3SFKA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm267
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
375
structure length
368
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Structure-Guided Lead Optimization of Triazolopyrimidine-Ring Substituents Identifies Potent Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors with Clinical Candidate Potential.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 133
structure length 368
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sfkA00
5CSSA 5HUPA 4J9JA 4ZQMA 2JK2A 1C9DA 3NXFA 1SO5A 2X1SA 3G1FA 1EX5A 1FWRA 3M1ZA 5FI8A 4FIQA 3TJLA 1X1OA 1I2PA 1TCDA 5KSWA 4BWLA 3MHGA 1Q6QA 5I3HA 1FWNA 4Z0SA 3W7OA 3LLFA 3HGJA 4Y90A 1WYIA 4L4MA 3Q58A 4ZQNA 4DF2A 4LV9A 4EVZA 3NQ7A 1D3HA 3QZEA 4GFSA 4N9DA 2X30A 3G1AA 3G1XA 5D03A 2ZZ1A 3L0KA 2CLHA 4GJ1A 1S5WA 2NUXA 4GWEA 3G0XA 1W3NA 2RDUA 3T44A 2TYSA 3S8HA 2NZLA 4K37A 1FCUA 1VCVA 3MP5A 4CNPA 3NVTA 3EX4A 1GZGA 4DF1A 4HNVA 2VFFA 1UB3A 4M7TA 4GBUA 4WXZA 3W73A 1L9WA 4RZ5A 5DELA 1NF0A 2NX1A 3CIWA 2RDWA 1WOAA 1KFLA 3HB9A 2Q3RA 1G67A 2OT1A 2H6RA 4JD4A 2FPTA 1H7NA 1TTJA 2HS6A 4FXRA 5C6MA 5IBXC 3G8EA 3TKFA 2ZRYA 1D3GA 2A1YA 3GR7A 3GDRA 1SW7A 3P8IA 1NF7A 1GVQA 2E09A 3P62A 3T4CA 3FYOA 4NU7A 4QNEA 1TRIA 4RR4A 3LLDA 4A2RA 3B05A 3C56A 1H1ZA 2R14A 4A21A 1W5QA 4JX6A 5DN1A 1RQBA 2E6DA 2B0MA 3BGGA 5CZ0A 3O6DA 3W71A 1DQXA 1RZMA 3SIZA 1W31A 5D05A 2C1HA 2C13A 2GUUA 4LVFA 3HGOA 1Y0EA 1JRCA 3TC6A 3A23A 1LCOA 4XTDA 2WSRA 1VZWA 3SR7A 2QDHA 4UFKA 4NJJA 1LM1A 1EEPA 2QCCA 3FS2A 1I2OA 2YW3A 4Q4KA 4AF0B 4U28A 4JX5A 2E6YA 3LV5A 2J9XA 4PCFA 5FF3A 5C55A 1FWSA 3PG9A 2Y7EA 4TR9A 3WJWA 3MI3A 1DJNA 4BR1A 4MVAA 4U4MA 4O14A 1ML1A 3W1PA 4OGZA 5AFDA 1P0KA 3LI1A 5KINA 4POCA 2YFNA 4XKYB 5F2IA 3G24A 3NQGA 1O5XA 1XDLA 5F2LA 4ORMA 2Y61A 4UTLA 1KLZA 1OFBA 3TXVA 4WX2A 1EP3A 5G4EA 1FWTA 1QPQA 3CWOX 3RLUA 2C0AA 1A50A 3EXRA 1UBSA 2DJLA 1KM4A 3OIXA 3RLVA 4HHPA 2YZRA 1KM5A 1VYPX 4DO4A 4LC8A 3C6CA 2PE4A 1PCWA 2ISWA 3NA8A 4JTTA 3QEZA 2P0OA 1WX0A 4IMCA 2HTMA 1UJPA 1KFEA 3BG3A 4HPXA 3MBDA 4HNUA 4N6FA 2HSAA 3STGA 3LTSA 4W9TA 7TIMA 3W1MA 2YYUA 1OX5A 3O63A 2CLKA 3W74A 4Y8FA 1HO1A 4NZJA 1H62A 1PHWA 1W37A 3N9SA 3W7NA 3NYZA 4FNTA 1Q6LA 1VJIA 4MUZA 3EEGA 3QSRA 1QNVA 4QISA 2PRMA 3RF9A 3W7QA 1W0MA 4R34A 1XM3A 4OHQA 3QPYA 2ISSA 1LRTA 4FF7A 4TMBA 2EPHA 3PULA 1LTDA 1ONRA 3KFTA 2ZZ3A 3NPXA 3DFOA 5BNKA 5IM51 4WY0F 4LUJA 2WSQA 3DFQA 3I7SA 3T78A 3DFSA 3IIVA 5E93A 3GDKA 4UNKA 1T8XA 3S5OA 4O17A 2ATMA 4UTKA 4DPPA 1SZFA 1C8VA 3G22A 1MEIA 3EB2A 3MJYA 1OFOA 4UTTA 4GRSA 4K7VA 4GUJA 5FEXA 4MFEA 3DENA 4RJEA 2WPBA 3LCIA 3QH2A 3IIZA 4JDYA 4YMZA 4A29A 1K7EA 3W84A 3L5LA 4MJZA 1C29A 4WY0B 4M6PA 2ZQ0A 4PTNA 3HPSA 4ZZ9A 4DEFA 5K7JA 2NUWA 4AEOA 4NJIA 1MEHA 1TYGA 2B7PA 2V30A 4LS0A 1RV8A 2NWRA 2Q3OA 1FY6A 3MP4A 1JCJA 1W8SA 2VENA 1F6PA 5AHLA 2Z6JA 2ZRVA 4G1KA 4X2RA 2FB3A 2X1UA 5G2IA 4TX9A 3MYOA 3GXTA 2E77A 2A2IA 1WQ5A 4FEZA 4NT0A 1OFPA 4NJGA 4UCGA 5BMXA 4LS2A 1IXPA 5AOUA 1W5NA 1QOPA 1SO3A 4PEKA 5DLCA 5TBOA 4UTWC 4JS3A 4O12A 4DELA 2YXGA 1H61A 4EIVA 4NZFA 2OX1A 3EWZA 5H2ZA 2J9YA 3S1VA 3W7CA 1SZEA 1R2TA 3TSBA 3TH6A 4JEQA 3W1TA 6TIMA 5DXXA 3SSJA 4JR5A 1EB3A 3HG5A 1ZAJA 3U8GA 1VYRA 1MO0A 4NQ1A 5TIMA 1FCBA 3N19B 1SSGA 2W79A 2CLEA 1YTEA 2VFEA 3NL6A 5FEPA 3W2KA 4H6KA 1B9BA 4FO4A 3LCLA 4R7JA 1EWEA 1YPIA 1W3IA 4XKYA 3F1QA 2V2HA 2E5CA 3CT7A 4O1AA 4AXKA 4AB4A 3TJXA 1N8FA 5K9DA 3HMJG 1XBZA 2Q8ZA 1L6YA 3W1UA 3N2XA 1IF2A 4FNUA 1CW2A 4XTIA 2QCFA 3N73A 2YFOA 4LS1A 2NX3A 4JTHA 1FCQA 5BRBA 2B7OA 3CC1A 1KM2A 3V75A 4UMAA 4LC6A 1AK5A 4EF9A 4MFDA 1GYLA 2Y7FA 4A2SA 4JX4A 4C1KA 2FLIA 1H7PA 3E02A 4UMBA 1S3HA 3A22A 2OT0A 4JTFA 1EPXA 4FX6M 3P5ZA 5LGZA 2V5BA 3C2VA 2GVJA 2JKEA 3EWWA 3T55A 4FX7A 1D9EA 2WQPA 4N9BA 3S1WA 3IIXA 4MPQA 3IGSA 2B4GA 4NX0A 2YDAA 3NL3A 2H90A 5DXYA 1Z48A 3LRLA 2Q8LA 4GUIA 1AG1O 1KFKA 3GKFA 4UFJA 1SFJA 3AJXA 1XFBA 3GXPA 4O50A 1F76A 3GDMA 4NX5A 1I4NA 3O07A 3PBYA 3TSDA 3STCA 3EWBX 1W3TA 1Q3NA 2ZFAA 4XWUA 3QMSA 3THAA 3M43A 1KTCA 3NQMA 4PC8A 4CLMA 5A8GA 3WK0A 5F2GA 2GQAA 5F4SA 3W7KA 4MYAA 3TX9A 4UFIA 1LROA 1PHQA 1YLVA 5DY3A 3BO9A 5FESA 1H5YA 2ZCGA 3DFPA 3R5EA 3E9AA 4CQAA 4BWLC 5KZEA 2DZVA 5HR6A 3LHWA 5K3VA 3I6RA 3S9YA 4UR7A 5AYYA 3TFCA 4UFHA 2NUYA 2C16A 5D30A 2QJHA 1PS9A 2QR6A 3G1HA 4CQ8A 2QCLA 4MOZA 5FF2A 3QC3A 4RXFA 1TTPA 4OQVA 4IXHA 3MW7A 3A24A 4X22A 3UWUA 1GEQA 3MMTA 1TPVA 3EXSA 3G1DA 4DO6A 2A6LA 2EGZA 1EP1A 2V8ZA 5LNUA 3N3MA 5I3IA 4IJBA 1PIIA 1TPFA 1RR2A 3W2UA 3PB2A 1QO5A 1ZFJA 4ZVJA 3W7HA 3LCFA 3MI6A 4ADTA 3I65A 1KFJA 1TPEA 1P0NA 3SI9A 4JTGA 3UPBA 4O10A 3PVFA 2P1FA 4LVAA 4DO5A 3FOKA 4OV4A 3LBMA 3DHFA 2LLEA 4QIUA 3NQFA 1HUVA 3HPZA 3LXAA 1F73A 3GNNA 2ZRZA 1TQJA 2J27A 5K9XA 5C2XA 3AO0A 3UYCA 3MBFA 1W1ZA 3B4UA 1H60A 1KM6A 1BTMA 2VFIA 1TQXA 1OG0A 1W5OA 1XDMA 3W7JA 1YYAA 4K38A 1YADA 3TQKA 5K4ZA 1CX9A 3C4UA 3TW7A 1GJPA 3NQCA 1T0OA 1DHPA 3LCHA 1IGSA 2ISVA 2YPIA 3W7RA 3IRDA 5FF4A 3IVTA 2OMAA 2Y88A 5KZMA 1QO2A 1SW0A 4YL2A 3N9RA 1H7OA 3EX3A 1YTDA 2I14A 4IPJA 2OCZA 1AL8A 3C3NA 1A5SA 2WV8A 4O1CA 3NZ1A 3C0JA 5D2TA 4HNNA 3HGSA 3IVSA 