with Ki Ranging from Micro- to Picomolar
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 155
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zwyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zwyA01
3VMNA 3QR3A 4BCEA 1V0KA 2EPMX 1B3WA 3AHYA 4JAWA 3AHZA 1HJWA 4DUWA 3SCRA 2AAAA 1W3HA 2CHOA 4UNIA 4IM4A 1QI4A 1UKOA 2FH8A 4E2OA 4YHEA 3BMVA 2CPUA 2ZUUA 1RP9A 4ACYA 3IK2A 4GINA 3EDDA 3A21A 1R86A 3VD9A 3MUY1 3NJ3A 1UKQA 2VOTA 4QLLA 3RJXA 3AIVA 2WC3A 4ZXLA 4ML4A 4LYPA 4E4PA 4AISA 1E1EA 3IGUA 3W81A 3W6MA 2EPOA 1UD2A 4L4PA 1DWFM 3EYPA 3MU7A 2EBNA 4AZCA 1GQKA 3VVGA 2WLYA 3SCUA 4TX6A 1PX4A 4PMVA 1BFNA 1E1FA 5BXTA 2W63A 2WZIA 3GZAA 3QOMA 3TP4A 4MB4A 3FW6A 4R27A 3RMEA 1J0HA 4UZSA 3S5YA 4OKDA 4HZ8A 5M17A 1C7SA 3RM9A 4XB3A 1UKPA 5JBDA 3CLWA 4DO6A 3PTMA 1H0IA 3B9EA 3GNRA 2F7OA 2VNCA 4L4OA 1J0ZA 1KWGA 4J3TA 1VAHA 3WFZA 1WZLA 3BVVA 1GHSA 3CUFA 4GZIA 3LRKA 2UWFA 2A3EA 1JXJA 1V6VA 1OINA 3W38A 1W9BM 1UD4A 5I5RA 4OGZA 3ZJ6A 1OT1A 1CENA 1VBUA 1PX8A 4TVDA 1U33A 1MQQA 3VDHA 1NWSA 3VD7A 2OWWA 2VTFA 3WY3A 3OLDA 1BQCA 1KR1A 2F1AA 1W1TA 1JF5A 1H11A 5A6LA 2YL6A 2CBIA 4XZWA 4JIEA 3UCQA 4QLKA 4D1JA 2G3JA 1EO5A 1CGWA 1XYZA 1DWJM 2BHUA 2EAEA 1J9YA 2VUYA 3N1AA 2ZUMA 1JD7A 4A4AA 4PSRA 4W5ZA 4XV0A 3TA9A 4YPJA 3F4VA 1V3HA 1PPIA 4NRRA 3WDRA 1JZ8A 2VRQA 2G3IA 2BFGA 4CN6A 1V6YA 1FA2A 1CGVA 1H2JA 3AOFA 3IANA 4QDMA 3FY1A 2ALWA 2YDSA 1S46A 1Q6FA 2DT2A 2FYVA 2XPKA 4NXKA 3NSXA 5ABGA 1WKYA 3AMLA 1O7DC 1MW0A 3PZTA 3QGVA 1JZ6A 3VD4A 3NYDA 2VCCA 5F7UA 3LPPA 2D73A 2F7RA 1V0LA 3WMCA 4OJYA 3MUZ1 2PB1A 2F61A 3O2LA 1ZBCA 5D8ZA 2VCBA 3AMKA 2O92A 2CKRA 4W8BA 2Q8XA 3VD5A 3CZKA 3A6OA 2F2HA 4NXSA 1J0KA 2D23A 1RH9A 1M01A 3DYMA 2CBVA 1ZS2A 5EFFA 5GNZA 2VZTA 1VEOA 1JFHA 4MB3A 1VJSA 5A1AA 3CUIA 4JHZA 1AQHA 5AC5A 2VQUA 2UY2A 4OZOA 5HDRA 2UY4A 2DIEA 1W2VA 2VJXA 3D5HA 4UQBA 1OD8A 4HU8A 1EDGA 1QNSA 1E6NA 1TA3B 5D9OA 2GFTA 3AYSA 1V6XA 1V02A 1NOWA 1UH2A 4HTYA 5A6BA 1PZ3A 1PAMA 1RPKA 2EACA 3OLEA 1EGZA 1X6LA 1XD1A 4AYSA 3CIVA 3PZNA 1CDGA 2ZUSA 1WZKA 1EDTA 1GORA 2A3AA 2IGTA 5M3WA 1TQTA 1EIBA 2V5CA 4PMOA 3L2MA 6CGTA 4HU0A 2ZX7A 4KRTA 3DHPA 1UG6A 1JDCA 2Z1SA 3B9DA 4WKAA 3WBEA 4JKMA 5FD0A 2DT3A 1TQUA 4KWUA 2XFYA 1JZ3A 4WLCA 4UFHA 1JAEA 2FE0A 3L4UA 2A3HA 4J3VA 2XTKA 3WQ5A 3A4AA 1GOMA 5A6AA 1O6IA 2YL9A 4MNMA 1WAWA 2J4GA 3DX0A 4AC1X 3VMOA 1DWIM 3PTQA 1BVNP 2Y8KA 1BSIA 4K68A 4E8CA 3WH6A 3CMJA 3SURA 2CBJA 1KCKA 4RE2A 3PZUA 4D72A 5A2CA 3PBGA 3PHAA 1AQMA 3OIHA 1OB0A 2RGMA 5FCZA 3L4WA 1IZJA 5E9AA 1E6RA 4B16A 3WMBA 2JE8A 5LYRA 2PBGA 2J47A 3T2OA 5GQBA 2AOSA 2E40A 1H5VA 2V3EA 4CKQA 1WZAA 3CZ8A 1XD0A 2VCAA 3AHXA 4CUCA 3CUHA 1E6QM 4J3SA 2FH6A 2O9PA 3EDEA 1NM9A 4AZBA 2X05A 1C90A 4CN1A 3CGTA 1VFUA 4YHGA 4PSPA 4W5UA 3VKKA 3T0AA 2WB5A 3BC9A 4RE4A 5M03A 2XVNA 2WMGA 4F66A 4ATLA 1FH7A 2QPUA 4DUVA 1QNOA 5C8BB 1JZ4A 1VFFA 2J75A 3M6DA 1U2YA 2NT1A 2PWEA 4GQQA 3OG2A 5ECUA 1HJVA 2WCGA 1R7AA 1JAKA 4AD5A 3GH5A 5IHRA 3VM7A 1R85A 2XGIA 4QLJA 1E0XA 4R5EA 3UR7A 1NWUA 3AISA 4S3JA 3S6TA 1U30A 1ISYA 4W7UA 2DGAA 3POCA 2OYLA 1HVQA 5CPTA 4U2YA 3BH4A 3DX1A 3UG4A 1UYQA 4WKHA 5A6BD 3I3EA 4PUEA 3WDHA 4PMNA 3NDZA 5FKYA 3ARWA 5ABFA 1X1NA 2VO5A 4FNSA 5A69A 1BGAA 3WBAA 4AMCA 4GKLA 4UQEA 4HZ7A 3CZGA 1JD9A 2ZE0A 1W9DM 3VGEA 2E9BA 1EOMA 1LL4A 1CXLA 4UTFA 1H0GA 1JL8A 3WH5A 1JZ2A 1XH0A 4P8VA 1WPCA 4D6DA 3WF3A 4JFWA 4NRSA 4JCLA 4BS0A 3AS0A 1J10A 2XN1A 3EJRA 1FH9A 1GUVA 5DEZA 1KR0A 2PI6A 3W0KA 1UR0A 2Y8VA 3MMUA 1D2KA 1R87A 4Y7EA 3WL0A 3WSUA 1R75A 2E0PA 3T0DA 1G01A 5I6SA 1CXEA 4CGTA 3EJTA 5I2UA 5ABEA 3PZVA 2YFOA 4HOWA 2GVYA 1G1YA 1FH8A 2WNWA 4CVUA 1G94A 4M56A 4HA1A 1SZNA 2NT0A 1J0YA 3ARSA 3HG5A 5JIWA 1HJSA 3ZT5A 3F5LA 3L4TA 2QF8A 3WKZA 2J25A 5C71A 3PZGA 1EO7A 3W6LA 3AMCA 4UQCA 3NSNA 1DWGM 2WM0A 1NOFA 1TUXA 3D3AA 1W9VA 1XV8A 3WEOA 4U5KA 1ZBWA 1CLVA 3A3HA 2D3NA 3KL3A 1CECA 4AZ5A 1XRVA 2GDVA 4PMUA 3UETA 1K9FA 3UERA 7TAAA 4XZBA 1GVIA 3AROA 1NP0A 1SMDA 4W84A 1HKKA 3G6MA 2D24A 4OOZA 3QHNA 1HT6A 2CKSA 3LRLA 1XCXA 4JCMA 3WNNA 2X1IA 4KH2A 3VD3A 3A22A 2WAGA 1V3LA 2YLLA 1PJ9A 2W4XA 2UY3A 3AMGA 1KWKA 2J7FA 1CXHA 2GJPA 2D2OA 2Z1KA 3WF4A 2ZUNA 3WQVA 4RL3A 2NW0A 4J3WA 2F7QA 3CMGA 2WVTA 3NUKA 1GOWA 3KE0A 1X6NA 4HZ6A 4C7DA 3QOKA 3WY4A 1UR8A 2W91A 4J28A 3HG3A 2OYMA 3CHFA 4CVWA 2G3NA 2XWEA 1KTBA 2ZX5A 5CLWA 4AD0A 3S5ZA 4MTVA 1I75A 1KGUA 2BVTA 4W7VA 1E3ZA 2DIJA 3AFBA 5E0CA 4NZJA 4PRWA 1BAGA 4JFVA 4FNUA 4X0NA 1KBKA 2YBUA 1W91A 4J3XA 4ZENA 5BROA 1VB9A 4ZFMA 4H7VA 2GSJA 4PMRA 2VRKA 4D6CA 4DM1A 1UH4A 3K4AA 2QMKA 2EEXA 4AD2A 1JNEA 1UWUA 1QW9A 4GO9A 3WELA 2ZUWA 3L4VA 1VFMA 2F8QA 1WB0A 4WSJA 1WO2A 1D7FA 1QI5A 1JFXA 1JDAA 4B3KA 2ZX9A 1EA9C 4F79A 2XSBA 3S2CA 3LMYA 5D8WA 2QPSA 4M81A 1UZ4A 4DWSD 4YN5A 5JUVA 1VEMA 1NWTA 2VZOA 5A8OA 2XIBA 2DSUA 4BQ2A 1JG9A 1LG1A 1V0MA 4WF7A 2WMKA 4ATDA 4BQ3A 1XH2A 4FLQA 1K9TA 3WDPP 2WWCA 2VMFA 3O6AA 4FF5A 4N42A 1G5AA 1Q6CA 3FNDA 1HX0A 3DHUA 5HPCA 4D6IA 2WHKA 3W37A 2FHCA 2XSAA 3WH8A 4PCSA 3WNKA 1DHKA 3CHCA 3ZMRA 4IPNB 3D4YA 1BGGA 5BCAA 4BQ5A 2WC4A 3WQ4A 3LXAA 4WIWA 1BVZA 4W87A 3VX1A 3GXIA 3T08A 3PZIA 3VUPA 4P7OA 