3SFKA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm267
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
375
structure length
368
Chain Sequence
b'YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Structure-Guided Lead Optimization of Triazolopyrimidine-Ring Substituents Identifies Potent Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors with Clinical Candidate Potential.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 133
structure length 368
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sfkA00
1P0KA 4TU1A 4I7VA 2QCDA 3QPZA 4WY0A 2V0TA 3G1XA 1ZALA 4HNVA 1QFEA 5I3JA 2NXHA 5EKYA 1HTIA 3QMRA 3IIPA 4O17A 1OHLA 4XBKA 3LV6A 1W5MA 4DELA 1FWNA 3INPA 4O0KA 1FCQA 2ISWA 5DBTA 3MWAA 3W1UA 4X22A 4BWLC 1XBVA 3U6WA 3MHFA 4FF7A 2TMDA 1FUYA 2TRSA 2FFCA 1O4UA 1SQ7A 3E49A 3G1SA 4MVAA 1EP3A 3TCEA 1MZHA 1XBYA 2E5BA 1ME8A 3E0IA 4M7SA 3RMJA 2AQWA 4MYXA 4JTIA 3P8JA 3I7QA 2QUTA 4HNNA 3MBDA 2ZTKA 2ZTJA 4IMGA 3B05A 4LS0A 1GPWA 1DVJA 3IIVA 2JKEA 4NJGA 3LHZA 3F03K 3H54A 1EP2A 4BK9A 4R33A 3CEPA 3A5FA 1WOAA 3GDTA 3M5ZA 1K8XA 2ZRZA 2V9DA 4QIUA 3H55A 2VFHA 1WA3A 1S5TA 3W2JA 4JXCA 2Y6ZA 2Z6JA 4FXSA 4PTNA 2C0AA 3KRSA 3RLUA 4YCOA 1YTEA 4JR5A 3SGZA 1FQ0A 4LVGA 1RQHA 3BG3A 3CT7A 2ISSA 4N9CA 2BTMA 5AB3A 3LRLA 1KFLA 3LRKA 1UJPA 4O12A 2HS6A 3L21A 2JK2A 2WO5A 2CLOA 4DXVA 3SW6A 3QH2A 3B03A 2QJIA 5D2XA 2YYTA 1ICSA 3VNDA 3DHDA 5DCEA 3TFCA 5HWNA 3C2VA 3W71A 3BG5A 3R12A 1DHPA 1WV2A 1EWDA 4KFNA 4GBUA 3VFLA 4DEFA 1O95A 2NUWA 4O50A 4A2RA 3TU9A 1H1ZA 1W5NA 4NNAA 4K36A 2FLIA 2A6NA 3EEGA 5H91A 2NWSA 3M44A 3PG9A 3G0SA 3D0CA 1K03A 1XFBA 1KM2A 1LOQA 2Z1BA 3LHUA 4DPPA 4NUWA 3EXSA 3L0GA 2FJKA 1HUVA 3BLEA 3UZJA 2V2DA 2J24A 3NQMA 4YXGA 2VKZG 4LRTA 2Z2UA 4JX4A 1KFEA 3LX9A 4Z1DA 4HHPA 4UNLA 2OJPA 5G2HA 3O06A 3Q37A 3S5YA 3C52A 4JICA 1K02A 1DKWA 3W72A 4I9AA 3W83A 4UNKA 1XC4A 2VC6A 1EUNA 3SIZA 1AK5A 2FPVA 2ZA3A 5DCBA 5EY5A 3LCIA 4QNWA 1M7OA 2PRMA 3W6YA 4XKYA 1ONRA 3QYQA 1ME9A 1GVFA 4ZQRA 2A7RA 2ZZ5A 4UTTC 3QEZA 2JKPA 3GXTA 1XUUA 3IIOA 5FF3A 4OV4A 2XN0A 4YCPA 4AWSA 4IXHA 3W7QA 1AW2A 1LORA 3RFAA 4BF9A 1JCMP 3WJXA 4DBEA 4A3UA 1KV5A 1LYXA 3KVJA 4GUGA 1XBZA 1A50A 3HPZA 4KFOA 3QF0A 1SZEA 3A21A 4IUOA 1VHNA 2FB2A 2VFFA 1FCBA 2G96A 4I7WA 3UWYA 2QAPA 4CNNA 4FNSA 1VHCA 5AYXA 1LBMA 4OHQA 3V75A 1C8VA 1YLVA 4LV4A 3HG3A 3NM3A 2QCHA 1QCWA 3AJXA 3P74A 3P7YA 1ALDA 1AW5A 3OIXA 4JTFA 4XTIA 4ZVJA 3MI3A 2UV8G 1XCFA 1GZGA 1PV8A 5AOUA 5G4EA 1I2PA 2ZRVA 4FX7A 2CLIA 5FF2A 4IJBA 4OU1A 4AXKA 1PHWA 3W22A 1XXXA 2QJHA 3NAVA 2E68A 3TXVA 1O5KA 5DY3A 1JUEA 4MFDA 2G97A 5CPNA 3W73A 3HGJA 2OT0A 3DHFA 2QEZA 3DFQA 3S6DA 1AL7A 3TR2A 1W37A 1O94A 1QDSA 1W5PA 2A2IA 2YSWA 4IGHA 3E02A 5AHNA 3PSWA 1PS9A 4GC4A 4UMBA 4FIRA 1GG0A 1O5XA 2CLKA 5I3KA 1VJIA 1OABA 1VCFA 2Y88A 4HPXA 2CW6A 4S2BA 2DORA 2W6RA 3KVMA 4HSNA 4L4MA 5DBUA 4JEQA 1EEPA 4UTHA 3CWOX 3LB0A 5E93A 4CQ9A 1OX5A 4PODA 5IBXA 1X7FA 4FIQA 1F6PA 2QCFA 1ADOA 5BMXA 3S1WA 3CEUA 3UPWA 4JGDA 3V1PA 1K8YA 4N9EA 1LM1A 3QW4B 4O54A 3TC7A 2Q3RA 3QFEA 3IVSA 3GR8A 4LV9A 4JY8A 3HGRA 2J9YA 3KOFA 2PC4A 3SFKA 3GVGA 2E5CA 1QOPA 1VS1A 3NPUA 4HNUA 2VOMA 1Z48A 1W0MA 1N8FA 2BSLA 2QDGA 3W7PA 5I3FA 4A21A 4MY8A 2Y7DA 4UTIA 3TROA 2YPIA 4Q32A 4K7VA 3HQ1A 5HWJA 3S5OA 4FNTA 1QOQA 4BWLA 2A85A 1NAL1 5HUPA 1I2RA 5LSMA 3G1HA 1KFBA 4AEOA 4QISA 1HO4A 3LCXA 1FY6A 1TSIA 5CPMA 4OQVA 1R2RA 3SZ8A 4WZHA 4JTJA 5DCDA 2C6QA 3ABRA 1FCUA 3W75A 4O10A 5CSRA 5AC6A 3G3MA 3TQ0A 5KZMA 4UR7A 3LV5A 3W85A 1FCVA 3LTYA 1QPNA 3WK0A 5L6UA 2OMAA 2J9ZA 4POCA 3SSJA 1XUZA 4NJHA 3P8IA 1W31A 1LBFA 3FS2A 3TK7A 4H6KA 1RR2A 4BI6A 4O11A 4GWEA 3MP5A 5KSWA 1KW1A 1GTEA 2RDWA 3TIMA 2DZXA 4R34A 2Y70A 5CGQA 3I7RA 5KZEA 2OT1A 4N2YA 1IXOA 2E09A 1SO5A 3EWWA 2E1DA 3M5XA 3SGUA 3LI1A 3HF3A 2XFWA 1W3NA 4IMCA 3MP3A 1NF0A 5BRBA 4YLWA 3ANYA 2QUVA 2QUUA 1AW1A 1SSGA 1RPXA 4HT3A 1FX6A 2YYUA 4BR1A 4NQ1A 4O14A 1JJKA 1GVRA 5E1QA 4UFJA 4K8EA 5D30A 1J2WA 4WX2A 5SWUA 1TPWA 3LXCA 5AYZA 1V5XA 5FEWA 2QR6A 4BI5A 3DI1A 5CZ0A 4FNRA 5G1YA 1K3UA 3EX6A 1ICPA 4MFEA 4Z08A 3S5NA 4R53A 3N73A 4M5PA 2CLLA 4GFSA 1A53A 1YPFA 4K8HA 5LHFA 2VXNA 4ICNA 4IMDA 3NQCA 3STFA 1R47A 5DLCA 1Q6OA 1BTMA 4OE7A 3W1TA 1OFEA 3I65A 3TW7A 4GNJA 1F2JA 1WX0A 1JCNA 3MO7A 3OVPA 2ZA1A 5D03A 3R89A 3W7HA 3UWWA 3ATYA 1DL3A 2ZRYA 3BLIA 3HG5A 3PB0A 5D2TA 3STGA 1M7PA 4O0ZA 3UYCA 5F2MA 2ABBA 3NYZA 3BW2A 3MBFA 2R8WA 1A5CA 3O6CA 1VCVA 4XKYB 3HGSA 4JTUA 3W23A 3LERA 3W7DA 2ZZ2A 2X1SA 4DF1A 5LNVA 1Z44A 2NV2A 4S1FA 2A5HA 3HBLA 4RJEA 4UTKA 1H50A 2Y85A 3NQ6A 4LUJA 3PF3A 5AHMA 3TAOA 4NX0A 1IXPA 3LCFA 3G1FA 3A5VA 3M0ZA 3W2NA 2GUUA 1C29A 3LHVA 3O15A 1NEYA 1XKYA 5HR7A 1YDNA 2P0OA 1JQVA 3TDFA 5AFDA 1WXJA 4AHOA 3O6DA 3R13A 3WK2A 3KXQA 3KX6A 3N9SA 3W1MA 4AF0B 1KLYA 3N3MA 2Q3OA 1HFBA 3BARA 5IM51 2GJNA 2QCEA 1WQ5A 4EOUA 4TR9A 3LCGA 4HIBA 4NNBA 3C61A 2DJXA 3OHIA 4H4IA 4ZQMA 2YW4A 2ZZ7A 1FWWA 1XDMA 4A29A 1S3HA 1W8SA 4O15A 4ADUA 3FYOA 3P62A 4OV9A 4UTMA 4B5NA 1QMLA 1OYAA 2R14A 4WOZA 3NL2A 3TH6A 1OK6A 3OG3A 4Z1AA 3CB8A 4LUIA 1AMKA 3TE9A 4JYFA 3NQFA 3QJAA 1D9EA 3BV4A 1QPQA 2C3ZA 3P80A 3MP4A 2NV1A 4CLMA 1JCJA 