2F84A 4AWSA 2QCEA 1I45A 4GC4A 4XQ6A 3L68A 4YXGA 1HTIA 2ZA3A 3L0NA 1K02A 3S5NA 4JTJA 2QAPA 2VEMA 2PRLA 4XBSA 1GG1A 5DY2A 3ZWTA 4MZYA 4MY1A 2AGKA 3SJ3A 2V5LA 4K8EA 4JIPA 2R8WA 3R89A 1P1XA 3QQ0A 4LVBA 2VC6A 2Y62A 1GVRA 1LRQA 3USBA 4AHPA 3SGUA 3W2LA 1JCNA 3L5AA 4LTSA 5CKSA 3W2JA 4JTLA 3VCRA 3W6YA 3THQA 2IQTA 1DV7A 2V2DA 2ZDRA 2WNNA 1JULA 3PBUA 4JTEA 1QFEA 4H4IA 4YCPA 2G96A 3TW6A 1WAUA 3LX9A 3GDTA 4FNSA 3CB8A 1G4SA 1SSDA 3EX1A 5AYZA 3VFLA 3LB0A 3O06A 1NEYA 1ZJIA 3G1SA 3W86A 4OU1A 3IV3A 3VNDA 5HQEA 4WZHA 2DU2A 3A5FA 3NR0A 2EKCA 4K7YA 4E38A 1UCWA 1FWWA 3C2OA 4LY8A 3O1NA 1FCVA 1R2RA 3F4WA 3MHUA 1YPFA 2PC4A 1R46A 2PRHA 4PH6A 3W76A 5I3GA 2JGYA 3PUOA 4ZMGA 3W88A 4LT9A 5AHIA 1KM3A 1XBVA 3RFAA 2Y7GA 3M41A 2VELA 2VFDA 4JYDA 1RVGA 3Q37A 4KWVA 3HBLA 4TO8A 2W0UA 3W7EA 4WJEA 5EBUA 2FB2A 5LHFA 2I1OA 3KHJA 3K30A 4HSOA 2WOQA 5EYWA 3IGUA 2G97A 4UIOA 4UFLA 5D2XA 3ELFA 5F1VA 1FXQA 1MZHA 4S1FA 3B0UX 1NFBA 3CEPA 4UTTC 3BG5A 4O57A 1ZHAA 2DORA 2VKZG 3LCGA 3LHYA 3TCEA 3PUEA 1G7VA 3KRZA 1H7XA 2FDSA 1EWDA 1WBJA 3SECA 3SY5A 3C61A 1JQXA 1BKSA 4ALDA 2NLIA 1YXYA 4UC5A 5K2ZA 1Z41A 3WJSA 2FFCA 5D2VA 1OFDA 1DKWA 4RV8A 3N34A 3B0PA 1HG3A 4YLWA 4LWWA 4O16A 5AHNA 3PY2A 2NWSA 3JR2A 1GQNA 3TQVA 1WOBA 1TTQA 5KITA 2A0NA 1OFRA 1MSSA 2Y89A 4O54A 3LHUA 3QW3A 5AYXA 4QM1A 1KA9F 2Y63A 3W1QA 5LNSA 3NDOA 3GAYA 3UY8A 2Z0IA 2EF9A 3PBVA 1PE1A 3PF3A 4M19A 4WOQA 4AHQA 3MHFA 3LOTA 2ZTJA 2A7PA 5CSRA 3QMRA 5CZTA 3P74A 1VS1A 2WNZA 3LRKA 3OG3A 4OV9A 4UTIA 4Z0JA 2V81A 1U83A 5H91A 3QSTA 3DI1A 3NPUA 1ADOA 3C52A 1JVNA 2GJNA 3L0GA 1FUYA 2BSLA 1WDWA 4IQLA 4DBEA 2GVLA 1VQTA 3KAOA 2Z2UA 2ZTKA 3R13A 3EX6A 1LLWA 2E68A 1VH7A 1Q6OA 1WV2A 3FFSA 2H8XA 2VXNA 2C3ZA 3ATYA 2ZA2A 3LERA 5CZSA 1OFQA 2NX9A 3ZS4A 3R2GA 4QNWA 1KTBA 3P61A 4IXXA 1QMLA 2ABAA 1SZNA 4HPJA 3S0CA 3ABSA 1VLWA 2NXIA 4JIQA 4GUHA 3WK2A 3TNOA 3PSVA 2ZZ6A 3OVQA 2YX0A 4AH7A 2VFGA 1H7WA 1OX4B 4O11A 2CU0A 3RMJA 2E6FA 1B3OA 4ONVA 1L6SA 3W3OA 3EX2A 3W83A 4DF0A 3KRUA 4Y6GA 4N9CA 1KFBA 1H50A 4JTKA 2ABBA 1I2NA 3NL5A 5LKYA 3QFEA 4M7SA 1K7XA 4S2CA 3BK0A 3M5VA 2GQ8A 1ZY9A 1VGAA 3GK0A 4ORIA 3LHZA 3C2EA 4PL2A 2NXGA 4CCEA 2VEKA 3PWAA 1OK6A 3EKZA 2XFWA 1FQ0A 1TIMA 4HT3A 3UWQA 1JRBA 3TC7A 1J5TA 3UD6A 4UMCA 3N2MA 1EA0A 4IMEA 2FJKA 4I7VA 3UWVA 3GZ3A 1XUUA 4ZQCA 4Z1CA 3B0VC 1H63A 4QAIA 1WA3A 4LOCA 3NOEA 5J5RA 4K8HA 3NQAA 3W87A 1YDOA 4N4QA 1VRDA 3P82A 3FLUA 3I7QA 1P4CA 1JUKA 3G1YA 2ALDA 2ZBTA 2FQIA 2XN2A 5AC7A 1I2QA 5G5IA 1GYNA 5LSMA 3LTYA 3W9ZA 3L2IA 1SFLA 5E0KA 3BVJA 2QEZA 5FF7A 2YSWA 1B57A 1LZOA 1G4EA 3NZRA 3LCXA 4HNTA 1TPWA 2A7RA 1DOSA 3KVMA 4DXVA 4UTUA 4JYFA 1JCYA 1O4UA 3L67A 3HQ1A 1LOLA 3PM6A 2JGQA 3MP3A 1KFCA 4IWWA 1LRNA 1ZCOA 4NJKA 5DBUA 4AWUA 1FDJA 3TMQA 3P81A 4GNJA 5EKYA 3P8JA 4ZQRA 1FXPA 1XBXA 2V2CA 2TRSA 3B04A 3L66A 5CGQA 1GTEA 3OVPA 1JCMP 1EP2A 4ADUA 1XC4A 2E6AA 3LHVA 3GIYA 4D2JA 1TPH1 3NEVA 3G1VA 4IPIA 3W7LA 2ZZ2A 3LRMA 4LRSA 1X7FA 2C15A 1X1ZA 4UTMA 4N4PA 3S5ZA 2F7FA 3O15A 1UASA 3ZR4A 5C54A 4Y9AA 3VE9A 2CLLA 1CI1A 3LI0A 3O8AA 4NVTA 3GNDA 3WFAA 5DCEA 2Z6IA 4PFMA 5U4NA 1BEUA 4CNNA 2QCMA 1OK4A 1J2WA 4O15A 1M7OA 4UNLA 2YGYA 3OVRA 5BMWA 3DBPA 3RU6A 1NAL1 2RKXA 3W23A 4FX8A 2XN0A 1DVJA 2I9EA 2X16A 4I7UA 4O52A 4AHOA 2FPVA 3RK8A 2BTMA 1K7FA 4Z1DA 4EF8A 3GX9A 3NQDA 5KZDA 4Z1AA 3W7MA 1ZAHA 1OYAA 4N6EA 2CWNA 3IVUA 1TPUA 4N02A 1GG0A 1LOSA 1ME9A 4JY8A 1VHCA 5LNVA 5D2YA 3TQ0A 1JUEA 1R2SA 1TO3A 2DZSA 5AHEA 3L65A 1OABA 4P2VA 1LOQA 3NQEA 3W1LA 3HJZA 2W6RA 4ML9A 5EMUA 1KLYA 4R53A 1TSIA 2TSYA 5D37A 3CIXA 3E12A 1SUXA 5DCBA 1R47A 3LBCA 3G18A 3LXCA 2WKJA 1BWLA 3NQ8A 3P80A 1OX4A 4FHAA 2DZTA 1EUAA 1F6KA 5CPOA 2QCDB 4YCOA 3KVLA 4PODA 4WOZA 1JQVA 4CNOA 4H3DA 2OJPA 4NNCA 5G4WA 1FBAA 3STEA 1VLIA 4P61A 1GVSA 1TB3A 3G0SA 1T99A 1ZENA 3HIJA 3JRKA 3I68A 2JBMA 3O05A 4Q33A 3W75A 2JKAA 4B5NA 3NQ2A 4MYXA 5KMYA 3O16A 3CQ0A 3G3DA 5CZJA 1AW5A 4HSNA 2BXVA 4KFPA 2KZHA 3I7RA 1O60A 4BFAA 2RHGA 3KXQA 2ZZ7A 4HN4A 5K4XA 1XCFA 3F03K 3Q2DA 4E0CA 5I3KA 1HL2A 5L9FA 3C2RA 3ZWSA 2AQWA 4ICNA 2QCGA 3M6YA 2P10A 4RCXA 2WSYA 1PV8A 1PCKA 3NQVA 1TPDA 4JDBA 1QCWA 3WJYA 4FNPA 2AAMA 4X9SA 3B03A 4BI7A 1OF8A 1YTKA 4JNMA 4O1BA 5F2MA 4GXMA 2BX7A 4KWWA 4M5PA 4I9AA 4M6QA 3PG8A 3VE7A 5AHFA 2H3BA 1G7UA 1MXSA 2CLFA 3UPWA 3HF3A 1AL7A 2C18A 1LBMA 3HG2A 2V9DA 3G8RA 2JKPA 3M9YA 4E2BA 4IMGA 3LTPA 3IGXA 3WJXA 4R33A 3OBKA 3FYPA 1VCGA 3TMLA 2ZRUA 4KFNA 3MUXA 4EWND 1LBLA 3QW4B 1LP6A 3WJZA 3TROA 2QCNA 1K03A 1RQHA 3L5MA 5EY5A 3UXDA 2QDGA 1VPXA 1M7PA 2UV8G 4UTJA 4N9EA 3MYPA 4O0ZA 2YYTA 2E1DA 1THFD 2R94A 1TV7A 2BWGA 1TJPA 1OFEA 3BG9A 3DFTA 1A5BA 1LYXA 3W7PA 5HWNA 1OFAA 5SWUA 1L2UA 1ALDA 3HG3A 5L6UA 1JCXA 4BF9A 3DXIA 1OX6A 2D73A 1Q45A 3P67A 2DJXA 4FNRA 4Q32A 3TAOA 5HMSA 3CU2A 4IX0A 3W7IA 4K36A 5T26A 5EA9A 1GWJA 3BV4A 2A21A 1F7BA 4RZ4A 1LORA 4GUGA 3W7DA 3E96A 2B7QA 2E5DA 1WBHA 2ZYFA 4UFMA 3W1AA 1I2RA 2QUUA 2QKFA 4E2DA 5HR7A 3IEBA 1IXNA 2EHHA 1H7RA 1L6WA 1YXCA 3CHVA 4QJ1A 1IIGA 1QAPA 1AW1A 2FTPA 1K8YA 4LUIA 1X6UA 4YWIA 2HMCA 4PL1A 1SPQA 4FIRA 1QPNA 2QCDA 1NVMA 3NAVA 5D04C 4OT7A 4AAJA 1M6JA 1VHNA 4ZQPA 1W5MA 2J6XA 3UZ5A 4JXCA 2VOMA 