3V16A

An intramolecular pi-cation latch in phosphatidylinositol-specific phospholipase c from s.aureus controls substrate access to the active site
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
303
structure length
303
Chain Sequence
SDSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Structure of the S. aureus PI-Specific Phospholipase C Reveals Modulation of Active Site Access by a Titratable PI-Cation Latched Loop
pubmed doi rcsb
total genus 116
structure length 303
sequence length 303
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3v16A00
3NO3A 5T9BG 4GNKB 3KS6A 3V1HA 4F2UA 1AODA 1DJIA 4RV3A 3V16A 4QJ4B 2O55A 1PTGA 3H4XA 3KS5A 4I8YA 4Q6XA 3CH0A 2ZKMX 7PTDA 4S3GA 1QASA 4OECA 1DJZA 3RLHA 5T9CE 4PTDA 1O1ZA 3QVQA 1DJHA 2OR2A 4I9MA 1ZCCA 1DJXA 1YDYA 1T8QA 3RLGA 3QR0A 4F2TA 4RW5A 1DJWA 2PTDA 3OHMB 1PTDA 5PTDA 4I90A 3EA2A 4I9JA 6PTDA 1QATA 1VD6A 4R7OA 2OTDA 1T6MA 3QR1A 3L12A 1V8EA 4QJ5B 1GYMA 2F9RA 2FJUB 2OOGA 1DJYA 3MZ2A 3EA3A 3H4WA 4QJ3B 2ISDA 1DJGA 4I9TA 3I10A 2PZ0A 2PLCA 4F2BA 3PTDA 5T91A 2P76A 3EA1A 1XX1A 4RW3A 3V18A
chains in the Genus database with same CATH superfamily
1ZAJA 3W1AA 2EF9A 4RR4A 8XIAA 3ANVA 3Q58A 1TX0A 2XIQA 3MVIA 4DY1A 2YW3A 2CLMA 4EXAA 3ZIZA 5BZAA 2NUXA 3GZAA 5KSWA 2DW6A 4XUYA 3KS5A 2E6AA 3PY2A 2DT3A 2Q8ZA 3EPMA 3T09A 1E73M 3NZPA 3W1RA 4U33A 4NZJA 5G2HA 2Z7GA 3K4DA 4R9OA 5FL0A 3LHYA 4MNMA 4NIRA 2QF7A 2OOFA 2Z25A 1QAPA 3K5XA 2CPUA 3B40A 1KM1A 4B3ZA 3WF3A 4PULA 1JCNA 1G69A 4C6FA 5HMFA 3BG5A 4C5YA 4X0NA 4HPGA 3BOXA 3GW0A 4IJCA 5M2FX 3KCJA 3V75A 3NSXA 4F66A 3UP8A 2PRMA 4QFUA 3F2CA 4MZYA 1VH7A 3W00A 5G1TA 3IIVA 1TG7A 4AD5A 2X0HA 4XIMA 1EO7A 4Q8VA 2FFCA 2O4MA 1OFAA 4L6DA 1ZENA 1FHLA 4MB1A 1CXEA 2CLPA 5A6MA 1Z44A 2Z6JA 3U8GA 1RAKA 1XBVA 3D3AA 2GWNA 4Q33A 5T8GA 2Y24A 4G8TA 1A5SA 2NX3A 3AIVA 2OYLA 1W3HA 1LLOA 5EBUA 4D1IA 3R0UA 4AD2A 1L6YA 2WC7A 4XK2A 5I3KA 4PB5A 3A9BA 4UNLA 3P6LA 1JQVA 3KM8A 3BG9A 3NL3A 2I5IA 3E2RA 1H3GA 4KCUA 1IT0A 2QGHA 2J9YA 1H50A 3KWSA 1XICA 5HQMA 4Y2WA 1X8CA 4LWWA 4MDPA 1XDJA 2PSNA 1LOSA 5I6SA 4DYKA 2DUXA 2VELA 3EDDA 5IFPA 4C6QA 4L9XA 4FIRA 4PMQA 3DG7A 3LGDA 4PBFA 4MY8A 3EYPA 3NTYA 4GFIA 3ARSA 1QCWA 3G8EA 4DJDC 3H24A 3UXLA 1VJIA 2RGLA 4GZ7A 4DJED 1YNPA 4YXGA 1R3VA 4IJRA 4BA0A 3BLEA 2ZTKA 1CECA 4KCWA 3L0KA 5FKYA 4Z0SA 1WO2A 4L6HA 1CLKA 4PR4A 4O18A 2WM0A 3LNPA 1DQUA 2YL6A 5LA2A 5C9WA 1ZPTA 2Y85A 4PMRA 5I3HA 1FBAA 4Z42C 3PG8A 4UTJA 2NQJA 3TYUA 5TF0A 4C6DA 3VGGA 5DLCA 3NZGA 1Z89A 3STCA 4W93A 1P7TB 1E6NA 4X0VA 3VE9A 3LYEA 3CLWA 3AU2A 1NSJA 1BHGA 2PDWA 1D8CA 1WKYA 4DZ5A 2VL4A 3QY7A 3L4ZA 4CQ8A 3P61A 3QH2A 1ZY9A 2Y5EA 5F2IA 1IIHA 2VWTA 4HBKA 2WHJA 1LM1A 3M5VA 4O1EA 4CD5A 1EBHA 4M8UA 1WUFA 4O4VA 3PUOA 4M6VA 4X2PA 4ZOAA 5D05A 5BOFA 5CKSA 3MP3A 1VHNA 1EOKA 6REQB 3DI1A 1DWAM 4AEFA 3RIKA 4JTIA 1MUCA 2VR4A 3ARWA 5CZSA 1XIJA 3USBA 2WJDA 3KL5A 2HE5A 4AY1A 1XSKA 4ML4A 1XL9A 4DO7A 1EQPA 3GKFA 2QNEA 4O1AA 1QBAA 4AB4A 5C6MA 3DFYA 4JFVA 1UZHA 4O57A 2VOTA 2QULA 2X8RA 5C9ZA 2CITA 2ZZ1A 2OODA 1XIIA 1VLIA 4UTWA 3WD0A 1VHCA 5E5CA 2DVUA 3MCNA 3W7IA 2TMDA 5KZEA 2ZRZA 3LNMA 2PBGA 1V03A 1TTPA 2JBMA 3BK0A 4M56A 4O28A 4L56A 3DYMA 3VFLA 1L9WA 2P0IA 2BP1A 2BY2A 5I2UA 1N8IA 2E8YA 4HSHA 4HOZA 3PC0A 3W38A 3GM8A 4R9XA 3W7PA 3MCOA 4A2RA 3BZJA 2A6NA 3NQ7A 3FKKA 3K2GA 3TYBA 1QATA 4GXMA 4PSRA 3EMZA 1LQ0A 3NJ3A 3P14A 4MM1A 1YBQB 2OTDA 5A8QA 2EBNA 1QNRA 2OFJA 1Q6QA 2J8FA 3N15A 3ZQ9A 4WK9A 1MZHA 4YPJA 1P0BA 4RLIA 2OEMA 3S2NA 5GNZA 3VD9A 3CUJA 3VDHA 3KDOA 1PX8A 3GLCA 4Y7EA 3QV6A 3AUJA 4LS1A 1H1NA 3F5JA 1VRDA 3P5ZA 2GQ9A 2TRSA 3B9DA 2WJEA 5FIPA 2EHHA 1FWNA 1W3JA 5KITA 2D23A 1WZMA 4DQWA 3VMPA 1KCLA 2WBGA 2QVHA 4Q8WA 4HB7A 4ZTXA 2FMNA 2W0UA 3ABOA 1RA0A 4M3PA 1XKJA 2CLLA 1J4EA 3AXXA 4KGJA 5C2XA 3AIUA 1W3TA 4UTTA 4LV4A 2R1MA 3P67A 2OT1A 3U5YA 1ME7A 3WK2A 2XISA 4GXPA 1MUMA 2AL2B 2FMOA 4RE2A 2QAPA 2Y61A 5BCAA 2AMXA 1LTDA 3U2ZA 5ABTA 3F4WA 4NRSA 5PTDA 2JF6A 1RCOB 4CQCA 4AVNA 5JIPA 5D2TA 3PULA 1MEIA 2V82A 2ACSA 1F8MA 3T1GA 3S1WA 1GW1A 1NAL1 2ZUNA 3BVJA 2GJPA 3UU0A 3T0CA 3O2LA 2HBXA 1W5PA 1T8XA 1V08A 3A21A 2J7FA 4Q4RA 3VFCA 4UC5A 3VCNA 3I10A 5HJYA 2YPIA 2DUAA 3CQJA 5F7UA 4NAEB 1XQKA 2JKPA 3PTDA 3CB8A 4UZSA 1GPFA 3FHAA 2ZCGA 3O0KA 3B04A 3GH5A 5HATA 4NZCA 4FX7A 2YGYA 4K6AA 3RK8A 1Z48A 4J3VA 2J9XA 3WMSA 3EXTA 4FSAA 1F73A 4RV3A 3ARTA 3DENA 1E6ZA 2WKLA 2YCEA 4MUPA 1W5NA 3V3WA 4IMEA 4NYYA 3ARUA 3T2OA 1RBAA 3TXZA 3PZOA 1V79A 2NZLA 1W1B1 4JTAA 3TYEA 4EWND 3CXOA 3SFKA 1DJHA 4P5UA 2J62A 1ELSA 1GTHA 1LYXA 4TIMA 3WJZA 4Z2IA 1SGJA 4H01A 2ZTJA 2ZXBA 1WZKA 3L4XA 4IF2A 4ZO9A 3D46A 1GEHA 1I60A 4HK6A 3SBFA 2H3DA 3ITLA 1OZMA 4WY0A 3W7QA 1PS9A 2GSHA 3WNLA 1PTDA 2VR2A 2D1ZA 3S42A 1GOXA 4I9JA 3R7MA 3LSBA 3HB9A 4MB3A 3KRUA 3NQVA 4IZGA 1JPMA 4G7EB 3OLEA 2CHOA 1XLKA 2GPTA 4XZBA 2V2CA 3MJYA 5A8OA 3AFBA 1W5MA 2WSKA 1DQWA 4MPKA 4HYRA 4PMYA 3APYA 3K46A 3BW3A 1OG0A 4OUIA 2Q8LA 3PTKA 3EWCA 4LJ3A 2PCQA 2GVGA 1V5XA 4HCDA 4ZO6A 3CMGA 4LBUA 3BW2A 1BYCA 4LYPA 1OX4B 1QI0A 3TTEA 1OK6A 1GK8A 1VBHA 4OJYA 1NQ6A 4D6GA 3IIPA 7PTDA 3AIQA 2F61A 4V27A 3GXDA 3VKBA 1SO3A 3AS3A 5CGTA 