1KV8A 3MHUA 3NOEA 4LS1A 3L5LA 3NPXA 3UXAA 4PEKA 3W1LA 4UFHA 2IQTA 4NU7A 3ZFHA 4O57A 1M6JA 2V8ZA 4LVDA 4JTTA 1OFRA 3NQVA 3OEXA 4YWIA 5LNSA 4O18A 4EF9A 1KTCA 3M47A 3W9ZA 2FB3A 3HG2A 4ZQOA 2B0MA 2AAMA 1PL9A 1RD5A 4AMAA 1ME7A 2ABAA 4ORIA 3FJ6A 1MEIA 1Q6QA 4YMZA 4D2JA 5FEXA 1VLWA 1SR9A 3NGJA 5GVJA 2EPHA 3L65A 3PWAA 1TTQA 4JX5A 2ZA2A 2BX7A 3W1XA 3P61A 3DFNA 1TPUA 2C15A 4UC5A 2WSQA 1XL9A 4CQAA 2CLHA 1I2OA 2HSAA 4O19A 3S8HA 4TO8A 5EPDA 2I1OA 5LZLA 4JDYA 2VEIA 2YCEA 3TC6A 3VE7A 2J6XA 2QCMA 1TTJA 4ZMGA 2G95A 3LLDA 1FDYA 3EWYA 3G22A 1SZNA 3I6RA 4LC6A 5DN1A 1H51A 2OCZA 4C1KA 3K30A 3W3OA 5HQEA 2C18A 3EKLA 3UY7A 1GJPA 4P2VA 2ZRUA 3MJYA 3TKFA 3MHGA 4AHQA 4K37A 4MLRA 1YXYA 5F1UA 2C19A 4PL2A 3W7GA 3PY2A 2C14A 2A7PA 1Q6RA 4KWVA 3DGRA 3P82A 4NX5A 3RK8A 1ZENA 5D37A 1VC4A 4FX6M 2ISVA 3NG3A 1TV7A 3T44A 3Q2DA 3NR0A 3PS7A 1LRNA 4M6PA 3DFSA 2H3BA 1H61A 1VYSX 3QM3A 2H8ZA 3TQKA 4UMAA 4NVTA 3WK1A 2NXIA 2W79A 5FEZA 5FESA 1OFDA 2NXGA 1L6SA 2DZPA 1QPRA 3PM6A 4NJKA 3E9AA 4DPQA 3EXRA 4JYDA 4JS3A 1VYRA 4JX6A 3CIWA 3DFPA 2JGQA 1SO3A 1N7KA 1S5WA 3UQNA 3LXAA 4MZ1A 1WAUA 1S5VA 4FX8A 3LRMA 3W2UA 3GDRA 5EBUA 3H53A 3WJZA 3W2MA 1W56A 2CZEA 1T96A 2QKFA 3FA5A 1THFD 3BG9A 2E6AA 5BNKA 1FXPA 5AHIA 1TPH1 2GQAA 2I14A 2XN2A 2VENA 1F5ZA 3Q94A 1I2NA 3GKFA 4MUZA 2ZBTA 2ZRWA 3Q58A 5AYYA 1Y0EA 4XZ9A 5KMYA 4IXXA 3NQDA 2WNQA 5K9XA 1FWTA 5HMSA 3BW4A 2YR1A 2X1UA 4TX9A 3GX9A 1FWSA 1YTKA 4RZ4A 3W7MA 1WDWA 5J5RA 3RF9A 1IF2A 3CLMA 1K8ZA 1QAPA 1D3GA 3N2MA 5D2WA 5G1TA 3GR7A 1SPQA 3NQGA 4O13A 4EIVA 2P1FA 5U4NA 3FEMA 2X2GA 1OYCA 3DFTA 2A6LA 5K4ZA 3LDVA 4MOZA 4XBSA 1K7EA 4O16A 5CPOA 3TSBA 1XI3A 4GXMA 1WBJA 4CQ8A 4LT9A 3GDMA 3NPVA 3LCHA 4MJZA 5CZSA 1UASA 2PE4A 4KWWA 3W87A 3C3NA 5K2ZA 1X1OA 3GAKA 5BMWA 2QF7A 1TJPA 1A5AA 3NQAA 3O8AA 3NQ2A 2ALDA 5ABTA 4MIMA 3PUEA 1H63A 4JIQA 1DQXA 4N9BA 4JN6A 1GYLA 3TNOA 3ZWSA 4RZ5A 3HOJA 4AAJA 2RFGA 5D33A 3UD6A 4DO5A 3G18A 3LLFA 2H8XA 2O7SA 4DO6A 1TV5A 1G4TA 2QAFA 2V5BA 3W74A 2VEPA 1QNVA 2ZZ4A 1OF6A 4BFAA 1SZGA 2NUYA 4JYEA 1B4KA 3PC0A 4BI7A 2FPTA 3HPSA 1CX9A 4MKNA 2QCDB 4WY0B 5F2LA 1TPC1 4AHPA 5KTLA 3FFSA 1GTHA 4O1CA 4PFMA 4Z1CA 3LM7A 2A0NA 2I9EA 2PRHA 3QMSA 5AC8A 3BO9A 3W86A 3EX2A 2YFOA 1Q6LA 3BPWA 4MZ8A 1Z42A 4UTWA 4QAIA 5TIMA 2WNZA 2J9XA 2FQIA 1F74A 3MMTA 3STCA 4Q33A 2XN1A 1KTNA 2RH9A 1B3OA 2BLEA 3S42A 5T26A 2NZLA 4R7JA 4O28A 3BLFA 5A8GA 1TPVA 1JULA 3EWXA 3IIXA 3M7WA 2FTPA 2CLMA 2QDHA 1VGAA 1DORA 2CLEA 3G1AA 3O16A 2DJLA 4FHAA 4RV8A 4WD0A 4DBDA 3ZWTA 3EWZA 1IGSA 2Y62A 3G1YA 2E6YA 3LHTA 6ALDA 3F4NA 3PG8A 3LCWA 1WBHA 3USBA 3NQEA 3W7OA 1X1ZA 2ZQ0A 2ZZ6A 3WFAA 2A7NA 4HKPA 5LNUA 4FNPA 3EKZA 2WOQA 2ZRXA 1UUMA 1TV8A 4P61A 3ATZA 2EF9A 5AHFA 4RX0A 1PHQA 1U5JA 4UMCA 1KBIA 4JTKA 1YDVA 3M1ZA 3GNDA 4DQWA 5BOOA 1QPOA 4E2BA 4LY8A 3TJXA 3DKLA 2Q8ZA 3B06A 4RR4A 3CTLA 3W1RA 3TJLA 2Y63A 3UWVA 3EX3A 4ALDA 4NJJA 1H7PA 3KVLA 3QQ0A 2OZ0A 1OFQA 3U8GA 2W0UA 3N9RA 1G6CA 3DKJA 1MEWA 3CQ0A 1MSSA 3GK0A 2H90A 4LWWA 1JUKA 5C6MA 1G4PA 1G69A 3KHJA 1SW0A 2GQ8A 1SFLA 1RQBA 1FDJA 4KFPA 5HR6A 1LLZA 2BXVA 3TUUA 4NXKA 3W7JA 1W5QA 4OT7A 1GEQA 3VE9A 4IPJA 4LVBA 1OF8A 1H62A 4KKXA 2OX1A 3T55A 4LTSA 1FDZA 2NX1A 4Y9AA 6TIMA 4Q4KA 3TSDA 1B4EA 3P60A 4UTJA 3RNDA 3SI9A 3B0VC 4JY9A 4JTSA 1YPIA 3HPXA 2F84A 4MZYA 1X6UA 3GNNA 3M9YA 2YFNA 3IGUA 2ATMA 2TPSA 4UTLA 5LHEA 1T0OA 4UFLA 2GOUA 4N6FA 1KM1A 3G8RA 4Y96A 4UTUA 5BW6A 2H6RA 3WJWA 4ZQPA 3QZEA 3IGXA 4RZ6A 2C13A 1G7VA 1Q45A 1GT8A 1HG3A 3PVFA 4AWTA 3O05A 1LOSA 3U2OA 1EB3A 2QCGA 4WUIA 5G4WA 2DZTA 4UFIA 1SW3A 1PCKA 3BK0A 5G2WA 3HMJG 3LTSA 2CZFA 2WQPA 3PULA 4GUFA 2V81A 5CG7A 2WJZA 3NPWA 3NA8A 4K39A 3M5YA 2CU0A 2ZYFA 3A9IA 2C16A 3W76A 1XDLA 5HWMA 4N6EA 4XWUA 3LCLA 2PURA 1W54A 4ZQNA 2RDTA 3BGGA 3NDOA 1LLWA 3EX4A 4PA8A 4IMEA 3W7NA 4PCFA 3WK3A 1LZOA 3MW7A 2B7PA 3HGOA 1SO4A 4N02A 1RV8A 5U7SA 3NM1A 1TRDA 1DBTA 3TAKA 3GXNA 2CFFA 1FBAA 1KM0A 1H1YA 3PBVA 4MPQA 2B7NA 3MYPA 3W2KA 5LGZA 3L66A 4IX2A 2DZUA 4FXRA 1ZAIA 3DXIA 4NZFA 3NL3A 3E96A 4WXYA 3C56A 1OFBA 5J5DA 1VZWA 5D02A 4UTTA 4M7TA 4ML9A 3HO8A 5EYWA 1D3HA 3W1AA 3SECA 1MXSA 1TQXA 4IQLA 1R46A 3HJZA 5HUOA 1TPB1 5CPLA 1W3TA 4JDBA 4RCXA 4LW7A 1EWEA 1R2TA 1K7FA 1GG1A 5I3IA 4GRSA 1Z41A 5F2GA 2GVJA 2GVGA 3NO5A 4JNMA 3C8FA 3F1QA 3KRZA 2ZDRA 1PIIA 4HPJA 5FF7A 1GVSA 3SR7A 4WXZA 4FEZA 1OVDA 1EX5A 1CW2A 3A24A 4QQ3A 3M5VA 3KRUA 2HMCA 4UFMA 4FB7A 2FDSA 3C2FA 1ZAHA 4N9DA 3PSVA 1VRDA 1UUOA 1W1ZA 4UXDA 4EWND 2YXGA 1A5SA 2E6FA 2VEMA 3W7IA 1VQTA 3QPYA 5TQLA 1G4SA 3JR2A 4AVFA 1W5OA 4GUHA 2CWNA 3LHYA 3W70A 3THQA 5LNWA 1NSJA 1OFAA 1T99A 1L6YA 4MLJA 3W1PA 4HNTA 1TMHA 4Z1BA 4GUJA 3IIZA 4AWUA 4QJ1A 1DV7A 3GDLA 3A23A 2QCNA 3S0CA 1ZY9A 5K9CA 3IRDA 4AB4A 1ML1A 1SO6A 5HJLA 3LXBA 3W07A 5FI8A 2EHHA 1GQNA 3GXPA 1UB3A 3FOKA 5K4XA 1P0NA 3QRHA 4ONVA 2GJLA 3MI6A 4QITA 3G24A 5DXXA 3CPRA 5EL1A 2CLFA 1TYGA 3DFOA 3P5YA 4TIMA 3NNTA 3BVJA 4EVZA 1R2SA 3VKJA 3IV3A 4IX0A 4K38A 1AG1O 1U83A 5LKYA 3GB6A 5D2YA 2A1YA 3I68A 3CHVA 5A5WA 4CCEA 3M16A 5HINA 4UR8A 3WJYA 1H60A 4QNEA 1L9WA 1IIGA 5C5YA 1WYIA 1JCYA 2QJGA 1TREA 1SUXA 3STEA 4AH7A 1KTBA 5LNRA 1VH7A 1TB3A 2YZRA 5CZJA 4IWWA 