1E51A 1VR6A 3D0CA 2A5HA 2QAFA 4BK9A 3EKLA 1KM1A 1OVDA 4RXGA 3ABRA 1T96A 4KFOA 1S5TA 5DCDA 2CZDA 2WJZA 4A3UA 1XI3A 1UUMA 1F5ZA 2RH9A 1N55A 4JTUA 2ZRXA 3H54A 2DZUA 3PSWA 2E5BA 5LNRA 1XBYA 2Y85A 2WNQA 4AVFA 3G3MA 3LHTA 2ZZ5A 3UWWA 2CFFA 3S6DA 3BPWA 4LVGA 4XUGA 4MKNA 1OYCA 3FJLA 3S5YA 3W72A 4JTIA 4N2YA 1TMHA 4MY9A 2DZXA 2ZRWA 6ALDA 4AWTA 1DJQA 3R12A 1Z44A 3NPVA 3GVGA 3W85A 1EIXA 4O19A 2OZ0A 3T7VA 5J5DA 3EXTA 3EWXA 3M47A 4MIMA 1TREA 1OF6A 3CLMA 2A7NA 5HJLA 2DZWA 1G4PA 3B8DA 3NNTA 1GOXA 1TPB1 1VYSX 1QPOA 5LZLA 3M5XA 1TTIA 3UQNA 3M5ZA 1KW1A 3TUUA 1AW2A 4OE7A 1Z42A 3TIMA 4EOUA 3GLCA 1SZGA 3E49A 4NXKA 2X2GA 1H1YA 2BZNA 1X8FA 4MZ8A 4QSHA 4MY8A 1UUOA 2FPYA 4UXDA 4TMCA 3E0IA 3EWYA 3GB6A 5AN7A 2GVGA 3FA5A 1ZALA 1TV8A 2Z1BA 1XXXA 3KX6A 5AB3A 2PURA 3C8FA 3LGEA 3W2MA 4O53A 1DBTA 1SO4A 3W1RA 3TU9A 1XKYA 2V0TA 3VI2A 1FDZA 3DHDA 3MO7A 3W07A 3ANYA 1AMKA 1J4EA 3CM4A 3DKLA 4GUFA 3INPA 3O6YX 3LM7A 3M7WA 3FEMA 5HUOA 1TJRA 5D33A 4NNBA 4RKAA 2ATSA 3T40A 3PB0A 3FJ6A 4LVDA 5F4WA 3QMTA 2DZPA 2V82A 4HIBA 5KTLA 2C14A 5IBXA 1LLZA 4AMAA 1IXOA 5LNWA 2VEPA 3TFXA 4Z1BA 3A9IA 5G1YA 3UWZA 4DPQA 1Q6RA 1FX6A 3W7GA 4FNQA 4IMDA 1GPWA 3U6WA 4M6VA 3TDFA 3OEXA 3W2NA 1G69A 1B4KA 1IIHA 3NGJA 3W1XA 3LCWA 3C2FA 1LDCA 5DBTA 3BLEA 2Y7DA 5MHBA 1KBJA 3B06A 1TRDA 3L9CA 5BOOA 1JR1A 4MLRA 3NO5A 3QPZA 3M44A 3M0ZA 3WK3A 4UTHA 3KVJA 1W54A 3TE9A 1O95A 4JYEA 4UUIA 1MEWA 4O18A 3PUDA 1YDNA 1O5KA 4HKPA 5I3JA 3SZ8A 1GTHA 2J24A 3DKJA 3VKJA 3S1XA 1O94A 2J9ZA 4LW7A 4WD0A 2DP3A 1B4EA 5D2WA 5G2HA 1SO6A 3Q94A 2C19A 3KVKA 3NM3A 2QJGA 2CZFA 3UZJA 1K8ZA 3M16A 4JTSA 1LBFA 1ZNNA 1ME7A 1PVNA 5BW6A 2WO5A 3DAQA 1K8XA 5EPDA 5HINA 3ABQA 3BLFA 3SW6A 2ZA1A 4Y96A 2GJLA 3S42A 5CPLA 3ATZA 2GPTA 1OYBA 1K3UA 3OHIA 1W56A 3JS3A 4LV4A 3DGRA 2R91A 3CPRA 3N14A 1QR7A 3DZ1A 1M5WA 4RZ6A 3QF0A 4O8RA 2C6QA 3GXNA 1HFBA 4KKXA 1OJXA 2GQ9A 4NJHA 3GYEA 1EUNA 2GOUA 3CEUA 3BW2A 1GVFA 4AF0A 2X1TA 4NUWA 5G1TA 1F74A 3FIGA 1N7KA 2H8ZA 1G6CA 2O7SA 2QUVA 4O4WA 1KM0A 2QUTA 3IIOA 1SW3A 4X3ZA 3FKRA 4I7WA 2A4AA 3TXZA 4IUOA 2RDTA 1U5JA 4QQ3A 1H51A 3A5VA 4WXYA 2Y70A 4O28A 4XZ9A 4RK8A 5F4XA 5U7SA 2BLEA 3L21A 1KBIA 5LHEA 5HULA 3HOJA 3A21A 1JUBA 3QJAA 3DU0A 5ABTA 5EL1A 3GKAA 3DI0A 1F2JA 2YR1A 1GT8A 3P84A 1SQ7A 3LXBA 5FF0A 2H3DA 5D02A 5AC8A 3F4NA 3PBWA 3UXAA 5HNRA 3BGJA 3TK7A 4A22A 1JJKA 2G95A 3WK1A 4ADSA 1DORA 3HG4A 2J88A 3H55A 5FEZA 4QITA 4BI5A 4O0KA 1SU5A 3HGRA 3BARA 1V5XA 3NQ6A 3RNDA 3DH7A 1TV5A 5A5WA 3P7YA 3UWYA 1WXJA 4GE8A 3PR2A 1RQEA 3CWNA 2CLOA 4JY9A 3MI2A 4IMFA 3SFKA 3BW3A 1NSJA 3W22A 4LU0A 5HWJA 1F05A 2TPSA 2QJIA 1A5CA 3W1NA 3OA3A 3KOFA 3QYQA 1G4TA 4WUIA 5D38A 1QWGA 5TQLA 1JCLA 4O1DA 3TAKA 4TU1A 3S1UA 1IXQA 3O6CA 4PA8A 3PS7A 1YXDA 4UR8A 5F1UA 4DQWA 3FKKA 8TIMA 1QPRA 3NL2A 1R30A 5CPNA 1DL3A 2CLIA 1ME8A 2ZZ4A 5HWMA 2G5WA 4MZ1A 1VC4A 4XBKA 3ZFHA 3STFA 1FDYA 4UTWA 1GVOA 2CZEA 2X1RA 3PC0A 4OBTA 3V1PA 2RFGA 3BW4A 3U2OA 4OWGA 5CPMA 5FEWA 4CQ9A 3HPXA 4LNYA 2PCQA 3LV6A 1OHLA 5CG7A 3BLIA 1RD5A 1TPC1 4TIMA 1P5BA 1BWKA 1SR9A 4O4VA 4WY0A 4NXSA 5AC6A 3UNDA 2FIQA 3H53A 3KRSA 3G0UA 4WQ6A 3W70A 2QF7A 1A53A 3DFNA 1ZAIA 4RX0A 4JGDA 5LGXA 4O13A 1QOQA 1W5PA 2NV1A 1XUZA 4K39A 1PL9A 4JICA 1QDSA 1KV5A 3HO8A 3NG3A 5I3FA 4NNAA 4JN6A 4FXSA 5AHMA 2YCEA 3MWAA 2QCHA 3SGZA 3TR2A 1I8JA 4LRTA 5K9CA 5G2WA 2EAWA 5C5YA 4ZL1A 3TA6A 3GAKA 3M5YA 4CCCA 2YW4A 2TMDA 3YPIA 2Y6ZA 1ICQA 2CZ5A 4IX2A 1ICPA 3PAJA 3LDVA 2NV2A 1V7YA 5D32A 3IIPA 3CTLA 4IOTA 4BI6A 2XN1A 4K6AA 2VEIA 3P5YA 4MJMA 4MLJA 1KTNA 4S2BA 3TSMA 4C1LA 1ICSA 1KV8A 1RPXA 2VFHA 2NXHA 4IGHA 3EWUA 2B7NA 3ABOA 2O7QA 4L4LA 1DQWA 1XL9A 3P60A 3UY7A 3NPWA 3R8RA 4ZQOA 2A6NA 2HS8A 1HO4A 3QQ1A 2CW6A 4RLIA 3GDLA 1A5AA 4FB7A 1VCFA 2CLMA 1YDVA 3QRHA 4DBDA 3NM1A 5GVJA 3GR8A 2A85A 1S5VA 3TV8A 4Z08A 5E1QA 4CCDA 5D09A 3QM3A
chains in the Genus database with same CATH superfamily
4WCJA 5HUPA 1EDGA 2J7BA 2FZDA 4XK2A 2Y5EA 4CCZA 3M1ZA 4ACYA 3ANUA 4CN6A 2BY1A 2WMIB 4QJ3B 1X1OA 3PPHA 4XX6A 4BWLA 3MHGA 4RUBA 3W7OA 1E72M 1WYIA 4Q8VA 4ZQNA 2OXNA 3LMZA 4HU0A 3ARPA 3GIQA 2PMQA 1D3HA 4GBDA 4FS9A 1B54A 2ZZ1A 2CLHA 2ZWZA 4JFUA 1S5WA 2WMJA 2NUXA 1W3NA 2RDUA 3E2SA 3S8HA 2NZLA 3F5KA 1U33A 4H83A 4LCSA 4CNPA 2Z1SA 3EX4A 3DG7A 2VFFA 4M7TA 4WXZA 1M53A 3GW3A 4RZ5A 1CB7B 2NX1A 1O68A 1C92A 3AFBA 2W27A 3URQA 1G67A 2OT1A 2H6RA 4MWAD 4UR9A 2CHRA 3TKFA 3GR7A 2G3FA 3WZ0E 3KLKA 2G3JA 1SW7A 1R3RA 1IGWA 2E09A 3P62A 3T4CA 1D7FA 4I6KA 1QK0A 3OLIA 4RR4A 3KBJA 4PCNA 4A2RA 1W9BM 1H1ZA 3FXGA 4A21A 2A79A 5DN1A 1E3XA 2E6DA 3E3HA 3BGGA 3PP7A 5I00A 2QJJA 3UA4A 4NYYA 1DQXA 4ZOBA 6REQA 3QHMA 5D05A 4AZCA 4KGJA 3OJGA 2DZAA 1XYLA 3OLDA 3PN8A 1JRCA 1NOUA 1E5JA 1XIBA 1LCOA 3QY7A 2X8RA 4YPJA 2XUCA 3SR7A 3FVDA 2POTA 4C6IA 4AD5A 2Y8VA 3MC5A 4GI9A 2BFGA 4G2DA 2BGNE 2IKHA 1XSIA 5LA1A 4TR9A 1DJNA 4BR1A 4MVAA 2IPGA 3LI1A 1W32A 4IJCA 1XDLA 1EGZA 2YLAA 4R3UA 3TXVA 3VGFA 2YCLA 3ZYZA 4XZLX 3PTKA 3VILA 4WKHA 1Q6GA 1CCWB 1QHPA 1KM4A 3MDUA 2W4XA 1VYPX 4NZ4A 2ISWA 2EPKX 4JTTA 4IMCA 2HTMA 4GYPA 3MBDA 2DT1A 1UWRA 2QDEA 2HSAA 1C3FA 2R1MA 3STGA 3VDCA 3GNRA 5C9RA 4HU3A 3O63A 4GJJA 1KNWA 4US5D 4P8XA 