2ZWYA

Alpha-l-fucosidase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
442
structure length
442
Chain Sequence
b'RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural Basis of alpha-Fucosidase Inhibition by Iminocyclitols with Ki Ranging from Micro- to Picomolar
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 155
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zwyA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zwyA01
3KE0A 4H7VA 3A47A 1GPFA 3TTOA 2XPKA 2XN0A 1QNRA 1E4NA 2FYVA 4WIWA 3CZSA 4BQ2A 3ZR6A 1E3ZA 3LPFA 1B30A 4FF5A 1V3KA 5E1QA 2WAGA 3CZEA 1NQ6A 4MB4A 1LJYA 1PX4A 3BUIA 3MS8A 4WSKA 1R34A 1W1VA 4LYPA 1EDGA 5AYBA 1W3LA 3TP4A 3WUEA 1HJQA 5I23A 3QR3A 4HZ6A 3U57A 5JIPA 4JIEA 1H41A 3SCRA 2DSVA 3BAJA 3IAPA 2OYMA 1SR0A 2VX6A 3I3EA 1E6XM 8A3HA 3I3BA 4BS0A 3FW6A 1LWJA 3MMUA 5DO8A 1E1EA 3WELA 2A3EA 2VZSA 5DEZA 3D52A 1GOMA 3ARXA 1E6QM 3RCNA 7A3HA 1WPCA 3M07A 3VILA 3DDGA 3PZGA 4AIEA 3BH4A 4GXPA 2WC7A 4U3AA 5JUVA 3VMPA 1E73M 1QW8A 6TAAA 2DSUA 3BVTA 1NP2A 3CHCA 4HPHA 2QF8A 4H8HA 1IZJA 3AZRA 1B3YA 3FXYA 3ALFA 1GORA 3ZT7A 3WF0A 1JXJA 2WMGA 2X2HA 3MUY1 2BVYA 4X0VA 5HDRA 3WDRA 2MANA 2F1BA 2VZVA 3S5ZA 1E5NA 2JEPA 5CGMA 1M53A 1I1XA 2PI6A 5CGTA 5A2AA 4Q7NA 1J01A 4UQAA 1KWKA 2D24A 4S3JA 3VD4A 2ZX6A 3BGAA 1BTCA 1FH8A 1HJUA 1WNOA 2EPNA 2ZUVA 3LPOA 2EADA 4JFTA 1UKPA 3AOFA 3POCA 2ZE0A 3A21A 1L0PA 4X0NA 4ZE5A 3VIGA 3K8LA 5BXRA 1BG9A 2C8NA 4B16A 4H8VA 4PSPA 3EJRA 1Y7VA 1OGSA 1AQHA 5A94A 4FLSA 1UWUA 1TVPA 2YJQA 3U7VA 4LQ1A 4R5EA 1XHGA 3QHMA 1E6ZA 2VC9A 2XJ7A 5D9NA 5BXSA 4W89A 4OZOA 1MWOA 5CLWA 1UR4A 3CGTA 4J3WA 2JIWA 1VENA 2W5FA 5GNZA 1NM9A 5AC5A 2JF7A 4E8CA 2PWEA 2ZX8A 4W86A 1E72M 4RL3A 1UUQA 3HU7A 3WMCA 4AD1A 1UR0A 1PJ9A 1B3XA 4W5ZA 1TVNA 1H2JA 2JALA 3CUFA 2CBJA 1ZU8A 1KB3A 3CMGA 1JI2A 3UETA 3AYRA 5I79A 2D3LA 2XN1A 2YA0A 3WD2A 2VX5A 4PRWA 3MV11 1V3LA 2FHCA 3WUGA 1JZ8A 1TQUA 1F4AA 1CGTA 4D6EA 5GNYA 2E0PA 1VFMA 2WK2A 2EQDA 3WL0A 5LA2A 3WH6A 1JNEA 3WMBA 3SUSA 4ACZB 3SEPA 3ZJKA 3W6LA 3GXDA 1PX8A 1WKYA 2VQTA 2GK1A 1ZJBA 3NYDA 4UZUA 2HISA 2YKKA 1E6SM 1UWQA 1ESWA 1Q6CA 4X9YA 2OLHA 4PMDA 2PF0A 3AMDA 3ZR5A 1J0IA 1ISZA 5A8MA 1W9BM 1WZMA 2WB5A 4CCEA 2Q8XA 4RE3A 3VD7A 1OD0A 4CU8A 1JIBA 3AXXA 2BNJA 1H49A 4W8LA 3WL1A 4MAVA 2YA1A 2FE0A 4U31A 3FHQA 3PZOA 3AIWA 4OKDA 4AMXA 4JFUA 4PCSA 2NT0A 4WLCA 4LXFA 2DEPA 4W8BA 4AZCA 2IXUA 3WH8A 3KWXA 3UEQA 1OCQA 2XHYA 3L4XA 1R46A 4J3TA 5I0DA 1FH7A 3L2LA 2PC8A 2VVSA 3KZSA 1E1FA 1E6RA 1E15A 4FNRA 3PZMA 3EDDA 3GBDA 3WNKA 2EAEA 6A3HA 2WSPA 2GJPA 4XB3A 1S46A 2ZXAA 2WBKA 3NSNA 3ZM8A 1LG2A 2EPMX 1DTUA 4P8UA 1HTYA 1RH9A 1LL4A 5ABEA 1JYVA 1E4MM 3KLLA 5LA1A 3D5HA 1CXKA 2VRJA 4ZENA 3M46A 1EOKA 1HL8A 2CBIA 1HJVA 3SUVA 2F2HA 2DSWA 3L4VA 5AY7A 2QPSA 3HN3A 2YFNA 5BXPA 1OGBA 3WH9A 3OLEA 4KGLA 4B3LA 2YBTA 2WSKA 3VDAA 3GTNA 3AICA 1PZ2A 3BVUA 1J0ZA 3U5UA 4EKJA 1QBAA 1XH0A 3WY3A 3VM7A 3VDBA 3T09A 1JF5A 2JEQA 3WQ5A 2XVLA 1QHPA 1HP5A 1F4HA 1JGIA 4OIFA 3B8SA 3D4ZA 3GH7A 1EDQA 4WF7A 2VZUA 4MNJA 4OUEA 4AMCA 4CCCA 4IUGA 2ZUSA 1KBKA 4IPNB 1TR1A 3MANA 2UWFA 2GVYA 3CHEA 5FIPA 4YHEA 1W3JA 4J3UA 3OGRA 3VIIA 5E6YA 2OSYA 3E1F1 2D73A 4UZSA 1HJWA 2DIJA 1KTCA 1JZ5A 4PMRA 1QNSA 4WKHA 1QBBA 1KXTA 5A6JA 1PIGA 3QGVA 3EDEA 2VX7A 1UD4A 3WNOA 4LPCA 3DC0A 4NXKA 3SUTA 1VRXA 2CYGA 4HA3A 1MW0A 2NT1A 3AHZA 4P7RA 2ZUUA 3GNRA 4AIUA 3IJ7A 1QNQA 4UFJA 5EB8A 1CYGA 1UQYA 3UG5A 4L4OA 1D2KA 4Z2IA 2YIHA 1TA3B 4H04A 5A6MA 5I24A 3WBAA 3VGBA 1HJXA 2E9LA 3K46A 1W1PA 3WEZA 4KWUA 4W7WA 3VIHA 1HL9A 2XM1A 1B31A 3TTSA 3D51A 4QLLA 1PPIA 4CN1A 4H2CA 2XIIA 1JNDA 4K68A 4DM1A 3MSGA 2W66A 1QWUA 4U2ZA 1C8QA 2XVKA 2X0YA 3NUKA 1UA7A 1E56A 2V38A 3N18A 2J7CA 3PZTA 1UD2A 3W24A 3W25A 1ODZA 1KQZA 4E8DA 1HKJA 4P7QA 1C8YA 2UY4A 4EAMA 2XFYA 3O6AA 5BCAA 3RO8A 1V6WA 1Q6FA 4W88A 3DX2A 4DWSD 2J7FA 2FH6A 3WSUA 3LMYA 1A3HA 4MPKA 1FH9A 1K6AA 5HXMA 2E4TA 3A5VA 4N42A 2VCAA 4PUDA 5ECUA 4MJ2A 4MNKA 3EJUA 4AMWA 1PX3A 5I77A 1H09A 3RM9A 4AYGA 2Y8KA 1WZLA 3AI0A 3BAIA 4V27A 1KXQA 1HVQA 1TFVA 2VTFA 3WF3A 2X2YA 3LRMA 2OWXA 3IJ8A 4CN6A 2OSWA 5A6BA 2DGAA 4A3HA 3BVWA 3VGHA 5FL0A 1LQ0A 2X09A 2ZX9A 1WDQA 1BGAA 3AXIA 1H4PA 2WCGA 3NDZA 3WQWA 2PBOA 3B9EA 3WN6A 4ML4A 2DT1A 3AIUA 1GOWA 1E4IA 1JF6A 1XRVA 3GXNA 3UCQA 3L2MA 1C8XA 2J78A 2XG9A 5E70A 2XVNA 1ITCA 1UZ1A 3VD5A 4F9JA 1FHLA 3ARUA 5GQBA 2GJXB 1UR9A 5D9OA 3VO0A 3BVVA 4GINA 2GSJA 2FGLA 2ZUMA 2WYSA 3WH7A 1UR8A 3OLDA 5I3DA 3BLBA 4URIA 5M17A 3A4XA 1CGWA 4NX0A 3PHAA 3CUHA 2CKSA 4YPJA 1ZBKA 2W4XA 1V02A 1KTBA 1V3JA 2EBNA 3VIOA 4TUFA 2QLYA 3VNZA 1VF8A 1BVZA 2EJ1A 2ZXBA 1X1NA 1QI0A 2XSBA 2WVVB 3VIPA 1XYZA 2DIEA 4Z2LA 1BGGA 1W9PA 1XV8A 1BG4A 5DMYA 4MTVA 1W1YA 4UQCA 4ZE4A 1PAMA 3GXTA 4P8WA 1HNYA 3I3DA 1VEMA 5CXPA 4GO8A 3JUGA 3U7BA 1GOKA 4P7OA 3PZIA 3K8KA 1GHSA 3EMCA 2XWEA 2G3IA 4UOQA 1CLXA 3RILA 1NARA 1GQKA 1KGXA 1OGGA 2VI0A 4AZ6A 2XM2A 3WEMA 2J47A 2ZICA 3N04A 5D9PA 3AYSA 4GZIA 3L4TA 4UQBA 3SURA 1TQVA 2ZX5A 4M81A 3RM4A 5D9MA 1AMYA 1J9YA 1M01A 3A6OA 1M03A 4EK7A 2X0HA 4JAWA 1GOIA 1EHNA 4QCFA 2F7OA 3POHA 2DQXA 3PZNA 1TQSA 2CBUA 3IANA 1V3IA 3LXAA 1GVIA 2DSZA 3ZSSA 