3V16A

An intramolecular pi-cation latch in phosphatidylinositol-specific phospholipase c from s.aureus controls substrate access to the active site
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
303
structure length
303
Chain Sequence
SDSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Structure of the S. aureus PI-Specific Phospholipase C Reveals Modulation of Active Site Access by a Titratable PI-Cation Latched Loop
pubmed doi rcsb
molecule tags Lyase
total genus 116
structure length 303
sequence length 303
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3v16A00
3L12A 4RW5A 5T9BG 1YDYA 2ISDA 1ZCCA 3V16A 6PTDA 3RLHA 2PZ0A 1VD6A 1AODA 1DJXA 3KS5A 3EA1A 3CH0A 4OECA 1DJGA 3V1HA 1O1ZA 2OTDA 1T6MA 4I9MA 4S3GA 2O55A 4F2TA 2PLCA 4RW3A 1DJZA 4I9TA 4PTDA 1GYMA 3RLGA 3PTDA 1PTGA 1XX1A 1DJIA 1V8EA 1DJHA 4GNKB 4RV3A 3H4XA 1QASA 2ZKMX 2FJUB 3EA2A 7PTDA 2PTDA 3MZ2A 4Q6XA 5T91A 2P76A 2F9RA 3OHMB 1T8QA 3KS6A 2OOGA 4QJ4B 3NO3A 3I10A 2OR2A 3EA3A 4I8YA 1DJYA 4I90A 4F2UA 1PTDA 4QJ3B 3V18A 5PTDA 3H4WA 4R7OA 3QR1A 4F2BA 5T9CE 3QVQA 1QATA 3QR0A 4I9JA 1DJWA 4QJ5B
chains in the Genus database with same CATH superfamily
4ZO9A 5I3DA 4DI8A 2XFRA 3V36A 4KRTA 4A3QA 3U8GA 3KE0A 3W7LA 4Q6JA 2EBNA 4FOUA 4S3CA 3S2JA 3PSVA 1VAHA 2XDFA 3TJXA 4JYDA 4K7YA 3WK3A 5CZJA 1BG9A 2CLOA 1QW8A 2CC0A 1MEIA 3IANA 3MANA 4LUTB 4LEQA 1Q6DA 1VHCA 4EOUA 4AD3A 1MNZA 3VZYA 3ZR6A 2QCGA 3CWOX 4QE5A 1QAPA 4IXHA 1K4HA 4PZVA 2CESA 4Q33A 4UFMA 3EKGA 4CNPA 4DJFA 1GHSA 3UY7A 1XLIA 3VVGA 3MCNA 1YE6A 4BZYA 1V6TA 3A12A 1BVNP 1WKDA 1UH4A 4A8NA 2BY2A 3V0TA 4JCMA 1SZRA 4O1FA 3TQ0A 1P7TA 2ANUA 1JFHA 1A5UA 3PFRA 1LP6A 3GNDA 5D02A 1G67A 3IJIA 1QNRA 1KTNA 3HQ1A 3TZFA 2PCQA 2OVLA 1RAKA 1W9DM 4GCAA 3CHCA 1ZLPA 4GUFA 3FSTA 3M7SA 3L0NA 4JR5A 5GQBA 1KNWA 3AXHA 3PPGA 5HR7A 4AMAA 4B90A 1OX6A 1JR1A 1XYCA 4NL1A 3HV9A 3PZNA 1JCLA 2CLKA 4IUGA 3T8LA 3WEMA 1YDVA 3E3HA 4O1DA 2HPMA 3WUEA 1RLDA 7REQA 3QR3A 2QEZA 4XIMA 1DWHM 5I79A 1TELA 1JPKA 1X8CA 1JZ6A 3WKZA 2DSWA 1GYNA 3NFUA 4XD5A 3PZIA 3PZOA 4KESA 4F79A 4IMFA 1E4LA 1XIHA 2JIEA 3SCQA 3E2QA 4DJDD 3AMKA 2WQDA 3DFSA 3HG5A 1KCLA 4LSBA 4I9TA 3CZ8A 3T4CA 3DYPA 1PIIA 4GXMA 4Y9OA 4US6A 2QUNA 1Q6LA 4PUWA 1X97A 3VNLA 1LQ0A 1Q7ZA 1XYLA 4M19A 1SFTA 4J9JA 5HJYA 4HPJA 2CLHA 3ARTA 4QEHA 5ABEA 3W7CA 5CPQA 5A6SA 3EYPA 4MWAD 4AQLA 3QZ6A 1EDTA 3UEQA 2ZX5A 1P48A 2BVYA 4ZXLA 4IPIA 1XIMA 5I24A 3LCHA 2HTMA 3M07A 1P6WA 4RR4A 1J2WA 4AY1A 4TV6A 3O6DA 1VS1A 1EJSC 4U10A 1GOKA 4ZO6A 2JFEX 1XGEA 2WV8A 3EDDA 5BXTA 1JCYA 1VC4A 4ATWA 4Q8VA 2FZ8A 1TRIA 2UV8G 1XDLA 4HSHA 2ZZ1A 4GWEA 4J7RA 1THFD 1RHCA 2RJHA 3OQ8A 1OCJA 5T8GA 4RDZA 3BTNA 3PFMA 3UVIA 1V6UA 4FXRA 4QDMA 2XSBA 1X6LA 3W53A 2YXOA 3OTRA 3T07A 4B5WA 1C3FA 4FA3A 2OPJA 3LQLA 3P5ZA 1XIGA 3N13A 5EY5A 4KCVA 4PTDA 4ZO7A 5LA1A 3HPZA 1M68A 4AH7A 2ALRA 4MNKA 4ICMA 3GKFA 4P5UA 3S9ZA 5CGTA 1FTXA 2RHGA 2QGHA 1AMKA 1VRXA 3FDGA 2CW6A 2GJXA 5HJXA 3K46A 4PB3A 2GUBA 1E6XM 4D2JA 4AEFA 1AL7A 3OIXA 4JHZA 1TTQA 2QCFA 3T40A 4ZVJA 4D1IA 1DE5A 1GVQA 1O5KA 2C15A 4LUIA 4LJ3A 3PP7A 2V38A 4CU7A 3T7VA 4ZSTA 3I3EA 1XISA 2CU0A 1UW9A 3M0YA 2DW7A 4GINA 4CQ8A 3QR1A 3EDFA 2L5HA 2X1UA 1REQA 2A6NA 3D47A 2ZUWA 4GZJA 1Y0EA 4KRUA 8XIAA 3ZR5A 5DN1A 1NAL1 3O3RA 3K1GA 2EGZA 5MHBA 3VNZA 3AMGA 5I02A 4JY9A 1X8FA 3HGJA 1VPXA 5BYWA 3N3MA 3WF3A 4KT2A 5CGMA 4IFRA 4OUEA 1B4EA 1E0XA 5BRPA 1VCFA 1JZ2A 3EA1A 2EPOA 3ARQA 3VNDA 1XI3A 5LSMA 3OZOA 2J9XA 5J5RA 3OB8A 4CCCA 1TV7A 2XIMA 2CZ5A 3G1HA 4U5IA 2HXUA 4NAEB 3FSUA 4H19A 1SR9A 1NWRA 3MHUA 1H60A 2ZXBA 1MNSA 1GORA 3BQ5A 1UOKA 3FAWA 3CQIA 2R9RA 2RDXA 3WQFA 3WF1A 1WX0A 4ZOAA 1DJHA 2PDYA 5G2HA 2DVXA 4FF5A 2H9AB 9CGTA 3TC7A 1QFEA 4JN7A 3TONA 2E28A 1GW9A 4GQGA 1HVQA 2PGFA 4UTJA 3AS2A 3GNPA 3LRLA 2J6VA 1US0A 2B7QA 3SIZA 4HSOA 4XX6A 4B2DD 2FFIA 3I10A 5LIUX 1HKJA 2OR2A 4OOZA 3IJ8A 1RY8A 1HL8A 2VX7A 4KIEA 4ORIA 1CGXA 3B8WA 3W7PA 1O94A 4HPXA 3TNBA 1U22A 1M6JA 5GNXA 3NGJA 3MP4A 4AB4A 4AVOA 4FNQA 3MC5A 4CQBA 4AD4A 3PWIA 1V3IA 4DPQA 2PLMA 1EP1A 5E5CA 4J2PA 4LVFA 2Y7GA 4JIQA 4JYEA 1UH3A 2XWDA 3E38A 5JXQA 1IF2A 2VL4A 2V3GA 3PJTA 1AW2A 4A3UA 3GHRA 2EPNA 1HKVA 4AXNA 4QDPA 1JGMA 4RZ4A 1WDSA 4KFPA 2ZRXA 4JQ4A 4NI8A 4LQ1A 4F66A 1GVYA 1ECQA 3C56A 1MSSA 1Q85A 1K6WA 1T41A 2AQOA 2R1NA 3UXAA 1OZQA 2YYTA 1CGUA 1XUZA 5HOSA 5M5DA 3GUGA 4YHGA 3VZZA 4CNUA 3LLXA 3GYCA 1OYCA 1VBHA 1EOMA 2BOGX 1BEUA 3IVTA 2D2JA 4AVNA 4F8XA 1OFBA 2VZTA 3PR2A 2ALDA 1DIDA 3WNNA 2VCAA 3UQNA 1JEZA 4PUNA 4B3KA 2DVUA 1XRTA 1E55A 2ZUMA 1QUMA 1FH7A 2UY5A 1JXKA 4GABA 1H4PA 5E9XA 1YDOA 1JUEA 1VIWA 3W1PA 3LTPA 3NSMA 1GQKA 1AZ2A 3VIGA 5A8NA 1J5TA 1N7KA 1M53A 4QFUA 3MVIA 3U3HA 3GSMA 4YTTA 4IUOA 1OFQA 1YKWA 4F0HA 3MJMA 4K36A 3W29A 3IIPA 3EWCA 2Z1KA 1UH2A 2H8ZA 2VUNA 4FIQA 1FWNA 1RV8A 4CU8A 5CG0A 1FH9A 1W5NA 4M24A 1OFPA 3VTRA 2O7SA 3W26A 6ENLA 1A50A 3ZVIA 2I14A 2XH4A 3PPHA 4O8AA 3TOPA 1ZP3A 4HU4A 4L65A 4Q4SA 5FF4A 3CAVA 3EGJA 2WM0A 1M04A 2X1SA 1TV2A 3GVGA 3CUFA 4GD0A 4Z08A 2PDJA 5F7UA 1HKKA 1T40A 3W28A 2UWFA 5B7ZA 4IG2B 4GJIA 1M7PA 5CC3A 1GTHA 4R85A 4DIAA 3AIQA 3SCOA 3OPSA 1ZUAX 3I4KA 3SCRA 2QCDA 1XLDA 