3SFKA

Crystal structure of plasmodium falciparum dihydroorotate dehydrogenase bound with inhibitor dsm267
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
375
structure length
368
Chain Sequence
YNPEFFLYDIFLKFCLKYIDGEICHDLFLLLGKYNILPYDTSNDSIYACTNIKHLDFINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKVTENLILFRKRQEEDKLLSKHIVGVSIGKNKDTVNIVDDLKYCINKIGRYADYIAINVSSPNQEAGKLKNIILSVKEEIDNLEKNNIMNDEFLWFNTTKKKPLVFVKLAPDLNQEQKKEIADVLLETNIDGMIISNTTTQINDIKSFENKKGGVSGAKLKDISTKFICEMYNYTNKQIPIIASGGIFSGLDALEKIEAGASVCQLYSCLVFNGMKSAVQIKRELNHLLYQRGYYNLKEAIGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Lead Optimization of Triazolopyrimidine-Ring Substituents Identifies Potent Plasmodium falciparum Dihydroorotate Dehydrogenase Inhibitors with Clinical Candidate Potential.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
total genus 133
structure length 368
sequence length 375
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2011-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3sfkA00
2VELA 4N6FA 4GUFA 1IF2A 4XBKA 1JCMP 2Z0IA 3FOKA 4NNBA 2E77A 3W1QA 5BMWA 4XUGA 1EA0A 2ATSA 4GUHA 1I2PA 3P81A 5A8GA 3OEXA 5FF2A 1JCYA 4M7SA 3NQ8A 4XKYA 3GX9A 1G69A 3S1XA 1KM0A 3UWWA 3TAOA 5D38A 4EVZA 3OVRA 5CPMA 1TPUA 4LVBA 3HPZA 4XZ9A 3Q94A 1TJPA 3GDRA 1SR9A 1XBXA 1KM1A 4OQVA 1Q6RA 1FBAA 3TQVA 5FF4A 3HMJG 5C55A 3KRZA 2TYSA 3N34A 1R46A 2ZQ0A 1DKWA 1IIHA 3LGEA 1G4TA 3O07A 4Z1AA 3BW2A 2Q3RA 1O95A 2FJKA 4MY9A 4N9EA 3TR2A 1Q3NA 1VCVA 4JIQA 4MFEA 4NJGA 1WV2A 3GAKA 2AAMA 1A5CA 1EP1A 1GTHA 4TU1A 3KOFA 1D3GA 3OVPA 5KTLA 4O12A 4GUGA 2PURA 3DAQA 2UV8G 1TIMA 4TO8A 5U4NA 1BWLA 4EF8A 1B4EA 3UY8A 5EYWA 1W3TA 5G1YA 1AW1A 5FI8A 4MZYA 3HGOA 1W5PA 5C6MA 4IMCA 3W84A 5L9FA 3NM3A 3KX6A 3UWZA 1D3HA 1X1OA 3L2IA 5EA9A 1H62A 5LNWA 3WJXA 1QPOA 1H51A 3BGGA 4M6QA 1O4UA 3BVJA 3M0ZA 4MY1A 4UC5A 2W6RA 3PAJA 4GUIA 3HG3A 3IIPA 4O53A 4JS3A 4CQAA 2OT1A 1IXNA 1Z41A 5IBXA 3TMQA 1SFLA 4MIMA 2GJNA 2V8ZA 1DORA 4FX6M 3UQNA 3UWUA 3TUUA 1HFBA 3A23A 3B0PA 4N02A 4FIRA 2V2DA 1RR2A 1KFJA 1GVOA 1P0NA 4JTIA 1I8JA 4FX7A 3TQKA 3OBKA 1H1ZA 4WY0F 5E0KA 3P61A 2HTMA 3T55A 3FFSA 4JYFA 1L6YA 2X30A 1KLYA 4ZQRA 3LCWA 3O6DA 1LOSA 2H3DA 5AN7A 4OT7A 4RLIA 3SIZA 2ZZ5A 4LV4A 3EX2A 4TMBA 4BI5A 3SZ8A 2NUWA 3WK0A 4MLRA 4RX0A 1FWNA 1J2WA 1U5JA 2EAWA 1OF6A 3SECA 4ZQPA 3C2FA 2QCNA 4KWWA 3PM6A 1CX9A 4LRSA 1UJPA 5D30A 2DZXA 1P0KA 5CGQA 3P8IA 4UTWA 4RCXA 1Z42A 3OIXA 3W7LA 3NR0A 3GXNA 2C15A 3EKZA 2B7NA 2NXGA 4Q4KA 2WJZA 5F4XA 3TAKA 3KRUA 4HNUA 4NX5A 3CT7A 3NQVA 3W7IA 3K30A 1HO4A 5BW6A 3SJ3A 5G1TA 3UXAA 3MHGA 2NUXA 4LS2A 3F1QA 1KBJA 2ISWA 4MPQA 4JTEA 3YPIA 3WFAA 4DPQA 3CHVA 4UIOA 3ELFA 2VOMA 4N9CA 1OG0A 1U83A 2VKZG 2PRMA 4CNOA 4QISA 3BARA 1HG3A 5KSWA 2E68A 4BWLC 1OK6A 4E0CA 3W7NA 1OYBA 3G0SA 4FXSA 2WSRA 3UWQA 2BTMA 2HMCA 3ABRA 1R47A 4JDBA 1O94A 4FF7A 4BI6A 1DQXA 4J9JA 1H7RA 3W1NA 7TIMA 4O0KA 3S0CA 2QUUA 2QKFA 2NV2A 3M41A 3WK1A 2H8XA 3G1HA 3E49A 3CB8A 2FQIA 1M7PA 3HB9A 2NX9A 3MBDA 2RDTA 3EXSA 2J88A 3G24A 3A5FA 3KVKA 3TXVA 2QDGA 1FWWA 3BG9A 2BX7A 5KITA 3NGJA 2C1HA 3IVTA 3MHFA 1SZEA 2CFFA 3G22A 4YCOA 2VFFA 4X2RA 4MZ8A 1W54A 1Z44A 3IGXA 2ZRYA 4UR7A 3TKFA 4QIUA 3GDTA 4CLMA 1KV5A 4N9DA 4FB7A 3G1SA 3M6YA 4OWGA 1H7XA 4ICNA 4C1KA 2QJHA 5FEWA 3W86A 2FFCA 5CPOA 1EPXA 2TMDA 2BSLA 5D2XA 2FLIA 3QRHA 1QNVA 1XBYA 2FB2A 3GLCA 4ZMGA 4Q32A 2W79A 2ZFAA 1YYAA 1H7OA 3FYPA 4LC6A 3LCGA 3R13A 3MJYA 3NDOA 2E1DA 3W7DA 2V9DA 3W76A 1KFLA 1ONRA 4UFHA 3W75A 3B8DA 1X6UA 2NXIA 3FIGA 2NX3A 1YPFA 3WJWA 3N2MA 3NZRA 1G4PA 5D37A 1ZFJA 1EP2A 2GQ9A 5TIMA 1JQXA 3MP5A 2CWNA 1OFDA 1ICPA 3W23A 4MJMA 4OV9A 3G1AA 3NAVA 3W2NA 4RR4A 3IGSA 2E6FA 4ADTA 1TREA 2HS6A 2A21A 1S3HA 3BV4A 3IV3A 3LM7A 2J24A 2GUUA 4MYXA 2QCLA 3P7YA 1RD5A 4N9BA 2GQAA 3GNDA 3Q37A 4LW7A 4FNSA 1UUMA 4X3ZA 1NAL1 3AJXA 3CQ0A 3W9ZA 2Z6IA 1F2JA 3G0XA 4UCGA 1QO5A 1J4EA 1FQ0A 2VFEA 1QAPA 3MUXA 4MJZA 2WNNA 2C6QA 3ANYA 3DGRA 3S5YA 2AGKA 4UTIA 1YDNA 1JVNA 2RHGA 1LRQA 4MLJA 3QH2A 2CW6A 1K7FA 5LNRA 4O1CA 2CLFA 4UFJA 3L0KA 1P1XA 2NWSA 1IXPA 2WO5A 3DZ1A 5FEXA 5J5RA 4YCPA 3KVJA 1TPH1 1X1ZA 4K37A 3A24A 2ZA1A 4LVGA 3LV6A 3W7PA 3P62A 1W3IA 3BPWA 4O54A 5G2IA 3W7CA 1RPXA 2Y7EA 3W2MA 4AH7A 2A85A 3CIWA 3TA6A 2ATMA 1MO0A 2WKJA 3HJZA 3O05A 4K39A 3E0IA 3LV5A 3EKLA 1FUYA 4I9AA 4CNPA 3HPSA 3BW4A 1ZNNA 2CLEA 4IPIA 2JKAA 4S1FA 3NPXA 3UD6A 1R2TA 1GPWA 1H7NA 1QPQA 3HG5A 1QO2A 2WOQA 1KM6A 1DVJA 3M47A 1J5TA 1GG0A 3CWOX 3QW3A 1FCQA 3NQAA 4ZZ9A 2OCZA 3G1XA 5I3KA 1A5SA 3DFOA 3LTPA 1AW5A 3B06A 2YPIA 2Y62A 3QMSA 1MEHA 2CLOA 1ZALA 2Z6JA 4NXSA 1SZFA 1VS1A 2B7OA 3W1PA 5D2YA 3W7JA 2V2HA 1WDWA 1W31A 4QQ3A 4M7TA 4IJBA 3NG3A 3TDFA 3WJZA 1TTIA 2JBMA 2F84A 3QF0A 3SY5A 1H7WA 3LCLA 2PRLA 3MMTA 2ZZ3A 3G1DA 2WQPA 4CCCA 2GVLA 2KZHA 4UFMA 1RQHA 4UNLA 5EKYA 3B0VC 3DI0A 5K4XA 3CU2A 1TPB1 1OFAA 4HHPA 2ABAA 1JUKA 1NEYA 3BG5A 1EWDA 4ZVJA 1I2RA 3W7RA 1ZENA 2WNQA 5EY5A 3RFAA 3QMTA 3PUDA 2A6LA 4YXGA 3E9AA 3USBA 4O19A 1FCVA 4Y90A 1SO4A 2Y6ZA 3W7QA 1VCFA 1QR7A 2WV8A 4WOZA 3I68A 5KZEA 3IVUA 2G5WA 3IRDA 3PBYA 1VJIA 2CLMA 1RQBA 2OJPA 3MHUA 2CLKA 5CZTA 2RKXA 5AC8A 1QOPA 3TSMA 4N4QA 3CTLA 3LRKA 1QPRA 5BMXA 5A5WA 