1UWRA 2VC7A 3G5EA 2XU2A 4MLJA 3TSBA 1GQNA 1TTQA 2V5CA 2A7NA 3TP4A 1W9VA 3S6DA 2J4GA 3E1F1 3SUSA 3U7VA 1YKWA 1EB3A 2WCAA 1XUUA 4ZB2A 1E9LA 4GNJA 3H7UA 4PCTA 3GY1A 1PZ0A 3OTRA 3PJUA 3AJ7A 1JNDA 1V3JA 3FA5A 3PS7A 3FYYA 3BGAA 1TR1A 3BARA 4QJ1A 1VRXA 1R6WA 2Z1KA 3ARXA 4I9AA 3OYZA 2BOFX 4JIIX 2RKXA 1TWZA 3OG3A 4S2BA 3N4FA 1E0XA 4CN4A 4DELA 4Z1CA 4I3GA 2VVNA 4PUDA 3BDKA 1ISZA 4PEEA 1V6UA 4BZYA 3B4UA 3AYSA 4W9TA 3N9KA 4C7FA 1SFSA 4KERA 3REQB 2DZVA 1MI3A 3NQBA 4NX0A 1KFLA 3FGCB 4O15A 4GIAA 4W86A 1WUEA 1QNSA 1NM9A 3GE7A 4AMAA 2JKEA 3ARRA 5C55A 1XBXA 2ZVIA 5HQEA 7CGTA 4OOUA 5LHFA 3PZGA 4PUNA 4GGBA 3QV7A 2H3BA 4QTGA 1VYSX 1O66A 3VILA 3WQGA 3IV8A 4LY8A 3TR2A 3G77A 1XBZA 2E4TA 3UFYA 3TSMA 3CWOX 4PRTA 3CUZA 3W7RA 1GYNA 3LGGA 3MP5A 4RW5A 3E96A 1DOSA 1REQB 4JKKA 2ZXDA 3NPXA 2J7BA 3QLDA 2WVUA 3W7LA 1A5CA 4U2ZA 1E6QM 4KEZA 1WX0A 1NVMA 3UG4A 1HP4A 4FZIA 1K9EA 1T96A 4DXVA 3VIIA 4HNTA 3PZMA 1U2YA 3W2KA 2OT0A 3QMTA 4Q3MA 2E09A 4N02A 1YPIA 2Y89A 3N2XA 5HDRA 2VRJA 1BXBA 5CLWA 3W01A 3UG5A 5M5DA 1H7XA 4AIUA 3CB3A 3MUXA 2AQWA 1HKIA 2YDAA 1L8NA 4A8NA 4NAFA 2WSRA 1VIWA 1WDDA 3H2FA 4H9MA 1KKRA 4IP7A 4XSLA 1JYNA 1BXNA 1WZLA 4W7WA 5GPRA 4M1RA 2WC4A 5DRCA 4OECA 2GDQA 4MJZA 3TONA 5LNWA 3DG3A 5C7VA 2QAFA 5CSYA 2YBTA 4CQ9A 5DBTA 5HR6A 5CH9A 1R3WA 3UZJA 2J6XA 4AX7A 1ZUAX 2DQXA 3DCPA 3UNTA 4JX5A 2MNRA 2YYTA 3VVGA 1V4YA 3IV3A 4NU7A 1S2UA 3EXRA 3PZVA 1N8FA 4QE1A 2B0MA 2QVNA 1C29A 4KIRA 1J2WA 1VF8A 1UG6A 4AXNA 3S5YA 2PUZA 4XISA 2D2HA 4QSHA 3M44A 4O4WA 2I1OA 5FF0A 1TPEA 3M5ZA 1WXJA 3CZGA 3WDRA 1PDZA 4HTBA 1XLDA 4EANA 1OGBA 2FPVA 3MHUA 2WMHA 4GYPC 4K68A 3EA1A 3SRHA 4GO8A 4WQ6A 1JXJA 3L5AA 4HYVA 1C91A 5I78A 4JTTA 1FHDA 2HSAA 4GXWA 1U83A 3QHMA 1SW0A 3MBFA 1WQ5A 1JQXA 4M80A 4GCAA 1CIUA 2QPUA 4Q8QA 3A5FA 4TVCA 3NSNA 3WD3A 4GD0A 3FN9A 1X6UA 4IUGA 1YPXA 1CNVA 3K8LA 2YYUA 2KAUC 5A69A 4MWAC 3RJXA 3O16A 2XFWA 1KM0A 3MSYA 1T7LA 1RJRA 3RX4A 3VO0A 4F0LA 2PBOA 1JDDA 4Q7NA 3NYZA 2AQOA 2V68A 5G1MA 2PA6A 2PP1A 3LBCA 1R87A 3O9NA 1VKFA 1UH4A 3C6CA 1OYBA 4S23A 4UR8A 4IPLA 2DW7A 3ZSTA 1IHIA 1H63A 4ECLA 2V3GA 3S83A 1QFEA 3R89A 2F84A 3BLDA 1H1YA 5ENLA 4PTXA 4L5ZA 1EJUC 1U1UA 2DZBA 1HQTA 4MUZA 1JCLA 2VDIA 3GBEA 3LCXA 3SIMA 3DUGA 5DT5A 3GR8A 3R43A 1Q85A 3UZWA 1F3XA 3A4XA 3PBWA 5A6AA 3G0XA 3U5UA 1Y7VA 5C9RA 4O16A 1CEOA 1XCXA 2C19A 3AHVA 3EKLA 3AALA 2I56A 3HMCA 1S5MA 3TA9A 4R3UA 3NCOA 3UT0A 1AJ2A 5REQB 3W75A 3BANA 4FPSA 4P7LA 4AC1X 4H83A 4G1KA 4BQ3A 2I5GA 1H5YA 3O6AA 2JFEX 3QN3A 1OX5A 3V35A 1AD4A 1FWHC 3I3EA 3PPCA 2B31A 2IUZA 1MO0A 4M6PA 1S5VA 5AY7A 4ROQA 3ZR4A 3GC2A 2ZX5A 2ZWYA 3FKRA 1EDTA 4ZO8A 1JG9A 2FHCA 3SRFA 2Y6ZA 4LXFA 1V02E 2Q3RA 4OKDA 5LGZA 3M0ZA 3WK1A 1M53A 3W02A 3FVDA 3TU9A 1W9DM 3LXAA 1QI3A 3SGUA 2F6XA 1GOOA 3VA8A 3WLJA 1QNPA 4NJJA 3AOFA 1NU5A 1B3WA 2V5LA 2CLFA 4FNRA 1FY6A 4NF7A 5DT7A 3W82A 3BC9A 2VFIA 3VOFA 1QR7A 1GQJA 4QITA 1BKSA 3TV8A 5CPQA 4UTHA 5A8NA 2XIJA 8A3HA 3B8DA 4ZB5A 2BXYA 2J7EA 4JHOA 3NVTA 1WDRA 1R9YA 5ABFB 1V6VA 5FA5A 1VR6A 1CXKA 1J6PA 4YTRA 3BAWA 1OJXA 2E5DA 4Z1DA 2OWCA 1IXNA 4ZE5A 4ADTA 2QLYA 5H1WA 4HYWA 1RBLA 5I03A 5I7GA 1E4LA 4BEUA 1NEYA 1SO6A 1WPCA 1NJJA 3KWXA 3NQFA 1XLMA 1QPQA 1XV8A 1GTEA 8RUCA 4FALA 4TVUA 4H2CA 3QVQA 1OADA 1K7EA 4QDPA 1I1XA 3KVLA 5C2GA 5HWNA 2WC3A 3AMGA 1XRFA 1R86A 1TYGA 2E9BA 5SWUA 3HG2A 4F2TA 5G1YA 2FDSA 3AWOA 2NQLA 3G1SA 2I16A 4K7YA 3AIBA 1ITCA 1S1RA 5C9XA 3SSJA 3RNDA 3QQWA 3AIWA 4Q8NA 3BH4A 4W84A 2W27A 4DLMA 2MUCA 1VAHA 1OCBA 3GH4A 3KBNA 2OVLA 3CWNA 3ZWTA 3ES8A 1HJWA 1P7TA 3GBDA 3S4TA 1NWSA 1HKMA 2F6UA 3QPZA 3CBWA 1FWFC 1R3YA 1IT8A 4AZ5A 3GS6A 2CETA 3MWCA 3TLQA 2E25A 1ZAIA 2Z6IA 3LZ5A 3STEA 4CNUA 3S9YA 4YWSA 4XD5A 3B3DA 3WQPA 4GYFA 5I23A 5E9AA 3R5EA 3NO1A 5A8PA 1OB0A 1KLYA 1F4AA 3OU8A 4ZL1A 4EF9A 1QOXA 4K38A 4UFMA 3U6WA 1E56A 2CLEA 3KFTA 1KBLA 6REQA 2R9RA 2XSXA 2V2DA 3B8IA 2W79A 3IJ9A 3OVQA 3WBEA 3W1LA 2EPKX 3MKVA 1I2PA 3M9YA 5EFFA 4U5IA 1F7BA 4N9BA 3W76A 5CG0A 1JPKA 2VNCA 3TJXA 1GOMA 4FNQA 3P93A 4PB4A 1HGYA 3MUZ1 3GAYA 3F4VA 1O5RA 3RGTA 1DIDA 1PHQA 4GUIA 5CZ0A 3HMJG 3AMDA 1C8QA 1THFD 2OMAA 3WJXA 1UC5A 3CAKA 1OINA 3BGJA 3EX6A 3NGJA 3OG2A 3CZKA 1KA9F 3DI0A 3NL2A 4MYAA 2YR1A 4LEFA 4LRTA 2A1YA 4IQEA 3SCPA 3SADA 1H7OA 2VYOA 4DI8A 2C18A 4B90A 4GJIA 3WH9A 2WMKA 5D4YA 3KL3A 3PBGA 2C16A 1E4MM 4H8NA 4NZ5A 4YN5A 1XYAA 4HA4A 3CPGA 3WF0A 2VTFA 1VFOA 4QROA 1GG0A 4AZBA 1ME9A 4AD3A 2IMRA 3AXIA 4DNMA 4JTFA 4MVAA 1KNWA 4TTGA 3FK4A 3WFZA 1GOWA 4HP5A 4RXGA 1NOWA 3IVSA 3CUXA 3AIEA 3GXNA 1EIBA 1KCXA 3UZ5A 4E3VA 4WVXA 1TZ7A 3SUVA 3QFEA 1EIXA 3UPWA 3L65A 4CD6A 2PURA 3O07A 3HA1A 2ALDA 4IFRA 1S46A 1HVXA 4UNKA 1W1ZA 2OGJA 3AZRA 1B3OA 2WZEA 4BI5A 1QXLA 2DZSA 1YBQA 5IBXA 4J9JA 3G2GA 3OVGA 3BLPX 4EACA 2Z1BA 5MKGB 4D6EA 1BVWA 1KC7A 1S3TC 4JTRA 1EJXC 3C0SA 4KESA 3Q37A 4GE8A 4DUXA 2ABBA 4IG2B 3T07A 3KHDA 5E1QA 3RAOA 4S1FA 1VPQA 4DXKA 1FWIC 2D20A 2OSYA 3AWNA 4MKNA 1A5OC 3AHYA 1PBGA 1CGVA 3P3BA 2R82A 3B9OA 1JFHA 2G5WA 5K3VA 4H4IA 1B9ZA 1TZ9A 3ABZA 8CGTA 4H7ZA 1QW9A 2QQ6A 3ERPA 3SN4A 4Q32A 4YL2A 3TN6A 2YDRA 2Y7EA 4DLFA 4UTFA 3WG6A 4KW2A 1P48A 3ELFA 3GW3A 5DMNA 4PTNA 2AL2A 1I9CB 