3GUWA 1ZY9A 3VMNA 4IFOA 2F84A 3LSBA 5DX7A 4IT1A 1GHRA 3PVFA 3SCSA 2ZKMX 4H8NA 3APGA 4O28A 1HG3A 3V35A 3ZT5A 2GPTA 4IP7A 4LW7A 1BF6A 1EO5A 1SFJA 4N9CA 4URIA 3ELFA 3B05A 4H8HA 4TV5A 2JF6A 3DCPA 4KWUA 3GXFA 2IQTA 1TV4A 1WDWA 3BV7A 1E51A 2J24A 9XIAA 3ARXA 1XRFA 1BYCA 2VEPA 4UBPC 2YL6A 3NEHA 4GGBA 1KW1A 5T9CE 3GH5A 1ENUA 3KLKA 2FPVA 1DJWA 3GDLA 2C19A 3GXIA 1TX0A 1VBJA 4W8LA 5AC7A 4FNRA 5U7SA 1J8VA 3PBGA 2WANA 3KBNA 4US5A 2VGGA 3K8MA 3W4RA 1M3UA 4A22A 4EIVA 1IIHA 3EAUA 1VBGA 1QBAA 3CV2A 3QLLA 4LYPA 1RCOB 1X6UA 3UD6A 1XCFA 1GW1A 3M0MA 3Q45A 2PRHA 1B3XA 3M0JA 3Q67A 5M3WA 4DQWA 3IK2A 3AXXA 3TN5A 3CQKA 1GTEA 2RKXA 4LUYA 1QO5A 2VJXA 4JFSA 1P7TB 4M80A 1GVIA 1DBTA 2VURA 3S6OA 3NQDA 1KCKA 3B8UA 1E6QM 5G5IA 1D7KA 2WVTA 4NJIA 4OQVA 1TCDA 5RUBA 1U5JA 1ISYA 3IIXA 2HPIA 2CHRA 4KCUA 3GLCA 3COTA 2X16A 1UUQA 2TAAA 4DO6A 3LYEA 4A2RA 4TVUA 5C2XA 1YMYA 1N55A 3LUTA 5B7YA 1E0TA 4H83A 3W81A 4DEFA 4CCZA 3FA4A 4J3UA 2BHUA 4QJ3B 2GGHA 5F4WA 3N3TA 3UNTA 7REQB 1ME8A 1EP3A 4MB5A 2IQ0A 4JTUA 3DGRA 3P6LA 3TA6A 4H7ZA 1IE7C 4CU6A 4GX9A 1Y5XA 1ONXA 3RUBL 2Z29A 4MYAA 3VA8A 4LB4A 1GQNA 3LBCA 4E38A 2J62A 5KZDA 4HMNA 5G1MA 4UTWC 3RM9A 3FEQA 1S2WA 2A5HA 3HJEA 3W73A 1NY1A 2V81A 4CNTA 4AU0A 3L4TA 4LAZA 3LI0A 1C8YA 5CZSA 4G8TA 4JTJA 3ES7A 3HG3A 2CLMA 3RX4A 1XBZA 4DO5A 2PLCA 4E2VA 4CVUA 1J0IA 1FXPA 5KMYA 4DN1A 3NJ3A 3UNDA 1J0YA 3N04A 5HUPA 4XZMX 2WCGA 2OQHA 2V67A 1GJPA 4O54A 1KTCA 2J74A 3AMDA 1B5TA 2OSYA 1B2YA 3URQA 2O9TA 5I3IA 1QK2A 3LRKA 1DHKA 2J7FA 2QNEA 4LUJA 3KCJA 3OLGA 2R94A 4PCTA 4ZFMA 1EDQA 3V5CA 3LOTA 3BJSA 2NQ5A 4ES4A 1O66A 2GWNA 1HJVA 5XINA 3VAVA 1VHNA 4RXFA 3AYTA 5H2ZA 1V3MA 4OT7A 1BWVA 1M01A 2XN2A 2NVAA 4A21A 3M0IA 2JIWA 2QF7A 3QQ1A 1G5AA 4O19A 3ABXA 2ZE3A 5LHEA 2ZRYA 1SJCA 3S5NA 1N8WA 5DCDA 4OTKA 3CNYA 3WK1A 4NJGA 1MUMA 3K30A 3U48A 1G7UA 5HATA 3HURA 2PDBA 1ICQA 3GH4A 2EKCA 4ERAA 2XIJA 1T6MA 5JH1A 1FWJC 2XIIA 1VFSA 4JKLA 5CCZA 1Q6FA 1TE6A 1TWSA 1R46A 2PI6A 2GJXB 3N9KA 1NOFA 3IARA 3NQBA 2VVSA 3M4HA 1JUKA 2WW5A 3VXGA 1J0HA 3UWYA 2IQDA 3H26A 4H6RA 3BLDA 2XSXA 1HN1A 3BXWA 4B3LA 3L66A 1I0DA 2E3ZA 1V0KA 3B4UA 1D2KA 2CWNA 5J04A 3S83A 2P3EA 1QI2A 3GVRA 1ZB5A 2DGAA 3WBXA 4UTIA 1FXQA 1ZL1A 2VMFA 5A8QA 7A3HA 3CIWA 1R9YA 4JQAA 2C91A 2V0TA 1CLVA 1R3RA 4I8YA 1IEVA 1G0CA 3R0KA 1RBOB 4JTCA 3RU8X 3PULA 4JTTA 2VD9A 2PC8A 2C0HA 3GVVA 3GYEA 3W7NA 3UWZA 3ZO9A 5K7JA 3CT7A 4GYJA 3MKKA 3M6DA 5FJTA 1GKRA 4G7EA 1GEQA 1PKNA 3A3HA 3PANA 4KRZA 2Y89A 3BE7A 1WKYA 1H11A 5CZTA 3TFCA 1QI4A 3AZSA 2PWEA 4V27A 3UCQA 8A3HA 2EAWA 3AU2A 3N4FA 3ZWSA 3KS5A 4NYYA 5CPMA 4DBWA 3NO5A 3GR8A 4D8AA 2A3EA 4YWIA 3W70A 3N14A 3W7QA 4XB3A 3CV1A 3WNLA 4HU3A 4KS0A 1KM5A 3CUZA 2CNCA 4IIFA 4A8IA 2DZUA 3W6LA 5A2AA 1C8QA 2I5QA 2F38A 5C0QA 3EOEA 1HZYA 1SPQA 2W9MA 5A6BD 1KM3A 4PUMA 1TJRA 1EXBA 1H51A 3AYRA 3DX5A 4S3DA 1TR1A 3R4IA 3OVPA 4GX8A 1VF8A 1UPMB 5DY2A 3NQGA 3WQEA 3OA3A 1JULA 5AKQA 4TMCA 3T44A 4B5VA 1EBGA 2WSKA 3V75A 3SRDA 1HFBA 1JJKA 1UD8A 2R1MA 1KC7A 5TD4A 1FWSA 1LROA 2YSWA 3APTA 3SGUA 1OEPA 1V7AA 4WJXA 3VKKA 4I7VA 4ZOBA 3I6EA 1EDGA 3NVTA 5D2XA 2O0TA 1XYMA 1WUFA 1H2JA 2I5GA 3MSGA 1H49A 1FWTA 2E25A 1BHGA 2OFJA 2H3DA 2HEJA 3L21A 2V5BA 1VFHA 4AZ7A 1B4KA 2XM2A 2JF7A 3FIGA 3ABZA 3IIZA 2O4QA 4MUZA 4O0QA 5LIYX 2OT0A 2YCJA 3TQVA 1HT6A 3GD6A 2VQTA 3RMEA 2EG6A 4J3WA 1K9DA 6TAAA 2J7GA 3WQ6A 3H54A 5AECA 5LGZA 4U3AA 2VRKA 4RPPA 2IS7A 5CPOA 4Z17A 4GFSA 3MDUA 2ACUA 3M9YA 2E1DA 2Q3OA 3PNUA 1A4MA 3GDBA 3UPBA 4H6EA 4EPDC 2WWDA 3AIVA 3UZYA 2BSLA 1BFNA 1BG4A 3SN4A 3BG3A 5A3HA 3C8NA 4PTXA 3M41A 2POTA 3W07A 2XIBA 3O6YX 5HNRA 3URNA 3GFXA 1NF0A 4JEJA 3C2RA 3KDOA 4C6CA 4DHGA 3VUPA 3BICA 1OD0A 5DRCA 3NCOA 3WD2A 1PTDA 4B91A 1NJJA 3TAKA 1W3TA 3NYZA 3O16A 3W1XA 2C14A 4I5UA 3MUAA 3K4DA 4E2BA 4MDPA 2GQ3A 2X42A 3EDJA 5AHNA 3DENA 1Q63A 4DWSC 2WSQA 1DJNA 1KFLA 4Q8TA 1Q6QA 3M16A 4EXQA 3EWZA 3MMWA 3E5BA 1ZU8A 2WO5A 2EQDA 1FDJA 5M1TA 4PBFA 1AH4A 1OADA 1OC7A 1QCWA 5HANA 1VJIA 2GYIA 2QCDB 3W9ZA 1IXPA 4BI5A 4N6FA 4LBSA 2JEQA 3NURA 3RXZA 3ZOAA 2BVDA 1FY6A 3EWWA 3SUWA 3MO7A 3TJLA 4BEUA 2DIKA 2OKTA 1ZCOA 1TA3A 2VXNA 2ZRZA 3KLLA 3VKJA 3R13A 1HX0A 1VJSA 7TAAA 1QTWA 2VR2A 4LYRA 1JDDA 4HHPA 1UR2A 3TN4A 2B7NA 1ZJBA 3O0KA 3T8QA 2OQLA 4JKKA 3THQA 1H7WA 4UOJA 4H7CA 4MFEA 1ISZA 1QHZA 1U30A 2RH9A 4LAOA 4PH6A 1YW1A 3LGGA 5KETA 1GG0A 1Y5WA 4OU1A 1DWIM 2JGYA 4ZZ9A 1B3YA 2G3FA 3OYZA 3ID7A 5AZ1A 2J7BA 1AODA 3B9NA 3G6LA 1CIUA 4X22A 3NPXA 4JTDA 5D04C 4U31A 2PP0A 1BGGA 1A5CA 1O1ZA 4UR8A 4JX5A 1S38A 2EJ1A 1Q6CA 3GC5A 1A3XA 2Y88A 3M46A 4Z2GA 1UWQA 5FF7A 4I5RA 2H6RA 3ANVA 1YE4A 4P8UA 3M5XA 4K2SA 3OOQA 4LBUA 4QJ1A 4GYFA 2PDWA 1DPMA 4CLMA 4RDYA 3A5VA 2F6UA 3WBWA 1W54A 3OZYA 4NU7A 1KM1A 3H2EA 3IIVA 3UJ2A 5F1UA 4V15A 2IPJA 5LGXA 4AWEA 1W5MA 3FGCA 4NUWA 1FHVA 2OMAA 3TMQA 3AWNA 4KBXA 1J01A 3U6WA 3LA4A 4TR9A 2QS8A 3IPWA 3L5AA 3G5EA 2RFGA 4WXZA 1Q6EA 3ZT7A 1FHDA 5HQLA 1EEXA 1QOXA 3WNPA 2SFPA 3BG5A 4ZQMA 3WMBA 3IGUA 3IJDA 3QBUA 3CC1A 3C3UA 4UXDA 4C1NB 4HU0A 1RCQA 1P5BA 3WH7A 2A7NA 5K3VA 3WENA 3A4WA 3IVSA 1KV8A 2J6XA 2YA1A 3P60A 1XIBA 4JTGA 1W9UA 1M9HA 1F6KA 1DJXA 1F7BA 1JDEA 4S2BA 4NZ4A 4E0CA 