1DOSA 1F73A 3W7LA 3HB9A 2X16A 3S1VA 2E5DA 2V5LA 4FNQA 3QSRA 3YPIA 3T78A 3F4WA 3CIXA 4X2RA 1I45A 2HTMA 1QWGA 1OYBA 1G4EA 2VFGA 1EA0A 4WQ6A 4RK8A 1VPXA 3L0KA 3N19B 4JD4A 1B9BA 2GQ9A 3IVTA 1R30A 3JRKA 4M6QA 4W9TA 1KM4A 1RQEA 2KZHA 3C0JA 3SY5A 1TCDA 4GE8A 4JTEA 1TTPA 2Y7FA 2RKXA 1GVQA 2FIQA 2QCLA 2RHGA 4GJ1A 2G5WA 4IOTA 3KAOA 1J5TA 1J4EA 2X1TA 3A22A 1OG0A 1SZFA 1SSDA 3O6YX 3ABSA 3P84A 3MUXA 1KM3A 5G2IA 1UBSA 1DQWA 3N14A 4E38A 3GIYA 4K7YA 2V2HA 2NX9A 1YYAA 2Z0IA 1W3IA 3OVRA 2X1RA 3L0NA 4Y8FA 3FYPA 1KFCA 4CCDA 1ICQA 3O07A 3P81A 4YL2A 3UNDA 3S1XA 2Y61A 2Q8LA 4OWGA 4O52A 1G7UA 4M19A 4NJIA 1JQXA 3QC3A 4DF2A 4XQ6A 3S9YA 4LVFA 1PE1A 2WSRA 1BKSA 3PAJA 3PR2A 1RVGA 1C9DA 3KFTA 2J88A 2O7QA 4TMBA 2YX0A 1YTDA 4ZL1A 5MHBA 3MYOA 1QO2A 2WPBA 3RLVA 1EUAA 1FWRA 1Q3NA 1YDOA 7TIMA 1G67A 1ZNNA 2V82A 3FIGA 2JKAA 4MJMA 4NT0A 1OX4A 3PUDA 2R91A 3EB2A 3TA6A 1CI1A 3W1NA 4E2DA 4O1BA 1BWKA 2NX3A 2AGKA 2J27A 4G1KA 3TMLA 2FPYA 3P67A 5KZDA 4U4MA 2RDUA 3NVTA 2VFIA 1F76A 4C1LA 1QO5A 2WNNA 4JTLA 3UWUA 1ZFJA 5DY2A 3UWZA 5D05A 1MEHA 2ZZ1A 1JRCA 1I2QA 4PH6A 3EWUA 3NL6A 4Z0SA 3DI0A 3L67A 4ZZ9A 3LOTA 3B0PA 4AF0A 4JTGA 4NZJA 5FEPA 3G0XA 1JRBA 1YXDA 3TV8A 4UUIA 1GYNA 3TX9A 1BWLA 4PC8A 1EP1A 1LBLA 5F4XA 1PVNA 1AL8A 1H7XA 1LDCA 3HIJA 3L5MA 5F4SA 1I8JA 3W7EA 2WKJA 4A22A 3DAQA 1XM3A 2ATSA 3NXFA 1HL2A 5FF4A 4N4PA 3PUOA 4DF0A 3GAYA 3GKAA 1HO1A 5I3HA 3W84A 4LOCA 3DZ1A 3TQVA 4E0CA 1LOLA 4XUGA 1BEUA 1QR7A 3G0UA 2EAWA 2TYSA 3NQ7A 1KA9F 5D2VA 2CZ5A 3S1UA 3LBMA 4DO4A 3RU6A 3E12A 4K6AA 1B57A 2E6DA 2YGYA 1TQJA 5F4WA 3R5EA 3NL5A 2LLEA 2E77A 5K9DA 1SW7A 2B7OA 2DZVA 3UWQA 1P1XA 3T4CA 4LNYA 1OX6A 3T7VA 4Z0JA 3EX1A 5CZTA 3TMQA 2QCCA 3TW6A 4FNUA 2F7FA 4PL1A 2BZNA 5TBOA 3N2XA 3W2LA 1IXQA 1SU5A 4ORMA 2DZSA 1ZHAA 2B4GA 1LP6A 4WJEA 2Z6IA 1V7YA 3AO0A 3PBWA 1OFPA 2R94A 3W88A 4Y90A 3IGSA 4MYAA 1JVNA 3C6CA 3JS3A 1ZCOA 5D09A 2A4AA 3GLCA 4LVAA 4GUIA 4UIOA 1H7NA 1H7OA 1TRIA 2JGYA 1WOBA 2C1HA 3ELFA 3OA3A 1TIMA 3B0UX 5G5IA 2ZCGA 3DH7A 3FLUA 4X9SA 4LS2A 4IMFA 4ADTA 3ZR4A 1FXQA 3TXZA 5H2ZA 3W7KA 1IIHA 5LGXA 5D38A 4JIPA 4M6VA 4UFKA 4O1DA 5C55A 1JUBA 1L2UA 2GPTA 3CC1A 5C2XA 4QM1A 3C2RA 3O1NA 1ZAJA 3W7RA 4CNPA 3M43A 3S5ZA 5D32A 1JCLA 1EIXA 2Y89A 1PCWA 3WJSA 3L68A 1NF7A 3W1QA 4MY9A 1H7RA 1LRQA 2VELA 3M6YA 2WV8A 3NQ8A 3M41A 4JTHA 3DU0A 1NFBA 3NEVA 2EGZA 4A2SA 2VFEA 3L2IA 1TPDA 4ZQCA 3OVQA 4TMCA 3LGEA 3NZ1A 2PCQA 3NZRA 4RXFA 1DJNA 1UCWA 1VR6A 2P10A 3FJLA 2B7QA 3N34A 3PBUA 1GVOA 3MI2A 4HN4A 2EKCA 4RLIA 4QSHA 2H3DA 4OGZA 1OK4A 5E0KA 5HNRA 2DP3A 3QMTA 3VI2A 3CM4A 3CWNA 3IVUA 3THAA 3ABQA 1LRTA 4L4LA 1IXNA 1H5YA 1F05A 1VLIA 2HS8A 5CSSA 3LHWA 5F2IA 1T8XA 2Y7EA 4WY0F 5I3GA 2VFDA 5EMUA 4NXSA 3C2EA 3G1VA 1EPXA 2WSYA 3R2GA 5K3VA 4U28A 1YXCA 4NNCA 1TPFA 1KFKA 1KM5A 3UXDA 1O60A 2A21A 1VYPX 1P4CA 1LCOA 2D73A 3ZS4A 3DBPA 1M5WA 1MO0A 4LU0A 1F7BA 3B8DA 4S2CA 1KLZA 2ZFAA 2YDAA 1KBJA 2NUXA 3LBCA 3BGJA 4O4WA 5D04C 1LTDA 2DZWA 4O1AA 3FKKA 3B4UA 5AHEA 4RKAA 3G1DA 3GDKA 4HSOA 5C54A 3KVKA 1GOXA 2CZDA 4I7UA 5AHLA 2JBMA 4FO4A 2V30A 2BWGA 2NLIA 3L9CA 4O4VA 5EA9A 5F1VA 1E51A 1YADA 3LI0A 1ZJIA 2GVLA 4CCCA 3SJ3A 1RZMA 3PB2A 1K7XA 1P5BA 5K7JA 1I4NA 5FF0A 3GZ3A 3EWBX 2YW3A 1TO3A 3TSMA 3W7CA 1JR1A 4ADSA 4UCGA 1OJXA 3IEBA 2Y7GA 1DJQA 4H3DA 4Y6GA 3QQ1A 3C4UA 3EXTA 4J9JA 4LC8A 3UY8A 1OX4B 2VEKA 5DELA 1OFOA 3PBYA 4RXGA 1H7WA 1VCGA 1A5BA 1XBXA 3DENA 3R8RA 4O8RA 2V2CA 4XTDA 1SFJA 4X3ZA 5DXYA 3T40A 3VCRA 4MY1A 5KINA 3UPBA 4IPIA 4OBTA 1F6KA 5HULA 3OBKA 2PRLA 3CU2A 3G3DA 2NWRA 2TSYA 1GWJA 3HG4A 1TPEA 1N55A 3GYEA 3BW3A 4WOQA 1TJRA 3QW3A 1LROA 4N4QA 3I7SA 3FKRA 1NVMA 5IBXC 5AN7A 3P5ZA 3O63A 1JCXA 4CNOA 4EF8A 3B04A 3TFXA 2X30A 3L5AA 3QSTA 5KITA 3G8EA 3LTPA 2DU2A 1TTIA 1L6WA 2ZZ3A 1X8FA 4UTWC 4O53A 3ABOA 5L9FA 5CKSA 5AC7A 8TIMA 3C2OA 4LRSA 3UZ5A 1KFJA 1KM6A
chains in the Genus database with same CATH superfamily
4I7VA 3ZJ7A 2V0TA 2CCRA 1GYMA 4HNVA 1E6ZA 2O56A 5I3JA 5CSUA 2ASHA 3HPFA 4XBKA 4E3VA 4U3AA 2P88A 1W3HA 4HNLA 1FWNA 3INPA 2CBJA 4O0KA 4H9XA 5CSYA 2ISWA 5DBTA 4NRRA 1KQYA 1XBVA 3IJ7A 4XD6A 2NW0A 3C0LA 1ODUA 4FF7A 3RRAA 3GUWA 1ZBKA 1KWKA 2O0TA 3F2DA 1MWOA 1O4UA 1JNEA 1T6MA 3SCVA 1XLEA 1SQ7A 3E49A 3MY9A 3MMUA 2W9MA 1AZ2A 3K4AA 2Q6ZA 4M7SA 4MYXA 1X96A 3I7QA 3WY1A 2QUTA 2ZTKA 3B05A 4AZ6A 4XD5A 3LHZA 1R7AA 4UQEA 5BXSA 4Y9OA 3U4AA 3GZAA 1QNQA 3M5ZA 4C6OA 2ZRZA 1OQFA 4QIUA 1S5TA 1NQKA 3G2GA 3A4AA 3OHMB 4FXSA 4E4FA 3WNMA 3OYZA 5CGTA 1PBGA 2JALA 1FQ0A 1Q4WA 2Z29A 1NDYA 2ISSA 4N9CA 3VX1A 5AB3A 4ZBCA 1KFLA 3LRKA 1VRXA 2WW5A 2WO5A 3B03A 1TWSA 2EPNA 3VNDA 3W71A 3COTA 3BG5A 5EGRA 3VX0A 1DHPA 3QTGA 3WNPA 4G56A 4KFNA 3VFLA 1KBLA 3DHPA 1O95A 2YKKA 2PDFA 1W5NA 4NNAA 2FLIA 4IGNA 2A6NA 3M44A 4MUPA 2FVLA 5AY7A 1LOQA 2BB0A 3ZM8A 3VGHA 2AKMA 3LHUA 4DPPA 1O1HA 2PSNA 1KFWA 2FJKA 1HUVA 2F6UA 3NQMA 4YXGA 5E0CA 3L4UA 2VKZG 1H49A 2DH3A 4GH3A 3P6LA 2OJPA 2V68A 2VEGA 4PMXA 5E70A 1K02A 3W29A 3OQ8A 1F3EA 1VEOA 1XC4A 3SIZA 2PB1A 1W3LA 5EY5A 3E2SA 1HGYA 1WZAA 2VX7A 1A5MC 3G77A 1XIBA 2PRMA 4BZYA 3W6YA 3IACA 1E1CA 1R3WA 4YTUA 2AAAA 4UCFA 3T05A 1ME9A 1CGVA 1VFLA 2ZZ5A 3GNRA 1TVLA 3WKZA 