3M46A 3EJPA 3N04A 3W27A 3LPOA 3VNZA 1KCLA 1B3VA 3IAPA 1PIGA 2EPNA 2XG9A 2J7BA 3DC0A 3VOCA 1HL8A 3VDCA 1UASA 3AICA 1MFUA 5CQ1A 3VINA 5I78A 4AXNA 2F18A 3MSGA 1FOBA 2WHLA 1XHGA 1UR4A 2OLHA 3GNOA 3AHTA 1HWWA 1FFRA 1UHVA 4LQ1A 3VILA 1ZB5A 3HZ3A 3TTYA 3LPFA 1KQYA 4UCFA 1V3JA 4N0RA 3MMDA 2J7DA 4H8HA 5GNYA 1R33A 1J18A 3VX0A 2ZUVA 4P7NA 4UR9A 1Y7VA 5A94A 4S3KA 2X2YA 1BLIA 1UWRA 2Y4SA 4NF7A 3EJSA 2V38A 1B2YA 3OB8A 2OSXA 1LQ0A 3MO4A 2EPLX 4F9DA 4UQ9A 4MDPA 4Q7NA 1JF6A 3A5VA 4B3LA 4ACZB 3WDQA 4B15A 1FHLA 3EMCA 2EXOA 3ARZA 1GOKA 1L8NA 3GXNA 3OBAA 5C70A 1DTUA 2CCRA 1NARA 1HIZA 3T09A 2X0YA 4J7RA 4IISA 2BY2A 1V02E 1H1NA 1OCQA 1VJZA 1JYNA 5A8NA 1ISZA 3VSTA 1QNPA 4PTXA 5LA0A 5A6KA 1WDSA 3EDJA 2WYSA 4V2XA 5EFDA 3AMDA 2J74A 1J01A 1PS3A 3WL1A 1XSIA 2J78A 1T0OA 2EPKX 5E09A 5D9NA 3WQ6A 2D0GA 2W92A 2G8ZA 4JHOA 3K4DA 1MYRA 4AW7A 2ZXDA 3H54A 1UA7A 4JKKA 3BLPX 1SYTA 1MW3A 2G3MA 3L4XA 2XVGA 4FK9A 1AMYA 2YLAA 3K8MA 1QX1A 5DF0A 1UKTA 3CUGA 4WK9A 1OWQA 3ARUA 1LWHA 1DWAM 2W62A 3A47A 3F5KA 3THCA 4U31A 1JNDA 2GUYA 3IJ7A 1B31A 1GHRA 3VGDA 1W3LA 4Z2KA 1WDPA 1SFSA 4OUEA 4HA3A 2HISA 3ZR6A 2DH2A 3OZPA 3ZR5A 4J3UA 1WE5A 1E5NA 1CXFA 5CGMA 2VZVA 1PZ2A 3W29A 3K8LA 1R46A 2J8GA 1CXKA 2XGBA 3DDFA 3VIFA 2BY0A 4QP0A 2WZHA 4H2CA 3OLIA 3RCNA 4D6HA 1EHAA 3ARYA 3GBDA 4F9JA 4AZCB 1OGGA 4UFKA 3ARPA 3AIRA 3SCSA 3POHA 3APGA 2ZUTA 1MW2A 2XN2A 1EHNA 2X8RA 2NSXA 4JL2A 3WH7A 2XM1A 5GPRA 2XWDA 3N11A 1K6AA 1QHOA 2D22A 4H41A 4FNRA 1ESWA 1LJYA 1WZMA 5A2AA 4UFMA 2VI0A 5A6JA 2MANA 3WEMA 1TVPA 4DM2A 4GZEA 4IPLA 1CWYA 4CU6A 1OSEA 2JEPA 3AIEA 3WMSA 1E4LA 3A24A 5CG0A 2BVYA 3RM4A 1TQWA 2EO7A 1UQYA 1Q6DA 3AQUA 3BAWA 3K46A 1R7OA 3AHVA 2BHYA 2JIWA 4LX4A 2ZXQA 4PCTA 3ZM8A 3DYOA 1HJUA 2X2IA 3CZEA 3MMWA 4ZEPA 2J8FA 4MB5A 4C7GA 5CJ5A 1KGWA 2J62A 1I1XA 3ZOAA 1GPFA 4DWSA 1V6UA 4OBRA 5LA1A 1CGYA 1QBAA 1E6ZA 2XHYA 1QWUA 1EOKA 2BHZA 2B31A 3U5YA 5IXEA 1GNXA 4HMEA 1P6WA 1V03A 4KGLA 4M8UA 1CIUA 3SCQA 5EB8A 3ALFA 1JYVA 2G4FA 4ZXOA 5AYBA 4TTGA 3DDGA 5IFTA 4CCDA 4W88A 2EABA 3CO4A 5IFPA 1HP4A 1C8XA 2PC8A 1CEOA 1EH9A 1QI2A 2A3CA 2VZSA 1TCMA 1GOQA 5HOSA 4WSKA 1CBGA 1UQZA 1WNOA 1F4HA 1QNQA 2OW7A 3CTTA 4Z2JA 3DECA 2RGLA 4P7LA 2Y24A 4GO8A 4Z2IA 3SCVA 5CPQA 2J7CA 1BYCA 4E8DA 2DSKA 1ECEA 3EDKA 1OGBA 1EXPA 2YA2A 2VVNA 3RPMA 3LPGA 4D6FA 3BUPA 1ZBKA 1FP9A 2JFEX 3WFLA 1Z32X 3KZSA 1IV8A 5HXMA 3NSMA 5LA2A 2ZIDA 3BAJA 2YBTA 1HP5A 5BWFA 4DWSC 3G6LA 4W8LA 4HMCA 3W4RA 1H3GA 5BXSA 1NQ6A 1CZ1A 1W1VA 1ZBVA 3ZT7A 1KGXA 3VTRA 1JYXA 1QOXA 3GXFA 4X0VA 4CCEA 2WW5A 1H41A 3B8SA 4MDOA 1A47A 1J0IA 3AYRA 1OBAA 3SUTA 3CH9A 3WD1A 1HKMA 4DO4A 1B3ZA 2WSKA 1B1YA 5A3HA 4P8XA 5DMYA 3N18A 1E6PA 3TONA 1Q6EA 4EKJA 2JF7A 5M5DA 2PWHA 4HP5A 1TFVA 3IAQA 2O9RA 3CHDA 4NZFA 3OA5A 3SUSA 4U5IA 1HF6A 3L4YA 5ABHA 2DSVA 1UWSA 4BA0A 3SUVA 3A23A 4NI3A 3AS2A 1HKJA 3QHMA 3AXHA 5BYWA 3U5UA 2WXDM 2VX7A 1BYDA 2D20A 3MUIA 4TTUA 2PWDA 4RE3A 2GK1A 3WUEA 2DEPA 3FAWA 2DSZA 5A8MA 3ZSTA 4A3HA 4V27A 2YFNA 3OZOA 2GJRA 3TTSA 3PZOA 1M7XA 2PWGA 3ZIZA 3GDBA 4KGJA 4D6JA 4AIOA 4UFLA 3PZ9A 5EMYA 3IJ8A 4TXEA 4AY1A 4JFTA 2HVMA 4V28A 3HU7A 3SCPA 4UOZA 3SCWA 4AEEA 1W9PA 1VF8A 3ZQ9A 3T2PA 1FFQA 2WMIA 2DSWA 4PEEA 2O9OA 3N13A 3ALGA 3NCOA 4HPHA 3AIQA 2WMFA 4GZJA 3FHQA 2VT0A 1BF2A 4PMDA 2CESA 5CPSA 1XSKA 3LRMA 1E4IA 3EDFA 1G0CA 3GM8A 1MFVA 2OW6A 4W86A 4W89A 3AJ7A 5JBEA 4PMXA 2VX5A 4AIUA 2J77A 1E0WA 1GCYA 2VVSA 3OGSA 3BUDA 2WPGA 2Y5EA 3RIKA 1VEPA 3U7BA 3GTNA 4MJ2A 4M29A 1G9HA 1W3KA 1JDDA 1R34A 1OD0A 1UZ1A 4Q22A 1C7TA 4D6GA 3D52A 5I0DA 4M1RA 1B30A 4AZ7A 2GK1B 5BRPA 2OWCA 2VX6A 2WHMA 4PMQA 2X0HA 2WHJA 1HKIA 4PTWA 4NX0A 1E0VA 3SCNA 1XH1A 1TQVA 1LWJA 1V3KA 3AXXA 4DWSB 3W25A 4JZ5A 4GI6A 4AD1A 4GI9A 5E6ZA 4CD4A 4MADA 2IXUA 3BVTA 2X09A 2YA1A 3BSGA 4M82A 3UG5A 1D3CA 5A2BA 1PEZA 3FHAA 1UR2A 2ZX6A 4W93A 2VC9A 1KXHA 1ITCA 4FMVA 1SR0A 1A3HA 1ITXA 1YQ2A 3WUBA 1VRXA 4AMXA 5CSUA 8A3HA 4CD7A 1E9LA 1V0NA 1JGIA 5I24A 1ZL1A 1ODZA 2YKKA 4BQ4A 1XSJA 3N9KA 1HNYA 4EE9A 4QAWA 4U33A 4GI8A 2BS9A 2ESCA 1CYGA 1LL7A 2XVPA 3DYPA 1MXGA 2C7FA 1MVYA 1F4AA 5A8PA 1OIMA 2V5DA 2YA0A 3CZLA 4W7WA 1E15A 1IZKA 3KL0A 1W1PA 3M07A 2WBGA 1V6WA 4PTMA 4DO5A 4FNQA 5KEZA 2XUCA 3W24A 4A3YA 1HTYA 3RO8A 4F8XA 2DQXA 3SUUA 1XGZA 3BLBA 3AS1A 1E4NA 3H55A 2J7GA 4MJ4A 3WIJA 5FL0A 5EBAA 3WF1A 3BUQA 4MNJA 3VPLA 4AD4A 3WNMA 4WJXA 4UFJA 1E6SM 3ARRA 3VIGA 3BVWA 3PZQA 1XYFA 4HOXA 5GNXA 1GQLA 1V3IA 3PZMA 3T2QA 1UWQA 3SCTA 4EAMA 1PIFA 4C7FA 2FGLA 1BTCA 1M53A 4TVCA 1QI3A 2GDUA 3CBWA 4Z2HA 3GXTA 2D0HA 2QMJA 4H04A 3WH9A 2A3BA 1E3XA 2VZUA 6TAAA 3EMZA 1H49A 4HMDA 5A95A 1VBRA 1C91A 4DUXA 1SMAA 1PX3A 1BPLB 1E70M 3I3DA 2PWFA 4MNKA 1MQPA 1KBBA 4CD6A 1JXKA 4AD3A 3HMCA 1KTCA 4LPCA 2J7EA 3VU2A 2QLYA 2ZWYA 5BRQA 1ISXA 4U3AA 1B90A 1K9EA 3W53A 1US3A 5DT7A 4AIEA 4WKFA 3RILA 1MXDA 1UOKA 1GW1A 4EANA 1TMQA 2QV4A 4W8AA 1MWOA 4JFUA 2ZXBA 5D9MA 1ISWA 2E9LA 3PTKA 4P7RA 2JEQA 3FAXA 3ARQA 3BAKA 1ZJBA 1AQ0A 5I3DA 1VIWA 1NOUA 2XN0A 2O9TA 2CERA 3MV11 2UY5A 3ZT6A 2YDRA 4XX6A 3RM8A 4D1IA 1ISVA 4BZYA 2WVVA 5CZKA 3KL5A 1MQRA 3MKKA 3GXDA 3VO0A 2DT0A 2JIEA 1H4PA 