1P0DA 4LVBA 2QMJA 1EWDA 3BMVA 2TYSA 2AMXA 3G0XA 1TPUA 3UR2A 3PBUA 3R10A 4KQNA 1J18A 4X63A 4ZR8A 3OLIA 2OLSA 4GPNA 4RX0A 4WK9A 4EPKA 1BKSA 4IWWA 4DJDC 3AMCA 1KFBA 4NJJA 4QG8A 1GG1A 1R8LA 3W23A 4PMYA 3W1MA 4CN1A 1HJXA 4XAFA 4IICA 1HP5A 1HJSA 2Y7EA 1M7OA 4Z0SA 2XHYA 2QCCA 4B4HA 4HPGA 5C7VA 2G3IA 1WV2A 3TMLA 3WD0A 3U57A 3DBNA 5D37A 3MCMA 3AJXA 4B15A 1TB3A 3U4FA 1ONEA 4AD0A 1XG4A 2X2YA 4JIHA 2ZUSA 5BMWA 4E2DA 3U7VA 4MWAC 1GKPA 2YCEA 1UBPC 1BGAA 3T1GA 4B9YA 4C65A 1ZAHA 1GZJA 3IUDA 4A29A 5L9FA 1IT8A 1FWGC 2YXGA 3MHFA 3RRXA 2PCEA 1QNVA 1WP6A 4JIEA 1UB3A 2WHJA 4E2OA 3W38A 1AH0A 4S39A 2PGWA 4LV9A 3VGFA 1OGSA 3FJLA 1YXYA 4RE2A 2OLHA 4Z1AA 1TIMA 4EPBC 1QOQA 1DE6A 3KBVA 3AISA 2VYOA 4M6PA 1G4SA 1UPPA 5H6HA 2CITA 4NRSA 1TO3A 1J2BA 3WCZA 1B3WA 1UZDA 4GI6A 2FZBA 3QSTA 3OJGA 4NHVA 2QAFA 1M1BA 3E0IA 1KV5A 1FDZA 5DF0A 4K8EA 3C0JA 3P93A 2ZUUA 4YPJA 2NX3A 4JTLA 1JI2A 1UMLA 5H8PA 1HJWA 4GA8A 3WL0A 4F0SA 3TWBA 1EJ7L 3G8EA 3DIPA 3CUGA 2CWXA 2WZTA 5M2FX 1XINA 3W2JA 1QWKA 3WBEA 1QVBA 5KINA 4LF1A 3LCGA 4MVAA 4G7EB 4XBJA 1I60A 1UZ1A 3W1NA 2QMKA 3DFOA 3AI0A 3GKAA 4MG4A 4QLJA 1YYAA 5DBUA 1EQPA 4H4IA 1PX4A 3FKKA 3CPGA 1J10A 4MKNA 4R5EA 5H91A 4AYSA 3KTCA 3KRUA 4PC8A 2X1IA 5DFAA 3LLFA 1D9EA 3V16A 1R38A 1LUCA 2JE8A 3LZ5A 3RR1A 3CMFA 4L4LA 5IRPA 3BLOA 4FI4A 4UC5A 1MDRA 3LXBA 3U2OA 3SI9A 3ITXA 9RUBA 1PIGA 3DHPA 1LRTA 2FH6A 3WFLA 4CEXC 4CQ9A 2NQJA 4Q8OA 3RRAA 3SCWA 4GMEA 4ONVA 1A0EA 2Z6IA 4LVDA 4KEZA 2JQXA 2EKGA 4CCEA 1PAMA 3WDRA 4FO4A 2PBGA 1RCXB 5KEZA 4DWSB 4C6QA 5DT7A 3K2GA 4Z2KA 5MF5A 4RV3A 4AHPA 3S1WA 3MP3A 3D5HA 3FA5A 3VIIA 3H2NA 4UUIA 3EB2A 3OO2A 3CV7A 3OBEA 1FWCC 4PRWA 4Q7BA 3EWYA 2XH7A 1K7EA 1GZ1A 1B3VA 4XBSA 3ISIX 2DSVA 3AS3A 3RN6A 3UPMA 1T99A 3QLDA 2WC3A 1DV7A 4KWVA 3H2OA 1V6WA 2POZA 4CVWA 4DAFA 1N8IA 1S5VA 1MUWA 3R11A 4TOQA 2FMNA 1EF3A 1LRQA 4TX6A 4EACA 4HP5A 4H9YA 4XD4A 3QM3A 1YDYA 3NEVA 5E0FA 1AW1A 2WSPA 3N73A 2INZA 3KVJA 2V3FA 3W37A 5C71A 4IFKA 3E74A 4TVCA 3TWAA 4BQ4A 3HU7A 1CBGA 3QC3A 1DYSA 4OBSA 5A8GA 5IBXC 4AHQA 2DDXA 1LZOA 5D8WA 3LHVA 3IJ9A 3SCVA 4E3TA 1UCWA 2CXEA 5DMNA 1H7NA 3C0QA 3CK5A 3AC0A 1OIFA 2WLYA 1CX9A 3VZXA 4DBUA 4WZHA 4YCOA 5A8OA 2E0PA 4YVVA 4ACZA 3F4VA 3IGSA 4AZ5A 4IIHA 1PDZA 1I4NA 3LI1A 2XGZA 1Q45A 1AUSL 3VD9A 2GUUA 1XLFA 5CBJA 4QNWA 1N2VA 3KAOA 3DC0A 5E0KA 1EUAA 4IPJA 4MWAE 8XIMA 2C3ZA 3R8GA 3A22A 3E0LA 4F0LA 5F2IA 2OWCA 3GBDA 1Y7VA 1A3HA 3HGOA 1GK8A 1W3KA 1O6IA 4JN8A 1MUCA 1NFGA 2VDIA 4NG3A 3N19B 5I3GA 2X0YA 4HJFA 3QVQA 4GI8A 4HYVA 1E4IA 4LWWA 3CIVA 1UJQA 4L9YA 1US3A 4M5PA 1RH9A 1XYBA 3CHEA 3F5LA 4A3HA 2J47A 2J9YA 4ALDA 3V0SA 2PU0A 2FQIA 3QOMA 2DEPA 3HA1A 1DWJM 2QIIA 1TYGA 2Y5EA 3LERA 4C6NA 1R6WA 2XSAA 1WZMA 5A8MA 3RJXA 1EJUC 2XJ7A 4U2YA 3G1VA 1Y65A 1CW2A 3FDKA 2DSUA 3JRKA 1TA3B 3SCNA 4Z1CA 4GVFA 2FTPA 2HXTA 3G77A 2QULA 2B7PA 2F61A 3B0XA 1W8SA 3O07A 1PTGA 4MGGA 4IMEA 2V6AA 1FWAC 2W0UA 1TMHA 2DZAA 4R88A 3PM6A 1ZBVA 3CMJA 1C8XA 2F2HA 3T0DA 3E2RA 4GHRA 1ZBWA 3EA2A 3BLFA 1BTCA 2NT1A 2Y63A 3GFYA 4C90A 3DI0A 4FB7A 5CXPA 1EC8A 2BHYA 1XLKA 3W83A 2DSKA 3PBMA 4XZHA 3TZNA 2Q71A 2VM8A 4XAPA 3UGVA 4JHOA 1F3TA 1KD0A 1I45A 3ME3A 3E96A 1G4EA 3F4WA 3MYPA 2DUZA 2YCLA 1J0JA 3KBMA 1V77A 3VCRA 1VCVA 3MI2A 2QV4A 1D3GA 2OQYA 2HZGA 2PGEA 2ACQA 1W56A 3PF3A 1SJAA 4B5SA 3IVUA 1OCBA 4P7NA 3IGHX 2ZZ5A 4GBDA 4MWAB 3TYZA 5LXXA 2QF8A 4QS6A 5T26A 1ALDA 3K8LA 1SJDA 4WQ6A 2PWVA 3MMDA 3A64A 1Q2RA 1SO5A 4L5ZA 3W25A 3O8AA 3UYCA 1JF5A 5TBOA 3MUIA 3LXAA 2ZZ6A 4O15A 1MZHA 3CS2A 4QBXA 3TR2A 1BYDA 2XZ7A 4ZO8A 3SZ8A 4RE0A 1PBGA 5CLTA 5SWUA 3BLIA 1DXIA 5FJRA 1QNSA 3FGCB 1JQVA 4XIAA 4K1WA 2QVNA 7ENLA 3WH5A 3O1NA 2YA0A 3GBEA 3LDVA 1EGVA 4FNUA 2Z0IA 4LS2A 3DESA 4FXSA 1EGZA 5F2GA 4R27A 1XBXA 1LLZA 3W22A 3S1VA 1I9CB 4KPLA 3RM4A 1XLEA 2XISA 4KFNA 1QHPA 1FWHC 4FR1A 3L0KA 5FJUA 1I2RA 2BY3A 4N42A 2PWHA 3QC0A 5I3JA 2J7CA 1NQ6A 3KOYA 3H24A 3W27A 1F6PA 4MMWA 4KWSA 4IJCA 1BVZA 3NQAA 4RDVA 1FWWA 1CEOA 3VE7A 4ZTXA 1ZAJA 3WMLA 3VDBA 4MY8A 1AQHA 1UKTA 4O18A 2NLYA 3VIOA 4NZCA 1FOBA 3C61A 4QITA 3VPLA 4KEUA 2CKSA 2E9BA 2CCRA 4AEOA 2PTZA 2D20A 1RPKA 4IGHA 3I65A 2ZYFA 2Q8ZA 2PC4A 2XGBA 1UKQA 4DZIA 1I2OA 3VD3A 2MNRA 4LUSA 4B5UA 1V8EA 3WJZA 1NM9A 3N2TA 3F4NA 4PULA 3SDOA 3M7WA 4DX3A 4PB4A 1QR7A 4LANA 4OJYA 4O1AA 3A4JA 2E5BA 3BCFA 2FZ9A 3W7GA 4CKQA 3NVDA 1KBJA 4AZGA 4PYSA 4EE9A 1R30A 3SW6A 1UR0A 4FXJA 3Q4DA 5AHMA 4ZTYA 3CTTA 1VEMA 1W2VA 4FIRA 2Y7DA 4NIRA 3ONCA 2WMHA 3W24A 3LS9A 2Z4GA 4XO7A 4O1BA 4NZFA 4P61A 1MWOA 2BP1A 3UY8A 2CLEA 2F8QA 4O17A 4UTFA 1E40A 2EPMX 1H61A 3GZAA 2OO6A 2QR6A 1CI1A 4QR6A 1JPMA 1ZNNA 3RFAA 3IV3A 1JD9A 3JW7A 1XLBA 4JDYA 3KVMA 5A6BA 2IPGA 2V68A 2VQUA 4HYRA 3D3AA 4HZ8A 4W87A 2F6KA 1WXJA 4FZIA 2DSZA 2ZFAA 3SY8A 3PTMA 3V3WA 1R2TA 1CGWA 2DT1A 5AVHA 5C9ZA 4L6DA 4JYFA 1XH1A 2C71A 1OCQA 3BV4A 3A47A 4HZMA 3R94A 4MLRA 1A5NC 3RLGA 4K7VA 4XAGA 2P0IA 4MNMA 3R1ZA 4ACYA 2BDQA 3GU2A 4Q32A 3UCDA 4WSKA 4YTRA 4ZQRA 4PMDA 1XD1A 3QTPA 4M81A 4XTDA 3H4XA 4NNBA 1NP2A 2X1TA 2OJPA 1E6ZA 3I6TA 4BCEA 1KBIA 2I9UA 1F8IA 3KS6A 1F61A 3LSCA 4PEEA 1R3QA 4DXKA 3OIHA 1IWBA 2W79A 3CH9A 4D6DA 3FOKA 1O5QA 3S1XA 1W9PA 1TPWA 