3LLFA 3KAOA 5TQLA 4BK9A 2X1UA 4I7VA 4BF9A 3NPUA 1I45A 4NQ1A 1H63A 1BTMA 1SO5A 2GVGA 5DBTA 3W2KA 1W5MA 3LBCA 2V2CA 1CI1A 2V81A 1H7PA 3TROA 3NQ7A 1W37A 1ZCOA 1LROA 5K7JA 2ABBA 5EMUA 1S5TA 3HBLA 1KW1A 4NUWA 1KA9F 3T78A 3NQFA 4AWUA 1LORA 5ABTA 4IMEA 3EWZA 5IBXC 2WNZA 4PFMA 5K9DA 4CQ8A 4ORIA 3MP4A 1H50A 3T4CA 1KFBA 3P8JA 3VKJA 1VHCA 3F4NA 3NQ2A 3OHIA 5DN1A 4R53A 4POCA 5HNRA 3EEGA 3PBWA 4CCEA 4JDYA 4UTHA 3C2RA 3GVGA 3VNDA 3ATZA 3QFEA 1KM4A 3SI9A 1TMHA 4AMAA 3M5YA 4AVFA 3D0CA 3W71A 1TPFA 3O8AA 4HNVA 1JULA 2EGZA 2ZA3A 3FS2A 4LUIA 5E1QA 4R33A 3N9SA 1I4NA 1O5KA 4XTDA 2FPTA 1ME7A 1XFBA 4KFOA 2QEZA 4JD4A 4A22A 1A50A 1G67A 1BKSA 1GOXA 3G0UA 2VXNA 3BLEA 3TIMA 2A7NA 4NU7A 3LHWA 5CZSA 1DOSA 3QSRA 1GQNA 3W7KA 1G4SA 2QCGA 4Z1CA 3M5XA 5G4WA 1Q45A 4LRTA 3L21A 3LERA 4JN6A 4IMFA 4K6AA 3W22A 5LHEA 5AHLA 4Y6GA 3GKFA 1OHLA 3NA8A 4PL2A 2ISSA 3LCXA 4FNRA 1FDJA 3L67A 4HKPA 1P5BA 3GDMA 4UFKA 4DF2A 3THAA 2DZUA 2QUVA 3PBVA 1TCDA 1FXQA 1YDOA 2NWRA 2C18A 4XWUA 2RDWA 2CU0A 4U28A 3L9CA 3NQEA 3NVTA 4Y8FA 3TX9A 1K8YA 3SSJA 1R30A 1ZAIA 4UMAA 3H54A 5GVJA 3EX3A 3EWXA 1AL8A 4LC8A 1SZNA 2FPVA 5HWNA 3IVSA 4RKAA 4RXGA 1TO3A 3LCFA 4GC4A 3R12A 3TJLA 3PG9A 5E93A 4UMCA 1PVNA 2ALDA 5AYXA 1Q6OA 3P5ZA 4U4MA 2VENA 5AOUA 1FXPA 4UTKA 1VRDA 1LDCA 3NZ1A 3N19B 3IIVA 5CZ0A 2V5LA 4UNKA 2YW3A 3PF3A 5TBOA 1W8SA 3S9YA 1NF0A 3LHVA 2R8WA 4GE8A 4ALDA 1ME9A 1TTPA 1TTJA 5LSMA 5CPNA 3DHFA 3EWUA 5I3GA 4UTTC 2Y70A 3S5NA 2DZSA 4N6EA 1O60A 4IQLA 1XCFA 1GG1A 1XUUA 3HF3A 1ZHAA 2ZTJA 1JCXA 3PB0A 5HINA 1GWJA 4FNPA 1OVDA 3W7MA 5G4EA 2G97A 2GOUA 5LNSA 2DJLA 4AF0B 1W0MA 1PCWA 3DFNA 4LTSA 5K2ZA 2O7QA 1HL2A 3S5OA 2XN0A 1Y0EA 1ZAJA 2NZLA 5EPDA 5AC7A 2C0AA 4CCDA 4O4VA 1LCOA 5C54A 4IOTA 4GJ1A 2Y61A 1EX5A 3L0GA 3HG2A 2R94A 3UPWA 3ZWTA 2V30A 3NPWA 1ADOA 1JRCA 3BGJA 1JRBA 2YR1A 4RV8A 4GUJA 4MFDA 2QCHA 2WSYA 3QSTA 1YADA 3GNNA 3HO8A 2OX1A 4DO6A 4UFIA 2Q3OA 5I3JA 4DO4A 5LNUA 1H61A 1ZJIA 1TQXA 4O18A 5MHBA 1VQTA 3NQ6A 5K9CA 2QR6A 4OBTA 3LRMA 1XKYA 4UTLA 3G3MA 2G95A 4KWVA 3PS7A 5F2IA 4DBDA 4YLWA 3VE7A 4RZ6A 1M6JA 5F1UA 2VFIA 1GYLA 3KFTA 3LCIA 4MOZA 4N4PA 3W1UA 1YXDA 3G1VA 3W74A 4PA8A 1TPC1 1W56A 2CLHA 4MKNA 1OFBA 3DXIA 4AXKA 4H6KA 3C52A 3TQ0A 5J5DA 1QOQA 5LHFA 3P84A 3IEBA 3QYQA 4BWLA 1WX0A 1N7KA 1IIGA 2FDSA 3QPZA 2DZTA 1PL9A 3CEUA 4FNUA 1W5QA 3HIJA 6ALDA 4GRSA 4ZQMA 4ADUA 1LLWA 3QC3A 1SUXA 3IGUA 4FO4A 4QNWA 1SFJA 4JYEA 3PSVA 1F74A 4TIMA 2QCDB 4JIPA 2EHHA 1OJXA 4DBEA 4M6PA 1H60A 3N14A 4QNEA 3STCA 2VC6A 4ADSA 5D05A 1JCLA 5AC6A 5AHIA 3SGZA 3TW6A 4HPXA 4QM1A 4UTMA 3FKKA 4CQ9A 2WSQA 1I2NA 3W1XA 4AF0A 1VLIA 4HSNA 4EF9A 5CG7A 4QITA 3GR8A 1OX4A 4ONVA 4K7YA 3S1WA 2E5CA 1GVSA 1NVMA 3A5VA 4JY8A 4YL2A 4O57A 3NQCA 3CIXA 1A5AA 3HGSA 1KM5A 1SSGA 3TFXA 3T40A 3E02A 3V75A 4B5NA 4JTSA 3CPRA 1PV8A 2VFHA 2YFOA 3ZFHA 3BW3A 1YLVA 4WY0B 4UMBA 1B4KA 3ABSA 3GXPA 4W9TA 3IIXA 1KBIA 3QQ0A 1I2OA 3VFLA 5D04C 5F2MA 5T26A 3TSDA 4NJKA 1MXSA 3M43A 3M5VA 5D32A 3P80A 4G1KA 2E6YA 2I9EA 3TMLA 2VEKA 2A7RA 3G18A 5DXYA 1XDMA 1MEIA 3OVQA 4DEFA 2F7FA 1TB3A 3C6CA 2FB3A 3T7VA 3EWBX 3STEA 4ZQNA 4M6VA 1UB3A 1IXQA 1RZMA 4O11A 1OYAA 1SSDA 2GPTA 4O13A 2E6DA 1G7VA 4IMGA 4NJIA 4O15A 1GEQA 3BG3A 1WBHA 4NZJA 5HWJA 4GNJA 4PTNA 5LNVA 3A21A 3W07A 3U6WA 3UYCA 3GK0A 1SZGA 2YXGA 1OYCA 3L5LA 4MVAA 5HUPA 3TJXA 3CM4A 2JK2A 5I3HA 4AB4A 1T8XA 4WZHA 2YYTA 3EX6A 4AWTA 1F5ZA 3WK3A 3OA3A 4JTTA 1S5VA 3BO9A 1KTCA 4IPJA 1SW3A 3NPVA 3L66A 1XDLA 3WK2A 1UUOA 5SWUA 1TV7A 2FIQA 1K03A 3FJLA 2DZWA 1JUEA 5D2TA 2JKPA 2QCFA 2C3ZA 5H91A 4QAIA 2QCEA 1XUZA 4P61A 5DLCA 4HIBA 1QMLA 4RZ4A 2QCMA 3TV8A 3DFPA 3TC7A 4NZFA 1GTEA 3I65A 1X8FA 3LDVA 3UWYA 2YGYA 4PH6A 5FF0A 3R8RA 3LCHA 4LS1A 2ZZ1A 3O63A 2R14A 3MI2A 4O52A 1TPEA 5LZLA 4WY0A 3I7RA 1B9BA 3C56A 5F1VA 3W7EA 1OX4B 3W85A 4O10A 3S6DA 2QJIA 1EEPA 3M7WA 1TQJA 3QJAA 3DBPA 4HNNA 3HOJA 1FCBA 3W2UA 4JGDA 1K7EA 3HQ1A 3ZR4A 5CSRA 2BZNA 1KTBA 1NSJA 3DH7A 2P10A 5BOOA 2OZ0A 4TX9A 3F03K 4Z08A 2DP3A 1FDZA 2YSWA 1MZHA 3W2LA 4YMZA 1DJNA 3G8EA 4BI7A 3TU9A 2EF9A 3TW7A 3EWWA 3ABQA 4HT3A 1DQWA 1FDYA 3PC0A 2NLIA 1ICQA 2B7PA 2BXVA 2YZRA 3QEZA 1YXYA 3DI1A 3C2VA 4MUZA 4NXKA 2YDAA 1L9WA 1TTQA 3N2XA 1F6PA 1SO3A 1TPVA 1SQ7A 2X16A 3C2OA 4JTLA 2FPYA 3BLFA 4BR1A 1UCWA 1QPNA 4LY8A 1VPXA 1KFEA 3KHJA 5HJLA 4WJEA 1FX6A 5DCDA 1XI3A 1CW2A 3G1YA 1LBMA 3C61A 1RV8A 4PCFA 4L4MA 3LXCA 1TV8A 1OX6A 3PY2A 4Z0JA 3G8RA 3LHUA 3GKAA 3UZJA 4EWND 1IXOA 3GDKA 4JYDA 1SU5A 3C0JA 4YWIA 3EX4A 2H90A 3I7SA 1DV7A 1E51A 3STGA 1M7OA 1FY6A 3I7QA 1SW7A 6TIMA 1OFPA 2ZZ7A 1W1ZA 3MO7A 3NM1A 4JNMA 3F4WA 2GVJA 3P60A 4XBSA 2YYUA 2A2IA 2Y63A 3LI0A 3S5ZA 1TPWA 1H5YA 5AB3A 2YW4A 2I1OA 5HULA 1NFBA 5KMYA 3HGRA 5DXXA 2B7QA 3INPA 5FEZA 1JQVA 2X1TA 5DCEA 2DORA 3W2JA 3PSWA 3THQA 1FWRA 3FJ6A 1KFKA 5AFDA 1SPQA 3NL5A 3E96A 1LBLA 1VHNA 4LVFA 2JGYA 2QCCA 1KTNA 1TYGA 4TMCA 2Y7GA 5AHFA 4DF1A 4UUIA 3KRSA 5D33A 4N2YA 1O5XA 5F2GA 3UXDA 1TV5A 5U7SA 2QF7A 2Q8LA 3GR7A 1SO6A 1EUAA 3W1RA 3FLUA 4FNQA 1EUNA 4XTIA 4A3UA 3LI1A 1GYNA 2Y85A 3HPXA 3W3OA 3QM3A 1DHPA 3JS3A 4S2CA 2WPBA 4AAJA 3DFTA 3P82A 1TJRA 4X9SA 4FX8A 1RQEA 3A9IA 4A2SA 4JXCA 3UZ5A 1T0OA 3W1MA 2P1FA 1OFQA 4DQWA 4WUIA 3LTSA 3MYPA 4MZ1A 1F05A 3W7HA 