3T08A 3URBA 3QW3A 2VJXA 1X6LA 5JH1A 1OYAA 5T91A 2DIKA 3FOKA 2YBVA 5AZ1A 1LWJA 5CG7A 3WIJA 1PB0A 1JJKA 5AB3A 5D2WA 2Y5JA 4L64A 3LA4A 3IGUA 2D73A 2X41A 3DGBA 1GVYA 4LB4A 1QWKA 2G3IA 4XIAA 2QHAA 3RILA 5CC5A 3RM8A 2JEQA 1GONA 2O4QA 3BQ5A 5AC5A 3PFMA 4G2DA 3H2NA 1VFUA 1UPMB 1XD1A 1G4EA 3AMLA 2ATMA 4NAEA 4N0RA 3N13A 4DBSA 2FQIA 2VZSA 3SM0A 3DC0A 4E2VA 1UKPA 5LNVA 4JHZA 3F2DA 1IR1A 2E9MA 3W3OA 5RUBA 1XH0A 4GZEA 3I3DA 3GWQA 1GOQA 1FQ0A 1PYMA 4LRSA 1F3TA 5BMWA 2FPTA 3V4BA 3DFPA 5D37A 4AAJA 2WNZA 1WOAA 2QUMA 4C1NB 2GK1B 1DE5A 2OGYA 1W2PA 4XZ9A 4KS0A 1XC4A 3LHWA 3GIQA 3HTWA 5M03A 3O3RA 4HSOA 4MOZA 1YNQA 2QCFA 4FF7A 1DWFM 2V0TA 2UBPC 1BYAA 5K9XA 1WKEA 2OG9A 4KWWA 1UWQA 2E0PA 1Q6OA 2ZZ6A 3W1NA 3BSGA 1O94A 1J10A 3LB0A 4GC4A 1DL3A 1X98A 3KHJA 5EBAA 3ZT6A 3DU0A 2XIBA 2DPEA 1OX6A 4DWSD 3W4RA 3W29A 2PD5A 1BKHA 4PGLA 3GDTA 3MPGA 3HFTA 1H0IA 3APGA 1O5XA 2C1HA 4JTJA 3GX9A 4DBEA 3GTNA 4G7EA 1MXDA 1VFLA 1MVYA 5F1UA 1DIOA 2REQB 3QGVA 3TJLA 4JYFA 2CU0A 3UJFA 1X38A 1QOQA 2Q71A 1EX1A 5EMKA 3MMWA 2PRHA 3RX2A 3BMWA 3FA3A 1DEDA 4Y9OA 4P7RA 1QNVA 2PU1A 5L6UA 3NM1A 1H7WA 3J7HA 2O7QA 3E2VA 3W71A 2RDTA 2QYGA 4MAZA 1G6CA 1J0YA 4Q4OA 1ZNNA 1CT5A 2XGZA 4OOZA 1RY0A 1C9WA 5M1TA 3SCTA 3THQA 3HURA 3QHOA 1UZ4A 2FGZA 3QLLA 4WEVX 1Q2RA 3S1GA 2CBVA 4MWAE 2XVGA 3EKZA 1GJPA 3I7SA 2V5JA 2YKKA 1W6TA 4F8XA 3TNBA 3TJIA 4EP8C 3DHFA 2QIWA 2V38A 1GNXA 1CENA 4EWJA 1K03A 3W7HA 4O13A 3GDLA 3B0VC 2CWNA 4P8VA 5CPMA 3VOGA 4A3UA 3GVGA 1OSEA 3UG8A 3JR2A 4GK8A 1GYLA 2X1TA 5CLTA 1YEYA 4PN2A 4O0QA 1OFBA 1RD6A 1TIMA 3DFHA 1EA0A 1RP8A 1RQHA 4BWLA 4O50A 1DWIM 4E8DA 3U48A 2Y62A 5AHIA 1E6XM 1GVRA 1C9DA 3LCLA 1S2VA 2FVKA 4XKMA 3F5LA 4Q8PA 3FV9A 3ZMRA 3VIGA 2NXGA 1RQEA 1XLIA 4DJFD 4FHAA 4C6MA 5C8BB 3W1MA 3HF3A 1PIIA 3QKZA 3FGCA 1JD7A 1O1HA 5CPSA 2NSOA 4C6IA 4KETA 3LLFA 1BGGA 2C13A 4ZA0A 1GZJA 1XYLA 2GUYA 4DF1A 1IR2A 1P0NA 2XH4A 3G6LA 4GA8A 3B4YA 1NY1A 3CM4A 5C9UA 1DJYA 1IV8A 4CLMA 5EGRA 3BLLA 3H22A 2C7FA 5E93A 2W9MA 1BF2A 3W0KA 5AECA 1NFGA 3TSDA 5K2ZA 5IDZA 3E38A 5MHBA 4FO4A 2QDDA 4Y96A 4S3JA 1YDNA 4ICCX 1Z6KA 1CB7B 3UWQA 4P2VA 4IX2A 1REQA 3L5LA 3GFYA 2HDJA 2CCRA 1AK5A 5JBFA 2J7HA 3DAQA 1X7IA 3GXIA 4JTEA 4NJGA 1FUYA 3RPTA 1NELA 2VCAA 3G8RA 1YW1A 4ZOCA 3BL3A 1LOLA 3ITYA 3O6CA 3TXVA 3GXMA 1TJPA 3E0LA 2DORA 1LUCB 1UKQA 1W56A 2WZIA 3GVQA 2D2OA 4YTTA 3II1A 5HJLA 4R85A 4L61A 2INZA 3IJQA 2NX9A 3IJ8A 2GJLA 5AC7A 1VJZA 4UWMA 1QBBA 4CQAA 4DX3A 1OWQA 2VGIA 2GDUA 3ZO9A 3C2OA 5CSRA 3KL0A 4DUVA 4QR6A 4IIGA 4WXZA 4ROPA 3NPUA 1W9PA 1NQKA 2WLZA 2X1RA 2IPGA 4J5NA 4ICNA 1M03A 3IJLA 4FR1A 3P60A 3WQ8A 4O19A 1XIMA 3EDEA 2X7WA 4E2BA 5C70A 3G3DA 1YDVA 3MUAA 3E0FA 1TJRA 5I3GA 4GNKB 4NI3A 3LRMA 4JDBA 2XSBA 2J47A 5G4WA 1WNOA 5U4NA 4DEFA 4LEQA 3E2QA 5CEWA 3UR5A 3MS8A 5BMXA 4IHCA 1QHOA 3TOPA 3KEHA 2PPGA 1JZ8A 2VDGA 5A6TC 2EPLX 4HPXA 3SY5A 4UFLA 4ALDA 3CH0A 4KRUA 4M6QA 3WD2A 1BF6A 3U9IA 1EX5A 3QZEA 4PEKA 4JZ5A 2ZDRA 5BOEA 3IPWA 3LPFA 2QIIA 4B2DA 4S3FA 1PHWA 2B7QA 1LL7A 3LI1A 2J27A 3FYOA 3LRKA 3EWYA 3ABQA 4ILSA 1KQZA 5F2LA 3N4EA 5AYXA 1GVOA 1XPYA 3WF1A 3EX2A 3UY8A 4JKMA 2YB4A 1ICPA 4QG8A 3TCEA 6TAAA 2VFEA 2G4JA 2Y8UA 1GKRA 3WDPP 4XAFA 1F2JA 2Y88A 3L2LA 1EL3A 3LQLA 1RPKA 2W3ZA 3ABRA 3RN6A 3KP1A 3C2VA 1LZOA 4DIAA 1D3HA 3BSHA 3CUIA 4IQJA 1Z9AA 5EFDA 3UXDA 1IZKA 5FJIA 1YIXA 4F9JA 1FWRA 4JTLA 3WEMA 4Z1BA 3FS2A 1ITXA 2GJRA 1SFLA 1XYZA 4CCEA 5DY2A 1L0PA 2POTA 3WLTA 2X1IA 1GVIA 4X9YA 4HT3A 5D04C 4A3QA 1NARA 4ZFMA 4RW3A 1E0TA 4WZHA 5CC6A 3HPSA 3VIPA 3MCMA 1XXXA 4XTDA 2BHZA 2VD8A 3MQTA 3WUGA 3K1DA 2QCDA 3THCA 3WQVA 1SR0A 1XRVA 1JRCA 5I09A 1FWEC 2IKIA 3NZ1A 3LOTA 4AD1A 3LDVA 2GJNA 4B4HA 1K4HA 4B5WA 4A8IA 3WLLA 4AH7A 1Q7MA 4B5VA 4AFYA 3CV6A 4BK9A 4AHQA 2FIQA 5G4HC 4MZ8A 4G9PA 4S3CA 5D2XA 3CMJA 4D72A 3GDBA 2X2YA 3BV4A 1Q6EA 1G5AA 2WWDA 4LS2A 5H6HA 4IIHA 4Y9MA 2BBFA 5GJPA 3VNKA 2NV9A 1XSJA 4LYQA 3RXZA 5REQA 3UPBA 4KF1A 3EB4A 3CTLA 2V3EA 1XLEA 1TE6A 3N04A 3S46A 1VEPA 2TSYA 4WJXA 5BU6A 4D1JA 3CQIA 3QY6A 2DUZA 2V9DA 1CXHA 4ZFCA 2XGIA 3P74A 3AXMA 2WCSA 4HN4A 1TUXA 4DJFA 1PKLA 2JK2A 4QBXA 2V81A 3UR7A 4WX2A 2FKPA 5LIUX 3CUFA 1QHPA 4EPKA 4J7RA 3TN4A 2VX6A 3EEGA 2G8ZA 3PWIA 1P6CA 1M6JA 4P8WA 3RRAA 4ZE4A 4KFNA 2HJPA 2P53A 1H1ZA 4A29A 2WWCA 4QEHA 1EP3A 3FJ4A 3C2EA 5J5DA 2DJLA 1UUOA 1QRQA 3PPGA 2VX4A 3HG5A 3R94A 3NXFA 3A4WA 4PMUA 3TC3A 2VCBA 1XKYA 3DBPA 3SUWA 2PD9A 4DPQA 4PTWA 2XN1A 1AFSA 3N6HA 4ERAA 4GVIA 4R88A 4YIWA 2PDNA 2QXWA 1M41A 3ARVA 3PPFA 4GI4A 3URQA 3WLIA 5DCBA 3MUIA 3GIPA 1N7KA 4L65A 4M19A 4DF0A 4I90A 3EB3A 1AJ0A 1B0IA 2YX0A 3L0NA 3S9IA 1BPLB 2DIJA 2XPKA 4U31A 4KH2A 3N6QA 4C7GA 4LV9A 2GZXA 4CN6A 3PN8A 4CNSA 2NXIA 4F0SA 4J3WA 1W2VA 1EOMA 1P6WA 2NVAA 1KM3A 1RHCA 1RK5A 3LSCA 1HJUA 2CHNA 3T0TA 3GNRA 3AXHA 4JFTA 4HA1A 4HOWA 3TYAA 2XFRA 3VIOA 3W7JA 1ME8A 1H4PA 2JE8A 3BJFA 1WOBA 3U0HA 1PPIA 4HJWA 5CGQA 3IUIA 5LHEA 3B0UX 4HMNA 1G94A 1E55A 3STPA 4IPIA 1ESWA 1UR4A 3VIHA 3W23A 3WQCA 4A8LA 3MSRA 3LHUA 3LV6A 2NWRA 3K1GA 1QU4A 3T6CA 3TAOA 2C91A 3TQPA 4GLEA 4MIMA 3U4AA 2XN0A 3CQKA 3ME3A 3SQMA 5BRQA 4WKAA 2AAMA 4ZOEA 5D8ZA 4ZENA 4IMFA 4EXQA 1H61A 3H2AA 2CW6A 2GJXA 