3KEHA 1PBGA 3DDFA 4JZ5A 3PZ9A 2WHMA 4N0RA 1EQPA 1NP0A 3W28A 3WD3A 4FNUA 3EDJA 3G6LA 4M56A 2E40A 5HOSA 4AZGA 3H54A 2FDMA 3PZUA 4F66A 3VX1A 1OINA 4CU7A 5BRQA 3A3HA 2G3NA 3BCFA 2XTKA 1C91A 2GDUA 1MFVA 3VU2A 2AOSA 1XD0A 4J3XA 3OLGA 1W3KA 4UR9A 4M8UA 1OT1A 5F7UA 4NZCA 4UTFA 3BUPA 3WH5A 3BC9A 2ESCA 4CD8A 4BQ4A 1PEZA 3B9DA 3AHVA 1I75A 1K9DA 3GNOA 5C8BB 2VL4A 1VFOA 3SCVA 5HNNA 1MQRA 5AC4A 4MADA 2CEQA 2F7RA 3SCUA 4UFHA 3M6DA 3LPGA 2J75A 4RE4A 1C90A 4DM2A 5M5DA 1V3HA 2W67A 4GO9A 1V02E 4OBSA 2FHBA 4HOZA 2PWDA 1RP9A 2VRKA 1N82A 3FY1A 1B2YA 4CCDA 3DECA 3TOPA 3AXHA 1CBGA 4HMDA 4TTGA 2OSXA 4PTWA 1B3VA 1UOKA 3AS3A 5I5RA 1JFXA 4TX6A 5JIWA 1ZBCA 3WUBA 1QHOA 1CPUA 4NSBA 1GW1A 2JFEX 3T0AA 1B9ZA 3AMLA 1O7DC 2B31A 2A3BA 4UNIA 1LL7A 3HZ3A 4UQEA 4U5IA 5A6LA 1MW2A 1V08A 3W37A 2Z1KA 1ISXA 2WC3A 4V28A 4MB5A 4ZXOA 3WDQA 2BXYA 4JFWA 3WFZA 1BYBA 1AQ0A 2ZUWA 4S3KA 4C7GA 4R27A 2YLLA 1M04A 2G41A 1R85A 4CU6A 2WZIA 3AHXA 4JL2A 3NCOA 2YFOA 4WKAA 1UASA 2WANA 3L4UA 4D6CA 1CNVA 2J77A 2G8ZA 4Z2HA 2W63A 1H0GA 2YDRA 2CESA 1OT2A 4HP5A 2WCSA 7CGTA 2NW0A 5ABFB 3GXMA 3VKKA 1BFNA 2YOCA 3VMNA 2CETA 1R8LA 1GOQA 1PIFA 3WMSA 3OBAA 1VFFA 4P8VA 3T2QA 4D6JA 2BHZA 2J7DA 5I78A 3GM8A 1BF2A 3EJTA 1RD6A 1VIWA 2D1ZA 2EO7A 2J7BA 3W81A 1BQCA 1MVYA 5A6AA 2PWFA 3AS2A 5ABHA 1OD8A 2WKLA 1XYFA 4WJXA 1C93A 3OGVA 5A8PA 3ZJ6A 4DWSB 1IZKA 1MW3A 4C7FA 5E0FA 5LA0A 1W9XA 1JDCA 2G3JA 3W0KA 4OOZA 2O9RA 2WHLA 4P7NA 1VJZA 5I6SA 2WCAA 4NF7A 3D50A 1LG1A 3AMGA 2Z1SA 1V0LA 2OYLA 1U33A 1IT0A 2CNCA 1DWGM 3VIJA 1GNXA 1CGXA 1WZAA 1W32A 4J3SA 1DWAM 4PMQA 4GI9A 3G6MA 3GDBA 2VUYA 1H11A 1A47A 4MDOA 3PTQA 3LRKA 3DYOA 3W6MA 3EJPA 2OWWA 2IXVA 5BWFA 4J27A 3ZSTA 4F9DA 2CKRA 3WNMA 5M3WA 1VBUA 2WZEA 3BSGA 3ARQA 3W4RA 1CEOA 2J7GA 3CZ8A 2V3EA 1UYQA 4E2OA 3WUFA 1DWJM 2DT2A 3DYMA 2X2IA 2BY0A 1CGYA 2YA2A 3BAYA 3OB8A 3WY2A 4D6HA 3ZT6A 3IK2A 2W61A 1UD6A 3BLPX 5I2UA 4MB1A 1OM0A 3WEOA 1B3ZA 2W92A 3FHAA 1QWNA 1BHGA 1ZL1A 1KCKA 5CZKA 3CV5A 5CJ5A 1U30A 1TCMA 1WB0A 1R7AA 1GCYA 4BZYA 3TA9A 5A8QA 2GFTA 3UESA 4W5UA 4P8XA 3WNNA 1ISVA 1BYCA 4GIAA 3W29A 2E8ZA 1K9EA 4J3VA 1NWRA 4GKLA 4B9ZA 4UCFA 2VRQA 3VIFA 1QI3A 3F5KA 3VMOA 2XIBA 1J0YA 4DO4A 2WMFA 1CECA 1PS3A 3J7HA 2OW6A 1QX1A 4FNSA 2ZUTA 4DO5A 1UR2A 1EH9A 1W9DM 2E9BA 1HP4A 1X6LA 2JF6A 4MB3A 3WD4A 1CGUA 3WDIA 1WO2A 1SYTA 1QHZA 1EDTA 1UD3A 1VJSA 3UG3A 5KEZA 2C0HA 2VURA 3AIVA 4TX8A 2VZOA 2EEXA 2WWDA 4V2XA 2WXDM 2O9TA 3K4DA 4HA4A 2AAAA 5BRPA 1TQWA 3ZT5A 3SUUA 1LLOA 3BUQA 3SCPA 2XWDA 1E0XA 2VCCA 3S5YA 1H5VA 3WKZA 4JFVA 4JHZA 1O7AA 5FCZA 3N17A 4AZHA 2FGZA 4CD6A 2YDSA 3WIJA 3ZO9A 1ISWA 3VM5A 1E40A 3SCQA 1UH3A 4W8AA 3VUPA 4ATDA 1GJWA 5C70A 2VR4A 1FOBA 3BXWA 4H41A 1Q6GA 4UOJA 1J10A 2WBGA 2UY3A 3EJSA 4WK9A 5IXEA 2BV9A 4Z2JA 1C3FA 1WE5A 1ZS2A 3THCA 3AIEA 1GVYA 2VMFA 1ECEA 3TTYA 1UKTA 2EACA 2YL8A 1JI1A 3PZVA 5ABGA 5A3HA 3GXPA 4EE9A 4ZEPA 4XZBA 1CTNA 5CQ1A 3OA5A 1XGZA 3BUDA 5A6KA 5A6BD 3CHDA 4FNPA 3T08A 4OOUA 3T0DA 4GZEA 1QNOA 1OB0A 4PMZA 3ARTA 3RJYA 2VZTA 1HKMA 2A3HA 1XCWA 3HMCA 3VSTA 3AQUA 2J8GA 2D2OA 3AIBA 4D72A 1UH2A 1VAHA 1RPKA 3BSHA 3IAQA 1EA9C 3AHYA 2V3GA 3DHPA 1V6XA 3AFBA 5CPTA 3TV8A 1UKQA 2VVNA 1SMAA 3MSDA 1TG7A 3ZJ7A 1US2A 1W2PA 4JL1A 4DO6A 1QNPA 2BHYA 1HIZA 2YDQA 4UOZA 2XGIA 2J74A 1KGWA 1J0JA 3BLKA 2DT3A 3MKKA 1NOFA 3VPLA 1QI5A 3CZNA 4DUVA 4W85A 3M7SA 1D7FA 3FAXA 2C7FA 4QP0A 2WMKA 4UFIA 4CUCA 3LXCA 4ATLA 1K9FA 5HBFA 5KZ6A 1G1YA 2BY1A 4XZWA 1GQJA 1U2YA 1GUVA 2VX4A 4UFKA 1US3A 4QFUA 4GI6A 1CGVA 2XFFA 3WNLA 1Q6DA 2RGLA 3N13A 3ZIZA 1O6IA 1IV8A 4XUYA 5D4YA 4W87A 3CH9A 3THDA 2V3DA 3K8MA 4MNMA 2WPGA 4NI3A 4HMCA 1UR1A 3N15A 1V6UA 1RP8A 2ZXDA 3A4AA 4AW7A 3CBWA 5IHSA 4AISA 5EFDA 2WMIB 1V6VA 3AISA 3N1AA 1EQCA 1BSIA 1HF6A 4BQ3A 2VR5A 2Y24A 3K4AA 3ALGA 2GK1B 4D6FA 3NSXA 4QCEA 3CUIA 3OIHA 4ACZA 4TVCA 1BYAA 4AEFA 1GONA 3MI6A 5IHRA 1VEOA 4AD5A 1FFRA 2G3MA 3SCTA 4AZ5A 4WSJA 2WMJA 3GH4A 1P6WA 2DDXA 5CSYA 2V3FA 1DWFM 3UR8A 3IJ9A 5FOOA 2WKGA 2D0FA 2J62A 1MQQA 2BY3A 4P7LA 1JXKA 3U5YA 3CZKA 4BQ5A 3W27A 1TQTA 2CHNA 4LYQA 4B9YA 1H1NA 1VB9A 1C92A 1E9LA 1E70M 1XSKA 1V0KA 4AZCB 4PEEA 1H3GA 1B90A 4J28A 3WD1A 1JG9A 5CSUA 5E0CA 3L4YA 2UY5A 3W26A 1QW9A 2ZUNA 3H55A 4TTUA 3PN8A 3WF2A 2O9PA 3ZJ8A 4AD4A 3WQ4A 2OYKA 2F7PA 2EABA 4ACYA 4FNQA 2X1IA 4M29A 4F79A 1OIMA 1W9UA 1W2VA 2D23A 4ZXLA 3VDHA 1QOXA 4C7DA 2BVTA 5JBFA 2XVGA 1UWRA 2J8FA 3AMCA 2VT0A 1MXGA 3MV01 1HT6A 2CITA 4TXEA 1R33A 4GI8A 4CGTA 5C71A 4D71A 2PWHA 1AQMA 5E6ZA 2VNCA 1KGUA 1CXHA 2IGTA 3VINA 3VDCA 2F7QA 2A3CA 1KXVA 1MW1A 9CGTA 2Y2WA 3RIKA 5D8WA 2V5DA 1CXLA 4PYSA 3BAWA 1UG6A 4PMOA 3WDJA 2J79A 2XUCA 1UKSA 3QOMA 2XN2A 1W3HA 1H0IA 1JZ4A 4U3CA 4FK9A 3APGA 1ISYA 5FD0A 4M24A 5IFTA 1E5JA 4UFLA 2J25A 3OZOA 4D6IA 4D6GA 1J18A 3AZTA 1B1YA 1C7SA 4DWSC 5A2CA 4U33A 3DYPA 4OGZA 1SFSA 4AY1A 2FH8A 1HJSA 3ECQA 4PCTA 1JL8A 3WBEA 4PMVA 1WCGA 3SCOA 3HG4A 4IPLA 2D0GA 2PWGA 1BAGA 1SZNA 1GZJA 1G01A 4D6DA 4HA1A 2FHFA 1CXFA 4GZJA 3SCSA 4JKKA 1YHTA 3HG5A 3O9NA 1E4LA 3WQ6A 1CXIA 2RGMA 4GQQA 4HOXA 1UD5A 1HX0A 4FMVA 1TA3A 5EFFA 3SIMA 1J11A 2ZWYA 2WMHA 2J7EA 2F8QA 1DWIM 4AD3A 3SCWA 5BYWA 4KGJA 