1LOQA 4WXYA 1T96A 1MSSA 3BK0A 3UWVA 2Y89A 3L68A 2E6AA 3MP3A 4UFLA 2AQWA 4O0ZA 1G4EA 3M1ZA 4DXVA 2DU2A 1OK4A 1FCUA 4Y96A 4K38A 4AHOA 1VYSX 2ZZ6A 3R89A 3W88A 3C3NA 3TFCA 1N8FA 2IQTA 2VFGA 3RNDA 3NL2A 1ME8A 3PUEA 4H3DA 4OV4A 4GBUA 3RU6A 1VR6A 4XQ6A 4O14A 1K8ZA 2YFNA 2J9ZA 2ZZ4A 1EIXA 2A0NA 4KKXA 2A6NA 1ZAHA 3O6CA 2CZ5A 2PRHA 3PULA 1AG1O 3NO5A 4JY9A 4JTHA 2C13A 1P4CA 2E09A 4RK8A 3LBMA 3M9YA 3STFA 4RZ5A 4K36A 3RLUA 3S1UA 1QDSA 1YDVA 3TXZA 1WBJA 3EX1A 3PWAA 4FIQA 3W1LA 1C29A 3OG3A 1V7YA 5L6UA 4JX6A 3SW6A 3LHTA 4AWSA 2QJGA 1C9DA 4LV9A 4C1LA 3LOTA 3CWNA 3SR7A 1Q6QA 2QUTA 4WOQA 3NQMA 5G5IA 3TH6A 2A5HA 2RDUA 2H3BA 4IXHA 4GWEA 4I7WA 2CLLA 4M19A 2V0TA 1GJPA 3ABOA 4PODA 4JX5A 1THFD 4LVAA 4OHQA 1B3OA 4WQ6A 4FXRA 4ZQOA 2QAPA 4HNTA 3NL6A 4A21A 4QJ1A 4L4LA 4S2BA 1Z48A 1LRNA 2NXHA 2FTPA 4LNYA 2CZDA 4AEOA 4ML9A 4A29A 1VGAA 4OE7A 1EWEA 5AHEA 4M5PA 3MBFA 1AMKA 5CPLA 1VH7A 1XXXA 1LYXA 2V5BA 3O1NA 3JR2A 3QW4B 3I6RA 1XBVA 5IM51 3CC1A 3DHDA 2EKCA 2Y88A 3W7GA 1L2UA 2EPHA 1ICSA 4UR8A 1S5WA 1YPIA 3RMJA 3W7OA 3N73A 1TPDA 2C16A 3GXTA 5G2WA 5H2ZA 3DFQA 3HG4A 1OFEA 3EXTA 2BWGA 5AHMA 1JCJA 1X7FA 4Z1DA 4JTJA 2A4AA 1ALDA 3L65A 3LHZA 1WA3A 4MYAA 1WQ5A 1AL7A 3V1PA 3LXAA 4HN4A 2C19A 5EBUA 1YTEA 1V5XA 2J6XA 5FF7A 3QQ1A 1PE1A 4O1BA 5D2WA 4FEZA 2NUYA 3LX9A 4ORMA 3G3DA 2H6RA 3P74A 4ZL1A 4IX0A 4NVTA 4O1DA 1WAUA 1JCNA 3ZS4A 4AHQA 4R7JA 4PEKA 4NX0A 3FA5A 1EP3A 2OMAA 2NV1A 5DELA 1R2RA 1LLZA 1W5OA 2ZRUA 3KVLA 3A22A 1UASA 4FNTA 3RK8A 4JTUA 3L5MA 1PS9A 4K7VA 3PUOA 3O15A 1AW2A 3NQDA 3EB2A 4IUOA 3GAYA 3NYZA 4O8RA 1LZOA 1D9EA 4IX2A 4O17A 1B57A 2VFDA 3NXFA 4O4WA 3TNOA 4UTTA 4O28A 2HSAA 4WX2A 5DBUA 5HR6A 1PHWA 3O6YX 5HWMA 1F76A 2ZDRA 1XC4A 4NT0A 3T44A 8TIMA 3B03A 1OABA 3WJSA 5C2XA 3W6YA 3DFSA 4LWWA 1L6WA 1YTKA 3W72A 5K3VA 2ZBTA 4NNCA 3ZWSA 3PB2A 3S1VA 3BLIA 2ZCGA 1TRIA 5K9XA 2TPSA 3S8HA 1DL3A 3LB0A 3UPBA 1G6CA 1WYIA 1BEUA 5I3FA 4LVDA 5I3IA 1AK5A 4RXFA 4JTFA 1NF7A 3IIOA 3M16A 1SW0A 5HR7A 1GZGA 3M5ZA 3KXQA 4BFAA 3NNTA 1DBTA 3N3MA 4GXMA 1W5NA 5DY2A 2QDHA 1LOLA 4KFNA 1JJKA 2NX1A 2Z1BA 1LRTA 4WXZA 4A2RA 1KFCA 1LM1A 3S42A 4FHAA 2A1YA 3TCEA 2A7PA 4O16A 5CKSA 2I14A 3DKLA 1XL9A 3TE9A 3U8GA 3NL3A 1L6SA 3HGJA 2RH9A 2TSYA 3VE9A 5BNKA 1UBSA 4PL1A 4D2JA 1KLZA 2J9XA 5D09A 3QMRA 3IIZA 2XN2A 2J9YA 4P2VA 2CZFA 5BRBA 3NQGA 1GVFA 2BLEA 5FEPA 1FWTA 2GQ8A 4NJJA 3MWAA 4X22A 3DENA 4MY8A 1QFEA 2XN1A 2ZRWA 2DJXA 1XM3A 4DELA 2ZRVA 4HSOA 2OT0A 3DU0A 3C8FA 3GZ3A 1VLWA 2ZRZA 2YCEA 1OX5A 2X1RA 1DJQA 2ZTKA 4QSHA 1LBFA 3O16A 1K8XA 3W73A 4EOUA 4UTJA 3UNDA 5HQEA 3MYOA 4KFPA 5CSSA 5D03A 4OU1A 4DPPA 2LLEA 1IGSA 3LLDA 4I7UA 4DF0A 2G96A 1OFRA 2Y7DA 1WOAA 2Q8ZA 3Q2DA 2B0MA 3GB6A 3Q58A 4OGZA 1H1YA 4JEQA 1KV8A 3FYOA 5KINA 1MEWA 3ATYA 3N9RA 1XBZA 1K02A 2VEPA 5F4WA 1JUBA 1VZWA 1TSIA 2ZA2A 4K8HA 1WOBA 3H53A 3EXRA 5AHNA 3B0UX 4JTGA 2XFWA 2V82A 3GYEA 2P0OA 2VEIA 1F6KA 3WJYA 3W87A 4LT9A 5HUOA 3DKJA 4LUJA 5D2VA 3RF9A 2C14A 3LRLA 2GJLA 3M44A 3UY7A 3AO0A 4XKYB 3TC6A 1LTDA 3FEMA 3W1TA 5G2HA 3QZEA 1PIIA 3RLVA 3PBUA 2X2GA 1VC4A 1C8VA 4AHPA 5C5YA 4EIVA 5LKYA 3CEPA 1R2SA 2DZPA 3NEVA 3SGUA 1OF8A 1YXCA 3MW7A 5FF3A 2ZRXA 2QCDA 4E2DA 4IXXA 4UTUA 1A5BA 2PE4A 3VCRA 1W3NA 2CLIA 2DZVA 1F73A 2O7SA 2Y7FA 4JICA 3C4UA 3B04A 3R5EA 5CZJA 2PC4A 1K3UA 4WD0A 4H4IA 1JR1A 3W1AA 3O06A 1PHQA 5EL1A 3W70A 1BWKA 4GFSA 3E12A 1ZY9A 5KZDA 4CNNA 1HO1A 4ZQCA 1M5WA 1RVGA 4HPJA 4Z0SA 3TK7A 2PCQA 5LGXA 4NJHA 5HMSA 1T99A 1VCGA 1TRDA 1WXJA 2W0UA 2HS8A 3LHYA 4LOCA 2E5BA 3FKRA 3W83A 4JTKA 4UXDA 1ML1A 4DO5A 1N55A 1GVQA 2B4GA 2E5DA 3H55A 2R91A 5D02A 1EB3A 5K4ZA 1VYRA 5LGZA 1K7XA 1Q6LA 1PCKA 3JRKA 4LS0A 2D73A 4IGHA 3GDLA 1VYPX 3LTYA 1OFOA 1I2QA 3SFKA 3R2GA 4E2BA 2VEMA 1GVRA 4R34A 1KM2A 4PC8A 5AYYA 2ZYFA 3P5YA 4LU0A 4Y9AA 3GIYA 3B4UA 2J27A 4O1AA 5DY3A 3C2EA 3P67A 3KVMA 3L5AA 5AYZA 4K8EA 1QCWA 1QWGA 3B05A 3MI3A 4JR5A 1G7UA 1KM3A 4TR9A 3VI2A 2ISVA 2JKEA 5F4SA 3PR2A 1A53A 3PG8A 2CZEA 2RFGA 2TRSA 4NNAA 4UTWC 1HUVA 5KZMA 2Z2UA 4IWWA 4JX4A 1HTIA 4RJEA 5F2LA 5FESA 3CLMA 1F7BA 3PVFA 2ZZ2A 4Q33A 1FWSA 2QAFA 2H8ZA 3MI6A 5DCBA 4Z1BA 3EWYA 4IMDA 2X1SA 2JGQA 3LXBA 2YX0A 1LP6A 3L0NA 3NOEA 3U2OA 3TSBA 3G1FA 1GT8A 4E38A 3QPYA 1YTDA 4O50A
chains in the Genus database with same CATH superfamily
3GTIA 1IF2A 4UZSA 3FOKA 4TTUA 1TELA 2ATSA 3OQEA 1ZTVA 1FTXA 3GX9A 1G69A 2F38A 4LFYA 4HJFA 3UWWA 5D38A 2Z4GA 4LVBA 3N4AA 4QXIA 1OB0A 1TJPA 3NO1A 1SR9A 4QBXA 3D6NA 1PKNA 4DZAA 1E1EA 4ES4A 3WY1A 4Z2GA 1R85A 2ZUTA 3RHGA 1RHCA 2PGFA 2TYSA 2KX9A 3PZOA 1E5JA 4IH3A 2WM1A 3O07A 2VMFA 3UJSA 1OGGA 4MY9A 3E38A 2OVLA 4MFEA 4NJGA 1WV2A 3U4AA 5HNNA 1A5CA 3LGGA 4O8AA 2IKGA 4TU1A 3KOFA 1MXDA 5KTLA 3CUHA 4J40A 2AQOA 1KGXA 4KESA 1P6WA 4LJ3A 4AZ7A 1N2VA 1VFSA 1B4EA 3UY8A 1W3TA 5G1YA 5FI8A 7PTDA 1W5PA 2DW7A 4YN5A 5C6MA 4IMCA 2PEVA 3IUDA 3I3DA 1WDPA 2OG9A 3K8MA 4M6QA 4GYJA 1XSKA 2VD8A 3PAJA 4KCVA 3AUOA 4B5WA 3HG3A 4O53A 2HV5A 5HMFA 1IXNA 1IZKA 1SFLA 2QVNA 4MIMA 3OYZA 4HTBA 1OCQA 4FX6M 1UD2A 1P43A 3UWUA 3TUUA 4ZB5A 2V2DA 1RR2A 1T8QA 3CLWA 4KCWA 1H1ZA 1UA7A 3P61A 3RUBL 4QTGA 5CSYA 5C9XA 4JQ3A 3MV11 3AXKA 3PFMA 4ZQRA 3O6DA 5AN7A 3PJXA 4OT7A 4J7RA 4RLIA 3OGRA 4IIHA 4RW3A 1J8VA 4LV4A 