1XUUA 4HB7A 4Q6XA 4ENLA 4AWSA 4OKDA 3WEZA 1LORA 3ABXA 1I75A 3UJFA 3WJXA 1OC5A 1G01A 1LYXA 3VNYA 4IM4A 3QF0A 2PF0A 3N4EA 2F6KA 4JOMA 4ROQA 3A3WA 4IF2A 1EQPA 3H7VA 5BU6A 4AEEA 2HXTA 3WBXA 3H2OA 1LBMA 3WLLA 4AZGA 1C8VA 1M7XA 4XKMA 1C8QA 4LV4A 2QCHA 3ARUA 4I6VA 3AJXA 5MKGA 3GH4A 3GIPA 4JTFA 3MWCA 4R85A 3H24A 2CLIA 3F4CA 3K8LA 4PB5A 4OU1A 4AXKA 1PHWA 1XXXA 2QJHA 3VIHA 5I6SA 5JVLA 4DYEA 1JUEA 1K6WA 5CPNA 3TTOA 2GJRA 2OT0A 3DHFA 4H8NA 1OCNA 2OR2A 4H7ZA 4K1GA 1UD2A 1RBOB 1FKWA 2YSWA 3D5HA 1GW1A 4GC4A 4UMBA 4FIRA 1GG0A 1RCOB 1CEOA 2CLKA 1VJIA 4GNKB 4ZB0A 2CW6A 3KOYA 4DAIA 4L4MA 3HZ3A 3IJ6A 4JEQA 1EEPA 1U22A 3VFCA 3U7BA 3DIPA 3BUVA 4ZOCA 4FIQA 1EDGA 4KWSA 1VP5A 2BY3A 2R1MA 1S2AA 4MG4A 1V0LA 5BMXA 3UPWA 4JGDA 3V1PA 1NY1A 4O54A 1HKJA 3IVSA 1UR1A 7REQB 3GVGA 1RPKA 1LWHA 3RJXA 4TTGA 4HNUA 2ONEA 1Z48A 2VOMA 2VP8A 1HXJA 3CUZA 4BQ2A 2QDGA 2PDPA 4C6DA 5I3FA 1UH2A 4MGGA 4QRNA 4GI4A 2Y7DA 4AZHA 3GH5A 3PFMA 3TROA 2VNCA 1B5TA 1Q5MA 1SFTA 2PWHA 3D46A 1UD3A 3FN9A 3HQ1A 5HWJA 2VVSA 5B7YA 1WKYA 3GXIA 5A6BD 2NQJA 4AY1A 1J93A 1NAL1 2EPKX 1I2RA 1HNYA 4UNIA 2VRJA 3WENA 1LT7A 3FK4A 4GABA 4RE2A 1TSIA 5AC6A 3G3MA 3CUXA 3LV5A 3STPA 1QPNA 2PPGA 4Q7IA 6A3HA 2VD8A 2CNCA 3W37A 3P8IA 1KGXA 1VD6A 1XIGA 3RR1A 1E4IA 1RR2A 1EZ2A 1GTEA 2RDWA 3TIMA 1WZMA 2DZXA 4D9PA 3ZO9A 4R34A 4PBGA 1K9DA 1J9YA 4AD2A 1VBUA 3QFWA 3EWWA 4PRRA 3M5XA 1UROA 4GKLA 3PPGA 2VQTA 1M01A 1W1VA 4IMCA 1ODZA 4GO9A 5EFFA 1NF0A 5BRBA 3KOWA 3K46A 1AW1A 2C71A 1PPIA 1DEDA 4NQ1A 2WM0A 5C8BB 4ES4A 4AD5A 4UFJA 4K8EA 4WX2A 2R1KA 5FSDC 4GJJA 5M1TA 1V5XA 4LB4A 3O7UA 4H2CA 1V0NA 2Z1SA 1GCYA 3DI1A 3WQGA 2FDMA 1EJ7L 5HQLA 1XIDA 1A53A 3EZ4A 1YPFA 3ARSA 4ZO6A 4NYYA 4IMDA 2X2YA 3NQCA 5DLCA 1F2JA 1PIFA 3F5JA 5BOFA 3I3EA 5D03A 4YS1A 1OSEA 3UWWA 5D2TA 3PB0A 2BDQA 2XFRA 4AD1A 3T0TA 1UWRA 2KAUC 2J13A 5AC5A 4JHOA 3W01A 2PS2A 3LUTA 2FGLA 3O6CA 4QJ4B 4XKYB 1VBGA 3W23A 4DBWA 3LERA 3WBWA 4NZ3A 2JIWA 3W7DA 2ZZ2A 5G4HC 4ZEPA 3JW7A 2A5HA 2X40A 2YDRA 4U10A 3G1FA 3M0ZA 3W2NA 3O15A 1JEZA 1AODA 1NEYA 3MUAA 4AX6A 2D3LA 4XZHA 4H7CA 1MMFA 3WQPA 1JQVA 3TDFA 3B0XA 5AFDA 1WXJA 3GS6A 1UD8A 3NZQA 1ECQA 1KLYA 3EB4A 1HT6A 2FJUB 4TX6A 4Q8VA 3BARA 1J79A 5IM51 1KR1A 4H8VA 2GJNA 3CBWA 1WQ5A 3BAYA 4X9YA 3LCGA 5GNZA 4NNBA 3C61A 3OGSA 1UD4A 3AIBA 2Z26A 1C8XA 3OHIA 3DFYA 1FWWA 1XDMA 2RGLA 1S3HA 3P62A 1OG6A 1OYAA 2HBXA 3NL2A 4F3HA 2VYOA 1RJPA 3CB8A 1ZB5A 3WMSA 3TE9A 3UG3A 3NQFA 4GX9A 3QC0A 3P80A 3MP4A 2QHAA 2VR5A 1ELSA 1JXKA 1K70A 5C9RA 1W9DM 1FWGC 4EPDC 4EKJA 3W1LA 4AISA 4NU7A 4O1EA 5I00A 1QNRA 1EC9A 1OFRA 1P1MA 5C9XA 5LNSA 1TE1A 3QR1A 1KTCA 3W9ZA 4HTBA 5EU9A 1V3KA 3TYBA 4IIFA 2WVTA 4B4HA 5D8ZA 1B3VA 2WSKA 1JYNA 1ME7A 4M80A 3M0KA 4Z2HA 3FJ6A 5HXMA 2BMBA 1V6VA 2PP1A 4YMZA 4CQCA 1CTNA 3PWAA 1TTQA 4ERAA 4Q4SA 5AZ0A 4H01A 4KGJA 3P61A 1SJCA 1TPUA 4UC5A 3TN4A 2PDUA 1BGAA 3VNIA 2DIEA 2NT1A 2CC0A 1IWPA 3M4HA 3S8HA 1QI4A 1EJTC 5DO8A 3MB9A 4TV5A 2I1OA 4JDYA 2YA0A 2VZUA 3KS5A 3THUA 1TTJA 1J2BA 3LLDA 3EWYA 3G22A 4QBXA 3EKGA 4JNYA 3FA4A 3UR5A 3NWRA 3VILA 4C1KA 3K30A 3W3OA 5HQEA 3SGGA 2VCAA 1CXIA 3PTDA 4P2VA 1JI2A 3TKFA 4AHQA 3QKZA 4MLRA 1QWKA 1XPGA 3ARRA 1UG6A 5LA1A 1OIFA 4CQDA 5HK4A 3DGRA 1A5OC 1A49A 3V5OA 3WBYA 3RK8A 4Y9MA 1C8YA 2PDGA 1SJAA 4DLFA 4YYCA 4ZXLA 1VAHA 4IHCA 1H3GA 1BHGA 4GYJA 4HMCA 3DFSA 2H3BA 1Q66A 1TG7A 3TWBA 1LJYA 4UMAA 2VGGA 1KCZA 4DM1A 3VPLA 2NXGA 1L6SA 3HQPA 1KD0A 1QPRA 3PM6A 4C7FA 4JS3A 1O1ZA 4IUGA 1VYRA 4JX6A 2VOTA 2EPLX 4DXKA 3DFPA 2JGQA 1SO3A 4PMZA 4PMRA 3MSRA 3S2MA 2IS7A 4Y7EA 3GDRA 5EBUA 5ECVA 3H53A 3WJZA 3SUTA 2FVMA 1RLDA 1THFD 4PE8A 3UT0A 1TV4A 3LPPA 1FXPA 3PK7A 1BKHA 2PLKA 1KCKA 3Q94A 2W67A 3K5XA 3M6DA 2ZBTA 4ZTYA 1Y0EA 3ECQA 4XZ9A 5KMYA 3B9OA 3H2NA 2Q01A 2Y8UA 5K9XA 1IR2A 2GSJA 3BW4A 2X1UA 3GXFA 2V3FA 4GY0A 1QI5A 2F6XA 4CCZA 1TR1A 4MHBA 1WDWA 3RF9A 3LPOA 1IF2A 3WLQA 1K8ZA 5D2WA 4L9YA 2PDBA 1SPQA 3PZQA 3FEMA 3CJPA 4XK2A 2X2GA 1OYCA 4NZ1A 4ACZA 4XBSA 2I57A 1XWYA 2VUNA 4EXBA 1WBJA 4CQ8A 4LT9A 3GDMA 3T08A 4MJZA 3XIMA 3GAKA 5LIUX 2QF7A 1TJPA 4F2UA 1A5AA 3NQAA 3GG1A 4BQ5A 3PUEA 1H63A 3ALFA 4YTQA 4N9BA 4JN6A 3VIIA 4DJFA 4A4AA 3DERA 1BG4A 4LH8A 3NCOA 3LLFA 2FZDA 3H2FA 4FXFA 1RCXB 4XZMX 1IEXA 1TV5A 4P5UA 3A64A 1X97A 1PJ9A 1R9ZA 2YCLB 3ES8A 2VX4A 3A3XA 5HOSA 2OEKA 2VEPA 3H4GA 3LQGA 5REQB 4BFAA 4GCXA 3PC0A 1W9XA 4M6UA 5A6MA 2IXVA 1VPYA 2ZUTA 4UOJA 2Z24A 5JQ9A 5KTLA 3AHYA 4Z1CA 2A0NA 2I9EA 1F3TA 1DP0A 5M17A 5AC8A 3BO9A 2V63A 1F07A 2YFOA 3B8VA 4UTWA 2IPJA 2CHOA 3WNOA 2WNZA 2J9XA 2PDCA 3QY6A 2ZX9A 3MJMA 1D7KA 1KTNA 1B3OA 2BLEA 1UR9A 4O28A 3GD6A 4ATDA 1TPVA 3QV6A 1JULA 3IIXA 2FTPA 1VGAA 2R1NA 2CLEA 3QV7A 1IGSA 2Y62A 3CQKA 3HQOA 4MKVA 3ARZA 2E6YA 5M5DA 2X09A 3CHFA 2PDKA 2VZSA 3WLNA 3LHTA 1JG9A 1WBHA 1XS2A 2W4XA 3WH9A 3NQEA 4B4FA 3H22A 4PN2A 3KLLA 4DO7A 3BOXA 4DUVA 2A7NA 1UUMA 1R3SA 1F61A 4P61A 1V79A 1SFSA 1OD8A 2OTDA 1GPFA 4RX0A 1YDVA 1KNWA 3U0HA 3GNDA 2GGIA 4DQWA 3WN6A 2DT0A 4C6LA 3LPFA 4PB4A 3AIUA 4J35A 3RGTA 2PDLA 4FI4A 1R3VA 4ZB2A 1VEMA 2YB1A 2GWNA 3CLWA 3WUBA 3C3UA 4JPGA 4X0NA 2D23A 3UWVA 4ALDA 1H7PA 3TTSA 2PTDA 1P0EA 3QQ0A 4XSMA 1MFVA 3BAWA 2OZ0A 