2PB1A 2WNWA 2WZHA 2VO5A 4IISA 3W82A 4HPGA 1GHRA 1UA3A 3ARVA 4L4PA 1Z32X 5E9AA 3CUGA 4LGXA 1M7XA 3EJQA 3CZJA 1E43A 2W91A 3EMZA 4PBGA 3ARRA 2ZXQA 4QDMA 2G4FA 2XSAA 1JYXA 3IGUA 5E09A 1KWGA 2WWCA 3A23A 3EDFA 3AS1A 3BMVA 4OBRA 1YQ2A 1NH6A 1MXDA 3L4ZA 3T2OA 1FA2A 4AZ7A 4JFSA 2ZWZA 3VSVA 2YL9A 1UQZA 1EO7A 4HZ8A 4TVDA 2CIPA 4HOWA 1ZBVA 3L4WA 4U5KA 4CD4A 3WENA 1PZ3A 4MDPA 4QLJA 4PTXA 4JKLA 2W62A 2QPUA 3LPPA 3OG2A 3ARYA 1QPKA 3PTMA 4AYSA 4BA0A 3VIMA 5A6SA 1UWSA 1T0OA 4A3YA 5A69A 3N11A 1XD1A 1BVNP 2EPKX 1DHKA 1G94A 3MMWA 1V03A 2VOTA 3WQ8A 1KBBA 4AXNA 4XV0A 1JZ2A 1EO5A 1HXJA 3ARPA 1NOUA 2ZOXA 1E6PA 2BFGA 1LF1A 3AHTA 1G5AA 2E9MA 5FL1A 5M03A 2YLAA 1KCLA 4M82A 2EPOA 2D20A 1OBAA 1XCXA 8CGTA 2YBUA 2XGBA 4AZIA 4F8XA 2F61A 1JYNA 1ITXA 1CENA 2J4GA 2X8RA 3OLIA 1OSEA 2HVMA 1EIBA 2GUYA 2BY2A 2CERA 3DX4A 2QV4A 2AMGA 4BF7A 5A8NA 1MFUA 2WMIA 3CC1A 1XSIA 3A22A 3N12A 2GJXA 2DH3A 2DPEA 1R7OA 5GPRA 5CG0A 2CPUA 1DP0A 3VGFA 3EMQA 3T2PA 4AD0A 1FHDA 4AD2A 1SMDA 3ZQ9A 1UKOA 4HU8A 5A8OA 3WQVA 4W93A 1FP9A 2D3NA 3AS0A 4FNTA 1EHAA 3VX0A 1HXKA 1GOOA 5HPCA 2TAAA 2JIEA 4AIOA 5DT7A 4ZFMA 3W53A 3KL0A 4NRRA 3VGDA 1TUXA 3NJ3A 1WDPA 3S2CA 4PN2A 1GQLA 2O9OA 3ARSA 1FFQA 3QHNA 2WVTA 3BAKA 1B0IA 2Y4SA 3WF4A 1XC6A 2X2JA 3VIKA 3NIYA 2DSKA 1K9TA 2DH2A 1CZ1A 2WVVA 3WDPP 1TZ7A 4A4AA 1BLIA 2WC4A 3HG2A 2CCRA 4DUXA 2XYLA 1JFHA 1V6YA 3SUWA 1JDAA 5FKYA 2E8YA 1QVBA 1GQIA 4EANA 1DWHM 1V0MA 5A2BA 4KRUA 1ODUA 3AMKA 1JYWA 1NOWA 2A3AA 4Y7EA 5IFPA 4CVWA 4HZ7A 3CZGA 3T0BA 4W84A 2QHAA 5CPSA 1ZJAA 3AIQA 3CPUA 3O2LA 3BMWA 3HG3A 2WLYA 1HKIA 5JBDA 1MQPA 1R87A 5BROA 4AWEA 4HU0A 4GQRA 1AVAA 1UWIA 2GDVA 3QHOA 3VVGA 4WKFA 2NSXA 2Y5EA 3AZSA 3RDKA 3EDKA 4OJYA 1EGZA 2CXGA 3LRLA 5LYRA 4D1IA 2CHOA 3ZMRA 1UWTA 4BCEA 3KLKA 1R75A 3GBEA 1VBRA 3B9AA 3AIRA 3MU7A 1WZKA 3VTRA 3CTTA 4TVUA 2VCBA 4PSRA 3LX9A 2PBGA 1L8NA 1JZ7A 4JHOA 2QMJA 1WAWA 1CWYA 4XX6A 3WY1A 1KQYA 2YL6A 2WHJA 3NDYA 2YL5A 1CDGA 1VFUA 2BVDA 2WHKA 3VGGA 1KR0A 4FLQA 1ZBWA 4AZBA 3EBVA 4IM4A 3CHFA 3EYPA 1VEPA 2JE8A 3AJ7A 1E71M 1EXPA 3SCNA 3CMJA 1Q4NX 4W7UA 2O92A 1W1TA 5CPQA 4RE2A 5IDIA 1C7TA 2VJXA 4TOQA 2CBVA 4CD5A 4MNLA 2X05A 1UHVA 3MO4A 4NZFA 3F5JA 3WFLA 1W9VA 3GXFA 2WVSA 2D22A 1W91A 2J7HA 3WY4A 1JAKA 1D3CA 3MUAA 3PZQA 3NSMA 1G0CA 3GNPA 2Y8VA 1X6NA 1UH4A 3DHUA 3CO4A 3TTQA 3GXIA 3UR7A 4MAZA 1TMQA 2OWCA 1XH1A 4KMQA 1TE1A 3RPMA 3WDHA 3BUBA 3N9KA 4LYRA 3FNDA 4M80A 3H53A 4JCLA 4YN5A 3AROA 3WF1A 1HVXA 4KH2A 3VD3A 4PMYA 1OIFA 1J0KA 1J0HA 3BAXA 1CXEA 2XVPA 3F4VA 3TONA 1I1WA 2EXOA 3S6TA 4FLOA 3GH5A 1JDDA 2BHUA 3MMDA 4UQ9A 1R47A 2VQUA 4M1RA 2EPLX 1UD8A 3OGSA 3RM8A 4Z2GA 5DT5A 3KL5A 4W7VA 1KR1A 4GPNA 3K1DA 2UY2A 2XFRA 1GJUA 5EBAA 5A1AA 2ZX7A 3A4WA 1V0NA 1DEDA 4ATWA 1WP6A 2V5CA 3D3AA 4PMXA 3DX0A 1BYDA 3CUJA 3CIVA 5ABFA 1FP8A 3FN9A 3VD9A 5CLTA 4HMEA 4CD7A 4QLKA 4MJ4A 3VGEA 4CN4A 3HJEA 2QMKA 1CIUA 5TD4A 3FAWA 1JZ6A 3W38A 1OWQA 5A95A 3DX3A 4JKMA 2ALWA 3PBGA 3ARZA 4JCMA 4PMNA 2OW7A 1V3MA 3RMEA 2BXZA 1G9HA 1XH2A 1EOMA 5HPOA 1JD9A 4U2YA 3ARWA 2E3ZA 1UZ4A 3CLWA 4DWSA 4QAWA 1HN1A 3PTKA 4LX4A 1B3WA 3F5LA 4NRSA 1HKKA 1WDSA 2D0HA 4J7RA 3D4YA 4HTYA 1ZB5A 4CKQA 3QOKA 4CVUA 3UG4A 4D1JA 6CGTA 5D8ZA 4B15A 3BVXA 1KXHA 1JD7A 1JZ3A 4PTMA 4PMUA 1QI2A 4DUWA 4NXSA 1Q6EA 3WNPA 3DX1A 1HWWA 3KL3A 1BPLB 3GZAA 4PTVA 3GYCA 3VSUA 1WDRA 4PUEA 2WW5A 1NWTA 1LL6A 1E0VA 1J12A 5DF0A 2WVUA 2IUZA 1CLVA 4E4PA 4H8UA 4Z2KA 5BXTA 4UFMA 2ZIDA 4Q22A 2GJRA 1JAEA 4AEEA 1KFWA 3MUZ1 4B3KA 2WLZA 4KRTA 1LWHA 4UQDA 3VNYA 1E6NA 3OZPA 3VOCA 3ZOAA 3WD0A 5DFAA 5GNXA 2BS9A 2DT0A 3RJXA 1QI4A 1E0WA 5EMYA 5AYIA 2WM0A 4AC1X 1MYRA 1R86A 1E3XA 4YHGA 2F1AA 3UERA 3A24A 2F18A 1E55A 3LXBA 7TAAA 1NWSA 3BCDA 3CZLA 3II1A 4NZJA 1XSJA 4FLRA 3MUIA 1NWUA 5JBEA
chains in the Genus database with same CATH superfamily
3TNMA 1XCTA 1GPFA 1SZGA 2YSWA 3O4OC 3CDCA 3UJJH 3V52H 4LVHB 2YD7A 3WIIH 4ZMLA 4JFZL 1XIWD 3SYCA 1KXQE 2OSLB 4QDWA 4UUJB 4KO6A 2WQAA 4ZMNA 5J9PA 3O11A 4XSLA 1JGLH 2VX6A 1FQ9C 2X40A 3IKKA 3RIAF 4NHVA 1KLGB 4Z76B 3WELA 5DEZA 4J23A 4M7LH 5IMMB 3NCCB 4ZUWB 3JYBA 4KAQH 3DDGA 1U8JB 3U30B 5CAYB 5E8NB 1G7JB 3IS1X 4LU0A 1RURH 5F1KC 1MCPH 5L2KA 1UP2A 2VLJB 3GVQA 3NQFA 5IFAL 1YTKA 2MANA 5J5RA 2F1BA 4RESB 4N9OB 4NKDB 4IK7A 2NY1C 2BZDA 4BK5A 4S3JA 3VD4A 4HH8A 2WLIB 4GAYA 5I26A 5HYJE 1Q1JH 2W0UA 5K93A 3AOFA 2JIXB 5FB8B 5HHOE 3QWQB 1UPPA 2KZHA 5F9OH 3VNMA 1OWWA 5A94A 4M7SA 4FI6A 5GS2H 2UXGA 3IB4A 4O57A 5DQ9A 1KTLB 5JMOC 3FQ2A 4TUOB 2J6WA 3HU7A 3HPSA 4DEFA 3SDOA 5KBDA 4Y5VA 3VFMA 3W2NA 4FJ6A 2RH0A 4KVCH 5FYJU 3HC0A 2NZ1A 3JV4B 1U8MB 3GSQA 2FHCA 4H9TA 3VGAC 1KYOK 3UBPC 3RUGB 1F4AA 3UJSA 2CAKA 4D6EA 1BFTA 1NCCL 1AP2B 3MNZA 3WL0A 3SKJH 2X87A 3PAYA 1J9SA 4YXKH 1FC2D 1E90A 3NMEA 1AE6L 3QZ6A 4IP7A 1AR1C 2PF0A 1RZMA 1KW1A 2Q8XA 2JELH 5D04C 2VR8A 5CAKA 5C9WA 1H49A 1XINA 3WL1A 4A6YH 3QPQC 4JHVA 4EI5A 3P4NB 4OAWA 5SWZA 2YZ1A 4R34A 3UR5A 4YDKL 5DMIH 3FFCA 5TQ0L 2FX7L 1BEXA 5EWIL 5KSVB 1AI1L 2Z34A 3RE0A 4LKCA 1CURA 4HXBH 1NGZB 3STCA 4X99A 3OX8B 1QRNA 2WSPA 3W7IA 3DX7B 2NNAA 3LKRB 3M1OA 4IOFD 3MV9E 2EEBA 5C0BB 1TEYA 2ICES 4ZTPH 2A0LD 5AAWC 5JUEL 3SUVA 