3EX2A 6CGTA 1OT2A 4CKQA 1NY1A 4Z1YA 3VNLA 4RX0A 5MF5A 1U5JA 1LUCB 3LMZA 2EAWA 3QBUA 3C2FA 3H2NA 3PM6A 3WMSA 1A5NC 5CGQA 2DSUA 1K4HA 3KW3A 3TJIA 4ICCX 3WG6A 1DJYA 3EKZA 5HJXA 3HFYA 3TAKA 3KRUA 1HIZA 4OIFA 2C8NA 3CO8A 3IAPA 2AQVA 4GH3A 1O6IA 3AJ7A 4NI3A 3WELA 4FMVA 2AL2B 2FZNA 5G1TA 2NUXA 1GUVA 2EPNA 4GCAA 1QVBA 1O68A 4YTQA 3LMYA 4DPQA 3OLIA 5EMMA 4H9UA 1EO5A 1GCYA 3UXKA 3R10A 4FSAA 3HMCA 3L4UA 4ERGA 2PRMA 2BVTA 5DFAA 2V68A 4B91A 1E6XM 4L1XA 5I2UA 4BWLC 4E0CA 4AZCB 4PMDA 3G0SA 4FXSA 2WSRA 1Z7AA 4RNIA 3RGTA 8XIMA 1R47A 1US0A 1O94A 4FF7A 4BI6A 5HXMA 3GS6A 3T09A 3W1NA 7TIMA 4O0KA 3S0CA 2QKFA 4EANA 2Y1HA 3KL5A 3G1HA 2FQIA 3BDKA 3MBDA 1UZDA 1XIJA 3K4AA 4HNCA 4J1OA 1J01A 2QXWA 2QDGA 3BG9A 1CLVA 3IVTA 5DRCA 2ONEA 2VFFA 3AHVA 1VD6A 1UPPA 3A6OA 4X63A 3MV01 1Z44A 1ZBKA 3TLQA 1AJ2A 1IWPA 2ZRYA 4UR7A 3GDTA 4P8UA 1KV5A 3R0KA 3M6YA 6XIMA 1H7XA 4C1KA 3K2GA 1I0DA 2FFCA 3S2LA 5BXPA 4DJED 4FALA 4Q32A 2W79A 2ZFAA 1PIFA 1H7OA 3LCGA 3R13A 4GVHA 2Y4SA 4HMCA 3W7DA 2V9DA 4MF4A 1ONRA 4UFHA 2ZIDA 1TA3B 1FWBC 1WAWA 1X7IA 5FCZA 1EP2A 4G6CA 5TIMA 3WUFA 5M17A 3CQIA 3E2SA 5GJNA 1HKWA 4GVGA 1LL4A 4MJMA 1FKWA 1H5VA 4EX4A 5HPOA 3ZT6A 4WIWA 4OV9A 1XICA 3G1AA 3W2NA 2PWDA 4JFUA 2BVWA 1S3HA 3WLTA 4A8LA 3BV4A 5EGRA 2EPOA 3IV3A 3SN4A 2W3ZA 1XGEA 1JG9A 3GNDA 3ZMRA 2HXTA 1CZ1A 1EJUC 1BVWA 1NAL1 3WDJA 2OX4A 3BAYA 2Z25A 3CQ0A 2DVUA 1UKSA 4UCGA 5TF0A 4KBXA 1QO5A 2ISFA 1J4EA 3MUXA 2WNNA 5I24A 3RG6A 1JVNA 4NAEB 2CW6A 1K7FA 4O1CA 3R6IA 1C7TA 3PTMA 1IXPA 3DDMA 3DZ1A 2CKSA 4H19A 1NOFA 2ZA1A 3W7PA 3CUZA 1C92A 2CHOA 3V16A 3W7CA 1RPXA 3MMWA 3G77A 3GM8A 4H9XA 3CIWA 2ATMA 1MO0A 4KPLA 4GJIA 4A05A 1CXFA 1FHLA 1XX1A 4P7QA 4FR6A 2CITA 3FSTA 4OJYA 1FCQA 4ZZ9A 1A5SA 2Y2WA 3QMSA 2VCAA 3BJFA 3ARPA 1HL8A 1LWJA 1OD0A 3IK4A 4US5D 3AU6A 2BHUA 1V93A 4L1WA 1BVZA 4NASA 2DH3A 2QDDA 2DPEA 3QF0A 2XFRA 3MMTA 4L7ZA 4P5UA 1F3TA 1G0CA 1TPB1 4ZVJA 2E3ZA 2WBGA 3N6JA 1LQAA 4HZ8A 3E0VA 1IZJA 1ZENA 2WNQA 4MG4A 3CUXA 3IWPA 5T8GA 4O19A 4UBPC 1SO4A 3BLLA 1QR7A 4DYJA 4A3QA 3UNTA 5KZEA 3M0LA 3IRDA 4KWSA 4IGSA 1MDRA 1MRAA 3U5YA 2KAUC 4AD2A 1QPRA 4V33A 3KAOA 3MT1A 4NAFB 4DWSA 5CC3A 3AMGA 4BK9A 2YB4A 4GLEA 3ITLA 3Q4DA 4BF9A 3NPUA 4ZO8A 1SO5A 4K8GA 1W5MA 1C90A 5JH2A 1PKMA 4TX6A 1W37A 4KETA 1MYRA 1ZCOA 5K7JA 5EMUA 4EP8C 9CGTA 1LORA 4L6HA 3I3EA 5LXEA 5IBXC 3TN6A 4HPNA 1A3WA 1DYSA 1P6BA 4ORIA 3MP4A 2XDFA 4AEEA 4JEJA 3CT2A 2GJPA 1F61A 2X40A 3OHIA 1TWZA 3GBDA 4R53A 4HOWA 3MJMA 3IJQA 4DJEA 1M7JA 3HQNA 3IUHA 1KBLA 4UTHA 1B54A 3GVGA 3QFEA 3SI9A 4AMAA 1TPFA 5IDIA 4LYPA 2EGZA 3CTTA 3L4ZA 4KWOA 2PDBA 1TX0A 4XTDA 1ME7A 4JD4A 3UBPC 1A50A 4HU0A 1G67A 1GOXA 5JQ9A 1E6ZA 3TIMA 4A8IA 4GJJA 3LHWA 5CZSA 3HTWA 4D6CA 1GQNA 3W7KA 4I8YA 4WVXA 5E9XA 5G4WA 1J5SA 3NSXA 1NQ6A 3L21A 3LERA 4JN6A 4K6AA 4JKKA 5AHLA 1LJYA 3VK5A 1JGMA 3GKFA 4W7VA 3NA8A 3LCXA 1FDJA 2BB0A 2R1MA 4HKPA 2VDIA 1P5BA 1TJ1A 1R3VA 4RPPA 2YKKA 2DZUA 2QUVA 3PBVA 3VKDA 1TCDA 3RPDA 1IEIA 1FXQA 1YDOA 2NWRA 2C18A 4XWUA 4A4AA 1K8CA 1EHAA 2CU0A 4AVOA 3PK7A 2PC8A 1E4NA 4TVCA 3NVTA 3TVAA 4FOUA 4L61A 3SSJA 4F2TA 3IUIA 3EX3A 5GVJA 5BRPA 4EAYA 1AL8A 3CZEA 2GSHA 4UQBA 3S6OA 1Q4NX 1DJXA 3IVSA 1TO3A 4YTRA 2CBIA 3L23A 2YA0A 4GC4A 2D22A 3TJLA 4GABA 4B5TA 3RCYA 1DE5A 5LXXA 4Q6XA 2DIKA 2HK1A 5AYXA 1Q6OA 3P5ZA 1XSJA 2O9OA 3OTRA 3GD6A 3WEOA 5JU6A 1KQYA 1XG4A 1OGSA 2YW3A 3PF3A 4AD4A 1W8SA 2Z00A 3WNLA 1NF0A 3LHVA 4GE8A 1ME9A 3LM3A 5LSMA 1HKVA 3DHFA 1UWRA 2I5QA 4UTTC 1QW8A 3S5NA 4LYRA 2CEQA 4IQDA 1ISWA 2QMKA 1O60A 1ONXA 1HX0A 4H9TA 4ATDA 4DUOA 1UKPA 4S3DA 1XUUA 1YNQA 3HF3A 3PB0A 4XVEA 1XH1A 2XVLA 1GWJA 3K13A 3GY1A 3W7MA 4N0RA 5I6SA 1VPYA 5LNSA 4AF0B 2D69A 4IG2A 1TZ7A 3BICA 2O7QA 1Y0EA 2OLHA 1J0JA 5EPDA 2O55A 2RJHA 3U2CA 1W1VA 1RJQA 3WD4A 1UZ4A 3PPHA 4IOTA 2WJDA 2DQXA 2V30A 2VUNA 1B90A 1XGDA 3BGJA 2ZE0A 2QCHA 4C5YA 3QSTA 2OX1A 3F2CA 4P7OA 4RE3A 4I5UA 4O18A 1CGXA 5MHBA 1FWCC 5TAOA 1JPKA 1JIBA 4U10A 2EXOA 1CYGA 1E72M 3WL0A 1LL6A 2OELA 1BQCA 2POZA 2VR2A 3NJ3A 3PS7A 3LPOA 4CNTA 4DBDA 1EQCA 3VE7A 4RZ6A 2VFIA 3PZIA 1D3CA 1MUCA 1YXDA 3W74A 3VOCA 4E6MA 2CLHA 1HNYA 4MAZA 1S1PA 4MKNA 4LCQA 1AZ2A 2OSXA 3C52A 3QXBA 3TQ0A 1V03A 5CBBA 5J5DA 1QOQA 5LHFA 3P84A 2V3FA 2BASA 3QN3A 1PEZA 3RLGA 3PBMA 2JF7A 4K2SA 1ZZMA 4ZCWA 4I5RA 3CEUA 3WLIA 4KEMA 2XWEA 1TKKA 3IGUA 4QNWA 1XLLA 3AHYA 3OBEA 1KCLA 5D9MA 4C6NA 4M6PA 4HCHA 4QNEA 4ADSA 1O1ZA 3TW6A 4MNKA 3CO4A 1EFZA 4IPPA 2WSQA 3W1XA 2V6AA 4LAMA 3ZVIA 1CLKA 3TNBA 2IMRA 1OX4A 2CERA 1E6QM 1GVSA 4JY8A 4YL2A 4MWAD 4F66A 3NQCA 1A5AA 1SSGA 2F2KA 3QPEA 1PV8A 2VFHA 5BOFA 3V1HA 3ZFHA 4NZ3A 5F7UA 1V0NA 1YLVA 3QOKA 2JF6A 3GXPA 3B3DA 2WWDA 1VJZA 3VFLA 5D04C 3TSDA 4NJKA 3H21A 2VX5A 3V0TA 2QPUA 4J28A 4XG1A 1Z9AA 4G1KA 3UVAA 2G0WA 2E6YA 1FWGC 3S6TA 3RCNA 1QUMA 3AHTA 1NTHA 1WKDA 3OVQA 3V5OA 4I90A 3C6CA 3FYYA 4ZQNA 4M6VA 3TYDA 2BFGA 5HATA 1XIIA 1S2WA 1R0MA 4Z2KA 1EYEA 4IMGA 1GEQA 5A8MA 2Z1SA 1P6CA 3TYUA 2V3GA 2CBJA 4GNJA 4PTNA 5LNVA 1BWVA 3VZXA 1A3XA 3GK0A 2HE5A 2WAGA 1REQB 3EWDA 1OYCA 2YZ5A 4PTXA 1UH4A 3II1A 3CM4A 3K1GA 4PMXA 1JNEA 2YYTA 1F5ZA 1KNWA 3WK3A 3OA3A 5A1AA 1W9PA 2QJMA 4S38A 4IPJA 3C0QA 3B0YA 1KD0A 1TV7A 2OQHA 3FJLA 2H9AB 2QULA 5D2TA 5HANA 1EYWA 