1OFQA 3N9RA 1MEWA 2OXNA 2ZX5A 2X7VA 2H90A 3CQ0A 3GK0A 1JUKA 2XWDA 5C6MA 1E5NA 4YPJA 1G69A 1SW0A 1N2VA 2GQ8A 4KFPA 4XUYA 4D72A 4V2XA 4NXKA 1NWUA 4OT7A 1E73M 3OP2A 1H62A 3H8AA 4C65A 2OX1A 3T55A 4LTSA 3KBWA 4Y9AA 6TIMA 2NLYA 3TSDA 2VX6A 4JY9A 4JTSA 5KEZA 3HPXA 1DE5A 4D6HA 3GNNA 2J62A 3OVGA 3U57A 3ZYZA 5LHEA 3R43A 1UP0A 3WQ6A 3G8RA 1JD9A 3GC4A 4RDWA 2YLLA 4ZQPA 1G7VA 4F0SA 1O66A 1HG3A 3PVFA 3GY1A 2W61A 2G41A 1NQ6A 2FH6A 3CWHA 4OBSA 1S2WA 1BYBA 2QGHA 4ILSA 1W9BM 2DZTA 3CZGA 4UFIA 3M7SA 4YU1A 1NJJA 4RZBA 3PJTA 3I6TA 3KBNA 3HMJG 1N8WA 4LNCA 1BXBA 3LTSA 2CZFA 3RLHA 1TZZA 3WEOA 4GUFA 4WDTA 5IFTA 3NA8A 2CU0A 1KGUA 3TONA 1XDLA 4N6EA 4LALA 3VTRA 4ZQNA 1E1CB 2RDTA 4GOAA 1EX1A 2PDJA 4HCDA 2X05A 1S38A 2C79A 3CAQA 1LZOA 3VIFA 2XIQA 1QXLA 4YYFA 1SO4A 1RV8A 5CC3A 3GXNA 2L5HA 3WH6A 3PBVA 5I07A 5LGZA 1HKIA 2PD9A 3WQCA 3RX3A 1HJXA 3BGAA 4NZFA 3NL3A 3E96A 3JVAA 3C56A 1HIZA 2D3NA 3HO8A 5D8WA 3W1AA 2R82A 1UWQA 1TQXA 3HJZA 1R3YA 1G0CA 2GGGA 5CPLA 3NIYA 2G8ZA 2DW7A 1GG1A 2OPJA 1Q6FA 4DM2A 4LEQA 4NP7A 5CXPA 2GVJA 3NO5A 4JNMA 5MKGB 1AJZA 4J2PA 1S2TA 2BVWA 3TYAA 5FF7A 1GVSA 4GACA 3T1GA 3VNJA 4RPQA 2FZ9A 3QOKA 3A24A 3QHOA 4HYVA 4M1RA 4HMNA 2WVVB 3KRUA 2HCVA 5XIAA 3C2FA 1ZAHA 4F8XA 4N9DA 4EWND 2ZC1A 3WDRA 4AVFA 5TQLA 3QZ6A 1G4SA 3JR2A 1X6NA 4GUHA 3PZMA 4D1IA 1EC7A 1PB0A 1B30A 1NSJA 3VNMA 4EXAA 4MLJA 5I77A 3W1PA 1FOBA 1E5JA 4Z1BA 4GUJA 1MRAA 2PGFA 3PP7A 4QJ1A 3GDLA 3ZZ1A 1A5KC 4EP8C 3S0CA 4Q3MA 4LBRA 3CZEA 4FOJA 3NTYA 3LXBA 1W1B1 4DXXA 5I23A 1GQNA 1UB3A 3V4BA 3VD3A 5K4XA 1P0NA 1NFPA 1GZJA 4PUMA 1E0UA 3QLLA 3MI6A 1VBJA 1PXGA 1E1EA 4IFRA 2HDJA 1MQRA 3APYA 4LUSA 4TIMA 3CL7A 1GVYA 1HX0A 1OADA 1DWHM 4K38A 3VC6A 1AG1O 5JIWA 1U83A 5LKYA 5D2YA 2A1YA 3I68A 4ZODA 3CHVA 5A5WA 3WJYA 1JCTA 3SEPA 1CB2A 1L9WA 3N2TA 2FFIA 1CECA 2QJGA 2WXDM 3WDQA 4XSLA 1Q85A 2AGTA 1R3QA 3OIHA 4JEJA 2YZRA 1K77A 5CZJA 1JZ3A 2BGNE 1F73A 2IPWA 3AXXA 4F0MA 1UYQA 3SRHA 3EOEA 4FNQA 5FL0A 1NIUA 3F4WA 1XLCA 4ICMA 4X2RA 3TJIA 2HTMA 3IGHX 1G4EA 3ALGA 4RK8A 3ITYA 3VVGA 4JD4A 1B9BA 3RPDA 5T8GA 1E4LA 4GZJA 2HE5A 4W9TA 3CQJA 1PKLA 2KZHA 1ENUA 1TCDA 4JTEA 1TTPA 4D8LA 2FIQA 3CZJA 3B40A 1W8GA 2G5WA 2OZTA 5CQ1A 3A22A 3GFZA 2ZADA 1LG2A 3N13A 1ISWA 1MUCA 3E5PA 4MKSA 5LIXX 3MUCA 3GIYA 2NX9A 2INZA 3SUSA 2Z0IA 2X1RA 3L0NA 3FYPA 4NAEA 3SN1A 3O07A 2J7FA 1FHDA 2Q8LA 3FW6A 3WNKA 1QPKA 2JE8A 4LANA 1KQZA 4LY4A 3K8KA 3BJFA 4XQ6A 4G9PA 2DUZA 3S9YA 2ICSA 1XLAA 3QGVA 1UIOA 4KCVA 4A3YA 1BKSA 1A3HA 3PAJA 1K9EA 4W7VA 4XBJA 3PR2A 4QCEA 1EDTA 4KBXA 1RVGA 4J4KA 2J88A 2O7QA 4F48A 1TZ7A 1UD6A 1YTDA 3OLIA 4NG3A 1XLFA 1C7SA 1U1JA 2CWXA 1P6CA 5CC5A 3WQOA 1E9IA 3OLEA 2R91A 3ARQA 4E2DA 4O1BA 1BWKA 2J27A 1HJSA 3DG7A 4FR1A 4F66A 4AD0A 4H04A 2WK2A 2WNNA 4NZCA 1UOKA 1ZFJA 3UWUA 3GU9A 4MWAE 1MW2A 4ECLA 5M2FX 4QJ3B 2QDEA 2ZZ1A 4JFSA 1JRCA 1QI0A 4AVOA 1I2QA 3T9PA 3WNNA 3NL6A 4LEFA 3UYIA 2REQA 4JTGA 2QZRA 1J0JA 4JTAA 3TV8A 5I24A 2PZNA 4GVIA 4MNKA 1PVNA 4X63A 1AL8A 2F8QA 3VOCA 5DQPA 2E28A 3U7VA 1J0KA 1YBQB 2ZX8A 4A22A 3DAQA 4EE9A 1RA5A 4PCNA 3SDOA 3L7RA 2HEJA 4DF0A 3GAYA 3GKAA 1HO1A 3DZ1A 4IPNB 1LOLA 1YEYA 3ZQ9A 3V36A 4H9YA 4DO4A 3WD0A 3AYSA 2E40A 5J04A 2BVTA 4JTRA 4F9DA 5K9DA 3UWQA 3AROA 5CZTA 2JQXA 4PL1A 1IV8A 4CKQA 3EBVA 3URBA 2DZSA 3EPNA 4KERA 2QMKA 1OFPA 3W88A 3A4XA 3KZSA 4Y90A 3WFZA 4P8XA 4KESA 2R1LA 3FV9A 1ZCOA 1H7NA 1TRIA 2GSEA 1WOBA 1TIMA 4K2SA 4PMVA 3V0TA 4X9SA 2Z4GA 1PYFA 3L4ZA 1OINA 1FXQA 1AZ1A 3S1GA 3VGBA 3GVWA 2HPIA 3TXZA 2ZUWA 3VD5A 4M6VA 4W5UA 3WDIA 4O1DA 5C55A 1CZ1A 1GUVA 3W7RA 2X0HA 3TCSA 2WKGA 4QG8A 2QVNA 1JCLA 3VOHA 2HNEA 3L68A 1H7RA 3M6YA 1CGYA 3M41A 1NFBA 4D6IA 2VFEA 2BODX 4UZSA 5LIYX 3W26A 4ZQCA 3NZ1A 3NZRA 3N34A 1QHOA 2B7QA 1YNYA 1CB7B 2EKCA 4PMUA 2YL5A 2R9RA 3VI2A 3TOPA 4DYKA 1WCGA 2ZUMA 3THAA 4TTUA 4X61A 4PTVA 1JZ5A 5F2IA 2X42A 1T8XA 5I3GA 4PUJA 1EPXA 2WSYA 3E5BA 2BASA 5K3VA 4NNCA 1KFKA 1UA7A 1H09A 1O60A 5DANA 4LU0A 3C2YA 3TZNA 1KBJA 2NUXA 3U2ZA 3N4AA 4HU0A 3SCPA 5I5RA 1ITCA 4DUOA 3VO0A 4QR6A 4W88A 6XIAA 3FKKA 3B4UA 3NSMA 2WMIA 4RKAA 2VZVA 1BSIA 3GDKA 5AHLA 4QDMA 4UOQA 1TWDA 4BJHA 1QHPA 3L9CA 2NLIA 1MW0A 3TN6A 4CVUA 3S3GA 2WJDA 4CCCA 3ZT5A 3SRKA 1P5BA 3GZ3A 4LAKA 1OJXA 3IEBA 4Y2WA 1DJQA 1PAMA 4XV0A 4CGTA 4Y6GA 3AUOA 3SIMA 3ARYA 3SJNA 3NVDA 1DJGA 2J6VA 5EMYA 3EXTA 4J9JA 2OKOA 4PEEA 1PUDA 6PTDA 1M68A 1OFOA 4J3SA 1QTWA 4A8NA 5ABFA 2ANUA 1GGOA 4LAOA 4C5YA 2PLMA 4O8RA 2V2CA 5DMMA 3FAXA 4X3ZA 4XTDA 4Q8NA 3T40A 4MY1A 4GIYA 4IJCA 3S46A 1F6KA 2OYMA 1E6SM 2ACSA 3U2CA 5FKYA 4JBRA 1GWJA 1TPEA 2CXGA 2GOKA 3GYEA 3BW3A 4WOQA 1Q65A 4NAFB 6CGTA 2VCCA 4PCPA 1V8EA 3FKRA 2ZKMX 1PO9A 3WD3A 1Y65A 5KZ6A 1M53A 4L1XA 1JCXA 4U2ZA 4CNOA 2XIIA 1UKTA 3B04A 4L1GA 3TFXA 3H7UA 3UG5A 5A95A 3L5AA 5KITA 3LTPA 3MKCA 3REQA 2ZZ3A 1V3LA 5FA5A 2VWSA 4O53A 2FHCA 1CGTA 1W6TA 1TJ1A 5AC7A 2Z28A 4LRSA 1XIIA 1PZ3A 4HZ8A 1EGMA 1KM6A 4EANA 1P0KA 3FYYA 4WY0A 1Q2SA 2XISA 3G1XA 4DZHA 3DESA 5FCZA 1HTIA 4LUTA 1ISXA 1V93A 3IIPA 4O17A 1F8MA 1TELA 3OW1A 1TV3A 3GSMA 3AMGA 3MPGA 1YRRA 5H8UA 4BF7A 3MWAA 4X22A 3BZJA 3U6WA 1V0MA 5M3WA 1FUYA 5RUBA 1J0ZA 2TRSA 2FFCA 1YE6A 1M03A 3UERA 