1I2QA 4MB4A 2GSHA 1YTKA 1LUCB 4M6UA 4E4FA 2OODA 4A8LA 4W84A 1IXOA 5LXEA 3NQVA 4BQ2A 3QGKC 3SCUA 3WDIA 4GUHA 3ICJA 2ZX6A 1OVDA 2EJAA 1AL8A 1X39A 1G94A 3WQDA 2D0HA 3B0VC 1HJUA 2GJRA 1JPHA 4DZ5A 4D9PA 2Y2WA 4O8RA 2MANA 1ZPTA 4L56A 1OK6A 3GNXA 4RDWA 4HJWA 5AY7A 1R9XA 3R0DA 1GGOA 3FXGA 3HG2A 2FPYA 2YL9A 3P84A 1SZGA 1CGVA 3KUMA 5EMLA 5HMSA 4DXXA 4Y9AA 3TSMA 1G6CA 1KQYA 4UQCA 4GK8A 3ABOA 1GOIA 3S2MA 3VIFA 3VGGA 1IEWA 2B7OA 3UGRA 2VCCA 4UTUA 3S8HA 3WF4A 3ARSA 2BHZA 3C0SA 2DW6A 2WMFA 4JFUA 3ZXWA 1VQTA 3BMXA 1UP3A 2A85A 5ECUA 5IM51 2E6FA 4JIIX 1OWQA 4UTTA 2Q3RA 2F6XA 3LCWA 2HE5A 3EB3A 2YXXA 5JUVA 1W3NA 1U33A 1Q8AA 1XWYA 1LLWA 5ECVA 4WUIA 4UNLA 4OV4A 2NXGA 3BPWA 3L12A 4ZB5A 2HISA 3GU1A 4IFKB 5EFDA 3DFTA 3SSJA 1NF7A 4LC6A 3PS7A 4Z2LA 1J0ZA 7XIMA 4M1RA 2XGIA 1TX2A 1I0BA 4Q3MA 4YYCA 3QMTA 4HPHA 1OIMA 2ZA1A 3BK0A 1R3VA 4LXFA 2QPXA 4UZUA 3TH6A 3LCXA 1R85A 4YHEA 1VPYA 3H7UA 2E4TA 3QY7A 4IQDA 1OX5A 4ACZB 1NEYA 1SW0A 4ZFCA 5XIAA 1A5KC 1H1ZA 4BQ5A 4RZ5A 2GVLA 1XR2A 3S47A 4N02A 1C7TA 4ECLA 1G69A 1FP9A 2A21A 2D0FA 3OZMA 3IUIA 4Z2HA 3ARVA 4A8RA 1XH0A 4HTYA 3ZSTA 4GO8A 4CQDA 1WOAA 1CYGA 3EEZA 3C4UA 4ORMA 4JKMA 2BX7A 5BMXA 3ITTA 3ZT6A 1EH9A 3QGVA 5KITA 4FR6A 4PFHA 3TOYA 3LM3A 3QF0A 3TQKA 1A47A 3MS8A 1ELSA 1WZKA 3WQOA 3DFHA 4DELA 3Q2DA 5A6LA 3HOJA 4GY1A 4I7UA 5D9MA 1KKRA 4L6HA 1P6BA 5K9DA 1EX1A 1TJ2A 2IXVA 1JXJA 3MSYA 1PS9A 4QGCA 3WO8A 3LRMA 4E8GA 3PBYA 3MPGA 3WJXA 4HA1A 5HAOA 1C93A 1IEXA 1Q6RA 5BRBA 1UWRA 1GKQA 1H7PA 3QYQA 4R9XA 1JCXA 2FYMA 4LS0A 4HNNA 3RHGA 3H2FA 4IP5A 4DJED 1ZJHA 1S2AA 3DGBA 1EOKA 3RPDA 1GNXA 1LM1A 1ZFJA 2J13A 4JTFA 4H9VA 4O57A 3VABA 4UIOA 3NPWA 3SIMA 4GISA 2XINA 3GH7A 4G9PA 4OVXA 2ZVIA 4U28A 3FFSA 1DHPA 3S46A 3V7PA 4BR1A 1S5TA 3G1DA 3A13A 1XC4A 3UF9A 1F73A 1BF2A 4S3AA 4FOJA 2PDXA 2FVMA 2VFHA 3AIWA 3QFWA 1FBAA 3S2NA 2ZZ7A 3GQYA 3GC4A 1YXDA 2WSRA 3QKEA 4TIMA 5AHEA 1KXHA 1MW0A 4UQEA 4DRSA 5LNSA 2ZDSA 2MUCA 4UFLA 4C6KA 2NV9A 3TC3A 1T96A 3H53A 4YN5A 4NJKA 3TR9A 4O4WA 1RP9A 2GDVA 4PMUA 2QCHA 5D05A 5C6MA 2VC9A 4F2BA 2CHNA 1H09A 4I9JA 4IMDA 4HOXA 1OJXA 1W17A 2A3LA 3ABSA 2X1RA 1ICPA 2P3ZA 1SW7A 4LYKA 1TPFA 4L9ZA 1G7VA 3S2LA 1SZNA 4L4OA 2GGIA 3VE9A 2CFFA 5XIMA 5BRQA 4WRHA 4KMQA 5CQ1A 4WOQA 3BG9A 5FJPA 3N15A 3R5EA 3AXIA 2WHKA 3R8RA 1RJQA 2VRJA 4J40A 2YBTA 1JCJA 2PDMA 3SECA 3AIRA 4C6OA 1EXPA 2Z2BA 2P53A 2WK2A 1SO3A 3LY0A 2WMIB 1XLJA 1AD4A 3IGXA 1IHIA 3KP1A 2DZVA 1LWIA 3EOOA 1F6YA 3E0FA 1F07A 4J35A 2WBKA 3WH9A 4R53A 2H9AA 2ON3A 2YR1A 5BW6A 2FGBA 3VNIA 3G6MA 4BJHA 4DYEA 1VFLA 1CENA 4YLWA 1V6YA 3W85A 1LORA 3YPIA 1RSCA 1NIUA 3ITOA 2NVCA 3K4AA 5ABFB 5GJMA 1HVXA 3S5YA 2IKJA 3QMSA 2V2HA 3BUVA 1NWUA 3G3MA 1V03A 4MFDA 5FF0A 5CPTA 2WB5A 2Y8VA 1GCYA 3ARWA 3ANUA 4GXPA 3JS3A 4C60A 3GG0A 1WKEA 4MF4A 3VGHA 5GNYA 1QATA 3DHFA 1EA0A 1S46A 3L4UA 4MAVA 5CEWA 3QPEA 4FNSA 2VGFA 4MYXA 2CLFA 3L65A 1M7XA 3K13A 4IPPA 3IEBA 1EHAA 2AAAA 3SUTA 5CSYA 2YPIA 2QVHA 5I3FA 3FHAA 5G2IA 1VD6A 2Z27A 2DH2A 5HINA 1HL9A 3LENA 3TX9A 4NX0A 3KOZA 1NFBA 3AYVA 4HCDA 4GUJA 1FWEC 1QPQA 1Q13A 1Z7AA 4TXEA 2FVKA 1Q6GA 4FXFA 2EHHA 2OTDA 1T7LA 2IPFA 1LOSA 2YW3A 5DMLA 2H3BA 3NOEA 5I00A 1W1VA 2O55A 4LUSB 5FJIA 1XIEA 1W5PA 3H2CA 4UOZA 2RDWA 4C6IA 4N9BA 4M7TA 3LMZA 4MUPA 3VOCA 3S5ZA 3MP5A 4LX4A 4PUUA 1X1ZA 3S3GA 1JNDA 1UHVA 4K6AA 3NZQA 3GY1A 2PDUA 1B31A 1YBQA 1MMFA 1MW3A 4AF0A 1EFZA 5J5DA 3ARPA 2R1PA 1CT5A 1VEPA 3NDZA 2XN0A 3M0HA 1XIFA 3H2MA 2XUCA 4F2UA 1WAWA 2VENA 1IXQA 2XIQA 2ZXAA 5DANA 1QI3A 5C70A 4YNGA 3GFZA 2Z1BA 4C6LA 4KERA 1OC5A 4DF2A 1NOWA 4ZENA 1XGZA 1H0IA 1VZWA 1XS2A 4KEMA 4MZYA 2WHLA 3OHIA 1JRBA 5JVLA 1B9ZA 3LTSA 3MKCA 2RDTA 4EWND 4NYUA 3W7IA 2FHFA 2YIHA 4MB3A 2NXIA 4JNMA 1FDYA 3CUXA 2PWGA 4AEEA 5HPOA 2NQ9A 1AJ0A 1OT1A 4UTKA 4NF7A 1XG3A 4HMDA 4PTNA 3PPCA 3URAA 3N11A 4LAUA 4ERGA 3BL3A 2QUMA 2W62A 2FDSA 2I57A 2OSXA 4CN4A 2HSAA 2VEGA 3R12A 2NQHA 1YX1A 2GDQA 1UKOA 1HW6A 3QJAA 4IQEA 4D6HA 3LPFA 2HQAA 2R82A 3CAKA 4N2YA 4WEVX 5ABGA 3EXSA 1QASA 2DJLA 1WUEA 3MUCA 4A05A 1QT1A 1VGAA 1TQXA 2ABBA 4WDUA 4Q4MA 1ONWA 1K8YA 4JNZA 3CLWA 5AOUA 2E67A 3PZ9A 4C6BA 5DXYA 5G4WA 3GTHA 3EWDA 4J3XA 3KL0A 3TJIA 3V18A 4H6KA 4AC7C 5A6AA 1E56A 1OFOA 4U3CA 3WNKA 4DJFD 2XN1A 1RBLA 1JDCA 1D3CA 3TXZA 1U5HA 1W3HA 3O2LA 1VBUA 4JXCA 4DM1A 3LB0A 2X8RA 4XAZA 2E9LA 1NSJA 2OYLA 2VFDA 2WCSA 5G4EA 1MW1A 4FLOA 5LNRA 4JTIA 4XZ9A 3T05A 4N9EA 3LMYA 5DY3A 5FA5A 3UXKA 1TJ1A 4BF9A 2VGBA 3PN8A 1K3UA 1BSIA 3LXCA 1JGIA 2UY4A 1WE5A 3B3DA 3WMSA 1MEWA 4IM4A 1WA3A 3DZ1A 1S1PA 1UR1A 2NW0A 1NELA 1H50A 3IK4A 4C1KA 1UBSA 4LVGA 4I9AA 3AHXA 5IHRA 4JZ5A 4D6CA 1XL9A 3NXFA 4CQAA 1ICSA 2HVNA 1H7RA 2E9MA 1CECA 2G8ZA 3PAJA 2EO7A 4DLFA 2VP8A 3TW7A 1HTIA 3B0YA 3LHZA 3WLHA 2LLEA 4MJZA 2P5NA 3S9IA 3PB2A 3WBYA 1VEOA 3QHNA 3OZPA 4LT9A 4LNCA 3UXIA 1VBRA 3QTGA 3RCNA 3RO6A 1EX5A 3L5MA 1PYFA 1JCTA 4PMJA 4XV0A 3PBWA 3KBJA 3ZSSA 1V3JA 4PUKA 4AZHA 5FOOA 2VEMA 3OG2A 3BGAA 4HNTA 1TPH1 3G1YA 3UP8A 2GVGA 3QSRA 2ISDA 4EVZA 1E9IA 1TJ0A 1UR9A 3MO4A 3A23A 1OF8A 1VR6A 2QCNA 5AC6A 4DXVA 1T5AA 1R0MA 3VNJA 3SRFA 2XFFA 4IIBA 1KFKA 2PDPA 4JFWA 2CBJA 4OECA 4BKNA 4XVEA 2C79A 4QROA 4TVDA 4POCA 