3GNPA 3GW0A 3QR0A 2AOSA 5H91A 1AJ0A 4P61A 5AYBA 5CSUA 1NOUA 3TV8A 4QX4A 1U5HA 3DFPA 3TWBA 3V5FA 4NZFA 3I65A 4CU8A 5I02A 4PTWA 4XX6A 2OQYA 3AXXA 3QHNA 3UWYA 2PDFA 2F2HA 3T0DA 1P1MA 4PH6A 1XLDA 2PB1A 3R8RA 3LCHA 4LS1A 3QV7A 3O63A 1ZJBA 5DT7A 4WY0A 2XTKA 2WMIB 4AG0A 3I7RA 3KTSA 4D8ZA 3ONCA 3W85A 3P2VA 3MWCA 3SUVA 1B3WA 3A64A 1CGVA 2ESCA 3QJAA 1PKLA 3B40A 2OSYA 4LPCA 3VMPA 4BF7A 3F7JA 2XSBA 4NYYA 4I5XA 3DG6A 3CUGA 1RCXB 3ZR4A 1KTBA 5AZ0A 1NSJA 7CGTA 4HSHA 1HKMA 3AS1A 3F03K 1JF6A 1EQPA 1OADA 1HQTA 4PMZA 3SO7A 4H6QA 3W2LA 3GHTA 2V38A 3OU8A 5EB8A 3ITOA 2J74A 3GDBA 4OZOA 3MUY1 1P0EA 4ASTA 2XVPA 4M51A 5REQB 4MADA 1ICQA 1AH3A 4IQEA 1PX4A 2B7PA 2YZRA 4ICMA 2Q09A 2CBUA 1NWUA 2BBFA 2QJJA 4MUZA 3DHUA 1UZ1A 1TTQA 2GYIA 1F6PA 2X16A 3FV9A 4EPDC 1AQ0A 3S3GA 4BR1A 1UCWA 4KCUA 4GK8A 2QV5A 2ZVRA 3KHJA 1MQQA 4WJEA 1QNQA 1X98A 3NZGA 2HDJA 3TZNA 1LBMA 2PD9A 4HOZA 1IEXA 4PCFA 3JZEA 3HA1A 3ZLHA 1OX6A 1EGMA 3TTOA 3WQ5A 3LHUA 1IXOA 1E0VA 5AC4A 1SU5A 1TWIA 3T6CA 4Q3MA 3EA1A 4A8NA 2H90A 4WDXA 5H8MA 3I7SA 1E51A 4XAFA 1XLJA 1FY6A 1SW7A 3MO7A 2PUZA 1TWWA 1ESWA 1H2JA 2JE8A 2Q01A 1V8EA 4LAKA 4LEFA 4PUJA 5DXXA 2B7QA 2QGYA 1JQVA 1EJWC 3C8NA 3AXMA 3W28A 2PTWA 1B5TA 5M3WA 5TNVA 3SQSA 3PJUA 1J0YA 2Z29A 4KWUA 1K70A 1KGWA 4C5ZA 1BFNA 4GIRA 4HPGA 4L6OA 5EBAA 4H8NA 2Y0FA 3NL5A 3GFZA 1LBLA 3JUGA 3RXZA 4LVFA 2QCCA 2Y7GA 1BGAA 4DF1A 3M0XA 4UUIA 2IW0A 4A3RA 3KLKA 1BTCA 3B8WA 4PMOA 2QF7A 2Q8LA 2ZKMX 1EUAA 2WMJA 2MUCA 4B2DD 3LI1A 1EDTA 1GYNA 4NG3A 3W3OA 1XJBA 3JS3A 4AAJA 3DFTA 3P82A 1TJRA 4X9SA 2VCBA 2PGWA 3TTQA 2W61A 2B31A 4LF2A 2P1FA 1BXCA 4XB3A 4ZENA 1GOWA 4C7FA 1T40A 2ZC8A 3LTSA 4GD0A 3OBAA 1UR0A 1AD4A 2BDQA 4WXYA 1T96A 1PWLA 3PPGA 3HM7A 1S2CA 3OA5A 4AHOA 1A0CA 2IQTA 1DIDA 1GOKA 2VFGA 3GU9A 3RNDA 4H41A 3RU6A 3AICA 2FHBA 4O14A 4GIYA 3NO3A 1K8ZA 2J9ZA 1SMDA 4KKXA 3U5UA 1ZAHA 4XAZA 2CZ5A 3PULA 4X60A 3NQBA 4MB1A 4PB4A 4NP7A 4JY9A 3VD9A 3THUA 3OVGA 1B3XA 1UR3M 1UP0A 3XISA 5EMKA 3PN8A 4RZ5A 2J7EA 3TXZA 3EX1A 4NZ1A 3W1LA 1C29A 4HA4A 1V7YA 4JX6A 1A5KC 2QDEA 3CL6A 3SW6A 5A94A 1V3MA 3APYA 3LQLA 3ZZ1A 4RDWA 4QAWA 3F2BA 3LOTA 4LCSA 1E71M 3CWNA 3WLJA 2PODA 1ITUA 2A5HA 1BSIA 1UQYA 3N9KA 3AMKA 3GSMA 5C7HA 3E6EA 4PE8A 1GJPA 4AC7C 1KXTA 4PODA 3ANVA 3BGAA 5AC5A 4FXRA 4A21A 1Q8AA 2PDUA 4ILSA 5HMEA 4IHCA 4A29A 4OE7A 3KDOA 2ZUVA 1AMKA 3F4CA 5CPLA 3DYMA 2V5JA 1VH7A 3O1NA 4IFKA 4Z2LA 3I6RA 4P8VA 3BZJA 5IM51 1TWSA 3LENA 3SRHA 2INZA 2G41A 1S5WA 3EB4A 4CVUA 2I5GA 3W7OA 5TD4A 1R3TA 2C16A 3EXTA 1RP8A 5AHMA 4AISA 4C6FA 3C0LA 3MMUA 4JTJA 2A4AA 3GTFA 2QZRA 3GG0A 1JZ8A 2ZICA 1AL7A 3V5CA 4HN4A 2C19A 3HPAA 2D2GA 2E7FA 5FF7A 3VTRA 3N25A 5D2WA 3LX9A 3GNRA 1BD0A 1QHZA 4O1DA 1WAUA 3EA2A 1JCNA 2PZ0A 3LGDA 1EP3A 2FTYA 4XK2A 4UWMA 4PCTA 2YCJA 1FP9A 3RK8A 5T91A 3KWSA 1DWJM 1PS9A 3L5MA 4K7VA 3PUOA 3NQDA 3SUSA 3GAYA 3REQA 1JI2A 3U9IA 2PAJA 2DT3A 3VYLA 3AC0A 2OGYA 1H0GA 1R9XA 3NXFA 3U2EA 1FA2A 3RRAA 2HSAA 4QFUA 4EPEC 3APTA 5HWMA 3SEPA 5CJ5A 3CHCA 3B03A 4H9VA 2CXGA 4JNYA 5BROA 2G3IA 3FX4A 3PWIA 3PB2A 4BQ2A 1DL3A 3GUGA 3N15A 1W3LA 4NHVA 4YHGA 1WYIA 1E0UA 1FWEC 5IDZA 5G1MA 4DWSC 4RXFA 3ITCA 1OZQA 3PAOA 1NF7A 3IIOA 2WK2A 2OEMA 3M16A 1SW0A 4GQQA 4Y9MA 3TN4A 1C8QA 1HJUA 1P7TB 3CYJA 4V2XA 1W5NA 2YA1A 1DJGA 3CUFA 3T4WA 3SCSA 2Z1BA 3VNKA 2X2YA 2JEPA 3RCMA 3VDCA 4K1GA 2A3LA 4C65A 3TWAA 3M0IA 3SCPA 4M56A 3TCEA 3N12A 2XIMA 4GYPC 1UP3A 3P6LA 5ECUA 4I3GA 2TSYA 3DCPA 3IACA 1UBSA 4L9ZA 4RV3A 5A2BA 4YWSA 4LCRA 3I6TA 5GPRA 4DM2A 3N13A 4H9MA 3B0XA 3SDOA 2X09A 1NARA 2PZNA 4C60A 5D8ZA 3FGCA 3DENA 2XN1A 4E4PA 4JQ4A 2PDLA 2EPMX 1YNYA 3LLXA 3KZSA 2DSZA 3E0LA 1QI3A 3C8FA 3DIPA 4G7EA 2ZRZA 2YCEA 1MDLA 2PBGA 1SYTA 1XIEA 5BWFA 5HQEA 3WD3A 3MYOA 3AQUA 1HJVA 4G56A 1H41A 4M29A 5CSSA 2C1IA 2BGNE 1IGSA 2I5IA 3WQEA 3ECQA 3ALGA 2G96A 1WOAA 2Q8ZA 2EG6A 3GB6A 3LYEA 3WENA 1C91A 2WMHA 4PUNA 3SCNA 5CPTA 4C1NB 3AYRA 5KINA 3N11A 3G6LA 4GZJA 3EA3A 2VEPA 2Y5EA 5F4WA 3AAMA 1V77A 5AHNA 2XFWA 1XYZA 2V82A 2P0OA 2VEIA 3N29A 1F6KA 3WJYA 4CN4A 4PSRA 2YOCA 3RX3A 5A95A 4P8XA 3VD7A 4LT9A 3W87A 3GXMA 3WNKA 3OG2A 2PTYA 5D2VA 1R87A 1QHPA 1LTDA 2AMXA 3UJEA 3W1TA 5H1WA 3H7UA 1C8VA 1HKIA 2WMFA 3UCQA 1DWIM 5A8QA 4YU1A 1AQFA 1BRLA 1OF8A 1XYMA 3W0KA 3OB8A 4FLOA 4E2DA 4IXXA 1A5BA 3OO2A 3VCRA 4AQLA 2O7SA 1SVDA 1LL7A 1PHQA 1E6SM 1XLHA 1BWKA 3ARWA 4LBRA 3KCJA 4CNNA 4ZQCA 1M5WA 4HPJA 2WVUA 1XQKA 4JHMA 1VCGA 4G8TA 4DLFA 1TRDA 2HBVA 2W0UA 2HS8A 5AKQA 1TUXA 3MKKA 1FH9A 4JTKA 1W91A 3GNOA 1N55A 3ARZA 4RE2A 2YDSA 2BHZA 2E5DA 2R91A 3BSMA 3I3BA 1EB3A 3PZQA 4Q4MA 3EBVA 4HNOA 2GGHA 3DERA 4ROQA 2VEMA 2XWDA 1GVRA 2W63A 1KM2A 3K1DA 2ZYFA 3P5YA 5E0CA 2J13A 3GIYA 3B4UA 2J27A 1IT7A 3ITYA 3B4YA 4GKLA 4J27A 3KVMA 3L5AA 3BC9A 4X9YA 5G4HC 4QP0A 3VI2A 2ISVA 3C5QA 4PEEA 4H7VA 4QS6A 3PG8A 3SUUA 1XCWA 2IS7A 1FWFC 1ZBVA 4KEVA 1X6NA 1F8MA 4WEVX 4IWWA 4JKLA 3PTQA 1HTIA 4DBUA 2QAFA 2H8ZA 1BYBA 2DSVA 4U2ZA 2YXOA 3EWYA 9RUBA 2JGQA 1W17A 2YX0A 1OWQA 2P8CA 3KWXA 4E38A 3QPYA 4E4FA 3NCOA 3THCA 2VELA 1JCMP 2Z0IA 2E77A 1EA0A 4XUGA 2GOKA 3V18A 1LT7A 4WDWA 3P81A 4JIIX 1JCYA 3C2YA 2Q8XA 2O56A 1E6PA 3TAOA 4EVZA 3OVRA 5CPMA 1TPUA 3IANA 3MA8A 3VILA 4HPHA 3Q94A 3A4XA 3GE7A 4RL3A 