3WQWA 2WCAA 3IJ9A 4HPGA 5HBFA 2CYGA 1EQPA 1NH6A 3WNPA 4BF7A 2ZXAA 3BAIA 1RP8A 2WSPA 3ZJ7A 3VDBA 2VR4A 4FLOA 3VIKA 5I79A 3VIHA 3KLKA 2VQTA 2WANA 3DX2A 4ATWA 1DEDA 4KRUA 2J7HA 1BG9A 1Q4NX 1W9UA 3W26A 1J0JA 2ZICA 3BMWA 1WDRA 1CPUA 1HL9A 4UQDA 3NIYA 3HN3A 2BNJA 1GJUA 1E56A 4ZE5A 1TE1A 4Z2LA 3E1F1 3HG2A 3N17A 2WZEA 4U3CA 5E1QA 1QHPA 3ZJ8A 3WD0A 1KB3A 2PBOA 5DO8A 2XFFA 3KWXA 1GZJA 3ARVA 3BUBA 4UQAA 2IUZA 4X9YA 1K9DA 4JL1A 1VFOA 1MW1A 1B0IA 1OGSA 4TOQA 5BXRA 3A4WA 4P7QA 1UD5A 4MB1A 3VGBA 3UESA 4AZGA 3EJQA 4OOUA 4PN2A 1QNRA 3BLKA 4FLSA 1UH3A 4AZHA 3M7SA 2W66A 4H8VA 1EDQA 1GOOA 3CHEA 1E43A 3HG4A 4AYGA 1C8YA 4MAZA 3L2LA 4PYSA 1W3JA 4QCFA 3WNLA 4B9ZA 3BVXA 3TOPA 4GXPA 3AZSA 2WCSA 2OYKA 1KXVA 1E55A 2WLZA 4KMQA 3PN8A 2CITA 2DH3A 3CUJA 2EADA 3GBEA 2CNCA 3AZRA 3WF0A 5FIPA 1UKSA 2E8YA 5AY7A 1GVYA 2WWDA 3B9AA 3LXBA 5HNNA 6A3HA 1R8LA 3N12A 2Y2WA 2W67A 3VMPA 2XIIA 2G41A 1UUQA 2E3ZA 3MANA 4PUDA 3UEQA 1LL6A 2WVUA 1OM0A 2F1BA 2VRJA 2EJ1A 2WKLA 1DWHM 2V3DA 1QI0A 3RDKA 3U57A 3WD3A 1E71M 4UZUA 3EMQA 1LLOA 1CTNA 3VSVA 1E72M 2CBUA 5CGTA 3FXYA 3H53A 3AS3A 2V3FA 2BY1A 3D4ZA 1NWRA 3BAXA 3GXPA 4CN4A 3QHOA 4NSBA 3AIBA 5A8QA 2PF0A 2VR5A 1CXIA 2J79A 5D9PA 3ECQA 3WD2A 3UR8A 3SCOA 5D4YA 5BXPA 4P8WA 3HJEA 1UR1A 3WY1A 1JI2A 1E6XM 2WMJA 5IHSA 3EBVA 3D51A 1KXTA 3K8KA 3WDIA 3WENA 2FHFA 3GH4A 5TD4A 1ZJAA 1V08A 4P8UA 2VX4A 1QVBA 3ZO9A 4XUYA 1E4MM 1HJXA 9CGTA 1GONA 1H09A 3VSUA 4U2ZA 2OSWA 4IUGA 4OBSA 3WNOA 3THDA 2WBKA 2FHBA 2DT1A 2QHAA 1V3MA 3K1DA 1W1YA 5CLTA 1QW8A 4AMWA 4CD5A 2E9MA 2D1ZA 3WD4A 1TVNA 4HOZA 3VNYA 3NDYA 4PBGA 3AZTA 3KEHA 1RD6A 3KLLA 4EK7A 5I77A 4ACZA 1JZ7A 2JF6A 2DDXA 1B9ZA 3ARTA 1TG7A 2VL4A 4GPNA 2OSYA 1US2A 2CIPA 3A4XA 1ODUA 4FNPA 2WMHA 2TAAA 3DX3A 1QPKA 1UA3A 3OGVA 3W82A 1C92A 4UOJA 3SEPA 1GQJA 4TUFA 3VIIA 1EQCA 4CU8A 3FN9A 1IT0A 3CZSA 3VIOA 4JFSA 3OLGA 2XJ7A 1JZ5A 3VDAA 1N82A 2VURA 1UWIA 2XVLA 5E6YA 1VENA 2V3GA 4NZCA 5E0FA 1DP0A 1UD8A 3VGHA 4QCEA 1HXJA 1CNVA 4D71A 2XM2A 2W61A 2E4TA 2YL8A 1OT2A 3ZSSA 1B3YA 2WMIB 2YDQA 4LXFA 4CU7A 3F5JA 3SIMA 1KXQA 1BHGA 1GQIA 3VGGA 3WUFA 4PTVA 3J7HA 2CXGA 2FDMA 1KQZA 3GH7A 2YL5A 1NP2A 3MS8A 3WUGA 1J12A 1JYWA 3LXCA 3BCFA 2CHNA 3CC1A 4URIA 1ZU8A 1UD6A 4MAVA 1BG4A 4TVUA 1WDQA 3EJUA 1W32A 2C0HA 2ZOXA 2C8NA 3WY2A 2BVDA 3CZJA 4PMZA 3RJYA 1CGTA 1CGUA 2CEQA 1E40A 5AC4A 1UWTA 1B3XA 3VGFA 3W28A 1YHTA 1BYAA 4UOQA 4ZE4A 3BSHA 4H8UA 1GJWA 1CGXA 3CV5A 1LF1A 1QWNA 5DT5A 3VIJA 3T0BA 1QHZA 3BAYA 3WF2A 2GJXA 3AIUA 3GXMA 1HN1A 2ZWZA 2F7PA 2BY3A 2D0FA 4M80A 3MUAA 2BXYA 5AYIA 4HA4A 1WCGA 1WP6A 3LX9A 3GNPA 4QFUA 3DX4A 2CETA 2YJQA 4LYRA 3GYCA 1PBGA 2FGZA 4J27A 3ZJKA 2OWXA 3VIMA 3MV01 4B9YA 2X2HA 1C8QA 2X2JA 4FLRA 1C3FA 4OIFA 4FNTA 4GQRA 3VIPA 1R47A 4TX8A 4AWEA 5FL1A 3BCDA 2GJXB 1O7AA 2E8ZA 2AMGA 4Z2GA 4CD8A 3CPUA 7A3HA 2WVSA 1E73M 1E5JA 3II1A 4AZ6A 3I3BA 2XFRA 3VM5A 3BVUA 2YIHA 1JIBA 4UFIA 1XCWA 2DPEA 3AXIA 4LGXA 1HVXA 5CSYA 3BXWA 3AIWA 5HPOA 3WEZA 5JIPA 3WDJA 5A6MA 4AZIA 2IXVA 1CLXA 1OIFA 1I1WA 3SUWA 1M03A 2BV9A 1M04A 5CXPA 4LYQA 3TV8A 1KFWA 2EQDA 1XC6A 2W5FA 1TR1A 3JUGA 1UD3A 3MI6A 4CCCA 1TZ7A 1JI1A 1AVAA 2WK2A 5FOOA 3D50A 4JKLA 1UR9A 4W85A 1J11A 8CGTA 3BGAA 1W9XA 5ABFB 1L0PA 3BUIA 3N15A 5E70A 2WKGA 1GOIA 3TTOA 5I23A 3O9NA 4D6EA 4GIAA 2YOCA 3OGRA 3U7VA 4MPKA 3L4ZA 2JALA 2WVVB 4AEFA 1QBBA 1Q6GA 5DFAA 3WN6A 3CZNA 1LG2A 2XYLA 2D3LA 1TQSA 3MSDA 4PMYA 3TTQA 1TA3A 4MNLA 5A6SA 1BYBA 3ARXA 5JBFA 2WC7A 1HXKA 5IDIA 1W2PA 2ZX8A 3UG3A 1FHDA 1C93A 1FP8A 7CGTA 3AI0A 5KZ6A 4M24A 3WQ8A 1HJQA 2XVKA 2BXZA
chains in the Genus database with same CATH superfamily
3VMNA 4P2QA 3CYVA 4N2AA 4TQPA 3L3JB 2AK4A 2VC2B 3NQ2A 3FT4A 4XAWL 2I25N 3SYPA 2I32A 1R3TA 4DUWA 4NC1E 3G9AB 4F57H 2DBJA 4KUZL 4FG6C 4HJ0C 3X1GA 4IM4A 5GS0H 4YTTA 5CNHA 1A6TA 2CU9A 1DQVA 4NWTH 2PZNA 4XN5A 3SDAC 4MD4B 5AOJA 3DOPA 3LB0A 4YHEA 4UTTA 2I07B 5DYFA 4PJXE 1G7MA 2CO7A 2EE3A 2CPUA 1DANT 4HIIA 4ODBD 4ACYA 3IK2A 3LEVH 4GINA 3N73A 4KMTL 3TBYB 3MUY1 4GOSA 4TUOA 4XMPH 1IB5A 4LARL 4JHWL 5G5IA 1HH9A 3X13B 1V5XA 2OZTA 1IBYA 1ZSHA 4WHYG 2PW1B 1QUPA 5F1IB 1AO7B 4E4PA 1WBHA 1RMFL 2C5DC 2EILB 1QTWA 5LNUA 1EGJL 2KKQA 5C0CE 3DX5A 3UIYA 1UD2A 3BKYH 3ASWA 2YAEA 4Q56A 4HCFA 3EYPA 4M43L 4FX8A 5C9JB 3MU7A 1A2YB 4L8BB 1OF2A 3E6EA 4WW1A 3SCUA 1FGNL 3QORC 4K8RH 5DQ9A 3RWHB 1I9JH 1NLDH 4TNEA 4XZMX 5BXTA 2W63A 3V0IA 2IKHA 1NANI 2WZIA 3SQLA 3W07A 2MNJB 2K7PA 3TP4A 4G5DA 4A7UA 1KCSL 2DICA 1LGVA 1OFOA 1RIHL 3G6DL 4P2OC 2EYRA 2YK1H 3A4DA 3D39D 3MNZB 1J0HA 4S1RL 4UZSA 1G4EA 5CN3A 3S5YA 2BTMA 2Z35B 1RSFA 1X5FA 1Z41A 4PTDA 5M17A 1QBLH 4PB4A 5F9JB 4XB3A 3PBMA 4HZMA 1UQSB 1V10A 1DZBA 1MUMA 1CVRA 4IGHA 4RE0A 1O7VA 3B9EA 1K7FA 2ALRA 4HNTA 4NO5A 2F7OA 3PU7A 2VNCA 1SOXA 4MKMA 4PJHB 5JDSB 4YO0B 1JF1A 3HUJB 4MNQD 1GHFH 1ZOXA 3M1BB 2VDNB 4AL8C 3RWHA 3RPIB 1XZ0B 5GSVA 5I19H 1XGQA 3BVVA 3ZX1A 3TWCL 5DVPA 1GHSA 2R8WA 4NGHL 1TLMA 1CICD 2UWFA 1SYVA 2A3EA 2HPMA 5I15L 1RUAH 1T6VN 1F8MA 1UD4A 1BRLA 4QSFA 3KYNB 4L3FA 5FYLD 4OGZA 1AFSA 3UXDA 3BPOB 3L9BA 3Q1EA 1NFAA 3MBEB 3GUGA 1OT1A 1SM3H 2BGSA 3TQ0A 3STLB 3GG8A 