2V5BA 1PV8A 3I7QA 2VRKA 5IOBA 2PCEA 3KTSA 4EAYA 2CNCA 3S1VA 5HBFA 4LVBA 6ALDA 3ZXWA 4YHGA 2Y7FA 5EMUA 1K1DA 5AYIA 4C6LA 2PGEA 1GVQA 3S0CA 1SVDA 2Z27A 1B3XA 2O7SA 1JPIA 1RR2A 5I24A 1M7OA 3W22A 1M7JA 1Q7ZA 2BB0A 1MDRA 4GIEA 5HR7A 4TVDA 4KGLA 3TX9A 3GFXA 4E6MA 1Q65A 5C54A 4JN7A 1J9YA 5M17A 4BI6A 4JY8A 1D2KA 5XINA 3CAWA 3IUHA 3TVAA 2A3HA 1BSIA 1US0A 1ZJIA 5FF4A 1Z8AA 2H9AB 3T4WA 4UXDA 3NQEA 1IIGA 4OUEA 4UQDA 1KV5A 1KTBA 3OGSA 4ZMGA 1PXGA 4LFYA 1UOZA 1PDYA 1NFPA 4XD3A 4F4RA 3KZSA 3OOQA 3ISIX 3OO2A 4M0XA 3S2LA 1YDOA 2E8ZA 3W2JA 1ITUA 2WKGA 1OT1A 1Q63A 1TA3A 4YMZA 4MPQA 2D3NA 1H49A 4RZ6A 1TPDA 3KTCA 3OLIA 3GTXA 2A79A 2BY3A 1M01A 1FKXA 1SZRA 1E0VA 3BURA 2O9TA 1V0MA 4H8HA 6CGTA 3VDBA 3STGA 1EUAA 4U3CA 2A7RA 4XSMA 4FXSA 4E2OA 2YBUA 4NG3A 2I7GA 1I1WA 1M9HA 4W87A 3WUFA 3ALGA 1WBHA 3M0VA 3W7GA 2C0AA 5MKGA 3RM4A 1H2JA 1NDVA 2CHRA 3LV5A 4IMDA 4FA3A 3GR4A 1LDCA 3PR2A 1EO5A 2BHYA 1KBIA 5A6KA 4WJ8A 1F6KA 1AJZA 1SZGA 3MMDA 1AW5A 4LOCA 4TX9A 4HD5A 1PZ3A 3TR9A 4B4FA 3RX3A 3RYSA 4JICA 3MBDA 1A0EA 4IG2A 2OQLA 3MW7A 4ML9A 1DWHM 3MP4A 3OIXA 4LBRA 2I5QA 3N3TA 1HG3A 3EDJA 4NP7A 2G0WA 1MWOA 3M41A 2E6DA 3QTPA 4XV0A 4FX6M 2WV8A 4N4QA 5DELA 1W54A 3SEPA 4WUIA 1K7XA 1UP0A 3ALFA 1JR1A 2OYKA 2PDBA 1NOUA 2RUSA 3KBJA 4HU0A 3QR3A 1YADA 4UIOA 3JS3A 1F6YA 2YIHA 4LVAA 4Z1YA 2WW5A 4JR5A 4YHEA 3EWBX 3BCDA 3GRIA 3OYXA 2VR5A 4XBJA 4PH6A 1O68A 1OC7A 2OB3A 2CBUA 2FYMA 2WMIB 3ZLFA 3K4AA 3EOEA 4I7VA 1MEHA 3DFTA 4S39A 3OP2A 4DPPA 2FH6A 2D69A 4HMEA 2E6YA 1Q6LA 2OKOA 1UROA 1VYPX 3UXAA 5A1AA 1ZL1A 3PBVA 1WAUA 2YSWA 3GXPA 3N34A 1BG9A 1R7AA 4A8RA 1W3LA 3SB0A 1TX2A 1MZRA 2R1PA 4H6EA 1OHLA 2C79A 4CCCA 2QEZA 5HULA 2BOGX 3B03A 3ID7A 1K9TA 4PCNA 2Z4GA 1NWUA 1FWSA 1L6FA 1EA9C 3N73A 1E9YB 2HVNA 4V2XA 4H9ZA 5JUVA 2NQ9A 3LTPA 3OA3A 1ODZA 1GQLA 1RA5A 2IPFA 2NUWA 4C1NA 4RDWA 1VLWA 1IE7C 3WZ0E 1E1EA 1VPYA 1CXIA 1O12A 2XZ9A 4NNAA 1AQHA 2J13A 4UFIA 5AHEA 1JIBA 4JEQA 5EMYA 3U57A 1SSDA 4J40A 4LT9A 3W7OA 5D30A 4HHLA 2WLYA 3MSGA 3P7YA 3FJLA 3CEUA 4KCTA 4ZTYA 1T99A 1OC6A 3W27A 4LVGA 2XWEA 3GO2A 1PVNA 4KRZA 1UP3A 4TXEA 1XLLA 4JL2A 2D0HA 1M1BA 1QVBA 4RX0A 3V0UA 3UPMA 2X16A 2HV5A 5E0KA 3MU7A 3F2BA 4EF8A 1R0MA 3FCPA 3ITOA 1FCUA 1MNZA 5FI8A 2G37A 1YTEA 5K7JA 3ANUA 1XGZA 3DERA 1SJDA 2G50A 2REQA 3UW6A 3L66A 1JNEA 3QEZA 3NGFA 5D2VA 1SFJA 1E5JA 2GVYA 1ONEA 2ATSA 1OVDA 3PB0A 4AYGA 4L1XA 5FF7A 1FCVA 1A5KC 2IXVA 3S1XA 3T55A 3CAVA 3D5HA 2PDMA 3WUEA 2GL5A 4JTCA 1S1PA 1VIZA 4OWGA 4UUIA 3FYPA 2ZUMA 3W1QA 4HVXA 4YJ5A 3N2CA 2XGBA 2VEGA 1AW2A 1HN1A 4XAPA 3LHTA 2PDPA 2PWHA 4GJJA 4OQVA 1UJPA 3IK4A 1MQQA 1U5VA 4N42A 3NQ6A 4F0HA 1UWAA 3V16A 4EX4A 1QK0A 1PTGA 1B30A 4UZUA 1A3HA 5KZMA 1B4EA 5D9OA 3ARYA 2GGHA 3SRDA 3W25A 2V3FA 4WKFA 3VD4A 3L67A 4XUGA 4ZODA 2VD9A 3M0YA 3VKCA 9XIMA 3MDWA 1ISXA 4NVTA 1DVJA 3WNNA 2R1KA 3WK3A 4P8XA 3ZVHB 4TMCA 4MF4A 4RDVA 3KTXA 4F40A 3SR7A 1FDZA 1GVEA 3PJTA 3GNOA 3H54A 3ARPA 2VC9A 3FA4A 2ZUVA 2P10A 4UOZA 4UTMA 3WEOA 1E1CB 2F8QA 1XJBA 3VX1A 1D9EA 4KWVA 1M65A 2PWVA 4UTWC 4GQGA 1E4NA 4D8ZA 3VD3A 3LM3A 3WQDA 2PZ0A 2J77A 4ATLA 3VINA 2YA0A 3HPAA 3NOYA 3GG7A 1GPWA 3OBEA 3T7VA 2ZA2A 4C91A 2POZA 1V3HA 4I5XA 1YLVA 1XBYA 3GG8A 3NDOA 3O05A 1W37A 9CGTA 2NSXA 1YTDA 4J28A 4R53A 3W83A 3AAMA 4YYCA 4OVXA 3HIJA 2RHGA 3N18A 4EOUA 2R24A 3E0WA 3LPGA 5HMEA 1DHPA 4JTGA 3GUWA 4LCSA 3UD6A 3G0SA 2X40A 1KO0A 1ZZMA 1RZMA 2PC4A 4LW7A 1OEPA 3HQNA 3TN3A 1PX3A 5E0CA 1Y65A 5DMYA 3N3MA 1ZBVA 3OGVA 2IKGA 4C6CA 3KBSA 1M7PA 4QS6A 1S5TA 3TOYA 1GGOA 2H8ZA 4W4QA 3W81A 2OEKA 4NZ3A 1B57A 5CSUA 3K8KA 1UWIA 4JX6A 4JCMA 2WSYA 2QR6A 3A4JA 1BSLA 4JQAA 4WD0A 1ZGDA 3UCCA 3G0UA 2CXEA 2RDWA 3VGHA 5JU6A 3LY0A 1BVNP 3M5XA 5I3JA 2ISDA 3T8LA 1LUCA 1V6TA 4MAVA 3C3UA 4LC8A 4CD4A 4FP1A 1R3QA 4E4UA 4B5XA 3FY1A 3CT7A 5HNNA 3CH9A 2XM2A 3TH6A 1SJBA 1LROA 4HZMA 4JS3A 2VFGA 1Q4NX 1EUNA 4JIHA 5DBUA 4O1FA 4UTTC 1S2CA 4CEUC 3T44A 1NF0A 2A21A 4JAWA 4UMBA 3WMCA 2IQTA 4PYSA 3QOMA 4KT2A 4D6CA 1XYMA 4UCGA 1UD8A 3DH7A 2G97A 5F1VA 3RLHA 1EEXA 3C0QA 3V0SA 5HANA 1RV8A 1ZB5A 3TQVA 1KCKA 3A3WA 1TPB1 1EPXA 2Y8VA 5LIWX 3N29A 4E2DA 1NDZA 4RK8A 4NASA 3DESA 2G3MA 3TA6A 4WKHA 2VUNA 4S3DA 5E70A 4LVFA 1XFBA 1W5QA 4J27A 5U7SA 1I6NA 3KOWA 1RVGA 1TMQA 3W2UA 5FEXA 4B5UA 1XIGA 4AY8A 1LF1A 3KBVA 4J3UA 2PDLA 3VKJA 2P3ZA 1D7FA 3U2EA 4XAZA 1FH8A 3WLNA 1AG1O 4JQ1A 5CXPA 1NP0A 4B16A 2DZUA 1XDMA 3LLXA 4GZIA 1ADSA 1FFQA 2G3FA 4AISA 8TIMA 3MJMA 4RNJA 1DHKA 4C1KA 1FRBA 4HA3A 5I00A 5DF0A 4DJEC 4EPDC 4Z2JA 2EG8A 4ERGA 3KAOA 1XG4A 6A3HA 3QGKC 4JX4A 1RUSA 3BJSA 3QPEA 4A35A 1FKWA 3UGRA 2AAAA 3A4AA 3FX4A 3WUBA 3SDOA 5D9MA 3CS2A 3VM5A 4GGHA 1UD2A 4RE4A 2GOUA 2DT1A 5CBBA 3ZOAA 4LCQA 3ZR6A 3B8VA 3AJXA 4Q6JA 3S5ZA 5CBJA 4BCEA 4PFHA 2HPIA 3HGSA 4H19A 2QW5A 4M6UA 4UTIA 1PAMA 3O1NA 4U28A 2E7FA 1A50A 3SFWA 1PTAA 5G4EA 1T40A 1V6YA 4MZ1A 3UZZA 3V5FA 1XR2A 1C3FA 3C56A 1O95A 1Z69A 4O11A 1JZ7A 4AD0A 3L7RA 3FHQA 4OFCA 5BXTA 3GAKA 4GO9A 4AYSA 5JQ9A 3RCYA 1XRSA 4M1BA 5HJXA 1T6MA 1ADOA 2YCIX 4EK7A 1TUFA 1BWLA 4XZNX 3NIYA 2IKHA 3FEQA 4DYJA 4WDUA 4R7WA 1RCQA 4Q4SA 1U1JA 1F07A 2PF8A 1WP6A 4Q7IA 3QTGA 2A3BA 2PP0A 1C92A 4O1DA 2NVCA 