3SYOA 2X1RA 4MSWA 3SJVB 1FIGL 2JVUA 3Q44A 3NZPA 5EN2B 3O1NA 2HMIC 3QV9A 2ZZ1A 2VD9A 1LHZA 4ADSA 2C91A 3MRIB 3QHZL 4MCMA 1OGAE 3NSCA 4MFHA 2GBTA 3D4ZA 5GGSY 3LNGA 2J6EH 2FWUA 3I4KA 2ZUSA 1H15A 4EUPG 3EFDL 5CLXA 3CHEA 7PCYA 4C6FA 5C6MA 4K9JA 4Q4KA 2JCWA 4AAJA 1QRKA 5IW1B 5L88H 4UFJA 4PC8A 2YIHA 1SM3L 1A4JB 3TO4A 4DTGL 3EA1A 4Q4SA 1UTDA 3AW5A 1A5FL 3N1MC 3V4UH 1C8QA 4JHBA 4G82A 1QMLA 1TZGH 4RH4A 2J7CA 1Q3NA 2OL3A 3WUZA 2V8MA 5IBXC 1BXCA 1IBZA 3EF7A 3S6CA 3I6LD 5GJTH 2I26N 3FS9A 2PCFA 4UTHA 3LKQB 3L5AA 4U1NB 1KYFA 1N70A 1O12A 3H2EA 1P0DA 2R29H 4YFLI 3L9EA 1XIFA 3C8DA 5T5FL 1CBVH 5I6NA 2D2GA 4DK3A 1YUHB 3WF3A 3VXRE 2E6FA 4GIYA 3KM1A 1LQ0A 3HFTA 5C07B 1KJMA 3UYRH 5GRUL 1BGAA 3LTPA 3V0WL 3WQWA 5KZCB 5HUOA 1ICPA 3HN8A 4JG0L 3HAEB 1UZ1A 3FH5A 3GS4A 5D9OA 3OMAB 2G60H 4FLHA 3REVB 2G9KA 2MSPA 1E4WL 5CBBA 3C8FA 3UC2A 4OI7A 1RPUA 3QQ1A 5AW6B 1YNKH 2GBUA 1KNOA 4GAGH 3CB3A 3SYAA 4DH2A 3D39D 3D1MC 2P3EA 3WS3B 2JJWA 5DXYA 4OLUH 2A6KA 3UTTE 2NY3D 4PJHE 5CGQA 1G7QA 4NT6B 5CHNA 4ODXB 1PKQB 1Z6KA 5LUMA 5C9XA 4FF7A 1GOKA 4FKHA 5JVLA 1I1AA 4R3SB 4UOQA 1GKOA 1F90H 4A55A 2QGDA 1BWVA 3MLUL 2E47A 1TQVA 4WVXA 4TMPA 1BQHA 3IVSA 1YEEH 4YBLC 1XLMA 3KBHE 3LXAA 3M8OL 2X0VA 3GQYA 2FZ9A 2HSIA 5EO1B 3PAZA 4RGOL 5DWPA 4PB9H 4RZ6A 3G1YA 4FQCH 2DQCL 4ZNEA 1MIEH 4JQIL 4HNVA 4KI1A 3R94A 1BZQK 4UZGA 4XZMX 3L65A 1PYWB 3IDGB 2EG6A 4X9IA 4P3WA 3QG7H 4UTAH 3UXFA 4NJGA 4M8UA 3G1RA 2F5BL 5BU6A 2VL4A 2CLVB 1KYOJ 4HNLA 1W1IE 4MADA 5AC4A 3PXJA 3V7AE 5GRZA 4FA6A 2NV1A 1W3TA 1FZKB 1C12A 3RA7H 3DGRA 4HAFA 3D47A 1NEYA 2V7HB 3VKJA 4XVEA 2ZXEB 1R24B 1MUCA 1KM3A 1WIUA 3QA3A 4ANVA 4X9HA 3FT2A 4WJKB 2OSXA 4JPVH 2V9DA 1TYEB 3X14A 4P23C 1BZ9A 3JV5A 3GRWA 1BJMA 1RD5A 6XIAA 4AT6B 2H8PA 4MM1A 3S4SB 3HZMA 2Y7LA 3C9NB 4LK4A 4DFHA 4YSSA 3WDQA 3FCGA 5IBLD 2P24B 1BYBA 3AAZB 4XCFH 5HHXL 4GT7A 5EUKB 2H3XC 1BZDA 4JQVC 1VBHA 4MXQC 2HNHA 2OX5A 3B0YA 4OLZH 5C0CA 1C5DA 1IGSA 2CRZA 4A7SA 2JKAA 4C1NA 4QXUL 4P3DA 4POUB 3LQZA 3PULA 1TV5A 3W39A 3VMNA 4FQHB 4HLZH 5HHVH 2BM3A 2KS0A 2WB7A 4P8VA 3KCPB 4K8RD 2HXUA 3BLDA 1NFKA 4EMZA 5FACA 4CEXC 2D1ZA 2EO7A 1GYUA 4E2VA 3SE3A 1UJTA 2AK4D 1HKLH 2CJUL 3PAJA 1C93A 1KC5H 2VXNA 3F1QA 3ZJ6A 2MIZA 1MW3A 1YY8B 2VLME 3G7TA 3OJGA 4NOBA 2G3JA 1IGTB 4HVBA 2WP3O 5G4MA 4E42B 3FK4A 3S37L 5AVVB 3VIJA 1FFTB 4J3SA 3G6MA 4L8SC 3LRKA 5BZZA 3MUGB 5DHDA 2OWWA 4ZMYA 3S34H 1HQRB 2X7LB 2WZEA 4YL9A 3FO1B 3R0MA 3GI9H 1Z9LA 4KKBC 4RR4A 3SR7A 4G2DA 1UD6A 1W8SA 3HB3C 5CGYC 3BI9X 4Z0JA 4ZRGA 3CFQA 4WJ8A 2F15A 3UNDA 3RCYA 5D71H 4UMBA 4NJAL 3QNZB 3BDKA 1KG0A 4FQ2L 2VOMA 4ZW7A 5BOPA 3WGVB 4MZ3A 3EOAA 2Z6IA 4B9ZA 5B7YA 1QUPA 4H6RA 3J7HA 3CN3A 3TYEA 1SYTA 2FBRA 2D31B 4YQXL 1YEWA 6FABL 1DLFH 4Y7OC 2OSLA 1X5ZA 4JNMA 4UUJA 1WGVA 1A7PL 1R3LB 2XWDA 4PP1C 2XH4A 1X3DA 5K5YA 2XRAH 3TYFB 4LSPH 4Y5YB 4Q8MA 1KLGA 1KFKA 4Z76A 4W8AA 5IMMA 5KG9B 4ZUWA 4QNPE 4RNFA 3BUVA 1U8JA 3H4GA 3DXIA 2EIDA 1T5WB 1AH4A 1G7JA 4OIBA 4DB7A 4L9DA 2CE6A 5FCSH 3BIAX 3VCNA 3IJSB 4OHQA 3MVIA 3E3HA 2VLJA 4J8RA 3SPVB 4I6VA 4GSQA 3W85A 4IHBA 3NURA 4NKDA 1YNPA 1TTBA 4D72A 4FMFA 1UH2A 1OFQA 5FA3B 1MFEH 3DHPA 4HNTA 5T8GA 3QDGD 4LQFH 3HKZA 2JIXA 5FB8A 1SLVA 2ADGA 4RAUB 4GRWH 4NC0B 1MRAA 1AH1A 4LIQL 4RRPA 5LIWX 1Q9OB 3S2JA 1O6TA 4NNAA 5HBFA 5KZ6A 1KTLA 2VMJA 4TUOA 1RZPA 3F62A 4QFUA 3NN8B 1Q6DA 4X60A 3KMDA 1DE4B 4FZIA 4BKTC 3QEUB 5AKQA 2Y07H 5SWQB 1UR1A 1QTWA 4FEMA 4JFEE 1OEPA 3JV4A 4FQLL 3VCRA 3KPMA 1U8MA 3F7PC 4POZC 4XQ6A 2VR5A 4A38A 3RUGA 5DJ8B 1AP2A 4DKFH 4IWWA 3NIFB 4ES8A 3TR2A 4N9CA 2AQTA 2Z8VC 2FFIA 5GS2D 4Y16C 4LDCA 2BDNL 2G3MA 3PJSA 1F00I 1NUFA 1ET8A 1XL9A 4ODTL 4TUKL 4JM4L 3SJVD 2AZAA 3P4NA 3DXAE 3O3AA 1QW9A 2ZZUT 4M5TA 3UVIA 3CDZB 4QAMB 2HCZX 2CZNA 3RBSA 4B7LA 3C6CA 4QKXB 4C7DA 5JBFA 1ZZMA 1NGZA 1GPOH 4JKPL 3OX8A 2J8UE 1VLXA 4DPAX 4EQ3A 5C0BA 4LSTL 1KZQA 2IGTA 1L3WA 5BS0B 1KCVL 1AR1D 4GFXA 3Q8FA 3BAWA 3KYNB 1N9PA 3PF3A 3KPLB 3WDJA 2FEEL 2OPJA 3BPNB 5C09B 3QPQD 3MRIA 4XCEB 3NZQA 1D5IL 1J18A 2PR4L 3QQXA 1JNJA 3BJFA 3O2VL 4ZCWA 1NCDL 1HJSA 2VKXA 4D9PA 2YSSB 3TJXA 3MBXL 3PFMA 2IH3B 1GY1A 4TVPH 1BAGA 4F57H 5C2UB 1R5IA 4UANA 1E4LA 2JKXA 2BIOA 1ETA1 5IW1A 5FO8B 1HX0A 2B5IB 3SIMA 2QGYA 1A4JA 3D5OF 2VO5A 4I9WE 1XKJA 5JW4R 2AABH 2HMID 1PZCA 2A73B 4PD4K 2ZWSA 4ZZ9A 2MMXA 1MJUH 1VCAA 2ZOKB 1JYXA 4OBRA 3K6FA 5KZCD 1XJBA 1UT1A 1JFQH 3CWHA 1EO7A 2ZYHA 1QUNB 3L4WA 4K9EL 3HC3H 4QLJA 4O11A 2QVMA 3LKQA 3RO6A 2BP8B 4U1NA 5EZLB 1T0OA 1J05B 4KPHH 3O6KL 5F2GA 1EO5A 4HNOA 1YUHA 3LZOA 2D20A 2GWNA 3CT2A 5C07A 2R2CA 4IRSA 2X8RA 2FIRT 4ERSL 5I0YA 3HAEA 3NR0A 1BP3B 5FF3A 3DX4A 3QMTA 4A8IA 1Q94B 4UM9D 3H3BC 2PGEA 4UUIA 3AO0A 5KBKA 2NSMA 4F91B 3REVA 3VGFA 3T2PA 4IHOB 1SMDA 5LXVA 5LDUA 4HCRL 2R56L 1SJEB 3WG7B 4GUJA 3RB5A 2HSAA 5IVXE 1YKWA 1XQ4A 2KLRA 2X1WL 4FXKB 2Q10A 4QRBA 1DJHA 1FWJC 1C9DA 4JGNA 1RZ8B 3BV7A 2VEMA 4DF1A 1XG3A 3WS3A 5C2CA 3VD1A 4BFOA 4LEBA 2CCRA 1J87A 3S3GA 1CR9H 4HIJB 1QVBA 4NT6A 3CH1A 4ODXA 1PKQA 1QMUA 3O6FB 1X9UA 4GUPB 3ULSB 4R3SA 4JG9A 3F7QA 1IBDA 4GQRA 4LGRB 4U1MB 2GDVA 5DD0L 2J1ZA 3AZSA 2GY5A 3C75A 4Y2LA 1DSFH 3ZMRA 3LHVA 3KLKA 5EO1A 1DJQA 3MU7A 