2B0SH 1U2HA 4R4BA 1K8XA 1MCPH 1TIMA 4TNVK 1W5NA 3LLDA 4KTDH 1AZCA 3VKCA 2F53E 2NNFA 2OX5B 3TS8A 1UOZA 4TVDA 5GGSA 3TA3D 2PR4H 2GQ3A 3EJYD 4CQBA 4Z17A 2AK1L 1NWSA 2H45A 1G87A 3TVMD 1W2KT 2IADA 3CFJA 3CXDH 1LRNA 1PZAA 3BP7B 4FFYA 4B9FA 5C2BL 3VI2A 2DQDL 4K55A 4X8JB 2GOKA 2VM3A 3QPXL 2IJ0C 3OX8B 2WO3B 3JV4B 3L3OB 3T0XA 5MHSD 3BISA 5DXWA 3N43F 1GZHA 1BKSA 3KXQA 4YNYB 4Y6GA 1YKWA 3ZWTA 4F2TA 2HJKB 4PJ5E 5CZXD 2ZOOA 4RH4A 4EXKA 2CBIA 4EDWH 3BG3A 3TSDA 4UMGA 4N8VA 2V2TA 3ULVL 8RUCA 3T6VA 4QLKA 1ZA3B 3B4YA 1MY5A 2F54D 2WKOF 2IQ0A 4D1JA 4EN3B 1UT2A 2AXGA 1XXFC 3EGSB 4KNSA 1EO5A 3HIJA 1CGWA 4IOFC 4ZPVA 5HHPB 3AAZA 1DWJM 3MWAA 4BWLA 3KPQB 2EAEA 4LEEA 2BZCA 4NO2B 1C12A 1KBGH 5D7JC 4PJIE 4WSHA 4CADA 2ZUMA 1JD7A 4A4AA 4MCZA 3FJNA 2ASHA 1QRNA 3TA9A 2RGSA 3OQRA 4NRRA 5LNWA 2V5MA 1P43A 2P7TA 2VRQA 4PJCF 1V6YA 1NEYA 4HF5H 2YPLD 1TCRB 4JGJA 1I7UB 4PJ8C 1E4JA 3CHQA 5FB8B 3QUKA 3HF3A 4I0PA 4Q8MA 2ALWA 2ZXEB 5CSZB 1TJXA 1S46A 2KLSA 2YQ3A 4JMXA 2P5WD 3IMBA 2MOGA 3ILEA 2XPKA 4DP2X 3G1AA 5ACZB 3QB7C 1IC7L 1XL4A 3S37L 4HUCA 3HGOA 5EOQH 3W2KA 4P2VA 4MY1A 1G7UA 4WFGD 3WQDA 1FHGA 5ECJE 5C0BD 2OL3A 4D7PA 4Y4FA 1O7DC 4HDIA 4DJDD 1MW0A 2V69A 2C3VA 1QT1A 3V0WH 3PZTA 5JYLA 3THMH 1PL9A 1JZ6A 2VCCA 3LPPA 2YUVA 1OCWL 3CVHA 4X6DE 5IJVA 4OJYA 2FWSA 3MUZ1 1EJWC 1AKJA 1VGEL 3BGFB 2O92A 4LNCA 2DM7A 4Z7UE 3ATAA 3VXUE 5GZOA 3SJVA 3Q4DA 4F2BA 4JTKA 4YWGH 1M68A 3S9DB 3MV7E 2HG5B 1LK2A 4XD3A 2OL3L 4I7ZC 3I75B 1U8OA 4L4TE 4Q6IB 3PY9A 1V7ML 5I1AB 1NGXA 2OV0A 3DYMA 4ODSL 5T1DL 5KVEE 1M01A 5EOTA 5ICYA 4X8GA 1P0DA 2VC5A 5EFFA 2IANE 4MA1C 2NCMA 2EIZA 3FRUB 5BZZA 3VI3E 2EUWA 1DN2A 1VEOA 1VZWA 3CVHL 3IV8A 4JRXE 1S9VB 2NX5B 1OPGL 2YUWA 4PTUB 1DXFA 4HETA 5C2UB 4JTFA 3APFA 4D8ZA 1HHJA 1HE7A 3O4OC 1VJSA 4AIZA 4LS2A 5KSAA 5E0QA 3ZTCC 4JHZA 4LMQI 4PWGA 3KBPA 3ID7A 3DSFL 3EG9B 2JB5H 1YQVL 4NILA 3B56A 3QISA 5DMKA 1GMIA 3W39B 1CR9H 4GYFA 4P2QE 2J6VA 1Q6QA 5ETUB 1QBLL 1EBAA 4X6BA 4BFRA 1A66A 4RNFA 1DUYB 1IILE 3VQ1C 2UY4A 3KCJA 4UQBA 1ZT4B 2BSEA 3IU4H 3SKOB 1DQML 2H4EA 2NOYA 2VR9A 8FABA 5JUEL 2Y7EA 5J5RA 3VZXA 4YVUA 4Q89A 3T6QC 3QCVL 4I48A 4QRPE 5BWAA 3LDBB 4PP1C 1EUUA 1EJFA 4LVEA 5E03A 1TA3B 3INPA 4IGSA 5L88H 2GIYA 1JNNL 3IN0A 5D7IA 4S2SA 2GFTA 3QXVA 1V6XA 2OQLA 3SRFA 4D8LA 1F1DA 1NOWA 1H5BB 1BJMA 1SDDB 2WZPD 3CN4A 5E24E 2REQB 3LERA 2OJEA 3JTSB 5A16B 5A6BA 4WFGE 4Z7UF 1ETZA 1AL7A 2VEFA 4YQXL 1T99A 5EFIA 3CIWA 1EJ6A 3L6FB 3V6BR 3UC0H 2FVMA 1U8HA 3QJFB 4Y16B 3S36X 2CA3A 3N1FC 3SZ6A 2GVGA 3MJ8B 3H2MA 2R0KL 2V68A 3PZNA 4GP8B 1CF8L 4H1LA 4JFXB 5IB2A 3DG7A 1OHZA 1TQTA 1NY1A 4NYUA 2PC4A 2XA8H 3CFNA 4PMOA 6CGTA 2AABH 3U9PH 4J5NA 1UWEL 5I73C 5DFWH 3DHPA 1LO0H 1O7DE 1N59B 5GJNA 4CADB 2Z1SA 2WSDA 4PRHA 4A8LA 4EUPB 2NLJB 4OT7A 2DJSA 3DUSA 3ML8A 4JO4H 3MHUA 1ID5I 3MRRA 4UT6L 4IKJA 4G6KL 4FA6A 2DT3A 3TU6A 3QFJD 4KAQL 4JFHD 4R8WH 5FM5O 4HS6A 2AK1H 4JCWA 3RWCA 4RIRA 1D2OA 4OKVB 4XPBH 3L4CA 3P0VH 5GGVH 4RA3A 3ZVHB 3TZVC 2TRHA 3T4AA 2A3HA 1PDKB 4WW2F 2XTKA 4OUUB 3NQ7A 3WQ5A 4U6HA 4RZ5A 2HTKC 2GTQA 3TCXA 4XWUA 1EUAA 5F7FA 2WNKA 4HUXA 4L8SA 1O6IA 4XNUL 2G50A 3B9NA 1Q7MA 4Q0XL 1WAWA 5IHBA 3UPRB 3QCTH 3U7YL 2G96A 2J4GA 4XUGA 3CFBB 1AFVH 4GLRH 1A53A 2XIQA 1RK6A 3KYKL 5IF0B 3IJEA 1ZLUH 3UTTA 3VMOA 5CBEB 1RVFL 4PTTB 5EU3A 4B9IA 4F37K 2YD5A 1DVXA 4ZMYA 2XLLA 4LSTL 1EX0A 1BVNP 1NDMA 3CVIH 2BDNH 4YCOA 4X22A 4OZGF 2H5UA 2X7WA 1YEKL 4MJZA 5LCVH 4C6KA 3SURA 2CBJA 2EH8L 2IDFA 5D6CA 5C8JA 3SO7A 4JN1L 4HHAB 4C6OA 2IV9A 2GLKA 1UC6A 2MQ3A 4M7ZC 3ME3A 4NQQA 1L6GA 2AJUH 5KAQF 2VFIA 1HFBA 1B6DA 3EEZA 5HUPA 1TJMA 2FO1A 2CE6A 5A2CA 3NPXA 4F7EB 3STZA 1AZRA 1SXAA 2BSBA 1MCBA 4ZTPH 1D9EA 3F85A 4WNSA 3EOAB 4JFFD 5EOTB 5AAWC 2GI7A 1SLWA 5ICYB 1FE8H 4UTKA 2WAHA 1PQZA 3L4WA 4M1DL 5HI4C 2K8MA 2P5NA 3GHEL 3CHSA 5E9AA 4WWOA 1OSZB 1XB8A 2AITA 3AREA 3OMZA 4ZFGL 1E6RA 1SZRA 4O1FA 4YO0A 3I2CH 1UXSB 3QUML 1TZIA 2J47A 4O1BA 3SE6A 5GQBA 4KZCA 5TDPA 5FYJL 2TMDA 2ICWI 3F7RA 4QYOB 3FT2A 5AKVA 3OPZH 5FYLL 5DRWB 4EEEA 1OFQA 4OF5A 4AEIL 1UT9A 2Z34A 4DJDA 3C9NA 4LHUA 1XD0A 4WO4D 3AHXA 1P4BH 2QDEA 2F8VA 8FABB 3VYPA 2DEYX 4J3SA 4QXWA 4XK2A 1S2AA 1NM9A 3PABA 4AZBA 1XR9B 3MCG1 4ONFH 4NQTA 3S5LB 4U28A 1ZFJA 1C08A 1W15A 4LCWB 1RERA 2O5XH 3VXRD 5IVNA 2ZSVB 2D2GA 3I7RA 4W5UA 1IFHH 5F7AA 2QQLH 3ZYZA 4YDLB 5AD0A 4FTVE 2GY5A 4PJ6A 4X60A 3LVTA 4Y2DD 5IT2L 2XVNA 1MDLA 3E3HA 5ECVA 2ZSWA 2FAUA 3FV9A 1L9OA 1YYMH 3CB8A 3QDGA 3MC0A 1J8KA 5KW9L 1GKEA 3QEQA 2CZNA 4YEEA 2FBRA 1G7IB 3AC0A 2XT1B 3GJEB 2N56A 2YSSB 2VAAB 4XBGB 3GJFB 1UA6H 4LJ3A 2A74A 5C8BB 3DURB 1JZ4A 5EEYA 1MJ8L 5HGHA 2N1KA 2RR3A 4N0CC 1D8WA 1TZ9A 1VFFA 1M7DB 1MY7A 3M6DA 2R9HC 4YLQT 3KCPA 3IGFA 3GDRA 4HULB 1K6QL 2PWEA 4OZGB 1OFDA 1PYWB 3L9CA 2QTVA 3TAKA 4G7SB 4MFHA 2HJLA 4FOMA 3D46A 3MA9H 4DOHB 3HAEH 3UF9A 1QBMH 3VM7A 5IHRA 1IBFA 3HC2A 4X6DA 4KXBA 4R97B 4W6XB 3QDGB 4LLWA 4D0DB 2XWJB 2X4TB 3GMOB 3KM2A 3PGDA 4H9YA 1NWUA 1EHLH 1MXSA 4HYWA 4R33A 3RU8X 3RYSA 4MXQD 1FYTB 1JCVA 3BPOC 4W7UA 3B0YA 3E8UL 3SD2A 3NSDA 4MAUL 1X96A 2H1XA 2HN7A 1FYTD 2DQHL 3PWLA 3FT4B 3HPJA 1FVDA 2FYYB 3RJDA 