4EAYA 3QZAA 4MVAA 1EP3A 3TCEA 2Y4SA 1ONXA 1XBYA 2C0HA 2E5BA 1ME8A 1C3FA 3OA5A 2AQWA 3KHDA 3FGCA 4JTIA 4P7RA 4U2YA 3MBDA 4LS0A 2D0HA 3DC8A 4GA8A 1KCXA 3BAJA 1UQYA 1EP2A 4JZ5A 9CGTA 3CEPA 5FL1A 1WOAA 3S9ZA 4HU3A 1HKKA 5D9OA 3GTFA 3IJDA 5MF5A 3W2JA 4JXCA 4X2PA 3UGVA 4PTNA 2C0AA 1XLGA 4YCOA 3SGZA 2PTWA 4AG0A 3MKKA 3CT7A 3TLLA 3S6TA 4I90A 3GYCA 3L21A 1AJ2A 1AH4A 1BGGA 2VO5A 2QJIA 5A6AA 1TUXA 1RK5A 4GYPA 5HWNA 3N9KA 1CBGA 1AQ0A 2NUWA 2Z1WA 4O50A 4HBKA 4A2RA 1O5QA 2O9PA 3SADA 3EEGA 2NWSA 4GH1A 2MANA 4AYGA 1TA3A 3QY8A 4DIAA 4MB3A 4C91A 2Z1BA 4Q4OA 2IXUA 3VM7A 3OLDA 3M0JA 1A4MA 3EOUA 4LRTA 3S5SA 2HISA 1D2KA 4R7OA 3BSMA 3LY0A 3V16A 4Z1DA 1LUCA 4HHPA 3O06A 4QJ5B 4JICA 1DKWA 3BQ5A 3UVAA 3W83A 1N82A 1DJIA 4UNKA 3WBEA 4YIWA 4A35A 1AK5A 4F0KA 3LCIA 2QLYA 2YXXA 4YNGA 3QBUA 6ENLA 2CESA 3VMNA 3QYQA 1UWAA 3CASA 4M24A 1GVFA 1XV8A 4EACA 4JFUA 3GXTA 3IIOA 1QT1A 1XW8A 4H9UA 1J6OA 2XN0A 1U5HA 3CYJA 3W7QA 1XCXA 1AW2A 2X1IA 4XO7A 3LK6A 3CUFA 3PZTA 3RFAA 4BF9A 1XDJA 2VL4A 4DBEA 3FSTA 4A3UA 1NDWA 1KV5A 3KVJA 1XBZA 1A50A 1SZEA 4C60A 3WUEA 2G96A 4I7WA 4IP5A 1XLJA 2QAPA 4B5VA 4CNNA 4JCMA 1VF8A 4HA3A 2Q8XA 3EWCA 3QY7A 1YLVA 2BY2A 3IUHA 1F3WA 3CZ8A 3P74A 1ALDA 1AW5A 3OIXA 3NUKA 3IAQA 3MI3A 1PV8A 1I2PA 5FF2A 1DWJM 4C6FA 3NAVA 5HAOA 2E68A 2DSVA 1O5KA 4MFDA 1J8VA 3VKKA 2QEZA 3PWGA 5BYWA 1W37A 5CPTA 1WNOA 5ENLA 4UQAA 4IGHA 3M0LA 1V3MA 3WQ4A 3PSWA 1XYBA 3OO2A 4WHBA 3SCWA 3DFHA 1OABA 2Y88A 1GOQA 2PC8A 4S2BA 2DORA 3A3HA 4HSNA 5DBUA 5IOBA 4UTHA 2PBGA 2AOSA 3CAVA 5E93A 1OX5A 5HBFA 3V35A 1QW9A 4W7WA 3CXOA 3PHAA 4J3WA 5JH2A 3UPMA 3MS8A 2G0WA 3XINA 1BYAA 2PEVA 1LM1A 3QW4B 1C91A 3FVMA 3LN3A 3TC7A 2Q3RA 3QFEA 3GR8A 2IKIA 3HGRA 1SMAA 2PC4A 2E5CA 4Y9PA 4RNFA 3M0IA 1QOPA 1VS1A 2BP1A 4LYKA 1W0MA 1N8FA 4HK6A 3RPTA 1EYWA 2IQDA 4A21A 1FWJC 3CMJA 4QS6A 1IHIA 5CJNA 3UZWA 1GORA 4UTIA 4AZCA 1YE4A 4G2DA 5H8PA 4DUXA 1JPHA 2HZGA 2YPIA 4Q32A 2XU2A 2PWGA 4FNTA 3AHVA 2P53A 3UXKA 1QOQA 3Q65A 3P0XA 4RNIA 3T42A 4AIUA 1XPYA 4QISA 2AL1A 3WH8A 1FFQA 1FY6A 3GVQA 4WZHA 2DVTA 4MAZA 2WB5A 5DCDA 2GGJA 3URQA 3TQ0A 4FLSA 1P7TA 5FJJA 1FCVA 4RW3A 2OMAA 4S38A 4ZSUA 4MSSA 1XQKA 3MQTA 4IIEA 1DIKA 4BEQA 3TK7A 4H6KA 1AFSA 4GVHA 2JIEA 4BI6A 1ONWA 5A3HA 1KW1A 3ARWA 1ZZMA 1YW1A 4J27A 3ZOAA 5KZEA 5DF0A 2OT1A 4CU8A 4N2YA 1JDAA 2A3HA 1IXOA 5BCAA 2XFWA 3R4IA 2DVXA 1B3YA 1OB0A 2FZ8A 4GG9A 1PX3A 5JMUA 1MUMA 3ANYA 2QUVA 4KF1A 1RPXA 4I8DA 3RO6A 1JJKA 1F6YA 1N8IA 3CUJA 1GVRA 2O9RA 5E1QA 1FWHC 4PUUA 4GI8A 2J75A 3LXCA 4DY1A 2INEA 4W8LA 5AYZA 3QOMA 2BS9A 2QR6A 3GNXA 5CZ0A 1C7TA 2QQ6A 2WC7A 5G1YA 3OPSA 1NWRA 4XD3A 1JYWA 2CLLA 2AL2B 4GFSA 2EPMX 4AC1X 3QPEA 5LHFA 1J18A 5BRPA 2XHYA 1VJZA 3WSUA 1HL8A 3STFA 1R47A 1Q6OA 1BTMA 3OGVA 3I65A 3TW7A 4GNJA 2JEQA 2XGBA 4GNVA 3MO7A 5C9ZA 3W7HA 2ZWYA 3T8LA 3ATYA 2ZRYA 3BLIA 2CETA 2WMFA 3EMQA 3STGA 1M7PA 1E0WA 2ABBA 5A8PA 1E4NA 4C1NA 1L2QA 3FAWA 4GY7A 2R8WA 1A5CA 2OWXA 3GIQA 1QVBA 4YHEA 4DF1A 1EBHA 4F2BA 5LNVA 1Z44A 1KRAC 2NV2A 3C86A 4S1FA 4H41A 4RJEA 2WAGA 1H50A 3NQ6A 3PZGA 3R1ZA 4C6CA 3AZTA 4NX0A 3PPFA 2GUUA 3K1DA 4E8DA 4DJFC 3W6MA 4FLOA 4BA0A 4D6JA 4D6CA 1D3CA 3VDAA 4DWSA 2GVEA 1CXEA 4AHOA 3HURA 3CTTA 4YJ5A 1A3WA 3O6DA 3R13A 4KEVA 1WUFA 2REQB 4GQ0A 2WVSA 3BOLA 2Q3OA 4A8LA 2VD9A 2VR2A 1BTCA 1HFBA 5A2BA 1I0BA 3T2PA 3C8NA 2QUMA 3AAMA 3B8IA 4TR9A 4AFYA 2DJXA 2IUZA 2ZZ7A 5E6YA 2YIHA 2ZE0A 4JIRA 4ADUA 3B3DA 3D3AA 4DJED 3FA3A 4UTMA 1QMLA 4OUEA 5FAGA 2VDGA 3PTQA 4WOZA 1F9CA 4N0RA 1OK6A 3SQLA 4Z1AA 4LUIA 3QJAA 3BV4A 3GHSA 2XZ9A 5A6LA 3MHUA 1W9VA 3NOEA 4GMEA 3L5LA 3T2OA 5GNYA 4B2DD 4QCFA 3SUUA 4O57A 4B5UA 1M6JA 2V8ZA 1YMYA 2ZX6A 4YWIA 4PUNA 5FJIA 3URNA 4D6EA 3DCPA 4QE5A 4IGMA 4KGLA 4EF9A 3W28A 1OC6A 3GHRA 4DJDD 4ZQOA 2B0MA 2BVYA 1JPDX 1UR0A 1RD5A 1W32A 2PF8A 3VU2A 1O12A 3SM0A 1EHAA 2YCJA 4D2JA 3GFYA 1EF3A 1VLWA 1SR9A 3NGJA 4RW5A 3L65A 3H2AA 5FJRA 4QHRA 1DJXA 1TMQA 5I02A 4QROA 1XGEA 1VFSA 3VM5A 2ZA2A 2BX7A 3KCLA 3S6OA 1UH4A 4GZ7A 2Y5EA 4R7WA 1DIEA 2CLHA 1I2OA 2P0IA 3JZUA 2PDWA 5EPDA 4JKMA 5CG0A 2VEIA 3MVIA 3T0BA 4DLMA 3TC6A 3VE7A 4HU4A 4ZMGA 3IK2A 4D1JA 1FDYA 3AI0A 3I3BA 1OGSA 3BAIA 3R0KA 2OCZA 3AWNA 1TZ9A 1AH3A 5CAHA 3L12A 3D6NA 3EKLA 3UY7A 4Q4PA 2ZRUA 3GU1A 1CYGA 4H19A 4C6JA 3VIOA 2XFFA 3KEHA 3W6LA 4NIRA 4GGHA 4KWVA 3SURA 3LD5A 1T41A 3T44A 3Q2DA 4G8TA 4RE4A 3PS7A 9XIMA 3W24A 4HK7A 4PMJA 1H61A 1VYSX 3QM3A 4GXWA 3TQKA 2YCKX 3E0VA 5FJUA 2UZ9A 3KLKA 4UQDA 5FESA 4TVUA 1NP2A 1LT8A 1EGVA 4HNCA 1JZ8A 3EXRA 3NDZA 3K2GA 1RY8A 1XYMA 4ZCWA 1N7KA 1S5WA 3UQNA 1WAUA 1S5VA 1JZ2A 4FX8A 3LRMA 4GVGA 2VT0A 1FWIC 1UBPC 1W56A 3V1HA 2QKFA 1EPVA 5C2CA 2F2HA 2OFJA 3CZLA 3DBNA 1EJUC 1TPH1 2GQAA 3SQMA 3KCJA 5KETA 1U30A 2IKHA 2QPSA 1UZHA 2QVHA 2ADAA 2PLCA 3GKFA 4MUZA 3IANA 3SQSA 3NQDA 1R9YA 3VIMA 2XIJA 3CO8A 2VGIA 3VDGA 4WCJA 1J12A 4GQGA 3EPOA 1EOKA 5J5RA 2INFA 4YVPA 1XLMA 4ZOBA 1JIBA 4HZMA 5ABFB 2J8TA 3VD9A 3FVDA 4M51A 3TSBA 1XI3A 1B3XA 3VOGA 1DWIM 2NQLA 3LCHA 4JN8A 5I2UA 5CZSA 1UASA 2PE4A 4KWWA 3W87A 3C3NA 4L4OA 5K2ZA 2QS8A 3WIJA 4HP5A 1UR3M 3VK5A 2ALDA 4MIMA 4FLQA 1MZRA 1W3JA 3QHMA 3FCPA 4US5A 3BJSA 1DQXA 3H26A 4DRSA 