1H5YA 3WD3A 1NDWA 2PWUA 2PLKA 3SUUA 1XRSA 3HJZA 1CGTA 5K4XA 4LU0A 5CG7A 3CYVA 3MW7A 3GM8A 1AQMA 1FCVA 3L5LA 3C2OA 1TE1A 3D0CA 1I1WA 2BMBA 2UZ9A 4JL1A 3KZSA 1HF6A 3G22A 4W5UA 2CLIA 2IW0A 4K8GA 4O11A 4AMCA 1WQ5A 2Y0FA 3VCNA 4RNIA 3T0BA 1W37A 1XPGA 2QCEA 2X0HA 3CAWA 1F9CA 1LL6A 1FKXA 1PSCA 3GG8A 4Q7IA 4EKJA 3GXNA 3QW3A 1XKYA 1WZAA 1DTUA 4RPQA 4GJJA 5I03A 4IJBA 1S1RA 5M03A 2Z2AA 4I90A 2GVYA 4DNMA 5D30A 3ZJ7A 5PTDA 4REQA 3FA3A 2HMCA 3QW4B 2EPLX 4CNOA 1MO0A 4OUIA 4E4UA 4HGXA 4GCXA 1AA1B 1L0PA 2VC5A 1QK0A 1BQGA 2D0GA 4JTSA 4O0KA 2VI0A 4F9DA 4B92A 2AMGA 2QQ6A 3THDA 4HTBA 2R6OA 3AROA 5BXRA 4AZCB 4EAMA 2GL5A 3VNMA 2OSWA 4D8ZA 2R1LA 2DT3A 1QHOA 3W72A 2XH2A 4H8VA 2VR4A 3WLQA 4MKSA 3R7MA 3BLPX 4AC1X 3L4WA 3VYLA 1MQPA 2EF9A 4Z1DA 3CZLA 3KEHA 2Y1HA 2D2GA 4XD3A 3MA8A 1PEZA 3WH6A 4PMNA 4LC8A 1JPIA 1KCXA 2BBFA 2C1GA 3UG5A 3WLNA 5HA7A 1ZAIA 3RPTA 4K1GA 2PB1A 3L4YA 3U5UA 3FS2A 4DYKA 4HN8A 3EOSA 1GJWA 5LYRA 2DZWA 1GOOA 3TYBA 4PUJA 3LPGA 2ZA3A 3NZGA 3POCA 3GTFA 4HZ7A 4A3YA 5IDZA 2Z1VA 1LRNA 3I7RA 2VTFA 2QUUA 2J7DA 3W6YA 2F9RA 2YB4A 3KRSA 4YL2A 4JNYA 2NUWA 1JZ3A 2OX4A 5AC5A 4XKMA 2CXGA 4A4AA 1E73M 3BAWA 2OZ0A 4QISA 3VM5A 4IGMA 1CWYA 1GJUA 1ISWA 4UMAA 3H4WA 3VMOA 3CO8A 3HV8A 4DO7A 2A4AA 5AYIA 4Q8NA 1FA2A 4HQVA 5C2CA 4O4VA 1IWPA 1QPKA 3K4WA 4W89A 1Z32X 1ADOA 2NXHA 3H7VA 3L7RA 3NDOA 1LOLA 1EGMA 1RVGA 1RXOB 4H1ZA 5BWAA 3P80A 3TC6A 5CJ5A 3ARRA 4XSLA 2YOCA 3LLDA 4DBSA 3NM1A 1RQBA 3W00A 3ARUA 1YPXA 1AQFA 3T0AA 2XFWA 1H3GA 3BJTA 1MZRA 4AWUA 4C6FA 1TIWA 3KL5A 3B04A 4WJEA 4AIOA 3N6HA 1MFUA 1GVSA 3LV5A 4Q8QA 3RMJA 1U2YA 5K9XA 3VGDA 3NR0A 3WL1A 1YXCA 3HFTA 3NUKA 2OCZA 1V4YA 3D3FA 2PWDA 1TPB1 4MJMA 3LZ3A 5DCEA 2ODOA 4PRTA 1C91A 4DAIA 4LALA 3MUY1 3MB9A 3FY1A 4UWMA 1X38A 3HFYA 4ZCWA 1AJ2A 3HN3A 3N17A 3UA3A 1G9HA 2QDEA 2ISVA 1TWZA 1LJYA 2NT0A 3WBAA 1UIOA 2BGNE 5C8BB 4P7OA 1FP8A 1MXDA 3SBFA 1J79A 1QDSA 4GI4A 4ML9A 3QV9A 4G5DA 4QIUA 3B8SA 4Y9MA 5FACA 4N4QA 4S3BA 3LHYA 4IMGA 3LNPA 3R6IA 2FLIA 2PP1A 4AUBA 3WELA 3E2SA 3M0LA 3REQA 3HPXA 3TVAA 3CT2A 2YJQA 3T2QA 2E8ZA 4S23A 4C6JA 1FX6A 4XZWA 6XIAA 3ARZA 3AIEA 1SGJA 1QWGA 5K4ZA 3W1QA 2CZFA 2YA2A 4RW3A 4ZQCA 1BVWA 4FX7A 4J1OA 4WVXA 3SJ3A 4BY3A 1HGWA 4HVXA 2PRMA 1LWHA 1HO4A 2WC7A 1FFQA 2QPSA 1NVMA 5EMJA 4HNUA 4MPQA 1YLVA 4AX7A 1QPRA 1YBQB 3QKZA 4AF0B 4QG6A 1GQLA 1TTJA 4N6EA 1VJZA 3M64A 2X7WA 1V7YA 1WB0A 2E68A 2ZX7A 2XVNA 2HBXA 3EXTA 4M7SA 3UZZA 4FX8A 1QI5A 3VFCA 3NZPA 4S3JA 3QFEA 4FS9A 3TXVA 3U5YA 3M5VA 2P10A 4ZOCA 4LB3A 1DTNA 3MMUA 3BH4A 3EWXA 3QV8A 4ZQPA 4JICA 4BS0A 3GIQA 3QMRA 1JYXA 1VIZA 3SSZA 3ES8A 4FF7A 3I7QA 1L8NA 5C5YA 3H4GA 4TTGA 2Q02A 3WLLA 1KRBC 3EWBX 3GZ3A 3CH0A 5GPRA 4ZMGA 5EKYA 1S39A 3CQHA 3GW0A 2CHOA 3W7OA 4DBDA 2A1YA 3NL3A 3PTQA 3A4AA 1W5QA 3VDGA 2Z7GA 5G4HC 1TPDA 4GIRA 3HGSA 4HSNA 1A49A 2X09A 2VFFA 3P74A 2X41A 3UR5A 1RA5A 1WYIA 4HKPA 1TWIA 5DMYA 1I8JA 1ML1A 5BNKA 3AO0A 1CXFA 4UTWA 4PMQA 3P81A 3FCPA 1JCNA 1V51A 1MRQA 4LV4A 4MJ4A 4US5D 3LG3A 1Q7MA 7PTDA 3B9AA 3GNOA 4NQ1A 1KBKA 3WLTA 4A35A 2ZZ3A 4X9SA 3ITCA 1PZ0A 4OKDA 1V3KA 4JAWA 4BQ3A 3S9YA 1H7XA 1IYXA 1EPXA 1WPCA 3R25A 1KBBA 1EZ2A 3P67A 5DELA 1SSGA 5HK4A 5C9RA 1BRLA 4ZA0A 3UG4A 5D33A 3ZLGA 4I6KA 1PX8A 1W32A 2BFGA 1TZ7A 4K3ZA 2IKGA 1J12A 5IFTA 1JD7A 1EZWA 4AY8A 4XD6A 1JZ7A 3WDHA 2BTMA 4NZ3A 1R86A 3KOWA 3EPMA 4S3KA 5H8UA 5FSEC 2I5IA 3W75A 3IRSA 1HUVA 2AKMA 3TW6A 5D9NA 1PX3A 3UJRA 2VFGA 2G37A 2BVWA 2PURA 3KVLA 3UYIA 1W1TA 1ITXA 2BG5A 2BGQA 4GQRA 4BFAA 1O4UA 2WZMA 4U33A 3U2ZA 3UZ5A 4DF0A 4CEUC 2HCVA 5I09A 4MHBA 2V5KA 1SQ7A 3DFPA 1R2SA 2WJDA 5D4YA 2J75A 5U4NA 3QGAC 2NV1A 2V82A 2WPGA 3TFXA 4PN2A 1H1YA 3LN3A 1BKHA 2A7RA 4HHMA 2YLLA 2OYMA 3GNRA 1AMYA 5A6JA 1WDRA 3WX7A 3M0VA 3UWWA 3SEPA 3EX4A 3TDFA 4IGSA 5AHLA 2GJNA 3HZ3A 3QN3A 5I0DA 3AAMA 1US2A 2J7EA 1OY0A 3A4XA 4QJ4B 4LCRA 5LIXX 2GJPA 4YTSA 4Q22A 1R7OA 3WZ0E 1XF0A 4KCTA 4RNHA 2I56A 2B81A 3W7MA 4IL2A 4C1NA 5FI8A 3KWSA 4YVXA 3AHZA 4QS5A 1YNPA 1MVYA 2WJZA 1LT8A 1CB7B 3NQ7A 1OYAA 3G2GA 5A69A 4UB9A 2BASA 1K9TA 1XD0A 3BW4A 4EAYA 1W9VA 2G97A 3L9CA 4IX2A 2Q01A 4GNVA 4NRRA 1ZCCA 1PB0A 2GGEA 2R14A 3WJWA 3Q37A 3TW9A 4FLRA 3CZGA 3VX1A 4WY0B 1GOMA 4M29A 4OHQA 4MNJA 3WQWA 2ZTJA 3BDKA 2VZUA 1PXGA 4F2TA 4ZQNA 4GQQA 1QNQA 3UXLA 2I16A 3DOPA 2ABAA 2VWSA 2PD9A 4E8CA 4P7LA 2Y8UA 3MV11 4QQUA 4HA3A 2OG9A 3PK7A 3EZ4A 3W0KA 4DUVA 4F3HA 1EJVC 1M5WA 4FLSA 1Q4NX 4XZBA 1ZJIA 4DWDA 1WKFA 2WVUA 3Q58A 4C7DA 2GQ9A 3GDMA 3QHOA 1NTHA 5H8MA 3R58A 4INFA 2QIWA 1FRBA 3HTWA 1K77A 4REQB 4ZSUA 1V93A 2NLIA 1VFMA 3CPUA 2Y70A 2W61A 1DIOA 1LDCA 2INEA 4Y9PA 4LEFA 2VKZG 5KZMA 1XLAA 3A24A 4J27A 1LBMA 3EXRA 1V0MA 3THCA 1OT2A 2P8BA 1PE1A 1S2UA 3KX6A 1EC7A 3MI6A 1UR4A 3VIJA 3H21A 2BODX 5CC6A 1AZ1A 3W7HA 3EMQA 3O06A 5IFPA 3AHVA 3DKLA 4R33A 3LV6A 5CBIA 3NA8A 3G1RA 4DJEC 5AFDA 3C8FA 4JTKA 5IHSA 1BWKA 3N29A 1W3JA 4ZOEA 1OFDA 2DZTA 3I4EA 4RNFA 1XUUA 1SMDA 4W5ZA 2YDSA 4L80A 3CASA 1DP0A 3TIMA 3W74A 4HCHA 3DC8A 3VDHA 1F5ZA 4MJ2A 1JZ5A 2IMRA 1KFEA 2C6QA 3TTYA 3WK2A 2JGQA 3OVQA 3PUGA 3NQ6A 5E70A 4BK9A 3L4ZA 4QDWA 3SJNA 1R3YA 3WH8A 4EP8C 4UMBA 4KGLA 3HPFA 2KX9A 1XW8A 1RUSA 1UWUA 3G24A 