4Y8FA 3QC0A 1PHWA 3VKDA 3W7NA 4FMVA 4MUZA 1QNVA 2G8ZA 4IGNA 4QISA 2Z2BA 4GQGA 2ISSA 4FF7A 4TMBA 5C7VA 4Q4OA 1LTDA 2DQXA 1F4AA 3KFTA 2DIEA 1CT5A 2XDFA 2DZBA 4LUSA 3DFSA 4DWDA 3ANVA 3S5OA 4DAFA 1V4YA 4O17A 2X0YA 2ATMA 4UTKA 4DPPA 1SZFA 1C8VA 3P0XA 1BRLB 3NZQA 3G22A 2BGSA 2OZ3A 1FWBC 3CZGA 4GRSA 4UTTA 3E38A 5FEXA 4RJEA 2WPBA 3IIZA 1DJWA 4A29A 5LXXA 1EZWA 3W84A 2NSXA 3BZJA 2GJXB 2Y0FA 4WY0B 3OGVA 5M2FX 3CO4A 4C6LA 4BQ3A 1MEHA 2NWRA 3OVGA 3N25A 4GACA 3MP4A 2E4TA 4D8AA 3GHTA 2Z6JA 4GZ7A 2FB3A 2IPJA 3GXTA 3H26A 1WQ5A 4FEZA 2ISDA 4NT0A 2OU4A 4UCGA 2PC8A 4LCQA 4OKDA 1E1CA 1QOPA 1TVLA 4PMUA 1JDAA 4Q4SA 1NJJA 4O12A 4DELA 2F61A 3H2MA 3RO6A 2OSYA 2XSBA 3T9PA 2HBXA 4PUJA 3W7CA 3SIMA 3DEQA 6TIMA 1QBBA 5DXXA 3FY1A 3N19B 3GTHA 3VMPA 1AZ1A 3WEZA 1V8EA 1B9BA 2JF7A 4XG1A 4B90A 3U2ZA 1XLKA 4HN8A 1P6WA 1W3IA 4XKYA 3F1QA 1RBOB 3FW6A 1XRTA 4TX8A 5K9DA 4NI3A 1YE6A 5A6AA 4JQAA 4FNUA 1CW2A 2QCFA 2PLCA 3DG3A 3N6HA 5BRBA 4NZ1A 3CC1A 1KM2A 4GFIA 5LXEA 1PJ9A 4LC6A 3GIPA 1AK5A 4MFDA 3WF2A 4JX4A 4C1KA 4IFKB 3IPWA 2EJ1A 3SADA 1VD6A 4YTRA 6PTDA 3OZPA 3UJSA 1JD7A 1UA3A 2GVJA 1J0YA 3UYIA 1D9EA 2R1LA 4KETA 3IIXA 2B4GA 4M6UA 2YDAA 4MWAC 5DXYA 1Z48A 4ZFCA 3O3RA 4UFJA 1SFJA 1V3KA 1AQHA 3LPPA 4NX5A 3PBYA 3TSDA 3STCA 2O4MA 1R8LA 1W3TA 3CJPA 3QMSA 5FJOA 3QV6A 2WW5A 4GGHA 4JQ4A 2JF6A 1U5VA 4C60A 4H8HA 4KEVA 3IK4A 5F4SA 1VBHA 3W7KA 2ZVRA 2E9MA 1EEXA 1HKIA 5DY3A 2ZCGA 1PKYA 4GI4A 1A5NC 3DFPA 3CUZA 5KZEA 3LHWA 2Q02A 3I6RA 4FLOA 3AS0A 4UFHA 1Y5WA 1XC6A 2UY3A 3CL8A 4PGLA 2QJHA 1PS9A 1HJWA 1T41A 1XLBA 3RUBL 4YU1A 1FHDA 3BSGA 4LJ3A 2QDDA 4OQVA 4IJRA 3CHFA 3I4EA 3A24A 3VOFA 4GVFA 3MMTA 2OFJA 5M03A 4R88A 3POHA 2NW0A 2EGZA 1QHOA 1W8GA 4IJBA 1KXHA 4ACZB 3PB2A 1Q2SA 1VBRA 2V5CA 1LG2A 4JTGA 1PX4A 3PVFA 3EKGA 4DO5A 1O12A 4OV4A 1VIWA 2LLEA 3FDKA 3SRFA 3GNNA 4BHYA 1JPMA 4YHGA 3AMDA 5IHRA 2XFRA 3AO0A 4WK9A 3AHTA 1ODZA 3MBFA 1KM6A 1BTMA 1TQXA 2WCSA 4AZ6A 5T8GA 4F2BA 4GI8A 1YYAA 4JFSA 1I0DA 3NQCA 4MNJA 1XIFA 5C7HA 1IGSA 2ISVA 3IRDA 2Z4GA 2O9PA 2Y88A 1QO2A 4QSFA 4YL2A 3N9RA 1NU5A 3CTTA 2I14A 3DHUA 1TMLA 2GK1A 1MYRA 1A5SA 1QXLA 1RK6A 3NZ1A 1MDRA 3FGCB 3WQGA 3H2FA 2F84A 1LLOA 3AHZA 4GC4A 4XQ6A 3SJNA 2VEGA 3TOYA 3B4YA 2GWNA 3S5NA 4JTJA 4DYKA 4WGHA 2G3NA 3CPUA 3C2YA 1CXEA 4JIPA 5A8NA 3QQ0A 3WBAA 1OINA 2VC6A 3S1GA 3C86A 3WD3A 3BGAA 3RCMA 3MSYA 4AHPA 3SGUA 1JCNA 2G0WA 1TMQA 1BF2A 2V2DA 2W9MA 2ZDRA 4L7ZA 5E9XA 4JNYA 4QX4A 4JTEA 1QFEA 4H4IA 1ZRQA 1S5MA 2G96A 1WAUA 4RE2A 1B31A 3GDTA 1G4SA 6A3HA 3O06A 3TYUA 4CKQA 4MJ2A 1NEYA 2PDUA 3G1SA 3AMCA 2BDQA 4JHZA 1J0HA 3NR0A 5AY7A 2CNCA 1LWHA 1U5HA 3VX1A 4LY8A 1E40A 3AUOA 3CAWA 1FCVA 4JEJA 5I02A 3WUEA 1YPFA 3GH7A 4GK8A 3W76A 3VX0A 2JGYA 4LT9A 3QKZA 5AHIA 4IICA 1ZQ5A 3EAUA 4KWVA 2PD9A 3HBLA 4PYSA 1UD3A 3T0CA 1GOIA 2GGGA 5LHFA 3RCNA 3BCJA 1C8QA 4UOZA 1ZU8A 4WJXA 5EYWA 3IGUA 4Y8EA 2G97A 3STPA 1EPVA 3NDYA 4UFLA 3ELFA 2XH7A 4IP5A 4J35A 1XYCA 2XHYA 3QOMA 3T05A 4G8TA 4OOUA 4S1FA 4XKMA 3CEPA 1MXDA 1OY0A 1UD4A 2POZA 2WCAA 4W4QA 1V02A 2DORA 3LCGA 3TCEA 4NHVA 3PUEA 4LB3A 3ARQA 2Q09A 3VIOA 3BOXA 1RLDA 2C0HA 1JQXA 3W25A 1BKSA 1UC4A 2QHAA 1YDYA 4IIEA 1L8NA 3TYEA 1BLIA 3WJSA 1EJVC 1DP0A 4HA0A 5D2VA 3MV11 4DWSB 3EA1A 3QZ6A 4C1NA 4FOKA 1XDJA 5AHNA 4L65A 2V3GA 3E2VA 5H8PA 4QJ4B 3CUJA 2A0NA 5BYWA 2Y89A 4O54A 3LHUA 3WQ4A 3VGDA 2Y63A 4A3QA 2XIMA 3NDOA 3HFYA 4BQ4A 1DJHA 1PE1A 4KRZA 4M19A 2Z1WA 4E5TA 4WOQA 4AHQA 4A05A 3DYPA 2WHKA 5CSRA 4AEEA 4GO8A 2DFAA 4B5WA 3V4BA 4G7EA 4EKJA 5EMLA 5TAOA 4GLEA 1LL6A 1M7XA 1U83A 2ESCA 2E0PA 2XSXA 3EOUA 3VNIA 1S2UA 4UQEA 1E6ZA 4PMVA 3H8AA 1MWOA 1J5SA 1R3QA 1VBGA 1A5MC 1FUYA 1PKMA 1WDWA 3TQPA 1KKRA 4DBEA 1CTNA 1JPDX 2HVMA 1EF3A 1LLWA 3ARYA 5DT7A 4RDVA 1WV2A 1M7JA 1ELSA 3FFSA 5REQB 2C3ZA 4RNHA 3ZS4A 1U30A 2OYMA 1UA7A 5DRIA 1VLWA 1W2VA 2NXIA 3WK2A 4C7DA 4AH7A 1GCYA 1XH0A 4W93A 3W83A 4AVOA 3KRUA 3VIPA 4PR4A 3NURA 3KBVA 3WQPA 4JTKA 3NL5A 1Q7QA 3AQUA 3KP1A 1OWQA 3BK0A 3M5VA 2H9AB 3C2EA 3GD6A 2X0HA 1OK6A 1FHUA 1TIMA 3UWQA 3TC7A 4FR6A 3UD6A 4I8DA 1JI1A 4E4FA 1BD0A 2QLYA 1HJQA 2FJKA 3GZ3A 4Z1CA 3WLPA 1H63A 2WZEA 3ALGA 3NQAA 1XD0A 3VIJA 2D69A 3FN9A 1RAKA 1JUKA 4QJ5B 3CV2A 1BSLA 2UY5A 2XN2A 4PE8A 1I2QA 1FWHC 2F2HA 3V0SA 1HIZA 3W9ZA 2QEZA 4DYJA 1QBAA 3W26A 3WX7A 1LG1A 3LCXA 1SJAA 4LEQA 1W3LA 1O4UA 5A1AA 3PM6A 1JPHA 4N0RA 5DBUA 1ODUA 3HV9A 3LEPA 5C71A 4AU0A 2D2OA 5EKYA 3P8JA 2FMOA 3OG2A 3GU2A 3B04A 1GTEA 1JCMP 3IJ7A 1OT1A 2E6AA 1TPH1 3DECA 3NEVA 4LRSA 1X7FA 4UTMA 2WJDA 1I60A 3M7SA 4N42A 5FJTA 3WUGA 1Z8AA 1UASA 1DJYA 4Y9AA 3KHDA 4PMYA 2CLLA 4L6HA 2QQ6A 2Z6IA 1BEUA 2P0IA 1OK4A 1J2WA 3OVRA 5H8UA 4FX8A 1DVJA 4L1XA 4PUUA 3VKKA 4OBSA 4I7UA 5AECA 3G1RA 4NZ5A 3LPFA 4AWEA 3JW7A 4JPGA 1K7FA 4Z1DA 3GX9A 1JYVA 1P6CA 3RPDA 5CGMA 1ZAHA 3EDEA 5D4YA 2CWNA 4C5YA 3WBEA 4N02A 1GG0A 3WH5A 4Z42C 1LOSA 4W85A 1ZP4A 1VHCA 1JZ4A 5D2YA 4ROQA 1ZUAX 4LX4A 3R4IA 1JUEA 3UP8A 4C90A 2J7EA 3SCUA 5AHEA 1OABA 1IT7A 4ZO8A 3A4AA 1EOMA 2A3EA 2W6RA 4LEFA 3WL1A 3DX5A 4AZ7A 1HVQA 5D37A 3CIXA 4QDWA 5MF5A 3ORWA 3G18A 1F6YA 3LXCA 3B9AA 5TNVA 1OX4A 3VDGA 3TWBA 1JZ3A 2DZTA 1EUAA 1F6KA 3A3HA 4MM1A 2J66A 4PBEA 