1HINH 1E9YB 1FWNA 5HHME 4GYPC 4IRSB 1M7DA 4QTIH 1F73A 3FN0L 1JZEA 1TTQA 4L4MA 5CPTA 1CDUA 2V33A 4YH6A 4JO5A 3VFGH 2GABA 5GS0D 5TDNB 3ECWA 3WGVB 3LCHA 4OCXH 4JIHA 2W0PA 3D1MC 2CFFA 2AKRB 3I3EA 2WN3A 1FGVH 3NDZA 5FKYA 5AW1B 5CAYB 1QSFA 1XLKA 4NFDA 4JRYE 5FDWA 3VC5A 4FNSA 5LN8A 1KTNA 4FQCH 4B41A 1CD9B 3LY6A 4WHYH 1OCRB 3O6KL 4FEIA 4GKLA 4U05A 4G2AA 3V95A 4WDTA 4KK5C 1FXQA 2O5ZH 5E9DD 4EZLA 3RX3A 3NZHH 3APDA 4MMXC 4P9HL 3WFDL 5GS1C 3B40A 5G4WA 2E9BA 3N1GC 2W95A 2GG1A 4EDXA 3THQA 4IMFA 4DY1A 4JQVA 3D2TA 1XLIA 1QFHA 1FZMB 3UBHA 3UC2A 1JGLL 1H0GA 2APVA 5DZPA 5E8DH 3N55A 4ELKA 3T0ED 1JZ2A 4C59B 1RUKH 4ODVH 1CLCA 1DLFH 1WPCA 4QRRB 4DVBA 4ZQPA 1LE5B 2NUXA 3VINA 4POZC 1F3RB 2NW2A 4QAMB 2BNQB 3AS0A 1KCVL 4HOMA 4IIQB 1EJRC 2YDAA 2I9LA 1J7VR 1RQHA 1GUVA 3C86A 5AYXA 4CEUC 5C0AD 1QTYT 4JFED 2PPFA 4Y2DC 4M3JA 3SDDB 1AS7A 4IYKA 5E9DA 4BHUI 1QSVA 2XCMC 4V1XA 2Q8AL 1TSRA 3FTSA 1ML0A 3QK0A 4X4XA 1D2KA 1R2SA 2HX9A 4KH9A 3WL0A 3ULUL 1DBAH 3D18A 4MJIA 2JBMA 2E0PA 2PO6C 1QPQA 3W11D 4G8EB 3PAVA 4XP5L 1G01A 4OI8A 1SJAA 2Q8LA 3UFYA 2Z7KA 5LUMA 2F68X 3L9RB 2KL6A 1X8CA 1E4WH 1ZRQA 2WBXA 4M7JL 4FOJA 3C8KA 5CKAA 3MWCA 3WBDA 5I2UA 1JPEA 4Y5XC 3RVXD 3BD5A 5F7HA 4UM9D 3V0TA 3FYYA 1QKZH 1AE6L 2GJ6B 2Z1PA 1G1YA 4JK0D 2WNWA 2QCNA 2H47C 1KM2A 3S5OA 3G5XB 3SDXF 3KLHC 3KRZA 5FJRA 1G94A 4M56A 3SDDA 2NT0A 4NIYE 2HLAB 3ARSA 1TTJA 4C6IA 3QYSA 3PPSA 2BH0A 3JWOH 5DMIH 2TSAA 5B1JC 2F6XA 5FYLH 1EGVA 3L4TA 3WKZA 5XIMA 3EWUA 2N1TE 3PZGA 3BZFA 3SN0A 1GZPA 2BCKA 2Z4TA 2IC2A 2UZ9A 2A9CA 3AMCA 1H6TA 3EJCA 1DEEA 4NU7A 3C2EA 5C0RH 2VHLA 3S1GA 1A64A 1AD9A 1I85C 3OHXC 3UYPB 5CCKH 1HJBC 1P48A 4XBKA 2AW2A 4NAQA 4M1DH 3UADA 2WM0A 5I3GA 4BDVB 1FPTH 5T3ZL 5L2KD 1XV8A 2Q7AA 1NBVL 1NUGA 3AG1B 3L3HA 4MS8D 5MENE 1ZBWA 3MDUA 1CLVA 3KOYA 2D3NA 3UZYA 1ZCRA 3QV9A 2O5YH 3AQYA 3CV2A 4L1WA 4XAPA 2QPDB 2HRGA 1XRVA 4K7PH 5E95B 5GRJH 1CFVL 5CEZL 1U95A 2GDVA 2G9KA 3PDDA 2PDCA 2VDGA 5BOZG 5D33A 1LQSR 1YLBB 4HIEB 1EP2A 4XZBA 2SEBB 4X83A 2C79A 4X3ZA 4Y2DA 1D5MA 2C0AA 3TNOA 3HI5L 3PQYA 1AZUA 1DQLL 4LLDA 1TWSA 2MPAH 2EH8H 1MCHA 5E4EB 1KCRH 2BVUA 3VXNB 4ETYA 5B8CB 3MRJA 1FWEC 2X7VA 4YDKL 2DORA 5C6TH 3GY1A 3WS3A 1NAKH 2JH2A 3PVFA 4UMSA 4OOZA 4H83A 3O16A 2CKSA 5INDB 1OE3A 1S9KC 2I26N 4JCMA 5LBSA 3ULSA 1JN6B 4QXGL 5IB3B 1V7NL 1XF1A 3KH4A 3S3BB 2I7GA 3A22A 3ES8A 4S2CA 3QQ3B 2H6PB 3QC6X 2G2NA 4LAUA 2UY3A 4MSWB 4OBTA 1TYRA 4DPCX 3VYLA 3KR3H 1QSZA 3B7TA 4KKNA 3MNWB 3T6CA 4LU5L 1VACB 2XIMA 4HK0A 3CBKB 4XN8A 4DESA 5LCVA 3K71B 2CHWA 4XN1A 5GNYA 3TH6A 4J3WA 3NZHL 2F7QA 2GSIA 3WHE0 4MJ5B 3F58L 4QEGA 2F15A 4B27A 1MAJA 1FCQA 2YXXA 1HDMA 3GF8A 1FZKA 3UJSA 3D4GA 1GOWA 3RPIA 3N0AA 3BUYB 4E9WA 2XH0A 5GGSY 4JTHA 1XF4A 1P1ZB 2C9SA 4FFZL 3PWPD 1X6NA 4M93C 4E5XB 4C7DA 3H26A 2ODHA 2IVFC 3WY4A 1OY0A 1T0NB 1W37A 2X3BA 2IPUG 5AVVB 3RVTD 2C1HA 3EOUA 4APXA 1UR8A 5CJXC 5TDOB 1CD8A 4J28A 3RIFK 5IB1A 2C1OB 3B04A 5JLZB 3QRFM 3ILPB 4YE0A 3U2IA 3IXTB 3GC4A 3WTWA 1KLFA 2JJTC 3SPVA 4ZMQA 2V8MA 2XZAH 4M3KB 1IO4C 2QQ6A 1ZDSA 3UBXA 2XH7A 4AD0A 5JH1A 2PLJA 3N85L 1ELSA 4XPHL 1R5WB 3PPFA 2BVTA 5DHDA 4AYDC 3DFHA 5AKQA 4JKWA 4LCWA 4ZMPA 1CCWB 5CEYA 4ENZA 2P76A 4W7VA 1PLCA 3LZRA 1IWBA 2DQTH 4ALDA 5E0CA 3UTTD 4DFIA 4NZJA 4PRWA 5ALBL 2F6KA 4BZ1A 1BAGA 1T4KB 1E6JL 2A99A 2E6PA 5DGRA 5HJ3B 4X0NA 5KSUA 1FFNB 4P5RA 3GIQA 1FAIH 3G6AA 5F71A 4ZQKA 5TK4A 5L88L 1YECL 4G1EA 2XN9D 4J3XA 4PLJD 4Z5RB 1VYSX 1S3KL 2JJSC 4TUKH 3ZL2A 3BH9B 4JRYD 2NY4D 4H7VA 3B43A 4JDYA 2IPWA 5MEQA 4JQ2A 3QUXB 2NY4B 2VRKA 3QQ4B 4KCUA 3E9AA 4N6EA 3MFFA 2X6AA 3ZW3A 1H3XA 5D5ME 2VD8A 4DM1A 1ZT4A 4N90D 2QULA 4H2AA 2ZRYA 4AAJA 5IFJA 4YBLC 1LK3H 1SUHA 2HVJB 5T3XL 2AJYH 2VSCA 4ALAH 4H8WH 1REQB 2H2SC 4AD2A 2E6QA 4PVBA 4EI5D 5JO5B 4LESA 3QO1A 4RAVB 1JNEA 2CHRA 3W1PA 3JZYA 5DT1H 3CWNA 5JPMC 2E75C 3DBSA 3WFEH 4GO9A 1MELA 4JM4L 2XI9A 4OGQC 3VFOA 4JJHA 5KWYC 1QUNB 4YGVB 3NCXA 4GW5B 4OT1H 1JNJA 2F8QA 2I56A 3ABQA 4JIIX 1WWAX 1UUNA 4N4PA 4FZ8L 3RXZA 1EHXA 4TKWA 1J1PH 5EO1A 3SSJA 4IPIA 2R2EB 5EIIG 1T5XA 1WXJA 3M0IA 1FWCC 3FLUA 1QI5A 2VN5A 5C09D 1JFXA 1KLGA 1VRSA 2C3GA 4Y9GA 1ZLVH 1TQJA 4OZHA 3CH1A 4G80A 1ED3A 2E4FA 2WJ5A 1HEHC 4IRZH 5KBNC 2P3ZA 1JWSB 3P11H 3CMFA 4IRSA 1WLHA 4KJPC 3ZKQD 1FIEA 3Q65A 4QR6A 3V4VB 3EX2A 1CFNB 3IDYB 3VVVA 3RX7A 1L7IL 4S1SH 1XR2A 3EJYC 3HHRB 4PHXA 4EIBA 1US0A 3SN6N 3WYRA 3ITTA 3S9ZA 4QKTA 5DA4A 1THAA 3IFNL 4KJYA 3SPHA 4OGXH 1QO3A 43C9A 1VCVA 5AVQB 3LMYA 4WXYA 2VDOL 4NEHB 5DC4B 4XP6H 1T66C 1NQBA 3MUHL 4M81A 5FKAA 4FMKA 2BP3A 3ECVA 3MREA 2ZOLB 4YN5A 3VWKB 1MQKL 5K9CA 3Q05A 1WD9A 2G4EA 2VZOA 5JIDA 4LSSL 3GRWA 4GLRI 4PCYA 3N14A 2LAGB 1LWIA 4C1LA 3FUJA 4BCYA 4NGHH 3HZMB 2P1FA 1JRCA 2P88A 1F3JA 4QIRA 2XTJE 3QO0B 4HX1B 4KJQD 4G9FB 3RKPA 3CU2A 3IRSA 3O4LD 3U0WL 3VRLF 5F6HJ 5KSBB 1IGFH 3EO1A 4BQ3A 1XH2A 3C0SA 5CHNA 2K4WA 3HZYB 1MHPL 5C0EA 9RUBA 3SPCA 4JPGA 1REIA 1TJRA 1UP0A 3W84A 3WDPP 4HIHA 5FX3A 4JIPA 1CI1A 1BMGA 4M02A 3O6AA 3W88A 1U8MA 2KLRA 1DJHA 5HDQL 1KM4A 3FEMA 5BZWB 3VH8A 3T8XB 1Q6CA 3FNDA 1HX0A 2WO4A 2YHGA 4WUIA 4YCPA 5KYWB 4LLVB 3ZHFA 1FNEB 4BH8A 3RZCD 