5FEXA 2G41A 3VI2A 3A9IA 2QJNA 3FJ4A 4X61A 3EDKA 3XISA 3OQEA 5AVNA 4PA8A 2G5WA 2PF8A 1TPC1 2G4JA 2NV2A 4LOCA 1BWLA 3C52A 1KR1A 5I2UA 3LNMA 3CL7A 2VX5A 1QNOA 1G4PA 3N2OA 5A94A 2WMGA 1NWSA 4D6EA 1TVNA 3WLIA 5A6KA 2WVVA 3BLLA 2OB3A 4LAMA 5DXXA 4EXBA 1NARA 1LLOA 2WC4A 3NTYA 4EK7A 3ZLHA 3TNOA 2V5LA 2XZ9A 4L4MA 4K8HA 4HCLA 4NNAA 4JGDA 1P0KA 3GTXA 3ABQA 1RBAA 4N7QA 2NUYA 4IH3A 3BOLA 3BOXA 4DI9A 2FMOA 2EXOA 5F2LA 1PWMA 3W01A 4LTSA 2OXNA 2QCMA 3DG6A 2PD5A 1ZP4A 4HA0A 1IEQA 4O16A 3PZVA 4DWSA 4S3EA 4PR4A 2DZBA 2O56A 3USBA 2WM1A 3F5JA 3ZLFA 2WCAA 2ASHA 3P8IA 4MM1A 4AVFA 5EMKA 2OKOA 4ADUA 3NPUA 2VZSA 1YNQA 1WDQA 4GVHA 3TN3A 3W1RA 1O7AA 5JH2A 3CHFA 1FKWA 2OWWA 4Q6XA 3T42A 1RVKA 2C7FA 2ZZ2A 4HNOA 4ZE5A 2XVGA 2G4FA 1EKOA 1ZTVA 1EYWA 3P8JA 5JBFA 1KLYA 4A3RA 3L67A 3QZEA 1QNPA 2NWSA 4YTUA 4H9XA 1RJRA 4Q8MA 4QTGA 1A5AA 5EMYA 4AG0A 5I3KA 2BVTA 2HVMA 2WPBA 3DXIA 4EXAA 2HK0A 4GI9A 5D2YA 2ESCA 3HM7A 2BXZA 4FOKA 5AHIA 3REQB 4D6GA 1ZHAA 5CH9A 1ISXA 1TMQA 3HQNA 4NVTA 1D8WA 2WKJA 3OW1A 3CHVA 3M47A 5AYZA 5DLCA 1LYXA 1TPVA 2J4GA 1OK4A 2DZPA 2I9EA 2PE4A 1QI0A 1MDLA 3LM7A 1UIPA 1GUVA 3GTIA 4IMCA 5A1AA 2PA6A 4RNJA 3WQGA 3IJ6A 5C9WA 1RZMA 4RXGA 3MZNA 1OF6A 5D09A 2CYGA 1SZFA 1UR8A 4OBRA 3KRBA 4WDTA 2J25A 1YIXA 3SURA 1XQKA 2E77A 3P62A 4PODA 3QEZA 3T4WA 1W9BM 3W3OA 3W1LA 1R87A 4AZ6A 2PDLA 3PHAA 4K38A 1U83A 2WZHA 2OT1A 1O5XA 4L1XA 4EPEC 4PCSA 4ERIA 3CUIA 1XFBA 1F3EA 2GK1B 3E1F1 3N2XA 3NNTA 1W9XA 1HP4A 3OGVA 4W9TA 1O68A 1MW2A 4L7ZA 3VDCA 1BXCA 3AHTA 2J9ZA 1RALA 1S5NA 1FCUA 5BU9A 3WEOA 5EMUA 4MZ8A 4J3TA 4GLEA 3KZPA 1RK6A 4YYFA 2PZ0A 1MXGA 1S2CA 1CB2A 4KWWA 2CKRA 1FFRA 3BQ6A 4HA4A 3TSBA 1PZ3A 2FIQA 1Q2SA 1PKMA 4P2VA 1X96A 1XSKA 2A3BA 2WKLA 3W2MA 3HG4A 1JI1A 3UJFA 4O12A 5LNVA 4IX0A 3ARYA 2DY3A 4X60A 3I68A 3EMCA 1EPVA 3OEXA 1OGGA 1WXZA 4L1GA 3AZTA 3UFYA 4L1WA 1ZJAA 1S2VA 5K2ZA 1EUNA 1KGWA 4JQ2A 3RX3A 2FHCA 1IR1A 3W1UA 3W71A 4JOMA 1P0NA 4ZBCA 4BA0A 4ZB0A 2VEIA 3AMLA 2DV0A 4WSJA 3PB0A 3QPYA 2P76A 3LCIA 3WLJA 2G95A 1T8QA 3N9SA 1BRLB 4FMVA 4DJDA 3IJLA 4JEQA 3RJYA 4HYWA 1CXLA 4RZBA 2FH8A 5BZAA 3AIBA 1TPEA 3STFA 3O0FA 4KFOA 4L64A 4UZSA 1NDZA 4ML4A 4IHCA 4QP0A 3SY5A 3TN6A 3WD4A 4S1FA 3UJEA 1Z69A 3TQPA 1A53A 1TRDA 2DH3A 4FX6M 3N34A 4XZIA 1BD0A 3WLOA 1XRVA 4GKTA 4DJFC 1Q3NA 4FAMA 3U2EA 3CEPA 2X40A 4KETA 5LA2A 1DOSA 2V5CA 4MWAA 1UD3A 2C16A 3UT0A 3GDKA 3W84A 5IXEA 3LEPA 5CGQA 1R7AA 4AYGA 1KXTA 1QBBA 1PL9A 4ROPA 3CGTA 2WOQA 4XBKA 2Z1XA 1Z41A 1BYAA 2TRSA 2W5FA 4OGZA 1EB3A 2C8NA 4Z2IA 1E6SM 5BWFA 3TYAA 3N6JA 3H8AA 3ECQA 3NDYA 3WSUA 1EJXC 3WUBA 1PVNA 2TSYA 6A3HA 1SO4A 1A0DA 5K9CA 4B5TA 3OODA 4CD7A 1E3ZA 1NWTA 2Z2UA 3TA9A 2ONEA 4XG1A 4O14A 1E6PA 4JX6A 1RY0A 3CM4A 3GR7A 1WXYA 1T8XA 3ORWA 2QGYA 5C2GA 1IXNA 3HQPA 2J88A 3L2IA 3HB9A 4OWGA 4ILSA 5FKYA 3G18A 1LWJA 4LCQA 5CLWA 3WF2A 8TIMA 1J9YA 3PC0A 3N2MA 1CLKA 5A95A 5CJNA 3WF0A 2JALA 2ATMA 1SU5A 2OO0A 3L2MA 2Z24A 1MFVA 3E02A 3IS4A 1P0BA 3AXKA 1E0VA 2XVLA 3OP2A 1E3XA 3ONBA 4U5KA 1L2UA 1TV8A 5FIPA 2YDAA 4ZL1A 5HMEA 5H1WA 3VKDA 1E70M 1EYEA 3UERA 1KRMA 3VUSA 2WJEA 3CU2A 1RPXA 3BMWA 4GUGA 2YYUA 4LGXA 6REQA 2AKZA 2ISFA 3NAVA 5HR6A 1KM2A 1W1B1 3KFTA 1B90A 3GU9A 5JU6A 3GTNA 4LNYA 2FZDA 1K70A 2AL2A 5FJOA 2IPWA 1YNYA 2AGKA 3S4TA 1ZRQA 4YXGA 2PSNA 1JPDX 4XAYA 3UXDA 3FNDA 2OOFA 1YRRA 4PTMA 1UQZA 3MQTA 2BWGA 1W8GA 2ZVRA 3V1PA 1XFCA 4UQAA 5HMDA 3LGDA 4GYPA 3B0UX 2GGGA 1TZ9A 3SN1A 1R3TA 1CGYA 4AZIA 3MSDA 5E9AA 1XKJA 3DYOA 5BXSA 3G1SA 2EPKX 2D3LA 3CUJA 3NQEA 4XZNX 3KHJA 5HMFA 4FNTA 3VCCA 4DPPA 2ACRA 1GPFA 4FEZA 1Y5VA 4ADSA 3T09A 1TV3A 2F7FA 1XJBA 8CGTA 3A21A 3NL5A 1WBHA 4QRNA 4IPLA 3KP0A 2ZRVA 1GVOA 2QLYA 2YZ5A 1D8CA 4V1YA 1ZZMA 2J8FA 1UZHA 2AGTA 2Y5SA 4B2DA 2CZDA 4PB5A 3TYCA 2O9RA 2GLKA 4WDXA 3EWUA 2PTWA 1P43A 3OVGA 5JIWA 2ZTKA 1JCMP 3LHUA 4WKHA 3DEQA 1SMAA 5HNUA 4A6GA 5D8ZA 1V02A 1SVDA 3ALGA 3FYOA 4OZOA 1WDPA 5A6TC 3K5XA 3UG3A 1E5NA 2DUXA 2GUYA 4QCFA 1P1MA 2HVOA 1VB9A 1W91A 4RKAA 2WXDM 4UMCA 3LHWA 1W1YA 3B8VA 5IBXA 3UWEA 3HMCA 3IIOA 1OABA 4GC4A 1VKFA 3PZMA 1RLCL 2QYGA 1TJPA 3TEVA 4WSHA 1FWRA 3CPRA 4XQ6A 1U1UA 1CXIA 1LG1A 5D9OA 2WVVB 2GQAA 3SCPA 3DUGA 4WOZA 1SW3A 4P7RA 3KOXA 4R7OA 3ZVHA 3F4CA 4FK9A 1UA3A 1KFCA 3GO2A 4ADTA 3VIKA 3BC9A 2PDIA 1BLIA 3MYOA 3WLSA 4ZEPA 2E7FA 3CZJA 1R3WA 2X05A 4AWSA 1C92A 2QJMA 1OBAA 2HRWA 2ATSA 1JAEA 4W88A 3PWAA 3VOJA 3WFAA 2C0AA 2JEPA 4GYPC 3TYUA 2Y6ZA 4NXSA 1PUDA 3W7EA 1HQTA 5D2WA 3GC2A 3CZKA 1QRQA 2QDHA 1UWIA 4BWLA 3KVKA 2OZTA 2A79A 1JFXA 2AQWA 1WBJA 4CD8A 2W91A 3W2LA 2FDMA 5B80A 5AC4A 3LCFA 1DQWA 2GVJA 3ZQ9A 1V6VA 4HU8A 5BOOA 2W6RA 5I23A 5C9UA 4H3DA 2YW4A 1S2TA 1VP5A 2YCKX 3W87A 2D73A 4FP1A 2OYKA 1MQRA 4TUFA 1J6OA 1Q6OA 2CETA 2VC6A 4KGJA 4ATLA 4HBKA 3VILA 1RP8A 4GH1A 2RGMA 2QJGA 1K9FA 3BW2A 4TMBA 1XBVA 5CBBA 4IF2A 2PU1A 3EX6A 4H9UA 5C54A 2HNHA 5CPSA 5CPLA 2ZX8A 4WDWA 3W7RA 3TK7A 1XH2A 4B3ZA 1TFVA 3FK4A 3QXBA 4O13A 2IKIA 3JR2A 3WLPA 4L6OA 4UCFA 3ATYA 1Q5MA 1K1DA 3S0CA 5G1YA 2HK1A 3ZR4A 3VOHA 3B8IA 2O7QA 3ZJ6A 3AU6A 3MTWA 6PTDA 4KF1A 5E09A 5BOEA 2OGJA 5AYYA 5HULA 3UBPC 1SR0A 4IIGA 2WAGA 1Q65A 3FYPA 1KLZA 2Z1WA 4QLKA 4NZ5A 3LPOA 4G2DA 3M0ZA 