3V0SA 1ZL1A 2Z7GA 4AAJA 6REQA 2EG7A 3KOXA 3UD6A 2W91A 1KRBC 2H8XA 5FOOA 1XRVA 2IMRA 1G4TA 2DQXA 3WDPP 4S3CA 4Z2LA 3REQB 4US6A 4DJEA 3WD2A 4C6IA 4PTXA 1ISVA 4E6MA 1OF6A 3QLDA 3BWWA 1CX9A 2QV5A 4MKNA 2VDIA 4WY0B 1TV2A 4PB3A 2W5FA 4AHPA 1GOMA 3TYUA 1M7JA 4PFMA 4LUTB 4LGXA 2Z25A 3MDWA 3ICJA 1HP5A 2ACUA 5GQBA 4GD0A 4B2DA 4M8UA 3MSYA 4Q33A 3L4VA 2XN1A 2FZBA 2RH9A 3SFWA 4TQTA 2NZLA 5A8GA 1REQA 2J7CA 3G1AA 1DORA 4WD0A 2HNHA 3G1YA 2OU4A 3B8WA 5FAJA 6ALDA 1E6RA 1E4MM 3USBA 1XKJA 4AUBA 4XD4A 3E2QA 5LNUA 4FNPA 1TWWA 1TV8A 1O5RA 3DC0A 1ITUA 4I5RA 2EF9A 4KIRA 2WBKA 5AHFA 1PHQA 1U5JA 4UMCA 2MNRA 3LSCA 1LQ0A 4JTKA 5DFAA 5LYRA 1KXHA 2YL6A 1LL4A 4J5NA 5BOOA 2F38A 5HANA 4KCTA 4XX6A 4E2BA 5IDIA 1XRFA 2Q8ZA 4QFUA 3KW3A 3CTLA 1PX4A 5CLWA 2NVDA 2Y63A 1EJWC 3ITVA 3EA1A 3AIRA 3CPGA 4NJJA 2PDMA 2PMQA 3KVLA 1I6NA 1Q8AA 3DKJA 4WR3A 1MSSA 1W1IE 4IG2A 1Q63A 2GQ3A 4XVDA 1SFLA 4HHHA 1UWTA 5ABGA 2HK1A 3GDBA 1OC7A 1UUQA 4JQ2A 3M0VA 4LVBA 2VM8A 1OF8A 3LEPA 1K6AA 2KX9A 1B4EA 4MWAD 3AU2A 1YPIA 4ZO7A 5EFDA 2F84A 4FK9A 1Z9AA 4AQLA 1XF0A 1TA3B 4XISA 2DVUA 1PWLA 2XVKA 4E2VA 1Q8JA 1F3XA 2YFNA 4CD6A 2VDHA 3LBOA 3IGUA 2FGBA 1PZ0A 4UTLA 3BAKA 1T0OA 1Y5XA 1G1YA 2EG8A 5EB8A 1KM1A 4ERIA 4H6EA 3WJWA 3UJ2A 1GOWA 3QZEA 3IGXA 5CGMA 2OLSA 5DT5A 1LOSA 1Z32X 1EB3A 4J40A 5G4WA 3AXIA 2O55A 4MWAB 1SW3A 2PDYA 5G2WA 3PZVA 1FVPA 4FZIA 3SBFA 3NPWA 3A13A 3W76A 5HWMA 2XDFA 3P3BA 3W0KA 2PURA 1A0DA 2RUSA 1W54A 1S2UA 2HVMA 3BGGA 3CQHA 1LLWA 3EX4A 3VOIA 4PCFA 3WK3A 4GGBA 4S3FA 2B7PA 3HGOA 4HD5A 1TRDA 2ZOXA 1DBTA 3TAKA 4WIWA 1E72M 1FBAA 1TR9A 3N11A 1Q13A 3JZEA 3MYPA 3L66A 4WKAA 3BURA 5AZ1A 3B9DA 1XYZA 4QLLA 1J0HA 1RK6A 1UKSA 1OFBA 2BXZA 3GBDA 1VZWA 4M7TA 2X8RA 4EX4A 5EYWA 4Z2JA 1D3HA 3V3WA 1MXSA 1S3TC 4A6GA 4E8GA 2I5GA 4GIRA 4IQLA 1R46A 2AQOA 1XIJA 1W3TA 4RCXA 1R3TA 1SZRA 5I3IA 4GRSA 2J74A 1FHVA 4Z1YA 5F2GA 2ZX7A 3M0YA 5CZKA 5HQMA 1HJUA 1LWIA 3BCDA 2ZDRA 4HPJA 2NT0A 8XIAA 4WXZA 4PSRA 1EX5A 4MM1A 3M5VA 1GOOA 2PP3A 1K1DA 4R9OA 3LSBA 1XRSA 1ZJHA 2DPEA 1A5SA 3LM3A 4I9MA 3W7IA 4D8ZA 3THQA 4MB5A 2UY5A 1QNSA 3NJ3A 1T99A 2FTYA 4HNTA 1TMHA 3IIZA 3AMCA 4JQ3A 2DIKA 4AWUA 2WM1A 3ONCA 5I7GA 4UQBA 4UBPC 3A23A 2XH4A 2QCNA 4ATLA 1ML1A 3LA4A 5HJLA 4DJDC 3ZLHA 5FI8A 2EHHA 1XSKA 3WEMA 3QRHA 2P8BA 4MJ4A 2GJLA 3AZRA 4QITA 1FH9A 3G24A 5TNVA 2QJJA 3CPRA 4NYUA 3B4YA 2CHNA 4CN6A 1TYGA 3P5YA 4AY8A 3NNTA 3NZPA 2WBGA 3AWOA 5CEWA 3P2VA 2CLPA 2D2HA 3IV3A 4QDWA 4AZCB 3BLPX 2PFHA 5EMJA 3GB6A 2XH7A 1WZKA 3F7JA 1EJXC 3M16A 2BVDA 4UR8A 2VX5A 3MUZ1 4QNEA 3LLXA 1IIGA 2XWEA 1TREA 3GVRA 2OOFA 4LFYA 1V08A 3STEA 1KTBA 1VH7A 1TB3A 3KWXA 4IWWA 3IPWA 3W7LA 3HB9A 3C0SA 5HPOA 3YPIA 3ARPA 1XR2A 1P7TB 3VXGA 4E3TA 3U5YA 5C0QA 3TJ4A 3GXMA 1VPXA 3L0KA 5BZAA 3PZOA 3BZGA 3OZMA 1UD5A 2ESCA 3IVTA 4L61A 3OGRA 1L6GA 4G7FA 4M6QA 1PTDA 1RQEA 3UA3A 3UP8A 4GE8A 1GVQA 2CPUA 2RHGA 3S83A 4IOTA 2QJMA 2VMFA 1LLOA 1SSDA 3O6YX 3VAVA 5LA2A 3R94A 1SR0A 1AUSL 5J8LA 1SMDA 4V33A 3L2MA 2HWGA 1ZP4A 1L8PA 4E38A 3CL6A 1NOFA 2I56A 4YTRA 3SCQA 2WANA 5C2GA 3HV9A 4IQEA 1E9LA 4Y8FA 3UNDA 2V3EA 3S1XA 4OWGA 4GKTA 4NJIA 4NI3A 3AS2A 1OBAA 3BL3A 3QC3A 4AU0A 5CC7A 2PWDA 5DT7A 1OCBA 2NSOA 4XG1A 3A6OA 4ICCX 3KFTA 1BAGA 4TMBA 1W3KA 3LYEA 2D69A 1LQ2A 3MYOA 2WPBA 1EUAA 1DQUA 2V82A 4CD8A 1PKYA 3RDKA 2E9BA 4MJMA 4NT0A 1O6IA 1X98A 2V5KA 2E3ZA 3E74A 3S2CA 3W4RA 4G1KA 3TMLA 2WZTA 4FS9A 3NVTA 1F76A 1XH2A 4JTLA 5DY2A 1AVAA 2JEPA 3NSXA 1GEHA 1A0CA 2EJAA 2BOFX 4GFIA 3EWUA 1OZMA 5I03A 3L67A 2QPXA 4AZIA 4DNMA 4NZJA 5FEPA 1BPLB 3G0XA 1JRBA 2WLZA 4PTWA 3TX9A 4PC8A 1LBLA 5F4XA 3SY1A 5F4SA 4HCLA 4RDZA 1I8JA 3W7EA 5LXEA 5DMNA 4J2MA 3OQEA 2QF8A 1FP9A 5AVNA 2Z1KA 3NXFA 2DT1A 3UR7A 3N18A 2IKJA 1DWFM 1J0IA 4B90A 4KRZA 3W84A 2FHFA 4LOCA 3VDBA 1XH1A 1ZSXA 1AQMA 1XLKA 2TYSA 1KA9F 2CZ5A 3S1UA 3RU6A 4F0HA 2HQAA 2E6DA 2YGYA 2FHBA 3S2NA 2WQDA 4HK5A 1KGWA 2E77A 1SW7A 1ZUAX 4BEUA 1P1XA 3T4CA 2XH0A 3T7VA 4Z0JA 3KDNA 1EQCA 3DECA 4W7UA 2QCCA 3TW6A 5TBOA 1PTGA 1E3ZA 3W2LA 4ORMA 4WJ8A 5DRCA 1QBAA 4RNJA 1LP6A 4Q8PA 1X7IA 1V7YA 4UTFA 4KQNA 3LZ3A 3SUVA 2R94A 3GC2A 4L6OA 3SB0A 1OEPA 5E6ZA 3W00A 2PDXA 1LF1A 2XSXA 2ZUSA 5D09A 3GLCA 1DXFA 1POKA 3PN8A 3RCYA 3OA3A 3B0UX 1S5MA 3AHXA 3ZSSA 4AYSA 3U5UA 1IEVA 3DH7A 4PRTA 2E8ZA 5FIPA 2YDSA 1OWQA 4LS2A 4IMFA 1ISYA 3MA8A 3ZR4A 2WCAA 1F8IA 3W7KA 3O0FA 3R25A 1MW1A 3HQNA 4JIPA 2XPKA 4UFKA 4GYPC 1VBHA 3CC1A 3O1NA 3UG8A 1MQPA 3PJUA 4XZIA 5I78A 3WJSA 1IEWA 2XSAA 1NF7A 4YN5A 3SCTA 3W1QA 1BYCA 4AXNA 4JTHA 3EEZA 3NEVA 2EGZA 5CBIA 3USZA 4AIOA 3VD7A 2VZOA 2DSKA 3L2IA 1X38A 4JHZA 3LGEA 2P5NA 4RXFA 3RPMA 1CENA 1K4GA 5I3DA 4HN4A 4RLIA 1DJZA 4GYKA 3GTXA 1W9PA 1UIPA 1OK4A 3GQYA 1FWCC 4Z2GA 3CM4A 2JFEX 1KXVA 3IVUA 1C93A 3ABQA 1IXNA 1CLKA 2ZXAA 4MWAC 4W86A 4GLEA 3CAKA 5EMUA 4NXSA 1IEQA 4RE0A 4IGSA 4F4RA 4LYRA 3ZS4A 3VUSA 4MAVA 1M5WA 3B8DA 4S2CA 5IHSA 4Q8OA 2XVPA 4MNMA 2C8NA 3LGDA 3IJ9A 4O4WA 2OX4A 2DZWA 4Q8UA 1MDRA 3E1F1 1XISA 3GG7A 1UMLA 3POHA 3VINA 3VCNA 4URIA 3ZJ8A 4HSOA 2CZDA 3GFXA 4B5XA 3CGTA 1C90A 3NZGA 2BWGA 1UKQA 4AEFA 1NWTA 4W8BA 1YADA 2E9MA 3HM7A 3VC5A 1DWGM 1ZJIA 1UZDA 3U4FA 3NEHA 3SJ3A 1R5YA 