4DWSD 3SQSA 2B81A 3KZSA 2D24A 2ZUMA 2OJPA 1LQ0A 4KS0A 5E5CA 1FBAA 3NXLA 1A3WA 4P61A 1POJA 1ZENA 3HIJA 3QYSA 2VZSA 3I68A 3LGDA 3W75A 3ISIX 3CWHA 4B5NA 1EGMA 4R9OA 3NQ2A 5KMYA 4CN4A 4GY0A 3G3DA 2KZHA 5I24A 4B5VA 2PEVA 4HN4A 3GFZA 2ZXAA 5RUBA 2CYGA 4E0CA 4BEQA 5L9FA 4RW3A 1EBHA 3CXOA 4ICNA 2QCGA 5I7GA 2WSYA 5A6LA 1K9EA 4X9SA 4IZGA 5GJMA 3KCLA 3WLJA 5F2MA 2ZXQA 5CJNA 3LNMA 1X98A 2BX7A 2QS8A 3VVGA 5LA0A 3PG8A 4GABA 5AHFA 2H3BA 5ECVA 1QW7A 1UR0A 3PFMA 1Q4NX 2PS2A 4J3ZA 3VIGA 2C18A 1Y7VA 5A6KA 4LCRA 2V9DA 3G8RA 7TAAA 4DUWA 2BP1A 3M9YA 4IMGA 3WJXA 5B7ZA 3AS2A 5HXMA 3H21A 3AIQA 1TELA 4PCTA 1VCGA 4KFNA 4A8LA 2J7HA 3RPTA 3MUXA 1FP8A 3QW4B 1CGVA 3ITOA 5AZ0A 1K03A 2NQHA 4DAIA 3VGEA 2XJ7A 2DQWA 3L5MA 3GTIA 3NUKA 5EY5A 4JZ5A 1M7PA 4W88A 4UTJA 4HA4A 4KCVA 1GHSA 1W9UA 2WMHA 2Z26A 5E70A 4N9EA 3MYPA 4HA1A 3SCSA 2E1DA 1A4LA 2BWGA 1FWFC 3HPAA 2QV5A 1E0UA 3UXKA 5BZAA 3WLIA 2XIIA 3O0KA 2YLLA 3GBDA 1A5BA 1LYXA 2OG9A 3LYEA 5HWNA 2WLYA 4HOZA 1B3VA 5L6UA 1JCXA 1RA5A 2D73A 4C6BA 3WNLA 3RILA 1R87A 2OEJA 2PSNA 2QMKA 4K36A 4QLJA 4DZHA 1LUCA 4GVGA 2GSHA 4RZ4A 1WUEA 1ZBWA 1I9CB 2QUUA 2QPSA 3CH9A 1B3XA 3GG0A 4E2DA 5HR7A 3IEBA 1IXNA 3S2LA 2EHHA 3CV7A 1IV8A 1OCJA 4ZOEA 2QPXA 1AW1A 4UNIA 1LF1A 1VIZA 3GS6A 3FA4A 1K77A 2GUBA 2HMCA 3D46A 3ZMRA 2QCDA 2V5KA 4HJWA 3BQ5A 1T5AA 3B8TA 1VF8A 1CGUA 5D04C 5CSUA 3I3EA 4D9PA 2HV5A 4ZQPA 5GNYA 3WH9A 1Q6DA 3F4VA 3MO4A 3D0CA 2A5HA 2J8TA 1GQLA 1OVDA 3ABRA 3ID7A 4KFOA 5DCDA 3L7RA 4U10A 4H1ZA 4PCPA 1IZJA 3EB4A 1KRCC 1F5ZA 2ZRXA 3PZGA 4KH2A 3AXIA 1KRBC 4HTBA 4CQCA 1XBYA 1E9YB 3R0UA 3G3MA 2CZVA 1E3ZA 2V6AA 1KRMA 1Y8BA 5A6BA 1WDPA 2WCGA 3BLKA 3S6DA 2FZBA 2OR2A 5EMJA 3VABA 1D2KA 4GG9A 3XINA 1WDRA 1QNRA 3GXDA 3VOGA 1PTAA 4LNCA 1Z44A 1UH2A 2GGIA 1Q6CA 3M47A 4MIMA 3CLMA 1F61A 3FHAA 3ITYA 2DZWA 2Y1HA 2I16A 2GJRA 3E0VA 3I6TA 1VYSX 5LZLA 3M5XA 3UQNA 2PDQA 4DM2A 3O7UA 4FF5A 4TVCA 1A0CA 2X2GA 3MSDA 1DXIA 4LYKA 4MZ8A 1X8FA 5XIAA 3H2EA 4P8VA 4TMCA 1KD0A 3EWYA 2X05A 1MQQA 3V0UA 2HPMA 1P0DA 4CD6A 3IJ9A 3VOHA 5J8LA 1HJXA 3EPOA 5DO8A 2GOKA 1SO4A 3TU9A 1TFVA 3DHDA 4FSAA 4BJHA 3WKZA 3MO7A 3ANYA 3CM4A 3IS4A 4XAFA 3DKLA 5C9XA 5ABGA 2VCBA 3RX2A 4M3PA 2EO7A 5FL1A 4F2UA 5DMLA 2ZWYA 4DWSC 3VKBA 3QTGA 1JL8A 2R9RA 5F4WA 1SMAA 2NT1A 3P93A 3VIIA 2DH3A 2PDPA 2WHMA 4DHGA 4MUPA 4EACA 2J78A 4W8BA 2Z7KA 4DUXA 4PRRA 3NSNA 1UR8A 3TFXA 3S9ZA 4Z1BA 1U22A 4BF7A 2PGRA 3L12A 4DPQA 3W7GA 1GPWA 3W2NA 1G69A 1B4KA 3LA4A 3LCWA 5DBTA 2Y7DA 5BOOA 3A3WA 1JR1A 3NO5A 3QPZA 3FVMA 3WK3A 4UTHA 1UWAA 1O95A 4UUIA 1UWTA 2NSOA 3THDA 3WH8A 1EBGA 4LXFA 3UG4A 3VMNA 3W53A 3FYYA 3SZ8A 3KOWA 3VKJA 1O94A 4LW7A 4WD0A 2OO6A 1K4HA 2ONEA 3H2OA 3UZJA 4JTSA 3M16A 3WLRA 1LBFA 4IPPA 2FMNA 2VMFA 4RE4A 1K8XA 1ZBCA 4UQBA 4KRUA 3VD4A 5HINA 3N11A 2GJLA 1OYBA 3JS3A 1W9VA 1XP3A 3R58A 1QR7A 5LIKX 3SO7A 2V38A 4XAYA 2HJPA 4A6GA 3QF0A 1UZDA 1DJGA 2GQ9A 4F9DA 1XD1A 2OZTA 3UWEA 5FL0A 1MXGA 2UWFA 1UMLA 1UZ1A 2X1TA 4NUWA 2WQDA 3A4WA 3ABZA 2FFIA 2BOFX 3FIGA 4L61A 4O4WA 1N7KA 2QUVA 3VYLA 1SW3A 4QQ3A 4UQCA 4H9UA 3LENA 4IIHA 2Y70A 3UCDA 3BSMA 2J7CA 2QV4A 1E55A 3V5CA 3W6LA 1NARA 2E8YA 2CITA 4XZ9A 1US2A 2Z28A 5U7SA 4D72A 1OD8A 2V5JA 3VC5A 1KCZA 1JUBA 4AXNA 2YR1A 1SQ7A 2H3DA 1DWHM 3F4NA 2DV0A 3PBWA 3UXAA 3BGJA 4A22A 1EJXC 1JJKA 2FYMA 3QR3A 3WD4A 1QJWA 1XG4A 1OGGA 3BLPX 3H55A 4BI5A 2CERA 1CGYA 4OVXA 4O0KA 1XRFA 1SU5A 2IPWA 5HDRA 3ONCA 1V5XA 3DH7A 1TV5A 4ERAA 3P7YA 1VFSA 3S6TA 5JIWA 4C6DA 4PTDA 1Q13A 2FVLA 3FAWA 4PFHA 3TA9A 5M5DA 3BW3A 4OJYA 1TX0A 3W22A 2UY4A 4NY2A 2WK2A 3QV7A 4MDOA 1B30A 4G9PA 2D22A 2PUZA 5FACA 1XJBA 3KOFA 4WUIA 2RAGA 5TQLA 4O1DA 3TAKA 4OFCA 1BYBA 3K13A 1MUWA 4PA8A 1XPYA 1MW0A 4CD7A 2VC7A 3NL2A 1X7IA 5CPNA 4DX3A 2OLHA 5HWMA 3OBEA 1GHRA 4XBKA 2F6UA 1DJXA 3U4FA 3VA8A 4J27A 1UBPC 2RFGA 3BW4A 3U2OA 1MVYA 2F9RA 4L1WA 4X9YA 5CPMA 5FEWA 3T0DA 4IMAA 1PDZA 4E4UA 3WNOA 1OHLA 3UA3A 1C8XA 1TPC1 4H8UA 1LWJA 3VNKA 1SR9A 1XPGA 2GJXA 4WY0A 4UCFA 3UNDA 1ZSXA 6XIMA 3W70A 2QF7A 2PI6A 4NP7A 4I9MA 1JZ6A 4G6CA 1BQCA 5IDIA 4RX0A 5LGXA 3O9NA 4O13A 2C8NA 3OYXA 2FHFA 4P7OA 1VBJA 1XUZA 3H2NA 1QDSA 1KV5A 1EL3A 3EWCA 3T2PA 5I3FA 4NNAA 5HQMA 4D6JA 4UOJA 1EHAA 5G2WA 2QIIA 3GAKA 2WVSA 4XB3A 5BCAA 4LFYA 4ZFMA 3POCA 4MHBA 1Z6KA 2YW4A 4M8UA 2Y6ZA 4FA3A 2OODA 1PX3A 3EB3A 2NV2A 3AWOA 3BANA 1UR2A 4K6AA 4U5IA 3GH4A 4XD4A 4S2BA 2V5DA 3U5UA 1UD8A 2YCLB 3ABOA 2FZ9A 2FGZA 4L4LA 3UY7A 2J25A 2HS8A 3B9OA 4FB7A 2CLMA 1YDVA 1ZGDA 4DBDA 5GVJA 3KL0A 4CCDA 5D09A 1OCQA 1DJZA 4B9ZA 2WHJA 1BXBA 3NXFA 2WANA 4YN5A 1EX5A 1J12A 3KEHA 4ICCX 4IFKA 7ENLA 2G4JA 4S3DA 1TCDA 3QTPA 5I03A 1Q6QA 5I3HA 1FWNA 4Z0SA 4ZXOA 5C9ZA 4L4MA 3Q58A 5HATA 2WZHA 3B9EA 1XS2A 1HZYA 4LV9A 3NVDA 1NIUA 3ME3A 4QTGA 3OZYA 4CQBA 3QZEA 4N9DA 4PRWA 3G1AA 1ZBKA 1KGWA 1JYWA 4YS1A 3G0XA 5LA2A 5D9PA 3N4FA 4K37A 1VCVA 1OBAA 1GZGA 4DF1A 2ZX5A 3KTCA 4XIAA 4GBUA 1QNSA 1G1YA 3CV6A 1PSCA 4C6NA 3VOCA 1KWKA 1H7NA 2V63A 5C6MA 5IBXC 2ZRYA 1D3GA 4IIDA 1LQAA 2Y24A 1NF7A 1J0ZA 3L4ZA 5M1TA 4NU7A 4QNEA 3R8HA 3VPLA 3LLDA 3VD3A 3B05A 3C56A 2E9BA 2R14A 4NG3A 1W5QA 5CC7A 3N4EA 5CZ0A 2ACSA 6ENLA 3WN6A 1RPKA 3SIZA 1RBAA 