1XBXA 1KM1A 4OQVA 1Q6RA 1DEDA 3TQVA 5FF4A 3R79A 3HMJG 4B3KA 2BG5A 2VUYA 1R46A 3AMLA 2OKTA 1CXLA 2ZQ0A 1DKWA 1FH7A 2J7FA 1P48A 3CK5A 3XIMA 5JXQA 3GAKA 5BCAA 4U31A 4RDVA 1D3GA 3OVPA 4GUGA 3RX2A 3DAQA 3UEQA 5U4NA 3M07A 1BWLA 1GPFA 4BY3A 4EF8A 2ZXDA 2XU2A 1AW1A 4MZYA 3XINA 2XHYA 3DN5A 3QLLA 3W84A 3WDHA 5L9FA 3NM3A 1BF6A 3H12A 5EA9A 3WJXA 1QPOA 3BGGA 1A0DA 1O4UA 4UC5A 4V27A 1ZBWA 3A13A 4PRTA 3GTXA 1TX2A 3L12A 4JS3A 3KM8A 4EAMA 1Z41A 2V8ZA 1POKA 1DORA 3D3FA 1Q6FA 3MMDA 4A6GA 4N02A 2VZTA 1P0NA 1GVOA 4FX7A 3TQKA 2V5DA 1E70M 2WHJA 4WY0F 1XYAA 1CGTA 5E0KA 3VNYA 4Z42C 3CAVA 4LF1A 1YNPA 3FHAA 2H3DA 2PDPA 3GR4A 1Y5VA 2QMJA 2QUMA 1POJA 2YXXA 2A3HA 4US6A 3GRIA 1QBAA 3EDKA 4L9XA 4MLRA 1FWNA 3SECA 3BMXA 3H23A 4QLKA 4AIUA 2Z7KA 3M7SA 2DZXA 3IJ7A 1M01A 2PDQA 3U0HA 4AZHA 2GL5A 1I9CB 1Z42A 1GYMA 1V0MA 2BOEX 2C15A 3GC5A 2B7NA 1VFLA 4RE4A 1FHDA 3S1GA 3NQVA 4DLMA 5FA5A 1YIXA 3VZYA 1FWDC 1HO4A 5E70A 4ZO7A 1QNOA 1ZJAA 4LS2A 4I9JA 4F2UA 4JTEA 4RNHA 3CHVA 2QPSA 5EMYA 4GIEA 4KW2A 2PDKA 1U83A 3AYSA 1AQHA 2NLYA 4B9ZA 2RJGA 1WKFA 1TJ2A 3KBJA 1HG3A 2YBUA 4I6VA 5XIAA 1OYBA 3UWQA 4HCLA 1JYWA 3UR8A 2VDGA 4GGBA 1DIEA 3E2QA 4WK9A 3VD3A 4J9JA 2VX4A 3WF1A 1M7PA 3QR3A 2J88A 3BH4A 3A5FA 4YTSA 3TXVA 1UR1A 3CMJA 1FWWA 2BX7A 2ISDA 2C1HA 1BYCA 3USZA 1PTDA 3G22A 3N6HA 2V63A 4YCOA 4LB4A 2C1GA 1EIBA 2D23A 4FLQA 1ODZA 4MM1A 3F4VA 2WZHA 4M1RA 3SCVA 1TMLA 1GONA 4HA1A 4QIUA 4CLMA 2P76A 2NW0A 1PIGA 1PWMA 2WCAA 5FEWA 3EOLA 5CPOA 2TMDA 3DX5A 1J18A 3QRHA 1QNVA 1QWKA 1XBYA 4LC6A 3CMGA 2E1DA 4GQBA 3R8GA 4PUMA 3R1ZA 3W75A 1X6UA 2NXIA 5A6AA 2NX3A 4DI8A 1XPGA 3WJWA 4KEUA 1CBGA 4KH2A 3NZRA 1YBQA 5D37A 2NQJA 4W89A 1XISA 1A0EA 1JQXA 2CWNA 3SGGA 4XZWA 4PCNA 1MUMA 2WHMA 3VIMA 2PGRA 6PTDA 4R27A 4DY1A 3GH5A 3Q45A 1JZ5A 2E6FA 1TREA 2HS6A 2WVSA 3RM9A 2Z24A 1W32A 4HYWA 2W66A 3VGGA 4AY1A 5FAGA 2GUUA 3PTKA 1HF6A 3P7YA 1RD5A 4N9BA 2PWVA 1UH3A 4IF2A 1JZ6A 3VKBA 3UG3A 4X3ZA 2P50A 3AJXA 3DFYA 3NIYA 1IR2A 4LUSA 3S4TA 3G0XA 2GUBA 5A6SA 1XLBA 1FQ0A 4C6BA 5E0FA 3P93A 2VFEA 3VGBA 2EPLX 4EXQA 4MJZA 3ANYA 3DGRA 3OJGA 2PDJA 3EWCA 1TR1A 2AGKA 3N04A 4UTIA 4IT1A 3WMCA 2XIJA 1Q66A 3E5PA 5FEXA 3ZJKA 5CC7A 3KVJA 1TPH1 3EMZA 4K37A 4LVGA 1KXVA 3LV6A 4IIBA 3V35A 1W3IA 4LH8A 3BPWA 1RP9A 2PDXA 3VOGA 5G2IA 4G1NA 2HWGA 3W2MA 2A85A 1H49A 3OZMA 4US5A 3W4RA 3HJZA 4K39A 5DF0A 3E0IA 4FLRA 2HISA 1FUYA 3AS0A 3BW4A 1K9DA 1U1JA 1E15A 4MKSA 4S1FA 2BVDA 2JKAA 3LA4A 1R2TA 1ZJHA 5BXSA 1QO2A 4EWJA 1J5TA 1GG0A 3CWOX 3NQAA 3HJEA 4U5IA 3G1XA 1F07A 3N4EA 3DFOA 2YPIA 4U33A 3TYBA 3LU2A 1PZ2A 4NXSA 1SZFA 1WXZA 3DHPA 2PP1A 1WDWA 4Q4SA 1W31A 5DO8A 3KL3A 4M7TA 1R3QA 1FWIC 3WJZA 1IT0A 1Y7VA 4W93A 3UR2A 4KCTA 3LCLA 5HQLA 2PRLA 1J6OA 5DEZA 4CCCA 4S39A 5DMNA 2GVLA 3L2MA 1N8IA 4UFMA 2GDVA 3ID7A 3DI0A 5CZKA 4BJHA 4LX4A 4HHPA 1JUKA 1NEYA 1EWDA 4HHLA 4EK7A 3AZRA 3AFBA 2GZXA 4ERIA 4E4UA 2EKGA 2QJNA 3SAZA 1VKFA 3CBWA 2F6XA 2GDUA 3WQVA 1MVYA 2A6LA 3E9AA 3USBA 1MZRA 1CWYA 4Y90A 4FF5A 4GA8A 3BTNA 3W7QA 2YDQA 4XD3A 2PWEA 2WV8A 4WOZA 4J4KA 2D2JA 3I68A 3PBYA 4HN8A 1VJIA 2CLMA 3PWGA 3U3HA 2CLKA 3RX4A 1Q2SA 1VBHA 2PS2A 3VXGA 1XRTA 1MNSA 3L4WA 3LRKA 4H7CA 1WB0A 4Q4PA 3PNZA 2WQDA 4NI8A 2X1UA 3ARUA 4I7VA 4NZ4A 3WEMA 1H63A 4XV0A 1BTMA 1UWSA 2V2CA 3LBCA 3PP7A 4ZR8A 1PB0A 1IYXA 1CI1A 3CAQA 2V81A 3TROA 3NQ7A 2XIOA 3D5HA 3HBLA 1KW1A 4NUWA 1P7TA 3T78A 1K6AA 1LT8A 1WUFA 1XLIA 1PX8A 5ABTA 4IMEA 4PFMA 5K9DA 4AY7A 1EZWA 2X7VA 4CQ8A 2RDXA 1H50A 3T4CA 3WL1A 4IICA 3CZKA 1CIUA 2PDMA 3NQ2A 2J6VA 4BQ3A 3UG8A 3U7VA 5HNRA 1C93A 4DJFD 4JDYA 4AZIA 1HXJA 3VNDA 2AL2A 1KM4A 3M5YA 4CN1A 3D0CA 2CWXA 2HPMA 1OCBA 1HW6A 1YE4A 4FA3A 2FZMA 1NOWA 2PBOA 4HYVA 4IL2A 4FS9A 5E1QA 3GIQA 3UXIA 4AZBA 1I4NA 1O5KA 3GG8A 5ABFA 1XFBA 4KFOA 4LGXA 1E4MM 2XZ7A 3KOZA 5GNZA 1S1RA 2OYMA 2A7NA 1NFPA 1DOSA 3LNMA 2QCGA 4Z1CA 3VINA 5JBDA 2XZ9A 1Q45A 4IMFA 4PUDA 5LHEA 3KTCA 4PL2A 3NSMA 4X0NA 3V0SA 3GDMA 4C6DA 1TJ0A 4ATLA 1BGGA 3THAA 2CIPA 3C3UA 3VOHA 3RITA 2RDWA 4U28A 2ADAA 4UQEA 3BLKA 3NQEA 4HBKA 4KIEA 1OZMA 3BJSA 3A3XA 3WMBA 4UMAA 4LC8A 4L1GA 1SZNA 4MB4A 3RR1A 3WQOA 4RKAA 4RXGA 4D6DA 3LCFA 4IISA 3TYEA 3LUTA 4W8LA 4GZEA 1U5VA 4F40A 4C6JA 5B80A 3UW6A 2ALDA 3HN3A 4J3WA 4YVXA 5AOUA 2DUAA 3AMCA 4GBDA 1VRDA 1LDCA 6A3HA 5CZ0A 3C0SA 3GTHA 3KUMA 4V15A 3NZPA 4V1XA 5I3GA 1EL3A 2NVAA 1XDJA 4Z2HA 3FA3A 1U2YA 1TUFA 2D24A 1W9UA 1ZHAA 3ZSSA 2J47A 3UP8A 3WDRA 5G4EA 3VIIA 1WZMA 3GC2A 2G97A 4GG9A 4QE4A 1W0MA 4W7UA 9XIMA 4KRZA 3DFNA 3VX0A 1IR1A 4NL1A 1HL2A 3S5OA 3A3HA 2NZLA 1TR9A 4H8VA 3RMEA 4IL0A 3WQWA 3GVVA 3LZ3A 5C54A 4GJ1A 1EX5A 3T0TA 2DVTA 3L0GA 3HG2A 3ZWTA 3NPWA 1ADOA 3OYXA 3W27A 3WN6A 2YR1A 1XFCA 4MFDA 3OQ8A 1YADA 3WF0A 3HO8A 3TR9A 2VEFA 4DO6A 4I8DA 2Q3OA 1G1YA 4S3FA 3UZYA 2WBKA 3COTA 4Z2JA 3LRMA 3KHDA 3ORWA 5HAOA 4BF5A 1JPDX 1RK6A 2E9LA 2ZUSA 3QKZA 1GYLA 3CL7A 4QGCA 3LCIA 1R3SA 1TPC1 2OWCA 3FK4A 3WQ8A 2Q6ZA 3WLKX 4D6EA 4WKHA 3PHAA 1WX0A 2VTFA 1UROA 1CGWA 2DZTA 5IFPA 2G4FA 2UZ9A 1SFSA 1W5QA 4GRSA 3CHFA 1NP0A 3KCLA 1KB3A 1SFJA 1XLFA 3R0UA 1MW1A 3PSVA 1S39A 2EHHA 3EDJA 1SM9A 5LYRA 2WLZA 2O4MA 2OFJA 1H60A 4Q4RA 1JCLA 3MANA 4QM1A 1E9YB 1UH2A 3AYVA 3DGBA 2G3NA 1I2NA 1FOBA 5CG7A 4HQVA 4ONVA 1HP4A 