3GVQA 2WQPA 1EO7A 1PJ9A 2R91A 4XISA 2BZNA 3RM8A 3L2LA 3PTDA 2Z6JA 3ZJ8A 2WNWA 4Z0JA 5CSRA 2E40A 5I78A 4WX2A 4X9YA 4NKCA 3AHYA 4UR9A 2JKPA 3VNKA 1BPLB 2TODA 4S3FA 4NI3A 3WQVA 5FAJA 1XM3A 3DFQA 4BWLC 1UWAA 2DT0A 4NJHA 4YCPA 4CN6A 4GGHA 3AYSA 1UQYA 3NQCA 1XQLA 2Z00A 2ZX9A 1TVPA 1FCBA 5HPCA 3EOUA 4HK7A 3OA5A 1UA7A 2WWCA 5I07A 1L6FA 1AFSA 4J5NA 4DM2A 1NOUA 1Q4WA 3RG6A 4NSBA 4WKFA 2ZUNA 4Z2JA 3VKCA 4OBTA 2PS2A 3RX2A 2QJJA 2VNCA 3STPA 3UVAA 2XH0A 1SZEA 3TTSA 3AWOA 1BAGA 2E6DA 1P0EA 1A5OC 1KBLA 1Z42A 2D23A 3DG7A 2I17A 1E9YB 4RL3A 2WMKA 3LU2A 4MNLA 1RR2A 1RD5A 1GT8A 3GNNA 1XC6A 4C7FA 1YPIA 3C2VA 4WGXA 2YKKA 3BJFA 3CXOA 4H9MA 1P6CA 4YIWA 1H1NA 3N25A 1E1CA 2Z7KA 3UESA 1UOZA 3MU7A 2RGLA 2HV5A 3UA4A 1IIGA 3WNOA 2WZIA 4Q4PA 2DORA 4GH3A 3WQ4A 2BB0A 3WQ5A 1FCQA 5CZKA 1EWEA 4YTQA 1UWSA 3RK8A 2ZRUA 3CHDA 2XYLA 4B5XA 2PF0A 1LQ2A 2E1WA 1QMLA 3ITLA 3THUA 3AS0A 4AHOA 2Q09A 2FPTA 2ZCGA 2TMDA 1JUBA 4NZ1A 5KTLA 2Z28A 1WCGA 2VFIA 3UW6A 4QCEA 2PWFA 1XDJA 4P8VA 1XYZA 1PO9A 1W1A1 2CIPA 3TV8A 3DDMA 3EDEA 3WUGA 5T9BG 5ENLA 1L9WA 3FYYA 1ME7A 3S42A 4AD5A 1EEPA 5J8LA 3O63A 2XTKA 1Z9AA 1E4MM 5HNNA 4YWSA 3E2VA 1DJQA 2XPKA 4LY8A 1YADA 3RAOA 2VT0A 3BSHA 4HPNA 3S1GA 3IJ7A 2WMIA 1VH7A 3W1AA 1QPOA 4XO6A 2CPUA 1W31A 2H8XA 4GZIA 4GOAA 3EBVA 3T2PA 4XWUA 3L4XA 3WIJA 1EIBA 3G0UA 2ZXDA 2YFNA 2CEQA 3T08A 3GAKA 3SADA 2PMQA 1LT7A 3EMZA 4CD4A 5REQA 1DJIA 1H0GA 1V02E 1U1HA 5ABFA 4QNEA 4O1CA 2E6AA 3VIHA 1UG6A 3UWVA 3W82A 4MZ1A 3TAOA 3F03K 4M8UA 4P8XA 4UFKA 1KQZA 1J5SA 4BF5A 3AOFA 2JK2A 2ICSA 3CWNA 1ME9A 1B1YA 1W1ZA 2ZXQA 3NSNA 3PAOA 4HNCA 1TUXA 3B9DA 4BI6A 4G1NA 1IR2A 2J78A 5IDIA 3WG6A 3HBLA 4MTVA 3R8HA 3LK6A 3TUUA 4AD2A 5HQMA 2ACSA 1E71M 1SSDA 5BOFA 5EYWA 1L8PA 1TUFA 1REQB 2D69A 2V30A 4MLJA 4CQCA 1XLMA 2WJFA 3SRHA 2X7VA 3DECA 1ODZA 2PP3A 1EC9A 3N9RA 4MDOA 3CL6A 2DUAA 4AXKA 1B30A 3I3DA 3KRZA 4ASTA 2RUSA 3RF9A 3M44A 6REQB 2W67A 2V69A 3EX3A 4JX4A 2XU2A 5D2TA 3L68A 6XIMA 1I6NA 1SO6A 3OVRA 4DB7A 3H7RA 2AL2B 4HMEA 1OQFA 2PUZA 3KDNA 4QHRA 5F2MA 4HNLA 4PL2A 3FW6A 1W3IA 2DVTA 1AVAA 2X2GA 4O50A 5E6YA 1F4HA 1LL4A 2QKFA 1EJRC 5AZ0A 3QV6A 4TO8A 1L6GA 3V5OA 1GWJA 5D32A 2Y7FA 4Q4RA 2QJIA 1RQHA 5GJPA 1JZ8A 3WQPA 2QDDA 4I3GA 1A5BA 1IQ8A 4QE4A 4WY0F 1W6TA 4M0XA 3UG8A 3C5QA 3CUHA 3WY1A 3WQCA 3A9BA 4MY1A 3BAYA 4UOQA 3CQJA 4XZLX 1AD1A 1S5WA 1FH8A 3HIJA 1MEHA 1E9LA 2D24A 4IZGA 1BSLA 5MKGA 4C6MA 1Q7QA 1GVRA 1OFRA 3SO7A 3WN6A 4MKVA 4Y96A 2PGRA 1UYQA 3MBDA 3RCYA 3PUOA 1PHQA 1J93A 4GY7A 3PSWA 1XV8A 3LQGA 3FKRA 3NL6A 3G1AA 4H8UA 4IQLA 3DFYA 3DHDA 1VCGA 3QQ0A 1ISVA 1QPNA 3ITYA 3S1UA 1K4GA 2VRQA 4JQ1A 2G50A 2E09A 3O6CA 1WO2A 3UCCA 3P82A 1F76A 4I9MA 2QDGA 3SQMA 2B0MA 1ESWA 3UPWA 3M0XA 2A3AA 4NP7A 1AJZA 4X2PA 4GYKA 3AJ7A 3GG1A 1IZKA 3MSRA 1OCNA 2WYSA 3CB8A 3N2BA 4H00A 1GOWA 3BSMA 4GC3A 3TYDA 5JMUA 5I3HA 2I7GA 4B5NA 4GO9A 4RE4A 5DBTA 3W7DA 3SGGA 3MWAA 1GONA 4W85A 1XHGA 1XIIA 3W2UA 4ZE4A 4IOTA 3MZ2A 2J8GA 3DBPA 3MHGA 5CJMA 1OINA 4AIBA 1IGWA 3ZVHB 2D3NA 1KCZA 4D6FA 4PBGA 3LHTA 2VEKA 2YCIX 4D71A 1RK5A 1DWFM 1ZBKA 3AZRA 4W7VA 3WYZA 2OZ3A 2YDRA 1OD8A 3B03A 3ALFA 4WIWA 1Q66A 2QW5A 5TAOA 1B54A 3W6MA 2PDFA 3GWQA 1O5RA 4KIRA 3M1ZA 3VMPA 2VELA 3CQ0A 1VFFA 3GVWA 3F2DA 4KWOA 3N4AA 5M17A 4DUOA 3H55A 4Q4KA 3ENLA 1MRAA 4NILA 1E0WA 2AQVA 4LRSA 3MBFA 4QAIA 2V5DA 3EPNA 4Y7EA 5F4SA 5CSUA 1XCXA 5GJNA 4HNVA 5FAGA 5HWJA 3OLDA 2OLAA 5FD0A 5IOBA 1UKPA 1DWAM 4S3GA 2PODA 2DZXA 4PTVA 3ERPA 2OGYA 1RD6A 4U4MA 1KWKA 4JCLA 4H9ZA 3B8TA 1K8ZA 2HJPA 1Q8JA 2CLPA 3BCJA 1E1FA 1KM0A 4BHYA 3BVJA 4DUWA 2I1OA 3VFLA 4JHMA 1OGBA 3O05A 3CJPA 2VOTA 5T91A 3HQOA 3OGSA 3NQFA 1AG1O 4L4PA 2OOGA 3VX0A 3EPOA 1PKLA 4Y6GA 2PDNA 4GBUA 2Y5JA 3FX4A 1M41A 4QM1A 4HT3A 2ZZ4A 4B4FA 3ATZA 4FPSA 4D6IA 4QJ5B 1UZ4A 1JL8A 2QPUA 1UASA 3O6AA 4WCJA 4NASA 4JQ3A 4N9DA 4C6EA 2E5CA 5A6MA 3VNYA 4HB7A 2G3NA 4GIEA 3M6YA 5D03A 2CZEA 1GVEA 2UY3A 4Z42C 4ZODA 3GK0A 3L0GA 1Z48A 3DH7A 3W86A 4X0VA 4GXWA 4NT0A 1MYRA 1DWGM 3PZGA 2VWTA 1PZ2A 5A2BA 1G1YA 4M3PA 2UY2A 3UR8A 4I8DA 2PDCA 1TZZA 1YTEA 1QO2A 2VFEA 2VVNA 3VC5A 2DIEA 3C3NA 4DF1A 1ONRA 3PJXA 3C2FA 5JQ9A 3B4YA 4QQ3A 2O4MA 2PTDA 3AALA 4E6MA 3E6EA 4Y8EA 2WLZA 1S5MA 3MKVA 1SYTA 1W0MA 4O52A 3F1QA 4D8LA 1XPYA 2O9PA 3NO3A 1WZLA 2PPGA 3IRDA 3LPPA 1C7SA 3EA3A 1I2PA 1I75A 4ICNA 3QV7A 4O1EA 2PDKA 4ZXOA 3TTEA 1TWWA 2D2OA 3SUSA 4G6CA 1AH3A 3IWPA 1PCWA 1UWTA 5ABHA 2YB1A 3QR0A 2QUTA 4UQBA 3II1A 5D38A 4PSPA 1CCWB 1VRDA 3QPZA 1J11A 4RW5A 2HS6A 2GSEA 4AY7A 1V0NA 4AZCA 3VIPA 3R79A 5I7GA 4M82A 4H9TA 2Q8XA 7TIMA 3D6NA 1JYWA 2NSXA 1E1CB 4LYQA 3DI1A 4DZHA 4WKAA 1H62A 1H7OA 2FVLA 1P1XA 4PCPA 1CPUA 1QXLA 4GVGA 5JBDA 4GVIA 2J8TA 1XIJA 1Y8BA 4W7UA 1PV8A 3HMJG 1LF1A 1V6XA 5C55A 1IT0A 3WJSA 1MXSA 4W8BA 1J4EA 3ZM8A 4ENLA 3C86A 1VYRA 2E6YA 3C2YA 3GIPA 1W2PA 3AUOA 1R9ZA 2VD8A 3NG3A 1JG9A 4W93A 3VOFA 4LPCA 2UBPC 2FHBA 1JZ4A 2ISSA 7ODCA 1VFTA 4W4QA 2JBMA 4OV9A 2IXUA 2ISWA 4S38A 3GXPA 3I7SA 1NDVA 1F8MA 2P88A 2XFYA 4LY4A 3DYMA 1QU4A 3UU0A 4GNJA 4X0NA 4H7VA 1Z6KA 5EB8A 3KOFA 2W63A 3XIMA 1VLWA 3GDRA 2V2DA 2VDGA 2ZE0A 1XLGA 3VM7A 3ZZ1A 4B16A 1EL3A 1C90A 1EHNA 2EPHA 1UD2A 4WR3A 1OFAA 