4LVFA 4Y9MA 4YYFA 4KIRA 4CEUC 1AH4A 3TC6A 4ACZA 1VZWA 5B7YA 1UKTA 4UFKA 5LYRA 3FS2A 1JF6A 1I2OA 2YW3A 4Q4KA 3ZT6A 4U28A 4JX5A 5AYBA 2E6YA 2QMJA 4DY1A 1V02E 3F5JA 4CU7A 1S1PA 3WJWA 3MI3A 1A0DA 4U4MA 3RMEA 3WMSA 4HMCA 4OGZA 2TAAA 5KINA 4XKYB 3GFXA 5F2IA 3NQGA 1EJSC 2GWGA 3QGVA 1TZZA 5CBBA 1DIEA 2R24A 1PZ2A 1RBLA 3BJTA 1FWTA 3IACA 1VJZA 2PDKA 3ARVA 1MZRA 5HJXA 3U2CA 2DJLA 2HXUA 3OIXA 3RLVA 2CXEA 2YZRA 4DO4A 7PTDA 5KEZA 1JDEA 2PE4A 2G3IA 3NA8A 3FGCA 4M81A 3AIBA 4FZIA 4GZJA 3WDIA 1EJTC 1KFEA 5I3DA 4YWSA 5HNUA 4HPXA 1XLGA 2CBIA 3QHNA 3W1MA 1OX5A 3UF9A 3W0KA 8XIAA 1JZ2A 1FOBA 3T8LA 1HO1A 3H23A 3M0VA 1H62A 3FSTA 2DSZA 3NYZA 4EPKA 3ARUA 1CXKA 3RF9A 4R34A 4NSBA 2GQ3A 3QPYA 3ABXA 4W7VA 3QR1A 3W37A 2ZZ3A 2D2JA 2FTYA 5BNKA 5PTDA 4WY0F 3W38A 4LUJA 3WNNA 1K8CA 3IIVA 5E93A 3GDKA 4UNKA 2DEPA 3W6MA 1X8CA 3GM8A 3TTSA 1BFNA 4AD2A 5FSEC 3MJYA 2GJPA 4QCEA 4K7VA 4GUJA 4DLFA 3HTWA 2DT3A 3DENA 1MNZA 3LCIA 2GUYA 1UKSA 1V51A 1XIDA 4MJZA 1TZ7A 1C29A 3CHCA 1X96A 1OT2A 3O2LA 5CC3A 2J6VA 2ASHA 3ENLA 3HPSA 4ZZ9A 1VRXA 2RGMA 3UJFA 2R82A 1JG9A 2VENA 2VOTA 1VFUA 4PUNA 1T7LA 2A2IA 1BXCA 1OFPA 2PTDA 3FJNA 5BMXA 1IXPA 5AOUA 1W5NA 4S39A 5TBOA 2YXGA 4JN7A 4EIVA 1MMFA 5A94A 5C9UA 4PUWA 3O0FA 1TWSA 1J6PA 1SZEA 1R2TA 3TSBA 3VOJA 3MUZ1 4S3BA 3U8GA 4DJFD 3I10A 4NQ1A 5JBDA 1FCBA 4U3AA 3SCQA 1XRVA 4HHMA 3V5FA 1ZLPA 4QBXA 4AZBA 4FO4A 2DUZA 4MDPA 1Z3NA 1YPIA 3SCPA 1YMYA 5HOSA 4NZCA 1GOWA 4Q8OA 6CGTA 3CT7A 4S3CA 4AXKA 4WRHA 4AB4A 3TJXA 1AJZA 1N8FA 3REQA 1IWPA 3HMJG 1DWIM 1XBZA 4HBKA 1QU4A 2F6XA 1UR4A 3N2XA 2NQZA 1W1IE 2YFOA 4JTHA 2WMKA 1PWLA 4QRNA 2Z00A 4P8UA 4UMAA 2G50A 4LANA 1Q4WA 1J10A 4EF9A 1E1FA 1GYLA 4A4AA 5TF0A 2QUNA 2FLIA 3MWCA 4UMBA 1V3IA 1S3HA 3N17A 3XIMA 3BTNA 3VIKA 1UROA 3UZWA 3EWWA 5AC4A 1QNQA 4N9BA 4OUIA 3S1WA 4MPQA 5C2CA 4NX0A 3NL3A 1NWSA 4DRSA 3KM8A 1VAHA 4LPCA 4GXPA 3GXPA 3CMGA 1XH1A 3ITGA 4HCDA 3T09A 3EWBX 4L6DA 2ZFAA 4LBRA 4FAMA 5REQA 3G5EA 3NQMA 3U48A 3CAQA 3KDOA 4PRTA 2IQ0A 3RHGA 3TX9A 4UFIA 1LROA 4QS6A 3L4WA 9CGTA 1VJSA 3BH4A 4U33A 3E9AA 4BWLC 5HR6A 2PZ0A 1UW9A 4XZNX 5AYYA 1Q63A 3DCPA 4K1WA 2C16A 3OBAA 5D30A 4HP5A 4HU8A 5EMYA 2OWCA 4U2YA 3G1HA 2VM8A 4CQ8A 3UFYA 5FF2A 3QC3A 3LMYA 1TTPA 4AIEA 3MW7A 3UWUA 1LQ2A 3GXIA 4JIHA 3G1DA 3VFCA 5LNUA 3N3MA 3UZZA 1KCXA 3BLLA 1JF5A 1RR2A 1TPFA 3R25A 5EU9A 3W2UA 4IFRA 3BSHA 2I7GA 1ZFJA 4ZVJA 3W7HA 1V93A 3CT2A 2PTYA 3H2CA 3AIEA 1P0NA 3SI9A 3A6OA 3VD9A 4L9XA 3UPBA 4O10A 2OEMA 2ZIDA 2P1FA 2BXYA 4LVAA 3BV7A 4QIUA 3DHFA 1HUVA 3HPZA 1TWZA 1F73A 1ZCCA 1H0IA 4J3VA 2JFEX 2ZRZA 4H9TA 1F9CA 1N2VA 5K9XA 2ZUUA 2Z7GA 5JBFA 2FGBA 3RR1A 4C1NB 2QJMA 1D8CA 1H60A 2P3EA 4ZO6A 1S2WA 1W5OA 2W66A 4QAWA 3AZSA 4XVDA 2HE5A 4Q8MA 4GA8A 4C6PA 2YDSA 1E6NA 4Q4MA 4TQTA 4ZO7A 1NQ6A 3TW7A 3AIVA 2XIOA 4PUKA 3CL7A 2YPIA 5FF4A 3IVTA 3VAVA 4TUFA 2WM1A 4Y9OA 3G6LA 3GC2A 4GKLA 4GINA 4K8GA 3CO8A 1AL8A 4O1CA 1TJ0A 1XHGA 3C0JA 3WLOA 2VD8A 1TCMA 2DVXA 1AD1A 1HVXA 1A0EA 1MW1A 1I45A 3L68A 1V6TA 2ZC1A 4YXGA 2D3NA 3L0NA 4KCTA 2VEMA 2PRLA 2MANA 3GW0A 1J79A 3GVWA 3ZWTA 3RITA 3NSXA 4K8EA 1FH9A 3NIYA 3R89A 1P1XA 3GE7A 4LVBA 4F79A 2Y5JA 2Y62A 3WNMA 1GVRA 1UKOA 3USBA 3W2LA 3L5AA 5CKSA 1K6AA 4L4PA 2OYLA 4JTQA 2WNNA 2D23A 4J3UA 1F3WA 1R5YA 1OEPA 4YCPA 3TW6A 2YL5A 4ATDA 3LX9A 2RGLA 4Z2HA 4LAOA 4WJ8A 3WQEA 4ERIA 3VFLA 5AYZA 3ITXA 3LB0A 4R7WA 4EXQA 5DMYA 8CGTA 3W86A 3IV3A 3NQBA 3EYPA 1F8IA 4B5SA 4S3AA 4DBUA 3A5FA 2EKCA 3C5QA 4GYPC 4E38A 2VR4A 3F2BA 1FWWA 7REQB 3RLGA 3ZLFA 1B1YA 3OPSA 3F4WA 1JGIA 4WSJA 3MHUA 2PC4A 1KXQA 2PRHA 2CCRA 1E6XM 1KM3A 5BWFA 3A4XA 4ZE5A 3M41A 3TR9A 3GG7A 1RVGA 3WBWA 1UD5A 5FJPA 3QV9A 1UKQA 2FB2A 4J3TA 3OB8A 3GQYA 2FJUB 3I4KA 3IJQA 1TUXA 2WOQA 1UR9A 5I06A 1ZPTA 4W5ZA 3BQ6A 3CZJA 4PN2A 4CQDA 2HWGA 3UESA 2EG7A 3AMKA 3ONBA 1XQKA 4UTTC 3BG5A 4O57A 1UG6A 3CHEA 2VKZG 3LHYA 4WDUA 3GSMA 2PDHA 3KRZA 3LK6A 4TOQA 1OM0A 1XSJA 1H7XA 1WBJA 3SECA 3APYA 2Z29A 1DWAM 3GUWA 4ALDA 5G1MA 1DTUA 1N82A 4PB3A 4QE5A 1YXYA 3PZMA 1DWJM 3P3BA 1C91A 1LL7A 1Z41A 4ZOAA 3K5XA 3TTQA 1NWRA 1E0VA 4M51A 3B0PA 3B9DA 4YLWA 4LWWA 5CAHA 2E1WA 5T91A 2C1GA 1V0LA 1WOBA 1TTQA 3A4JA 3WSUA 2ZADA 2J62A 1MSSA 5GPRA 3LG3A 4WLCA 3PWIA 4B3ZA 3SN4A 5LNSA 3L2LA 4D8ZA 3UY8A 3PBVA 2BS9A 1R38A 1DXFA 4D1IA 3WNKA 2ZVIA 2ZTJA 2UY2A 2PAJA 2A7PA 3K8LA 2PB1A 1W1A1 1XIHA 4GOAA 2PDWA 8RUCA 3P74A 2WNZA 4OV9A 4PUEA 5LIXX 3QSTA 1B0IA 3IJDA 3WCZA 1BYCA 1R3WA 3D5HA 4G1NA 2XU2A 3ALFA 1ECQA 5CZKA 1EC8A 4V1YA 3VK5A 1X6LA 3WUFA 3WEOA 3EX6A 1VH7A 1ZBVA 2H8XA 3ATYA 2ZA2A 5CZSA 1OFQA 2JEQA 3USZA 3H7RA 4QNWA 4IXXA 1QMLA 2ABAA 1R0MA 1C7TA 4IF2A 2EPOA 2DDXA 1UZHA 3R7MA 2PDBA 3OVQA 1WB0A 1XIGA 1H7WA 1OX4B 2GGHA 2JIEA 1ESWA 1L6SA 3W3OA 3EX2A 4BZYA 4ROPA 3NZGA 4GIAA 1KFBA 1R7AA 3UR8A 1JIBA 3MKVA 3TN5A 3G6MA 1VEOA 2GQ8A 1QASA 3GK0A 3VUPA 4GZIA 4ORIA 3LHZA 1W3KA 4PL2A 3DBNA 4CCEA 1I1XA 1XCXA 5H1WA 3CZLA 1XGZA 4IMEA 4TVUA 4Q8UA 4L56A 4I7VA 4AW7A 2XTKA 3LY0A 4GYJA 4MMWA 2QNEA 1D7KA 4QAIA 1WA3A 5J5RA 3M07A 2J4GA 3W87A 1TX2A 4XO7A 1JXKA 3P82A 5MKGB 4HQVA 1P4CA 3C0SA 1CGXA 2HVOA 1WUFA 4B9YA 1XLIA 2FQIA 4YYCA 2PWEA 3MU7A 5G5IA 1MW2A 3LTYA 