1QXLA 1BEYL 2LTQC 4HYTB 4PY7B 4APXB 2PDMA 4R4FL 8XIMA 3UO1L 2VLKB 1XCQB 4FI6A 5CP3A 2XSAA 2JLLA 1BDYA 3E8VA 1IGCL 4PW4A 5C1MB 3UAFA 5MEND 1Q6RA 5G2HA 4L1LA 4F0SA 5KSVB 4IIFA 1F3JB 4C6QA 1HHKB 4GT7A 3ZL4H 1K8CA 3CAVA 3TYZA 2IW0A 3HZVB 1I2NA 1NSNH 2IGLA 1EFQA 4MAYC 2EDLA 4KV5E 5DZLA 3UZEC 3WE6A 1AH0A 2IBZY 4W87A 4WIWA 4P3CL 3L9RA 2XU2A 3PZIA 4DPQA 3FULA 1AH3A 1R0AH 1KIQB 1AJ7L 1KFAH 3Q8AA 3N04A 4XGZA 3LPOA 3QWQB 1KCLA 1K02A 4QYOA 3TFCA 1HIMH 4DP1X 1S9XB 5DHVH 3O0RH 3DO7B 2ZZ4A 2EG6A 3TKFA 3VOCA 5BW6A 1UASA 4N2HA 5IIEB 3MXVH 3X14B 1DSYA 1EEQA 3QDJD 3QSRA 3ZKMD 4AXNA 2R27A 2F18A 5FUOH 4DJEA 3GRIA 5LVEA 2WHLA 3KBWA 1XHGA 1MEXH 2OLHA 2W0FA 3VNDA 2PTXA 2AAMA 2SODB 4R90H 3QYMA 4DPPA 3IU3A 4AQ8A 2YARA 2G75A 4CNIB 5I19L 2BCKB 3LQAC 3LPFA 4XBMA 4A2DA 1V3JA 4JRXB 2XYCA 2BVQA 1KN2L 1Z9LA 1I2QA 1NDZA 3CV7A 1G9NC 5EZLB 4Q97A 3EZ4A 2F19H 1VADB 2DQ6A 3EGXB 3FBQA 3VFOB 2B1OA 2J7DA 1HEZA 3MKVA 2VDKL 1RIUH 1ETA1 4H8HA 2Y70A 3P4OB 3PUCA 3RTQD 1J18A 3W2JA 1SHWA 2D9QB 2DQEH 1KFKA 4MYWB 2GQ8A 3FSTA 4NKIL 3V4UH 2QJHA 5CC5A 3URAA 3NP4A 3QORD 4HT1L 1DQIA 4I2XB 3WFAA 4ENLA 3WK0A 3QORB 1G67A 3M0LA 2M1KA 3KPLA 3P0YH 1UWRA 2Y4SA 4JNXA 3EJSA 4G9PA 3HG1A 4F24A 5AC8A 1QD0A 4AH2B 3SE9H 3OB8A 1SXBA 4HT1H 2VL5B 4BKTC 1GGOA 2SEBA 1AP2A 3PWJA 3E9UA 5K9KB 5JHLL 3SKMB 3B0VC 4DLMA 1JF6A 5LJYH 4XOEA 3H4GA 3ESOA 4M6QA 3LCLA 3V6ZA 5GGRA 3MROA 4NQCE 4QTHA 5MEOA 1FBAA 4L3EA 4HLZH 4Z8FH 5K59F 2P8BA 3MGOA 3WKQA 2R51A 4YHNB 4Q4QA 7PTDA 1HU8A 4UAOC 2E59A 2H3NB 1T6BX 3RG1C 2EXOA 1QAPA 3W72A 1S5VA 4L6HA 4ZBCA 1N6VA 4AJYV 3ZYIA 4P5UA 5CCGE 1ZPLA 1CDIA 4R90L 1D5RA 4FG4A 4HUUB 1QSFE 5TTRA 5IEHA 4FPSA 1G7JA 2BINA 3T09A 3VD0A 4YEFA 4K7VA 2BY2A 2D7TH 1A49A 4AH2A 2OSLA 4NZRL 3QPXH 1JJUA 4IRJB 4RRPM 3SDCB 2PXYC 2ADYA 2WD0A 2DBLL 1QNPA 3EOSA 4AMAA 2AZAA 1F11A 1KENL 1QEXA 2FATH 3WJLC 2V2HA 2QVMA 4EZMA 3EDJA 5F6HI 1NDVA 1R1CA 2NXYD 3A3WA 1ICTA 2D7OA 5IJBC 3FU6A 4ZPTB 1DE5A 2HDJA 3L3OC 3PXHA 3BRGC 1FF5A 2XTJD 4GKTA 1VFHA 1BSLA 2R9HD 4F40A 2CRYA 4Z3IA 4GBXD 4WRLA 5D9NA 3ITYA 2D0GA 3R11A 3DGRA 4Y0GA 4KCVA 4LCIH 2PR9A 3WFCH 4JHOA 3FT3A 3W22A 1ND0A 3K4DA 3BG9A 2VWSA 4AW7A 5TGBA 3WBYA 1UPPA 5C0IA 5C0GA 3FB8B 3ISWA 4XNQA 2ITCA 5T5FL 3SE8H 3LN4A 3WN5A 1JR1A 3PULA 1XQ4A 5DR5L 1LVEA 4QTFA 1MW3A 5JZ7C 2G4JA 4L4TA 3R0DA 1I3VA 5BXFA 4XB8A 4Y19D 3IF1A 3ZDYE 4D8PA 4X80H 4WI2A 4HF5L 2DYPD 2A4ZA 4XC1L 1Q9LA 2I5YH 5E1GA 3K8MA 4ZS7L 43CAB 3VG0L 1QX1A 3CDZB 3IWUA 3PS6A 2E77A 1MF2H 4F9PA 2ZDSA 3QG7H 3CUGA 3BPCA 3HE6D 2XETA 2IWEA 4RMBA 4F27A 1ZHBB 2DEWX 1J9QA 3DK0A 3IFOB 4PBFA 4N26A 5E93A 3IJ7A 5GRVK 1CZ8L 5D7KE 4IQHA 4GAJH 4ZMZA 4AF0B 4DJFA 1Y1DA 1KT2A 3GWJA 1YEHL 1AGCB 1YHPA 5IHUH 2Z1BA 1XIBA 3SY1A 2GK0B 4HFWB 4NHUB 1PYWA 4M7ZB 2BOLA 4HA3A 5ALBH 4KO6A 3S35H 4XNZB 4R7NA 3TNNA 4AV5A 4J3UA 1WE5A 2Z31D 2CO7B 2WLMA 3HQPA 2Y06H 5CGMA 1F74A 2QBWA 5DZVA 3IVTA 2VZVA 2Q7YB 3K8LA 2VQ1B 2XWJA 3GMOA 1AQFA 1EHKB 1R46A 2WINB 1SLVA 3PUOA 1THCA 2GJZB 3CG8A 1N9PA 1CXKA 2AQQA 2QFRA 5FDYA 1LRTA 1ZCCA 3DDFA 4WHTA 3WJWA 3AXKA 5AZ0A 2OXGB 4OH2A 5CD3B 3B8WA 3T9WA 5CR8A 1LM1A 3KHOA 2EVGA 2WZHA 4A1RA 3MRNB 4OJFL 3MJ6A 2VDPB 4HXBH 4WKXA 5LQBH 2A85A 4PJ7B 4M7TA 5FUZH 1I31A 2XY1A 2XN9E 4F7CB 1Z5LB 3GSQA 1GOXA 3VOIA 1GKRA 1AG1O 1EHAA 4F15C 1RJRA 3GBDA 4XZHA 4KMTH 1OKEA 3FF8A 1M1SA 5EC2B 3OODA 4DRSA 4TX6A 4E9VA 1KXVC 1JWUA 2X9WA 3GBMH 4ABQA 4L6DA 3IEAA 2VR3A 3ZO0A 1DBAL 2R2BA 4MMZC 5DZAA 4P5TB 3UAJA 2Z28A 1D7BA 3MRDA 3D3FA 3HNSL 1YDOA 2NSMA 2F38A 1B2WL 1N2VA 1FDZA 2OQJA 3TXAA 3D0LA 5AZEL 4GJJA 1QHOA 1IL1B 3EAUA 5ID1B 1DIEA 4H41A 2P3YA 1IVTA 3BW3A 4X4YB 1LJYA 5F7NC 4KJWC 1WZMA 2W07B 4XOBA 5A2AA 3VCLA 4FALA 1FNGA 4FTVA 4H8WL 5FF6B 4PRIE 4AG4H 5IB4B 5G4HC 4U49A 5E2VL 1QSEB 4AQ8C 1K4GA 2GSHA 1JGDB 3WEMA 4EIZC 4PJAE 2C4FT 3ZLHA 4OCNC 3I6RA 1QYGH 3BTNA 1IEBA 1O7SA 4P99A 5A40E 4N9DA 4PBEA 3SBFA 2ZKXA 1GS7A 2NW2B 1E5YA 1E9OB 5BZWA 3TCLA 2FD6L 3VH8B 3TCEA 2R2BB 3QZBA 5KVGH 4PJCA 5BQ7B 1INQB 4QEHA 2BVYA 3FUHA 4QO1B 3EXJA 1TQWA 2YQGA 1KB5H 5IBLC 4APQA 2QQNH 2OZ4L 5HAOA 1P7QD 5I1JL 1A50A 4B5NA 4IRSD 3X3FL 4RRPA 5ICZA 1MREL 2GFBB 2QZQA 4Q74A 1Y65A 4R4ND 5DXYA 5KSWA 4K3JL 5AYYA 4LRIC 1TV3A 2B4CC 2ZYIA 1OADA 2BP5M 1NMAH 3CZFA 4FXRA 4ZEPA 1JRHL 2DUXA 2UV3A 4ERGA 2GITA 1I82A 4OTKA 4QRPA 4X4ME 4DAIA 5CJ5A 4NOFA 5E6RB 1J5TA 3W9EB 1A7NH 1UB3A 2LLNA 3G04A 1V6UA 2GZXA 3OXSA 4OBRA 2ZCGA 1O5PA 5LA1A 1WGOA 4Y9BA 2XPGA 3TYFA 2QADD 3MJ9H 1F76A 2QSCL 5TJWK 2B31A 1EXUA 4FCAA 3E96A 2ZAIA 5IXEA 3JWOL 2CLLA 4AZ8A 2J88H 5HGAB 3RDTC 3LVEA 4UTCA 3ALFA 4OFDA 2GFBA 2R2HA 3C0LA 3MQIA 2G4FA 3RDTD 1KMGA 4Q8PA 1PG7W 3B83A 4ZXOA 2XWTA 3EGSA 4G72B 3ESPA 1TJGL 1GJPA 3B2UC 3CO4A 3AFLA 5IFPA 2VGGA 5EV7A 4W9TA 4RFOH 2HZHA 4L1HA 3RWFA 1CEOA 1QI2A 3G8RA 5I6XC 1GOQA 2I9TA 3ENEA 5H2BA 5J3HC 1XCFA 1UCBL 4MCZB 4R2GB 3NCEB 5AWNL 1WNOA 5A43C 2YGYA 3L2IA 4NLHA 4N02A 1J8HB 2OW7A 3IDGB 2PP0A 3CTTA 4YBHA 2W0KA 1PG7L 2B4CL 1BYOA 3OVUB 3PGCB 3SIKA 1HO1A 4PUKA 4XNXL 4QT5B 4GO8A 3KPMB 1N8OE 1NPNA 2H26A 5CPQA 3T8LA 2HT3D 4C6JA 4DHLA 3QIWC 4E41D 4K3JH 1YEGL 1BYCA 3EPOA 