1DBJH 3V4PH 3VTRA 3MBWB 1L8NA 3WY1A 1ET7A 1KQYA 4EN3A 1X1OA 2PDNA 1MF2H 3MROB 4G8GE 2N56A 1PYWA 3IDGA 5FI8A 1ZBWA 1IKFL 3PWPB 2MTAA 3VYNA 4IM4A 1VEPA 3G1AA 2EDYA 3TEYA 4UAOC 4RRPG 4N0UE 3MLPA 2JJSC 3DHMA 4U6HB 3QPZA 1AHWC 1GZGA 2CCWA 1LE9B 2CLVA 1JUKA 5M94B 4F40A 4GRLC 1FZKA 2V5JA 2VXSH 1TZAA 3S2LA 3F65A 2MQGA 1YAIA 2VR6A 3AJXA 2V7HA 3AT9A 1XEUA 3LN9A 1R24A 4L0PB 5E2WH 3M5YA 3N9KA 3FNDA 4J2XA 4LAJH 2H3BA 2HVJB 4LFHD 4Y9AA 4BJHA 4AT6A 4EXQA 4MASA 3N2MA 1XF4B 1BREA 4KKCC 4UQ9A 4DPBX 3PGFH 2P24A 3FSTA 2Q8LA 2WV3A 5EUKA 2Z1WA 4JE0A 5D7EA 1UWEH 1KGYE 1KR1A 3RURA 1TWDA 4NL1A 5ERWA 3MDWA 3ZPDA 2BNUB 1HYRC 1LDPL 2DQDL 3ZL1A 1N7ML 1PG7L 3UTPD 1G1OA 4TU1A 1LRTA 4WTXA 2QZRA 2Y3NA 2G95A 5B1JA 4FQHA 1E7UA 5BW7C 3KBPA 4LB4A 2GEEA 5I7GA 3SYPA 4OLYH 4AXWB 1XM3A 4P23D 1JD9A 1BEYL 1X5GA 2MCMA 4DK5A 4DIXA 4DN4H 2L7UA 3PTKA 5E9DD 1YY8A 2EG7A 5FESA 4F2UA 4XBEH 5IG7B 1IGTA 3T0EC 1YNTB 6CGTA 2GQ9A 2DLFL 1BPLB 1K8IB 1O9VA 4BJLA 4MXQD 5F0JB 1UOLA 4EPEC 2DLHA 3MUGA 1OALA 4MHBA 1GZHA 3AM8A 2RDUA 2GJRA 2X7LA 4AEEA 3FO1A 1J5HA 3WLLA 4I3RL 4DOHE 1CICC 2BGSA 2X4NB 3VOCA 5FWQA 1OG0A 1Y18B 3GMLB 4P2YA 2YHGA 3H7VA 1IEAB 2IOIA 3UP8A 4IIZA 3O0KA 5CZXD 4UTIA 3WS6C 2RFXB 1XSJA 1LQ2A 1I8JA 3GIYA 2F6XA 2OMXA 4WTZA 3LZPA 5AKSA 4LOVA 3MS8A 1YEFL 1E0OB 3G5WA 2Y5QA 3GHEL 1ULVA 4XN4A 1YBQB 3WK1A 2WLJA 5FEXA 1QK2A 5FJOA 4PY8I 1R3LA 3I3BA 2NY7L 1I8KB 4N2GA 4X83A 3ZKSD 1U8LB 4RFOH 1ZXKA 3HB3D 4Y5YA 5CGYD 1TR9A 4CAGA 4U3AA 3VMPA 1I31A 5IT2L 3U9UB 4LFYA 1J5CA 2PLCA 4K5OA 4F9LC 1T5WA 2WW8A 2BSSB 3RKPA 3E9TA 5MEPB 3IFNH 3IJSA 4DP8X 3S5ZA 1XVSA 5T33H 3QUZC 2RCSL 3SPVA 3BAEH 5GGTH 4F7TB 3HAEG 1CFMA 1DYSA 4X0NA 1L0PA 4ZE5A 3IU4H 4A2MA 5FA3A 1NAKL 1Y7VA 2JJUA 2XXFA 3AUVA 4PP1D 4UQ3B 2HRGA 1Z6JT 4IBLT 2BNQE 2J72A 3UAAA 1G5GA 4EF3A 2HROA 1XHGA 4RAUA 6PAZA 3M44A 3MLZH 4K39A 4P06A 3CGTA 2YPVA 1FAKT 1Q9OA 4O53A 2ZX8A 2P5EE 4HSOA 3ZXWA 1A1NB 4UB0L 4Q6XA 2FJFB 4LASL 2AXWA 5BWAA 3GRBA 3NN8A 4PGCB 2VDMH 2FBJH 4GMTH 2DUAA 3H7UA 4LHUB 1F58L 4NQCD 5SWQA 2VX5A 3V6OE 4QRRA 1V3LA 4WJEA 5EEUA 1OFAA 3T8VA 1D6VH 3UTSE 5I09A 5HNRA 5LBGA 3QDJB 3VQ1C 3JWNE 4IMEA 4GUHA 2PTZA 1F4WH 2XN9E 4F20A 2WLLB 4DGYL 1U4FA 1HC1A 5BU9A 5DJ8A 1ZJBA 2X6AA 1VYPX 1RULH 5BV7L 1SJMA 5GZOA 1ESWA 4XNUL 4RCAA 1J0IA 2AGKA 2YYUA 3I9PA 4ERIA 3L1FA 4W6XB 2AANA 4O9HL 2BNJA 3V0TA 3RPTA 1NMBH 3LNIA 4PRIB 3CU7A 2J8UF 2V17L 1CDUA 3QUZB 3AIWA 4PCSA 4Q4PA 1KV3A 2ZXGA 1BD2E 4KRNA 4P4KA 1FL3B 3UEQA 4J40A 1ID2A 3P0GB 4HV8B 4JRYA 1L9NA 3U9PH 1SZEA 5GGRA 2INEA 1PV8A 3GBDA 5AVYB 4JNXA 5KSBB 2KYIA 4YHIB 2C14A 3CHXA 2VISA 1LDSA 4Q9CA 5K39B 1LL4A 1JYVA 1OLLA 3CVDA 2CBIA 1X5FA 5CJQH 3EGDB 4Y16D 5EIIB 1IC4H 4QBXA 1AGBA 1MFDH 2IAND 5BXPA 5BS0A 1YDYA 3CQPA 4XD4A 3GTNA 5EFIB 3BVUA 4FYTA 2QFPA 4IGHA 3KYNA 3T6VA 3WQ5A 3KPLA 4IGBA 2VLKB 4PULA 4MZRA 3S4SG 4I8DA 1RBOB 5C09A 4Z7AA 3GW0A 3NSJA 4UAHA 2ASHA 3MYPA 2GVYA 5IIEB 3RVXC 3KP0A 3UABA 1JV2B 2HZHA 1HJWA 1QNSA 1QPPA 3QGVA 2DZXA 3EDEA 2YSSA 3RIFF 3GTVA 1NGPH 2IH3A 3TVMA 4ZW6A 2CYGA 1F6PA 1RIHH 1MW0A 5EB8A 1XIWB 4XVJH 4Q0XH 2VC6A 4GA8A 1HEZB 1M71B 4LFHG 4WHBA 5XINA 2H41A 3N6HA 2Z6FA 1QTPA 3K5XA 2W66A 4N8CL 3M7WA 1MELA 5ALBL 4F2TA 2A73A 3TESA 4XXCA 4NIRA 4HT1L 4JLRB 3W25A 4E8DA 3OL2A 4O10A 3D05A 2UY4A 1IIKA 2IPUK 5BCAA 3REQB 4QITA 5D2NB 4US5D 1JBJA 2PMQA 1N10A 3WSUA 2Z7WA 5AB1A 4MJ2A 4TVPD 4NOFA 3SHSA 1F86A 2R0WH 2BP8A 3MW7A 1MCLA 2Q71A 2FPYA 5EZLA 4Q9RL 1KCZA 2IKJA 5A6BA 3H42H 2C9SA 2AXJA 4QXGL 5IVXF 3NDZA 4EI0A 3L2MA 1IKOP 1C8XA 4P5MB 4HS6B 1KJVB 4M3KB 2IVFC 2FX9H 3QQDB 1I4FB 4K5NA 2NDFA 1SXNA 3U0HA 3V9CA 2NZ9C 1Q94A 4AK2A 1EEYB 2GJ6E 4MFDA 4N2IA 5I3DA 3O6FD 3QIWC 4IHOA 1KYDA 2HVKB 1SJEA 1H6EA 2R4RH 4YPJA 1ZBKA 3N73A 4IGMA 3RLUA 4FXKA 3Q3GB 1UG9A 4K3DH 3BUTA 1KJ2L 3LVEA 1RZ8A 1KFEA 1PUDA 5MKGB 2R51A 4LF3A 3TX9A 5KVMC 3P9LB 2AQSA 2E76C 2GTQA 4Q4EA 4HNUA 3PZIA 4HIJA 4UINL 1XPGA 4MAUH 1CLXA 3QCUL 1AOHA 4GUPA 5IUCA 4OU3A 3ULSA 1VGAA 1SW7A 2QIWA 2PGFA 1DVFC 3BZDA 4WFED 3V6ZB 4FFZL 1U8KB 3ORJA 2E7DA 1M01A 3XINA 2YARA 4U1MA 1SJHA 1T03H 4LMQE 3CWNA 1ADQA 4FNUA 1XIIA 1ZANL 4M56A 1MMFA 3MT1A 3MBWA 2DJXA 1RR2A 3WV0A 2GGJA 4H1LH 3EJZC 4CU7A 4HFUL 3A3HA 3BCFA 5J8LA 3MROA 3UG8A 3SGEH 4NQTA 4FQ1L 1NL0H 3PWPA 4FZEH 4S1FA 4MCYB 2KT6A 2Y2TA 4CD8A 3EWYA 1T22A 4YC2B 5HGDB 1OY0A 4JG1L 1X5LA 1NKOA 4G6MH 3SCVA 3TK7A 4U6HA 3ULUF 1PEWA 1B4EA 4RE4A 3B34A 1AZBA 1LE9A 2MKLC 4PB4A 1DEEB 3R06B 4NAFB 4J2QA 5E1GA 3ARBC 4K15A 2DQHH 1IBGH 2DWEB 4CCDA 5DRIA 1KELL 2CJ3A 3NJFA 2VEKA 1UOKA 1HE8A 5I5RA 2QJHA 5JIWA 1CPUA 4NSBA 3T0AA 3AMLA 3MXVH 4UQEA 3EYSH 1J7VR 2HVJA 4MXVE 1UC6A 3YPIA 3SRKA 2P45B 3TEWA 2DZVA 1XF4A 4PJCB 2L7EA 3O6LL 5JXAH 1H51A 3KRZA 4KKNA 5B21A 5ABFB 2BNUA 1F8TL 3W1NA 3KYAA 4JJHA 1KN2H 2VR9A 1GOQA 4BKLB 4BWLA 3BZ5A 3VC6A 5LBSA 4LDEB 4PJ6A 1PLGL 3ASOB 4ABWA 1E6JH 4CSSA 1F8MA 5FSDC 3AS2A 2WKLA 2FT6A 3QVQA 1AFVH 1IZKA 4C7FA 2W07B 4AXWA 4L1TA 4Y5XC 2EC9T 2JQMA 1D5RA 4X6CB 4C6LA 3TQPA 1I9JH 3FO9B 3S5OA 4Z7QF 2ARJQ 4GG6B 1XYBA 5IG7A 4KKCD 2I9UA 3ARFC 1GNXA 1YNTA 2CG9X 3L3DB 4JW3A 4P2RB 5LN8A 1K8IA 3V3WA 1F5ZA 3WNMA 2A74C 3OMIB 