3N25A 4IT1A 3CWHA 3A3XA 5A2AA 1OGSA 2PTXA 4HTYA 3RU6A 3LHVA 4Y9AA 1JGMA 4TOQA 3NWRA 1U30A 1TELA 2SFPA 3TFXA 1IQ8A 3TMLA 2P88A 4D2JA 5HK4A 4XD4A 3GU1A 1CGUA 3OVRA 5CZJA 1V3IA 1K70A 2HMCA 2X2GA 3KOZA 3HG3A 5EL1A 1LRNA 4GZJA 3N11A 4JD4A 4QNWA 3UWWA 3F03K 4QDWA 4AU0A 3VGDA 1E40A 5CJ5A 3VZYA 1KRMA 5DO8A 3S5OA 3RCNA 2VQUA 3WY1A 1N55A 2D3LA 5DEZA 3IWPA 1LL4A 1J0ZA 3BG3A 1OD8A 3IVUA 2HXUA 3CZEA 3SCOA 1LORA 1LRTA 4YU1A 3WKZA 1VP5A 1V0LA 1VGAA 1LBLA 3P81A 3NR0A 4GX9A 3Q2DA 2NQHA 2DT0A 1GJUA 3NEHA 4O52A 1MW1A 4LUIA 4B5TA 3WLPA 2QUTA 4UQEA 4CCDA 4LNCA 3LCWA 1V8EA 3WLQA 2HK0A 2OX1A 3PWGA 1OCQA 3OZMA 3MZNA 2BHUA 4NXKA 2ZICA 3WLKX 4C6OA 3QC3A 5LSMA 4UTLA 1FWCC 3MA8A 1C8YA 5E09A 1X7FA 1PO9A 5AHMA 3BLOA 3USZA 4J3SA 1BVZA 1FHUA 3ZT5A 1E71M 4CD8A 1NIUA 2DSVA 3UG3A 1HKKA 2J25A 3LM7A 2IW0A 5FACA 2ICSA 3MKKA 3U4FA 3PUGA 4H9UA 3LENA 3WQOA 4NJHA 1AH3A 3QZAA 3M64A 3IIOA 4L1GA 3T0DA 3DFNA 3GVWA 1ZJAA 4WSJA 4BQ4A 4N4PA 2CXGA 4GABA 4C6KA 3WLRA 3AHXA 2FZNA 3RLVA 1ZCOA 4LALA 1SJAA 3HQ1A 1VENA 4JHMA 2DZPA 3LERA 1JUBA 3KXQA 3QQ1A 3UWEA 3PBMA 1IEVA 3EPNA 2PTDA 4QCEA 1QO2A 3RLUA 3NSMA 1WE5A 4H6QA 4J35A 3FEMA 3G1YA 1XF0A 4C7DA 2GUBA 1H7NA 3T78A 3MO4A 1HTIA 1HFBA 2CEQA 1O7AA 1LWIA 4O54A 2JKAA 3MZ2A 1GT8A 3GFZA 3O63A 3PVFA 4LANA 4ZZ9A 4JDYA 3U2OA 4V1YA 1TWDA 1TZZA 4N2YA 7XIMA 4FXRA 4ZEPA 3GUGA 3TTOA 1X8FA 2WZHA 5CPNA 3TUUA 1KGUA 1RCXB 4D9PA 4K7VA 2PTYA 2YZRA 1IZJA 3QHNA 4FAMA 4ES4A 1GWJA 3S5NA 4MMWA 4JOMA 3TW6A 2HVOA 4DVOA 3WBYA 3IRSA 4YNGA 1E4IA 1L2QA 1W31A 2PWDA 1LG2A 3M0XA 1BQGA 2NV2A 1J79A 1I2QA 1B1YA 4ONVA 3EB2A 3C3NA 1PWLA 2O92A 4GUHA 5K9DA 3DFOA 5TD4A 2YCLB 1K4GA 3GNNA 3VOHA 2EKGA 2OEJA 1UWSA 2JQXA 5CCZA 4N9CA 1J01A 5A95A 2E68A 1QUMA 3KCOA 2QCCA 3IEBA 3VNLA 1OIMA 3VDCA 5LNRA 1MFVA 1DJNA 2XH0A 1FH9A 3WNKA 4JFUA 1A5AA 4JTHA 5I3DA 2FB2A 1PKNA 2H9AA 2ISFA 5FF2A 4IGNA 1MXSA 3BPWA 5HINA 2EJAA 3A64A 2PDGA 1TJ2A 1TRIA 2BNJA 1UKOA 1KTCA 3O15A 4MKSA 3CUGA 1W3NA 2ZOXA 3BSMA 1A47A 3CHEA 3N12A 1GG1A 1R47A 3P84A 1K9FA 1DYSA 4I9TA 2I9UA 1I8JA 3AS2A 1R46A 3R11A 1U33A 3P8JA 5H91A 3RM9A 4LAKA 1YTKA 3UXIA 3I4KA 3LMZA 4HHPA 1TPC1 2P76A 1HO4A 1M3UA 1FP9A 2CZEA 3VXGA 4PCSA 4AZGA 1H11A 1R3SA 2WBKA 3IK2A 4LUYA 3TJ4A 2RH9A 2ZZ4A 5MF5A 3NG3A 1G67A 4YCPA 5JH2A 4IXXA 3TYDA 4Q7BA 3QW4B 3GU9A 3GTFA 3EWZA 4IMGA 2VDHA 5ABGA 1V7AA 4XD6A 1YE4A 3NDZA 2VC6A 1HL8A 3KLLA 2V5KA 4RNIA 2WPGA 5ECVA 5BROA 3XINA 8XIMA 2X0SA 2EO7A 5LKYA 3BAJA 3W7KA 2HNHA 3EOSA 4GQ0A 4IL0A 2X30A 3CV1A 1XFCA 1O6IA 3T40A 5F4WA 4G6CA 3SRKA 1KBJA 3QKEA 4XAYA 1KQYA 4A3RA 3GR7A 1PX4A 3FSUA 4BJHA 5DX7A 1A5UA 2DP3A 3TLLA 1P0KA 3B06A 3VZZA 4MGGA 1ONXA 1K7FA 3UBPC 3EA3A 3QOKA 3G3MA 4WRHA 5AC8A 2GWGA 1YXDA 4GVFA 2HS6A 3T0AA 5E0FA 4Q4PA 4DHGA 4GIRA 2AGKA 3O0FA 1VBUA 4BY3A 3TZFA 3LUTA 3QSTA 1GORA 4W8BA 4ACZB 1VBJA 3U2CA 3M0IA 3NQ2A 3NQGA 3WBWA 3C86A 1SR9A 5XIAA 1XUZA 4F9DA 5L9FA 2YXXA 4E4FA 1Q8AA 5FD0A 2YXOA 1ITQA 1PCKA 3PJXA 4IP5A 4X22A 3PF3A 1FWDC 2UWFA 3B8WA 2A2IA 2CFFA 1H62A 3LCGA 2YB1A 4O8RA 2PDJA 2PDQA 5CZTA 1RJQA 5CPTA 4OIFA 3HO8A 3MTWA 4Y6GA 4IWWA 4G5DA 4OGZA 1O60A 2E28A 2WOQA 3FJNA 2PDFA 7A3HA 4HU8A 3GG0A 1OF6A 4DNHA 3PSWA 4A3YA 2Q8XA 1FXPA 4QEEA 3WO8A 4GY1A 1DJWA 2CESA 1AW1A 2P8BA 3GVVA 2DSZA 3MMUA 4ACYA 4DO4A 5FEWA 3R25A 4A3HA 3ZFHA 2J24A 3GHRA 2WVSA 1AMYA 3IAQA 2JALA 3LU2A 1EZ2A 3MWAA 3TW7A 5AHFA 4KIEA 4E8CA 2IQDA 1UMLA 2QMKA 2ZX8A 4DAIA 1UJQA 4X61A 4F79A 4EAMA 1A49A 1GJWA 1XYCA 2XH7A 2MANA 4AXKA 4D6HA 3EWDA 3A12A 4TMBA 1HP5A 1LG1A 4J2MA 4QQ3A 1UBSA 5HMSA 5G5IA 2WPBA 1EJWC 1BYBA 3SGZA 1M7XA 1V93A 2CYGA 2FGBA 2BGSA 4DO6A 2QCNA 4HNNA 1WCGA 3LCHA 1KXVA 1FTXA 4W85A 4JYEA 3M07A 4ADSA 1J5TA 4RKAA 3CHDA 4WY0F 1B31A 4RPQA 1S5NA 1M04A 3H8AA 3OQ8A 2ONEA 3TTYA 3ATZA 1JDAA 1F5ZA 2WK2A 3R12A 2FHFA 3O6YX 4FLRA 3A24A 1G0CA 5FJPA 2WMFA 3QM3A 1EWEA 3HV8A 4MJ2A 5GQBA 3IVTA 3HPXA 3MI6A 2FTYA 3ZYZA 3ZZ1A 4GUFA 1EHNA 2G41A 1C7TA 2Q01A 4J3XA 1KB3A 4TTUA 5IRPA 4QHRA 2EG7A 3HGJA 4H41A 1VBGA 4ZBCA 2DSKA 3B8UA 1XG3A 3VYLA 3ZJ6A 3C2YA 2ZC1A 1L6WA 1DWGM 2WXDM 2XVLA 4MG4A 4GJ1A 1EQCA 1A0DA 1E0WA 2JF7A 1I75A 3ZVHA 3L21A 4XKYA 5IHSA 2XIOA 4GC3A 3SW6A 1JCXA 5AHLA 1JEZA 3WENA 3G1FA 3NO3A 5FAGA 1Z7AA 5C5YA 4G1NA 3F4CA 5CZKA 1QT1A 3E5BA 2B81A 3QY8A 4R7JA 2PP3A 2PWGA 4MHBA 1ZHAA 5AZ0A 4DYEA 3HQOA 3QBUA 2ZUTA 4DAFA 1E1CA 2OYMA 3W1UA 4Q6XA 2KX9A 4NZFA 2CWXA 1JZ5A 5IM51 4UTKA 3TW9A 4AVOA 2HZGA 3PP7A 4M51A 2E77A 2VP8A 1O5KA 3EWXA 1AL8A 3CGTA 4K2SA 3C5QA 1QI4A 4CNNA 2ISWA 1IEXA 3CHCA 3NQAA 1OFRA 3E0VA 4Z08A 2PDXA 4UNIA 3RPMA 1MQRA 3FXGA 4FR6A 1FDJA 4O0ZA 1KD0A 4ZQMA 2DV0A 3FFSA 3OODA 3HPZA 4V15A 2ZVRA 5BRBA 1CGYA 1TWIA 5JMUA 4GBUA 4GI6A 4MB5A 2WVVB 3GNXA 4TV6A 1D3GA 2TAAA 3CZJA 3KOXA 2Z29A 3I7RA 4WIWA 4BFAA 1HVQA 3V36A 3VGFA 1KFCA 5A8GA 4X3ZA 4URIA 1OIFA 4HNLA 5IBXC 1J6OA 2YXGA 3WLHA 2ZUUA 1J0HA 4QLLA 2A3AA 1DIKA 4UOJA 3W7EA 1UKTA 1P1MA 3B8TA 1G1YA 2YA2A 3ONCA 1RQBA 1T5AA 3W7NA 4IQDA 3DG6A 3K4WA 1EP1A 4OZOA 3H4XA 1HT6A 1TQJA 4I8YA 3PUDA 3AZTA 3TAKA 2OWWA 4PUEA 1Q2SA 5KETA 3CJPA 1JPDX 5HA7A 2ZA3A 2C3ZA 2FVMA 4H00A 2YFOA 4M24A 3HJEA 2WKJA 1EZWA 1TVPA 2OR2A 3E74A 4I9MA 