3L2IA 1RJPA 1SFLA 1NOFA 5FF7A 2YSWA 1F8MA 1B57A 3NZRA 2EKGA 5AKQA 1DOSA 4UTUA 5GQBA 4JYFA 1JCYA 3A9BA 4GH1A 4D6IA 1KFCA 3W27A 1ZCOA 4NJKA 4GQBA 2BOGX 4DZ5A 3P81A 1XGDA 3VGGA 1BGGA 2V2CA 3LPGA 2XG9A 3L66A 5LIYX 4ADUA 3P6LA 2P8CA 3MDWA 1DPMA 3GIYA 3LSCA 3G1VA 4KEMA 4BKNA 3OODA 2MUCA 3LRMA 1X1ZA 4HNCA 1PDYA 1GVEA 4N4PA 1CLVA 2F7FA 3V3WA 1UMYA 3DFYA 3M46A 3TP4A 4JTDA 1CI1A 1PIGA 3PTDA 3O8AA 1W91A 5DCEA 1US3A 4BQ5A 5HK4A 1M68A 2WJEA 4O15A 4WKAA 2YGYA 1NAL1 5CPQA 4IG2A 2PGFA 4TXEA 2I9EA 4F40A 1XSKA 5A69A 3RK8A 4Q6XA 4WF7A 4Q4QA 4LAUA 4GQ0A 1M1BA 5CSYA 1LUCB 1OYAA 5KZ6A 4N6EA 5HANA 1TPUA 4REQB 4JY8A 3FSUA 4S3KA 2YA0A 4PMDA 1E56A 3JZEA 3L4TA 3TWAA 3B9NA 3PZOA 1LOQA 2ON3A 1M01A 2BASA 3BLDA 4NRSA 4HPNA 2ZUNA 1E70M 2WC4A 2TSYA 5BOEA 2XPKA 1PTGA 1S2AA 1IE7C 4R85A 1KO0A 4ZA0A 5HMDA 3NQ8A 3P80A 3PJUA 3AOFA 2QCDB 3OP2A 5ABFB 4PODA 3VDAA 4DUVA 1JDFA 4NNCA 5G4WA 3AC0A 1CGWA 4Z17A 3M0HA 4J4KA 1GVSA 4NAEB 1TB3A 1T99A 3O05A 4Q33A 1TUFA 2VJXA 3CQ0A 1IWAA 1AW5A 2BXVA 4KFPA 3K2GA 4BFAA 3KXQA 3R0KA 5CG0A 3KS6A 2VC9A 4LY4A 3C2RA 3VD7A 4PMXA 2F6KA 2QJNA 4RCXA 2X0SA 3NQVA 3RYSA 1QCWA 3WJYA 3MUAA 1IEWA 3B03A 1XLJA 4BI7A 1UIOA 3DYMA 3AYTA 4ZB2A 4JNMA 2IKIA 4O1BA 4E8CA 4MB1A 3PZTA 1J96A 4M5PA 3VE7A 1G7UA 1MXSA 3UPWA 3TTOA 5CCZA 3MCMA 1E5NA 3WELA 1IHIA 4UQAA 1U1UA 5J04A 4E2BA 2NV9A 2E40A 3LTPA 3MCNA 3CUIA 3PZQA 3V1HA 1H41A 3OHMB 1UWQA 1R9XA 4H6QA 2ZXBA 1UWUA 1VFOA 3AHYA 4OIFA 1H11A 2BGQA 3R79A 2OKTA 2QDGA 4I5UA 3L4VA 2UV8G 3A13A 3OGSA 4MTVA 1TJPA 3BG9A 3DFTA 4PULA 1UC5A 3UCQA 3W7PA 1L2UA 3HG3A 4BF9A 4AX7A 1W1PA 1Q45A 2DJXA 5HMSA 1HGWA 2VD9A 4LUTA 3W7IA 4GJIA 4IH3A 1GWJA 1F7BA 4DO7A 1RCOB 3T2QA 2B7QA 3ZT5A 2XZ9A 3L4YA 3MCOA 3PAOA 4P7RA 2XH0A 4WDXA 3CHVA 1JNEA 1EJWC 3RDKA 1FTXA 4LUIA 4Q4RA 5DQPA 4UBPC 4YWIA 5GJNA 1SPQA 4FIRA 1QPNA 2INFA 3UG5A 3M64A 3L4XA 4OT7A 4AAJA 1VHNA 1XX1A 2OWWA 3KDNA 1E51A 4J1OA 4BK9A 3EKLA 1KM1A 2CBUA 2PGWA 4KIEA 4RDYA 1T96A 4HHHA 4JTUA 1B3WA 4YTUA 1VFHA 3PSWA 2E5BA 3B8IA 4AVFA 1XR2A 3SCTA 2CBJA 1GVIA 1T6MA 2Y8KA 4P7LA 1XGEA 3BPWA 4LVGA 4QLLA 5I78A 4F3HA 4MKNA 1UD6A 1J0KA 5LIUX 4IIGA 1B5TA 1OYCA 3FJLA 3S5YA 3UPMA 4LYQA 2VX7A 3W28A 2ZRWA 4WEVX 2E7FA 1V79A 1UUQA 3EZ4A 3R12A 5BOFA 1JAEA 1QHZA 4NILA 1CGTA 3EXTA 1WCGA 3NCOA 1PKLA 4TX6A 2EPNA 4AD1A 5CGTA 2XFYA 2VYOA 1GOXA 2R6OA 1TTIA 4KEUA 3Q65A 4OE7A 2DT2A 3WDRA 3S2NA 4C7FA 3TIMA 3KL5A 4EOUA 3GLCA 1YEYA 3KUMA 3E49A 1R9YA 1H1YA 1TA3B 1UR1A 2GDVA 1EF2A 2FPYA 4LALA 4M24A 1ZALA 5DF0A 1TV8A 5BU9A 3S5SA 3LGEA 3C8FA 4AMCA 5I0DA 3B8SA 1DBTA 3VI2A 3CUHA 3HZ3A 3TYBA 3P14A 1AMKA 4HZ6A 4E3TA 3GH5A 4PUDA 3M7WA 3FEMA 1TJRA 2BB0A 3KP0A 4NNBA 4B5UA 1XICA 5A6BD 3B40A 3W01A 1Z9AA 3FJ6A 1FWJC 1GORA 2FDMA 2V82A 5KTLA 2O9RA 4HHLA 3VZYA 1IXOA 5LNWA 4EP8C 1GZJA 3A9IA 3M4HA 1RP9A 4C6JA 4DJFA 1FX6A 2J74A 1VB9A 2WZIA 4V33A 3OEXA 1G0CA 3AXHA 3RIKA 3NGJA 3W1XA 4AZGA 3BLEA 1R85A 1W9DM 4K2SA 2JE8A 4MLRA 3RR4A 1XINA 2OSWA 5EMMA 3M44A 4L5ZA 3BAXA 3ZO9A 1FWCC 1W54A 3S47A 4JAWA 1KR1A 4F0KA 4O18A 2PLMA 1EDTA 4QP0A 3N13A 3FA3A 3F5LA 1LT7A 1PKNA 4R7OA 5A2AA 4BA0A 4HGXA 5G2HA 2XM1A 4Q8PA 3KVKA 9XIAA 3NM3A 4ATWA 1PPIA 1K8ZA 5DMMA 1D8WA 1HN1A 5FD0A 3WBYA 2WO5A 3DAQA 2Q01A 5CJMA 1SVDA 3SW6A 3F4CA 1T8QA 3RRXA 2CEQA 1Y65A 3ZZ1A 3NYDA 3DGRA 2R91A 1ZJBA 2F8QA 3VZZA 1FWAC 1W3JA 1QW9A 1Q8AA 4LF1A 1XLLA 2C6QA 4H00A 3GYEA 4S3FA 1SM9A 1KB3A 5AZ1A 5G1TA 4FP1A 1FP9A 2ANUA 3CZ8A 3IIOA 1EGVA 3FKRA 2A4AA 5CQ1A 1DE5A 4WXYA 3RRAA 2RJHA 1S5NA 1EH9A 3ITLA 5IFPA 3IAPA 1HKJA 2GGEA 4DJDD 4MB4A 3L21A 5C0QA 1RJQA 5CAKA 3DU0A 3LM3A 3SUSA 1BGAA 1JYNA 3IJ8A 1EXBA 3BAIA 3WDHA 1DQUA 5D02A 5AC8A 2Q6ZA 3TNBA 1GUVA 3V35A 3OQEA 3LZ5A 4GZEA 1DORA 3LQGA 2DUXA 2PTXA 4M56A 4QITA 4NAFA 3UG3A 3HGRA 1J18A 1NOWA 3OQ8A 4E4PA 2FZNA 4EAMA 3GWQA 3M0IA 1E6RA 2CLOA 5EBAA 8A3HA 3KL3A 4IMFA 3SFKA 5FAGA 1QT1A 5HWJA 3TZNA 1F05A 3CB3A 3OA3A 2DSKA 2WVTA 1VBUA 2VX5A 1QWGA 4WGXA 1J11A 4W89A 3S1UA 1IXQA 4M1RA 3ZVHA 3O6CA 4HVXA 1YXDA 4UR8A 1E4IA 2NVDA 4WHBA 3TC3A 1E4MM 3FKKA 4DQWA 4Z2JA 3N1AA 3AU2A 1R30A 1VPQA 1CBGA 5CH9A 2G5WA 4MZ1A 3STFA 1FDYA 2P76A 4UTWA 2XVPA 2CZEA 1EZ2A 2X1RA 1HP5A 1NDYA 3BMXA 4OWGA 3HPXA 3J7HA 3MZ2A 1A3HA 4IL2A 1JZ7A 1TE6A 2I56A 4LNYA 4DNHA 3LV6A 2KX9A 5CG7A 3BDKA 4TIMA 1E6PA 2PA6A 1GKPA 3LGGA 1HXJA 1HKWA 2O56A 4Z1YA 4O4VA 3WDPP 2XISA 4PB5A 2DUAA 4KF1A 3H53A 3KRSA 2VVNA 3AYSA 4WQ6A 5CBIA 3DIPA 1C93A 2VTFA 1EIBA 1A53A 2UZ9A 3DFNA 2G4FA 2HCVA 4HPHA 3H7UA 3HO8A 5A6TC 2BY2A 4GQQA 3NG3A 4JN6A 4FXSA 3SGZA 3TR2A 4EPBC 1I8JA 4LRTA 1MQRA 3U5YA 3IUIA 3WLHA 5D8ZA 4ZL1A 4XBJA 4D6CA 3M5YA 4QHRA 3UR5A 4H9VA 2TMDA 2D2GA 3PTQA 1CZ1A 1ICPA 3LDVA 1TKKA 1V7YA 5D32A 2VVSA 1XW8A 4XD5A 4IOTA 4BI6A 1IT8A 4KEZA 1ISWA 1TR1A 4MJMA 4MLJA 1ONEA 2WZMA 4HD5A 1P0EA 2VWTA 4NYUA 1ICSA 2VFHA 4IGHA 2D20A 1FWEC 2O7QA 1M9HA 3P60A 3NPWA 3QQ1A 1A47A 3CZKA 5HPOA 1XISA 3QRHA 1XYFA 4S3GA 2V3EA 3ZJ6A 3TV8A 4Z08A 5E1QA 4KESA 2VZUA 4J9JA 4ZQMA 1C9DA 1O1HA 3G1FA 3SCNA 1FWRA 2BNJA 5FI8A 1FWDC 4FIQA 4UZSA 3TJLA 1G94A 3AS1A 3GNOA 4GY7A 4EVZA 2BBFA 3B0YA 4E8GA 5IXEA 2IS7A 5HBFA 3BCFA 3MA8A 3L0KA 3CMFA 2XWDA 4GWEA 