3UG4A 3A5VA 4O57A 2F8QA 1K4GA 3HGSA 2GFTA 3DOPA 2VCCA 3T40A 1ZB5A 2SFPA 3F5LA 4CCZA 3WQPA 3LQGA 3ABSA 2AL1A 3N2BA 3BAWA 4W9TA 3IIXA 1KBIA 1TCMA 1Z6KA 1TIWA 1JYVA 1QASA 3MTWA 1X1NA 2VT0A 3BQ6A 3NURA 3H8AA 1FWAC 2X1IA 2I9EA 4AWEA 3TMLA 2VEKA 4EPBC 1GKQA 4Z17A 1RH9A 4UB9A 4ZO9A 3VDHA 3R58A 3W38A 1IGWA 4UR9A 1OYAA 4O13A 3CAKA 1G7VA 7A3HA 2ZVIA 4Q8MA 1M68A 1UYQA 3W07A 1A4MA 4X2PA 2YXGA 2Y8UA 1WP6A 3L5LA 4MVAA 5HUPA 4J3VA 1EO7A 4YYFA 3SBFA 2JK2A 3VNJA 4AWTA 2FGZA 3VGFA 4JTTA 3KBNA 1SW3A 3L66A 1ELSA 3NPVA 4AIBA 5SWUA 3UZWA 3QHMA 2FIQA 4DN1A 3SCRA 1E6RA 2WSPA 3MVIA 1JUEA 2JKPA 4HHHA 1W2PA 4CVWA 2QCEA 3TCSA 4K68A 3WCZA 2V69A 2XPKA 1QMLA 4TV6A 4ACZB 4L9YA 1I60A 3UVIA 1X8FA 3LDVA 4JTDA 2YGYA 3MB9A 4OFCA 1VB9A 4YPJA 1AD1A 2F6KA 4O52A 4OKDA 3HQPA 3NGFA 3H6OA 2ZC1A 3BAIA 3C56A 5F1VA 1OX4B 5DMMA 3BSHA 4O10A 4C6KA 1EEPA 4GYKA 4D71A 3HOJA 4XBJA 3W2UA 4NSBA 3R94A 4DAIA 2DZBA 4JGDA 1K7EA 3HQ1A 4NAEA 1RUSA 2BZNA 5BOEA 1E55A 1YDYA 2F6UA 1ECQA 2R6OA 2TODA 2G4JA 8XIAA 2OZ0A 3WF3A 1V02A 4HTYA 4Z08A 2YSWA 4NYUA 3U4FA 4YMZA 1DJNA 4C90A 3UWEA 4ZBCA 3I6EA 2EF9A 3TW7A 1V6VA 3ABQA 1JYNA 3VD5A 3PC0A 3RDKA 4P7LA 5JBFA 2FDMA 1WZAA 2ZX6A 3WBWA 3QEZA 5AZ1A 4D6GA 2W4XA 3M0KA 4NXKA 2YDAA 1L9WA 4JTLA 3C2OA 2FPYA 4EKJA 3BLFA 1EJTC 2PLKA 3E3HA 1E73M 4BEQA 4QCEA 2IQ0A 5HPCA 3L4YA 1JDFA 4ZB0A 1XI3A 1CW2A 4R9XA 2EG7A 2VURA 2VL4A 3CYVA 3LXCA 5C9RA 3OLDA 2XH0A 1XLEA 2AKZA 3UZJA 1V3LA 2PLCA 1UWUA 3C0JA 4YWIA 3EX4A 1A80A 1DV7A 3STGA 2EG8A 4BS0A 3I7QA 6TIMA 5HNTA 2GVJA 1DXFA 3N1AA 2IPJA 2A2IA 2Y63A 4ZA0A 4AZCA 1GK8A 2R1NA 5AB3A 2YCLA 4GVFA 2I1OA 4OBRA 4PN2A 3INPA 4Y9NA 2WMKA 3R0DA 1VP5A 2OLSA 4IG2B 2CXEA 2Z27A 3KOYA 4ML4A 4OTKA 3THQA 3OW1A 1EC9A 4CD7A 4L6DA 4KMQA 1KTNA 4HYRA 4TMCA 2R9RA 1PYMA 5D33A 4H8HA 1GZJA 1UD8A 1O7AA 1ZGDA 5U7SA 4C7GA 2XG9A 3GR7A 4IFKB 1S3TC 3FLUA 4FNQA 1EUNA 4XTIA 1ZBCA 2AKMA 3HPXA 1UIPA 4Q8QA 1RCQA 1P0DA 1W8GA 4FX8A 5FJUA 3QQWA 4A2SA 3H4WA 4JIHA 3WH6A 1J11A 1OFQA 4DQWA 1G5AA 3KL0A 1EPVA 1LG1A 3UWVA 3LEPA 3MP3A 4O0ZA 1G4EA 1EHNA 4DXVA 2VDHA 1OK4A 2DUZA 4FK9A 4JKMA 3TFCA 2B81A 4YIWA 4LEQA 2IKHA 2VD9A 1ME8A 4H3DA 1VR6A 3LD5A 1OC5A 2WWCA 2YFNA 1H4PA 2ZZ4A 4XZLX 4HK7A 2PRHA 5DT5A 2G37A 2I9UA 3W26A 1P4CA 5BRQA 2E09A 4RK8A 1G94A 3M9YA 4UQCA 2DGAA 3CL8A 5I06A 3S1UA 3NZQA 3SUTA 1PDYA 4DAFA 2BS9A 3PWAA 3WQDA 4JN7A 4DJDC 3FNDA 2GGGA 3UETA 2V5CA 2GK1A 1UOKA 2QJGA 4GCXA 2GJXA 1C9DA 4C1LA 2V67A 3DG7A 2QUTA 4W88A 4WOQA 2J7GA 3TH6A 1UMYA 2RDUA 5GNYA 3VX1A 4C6EA 4I7WA 2V0TA 1RJRA 3ABOA 2J7CA 1XRSA 1YPXA 2CESA 1THFD 4NRRA 4HNTA 4QJ1A 4L4LA 3CJPA 1LRNA 4LNYA 2CZDA 2OKOA 2A3CA 3ZVHB 3QV9A 2NQHA 1MFVA 4B5VA 1LYXA 2R24A 3QY7A 4YHEA 3CC1A 2QV4A 3ITGA 3VKAA 3TTYA 3W7GA 1L2UA 4MKVA 2D20A 3NDYA 4UR8A 4AFYA 4ZOAA 3PFRA 1XKJA 4JHOA 3N73A 5H8PA 4HNLA 2AMGA 4WF7A 3DFQA 2ASHA 2BWGA 4GOAA 2PDIA 4KERA 4CEUC 1ALDA 4GY1A 3V1PA 1WQ5A 5DRIA 2J6XA 5FACA 4IFRA 3IK2A 1PE1A 2JFEX 2PDNA 4O1BA 2NUYA 3G3DA 3UR7A 1W2VA 4IX0A 5ABFB 1VPQA 4F0RA 2WMIA 4NX0A 2OODA 4JFVA 3PZ9A 3T42A 5C71A 5DELA 3CQHA 1W5OA 2IKJA 4HA3A 2ZRUA 3A22A 2OO0A 3M0YA 4FNTA 1AW2A 1RY0A 1XIBA 3EB2A 1RA5A 4O8RA 3NYZA 1WDQA 1D9EA 2PP0A 3DUGA 4O17A 4PR4A 3SQLA 1Q6CA 4GNKB 2OYKA 5FL1A 3WDPP 3V3WA 4D1JA 1F76A 8TIMA 3QY6A 1UR9A 3TYCA 5I07A 4BQ4A 3BCJA 4RDZA 3EPMA 5C2XA 3W6YA 2FGLA 4Y9PA 3E2RA 3AXIA 2ZBTA 3B9NA 2VI0A 4PSPA 4JHZA 3WBAA 3BLIA 1TRIA 3IJIA 1AODA 3LB0A 4WCJA 3UPBA 2XVNA 2VRJA 1E3ZA 3ES7A 2ACUA 4DRSA 1LWIA 1OG6A 3KXQA 2YIHA 3MDUA 3NNTA 3N3MA 4IJRA 4YTUA 4HK5A 3QV6A 3WUEA 4I9TA 2PLJA 4D9PA 5DY2A 2NX1A 4A2RA 1KFCA 1LM1A 3H4GA 2CC0A 2P8BA 1EBHA 1G9HA 2A1YA 3QFWA 4RPQA 1A4LA 3FY1A 1KGUA 3W00A 2BV9A 1L6SA 2RH9A 4ZE4A 4PL1A 4PTDA 3T07A 1R38A 5CQ1A 5D09A 3IIZA 3BANA 2XN2A 3BOFA 1J79A 2DEPA 3WD0A 5GQBA 5BRBA 1Z69A 3MSDA 3F4DA 3EMCA 3GG1A 1IHIA 1EDQA 3R11A 1FWTA 8CGTA 2XM2A 4NJJA 2RGLA 2DJXA 1XLAA 4HSOA 2V3DA 4CU7A 4FP1A 4OOZA 3GZ3A 4IIEA 3WBYA 5FJTA 1E56A 4MTVA 3S47A 1K8XA 1V3JA 1FWHC 1F4HA 2FH6A 3SUWA 4UTJA 4EOUA 7ENLA 1SJAA 3WIJA 4DPPA 8A3HA 2J4GA 3LLDA 5DMYA 1FHVA 2GWNA 3IPWA 1CXEA 2Y7DA 3Q2DA 4M80A 1I1WA 3Q58A 3FEQA 5EU9A 2E4TA 4L80A 3WQ4A 2XINA 4RW5A 4QG9A 3N9RA 1K02A 2Y8KA 4H8UA 1JUBA 2BY0A 3APGA 1WOBA 2FFIA 4JTGA 4LYQA 4HK6A 4HMNA 5HUOA 1CGYA 2FHFA 1RXOB 3M44A 2BNJA 5BZAA 3AZTA 3PNUA 3GU1A 5FKYA 5C9UA 3W6LA 2X2GA 1Q85A 4AHPA 2ZWZA 5LKYA 2E8ZA 4D6FA 3ZVHA 1RA0A 2DZPA 3NEVA 3SGUA 3SN1A 1YXCA 3MW7A 1DIOA 5FF3A 2ZUNA 4TVUA 2ZRXA 4PMNA 2QCDA 2RGMA 3VIKA 4UTUA 2PE4A 1W3NA 2CLIA 3NOYA 2Y7FA 5A69A 4JICA 4JOMA 3C4UA 2FZ8A 2HE8A 2PC4A 4WD0A 3W53A 4LANA 3W1AA 3O06A 1F6YA 4FXFA 4DJFA 1JGIA 3SY8A 4DX3A 4IP7A 4Z0SA 6XIAA 2PCQA 4NJHA 1L8NA 1T6MA 1T99A 3N18A 1F8IA 1WXJA 4PGLA 2WZMA 4LSBA 4DO5A 2B4GA 3VPLA 1TV4A 5JUVA 5K4ZA 5LGZA 1ISYA 4LS0A 1VFMA 1J6PA 4IGHA 1VYPX 3QHOA 1OFOA 3SFKA 3VGHA 5D4YA 4C1NA 5AYYA 4QSFA 4E3TA 1QOXA 3C2EA 5AYZA 3VCCA 3MCMA 4IGNA 3B05A 4AXNA 1J0HA 4JR5A 1G7UA 3T08A 1ITXA 1NWRA 3RYSA 3PR2A 2ODOA 2FMNA 3T0AA 4ERAA 3RAOA 4UTWC 5KZMA 4DYEA 5JVLA 5FESA 3GXDA 3CLMA 2W92A 3VM5A 5DCBA 1V0LA 4WKAA 1W9VA 3LXBA 3EGJA 3U2OA 3TQPA 1XIGA 5HNUA 1T5AA 3GH7A 4TX8A 3G1FA 4H6EA 1XLKA 1YTDA 