2WNNA 2ZRVA 2HE8A 4W89A 1SMAA 3MHGA 1SZNA 1R8LA 1K8ZA 1AH0A 1U5JA 3R8RA 4O12A 1KW1A 1XLCA 4L9ZA 3H6OA 3UY7A 3M46A 3C61A 1RH9A 4XX6A 2C6QA 3EX1A 1V77A 3BMVA 4A22A 2NXHA 3WH5A 2QZRA 5A6JA 3W28A 2DGAA 3PHAA 4Z1AA 1IGSA 1W3IA 3LPOA 1UH2A 5I0DA 1E5NA 2FPYA 4ZQOA 3EBVA 1HGWA 2NUYA 4UFKA 1FOBA 4IPJA 4IICA 3KOYA 4UQ9A 1YRRA 2XINA 1IWAA 3KVKA 1TPFA 3WF4A 4LYKA 4MKVA 4I8DA 1B9BA 2DH3A 1TV3A 4W7VA 5H8UA 2IQ0A 1B2YA 4ADUA 3CL7A 1J0JA 1ZTVA 2ZRWA 4DBWA 1TWWA 3A9IA 1AQ0A 2Z24A 1VZWA 2ZX9A 1L8PA 3AYRA 1ECQA 6TIMA 3OVPA 1OQFA 2A7PA 2J79A 3AYTA 1ZU8A 3CHVA 3L2IA 2PTZA 3R13A 4I5RA 1ZBWA 3L4VA 3UWUA 3EEZA 3R6IA 3SQSA 3CK5A 5I5RA 1KWGA 2D2JA 3AS0A 1IEIA 3TYCA 3PFRA 4S3GA 1JZ3A 3JRKA 4GQQA 5C7HA 3HGOA 3NDYA 4H3DA 1SSGA 4M7TA 4AZ7A 4TUFA 1OD0A 2DT2A 2BZNA 4ZGYA 3WNMA 2NQ5A 4DM1A 3AIRA 2YL9A 4QP0A 1HW6A 3SI9A 2QUVA 3QC0A 5B7ZA 4CD7A 1QPRA 2VHLA 2JEPA 4HJFA 2BSLA 1UD4A 3EA2A 1M68A 3AMKA 1DXEA 2ZE0A 1B3VA 1VFMA 3ITGA 2OWXA 3UCDA 4C6NA 4K8EA 4Y8FA 4FNTA 3W07A 1HXJA 5DFAA 3MYOA 1XS2A 3ORWA 1KCZA 2W67A 3GHTA 2V67A 1A3WA 4PB3A 3LX9A 1Q45A 1WAWA 1TPUA 1ISWA 2Y0FA 1W0MA 4J4KA 3DIPA 4FNUA 3RFAA 3ONBA 3OW1A 4B15A 4H6RA 4XBKA 3GXFA 4GRSA 1A5NC 1UR9A 1FH7A 4FMVA 1ADDA 1I2RA 1KGXA 2VI0A 2VGBA 3M47A 3UCQA 3UEQA 1C8VA 3N14A 3WQ5A 4TO8A 3SAZA 2PFHA 1EJ7L 3NFUA 4K39A 5GJMA 5I3FA 2DY3A 1DXIA 3ABXA 1XP3A 2GGJA 4GISA 1WV2A 1JL8A 1OG6A 3A47A 4WHBA 3EDKA 2OO6A 4WOZA 1MXGA 1C93A 2ZX7A 1CDGA 4N6EA 1HUVA 5A6SA 4RNHA 2ZADA 1MQPA 2OX4A 1ZBKA 1R9XA 1LLWA 4I5UA 7REQB 1P43A 5LYRA 4IGHA 4Q8OA 3GKAA 3C8NA 3RO8A 3EX3A 2X1SA 3BCFA 2QJMA 1OYCA 3AUOA 3L12A 3AHZA 5M3WA 4XVDA 1RY8A 1DIEA 2ZUWA 4GPNA 2FVLA 3R8GA 1K8YA 3E5PA 3UYIA 1AH4A 1EGVA 5HWMA 1W91A 3G18A 3IGSA 3H26A 2QV4A 2YLAA 1TE1A 2W62A 2WYSA 2DZWA 2BXVA 4GIYA 4BWLC 2BVWA 3HU7A 4OU1A 1R5YA 2GFTA 4QDMA 2NX1A 2XH2A 3IACA 3BOLA 4JBRA 3DFSA 3WF2A 2J9ZA 2A0NA 3WCZA 4GFSA 4KQNA 2FB3A 2J8GA 4LSBA 4E0CA 1G7UA 4HMCA 4I7UA 3UESA 1VEOA 1TCMA 2YL5A 3HN3A 1XHGA 3W87A 1V3MA 4NJIA 1VCVA 1EYEA 2ZYFA 1SO5A 4GWEA 1PCWA 1ISVA 4DJDD 2EXOA 3CL6A 4C1LA 1D3CA 1JYXA 1CXFA 3WYZA 3VOIA 3U7BA 1POKA 3DECA 2CLIA 1JYWA 4QSFA 1R85A 2C71A 3FIGA 4AZHA 3E0IA 1E1FA 1TVLA 1ICSA 4HSNA 3C4UA 2GQ8A 4WJEA 4X2RA 3LCIA 1RK6A 3LBMA 1QO5A 3WD4A 1XLGA 5C0QA 4C90A 3UWZA 3FXYA 5FEZA 5A8MA 4H7CA 5DY3A 3URNA 1OCNA 4GH1A 1YHTA 3GU2A 2NQZA 3Q45A 2CLHA 2ZE3A 4HU4A 5CJMA 2A5HA 4Y9PA 3H23A 1K6WA 4BR1A 3R4IA 3V18A 2W91A 1VFSA 1DTNA 2XUCA 2DQWA 3KLKA 2F6KA 2AQVA 4KFOA 3FLUA 4U10A 2PWFA 2YLLA 2ZDSA 2WAGA 3KW3A 4W88A 5B7YA 5JBEA 3CAQA 5K4ZA 1CYGA 3OBAA 1LBFA 3N9RA 2Y2WA 3F1QA 4KPLA 5FL1A 2EPNA 4JTKA 3IJ7A 4HNCA 3GC5A 4IIEA 1YYAA 2UZ9A 2CLKA 1V7YA 4OV9A 2Z1VA 3G6MA 2F2KA 1F4HA 5FJRA 3AO0A 1I2NA 1EJVC 2WO5A 2QPXA 3GDKA 4L80A 2YDQA 4PUUA 3VMNA 4GHRA 2VOMA 1OY0A 1W32A 1SO4A 3SY8A 3N4AA 1UPPA 1JGIA 3MMTA 2J66A 4MB4A 1Q8JA 2QJIA 1UWTA 1S3HA 3UJ2A 2VT0A 3VIFA 2V3DA 1TV4A 3TIMA 2YCLA 4U2YA 4FEZA 1OABA 2AKMA 3A5VA 1EF3A 3NM3A 1JCYA 2ZRYA 1HKVA 2QCEA 3KE0A 3LXCA 2LLEA 4IX0A 3PWAA 1NTHA 2VEKA 1UR3M 4GVGA 3OHIA 1TTIA 1XLJA 2KZHA 3VI2A 3OPSA 2Q6ZA 1UWUA 1HL9A 4AWSA 4PL1A 1MSSA 2CLOA 4DN1A 3NL6A 1UW9A 3AI0A 3G1DA 4MWAB 2XG9A 3E6EA 5LIXX 2YOCA 1O5QA 1E3ZA 3B0YA 3G1AA 1GHSA 4EXBA 3POHA 3WDIA 3BAYA 4DWSC 3LLDA 1AD1A 5D03A 4PTDA 1X97A 1XSIA 2JIWA 2WCGA 4CQBA 4NYUA 1T0OA 3TMQA 1S39A 3RG6A 3RLGA 1EPVA 1W1PA 1R2RA 1XIEA 1EC8A 2VFDA 5FJOA 1IGWA 1QWGA 1Q13A 4Z2LA 3OIHA 7TAAA 4Q4QA 2VUYA 3W72A 1K3UA 3OZOA 3L68A 4B2DD 3IRDA 4H6KA 2OCZA 3GTIA 4BQ5A 1K8XA 3LXBA 2XN2A 4QLJA 4JYDA 3S5SA 5FJTA 3NVDA 1BWVA 2QPSA 4D6DA 3KBMA 2QDEA 3EOLA 2XHYA 1PSCA 2WNWA 4YS1A 4I6VA 2HK1A 1UMYA 2BXZA 3N2MA 5FEPA 3GHUA 4AG0A 4QJ3B 1GCYA 5T26A 1W8GA 3KUMA 3S8HA 2RDUA 3WK0A 4AF0B 5AC6A 3CU2A 3ITTA 1MRQA 2PLCA 3UA3A 1R9ZA 1PKMA 4JFWA 2OZTA 1MRAA 3AU6A 2WNQA 4FIQA 1E43A 4PZVA 2UY5A 3WBXA 3GQYA 3KVMA 1JI2A 2DVXA 1IEQA 1W9BM 1MW2A 4PCFA 2GQAA 4RPPA 4M5PA 3BGGA 2O55A 3TK7A 1J18A 4INFA 3NPVA 4P8UA 1ICQA 3BZGA 1JYVA 1QHZA 1DBTA 2VKZG 5HUOA 1OX4A 3ITCA 4NL1A 1AMKA 4HNUA 4YWIA 3NA8A 5TBOA 1Q4WA 4ACZA 4US5D 1GQKA 1X1OA 4HQVA 1LRQA 3CC1A 3B9EA 4PMOA 1NF7A 3QPYA 4DJEA 4IFKB 2CC0A 5E6ZA 1RXOB 2NW0A 1B54A 4GX8A 2C14A 1UASA 1FFRA 3L4UA 5FAJA 2D0FA 3QR1A 4JKLA 1BLIA 1Z32X 4C6BA 4DJFC 1GKPA 4AW7A 3GDMA 3JVAA 1QNQA 3H4WA 1HX0A 3AROA 1TSIA 5DRIA 3WMLA 1PKYA 1OT2A 2BG5A 3CNYA 4S38A 5D2YA 1ZP3A 2O0TA 1C7SA 1NFBA 4JN6A 5FSDC 4DJDA 1XLAA 3BQ6A 2VX7A 3P5YA 1X96A 2PZNA 1W5OA 2PDKA 4FLQA 2W61A 4YTQA 1J0IA 4B3LA 1E70M 1A5BA 3B8SA 3CO4A 3DFQA 1DE6A 2I9EA 4C5ZA 2OSXA 4L4LA 3UERA 4JNZA 2P3EA 1KTNA 1TCDA 1HZYA 1KFKA 3WH7A 1LQAA 3KX6A 1UIPA 1W1IE 3REQA 3IJDA 4X60A 1RSCA 1DJZA 2HVMA 1A80A 4CGTA 2GGGA 4JIQA 3DEQA 1WZAA 3LG3A 3WQ4A 4LBSA 1RJPA 3LGEA 3QSRA 3UNDA 4A05A 4JTSA 4W8LA 3SCRA 3PSVA 2OZ8A 2O9OA 4H9VA 2FGLA 4J3ZA 2OELA 1V3KA 1U1HA 2FJKA 3DYOA 2PI6A 1RD5A 2BS9A 3R79A 5H2ZA 4FXJA 3EX4A 1UUMA 2Z2AA 3LK6A 1XGDA 2DZAA 5I06A 4O17A 4BF7A 1TV8A 4D6FA 4LNYA 3KOFA 2GDVA 1A4LA 1E72M 3SIZA 3VDAA 1UA7A 4CU6A 3CZLA 1ECEA 3R8HA 4DB7A 3M7SA 4PL2A 1XM3A 4AEOA 2I57A 3DBNA 5D38A 2NV1A 