1UADC 1T7LA 4TO8A 1ZJIA 3STLA 2CDGB 2FWLB 3QJUB 1ADDA 4IDJL 3BQ6A 2QCDA 4E8DA 1OAUH 4ZOCA 5B1AB 5CF3A 1M4KA 5KYUB 4C6MA 4XP9L 4IFOA 2D7PA 4LDEB 4G1KA 3MJMA 1N26A 3C87A 3PWNB 4HJUA 5HGBB 3FSOA 3QQ1A 1A9EA 3ZDXB 5FGCB 3G6JA 4NCC2 2CU0A 4NQEE 1FP9A 4QYAA 1QNZH 3TW6A 1HNGA 5IM7B 3N25A 5K7JA 3NCMA 3ROOB 2B16A 3C5SA 4HH8A 4IMCA 3BN9C 2WYIA 4OJAA 4BY3A 2LU3A 3T1FA 1AJ0A 3G6JE 4H7ZA 4R5EA 3D0LB 3KXFD 2CNZA 3HPXA 1IMHC 5I02A 5H4ZA 3HFML 4IMKA 2R0LH 4DWSC 1F6AB 1HCYA 1JRHH 3OPZL 1IAOA 4BFAA 4HMCA 5C0AE 4ZRGA 3SDYL 3QIUC 4ZXBA 1JVNA 5IEHB 3W86A 1JHTB 2VLJD 3NQGA 1VCBC 3PP3K 1TJ1A 4AKPA 1W1VA 2Z65C 3WEXB 4JIQA 3NZSA 4LAJH 2EIZB 5IG7B 4JXCA 2R8SL 1BA9A 2XV2A 3CFDB 4NZTH 3GQFA 3GXFA 4YK4C 4E9SA 3QWNA 3Q6FB 4FERA 1DVFC 1MIMH 2ZWNA 1P1ZA 3BFOA 1A7BA 1KPVB 3RBGA 4BE6A 4POZD 4LE8A 1AJZA 1U2CA 1ZHKB 5E1HB 3DUUA 4RAUA 3L0KA 2BNQE 1XL6A 2FJUB 2QIIA 1EAJA 5LGKA 3CH9A 2NNAA 4APQB 4KMLB 3E49A 1B3ZA 2WSKA 4LZKA 2R1YA 1XIEA 3WZ0E 3M8OH 1I7UA 4APQD 1R6VA 3L7EB 4XCCL 5DMYA 1E6PA 1Q6EA 2YD2A 2RFXA 3RWDB 5E2TH 4G7YH 5ICXB 3VD2A 3U2CA 3DDMA 4JO3L 4HP5A 4I13B 4L1TA 5D9SA 1XIIA 1YN6B 4XCYA 3CHDA 4C4KT 3WO4C 1VS1A 4NKCA 3OA5A 5C97A 3SUSA 4JFQB 2YGQA 3IFLL 5BNKA 2B9AA 4XXDB 2J13A 4LDCA 1VHNA 4NQDA 1UXSA 2E47A 2REQA 3SUVA 1DIKA 1BZ9B 3B03A 1ZGLA 5GGQH 4UT9A 3SE3C 4YS4A 1N18A 3QGAC 3MPCA 3BQUD 4NVTA 5BYWA 2HWZL 3EOTL 1C29A 2FZ9A 2J8UE 2WXDM 4ONGL 4JYFA 2D20A 3CN3A 4HKBB 4W9KC 4LEFA 3UBFA 3B9KA 2PWDA 1WC7B 1R5YA 2MNRA 3IDJA 4TTUA 4C60A 5I26A 4QXVA 2WXHA 2ZNWA 3VGAC 1A1OA 4YSDA 3X17A 1D3HA 4H8PA 2VC7A 2Z1XA 5DMLA 2VXUL 4JO4L 5CU9A 2IQ9L 5IT2H 1TZGL 4A3HA 3HMWH 4S3GA 3D7PA 2K3TA 2G3ZA 1J9CT 3GDCA 4G43A 4I77H 1J8HA 3O3DB 3F1QA 4OJDH 3BPNB 2GJRA 3CHRA 3BRFA 2P8PA 1I8AA 4W4OC 2OFJA 3BK0A 3CX5J 4NPYA 5EBMB 3TZNA 1E67A 4NSKB 1X5ZA 4U1MB 4D6JA 4XNMB 5SWQA 2M2DA 2Z8SA 2GJZA 1F3TA 2XA8L 3RUGA 1E0TA 3OEXA 3CPLA 5DI8B 1I8MB 1H1YA 1MJJA 3DG6A 4W9ZA 4L8SB 3S5SA 3RVTC 2FB2A 1G9NL 1IGIL 2OGYA 3LN5A 1J5HA 4CVXB 4Z77B 1NCDL 5EIIB 3ISYA 3MV8D 4GAJL 2HVMA 4GABA 4JTSA 4LBRA 1RA0A 4ROQA 1M7IB 3BANA 1H3PH 4H7CA 4N8CH 4AEEA 1U21A 1VF8A 2VM8A 4PVLA 3IJLA 5MKGA 4KK9C 1OANA 2CKBA 1OAKL 2WMIA 3G08B 1A4KA 3Q67A 3V4BA 3H8AA 1H5BA 2O9OA 4MMXB 5FKPB 1TPB1 2OQYA 3N13A 3VXPB 3LB6D 4R7OA 5D37A 4EPDC 3H9SA 5C9WA 3BCJA 2J6EH 3X11A 1I3GH 4KHTH 4GD0A 4GEJA 4BZ2L 4Q8TA 1D6EB 5C7VA 3VXSE 1GS6X 4UDTA 3CC5A 3QJFA 3EADA 4B3EA 3MA9L 3BW9B 1ZT7B 5F1IA 2CESA 1R3LB 2Y5TA 2OODA 5CPSA 2A9NH 4JAMB 3EDFA 3S1UA 3GM8A 5CEXA 5KSBA 3HPJB 5B38B 1TVBA 2QGYA 2XH4A 4AVOA 2E56A 4CVXA 2MOQA 4AL8L 2H8PB 1X1ZA 4A2RA 1GCYA 1OP9A 2JCCA 5EMJA 1OF2B 1LL1A 1A4BA 1Q0XL 3HNTL 4YX2H 3WAJA 1OSYA 4ACTA 3GR8A 1NIUA 2Y36L 4H0HB 4HKJA 1B2WH 3VFVB 3V4PB 1THFD 3RIKA 1OPGH 3KGRA 2QQLL 1KG0A 1XH3A 1KENH 5C09B 2UWEB 1G9HA 4MPQA 3UXAA 2I9EA 4PJAB 4Y7MA 1R34A 4PJIF 4Q22A 1ZWIB 4HEMA 5D09A 1J1OL 1BQKA 1NBYB 1U93B 2EXSA 5E4AA 4WHCA 3RGVC 3RVXC 3UCRA 4DEPC 1XUZA 4JANA 1I45A 1UIPA 2W65A 1UFUA 1UACL 3QZOA 1LTXA 3UG8A 5C3TA 2GK1B 3B5TA 3VXME 1VGEH 3WHE1 3REWB 3SQBA 4PUBL 2VX6A 2OYPA 2OSLB 1I7TB 2WHJA 1EAQA 2V8LA 2FLMA 4QF1A 1QWHA 1HKIA 1E0VA 3U30C 1R0AL 3SKJH 4PTWA 3V0SA 5AUMA 3TIEA 1PSKH 4HV8B 1IGML 3I6LD 3UROR 4B95C 1FN4A 5FECB 1A80A 3P62A 1D5ZB 4N2DA 3NL5A 1ZCOA 1K5NA 2FUTA 2VJ0A 4X7EC 3TVMC 3CX5K 3P3UA 4GUCA 1SN0A 4MNGE 3RGVA 1TPC1 3BVTA 2IXUA 3GSXB 2BSDA 3BSGA 4M82A 4LV4A 2KDGA 3GIVB 4R7VA 2ATAA 4EQ2A 1PEZA 2X5PA 4FP8H 1UR2A 3LLXA 4P61A 1TPEA 3QM3A 4GUHA 2ZX6A 2UUDK 1Q0EA 4LCUA 4G2DA 5E5MA 4HNCA 2DMGA 3AQZA 3GI9L 1MUJB 1MMFA 2Y3NA 1N67A 3FFCA 1SF5A 5SWZD 3KPSA 1ITXA 1A21A 2K6ZA 3QRGH 4CSTA 3KJ4B 1OYAA 1E42A 1M9SA 3CL6A 3WUBA 1S38A 3QEGL 3OA3A 4PGDB 1LWRA 3ORWA 2DWDA 4GMSL 3NOIA 1ODAA 1YMHA 3LOWA 5I24A 4IIBA 5AB3A 4JR9L 3S34L 4FLHA 1ZL1A 4NPYB 1WBXA 2ICWB 5AW7B 1XS2A 2NPLX 3BN3B 1PXGA 3U1PA 2PDHA 4ZW3A 3QHTC 2IPTH 3FT2B 4TVPE 5DYOB 1AZ2A 1MDRA 2B1AL 3N9KA 1U3HC 1DBBH 4QAWA 3VI3F 2FJFB 4JFZH 4KT2A 4YXLH 1R9YA 4N7QA 2VLKE 4B5WA 2ZCKH 3GIVA 5AHIA 5T5FH 1RQ5A 4N2YA 1IM9A 2HN7B 4EJ1C 2BS9A 1CYGA 3I02A 1LL7A 1OZTG 5K4XA 1P7KA 1Z9SA 3RTQA 3KS6A 3T6XA 4LF1A 4JFZL 4ILDA 1MQKH 3UABA 4HKXA 3ZBMA 4C6BA 5A8PA 2Y89A 4JZJB 4KZDH 2V5DA 3LXUX 1Z2KA 5DK2B 1IGMH 4LUTB 3BPNC 4LCIL 4ODUA 1A5NC 3ZE2B 2NYYD 3ZU8A 3G08A 1IZKA 4PJBA 3UJJL 5F89A 1RXLA 4UF7C 5J56B 4OGYL 3ZGHA 4HWEH 3M07A 2GCYB 3MUGA 1V6WA 3IDMB 4H8NA 5D7LA 2X4OB 5H8DA 4PTMA 1GC1C 1NAMA 1IHIA 3QRLA 4FNQA 4AVKA 4NKOA 1CLYH 4M62H 4A3YA 3VFNB 5F6IC 1MCPL 1T80A 2EIKB 4S3BA 4ICCX 3ABGA 3W53A 3S0CA 3FA5A 4S23A 3EGDB 2MKLC 3LYEA 4HIPA 2LU5A 1QMLA 2Y6ZA 4KTEL 5F7EH 5IROD 4K8EA 1GW0A 4JDEB 1EQWA 4TR9A 1DJWA 4XSMA 5CN1A 2P8MA 4QRRA 1ITBB 3BUQA 3WF1A 4MDJA 2VDOH 4HKJB 1KTJA 2QDGA 2IAMA 4OD1L 4JGDA 1KCUL 4JN8A 2VGLM 4AQ1B 1QQDB 1R3JA 1TDQA 2IADB 2IXQA 2VC2H 3CFJB 3DPDA 1E6SM 3UOAB 1RAMA 1XIMA 3R89A 3VIGA 2OX1A 3GMPA 2K4AA 3W02A 5GNXA 4ADIA 2ZKHH 2V7NB 4PRNB 5BMWA 3GZ3A 1LLAA 3T2QA 1GGIL 3LGEA 1BXVA 4YHYB 2W79A 1MPAL 2HA1A 1PIFA 1AJ2A 3OVPA 4DKFL 1UVQB 3CO8A 1IVLA 1JHLH 3QNYA 1E3FA 4BSWB 