1XBXA 2V3EA 3TN5A 5DTFB 1GYVA 3BAYA 4YTUA 2V33A 1B57A 4P2QE 1A50A 1MJJB 4ORGB 3BDBA 1J86A 2X4NA 4HNCA 5BQ7B 3Q8CA 3UYOD 2WXHA 3CV5A 4OTXL 4PWEA 1Y18A 3GMLA 4NZ8A 5IR1A 1V8EA 5DLLA 4W5UA 1IEAA 3CNKA 4PG9B 3M7OA 1QATA 4XR8C 4X8GA 3W29A 1K9EA 2JB6B 4WU7B 2I27N 5LNSA 2RFXA 2WQUA 1R3IH 3D39B 4KY1L 4DO4A 4YX2H 1JF1B 3X1FA 1GOHA 1I7ZB 1IEWA 2NY3B 3INUL 3KS0H 1WO2A 1OO2A 4PJBB 2AL1A 2VW6A 1ET5A 4CADB 1F7BA 2CLOA 2VZOA 3T6CA 3W2MA 1NMAH 5FEWA 2WXDM 5FV2A 1NANH 4A2EA 3VYOA 2X28A 4ELKB 3S5YA 4P05A 2I07B 4I9AA 1D5XB 3CN2A 1W5MA 5EU6E 1OTTC 1U8LA 1V6TA 3QWRA 4HZMA 1GJWA 2EINB 4ATTA 3EWBX 1QQDB 3HFYA 3QY7A 4OD2B 1L9OA 3LNEA 3ZYIA 3U9UA 3SCMC 5EHFA 1X5AA 2YQBA 2BSSA 3OPZL 3QRGH 4QSFA 4UT6H 1SY6H 3GXPA 5MEPA 5LKYA 2ED9A 4G8IB 1F3TA 3DI0A 3MJ9L 5DVLA 3SO5A 3TW6A 1XCWA 2ARWA 4NWUL 4F7TA 3B9OA 1DJNA 1CE6B 1HHGB 3V4BA 2YDQA 1ME8A 5E5RB 4UQ3A 1ZSHA 4YE4L 3HMXH 2DMHA 5AHMA 2GG1A 5DQDL 3QRBA 3KAAA 1IEXA 4BHYA 4NM4H 4WW2A 4Z77A 4TQIA 2BY1A 3TCXA 1K4CB 3UWWA 4G8FB 1WH0A 2IMNA 2FVNA 4OZIF 1FBAA 2HPIA 1A1NA 4FADA 2VGGA 2OZ4L 2FJFA 4RMUA 1H3UA 3H7LA 4UNKA 2RDTA 3LIZH 4LHUA 1XUZA 1X7FA 3QUZD 3K13A 4UNLA 3OAUL 1HF6A 3F8UB 1SQ2N 4KO7A 3QDJA 5I6XB 5K4XA 4NNXB 2EYRB 1Q72H 2QTEA 4ES4A 1EK3A 1RALA 4ZMGA 2WLLA 2YC1B 4ZOAA 5G1TA 1GONA 3B7UX 3C8NA 4AZ5A 2WMJA 4AEHH 4K3HA 4Z0SA 2VDKL 1WAPA 3BVJA 3D85D 3FO0H 3ZHKA 2WO5A 4PRIA 4OFVA 3EYFB 5HJBA 1XSKA 1K03A 2AK4B 5IJKC 1H3GA 2AJYL 2WQXA 2E6YA 3BLOA 2JKLA 3V0UA 3F58L 4ZX6A 5I03A 1L6GA 1YMHB 4I5BB 4ZODA 1H3XA 1FL3A 4AD4A 5KS9B 3MNVB 4F79A 4HV8A 3L54A 4OQTA 4RW3A 3E6HB 3W0WE 1QBMH 3ZDZB 1UWRA 2B0SL 4ZAKC 3EB3A 2GOUA 5K39A 3NZ1A 4MWAE 1ZLEA 3MLSL 3VDCA 1PFOA 4PG2A 2H0JA 1UW9A 5EIIA 5BRZE 1BMGA 1MSPA 5HA7A 3E2SA 5F4SA 3N1GC 2A2IA 3WFEL 3SY5A 3HRZC 3PJNA 3W56A 3CSGA 5EFIA 3E1ZA 1H0IA 3OV6A 1KACB 5E1IA 2VLKA 5IVNA 4HLJA 3MWCA 3RX7A 1C8PA 2CBOA 2H6RA 4XAWL 2P44B 2OGJA 5IIEA 3ECQA 3GNMH 1JV2A 3GG0A 3PNUA 2YPLD 2PWGA 4QS5A 4DRSA 3AACA 4NQDE 2I5YH 2GYSA 3SCSA 3NYZA 3PPSA 4M7TA 5I1JL 4NP4L 1B4JH 1Z8AA 1XIWA 1ZGDA 4GQQA 4FMVA 2G4GA 5EFFA 3DOIA 2J20A 1HEZA 2VQ1B 1M71A 4JX4A 2ZZ6A 4ZMZA 3FF7A 4FEZA 1PWMA 4LGXA 1M7XA 1E43A 1MLBA 5D30A 2WWCA 3AS1A 1FUNA 4Q52A 3T2OA 4JLRA 4M7ZC 2Z24A 4O1FA 2GITB 3N85L 3REQA 4TVDA 5CJOH 5D2NA 3RVXD 3EB2A 3SSGA 2EUVA 5HJ3A 3Q6GL 4R7NB 4HK5A 2VP8A 2P8MA 3LH2H 3F4DA 1SN2A 5IQ7H 5KETA 5IESH 3O4OB 4AYSA 1CTOA 1R0AH 4A3YA 2A4EA 3M4HA 4AVOA 1KBBA 2OK0L 1PDYA 3JYCA 1CDJA 4GJTB 5TE4H 2YW3A 3BE1H 3QDGB 1EGJH 4P99A 2V2HA 3ZYJA 2XWBB 4HS6A 2Y1VA 3QQDA 3A22A 1I4FA 2DH3A 1IGIH 3H21A 5GISL 3NAAL 3HW7A 1T4KB 3OKMB 2QCDB 1EEYA 2JJTC 1Q38A 1HXKA 2CA4A 2HVKA 3GHRA 1CMOA 3GBLA 4I9MA 2ARJB 1ACXA 3AWFA 3S4TA 1T2QH 1P5VB 3U4KA 3Q3GA 3E2VA 1ZTXE 1K9TA 4YFDB 1DQKA 3HG2A 2NY1B 5CR1A 1FX6A 2HJLB 4JPKH 1QG3A 5I1CL 4O15A 3SUWA 5MKGA 1N12A 2VLLB 4L4JA 4X9SA 3SGGA 4A7GA 4BZ1A 7REQA 3P9LA 3T0BA 4UM8B 4B9PA 3WZ0E 3E2HC 2ANUA 2E7CA 4D9LH 4WDIB 3O3DA 1ZHAA 2NZ9D 4WKFA 2Y5EA 4CC4C 3V6ZA 3QFJD 1U8KA 4PRPE 1EGZA 2XWTB 4XZNX 4L1SA 1OM3L 1Q63A 3QIWD 4IJRA 1ZLPA 4F8PA 3TIEB 12E8L 1I8AA 1J8HE 2NSOA 4RNIA 1G43A 3MMTA 1WAWA 1M9HA 1I53A 4Q4QA 3HBQA 3NGFA 2RJHA 1SW3A 5F3BB 4M5ZL 6REQB 3RMJA 1XI3A 3VGAB 1KIPB 4OR1A 2BDQA 3LN5B 3MJ8B 3UZXA 1CLYH 5FUCE 4CILA 1EXPA 3WMPA 3CLEL 2J12B 4L0ZA 3W71A 3SY8A 4MCYA 3U0PA 3OR6B 4Z5RB 1W8EA 5HGDA 4MNLA 1AR1B 3QISA 1W9VA 3GEFA 3GKFA 1OFBA 5AYUL 1AQFA 1DVFD 4MXVF 1OP5K 3FB6B 1N64L 3IJHB 4A6YB 1DEEA 3R06A 4NAFA 4PRTA 3K5RA 1J1XH 5EUOA 4LHUG 1CJYA 2DWEA 4NKIL 1GVOA 4NQEE 3MODH 4R7LA 3ZIMA 1OIFA 2R1WA 2XU2A 3EJZD 1OE3A 1UR3M 4FLOA 4DETA 4PB5A 2VQUA 4L9LC 2UWEE 4G6JL 3CSYB 2YW4A 2ZX7A 4J2PA 4PJCA 1HNFA 5I6LA 2VGIA 3ZVHB 2BP5M 4WKXA 4JQXA 4RA3A 5ABFA 3VD9A 2CDGB 2O26U 4WDXA 2QCGA 2QMKA 5EEWA 4P2RD 1S38A 4HBCL 1CDBA 4MXWL 1T1YB 2QLVB 1XZ0B 4FABH 2DDQH 4N90D 5D96C 4OW6A 5EZIL 1G9HA 4Z8FH 1IEHA 4ILDA 4NIYE 2FAUA 3L9BA 3ITVA 4FO4A 2W07A 4LX4A 3UPMA 5CILH 1HKKA 5GGRY 4X6CA 4C6JA 4GBDA 4GG6A 4FNLL 1UZHA 3DPDA 3MYJB 3FSWA 5EIIG 2KHAA 3H12A 3C0QA 3N9RA 1E0VA 1T4WA 1YEKH 1A7RL 3GD6A 3OQEA 2J21A 3K80A 1OF2B 1DJXA 3VKAA 1CD1B 3MUZ1 3FV9A 4NAEB 4LCSA 1G0DA 3O2DL 2GQ8A 5DTFA 1WD8A 2VR3A 4UM9B 2HS6A 1MJJA 2H9AA 4ORGA 3WLNA 4OGXH 4P57B 1LWIA 1OX5A 2BS9A 2DT0A 1PYFA 1MPAH 1WJ3A 1XLJA 3U4BH 4YHGA 2ALDA 3GK8L 4PG9A 4L3ED 2PP7A 2X6UA 2QAPA 4ZZFA 2JB6A 4WU7A 3CK0L 2XPKA 4ABVA 2XN0A 4IOSD 3WXWH 3D39A 1PAZA 1JF1A 4HIXH 1I7ZA 2NNRA 1QFUL 3ITGA 2Q7YB 4MB4A 4N2AA 5CBEB 2R1NA 3P02A 5GGQL 4X5QA 4O8RA 1NBYB 4CADA 5JIPA 1H41A 3H2MA 2OYMA 4C6PA 5DUMH 4MAYC 4BS0A 1IHIA 4W81A 3FW6A 1LWJA 4ELKA 3D52A 2I07A 3GZPA 4CVZB 1J1PL 4PWHA 4Z7NE 4IW4C 5KAQF 5EORL 1URLA 2EPHA 3H6OA 1NDGB 1QQDA 3ALWA 4OD2A 1FHUA 1U2CA 4F27A 4HYVA 5BZAA 1THCA 4XX5A 3WDRA 3GJEB 3LNHA 3VVWA 5A5WA 3V79C 4G8IA 1R4XA 2EIEA 1EJTC 4NN7C 4IBVA 3D3VB 1CE6A 3PRZA 1BM3L 3U2SB 1HHGA 4FLSA 2DQFB 2ERJC 3UX9B 3RITA 1MNZA 5G2HA 5BXSA 2W5FA 5IB1B 5AC5A 3KLDA 1FHVA 3ZHFA 4YBLB 5KSUB 3D9AL 3WMCA 1LO2L 4GYPA 2V5SA 3IIZA 3ULVL 4OGYH 1K4CA 1XGQB 1BQLH 4LSRH 5JNYB 4G8FA 4OB5H 1H2JA 1EP1A 2I57A 1EBPA 