1QW9A 1CTNA 1XGDA 5DMMA 1A5MC 3RNDA 3OBKA 1DQUA 5FJJA 1E9ZB 4GQ0A 4NX5A 3IACA 3BAJA 2ZOXA 1JNEA 4TQTA 3RILA 4IQJA 2CBIA 4WXYA 1E15A 1DEDA 3EOLA 3ANYA 3DKJA 3VU2A 3WLRA 1AQ0A 3SY1A 3CL8A 3T9PA 4YVPA 5CKSA 5CSSA 2FB2A 3CEUA 4EWJA 1EQCA 5REQB 4W7WA 3SQSA 4GQBA 1V5XA 1ZSXA 4MY9A 6CGTA 1GZGA 5AHFA 3VKBA 2FZMA 3URBA 3U0HA 4MSSA 3GR4A 1HIZA 4QAWA 1EP2A 5DT5A 1OHLA 4V33A 3ZWTA 4Q8PA 1UP2A 2B4GA 5A8PA 4ICCX 5FEPA 3BAXA 1LG2A 1YEYA 2W92A 1XBYA 3GS6A 5I5RA 3B8DA 3G3DA 4F0RA 2V9DA 1HKIA 2EG7A 1OFEA 1YTDA 2YX0A 3QH2A 4P8WA 3H2AA 1DJYA 4IMAA 3F7JA 4HD5A 1A0CA 4A2SA 1HKMA 4D6JA 2BXYA 3USZA 1K8XA 1H63A 3PJWA 1LL7A 3QZAA 1TKKA 3T6CA 2XVPA 4RK8A 3OBAA 4JTEA 3BW3A 1GQIA 4F4RA 1PPIA 1SJBA 1ZQ5A 2GJLA 3GHSA 1KO0A 3UR7A 1BXNA 4AFYA 2FFCA 3PJUA 3P5YA 5CZ0A 3JZEA 2ZWYA 3RLUA 1TV5A 4DLMA 1DJGA 1HKWA 2AL1A 4V28A 3TP4A 1DXEA 4C5YA 1A5LC 3AIUA 5FL0A 3UWQA 2V5JA 4HHHA 5A2CA 3WFZA 3SN0A 1DJZA 3ZJKA 3GE7A 5E0CA 2EG8A 1GYMA 2XVKA 2C13A 4QEEA 3UZXA 3KTXA 2ZUTA 3GB6A 1EA9C 1XX1A 4BF7A 1WAUA 3FAXA 3TKFA 3P2VA 1V79A 1ZS2A 2DU2A 3DN5A 1UC5A 4E4PA 3N12A 2ZUVA 3RYSA 4J3SA 1DIEA 3TCEA 2B31A 2ZC1A 4E5TA 3BAIA 3W88A 4XUGA 4IIDA 4R34A 1RA0A 3BGGA 3RIKA 2Q8LA 3LX9A 8RUCA 2Y85A 5MKGB 3S5OA 2C18A 3SFWA 5LNWA 2EEXA 4RV8A 1C9WA 3SGZA 3R2GA 1M7JA 1N8FA 5HWMA 4ZB2A 1G01A 3CO4A 4AD1A 3KCOA 3VO0A 3QQWA 3MMTA 1E6NA 3NZRA 1UC4A 2VCBA 2VUYA 1E0UA 2Z25A 3UZJA 1Z3NA 3TLQA 4M51A 2ZWZA 4YU1A 1A80A 3QOKA 1TSIA 3HF3A 4KEVA 1LCOA 2HROA 2R8WA 3U9IA 1ECEA 2VDHA 4AISA 3WNMA 3W2KA 1NH6A 2ZRWA 1PDYA 1DL3A 1XXXA 3V1HA 4W86A 1E6RA 2P0OA 3UJSA 3MDWA 1KR0A 1JYVA 3H6OA 4LBRA 4YJ5A 2G0WA 4JN6A 4AZBA 4DZAA 3DFNA 3WLKX 1F3WA 4NNCA 5EBUA 1QOPA 3P7YA 4R7WA 1B3OA 1E72M 1FVPA 4MOZA 1IGSA 4Z1BA 5HDRA 3CV6A 4M1BA 2XM1A 4GNKB 3ZYZA 4UCGA 1KFJA 1T0OA 1IWAA 1SM9A 3CLMA 5EU9A 4G56A 1IEIA 4KKXA 4JS3A 1K8CA 3IAQA 2G96A 1PCKA 4PCFA 2OWXA 4UQDA 4TX8A 1O95A 4YMZA 1SFSA 1L6SA 2W3ZA 1S3TC 4J28A 4O10A 3STCA 4UFIA 5HUOA 1C9DA 3LBMA 2DIJA 1TMLA 3LD5A 3PG9A 2VO5A 1GVFA 5GVJA 2VZVA 2C1HA 3NQMA 4JD4A 5TQLA 2QCLA 3BSGA 4GZ7A 2NWRA 4ZQOA 5GNZA 3WJYA 3T0TA 2VX4A 1JAKA 3F2BA 2NQZA 5BXPA 2REQA 1R3SA 3CTLA 2JKAA 3AUJA 3SCTA 1OYBA 3APYA 2GSJA 3BAKA 1HL2A 1TREA 1CXEA 2Y62A 4LAKA 3NPVA 4F40A 5C7HA 3GDTA 3ZIZA 4E3VA 5I77A 3TSDA 3PZTA 2XIOA 2O9OA 1M03A 4TTUA 4NXKA 3HGRA 2CZVA 1FHLA 3WQ8A 2HWGA 2BS9A 2BOFX 3AFBA 5DQPA 1NP0A 3A3XA 4R9OA 1TR9A 3NGFA 4JL2A 2HBVA 1NFPA 1V3LA 3SR7A 4HMCA 2YL5A 4HZ6A 2P1FA 3LTYA 2FTWA 2PBOA 3B9OA 3KW3A 4ROQA 2DT2A 3DHUA 3PPFA 2PEVA 3AQUA 1B0IA 2J77A 5CAHA 1POJA 1OG6A 2TPSA 5AYBA 2NX9A 4WF7A 3BO9A 5LIKX 3EEGA 3VOIA 4F0KA 3P0XA 5LKYA 1ODUA 1KTBA 4O53A 4PCNA 2GWGA 2PAJA 3PY2A 5KSWA 3M5YA 2Y24A 3QYSA 3NL2A 4FHAA 1UR3M 1POKA 1H5VA 2YZRA 3BOFA 3GXTA 7CGTA 3JU2A 5LZLA 3KXQA 1AK5A 1R5YA 3Q94A 5EMMA 4JTRA 3B06A 1EF2A 3CMGA 3P3BA 3KTSA 2A0NA 1P4CA 3FHQA 2FB3A 4LFYA 4JTAA 2VX6A 1XP3A 4WY0A 4RUBA 2E8YA 5BCAA 3ZFHA 1FHUA 1XYAA 3T0CA 3GXMA 3BARA 3JUGA 2RAGA 3BCDA 2OELA 2WZEA 1XDMA 3D46A 3LCLA 1LQAA 1O1HA 1F05A 1FUYA 1UMYA 3EKZA 4CNSA 2QAPA 4N4PA 2E5DA 1I1XA 1TWDA 2A2IA 1L2QA 1JIBA 1KWGA 4CUCA 2HNEA 3P61A 4DY1A 1IZJA 3GG7A 4PMZA 2J66A 4XKYA 1DVJA 4I7WA 3E49A 4Y2WA 1SUXA 1V3HA 4ATDA 3BLEA 4E8DA 1G4TA 5JIPA 2QJHA 4C6PA 3GAYA 4XK2A 6ALDA 2GFTA 1KGXA 1F2JA 4L61A 4BEQA 3MT1A 2HS8A 2IUZA 3WEZA 2DJXA 3G1FA 5EGRA 1PTAA 4JY8A 1E4NA 4J3ZA 3SAZA 3DAQA 1MI3A 3L4VA 1KXVA 4JTHA 2DP3A 4I6VA 4NAFA 2A7PA 4DO4A 2PTXA 3NWRA 4JIPA 4TX9A 3S5SA 2V63A 3QRHA 1L6YA 2GOKA 1IV8A 2R24A 2YGYA 3OYXA 1LTDA 1QW7A 4CGTA 1KRCC 2KAUC 1PYMA 3QY8A 4PMRA 3TU9A 1GOXA 3F4DA 1BYBA 3NQ2A 5F1VA 3WK0A 1VFOA 3FV9A 3SRKA 1DXFA 2OZ8A 3VGBA 1R2RA 4W8AA 1TCMA 4PMXA 5DO8A 3O15A 5LNUA 4J2MA 4K68A 1B9BA 4M6VA 3E12A 2G3JA 1XIDA 3C6CA 4WHBA 1J0KA 5DEZA 1VENA 1OC6A 1X6NA 1ZENA 3MJYA 3MI3A 1QJWA 2QHAA 4FALA 1K03A 2D22A 3FLUA 4CNNA 4EX4A 2VGIA 3RU6A 2WNZA 1J6PA 3GX9A 2BXVA 1OX4A 4ZGYA 4IGNA 4XTIA 1ADSA 4NY2A 3V0UA 3EX1A 3ABRA 2A3HA 3THAA 2ZA2A 1KXQA 1XLLA 2O92A 2FTYA 1OG0A 1LBFA 4XVDA 2VEFA 4DBEA 4GE8A 2BLEA 4B9ZA 2VR5A 2FGLA 5E93A 2VOMA 2VHLA 1X1OA 1O12A 5FL1A 2PDQA 1E1EA 1B57A 1S3HA 3V4BA 3ITGA 3A5FA 2D1ZA 5LHFA 4J4KA 1OB0A 4UTLA 3I3BA 2QXWA 1BTMA 1ITCA 3CB3A 2PDGA 3LBOA 5EFFA 1VPQA 5DCBA 4D72A 5TNVA 5CC5A 3ITVA 2NUXA 3I6RA 3WDPP 2BOEX 4JPGA 4JFVA 1UUOA 4R7JA 3E0VA 1X7FA 1ITQA 5CAKA 4M56A 1EJTC 2CBVA 4Q8WA 4K39A 1KB3A 4AIEA 3T78A 1A3WA 4RLIA 1KRAC 2KZHA 3MUXA 2GVEA 5DRIA 1VFUA 2P8CA 4S2CA 2FJUB 6TIMA 4MAZA 3PNZA 4DNHA 2J27A 1V08A 3AS1A 2Z1SA 2Y8KA 4RJEA 5HQEA 5EL1A 4WJ8A 1XCWA 3W7JA 3N2CA 2BY1A 2HDJA 3SFKA 3NQ8A 4EF8A 2A3CA 1TTIA 4I5XA 3KWXA 2DQWA 3FJNA 3UZWA 4JBRA 4HOWA 2HE8A 1DORA 2F2KA 4IL0A 4Q4QA 3PZQA 1BXBA 2XWEA 1HGYA 1W3LA 3UETA 3TYEA 4P7QA 1UD6A 1F74A 3VOGA 1IT7A 3H12A 3FN9A 2D2HA 3MCOA 5HNTA 4PUDA 2PDHA 3RDKA 3NIYA 2PRLA 1W1IE 3WD1A 5F4XA 1UKSA 4X3ZA 4QSHA 3W76A 3NZ1A 3KBSA 4PE8A 3K8KA 3GIYA 3R0UA 1BQCA 4GACA 1CDGA 3BZGA 4KCWA 3POHA 4LUTA 2OEMA 3BZJA 1JRCA 2ZC8A 3WLMA 5I6SA 4GFIA 4PSRA 3EB4A 4GIYA 1WNOA 1UP0A 4AX6A 2GQ8A 1JYNA 3O7UA 3W2NA 4IPNB 3J7HA 3TTQA 3TLLA 5FSDC 4XSMA