5J6HB 2GDUA 3G5VA 2FEDC 3QW4B 3WLTA 5KZMA 1M2VA 1I7ZB 3DRQB 5PCYA 1Q4WA 1CLOH 1UOWA 4CW1A 3QUMB 4J3ZA 3DFYA 2Z0UA 1KCSH 1BM3H 1T22A 4N20A 3QEHA 4H04A 4WUUE 1Q9LB 1ADQL 2EDMA 3WH9A 2ZPKL 3TN6A 1YXDA 4H26A 4CJ1A 3WLWD 3MLRL 3TXZA 4N2IA 4DJDC 5FDWB 4C4BA 4HMDA 5AALA 4Y5VB 2YPKA 1T89A 3N44B 1IGIH 4UIMA 1YEEL 2HPIA 3DLQR 4MA3B 4N28A 3I9PA 1L9QA 1XIWB 1AYRA 5ALCL 1PX3A 5SX4I 2OTDA 1YRKA 5JR1H 1E70M 1AY1H 1XIWD 2PWFA 5ESAA 2EXYC 1GGUA 1N6UA 2P28B 1JP5A 1MWAL 4J12A 4KRPC 4NLAA 5DVKA 4LF2A 3KPSB 4BKNA 4FF7A 4KWOA 3U2SB 3O45A 2J6XA 1HAUA 4XVDA 3BUTA 4O51A 1OD7A 4NWUL 3KS5A 2WXJA 4R7NB 3TNNB 1A1MA 3WUWA 3S5LG 2AGKA 4QHLA 4W6YB 2QLYA 5AVSB 4QGYA 3Q01A 1OSZA 3IYLW 1S8DB 1B90A 3QNFA 4KVNH 4B7IA 1T1WA 2E6DA 2XKNA 3O0RL 4WKFA 1ULVA 1SJCA 4OCSH 4DBSA 4P4KD 3QRHA 3QJTB 3R0UA 4JX4A 3BKCL 4ZD3L 1NJ9B 1S7SB 3HNTH 5D1ZD 1MXDA 2CALA 4P4KB 4UNUA 4JE4B 5EWIL 4E68A 1SOSA 1TMQA 3MLTA 2QV4A 3MRIB 3O41B 4QHMB 3ZL4L 2HFEB 4JFYB 3V0WL 1XIWA 2WOQA 2VMJA 1LK3L 1QLEH 3EFFB 2YCJA 3HV8A 4XPAL 1NICA 1P6AB 3WHXA 4DTGH 1GY2A 4YJZL 3C60C 4G8FB 2JEQA 2MPAL 5BV7H 3FAXA 3ARQA 4BSJA 3S8GB 3TWCH 2CZVA 3QXBA 2X6MA 4OVUA 4LLDB 1MCOH 4O1DA 1A1MB 2XN0A 5LLIC 3OD3A 1NQKA 5F89B 5GS2H 5L4JA 1O12A 2NLJA 1A3LL 3PNRB 2BZNA 1TENA 5E4EC 2Y0SA 4K7FA 5TF0A 3TX4A 4ORGB 3I6SA 1GYUA 5LDSA 3DFPA 3QEGH 1KZQA 1EV2E 3RM8A 3HAEG 2VSDA 3DV6B 4D1IA 2X0UA 3AUVA 3PJLA 4JQVC 2H32A 3QQ3A 2W9DL 4B6ZA 1OGAD 5FYJE 2ERJC 3KL5A 1MQRA 4OUUA 2NQ3A 2CDEB 2OO6A 4KFOA 5SWZA 3HQNA 2OMNA 4P3WA 3K13A 1FH5H 2JIEA 3KLAA 4IIDA 3WQWA 2WCAA 3IJ9A 5JXEA 5I0WA 5HBFA 1EFXD 3ZHNA 1VF5C 3MBXL 3RIAK 2BZ7A 4J6IA 1XLDA 2PDUA 3MOQA 4IJTA 4HS8H 3QXUA 1YDPA 3GMNA 4KFNA 2IAMB 1HGWA 2B3RA 2ZXAA 1QOKA 1F6FB 3CXFA 1RK5A 2NXIA 3S1VA 2WSPA 5J7CC 2IAMD 3MLUH 4ONVA 4JHUA 3RITA 4PRBA 1BD2E 1X5MA 3KM8A 4B5SA 2VR4A 2SFPA 1EKOA 1XIJA 3CSPA 5I79A 1L7IH 1YY9D 2AJZA 5AW4B 4Z0XB 2VQTA 4O02H 2WANA 5IB1B 3DX2A 2BFVL 1ML1A 4RV3A 1NDYA 4OGXL 2J7HA 1BG9A 5I82A 4C65A 3F58H 3L7FB 1U8HB 5GRJL 3CS2A 5IKCA 1G4SA 2FYMA 3NSJA 4PB0L 3V4VL 1IAIH 5E2UH 5CGQA 1CPUA 5JXAH 4P9MH 1T7XA 5FA4A 1Y18B 1V6TA 4F80A 3NFNA 1TPXC 5BVPH 1L6WA 1A14H 3MCOA 2HFFB 2P24A 1MI5D 1RULL 1W0VA 4RZCB 5CM1A 5EU6D 1NCWH 3GHBH 1LO3H 3N41F 2VD9A 4ZE5A 1SFTA 2QVIA 3OXSB 1XYMA 4H01A 2X3CA 3N17A 1X44A 4U3CA 1MRDL 4OQVA 1QHPA 5DJ2A 3ZJ8A 5CEWA 5AW6B 1BXUA 3R8BB 4HAKA 1TQCB 1FN4B 4XE5B 3LKPA 5DO8A 2Q02A 3KWXA 4BWWA 2YPVA 1GZJA 3MW7A 4KUZH 2JIXA 1ASQA 4NT6B 5KUMA 4KZ0A 2NW3A 1GQNA 4X9YA 2CJTA 4OUIA 4KZEL 3JV5A 1JPKA 3VFUB 4JL1A 3SYCA 1MW1A 1B0IA 3K2MC 3SJVB 3BKJL 1OAXH 1OGSA 4W4NA 1A6AA 1A4CA 2GJ6E 2WLIA 3RPTA 2JCCF 3MTRA 5BV7B 2PA6A 4YHIB 1GVOA 2ENQA 3GU9A 4S1DD 4B0MB 2BSRA 1QABA 3GUWA 4A3QA 1DSFL 2KHAA 5LIYX 4G9DA 1UD5A 3NJGA 3PYCA 4KKBD 4MB1A 3UESA 3GJFH 5IEKB 2X16A 4GYJA 1BGXL 4LSPL 3ULAB 3GWQA 3EJQA 4QOKA 1JE6A 6TIMA 4DVBB 3WTXA 2FZBA 4MLJA 4N8CL 4M1BA 5G1TA 3GHUA 3PK7A 2MTPA 5DO2C 2W66A 2VN7A 3O05A 4YXGA 3IDNB 4NZTL 1GOOA 2V9TA 1F0LA 4XTIA 4GIPD 1E43A 4Z3TA 3UBPC 2IPJA 1GR7A 4P9HH 2ZCLL 1FH2A 3MYZA 5E2JA 3ZKND 4MAZA 4PH8A 5K33A 1MUCA 4Z0BL 3L12A 1LE9B 4Q8VA 3J27A 4FG0A 4IBYA 3BVXA 1O60A 3TOPA 3QYCA 2ISWA 1J96A 3AZSA 1WZ1L 2Q71A 1AR1C 2BSTA 2X9YA 3VFPB 1RJCA 3VFMA 2AQ1A 3TQKA 4EWJA 5DK2A 1EBGA 4G5ZH 2BC4B 5HHXH 1LEGA 2CITA 2MOVA 4I1PA 2DH3A 3FZUD 3CUJA 4JHAH 1KFJA 3NRQA 5GIRB 3LM7A 3H12A 3LEVL 1MSSA 2FL5A 2QJIA 3RUGF 2PLKA 1E4XH 1KYUA 4ONHA 4ZZFA 5JA8B 1WFUA 5KN5B 4PU2A 3H2NA 3WQCA 1H8LA 3DTUB 3QHZH 1EXHA 3UTQA 2VWTA 4GVHA 3LI0A 3NQCA 5AY7A 2IPUK 1P7TB 3X12A 3B9AA 1ETB1 3TL5A 2BNRE 5JIHA 1MJJB 2VXUH 3FUDA 3QXDB 1GC1H 3PWLB 1WIPA 2CD0A 1XRTA 4NWTL 3AM8C 1H7WA 3ZUNC 3ZDZF 1TZOA 1GWJA 4ZTOL 6A3HA 2B59B 3D85D 2C13A 2ED8A 3DHFA 3HB3B 4JDEA 2Q86A 2ZTBA 1J4EA 2HTMA 5FSEC 4Y1AA 5BRBA 2PCEA 4AK1A 1NFDB 2XZCL 1RZKL 2JJWA 2UY7A 4MA8H 4YXKH 4EN3C 1E5AA 1C12B 4HEPA 1AH1A 1F8IA 1Q65A 1AGDA 3IRCA 4P23B 2B9BA 1X5GA 2VMDA 4EN3D 1RLBA 1R9FA 2E6YA 3DFNA 3G24A 1P5VA 3D8MA 3IJSB 4PJ8B 4OFCA 5EU7C 1U9KA 3H9HA 1VLXA 2F54B 4N6QA 4NNYA 4UZUA 1CW2A 1LLOA 1NCOA 5H94B 1DVSA 3C4UA 4DKTA 1T1ZB 2KZWA 5B3SB 2CBUA 5TQ0L 4E9LA 1BQLH 3PP4H 3FXYA 3FJLA 3NEHA 3PG9A 2YMXL 1OFAA 2YSSA 4MBOA 3TZVA 3UPRA 1MCWW 4UUJB 1G7JB 2FIRT 1UENA 3AS3A 4KI5E 3PWVB 4FQ1H 4DP6X 3I10A 3L5MA 2KZBA 4A3UA 3TJLA 5JHAA 1M71A 3LNEA 3G1YA 4NIRA 5EMLA 4BHYA 1FTXA 2G37A 3QHOA 2JCCB 3GRGA 3GGWB 4CN4A 3B2XA 1TU2B 2CZEA 2ON3A 3CXHJ 3AIBA 4NC1C 5LGJB 1QRKA 5FESA 5D5MA 2NY6B 3NSYA 2X28A 3VXNA 5A8QA 4H26B 5C0DB 2PF0A 2O5XL 2WUBL 4H9TA 1RLCL 4UTIA 4WK0B 1INDL 4P2RA 5D32A 3WS3B 3BIKB 1NUFA 5DRNB 3WTTA 2HT2C 2I9LB 1J79A 3MQTA 4M7KH 4YFLF 3SCOA 4IMKC 3GMLA 1ZGDA 3NZPA 3TBVA 5D4YA 5B7ZA 5BXPA 2VDRB 1E6XM 2WMJA 4NUPA 1EVTC 2PGFA 1Q2SA 3ZE1F 3EBVA 3K8KA 1KXTA 1QLRA 2AQ2A 4KI5C 4A04A 3HE7A 5EORL 1UWGH 4AY0A 1S5TA 5ECGA 2GUBA 2HVNA 3MXWH 5GRUH 4B50A 4Z7QE 3CXHK 3QP3A 1E4KA 1E5BA 4P8UA 4GGHA 4B3VA 3FFOA 4YSUA 2MUCA 3WLNA 2ABBA 5AG8A 1SJXA 3IETA 2NY7H 2QQKL 1XHHA 1PJWA 2FIKA 2DI9A 3MLSL 1TZIB 4WJG3 1GONA 1TPH1 3IARA 1NFIB 2OXHB 3CFKB 3FQNB