1ASOA 1S9KC 3NJMA 2Y25A 1YDVA 2YA0A 1Z9SA 1IFGA 4FQIL 3U6XS 3L5XH 3RWCA 1S2UA 4JRXB 5HDBB 4F3HA 1AA1B 3MRCB 4NZ1A 2AGTA 2ZOUA 4NNXA 3S88L 1E5YA 3CBJB 2XVBA 9PCYA 1AUSL 1E6SM 2YC1A 4WTWA 1T96A 2Y5TA 3ABSA 1PD6A 4XI5D 4I1PA 2H4EA 1WZMA 4YTRA 1XTMA 2C9QA 3OXSA 2AC0A 2CZEA 5EL1A 3I6GB 5B7FA 3PPGA 4JTGA 3ZX1A 3N2JA 3EYFA 4DZ8B 3PXLA 2AK4A 5F97E 3QAQA 4P23B 5ID0B 4YAQA 1YMHA 4I5BA 2VVSA 5E9DB 1QAPA 1E1FA 2CBQA 4NC2B 3PAVA 5KS9A 3NCXA 2B9BA 3MNVA 3EWXA 2D9CA 1LG2A 1UIPA 1XIGA 1DTUA 3E6HA 5ABEA 4GE8A 2FO8A 5D5ME 1NLDH 4Z23A 1PZAA 1WDAA 1IT8A 4OU1A 3UQNA 1Y1DA 5E2TH 3ZHDA 4N1HB 2Y7EA 4E5TA 3OW1A 3KVMA 2DL9A 2O5XH 5ITBH 5H37H 1BXNA 3E3QE 5KVGE 3GPEA 4ZMAT 1OP5H 4NBYB 3K4ZA 4FZ8H 4Q8OA 1GG1A 4FR6A 3L1EA 3TJLA 4AMCA 5JIHA 5AOMA 3G1SA 1QFWL 2PPCA 3DIDA 1M7JA 1SVBA 1W80A 3ZWTA 2D73A 1MHPL 2E7BA 1QBBA 1XBYA 4JJOA 1A3RH 3DC0A 4I87A 1WFNA 4B5TA 1X5MA 4AIUA 4NU7A 4ZAKD 3FT9A 3VNIA 4L8SB 4Z2IA 5E8NA 1YN6B 3WBAA 3SQRA 2F6KA 3KLHC 3M0ZA 1MDRA 3LU2A 4PRHD 4PRBB 1NWOA 3X1NA 1U8QB 3WFCL 3H26A 3HB3B 5FUOH 3V35A 4PWJA 5BOFA 3RKDC 2WLIA 3E6FB 4AQ1C 3G5XB 4GJIA 4Y1AE 2C3HA 2W6RA 5DQPA 2VCAA 4GMSL 4W6WB 4R7NA 4YL2A 5DT1L 1K02A 4BFJA 3WFDH 3QV8A 3PPFA 3N06B 5ANMB 1Q6LA 5AOKA 3MA7B 3JXAA 3S9ZA 2ZX9A 2PP9A 1H4PA 1BOGB 5DO2C 5I00A 3QDGA 3UMNA 2LFEA 1A7NH 4TUJB 3ARUA 3SY6A 4Q8WA 1PY0A 4AKPA 1YEHH 2NY1D 2XWBA 4N3TA 4CC1A 2E5CA 2QHRH 4GSDH 3WFHB 1EAJA 3OKMA 2OZTA 3A4XA 4QI3A 2ARJA 1RMFL 4XWUA 4NQCB 5E03A 5BVPH 3VIPA 1P5VA 2YK1L 1OCNA 4X4ZA 5CH9A 4EIUA 3WJZA 1WS7A 1VEMA 5CXPA 2HJLA 4ENZA 1HTIA 5FF4A 4K3ZA 4DAGH 2VLLA 1XFBA 2F19L 2VUOA 1IJ9A 4EXKA 3SN4A 3CFJB 2ZKWA 1Q2SA 5KSVA 4GRWB 3MZTA 4PFEA 1A6VL 4UM8A 1QSEB 5JHDB 3VFNB 4X5RA 1HXYB 3WUWB 3DX7A 1S5HB 5D7IB 3POHA 4WDIA 3LPWA 3LKRA 4MDIB 3R18A 1XH3B 1GVIA 2XWTA 3ABRA 3DDFA 3DUSB 4TRPL 3SJVA 1NP0A 3TIEA 4APQC 3JV6B 1Z48A 5EN2A 3IIVA 5CEYB 3H54A 3UO1L 1Z7AA 2PW2B 3EB4A 4PP2B 4G5DA 4I90A 4I3GA 1FAIH 3CJPA 4P48A 2Y0SA 1RSYA 5F3BA 5CSZB 5EYWA 6REQA 1DO5A 5D1QE 4LAUA 1VQTA 3RWEB 3GBNH 3LN5A 1QLFB 5DR5L 3MJ8A 2R15A 1WBYB 4YLWA 3SOTA 4Y16B 1MWAL 2IANB 4O1BA 5F7FA 2X38A 4Z5RA 3LPGA 2W67A 3W84A 2Z3FA 4MJIE 3FB6A 1D5MB 1EVUA 4OBSA 4LAOA 2AQ1A 3IJHA 4A6YA 4MCNA 4CQCA 3Q6FB 4KRZA 1K4DB 1KTJA 3BKMH 1SO3A 2WM1A 1ZD6A 4JANB 2B31A 3MC5A 5LXXA 2QXWA 1XIEA 2DY3A 2VDQH 2BXYA 1AQ0A 2ZUWA 4KWOA 1CCWB 3ZE0E 1DDHB 2OULB 1IEQA 1OAJA 4R84A 1FGNH 1FRGH 3XIMA 2WANA 5AAWA 3CSYA 2YGYA 4Z2HA 2YDRA 3H2WA 3L12A 2WCSA 1LORA 3UJRA 5DWUL 1LTDA 2Z4GA 4ELMB 2BSTB 3DVGB 3ZVHA 1HDMB 4WFGD 2PTWA 3OBAA 1KB5L 4AGLA 2OTPA 4D6JA 2CDGA 4QXTB 3NCJL 4K7PL 4MJJA 4A67A 5E4AA 1VIWA 1XRSA 3RLGA 3WD5L 2F2KA 5BO1H 2E27H 5EF2A 1MFBL 5D9SB 5GXBB 2J6EA 1HKVA 1T1YA 1XYFA 3OGVA 1SOSA 1XZ0A 4Q56A 1AJ7L 1OZMA 4LP4A 3NZUA 1LWRA 1JDCA 4NJ9H 3DFTA 4XWGL 1DXEA 2V69A 1VBJA 4PJHF 3Q8BA 4PJAE 4PR4A 4Y1TA 4GIRA 4F3FB 4XZLX 4MD4B 1KCXA 3TPKA 1W32A 3FZUC 3IMUA 2VUYA 5GHWH 3SPHA 4MQXC 4S38A 3S98A 1XGYL 2GC4C 1BBDH 4K94L 3WUFA 2X2IA 1OF2A 2OELA 3JU2A 1CD1A 2R94A 3C09C 3B8TA 4NAEA 2W61A 3BLPX 5HDQH 2Q87A 3ZE2E 1OQXA 2CDEB 5JLZB 4UM9A 1SRDA 5CZKA 4KHTH 1RZKC 1OD9A 4IRZH 4P57A 4NZRL 1WUZA 3G04B 5IBXA 1RZKH 2OOFA 5HSFA 1E5ZA 1UVQB 3ZTEA 2WOQA 3DHJA 2Y70A 1ELSA 2I14A 3QO0B 1M05B 4HFWB 3BG5A 4POYA 1NGWB 3SPJA 2XX0A 2R29A 4LPYA 2ZUTA 4FNSA 4DO5A 3K74B 4Z7NF 4PJFB 2QCHA 1O6SB 2Q7YA 5CBEA 2EEXA 3Q8AA 1RIUL 1NBYA 5LIYX 4KDVA 1LLOA 2C4FU 1LO5B 1H5VA 3D87B 3ULUL 1E40A 2V5RA 4CQDA 4CVZA 3D3VD 3DKHA 1N5YH 1NDGA 3VI4E 2PZNA 1C3FA 4OWGA 3NACH 1WE5A 3PAUA 1I85C 1ZS2A 2VMFA 4L4VE 3FU6A 4XZBA 4M00A 1RK7A 1RUKH 1VYSX 3OQ8A 5CQ1A 1XGZA 2BCKB 1CZ8H 5I1IL 3GJEA 1UA6H 5DHEA 2VZTA 1F6LL 1RUPL 1B6UA 5K9DA 2ZZ3A 3HMCA 5AZEH 3AIBA 2JK5B 1FFPB 4C56D 2I25N 2LOEA 3LYEA 5C0AE 4WXYA 3S4SA 4MAYD 3U2SA 3C9NA 4JRXD 2YPKB 2DQFA 2A9BA 2H32H 3AAZA 2JKIS 1J1OH 2J2ZB 4G1MB 4OM0L 4RZ5A 4HU4A 5IB1A 1US3A 3ERXA 3F64A 4Q89A 5KSUA 1MNNA 1CGVA 1W0YT 3V4PB 3NOYA 4A22A 3KVJA 2Z91B 3XISA 1XGQA 1IV8A 5JNYA 4HQQL 2QDWA 3SBWC 3GF8A 1I7RB 1V6UA 2CIKB 1BYOA 2XZ9A 5CO1A 3KCPA 1EQCA 3GBMH 5DS2A 1TZZA 3T4YB 4JRXA 4BE5A 4UTAA 3W07A 4UAOB 3MRCA 4ZQCA 2QVFB 3HC4L 4YLBA 3RR4A 3Q5TA 5AG8A 2GIYA 1AHWB 2O6FA 2EJAA 2QCEA 4E42A 4TSAH 2A1WH 1NIBA 1PJWA 1WOBA 4IBSA 2VAAB 4GRLB 3W27A 1FWHC 2Z93B 1A66A 2CHNA 2FEJA 5LKNA 1J79A 2RJMA 4KK9C 5D5MF 1JHKH 1E70M 3I6GA 1HQRA 4XNBA 1XB6A 3FDWA 3L4YA 1S78C 4DZ8A 4I7WA 2ENSA 3PN8A 3CQ0A 2DZEA 1ITBB 1FRBA 1OK6A 4P23A 2GGGA 2OYKA 5ID0A 3WCYA 3C0SA 4FNQA 2PDJA 4NPJA 5E9DA 5GJPA 4G72B 3GWQA 1PU0A 1TX0A 4AJWA 4L1GA 2EICA 4TXEA 4HJGB 4GIEA 4JQVA 2J5WA 3QNZA 5E6ZA 1E0UA 7PAZA 3HBPA 3IDYC 4AYFB 5TBOA 1OEZW 1GA2A 3UYIA 1TLMA 3T78A 5ABDE 4JM2C 4IICA 3NJIA 3L1OL 4H25B 3MRRB 1L6XA 3PG8A 3E2RA 4KUZL 4PMOA 5AZ1A 4QNPF 4B5ZA 2IQ9H 4U1KB 3GSUB 1TTQA 3L3HB 2D31A 5LNGA 2J25A 1MZYA 2C1OB 4NRXB 4KKBD 3GUFA 2RD0A 1BPVA 3QCVH 5C86A 3S0PA 1KV5A 2YAMA 1X97A 3TYFA 1WCGA 2NX5E 3SCOA 3T0EB 1I1YB 4LEOB 4GVGA 4DX3A 4KKPA 5KG9A 2AL2B 4M4RB 5DSCB 3O6MH 4L8SA 3DENA 1AGEB 2HYMA 1YN6A 2J7EA 2F8QA 1YYMH 4GY0A 2WNWA 1PTAA 4Z1DA 4M5PA 2CFFA 3TUUA 5CJXA 