1K7XA 1TWZA 3CV2A 3L23A 3TTYA 5B80A 4QGCA 2YW3A 1JF5A 1AJ0A 4FPSA 3WF1A 3U48A 3KCOA 4G5DA 2ZXBA 4I9TA 3AS0A 2E4TA 4LC8A 3UY8A 1OX4B 3AS3A 1EYEA 3D47A 3PBYA 4QAWA 2D2OA 4RXGA 3AZSA 4JKKA 1A5BA 1XBXA 5HMDA 2EO7A 5HMFA 3PZNA 1AH0A 1VFUA 2PZ0A 3UPBA 5JBDA 1XYFA 4IPIA 5HULA 3OBKA 4KETA 2PRLA 4IIBA 1VBRA 4B91A 3ZMRA 5D4YA 4GO8A 1A47A 1N55A 4B3KA 3VMOA 1IT8A 1TJRA 1GKRA 1IGWA 4P7OA 4N4QA 5ABEA 4ACYA 4EPEC 1NVMA 5AN7A 1HZYA 3P5ZA 5FJOA 3O63A 4DUWA 1OY0A 2X30A 3EOOA 2FZMA 3QSTA 3G8EA 6REQB 1TTIA 1X8FA 3ABOA 5EMMA 1U1HA 5L9FA 3HFYA 5B7ZA 1GHSA 8TIMA 4GI6A 3ARVA 2CBUA 4ZXOA 4J1OA 3UZ5A 2HXUA 2QCDA 4TXEA 3N6HA 2NXHA 3QMRA 1QW7A 1OHLA 3FXYA 2Z1VA 7REQA 5LIWX 1W5MA 1XG4A 4DELA 1OGBA 2C7FA 1FCQA 2QULA 2J78A 1UHVA 2J7GA 4GHRA 3MHFA 3WMCA 3SO7A 3WLRA 3UCDA 4KRUA 2VJXA 3VIJA 1S39A 4JFTA 3G1SA 1H2JA 2Y2WA 1BVZA 2Z2AA 4MDPA 1REQB 2E25A 4B16A 1X39A 3LNMA 3E0IA 3RMJA 2PA6A 4QE4A 4HNNA 3RX4A 1GPWA 1DVJA 4NJGA 3SCOA 4PTDA 3SSZA 4PBFA 3TR9A 3WF4A 3F03K 4BK9A 1XHGA 4R33A 3QKEA 3A5FA 3GDTA 1R8LA 7CGTA 1K8XA 4QP0A 2QW5A 9RUBA 2V9DA 3H55A 2VFHA 1WA3A 1WPCA 4PGLA 1WZLA 3FNDA 2Y6ZA 2Z6JA 3FY1A 3KRSA 3QV9A 3RLUA 3URAA 1YTEA 4JR5A 2OVLA 4LVGA 5A6BA 3ZLFA 1HF6A 4G6CA 2BTMA 1KKOA 4H7VA 3A4JA 4O12A 3UA4A 2HS6A 2QIIA 2JK2A 2VC5A 2CLOA 3SW6A 5D2XA 3ZR5A 2YYTA 1ICSA 1PX8A 5DCEA 3TFCA 3C2VA 2IW0A 4IG2B 1EWDA 1JAEA 2D2GA 4NF7A 2YCIX 4DEFA 5FD0A 1HN1A 5H91A 3RR4A 4IL2A 3PG9A 2WHJA 3EA2A 3G0SA 2VHLA 1RH9A 3PJXA 2ZICA 3BMVA 3VOFA 2E1WA 3AMDA 3EXSA 3L0GA 3WG6A 4OIFA 1NH6A 3BLEA 3UZJA 2V2DA 2J24A 3I3DA 1FWBC 1KFEA 3E2VA 4EK7A 4L6DA 4LAMA 3EOSA 1YIXA 5G2HA 3Q37A 2J7HA 4DVOA 1EFZA 1MRQA 3NURA 4Q4MA 3GE7A 2OZ3A 2AQVA 3E0WA 4UB9A 4CVWA 4TOQA 2VC6A 4W4QA 1WDDA 1JL8A 4JHMA 4WSKA 2CERA 4WDUA 4O1FA 4QNWA 4L1WA 1M7OA 4XKYA 1ONRA 4H9ZA 3A47A 5AECA 4CU7A 2XFYA 1GVEA 1XD0A 4UTTC 1BVNP 3AMKA 3WMLA 4HU8A 5FF3A 1W1PA 2GSHA 4IXHA 1DXEA 4IPPA 5I79A 4RE3A 4IUOA 1VHNA 2VFFA 1BF2A 1FCBA 1GKQA 2ZE3A 4ZO9A 3R79A 4FNSA 5LXXA 2J66A 4OHQA 3V75A 3P7YA 3GU2A 4XTIA 4ZVJA 2H9AB 3BSGA 1SVDA 3TZFA 1GZGA 5AOUA 2ZRVA 4TVDA 4XZBA 4IJBA 1UP3A 3LNPA 3H7RA 4IP4A 3RIKA 1P6BA 4R27A 1AL7A 1O94A 1W5PA 1JPMA 3GNOA 5AHNA 3KRBA 1BSLA 1O5XA 1IQ8A 5I3KA 1VCFA 4HPXA 1EC8A 5HPCA 3TA9A 4F79A 3P93A 4B9ZA 3CWOX 1E56A 2PDQA 4CEXC 1W2VA 3LB0A 5DEZA 2J8GA 4CQ9A 3H21A 5IBXA 3TVAA 3BSHA 3HMCA 2QPUA 1DYSA 3L4XA 1NOUA 3BAXA 3S1WA 4L5ZA 4HA0A 1K8YA 4N9EA 4ZO8A 4LV9A 2OLHA 2D20A 1OIMA 3KOFA 3SFKA 3AHTA 3WF3A 3N25A 4XO6A 3MTWA 3R0DA 1LWJA 3AXMA 1QI3A 3NPUA 4IFOA 1LG1A 4JFVA 3II1A 3PPHA 1Y7VA 3KZPA 1M65A 4A8IA 4U33A 4BWLA 5HUPA 2ZXQA 4P8VA 4JCLA 4KRTA 1ONEA 5LSMA 3G1HA 1IZJA 4AEOA 3WQWA 4OQVA 1Q4NX 1O68A 4E4UA 2G4FA 3ABRA 3S2LA 7XIMA 3DG6A 5CSRA 4G7EA 5KZMA 1VIZA 2SFPA 1Z89A 3TEVA 3W85A 3CH0A 5HNNA 2QGYA 3WK0A 3F5KA 5L6UA 4L7ZA 4LPCA 1EJRC 4POCA 3SSJA 3H12A 3XISA 1GJWA 1W31A 4RDYA 2JF7A 1LBFA 3CUHA 5TF0A 2WWCA 4AW7A 3L4WA 4O11A 4GWEA 3MP5A 5KSWA 4C6BA 1ZP3A 1ITQA 4K3ZA 5CGQA 3PFRA 3W38A 1F4AA 1UR8A 1XGZA 3WX7A 4U5IA 2E09A 2Z7KA 2BY0A 1WKDA 3WDHA 2WZIA 4CD4A 2PODA 3SGUA 2I16A 2OOGA 3HF3A 1E3XA 4J7RA 1Q6GA 5C7VA 1W3NA 3IARA 4W87A 5IDZA 3MP3A 5I0DA 2G3FA 1SSGA 4HT3A 1FX6A 2YYUA 4BR1A 3DG3A 4O14A 5CCZA 5JH1A 1J2WA 1GQKA 5SWUA 1LQAA 2J79A 2XM1A 2WYSA 4BI5A 3R8HA 1CDGA 1NARA 4FNRA 1Q6EA 1K3UA 3EX6A 4UZUA 1GQIA 4MFEA 1B3WA 2PGEA 2VRQA 1S1RA 5AYBA 4R53A 3N73A 4M5PA 2XM2A 4W8AA 2WSPA 2WZEA 1HW6A 2YBUA 3W53A 2VXNA 2VC9A 4ICNA 1V4YA 2EXOA 1PKNA 3SY8A 4AZ7A 4OE7A 1EOMA 4PBEA 1PZ1A 4AD3A 3OVPA 3SAZA 1ZGDA 4B5TA 3HFTA 2GUYA 3HG5A 1KRMA 4O0ZA 1XICA 3UYCA 5F2MA 1EXPA 3NSNA 5HA7A 2Q09A 1RSCA 4KEUA 4U5KA 1M04A 1VCVA 2IPFA 3HGSA 3FXGA 4PZVA 4V15A 3MUY1 1V02A 2X1SA 4DHGA 3F4VA 5ECUA 3HBLA 2BG5A 1AQFA 4LUJA 1H0GA 4Z2KA 1IXPA 2YBTA 5IRPA 1T40A 1C29A 3LHVA 4H6RA 3NXLA 1GJUA 1EDQA 1XKYA 5EMLA 1HL9A 1YDNA 2P0OA 2OSWA 3UZZA 5BWAA 1DIDA 2BBFA 1GOKA 3WH7A 5AVHA 3WK2A 1P6WA 5JIPA 3KXQA 3KX6A 3W1MA 3N3MA 4FSAA 1XIEA 1MUWA 2PDIA 5A8MA 4Y9NA 4EOUA 4HIBA 4IMAA 3R7MA 4H4IA 3H2MA 3JU2A 2YW4A 3L4YA 4O15A 3FYOA 4B5NA 1PZ2A 1NWSA 2A3CA 2R14A 3ZR6A 2YCLA 3AU6A 3BQ6A 3HJEA 5JUVA 1BQCA 1D9EA 1QPQA 2C3ZA 3GHTA 1V7AA 1A3XA 1CT5A 3HTWA 4CLMA 1JCJA 1KV8A 2AKZA 3DYMA 4PMNA 1M41A 4UFHA 1ECEA 3ZFHA 3HPAA 3CHCA 4KT2A 4LVDA 4ZSTA 3CHDA 3NQVA 3OEXA 3WF2A 4R9XA 4HA1A 4ZGYA 3CB3A 3IV8A 3M47A 3CK5A 2FB3A 1CLXA 3T09A 2AAMA 1PL9A 4AMAA 2ABAA 4QSFA 1PDYA 3H2CA 4HMDA 2WMGA 1MEIA 1Q6QA 1W17A 1CCWB 1XLHA 4ZENA 4PUEA 5FSEC 1XLLA 1ZRQA 3E6EA 2OWWA 1M1BA 1L6FA 1UA3A 2EPHA 1NOWA 1UZ4A 1B3ZA 3B8TA 4Y8EA 2BNJA 4XAFA 1K9FA 2WJEA 4H2HA 1AD1A 1NP0A 2R24A 1XL9A 2TODA 3RM8A 2GJXA 4IJRA 2HSAA 4O19A 2ZWZA 2XZ7A 5LZLA 3LMYA 2YCEA 1XLIA 3G6MA 3PJWA 2J6XA 2QCMA 1R3RA 4NZ5A 2I9UA 4LC6A 5DN1A 3AIQA 4K8GA 1Q7ZA 5BRQA 1EF2A 2UBPC 2GWGA 5FACA 4GBDA 3MJYA 3MHGA 1BQGA 3IAPA 4PUKA 3AIWA 2GGHA 1OCJA 2PWVA 1YXYA 4NL1A 2C19A 4PL2A 1CXKA 1FP8A 2J25A 3SN0A 3CMFA 2DH2A 4J28A 5TD4A 3PY2A 2C14A 2A7PA 4IT1A 3WQEA 1Q6RA 1UPMB 4NX5A 5D37A 1FWAC 1VC4A 2YLAA 2ZVRA 4FX6M 3NG3A 1TV7A 3TP4A 4R5EA 2EBNA 3NR0A 1WE5A 4UWMA 1LRNA 4M6PA