3T44A 2TYSA 1UIPA 2WWDA 3UZXA 3MP5A 3UCCA 3NVTA 4H19A 2IXUA 4HNVA 1K70A 1UB3A 1S3TC 3W73A 1XQLA 4TV6A 1NF0A 2FZ8A 2RDWA 1KFLA 4DJEA 3GNXA 1M03A 2Q3RA 4AD3A 2XVKA 2X7WA 2HS6A 3OO2A 1Z32X 3R6IA 1I0BA 2BODX 1CIUA 3WFZA 3P8IA 2VX6A 4LBSA 5CPTA 1YQ2A 1HQTA 3FYOA 3MUY1 3H70A 2VZOA 1SJCA 4IM4A 4H01A 1VFFA 2B0MA 4S3EA 4L4OA 3IK2A 3O6DA 1FWGC 3GTNA 4ZXLA 1RZMA 3OIHA 2C13A 2GUUA 5ABHA 2YJQA 2OQYA 1J2BA 3HGOA 1Y0EA 1ISVA 4Q8TA 3WL0A 2WSRA 1H09A 5CLWA 4INFA 2YBUA 4RE0A 1V3HA 4GIYA 2YA1A 1F3XA 1O6IA 5DANA 3DDMA 1EEPA 2QCCA 4AF0B 3WNPA 4Q7IA 4B91A 2EJAA 3W02A 2OZ8A 3WF0A 5C55A 3PG9A 2Y7EA 2E8ZA 2FH8A 3MUIA 4P7QA 3S2CA 1ML1A 4GD0A 1ITCA 1OIMA 3TN4A 5H6HA 4POCA 2YFNA 3G24A 1XYZA 4AUBA 2C91A 4ORMA 1YHTA 4UTLA 1KLZA 1OFBA 4B3KA 1YBQA 3REQB 2WLZA 3AISA 1QPQA 1E9ZB 3DHPA 3HMCA 3CWOX 1A50A 1UBSA 4GVHA 3P2VA 3CLWA 1QI2A 4HHPA 4J7RA 4LC8A 3ARRA 1H49A 3C6CA 3SAZA 3LD5A 1PCWA 2J79A 3AS3A 3KCJA 2P0OA 1WX0A 2IPFA 1UJPA 1BYDA 1OADA 4GIEA 1V7AA 2PDMA 3BG3A 1OC7A 4HNUA 2DH2A 4BS0A 3VKAA 3LTSA 4RV3A 7TIMA 2PTZA 3CH0A 3EDFA 2YYUA 3LLXA 3AROA 1AFSA 4NZJA 2Z2AA 4M29A 1W37A 2SFPA 3CS2A 4ZGYA 3E0FA 1Q6LA 4GPNA 3EEGA 4D6FA 3W7QA 1W0MA 2VO5A 1XM3A 4JHOA 5AVHA 1X39A 2EPHA 3PULA 3WEMA 4HYRA 5A8MA 1BHGA 1IEQA 4W86A 1TJ1A 2VR5A 3DFQA 1N8IA 3T78A 1L2QA 1L0PA 1T8XA 2YIHA 1JPKA 3QY8A 1MEIA 1HKKA 3EB2A 1OFOA 3N2OA 3URNA 3VM5A 3THCA 3GFYA 4KERA 2EPLX 7REQA 2DIJA 1NM9A 5DEZA 2PF0A 3NGFA 4B92A 1P1MA 1K7EA 4ZCWA 4M6PA 2ZQ0A 2D2HA 4PTNA 4EXBA 5K7JA 2NUWA 4AEOA 4NJIA 1TYGA 2V30A 3TLQA 3UBPC 1RV8A 2W63A 2Q3OA 4Q8QA 1VFTA 1FY6A 3URBA 1W8SA 1F6PA 3TVAA 1PYMA 1EC7A 4TX9A 2E77A 1UWSA 2XVLA 1GJUA 3MSGA 4NJGA 2C7FA 4NZ3A 4LS2A 1P43A 3KZPA 1UYQA 4PEKA 5DLCA 4FI4A 2E67A 4JS3A 7XIMA 2V68A 2Z27A 3EWZA 2PP1A 3UEQA 3WH7A 1ONWA 3TH6A 4Q3MA 5CLTA 1JI2A 2VGFA 3SSJA 2XIQA 1EB3A 1VYRA 1MO0A 4LB4A 4UTFA 1EKOA 1YNPA 5JUVA 2AKZA 1SSGA 3Q45A 3W2KA 4MWAB 3RX3A 1WP6A 4R7JA 1QRQA 3RPMA 4JKKA 2IXVA 2V2HA 4P7NA 3LZ3A 1A5KC 1OG6A 5DT5A 3S83A 4O1AA 5EB8A 1P48A 1PXGA 3PZUA 4JQ3A 4DM1A 1XIJA 1U1HA 4EE9A 2Q8ZA 1K9TA 2XGIA 3H4WA 1IF2A 1XV8A 4LS1A 3K4WA 3TYCA 3I6EA 3ZVIA 2PP3A 3TYAA 1ZJAA 5HQLA 2Y7FA 2QPUA 3VDBA 7ODCA 3N6QA 1H7PA 1AQFA 1EPXA 2FKPA 5LGZA 2V5BA 3C2VA 2AQOA 2JKEA 1OCNA 2Q71A 4JFWA 3T55A 4FX7A 2BHUA 2WQPA 2HDJA 4MB3A 4J3WA 4QGCA 2W61A 3EOOA 3LRLA 4WVXA 3TYDA 2HPIA 2Q8LA 4GUIA 3GKFA 1IT0A 2XVGA 3AJXA 1XFBA 1Q6FA 4O50A 2OSXA 3GDMA 3WO8A 1I4NA 3O07A 1S2TA 4XWUA 3THAA 1UZ4A 1KTCA 4CLMA 3WK0A 4AYSA 2GQAA 3WDJA 4OTKA 3QFWA 1J0IA 1GK8A 5CC5A 1PHQA 2ZX9A 2OTDA 3BO9A 4GYFA 4Z2GA 3WD2A 4BCEA 5FESA 4EPEC 1H5YA 4F9JA 5JBEA 1WZMA 2BY3A 5DMNA 3R5EA 4CQAA 2YXOA 2DZVA 5K3VA 4A35A 3S9YA 4AISA 1RVKA 3U2EA 2XH4A 2FGLA 3UXIA 4CNTA 3LS9A 5IDZA 2QR6A 4XIMA 3V0TA 3A12A 2I9UA 5FIPA 3V18A 4RXFA 4IQJA 2PWGA 4M80A 4IXHA 4K3ZA 2QYGA 3W81A 1GEQA 3ES7A 3RXZA 4JTAA 2OPJA 5ENLA 4L64A 3W29A 1PIIA 2BHZA 3NWRA 4ZO9A 1QO5A 3NEHA 3SUUA 5FA5A 4GVIA 1UKPA 3MI6A 5MKGA 3G2GA 3QQWA 4ADTA 4BY3A 3I65A 1KFJA 1TPEA 2YCJA 1MDLA 3W00A 4B4HA 3GC5A 1RA0A 1YW1A 3CAKA 3LXAA 2OOFA 3RU8X 3I3DA 1TQJA 5JQ9A 3WMCA 4IT1A 4I9JA 1XIEA 1W1ZA 3B4UA 5CPSA 5C2GA 4F0LA 1OG0A 2WVUA 1ENUA 1J93A 1XDMA 4EK7A 3ARZA 1YPXA 2XH2A 1HP4A 4K38A 2IMRA 5K4ZA 1CX9A 3C4UA 3HURA 3IRSA 1DHPA 3EGJA 3UG8A 4GISA 5I6SA 4GC3A 2OMAA 2WKGA 5KZMA 3HQNA 3VKCA 3CIVA 1KC7A 4IPJA 4FXFA 1SFTA 3V36A 3C3NA 3V16A 1M41A 2HEJA 2E25A 2YL6A 3GRIA 4HNNA 5IHSA 3HGSA 2W67A 3IVSA 4AWSA 1KGUA 1HTIA 1K02A 2QAPA 4XBSA 3PJTA 1MRAA 4MY1A 2AGKA 4A8IA 4PEEA 4PZVA 2WBGA 3HN3A 4MG4A 1E6SM 2R1NA 2GDUA 2EG6A 2PDXA 3VCRA 3W6YA 2VQTA 4REQA 4AC7C 1KCLA 3E2QA 1EQCA 3F2CA 1Q65A 1XLHA 4JTCA 4FNSA 1SSDA 3EX1A 1XLCA 4MAVA 3VNDA 3M0LA 4JTRA 5HQEA 2BHYA 3ICJA 3BCDA 2DU2A 1QI4A 4I5RA 3FCPA 4K7YA 4DIAA 2E3ZA 4H6EA 3T42A 3U7VA 4F0MA 3O1NA 4LSBA 2YKKA 1R2RA 1M04A 3PANA 4C6OA 1GVYA 4CEXC 5ABFA 3PUOA 4ZMGA 1XBVA 1WZAA 2Y7GA 1R86A 1ONXA 4NAEA 4TO8A 2W0UA 1TV2A 4WJEA 5EBUA 2I1OA 1NP0A 1NTHA 4CU8A 3R0DA 2PWVA 4H7VA 3V5OA 3K30A 2OEKA 3OU8A 5D2XA 4I90A 5F1VA 3QOKA 5CC6A 4F0HA 5DFAA 1PX8A 1FXQA 1E4LA 1XYBA 4OUEA 4YTQA 3B0UX 1NFBA 4NKCA 2YBTA 1Q66A 2YB4A 1VENA 4DLMA 2HXTA 1E9IA 4MNKA 2FDSA 1EWDA 3EOEA 2CESA 5EFDA 1JDCA 3EMQA 1REQB 3MVIA 4UC5A 5HPCA 3WIJA 4A3RA 4QS5A 1OFDA 4RV8A 3N34A 1HG3A 4XZBA 1W9XA 2NWSA 3JR2A 1GQNA 4QG9A 3TQVA 1PYFA 5I23A 3U7BA 1B90A 3W1QA 1AH0A 2AGTA 3B0XA 3GAYA 3CYJA 1Z7AA 1TWIA 1G9HA 4B16A 3I3BA 3LOTA 1UWIA 3D3AA 4GIRA 4Q22A 4IG2B 5C70A 3QHOA 4AZHA 3QMRA 4H2CA 5CZTA 3W24A 4ZTXA 4QR6A 1VS1A 1W1TA 4UTIA 4Z0JA 2V81A 4ZR8A 3IJLA 3DI1A 3NPUA 2FTWA 3S2MA 1JVNA 2GZXA 3LQLA 2X09A 2GJNA 3DUGA 1EYWA 3K8KA 1E0WA 3L0GA 2BSLA 2W62A 4PCSA 3AICA 1XWYA 2O92A 1OZQA 3IJ6A 4UQDA 1VQTA 1TJ2A 4DI9A 3KAOA 2Z2UA 3R13A 2E68A 1AMYA 1P7TB 1Q6OA 2W91A 1DHKA 4HZMA 4XD6A 3LERA 1L6GA 2NX9A 3R2GA 4LGXA 1R9ZA 3WMBA 1I75A 1QK2A 3S0CA 3F7JA 2WMGA 4GUHA 1XG3A 3SCWA 2C1IA 2YX0A 2FHCA 4O11A 4ASTA 4RL3A 3RMJA 1B3OA 4ONVA 3N18A 4DF0A 4MADA 3SBFA 2F38A 4AEFA 4EANA 4Y6GA 5LKYA 1I2NA 1XLEA 4HCLA 3QFEA 4M7SA 1K7XA 4S2CA 4E6MA 2GVEA 1VGAA 4DJDA 4S3JA