4ATDA 3COTA 4Q22A 1YQ2A 5DMLA 3QMRA 1R3RA 1TB3A 2P8CA 4Y90A 4PMNA 1UH3A 3R0DA 1GVSA 4DBDA 2RJHA 4FOKA 3THDA 5GJNA 5GNXA 2P5NA 3D47A 4C6EA 4XZHA 1W17A 4DM2A 1X6NA 2OKTA 4ZCWA 4DI9A 3QRHA 4IIBA 4IMCA 2BVDA 4RZBA 1FWWA 2C1IA 3T81A 3M16A 2QJGA 1XYBA 3MYPA 3DKJA 2B7PA 2P1FA 4JIRA 1ZFJA 1MMFA 2PAJA 1XIFA 3R58A 1F05A 3VUPA 1SJCA 1HL2A 2VVSA 5BXSA 3SJNA 4C65A 1G4PA 4NNBA 1JZ6A 2DZXA 1L6GA 3K13A 4G7FA 4NRRA 3WLMA 2YZ5A 5KZ6A 2PGWA 3UJEA 2Y1HA 3MANA 4U4MA 4NHVA 3BCJA 4HZ7A 2HQAA 1TQXA 2ISVA 4KWSA 4WSHA 3VABA 4QG6A 3UVAA 1UBPC 4XZIA 4PSPA 4F2BA 2WHMA 3CV2A 4NJKA 7ODCA 4FI4A 3KZPA 4AD4A 4IUOA 5TQLA 3LHZA 2ESCA 4UBPC 1BXCA 1W1VA 3TTSA 2W66A 3MY9A 4LX4A 1S2TA 1DXFA 3EOOA 1J0KA 3H2MA 2WJFA 4IIDA 5EY5A 3T05A 3W1XA 1A5LC 5FSEC 2E1WA 2WVVA 2BX7A 2HTMA 3VKKA 4LS0A 4AIOA 2CBIA 2ADAA 1R38A 1FP8A 4L4PA 4S3KA 4LAZA 1PIGA 3CIWA 3T42A 3A3HA 1QDSA 4E38A 3WDJA 4PRWA 2GVEA 2VWSA 1XINA 1NWRA 1UC4A 1EP2A 3L4WA 5LZLA 1V02A 2NLYA 5CPOA 3VGEA 4E3TA 3VKDA 3IGHX 2OJPA 2FLIA 4QAWA 1HNYA 1O4UA 2G4FA 3E9AA 2GQ3A 4ZQRA 1K9DA 2J74A 4B91A 3ZJ7A 3AS1A 1VS1A 4HCLA 5I3IA 1CZ1A 2HXTA 4ZXLA 3N9SA 1TTJA 2NVDA 3UR2A 5EYWA 4OBSA 2FZDA 1EEPA 2O9PA 1BEUA 1VEMA 2XVNA 4QJ5B 1F61A 1N8WA 3FNDA 2VCCA 5A6BD 1I0DA 5TAOA 4PBGA 1U22A 2B7NA 1Q3NA 3SSZA 3VMOA 4ICMA 2TYSA 3TQ0A 2OZ3A 3GK0A 3WMBA 2QJJA 1T41A 1XH2A 2J6VA 3UWVA 1BG4A 2BWGA 3APTA 4Y9NA 2BOEX 3D6NA 3TYZA 4US5A 4JQ2A 2ODOA 1EFZA 1P5BA 1XCFA 4ZQPA 2DFAA 3HOJA 3PZTA 1BYDA 3ARZA 4PMJA 3C0JA 2FFIA 1CGXA 1UA3A 4LC6A 5J8LA 3C2RA 4PRRA 2QUNA 5LA1A 1S2WA 2X7VA 3WQWA 3HJZA 3ANYA 4JL1A 4PA8A 3CQ0A 3W2NA 3VTRA 3C2FA 4EE9A 4DWSB 4QXIA 4EPBC 2OXNA 1A0CA 3ITXA 3BWWA 3PM6A 3WX7A 1W1YA 1H51A 1TKKA 2F7FA 2QJNA 1HKWA 4B9ZA 4F0KA 3NOEA 4IIFA 3MB9A 1ODUA 2G3NA 4UMCA 2RJGA 5LNUA 1B3ZA 3GD6A 4K1WA 3CASA 2P50A 1XH1A 3V5CA 3MKCA 4PUKA 1LL6A 1VYRA 4H7VA 4OBTA 1RP9A 4WSKA 3I6RA 3L9CA 3BW4A 4IH3A 4HK5A 1VFFA 4QAIA 3GIYA 4JTQA 1DORA 1Y5VA 2VURA 5FJJA 3P80A 2BASA 2QV5A 3TNOA 1DPMA 2WHKA 3OZPA 1JUKA 4QNEA 1VPXA 1IXOA 5EA9A 3V1PA 2G95A 4NQ1A 1OCJA 2QCDB 4B3KA 4YTUA 2VEIA 5A3HA 3BICA 3UJRA 2J7GA 4L9YA 4XWUA 2OQHA 1TO3A 1Y5WA 3NQ8A 4QS5A 2BLEA 2VMFA 1EGZA 1XCWA 4XZLX 4LY4A 3TKFA 2E5BA 4MWAD 1F8IA 4TX8A 4LQ1A 5DN1A 2WMGA 6ENLA 3MDUA 1OM0A 4L6OA 1HF6A 3RITA 4LB3A 1JFXA 3WJSA 2R8WA 2R1LA 4P61A 3W6LA 5ABFA 5AVHA 4BHYA 4HCHA 3NNTA 2Z2BA 1IEWA 1EC7A 1ZP4A 3XISA 2PDHA 1FXQA 1PIFA 1VB9A 3N19B 3W70A 2JGYA 2W4XA 1Z41A 2YL8A 3NPWA 1F3WA 3DZ1A 3PUEA 5DXYA 4GNVA 4LF1A 1BGAA 4P7OA 1ENUA 4RE0A 4DO5A 1Q5MA 4MNJA 2XYLA 2ZBTA 5DCEA 1XIDA 3HQPA 4WDWA 1JUEA 5A6LA 3FW6A 3I3BA 3IANA 1XIHA 5D8WA 3CEPA 2J8TA 4J2PA 4LU0A 1GW9A 4QRNA 5CC3A 3GNPA 3TE9A 3SJ3A 3GVRA 1KXQA 1EGMA 1RLDA 1BD0A 2DJXA 9XIAA 3S1UA 4P7NA 4DZAA 2VEPA 4PUMA 5AFDA 3KRSA 3NZRA 1DTUA 1KWKA 1KM5A 1G4TA 1XRTA 3HBLA 4QIUA 5CC7A 1RALA 4W7UA 2W63A 1IWPA 2V63A 2XFYA 4XQ6A 1EKOA 5KINA 3B05A 3W6YA 3A13A 7REQA 5CAHA 2J7DA 1JXKA 1VC4A 3UYCA 5LNSA 3SCNA 3F7JA 1SUXA 2ZKMX 1E51A 4JGDA 4OT7A 1JCJA 3CPUA 1QASA 2GUUA 1XLFA 1PL9A 3CPRA 4ZSUA 2HRWA 3PNUA 1TPH1 3FDGA 4NZ1A 4IP4A 1G4SA 3EKGA 3FJ6A 2FZ8A 2E9LA 3LZ3A 4LAUA 3OGRA 5F2MA 3WNPA 4GY7A 1F9CA 3ITVA 3P82A 4ENLA 4MFEA 2XIMA 4FK9A 4B5NA 3RR4A 4FOJA 3BE7A 4BQ2A 2YJQA 1LWHA 3VOJA 1MW0A 3ICJA 4JCLA 3F4NA 1AVAA 3WFLA 5DMMA 4YVXA 4Z2HA 4FXFA 1Q6FA 3MUCA 1FX6A 4HK7A 2Z1SA 4FX8A 4ZO7A 5AYZA 1V0KA 1EXBA 2G3JA 4KFPA 2QKFA 2VENA 2VFFA 2BVYA 4QX4A 4GUJA 2XVPA 2GGEA 4UCFA 4KEUA 2GOKA 3NYDA 1XX1A 1QMLA 3W9ZA 1W1TA 4H2HA 2Y7GA 5HOSA 1NDWA 4BF5A 4UTUA 2O56A 2C0HA 3MI3A 1PJ9A 5CBIA 2DDXA 2H6RA 3OLDA 3RHGA 3VNZA 3SN1A 4Q8TA 5LXEA 2FDMA 3GHSA 1ZSXA 3O06A 3A23A 3PZNA 3IS4A 4AEEA 5E9XA 1E0UA 4O14A 4IXHA 4NX5A 5A6BA 2Z0IA 2WMJA 3W53A 2FH8A 1ALDA 2GJXB 3E2SA 4JIEA 3T9PA 4F0RA 3T4CA 5C71A 5LGXA 5C2CA 3WLSA 4NKCA 1HJXA 1XLHA 3VNIA 5BNKA 4AIBA 1E6SM 3GXTA 4I6KA 4KKXA 1TPVA 4O0KA 3EAUA 4I7WA 4POCA 4K1GA 1IF2A 5LA0A 1AA1B 1ZAHA 3M43A 3UETA 2PLMA 3S6TA 3RMEA 1CI1A 5LIYX 4GINA 4M29A 1KFBA 4IJBA 5DANA 4ZVJA 3QJAA 4H8UA 1IYXA 4HZ6A 1QPKA 2PC8A 3NQMA 2VO5A 4KWOA 2X09A 1W1A1 1JDFA 5E6YA 3CIXA 1NWTA 4JQ4A 5A5WA 1FWAC 3RJYA 2BODX 2PEVA 1HJSA 4PMVA 2DVTA 3HZ3A 3GYCA 4D71A 5I02A 1ZALA 3GTHA 1TA3B 3QZ6A 3E49A 3KRZA 1KFWA 4R33A 4GYPA 4XBSA 1XLBA 3LQGA 3TQKA 1CX9A 1V6WA 4PUWA 4E5TA 1FCQA 4L1WA 2QCGA 2VZTA 2IPJA 5XIMA 2WJZA 3VCCA 2X1UA 3MSDA 3QYSA 1ZJHA 3G1HA 1R2TA 1JF6A 3BTNA 2QCLA 1V0NA 4IGMA 1BRLB 3NUKA 1SM9A 1DQXA 1TFVA 5EKYA 4UB9A 4EPEC 4JEJA 4HOXA 2O9RA 2EEXA 2ZRXA 1KFJA 3OHMB 4HKPA 5I07A 4WOQA 1TRDA 3EXSA 4QGCA 4PCPA 4MWAA 4K3ZA 1J5SA 4IQLA 1H7PA 2GYIA 2QGYA 2PWUA 4OV4A 3AZSA 5FCZA 3VPLA 1BAGA 4JY9A 2AL1A 4YYFA 4ZXOA 3LBOA 1E6RA 2R14A 5BU9A 4C6PA 5IXEA 4XO6A 1QI5A 1LQ2A 3NURA 5EPDA 2GK1A 1OC5A 4MYXA 4N9DA 3SUUA 2PWEA 4HPNA 2I17A 3LN3A 2DU2A 5CJNA 2WZMA 2QT3A 5HAOA 1N82A 1P1XA 1GVFA 4MY9A 2QF8A 2BY0A 4PODA 4LUSB 4REQB 4IOTA 3KRBA 2CZVA 2XFFA 3V1HA 1EF2A 2OO0A 1UZ1A 2EKCA 4GACA 4QE5A 2V6AA 4KEVA 3ZLGA 2OLSA 2GVJA 3URAA 2UY2A 4RUBA 4YLWA 4AUBA 1BTCA 3IIXA 5T9CE 3LMYA 4AF0A 4EKJA 1DJXA 1WYIA 4NILA 3MT1A 2BFGA 2DEPA 3NZQA 4EVZA 