4UQDA 1DJIA 4N6FA 1EXBA 1XS2A 4XBKA 3WLNA 4NNBA 5BMWA 2CHNA 1I2PA 5A8GA 5FF2A 3NQ8A 4XKYA 3S1XA 1KM0A 2E25A 3VOIA 2ANUA 1SZRA 3RRXA 3HPZA 3RIKA 4XZ9A 2HEJA 4IZGA 3QC0A 1MMFA 1SGJA 1FBAA 5FOOA 2HROA 1QPKA 3REQB 5CLWA 1UD5A 3STPA 3LGEA 1IIHA 1G4TA 4PMQA 4Z1AA 4FLSA 4XZHA 1BG9A 1VCVA 4JIQA 1VRXA 2HVOA 2AAMA 1ECEA 2IXUA 1EP1A 1OBAA 4AX6A 2YA2A 4ROPA 3T0BA 4XO6A 4YTTA 1K9EA 1VIZA 4ENLA 3HGOA 4W86A 5IOBA 5HBFA 5RUBA 3R43A 3UWZA 1X1OA 1OY0A 5LNWA 1H51A 5D9OA 3WLMA 3BVJA 4MY1A 2E28A 2W6RA 5E6ZA 4CQAA 3TMQA 4F48A 4OECA 3B0PA 1PZ3A 4Y9OA 4FIRA 2OWWA 1Q6DA 1I8JA 5ENLA 3N2OA 2PDGA 4QLLA 1RBAA 3T55A 3FFSA 4JYFA 4J5NA 2J79A 2G3MA 3PZTA 2X30A 3WLRA 3SIZA 2ZZ5A 1OC7A 4TMBA 1KCXA 4BI5A 4GHRA 1CXIA 3SZ8A 3AIWA 4DBSA 2OGJA 1I6NA 4IIDA 3OZOA 1ZCCA 1MQRA 1IEQA 1J2WA 1VF8A 1OF6A 2OEJA 4LUYA 4KWWA 1CX9A 1UJPA 5D30A 5FJPA 1P0KA 1GKPA 1K9TA 2GVEA 3P8IA 3B9DA 4UTWA 3WX7A 1J93A 1FKXA 3OIXA 1QBBA 3EDEA 3W7LA 3NR0A 3ZOAA 4MWAC 4Q4KA 1BYDA 5F4XA 3FXYA 4HNUA 4NX5A 4XSLA 1GQIA 3VC5A 3CT7A 3M46A 4TTGA 3AOFA 5BW6A 3SJ3A 4HHMA 3KBWA 2DSWA 2QVHA 5I00A 2ZXBA 1KBJA 4MPQA 3MO4A 3YPIA 3WFAA 1UW9A 3N17A 2VRKA 1OG0A 3VGDA 1LWHA 5C7VA 3GHSA 1VFOA 3ITTA 2VKZG 3MU7A 3EYPA 1UA3A 1UR8A 1GQKA 4GI8A 3W7NA 5XIMA 3ABRA 4NRSA 1JZ3A 4JDBA 1BXNA 1DQXA 4ZO6A 3FDKA 4F8XA 1U22A 1H7RA 1Q63A 3DBNA 2NV2A 2PI6A 2H8XA 1E1FA 3E49A 3FXGA 3IARA 2NX9A 2RDTA 2O9PA 3VDBA 3GNXA 4X61A 1QI4A 3KVKA 1E9LA 3H2OA 1B0IA 3MHFA 1JI1A 2CFFA 1UPMB 5I78A 4MZ8A 4N9DA 2D0FA 4XZBA 3G1SA 4OWGA 3A4WA 3W82A 2NQZA 1HZYA 2FB2A 3GLCA 4ZMGA 3GTNA 5A6JA 4D6JA 3NWRA 1YYAA 1DWHM 2VVNA 3NDOA 1UOZA 3W76A 2GSJA 1NU5A 2CETA 2WCGA 3GO2A 3FIGA 3PZGA 1YPFA 1M1BA 3N2MA 3VUSA 2I7GA 1ZFJA 2GQ9A 2PLMA 4W4QA 1VFTA 4AEFA 1Y5XA 3MP5A 1OFDA 3W23A 4INFA 3U57A 4A8RA 2BMBA 1QI0A 1Q7QA 2P3ZA 3WBXA 1MNZA 3WKZA 4ADTA 3ITVA 2PF0A 2A21A 1UWAA 1Q7ZA 1V6UA 3LM7A 2QCLA 1VBGA 1MWOA 1XHGA 1EEXA 3JZUA 4QQUA 4LW7A 1UUMA 2YL9A 2RAGA 2XSAA 4JTQA 1CEOA 3AS3A 6ENLA 1Z32X 1X8CA 3W9ZA 3ZLFA 4FXJA 2O4QA 3ARXA 1M53A 4MB3A 2CHRA 2OZ3A 2P53A 2NVCA 3WZ0E 3TJ4A 1G01A 3E74A 3MSRA 3O7UA 4GFIA 3K4WA 4XVDA 1YDNA 4M0XA 3QH2A 4RNJA 1RJPA 4B3ZA 5LNRA 4CQDA 1GOMA 1MRQA 4LQ1A 4UFJA 1P1XA 2NWSA 4D72A 4UNIA 3PZNA 5J5RA 1HT6A 3B9AA 1X1ZA 4F3HA 1NIUA 3A24A 1VFFA 2FJUB 2DT1A 3IJLA 3P62A 1M04A 3MUAA 1BYAA 3M0HA 2Y7EA 4AH7A 3VA8A 3TA6A 4QG6A 3O05A 4ZODA 1H09A 3LV5A 2PMQA 3EKLA 3OP2A 3LNPA 1ZNNA 3TLLA 4ZSTA 1GPWA 3HG5A 1QPQA 4D1IA 2WOQA 1D7KA 3BLDA 1NWSA 4XZNX 4A3HA 4F4RA 4B5XA 3URQA 1E0XA 4DNHA 5I3KA 1YBQB 2E9BA 4WJXA 2Y62A 1V0KA 1RLCL 2INEA 2OQLA 3ARRA 5HQMA 2GGEA 2I57A 4C6QA 3W1PA 1P0BA 1Y8BA 3W7JA 4XUYA 2V2HA 2VZOA 3NFUA 5XINA 3VNZA 1XWYA 1H3GA 4QQ3A 5LIWX 4IJBA 3NG3A 1CB7B 1U1UA 3AWNA 1AUSL 2F84A 5A6KA 1YRRA 5A6MA 3SY5A 1H7WA 4XO7A 2VGIA 4UNLA 3B0VC 4P7NA 3RILA 2FYMA 1OFAA 3BG5A 3RO8A 4JFSA 2YCLB 1EJSC 1BAGA 4L4PA 4TUFA 1KO0A 3RFAA 3QMTA 3PUDA 5T9CE 2XVKA 1FCVA 1VCFA 1F3WA 2INFA 2QS8A 2WHKA 3MQTA 2GUYA 1S2UA 2G5WA 3OLGA 2O92A 1M65A 2VZUA 2OJPA 3CZJA 3ONBA 5CZTA 3PJWA 2RKXA 3HV8A 1GVIA 5AC8A 1QOPA 3TSMA 5BMXA 5A5WA 2GGIA 5FIPA 5TQLA 2HVNA 1I45A 2ACRA 5I7GA 1NM9A 1SJDA 5CXPA 2I56A 1W3KA 3H2AA 1H7PA 1KA9F 3MZNA 3NQFA 4AWUA 3PJTA 4PMRA 2XIBA 4R7WA 3EWZA 1GHSA 2HNHA 4D6IA 4E8CA 1KFBA 2Z26A 4KIRA 1UJQA 1XLCA 2AAAA 3P3BA 3VKJA 3TTEA 3F4NA 9XIAA 3BLOA 4CCEA 3MSGA 3C2RA 3ATZA 1JDAA 3WSUA 4AVFA 2J7DA 3B8TA 2OSWA 2QUNA 1FH8A 1PUDA 4B4FA 4HNVA 5JIPA 1JULA 1JD7A 2ZA3A 3GHRA 3FS2A 4LUIA 4OUIA 4H6RA 5ECVA 3N2TA 5CH9A 4R33A 2VP8A 2FPTA 4HZMA 2Y8VA 4QR6A 2C79A 1BKSA 4LBUA 3BLEA 4NU7A 2ZWYA 3QSRA 4L4OA 4IUGA 4ZFMA 4W87A 1AQMA 1UKOA 4LRTA 4C91A 4H7ZA 3WQFA 1XLMA 4FNRA 1Q5MA 3T05A 2BGSA 4GINA 3WH8A 4GI9A 4ZB2A 4PFHA 4ZE5A 4UFKA 3TA9A 1KR1A 3W02A 3CWHA 5JBEA 3V0UA 4P7RA 1ZPTA 2XGZA 2QNEA 4XAYA 4Y8FA 1K8YA 2DIEA 2DUXA 1ZAIA 4MJ4A 3H54A 1NH6A 2VGFA 4C6MA 3VU2A 2P0IA 2D0GA 1V4YA 3ZQ9A 1KXHA 3UG5A 4PMYA 1D7FA 3T2OA 2PU0A 3CB3A 2VX7A 4YYCA 5E93A 2VR5A 1PVNA 2D1ZA 4H83A 4WDTA 4U4MA 1EX1A 2VENA 3S9ZA 1R6WA 4UTKA 2ZE3A 4M1BA 3N19B 2V5LA 4UNKA 3FSUA 4MMWA 3NDZA 1A49A 1WDDA 3OZPA 3EOEA 4IIGA 2WC7A 3S9YA 1ISZA 3WD1A 5I79A 2TAAA 2PTZA 4AZ5A 1MUWA 2Y70A 2DZSA 4N6EA 3O0KA 3ENLA 4IQLA 2QGHA 1F3XA 2FVLA 1XCFA 5CPSA 2J8TA 2BP1A 1VBJA 3DC8A 1JCXA 1EBGA 2OWXA 3QY8A 4W84A 1Q6EA 4FNPA 3IRSA 5CBIA 7REQA 2GOUA 2DJLA 4XZIA 3MZ2A 4LTSA 5K2ZA 2PCEA 3HV9A 2PDHA 5AC7A 2C0AA 4O4VA 1LCOA 1SFTA 3G2GA 4DM1A 3OZYA 2X8RA 4DNMA 2ZX7A 2R94A 3UPWA 4GUJA 2WSYA 2ZUWA 3GNNA 2VYOA 5I3JA 5LNUA 1Y65A 1H61A 1ZJIA 4ZOBA 2ICSA 1TQXA 3AIEA 3ME3A 2VOTA 4DWSD 1VQTA 4HZ7A 1KFWA 4BZYA 3WH7A 5A8PA 2W9MA 5K9CA 3VKCA 4OBTA 1C9WA 4HVXA 3SRDA 1XKYA 4W85A 1X39A 3G3MA 2G95A 3FAWA 1M41A 4KWVA 1W9DM 1UD3A 2WYSA 4YLWA 1M6JA 5F1UA 3KFTA 4MOZA 4N4PA 3KE0A 4LAUA 4PA8A 2BY1A 1W56A 2XM1A 4AXKA 4I9MA 3S2CA 1TFVA 4CQCA 4IIFA 3SIMA 3QYQA 2BOGX 4BWLA 4F0LA 1IIGA 2FDSA 3QPZA 2DZAA 2OEKA 1XH0A 4FNUA 3IJ8A 6ALDA 4CGTA 4ZQMA 4ADUA 1J0KA 1LLWA 5B7ZA 3R25A 1N8WA 2PU1A 3TYAA 4FO4A 3VMOA 4ACZA 5CBJA 3FA4A 1ZSXA 4EPKA 3UU0A 3O2LA 1W1PA 3BAKA 3N14A 4QEEA 4UTFA 3STCA 2VC6A 1EJ7L 3CXOA 2VC9A 4Q8PA 1KC7A 2VC7A 3QTGA 1LF1A 4HPXA 4GZ7A