1QWGA 4L4PA 2B20A 1CICB 3NJGA 4PRBA 4PBGA 1O5XA 1ADOA 1U8QA 4HS8H 2VDRL 3QFGA 1NH6A 4XGZB 5D7LD 1AZ1A 2QPXA 1UWGL 1L5GB 3UP1A 4OLVH 2V6AA 3E6FA 1XGDA 3G5XA 2BOGX 1KM4A 4L29B 3I02B 4Z1YA 1XLIA 4N3UA 4FFYL 5F1UA 2AJXL 1JXFA 1XBVA 3QJQB 2WNXA 4LOEA 3R8BB 3U83A 1HEHC 1DHKA 4OLWH 3MRDB 2NY4C 1P0SE 3D6GA 4LU5L 4H19A 3W72A 2NNFA 5D2VA 5ANMA 5F4WA 4DKEH 2VFHA 5DELA 4RE0A 1MG2C 3AHTA 1J2WA 5MEQB 4M82A 2XIDA 1DE4A 3MA7A 3D34A 3QEUA 3KLHD 3FA5A 3WQGA 1PL9A 1BOGA 3KDPB 4AWSA 2CK2A 5JIIA 4KVNL 1XSIA 5IBTL 3U2JA 3RKDD 2D7TL 2P49B 3S3SA 3WFHA 4AIOA 1QSED 5JHDD 4L65A 2GKIA 3S2CA 1GQLA 3M0YA 5FKPB 2Y4SA 3LGEA 4NQCA 2OCZA 4JQAA 1JFHA 2JGYA 4BWUA 2ZP8A 4Z7IA 3QJVB 1UACH 5DO2D 4BY3A 5FO7B 1XICA 2LLNA 5EU7C 2PWVA 2BWIA 3AIQA 3CDZA 3CFJA 3LCWA 4FAMA 5JHDA 4POZD 3H6JA 3VFNA 2ZKHL 3PWIA 1KIUB 2F5AH 1E7VA 4N5EC 3D85B 1IGFH 2J4WH 3EDKA 1HXYA 3WUWA 4ADTA 3MOAH 1JWMB 4MDIA 1XH3A 1TUPA 4KZEH 3N3TA 4F58L 2VDMB 3DUSA 4GEIA 2V2WB 3LX9A 5EEYA 3JV6A 1KYUA 3PDDA 5CEYA 4ZW8A 1LNUB 3NDYA 1MJ7H 4GLRH 2PW2A 1TFPA 2ZWNA 4H8WL 5CSZA 4XCEA 5AFAA 4S3AA 3RWEA 3SCNA 2Z2UA 5CZ0A 1QLFA 3GVRA 2V2DA 2B9AA 1WBYA 3HVNA 4G59C 4DELA 2QQLL 4Y16A 2WVSA 2IANA 1HHHB 4TSBL 1OTUC 1XYAA 3EPMA 1WV7T 3GU9A 4Z3TA 4IL2A 1CFVL 3ZE0F 3RPKA 2J9XA 1ZGLP 1KEGH 3M47A 1D5MA 1DJGA 1A53A 5FO8A 3RG6A 5EZOH 3PUDA 3OZLA 4MVBC 3WDHA 1MQKH 3Q6FA 4APQD 1S9WB 1K4DA 4NYYA 4KH2A 3WAJA 4KXCA 3B9NA 4JANA 2YPLB 2ZOKA 3LIUA 3OGSA 3NPZB 3UZQB 3K1DA 2ISWA 1UXMA 1JP5A 2IBZX 1QUNA 3BDYH 1A49A 4PW4A 5FYJL 1XF5B 2QSCH 5IBUB 3G0SA 3P4MB 4CL7A 1FP8A 4HMEA 4ELMA 3T3PE 2BSTA 1J05A 3OKDB 3RYSA 3NJXA 3DVGA 5C55A 2Z92B 5CPNA 3DJ9A 4QXTA 4C6MA 3N5AA 1UOZA 2BXZA 3L7RA 4C6IA 4OFPA 1R9FA 3BGMB 5D9SA 3IJ6A 2KI6A 3P80A 5LAXB 4US5A 3D12B 1JVNA 2DB8A 3ZUNC 5I75C 1LO4L 1S7UB 2N0KA 4B15A 4M1DH 2K78A 5J3HC 3WNPA 3GGWB 2BP1A 1ZTVA 3MGAA 4F3FA 4PTVA 4MD4A 3DK2A 5DD1L 5B38B 3MUCA 4RXFA 4HLZG 2QJNA 5DF0A 4XPAL 4I18C 2OOGA 3SQMA 4B5NA 4X4KA 5IMLB 2FQFA 2ZCLH 1E6NA 3OZPA 3KBFA 1VKXB 3L48A 5LGJB 4BZ2L 2CDEA 5JLZA 2ADFL 2QZQA 1MYRA 5EC1B 1NFAA 4PJDE 3PFUA 3G04A 3O6FA 2ZC8A 2Z7UA 2R69L 2D9QB 3DO3A 3QO0A 2FZDA 1M05A 4HFWA 5FA4B 4ZS6C 3CQIA 3CMOH 2ZZ5A 3FZUD 3CO8A 1U3NA 2YXXA 4PJFA 4M93C 4MQXD 2YQGA 3TP4A 1O6SA 4BKSC 2ZD0A 3VI4F 3ATAA 3KHOA 2IAMC 5FYKH 1L6SA 5AFDA 5JQ9A 1F6FB 1T6MA 3IGLA 1LO5A 5E1AB 5JXEC 4UF7C 3CV7A 4K5MA 3QFJB 6PCYA 2XISA 3GINA 3QIWB 2DSUA 2GJZB 1TSHA 4AXKA 5IHLB 1IZJA 3ASNB 4H13C 4ICNA 1G1KA 1Q0YL 1P5BA 4X7FC 9XIMA 4JRWA 3FOLB 5IQMA 1NBVL 3CFKB 4ZS7L 4OI9A 4PWFA 4LS2A 1VDGA 2BCKA 1HINL 4J6IA 3GR8A 4CJ0A 4Y9GA 1NC2D 2ZE0A 2Y7MA 2JK5A 5IEHB 1FFPA 2KLSA 2Q20A 1TVPA 4A2RA 2YJQA 1OAZH 4WGWB 4L8DB 1DVFB 3FDKA 4H8PA 2YPKA 5FEBA 4PH8A 4NJHA 3W7QA 3CQKA 5I1GH 1CK0L 1AD4A 3QB7C 3FO2B 1JZEA 3H70A 1T0MB 4G1MA 2AQPA 5D72L 1E9QB 3DV6B 4PGEB 5IROC 3OBKA 1ZU8A 1N6VA 3S36H 2Z91A 1JZGA 5FHAL 4MVAA 4H1LB 2P5PA 4U1LB 4D3CL 2N7AA 4GRLD 4P59L 5FGBC 1I7RA 5AW2B 4NZ3A 2CIKA 3SDXB 3FJ6A 5HYSB 1K7FA 4Q32A 3MCYA 4ACZB 3ZJKA 4Y8FA 4WGKA 3ZVVA 1GKQA 2P8CA 4UU9B 3WUWG 3QQ4B 4DEUA 2JJSA 4WEBL 1MAJA 3W2KA 4ZTYA 1ZEAH 3EZ8A 2OLHA 3TEXA 1AHWA 3QZEA 3BLFA 3TEZA 1PFCA 2N1KA 4HJFA 4LUSB 1NIFA 1J2BA 2BGNE 3ARBB 3VZYA 5CEWA 2VAAA 1EVTC 4GRLA 3CAWA 4K36A 2Z93A 3PQYE 3US1A 4OFIA 3I9IA 4H8NA 1R46A 4BI5A 2PC8A 3MPGA 2JKSA 3DOSB 3FQXB 4QGYA 1RLDA 5TGBB 1A1MB 4LB3A 5DY2A 2FTAA 1E1CB 4MZ1A 2GWGA 1BFVH 2H7WA 2ZXAA 4R5TA 3AG1B 1RH9A 1E4MM 1FCCA 1PKNA 3M46A 4HJGA 5HWJA 4OD1L 1BOYA 3HN3A 3CFCH 3RX8A 3T0ED 2VEIA 5ID1B 5I3HA 4HMNA 3ZS4A 3ABZA 3KWVA 1W5NA 3H4FA 3MRRA 3EH4B 1JDFA 4FYQA 1L7TH 5MEOB 4U1KA 3GSUA 2VDOH 1EDQA 5BW7A 3HPJB 3L3HA 5DRCA 1IQWL 2RALA 4Q3MA 3KYKL 1YBQA 1S78D 4HEMA 4D8OA 1MEIA 2C1OA 1GGBH 4Y5XB 3P8JA 1MNSA 4NRXA 5D1ZC 5E2UL 1CICD 4L3EB 2WLHA 4JUTA 3R4RA 4PMRA 1I8KA 3ZTCC 1Q5MA 5GRWA 3T4WA 1E4XH 3T0EA 1I1YA 3ARFB 4LEOA 1VRXA 4CQBA 1EPVA 3T81A 4KMTH 4P3CL 4PE8A 2DZAA 4M4RA 3WNJA 1ZNNA 3TBVB 3FH7A 4DGUA 2A74B 1HL9A 1AGEA 5DJYB 4QLLA 4OH2A 4X4MA 2A5HA 2G4JA 3KPQB 2V38A 3SY0B 2VCOA 5AZ2L 2YRZA 2LW3A 4W1TA 1EB3A 3HGOA 4FXFA 1S1RA 1HKJA 2JLPA 1OABA 2P0IA 4XGZA 4RGNE 1V6WA 4JGJA 3TW7A 1L5GA 5SV3A 3ONBA 2MNJB 5DU7A 2EDMA 4RWYL 5E2VH 4HS3B 5KWYC 3WS6A 4L29A 3I02A 1H09A 1SXSA 3EX1A 4V27A 1HVQA 1A5MC 4DGVL 3MRDA 4XAPA 1TXKA 5C9UA 3KYMB 5L6YL 2X09A 3R12A 2WCGA 4PGCA 1U4EA 2YGQA 2HG5B 3C4UA 4IKLA 1E4IA 1KCBA 1VGEH 2XG9A 5E70A 2XVNA 4LNVA 3OJVC 3T0WA 5I73C 4N2MA 3BXNB 3V9FA 1M7UA 4RETB 2CWRA 1U3JA 1BWWA 3SE8L 1LYXA 3SCMB 4GOAA 4JMXA 4LOFA 3UTZB 4F9LA 2JKEA 4JTIA 4ML9A 3OAYK 1VF8A 3A6CL 4DGIH 3O4LD 4TSCH 3FJLA 2FFCA 2JCCB 4LARH 2NY4D 4NENB 4YDLC 4EDWL 5DMYA 3QUZA 5GGTA 3B37A 2Q02A 3F2DA 4S2BA 3A6BH 2CALA 2HV5A 4Q8QA 3M0IA 2X1TA 4Q14A 5J04A 1ONRA 3OQ3B 1WCQA 4JYEA 4AHQA 5TF1H 4UQBA 5BQDA 2MCPH 2LGNA 5KSBA 4YHIA 1WTGT 4QCFA 5U7SA 1KIUA 3D85A 1ETZB 2Z28A 3CVHH 4XAKD 3IFLH 1JWMA 3PZ9A 1S2TA 2WHMA 5LCVH 3NP3A 3EGDA 4QY8B 3N0PB 1K8ZA 1ZHKB 4WW1B 2V2WA 4NC1C 3O3RA 3TX4A 1ZV5A 4KEVA 2WAHA 1IAIL 4KFNA 1LNUA 1CQKA 2WP3T 2YCIX 2E9GA 1RPXA 1ZRQA 4JQ1A 3GSOB 3SFKA 4BH8B 5F96H 1RV6X<