1J11A 1PYFA 5ABEA 4ZSTA 1QNOA 3WL0A 2RDXA 3UA4A 4KCVA 3SZ8A 3H55A 3M1ZA 4CQDA 3I4EA 1WKFA 3W2MA 4BEQA 5AYBA 1TMHA 4O8AA 3DHDA 4P7QA 1JCTA 4JTUA 1OF8A 1H09A 4A4AA 4AZCB 3R2GA 4HMDA 1EC9A 4DUOA 1NH6A 3ABSA 4D6JA 1ML1A 3DGRA 3L5MA 5EB8A 1KGWA 2HBVA 2PU0A 2ZX6A 3CIVA 3UGVA 4MTVA 3WDQA 1GOIA 3BOFA 5T9BG 4IFKA 3VD5A 2Z1XA 3EWUA 3PK7A 4W5UA 1C90A 5FESA 5HUPA 3EWWA 3YPIA 4E8GA 7ENLA 3QYQA 1GUVA 2WZTA 1I4NA 4US6A 1US2A 1V6XA 4CNTA 1PEZA 2BGQA 4PMDA 2Y63A 1FCBA 4JNYA 4OHQA 2QS8A 2NT0A 3MI2A 3R10A 4IL2A 3VNYA 4CCZA 3B9NA 1KBBA 5D09A 4DUWA 1JD9A 3GNDA 1G9HA 4XB3A 2WSPA 1JAKA 4JIPA 3TZNA 2DZTA 2DSUA 1LOQA 3C52A 1KR1A 2XIIA 5FOOA 3SGGA 5J04A 1CPUA 1H41A 1F74A 4Q8UA 1IT7A 1XGEA 2XTKA 4GKTA 5JBDA 1SZFA 4QISA 1E6PA 4R27A 5HQLA 4J1OA 4GI8A 2A3EA 1FDYA 1S38A 5A94A 1HO1A 3PBYA 3R0KA 1WA3A 1TIWA 3W84A 1UIOA 2VGGA 2FZMA 3SUTA 1TR9A 5LIKX 4HPJA 4AZIA 1SMDA 1DJQA 3W7MA 1R2SA 2VGFA 3MC5A 3MVTA 1TV7A 4AMCA 3CYVA 2E6FA 3SURA 2A3CA 2NT1A 5I79A 2Y7DA 2BV9A 3VM7A 2H90A 4JN8A 1KFEA 3KS6A 5I77A 2CZ5A 1MDLA 3KBWA 2EPOA 4V1XA 4MY1A 4H1ZA 1QPOA 2ACRA 2PGFA 3RO6A 4PC8A 3WDHA 2CERA 2QCMA 3PG9A 2C15A 4LYRA 3SCVA 3IGXA 3IJIA 3INPA 1H5VA 3H21A 2ON3A 5JIWA 1F3EA 1H7RA 1UYQA 2ZWZA 1M5WA 4Q4MA 4QQUA 3T2PA 4RE3A 4GKLA 2YFNA 1W8SA 1EDGA 3ZVIA 3S2MA 2D2GA 3DC8A 1RLCL 4H9TA 1VQTA 1RVKA 1B5TA 4YVPA 4IFOA 4CVUA 5JVLA 3JW7A 3WELA 5ABHA 4LPCA 5BWFA 4NT0A 1BQCA 4M81A 4CN1A 2HPMA 3IIZA 3W1PA 1A4MA 3RCMA 3W24A 1GOKA 3P0WA 4GH3A 3S6OA 2VEFA 1XYFA 5FF3A 2EPMX 3QF0A 1JVNA 1HJQA 4WF7A 4GG9A 5AHNA 2ZUSA 5HWJA 1KLZA 3SQLA 1CXLA 5JXQA 3G1RA 3VD7A 1EXPA 3K30A 3LI0A 3LTYA 1B90A 2PF0A 2BMBA 1KM2A 3KDNA 4LUTB 1DV7A 1A5MC 4R34A 1UOKA 4F0MA 2ZZ3A 1ZBCA 3EGJA 4H8VA 1MW3A 4TV5A 3TC7A 3VC6A 1CGTA 1FWGC 1JCMP 3S47A 1UQZA 2P0OA 4CKQA 3PZUA 2NWSA 3QV8A 3GDRA 4QJ4B 3H53A 1OFOA 4IMAA 1X1NA 4PFMA 4AY7A 4L4MA 1S5WA 2PMQA 2AKZA 4NXSA 3TFCA 1VCFA 3WNOA 5HNTA 4D8AA 3VNMA 1O1ZA 4RZ5A 4KMQA 1V3LA 3UVIA 9RUBA 1JPHA 1ZCCA 1OFDA 3QQ0A 3WEZA 1W3KA 4UMAA 1Q6CA 3WH6A 4N6FA 3ZS4A 3POCA 3G1VA 1UHVA 3SY1A 5AC4A 4UR9A 1US3A 2GSJA 2OPJA 3TWAA 2IS7A 1GZGA 3MV01 6PTDA 4UFHA 4Q8MA 1WB0A 2BTMA 1EWDA 1HIZA 3BAIA 3Q4DA 1LT8A 2HWGA 2W6RA 1IZCA 3O8AA 3L2MA 3CHFA 4KWUA 1GYMA 2F9RA 1UB3A 3OZYA 4JNMA 2YW4A 1ZQ5A 2VZVA 5K4XA 2DH2A 4CUCA 3A6OA 2RAGA 1H0GA 4ZQCA 4CVWA 2W5FA 3Q67A 3BO9A 1ISYA 3DKLA 3Q65A 2TPSA 3AYVA 2EG6A 3PBUA 2Y5SA 3VNJA 1FVPA 1J8VA 1J12A 1CLXA 3P62A 4F2UA 4CNOA 1XW8A 1UR2A 3OA5A 1XD0A 4YVVA 5EU9A 1ZLPA 3M6YA 5CQ1A 2JGQA 1KXHA 2V5DA 4FB7A 3ZJ8A 2VQTA 1OFPA 4DXXA 3P2VA 3H4GA 2R1NA 3M7WA 1OFQA 1WDPA 4N9EA 1GKQA 4GMEA 1GZ1A 5CPLA 4HHHA 3VCRA 3VX0A 3LTSA 4LVDA 1Y8BA 3F5KA 3V5OA 2HS8A 3SCUA 4YTSA 3TC6A 2AOSA 4RJEA 5IHRA 3NEVA 3G22A 1R3TA 4IISA 1CBGA 2CKSA 1VJSA 3O6DA 2INEA 3UF9A 4BI7A 3XIMA 4TQTA 5AYYA 1JF5A 3CV7A 4PTMA 3WJWA 2A6LA 2Y70A 1TMLA 2AMGA 1GQIA 2Z7KA 4WDTA 2WANA 4K8GA 3ZSSA 2PRLA 1JRBA 1I45A 2TODA 4N7QA 2G96A 2Z26A 2OSWA 4DWSA 4CNPA 3LD5A 4MLRA 2C1GA 5J5RA 3ZJKA 4HNVA 5BRPA 2GVLA 1GEQA 4DZIA 1XIBA 3RMJA 2ZQ0A 4ZQNA 3WH8A 3MHFA 1X1ZA 2EGZA 3QMSA 4RDYA 1UR1A 2AGTA 4HU3A 4HPHA 3G1XA 1VFTA 1MUWA 3SCSA 3VC5A 1BTMA 1DKWA 5G2IA 5EMJA 1HJVA 3WJYA 4ERIA 1AQMA 1CGWA 3OBKA 3NL5A 1K77A 2H8XA 4RZ4A 3T2QA 4LGXA 3W88A 2XWDA 3S2CA 3ENLA 4RNFA 1UP2A 4LCRA 1QJWA 5DCDA 3WQ6A 3KCLA 5FJUA 4RV8A 3P0XA 1UKSA 4GVHA 3WD1A 2GSEA 1P4CA 3H2EA 1YE6A 4XZWA 2D24A 2QUUA 1T8QA 3W85A 1K8CA 4V33A 1AL7A 2BY1A 4AHOA 1Y0EA 1P6BA 3IARA 2Z28A 1KRBC 3EDFA 1KBKA 1XI3A 5D9NA 1U5HA 3I68A 2Q02A 3T0BA 5H8MA 4LF2A 1SU5A 4JPGA 2INFA 1VBRA 3D0CA 4Z2KA 4J3TA 4XO7A 5DXXA 2YA1A 3U3HA 3M0JA 2F38A 4L7ZA 2FTPA 3JZUA 5IFTA 2A3LA 1CTNA 4QCFA 1MYRA 3PTQA 1SZEA 3V0TA 2OZ0A 5GVJA 2ZRUA 4AZ6A 1UR8A 1JZ2A 3GYEA 5TIMA 3MUY1 1EH9A 3M0MA 4CU7A 2V69A 4TR9A 4GUGA 1SPQA 2W92A 3FDKA 4F3HA 1UR0A 2Q3OA 2Y4SA 3LEPA 3FSTA 4ASTA 2HNEA 3WLOA 3AICA 3HFYA 3VE7A 5CGMA 2ACUA 2L5HA 2VZUA 1KR0A 2X42A 4S2CA 3CYJA 3ES7A 1LBMA 4AWEA 2WHLA 3W86A 3TDFA 3FAWA 3E02A 1EYWA 2DSWA 1YDYA 4NUWA 1F76A 1N2VA 3M4HA 5BWAA 2YDSA 4UQCA 3THUA 3VZXA 1XQLA 3LRLA 2YCKX 3BAXA 1EDQA 2IPWA 4KRTA 1WDQA 1UUQA 3AQUA 2ISSA 4PMZA 1PZ1A 3NQDA 1JZ4A 2J75A 1J93A 3RDKA 2PLKA 5CSSA 4UR7A 3PZQA 3PNZA 2J7CA 3GB6A 1UD5A 3NO5A 4JFSA 2WB5A 1P0DA 4MSSA 1QPNA 2FJUB 1Y5XA 2OOGA 4HA0A 3I65A 5A2CA 1AZ1A 4FS9A 3W7DA 2D0GA 1WXZA 2PODA 1YX1A 4ZR8A 4U5KA 1W9XA 2QCHA 4WGXA 3ZR5A 3T8QA 1KXTA 3ARQA 4ORIA 4GQRA 3TCSA 3R1ZA 4RCXA 2ZXQA 1PUDA 3BUVA 4HN8A 4MNKA 2UY3A 3L23A 5D02A 5EMMA 4FLSA 2XM1A 4DWDA 4O1BA 1IXQA 4V28A 1YNYA 4C6JA 4MDOA 3WQEA 2E5CA 3WBAA 2OLAA 3DN5A 2PDIA 5K9CA 1YMYA 3A22A 1OGGA 1TJ0A 2Z2UA 5HPOA 4K8HA 3G24A 3H2OA 3H2CA 3OEXA 4OE7A 5D33A 2CZFA 3CUHA 1ONRA 4AWUA 1ZJBA 4O53A 1H60A 4DZHA 1VFHA 2E40A 3TTQA 3M6DA 2XJ7A 1FA2A 3F4DA 3V7PA 4AWTA 1SFTA 2ABAA 1F6PA 3PZ9A 3VIMA 4CEXC 2PDCA 3B97A 3TEVA 4LAOA 2X05A 1EBGA 3B0XA 4IPPA 1AZ2A 4M82A 2CBJA 3OJGA 2FZ9A 2Z1WA 3RRXA 1PE1A 1EJTC 5F2GA 2A4AA 3LCFA 4S3AA 2E1DA 3SECA 1BFNA 3E12A 5B80A 3TN5A 1KM4A 1KKOA 2BVTA 1NDYA 5G2WA 4S3BA 3EZ4A 4LUJA 1WXYA 3VOCA 1TVNA 4JTDA 2ZC8A 1V51A 3STFA 1L2UA 3VUSA