4E2OA

Crystal structure of alpha-amylase from geobacillus thermoleovorans, gta, complexed with acarbose
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
451
structure length
445
Chain Sequence
ERTWQDEAIYFIMVDRFNNMDVNVNDPKGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNMPGGYHGYWIEDFYQVDPHFGTLGDLKTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPTKKDWFHPKKEIFDWNDQTQLENGWVYGLPDLAQENPEVKTYLIDAAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKKDFFLLGEVWSDDPRYIADYGKYGIDGFVDYPLYGAVKQSLARRDASLRPLYDVWEYNKTFYDRPYLLGSFLDNHDTVRFTKLAIDNRNNPISRIKLAMTYLFTAPGIPIMYYGTEIAMNGGQDPDNRRLMDFRADPEIIDYLKKIGPLRQELPSLRRGDFTLLYEKDGMAVLKRQYQDETTVIAINNTSETQHVHLTNDQLPKNKELRGFLLDDLVRGDEDGYDLVLDRETAEVYKLREKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Crystal structure of a compact alpha-amylase from Geobacillus thermoleovorans.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Hydrolase/hydrolase inhibitor
total genus 166
structure length 445
sequence length 451
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4e2oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4e2oA01
4OOZA 1PJ9A 4P8UA 3T2OA 5C71A 3WD1A 1Q6EA 1B3VA 3N17A 2Z1SA 3LPGA 4UZUA 3RM8A 2VURA 5CGMA 3CZGA 4JIEA 3WNNA 4PN2A 2D23A 3MV01 3NSNA 1QNOA 1J0IA 1CXFA 2V5DA 3WF1A 5BWFA 4ATWA 2BHUA 3AIVA 1WPCA 1UWQA 3WQ6A 1EHNA 1XH1A 1PX8A 1R75A 3LPFA 5GNXA 3SCOA 5A6BD 4CN4A 3WBEA 1GHSA 1RD6A 5BCAA 5FL0A 1XSIA 1E70M 1WP6A 3U7BA 6TAAA 5HPCA 1MQRA 1KR0A 3K46A 3RILA 3BVUA 3CH9A 2XFRA 3ZR6A 4PMOA 1LWHA 1O7DC 2F61A 2XGBA 3VKKA 2XIIA 1H1NA 1V6UA 1QNPA 4GZEA 1UHVA 3T0DA 2CBUA 5FL1A 4C7GA 4F66A 2CKRA 5DMYA 1PS3A 3UG3A 4ATLA 3ALGA 2BXYA 1E0XA 5DEZA 1KWKA 1VFFA 4FNSA 4BZYA 4P8XA 1SFSA 4UFKA 3K4AA 2BHYA 4GKLA 4S3KA 4AD3A 3WIJA 4AY1A 2WM0A 2YFNA 1JYXA 1E72M 5BXSA 4H04A 4MTVA 3LPPA 4Z2HA 1JAKA 1UA7A 1R34A 2ZX8A 1GORA 2CKSA 4LPCA 2XUCA 2BS9A 1GW1A 2EPMX 4ZXOA 3KL0A 4IISA 4GXPA 3WH6A 4YHEA 1KXTA 2GJXB 1RP9A 1NOFA 2EPNA 3DYPA 4X0VA 4BQ4A 1OBAA 3ZJ6A 1JZ3A 4J3VA 4D1JA 1BG4A 1CGUA 3AXXA 3SCNA 1FH7A 1E0VA 3WNOA 3WDJA 2OYLA 2F7RA 1JDCA 1B90A 5KZ6A 2PC8A 2BY0A 1G0CA 3A22A 1UKPA 1GPFA 1VAHA 3SUUA 4B16A 1GOWA 4GO9A 1M04A 4AYSA 5HNNA 4JZ5A 4CD6A 4EKJA 1HF6A 1V3MA 5JBFA 2QMKA 2HISA 2VZUA 2DH2A 4OUEA 2ZWZA 4CU6A 3MUZ1 1HNYA 2WBKA 3BMVA 5BRPA 1UD3A 4AMXA 2WZHA 1UH2A 2XFYA 4DWSB 3CGTA 3PZMA 2VCAA 1DWIM 3RDKA 1UYQA 3MKKA 4FLOA 2BY2A 3LXCA 2G3NA 4AEFA 3PZTA 3EDJA 4PRWA 3WQ4A 3AJ7A 1V3IA 2XM2A 3CZEA 3WNKA 4HZ6A 3U57A 1JD7A 2EBNA 1XHGA 3AFBA 1D7FA 1H0GA 4OBRA 3BAKA 4OKDA 3UESA 1J12A 4HU8A 1JF5A 3BLBA 3THCA 2CEQA 3N13A 4PYSA 1H4PA 3K8KA 2RGMA 2WHMA 3NDYA 2HVMA 3WDQA 2UY2A 3QHOA 3WSUA 1KXVA 1BPLB 3WEMA 1XV8A 1FFRA 1MQPA 3AOFA 2C8NA 1XYFA 5LYRA 1H49A 2J75A 3B9AA 1PIFA 3VD5A 1BTCA 1EH9A 2Z1KA 3DX3A 3TP4A 3VU2A 5CPSA 3SCQA 1BYBA 1QI0A 5BXPA 4CD7A 3DYOA 1OSEA 3DX0A 4XV0A 3A24A 2OSXA 3S5ZA 1UR0A 4PMVA 1TA3A 4HMEA 4TUFA 1QI5A 2PWEA 2EADA 3WH7A 4NZFA 2XJ7A 1TCMA 5I79A 1TUXA 2VZVA 1GJUA 1CZ1A 1JNDA 3ZQ9A 4W8AA 4D72A 3AMKA 4JKLA 2PWDA 2JFEX 3OGSA 4Z2JA 3BVTA 4GI6A 5BRQA 3WMSA 3ZIZA 1ZBCA 1JF6A 4R27A 4J27A 1US2A 4P7QA 3CV5A 4KWUA 3MV11 1R47A 2WAGA 4D6FA 3BH4A 4MADA 3ZT5A 2VMFA 3AZTA 3NYDA 4P7LA 1EDTA 3CHDA 2DIEA 2VTFA 5CG0A 4PMYA 4MB5A 5I6SA 2YBUA 4PTWA 1A3HA 3MUIA 1M7XA 4JKMA 4WKHA 4U3CA 4U2YA 1QI3A 3MS8A 2VQTA 1W9XA 1C93A 1MYRA 2UY4A 1J0KA 4NXSA 3GXIA 3GXDA 4HOZA 3AS2A 4Z2KA 3VD4A 1SMAA 2V3EA 5GNZA 3CMJA 4AZIA 2X2JA 1ITCA 4CVUA 2PWGA 5GQBA 4BQ5A 3H55A 3VVGA 3K8MA 1CXLA 2FH6A 5BXRA 1HJWA 1BSIA 2CYGA 3VMOA 2W61A 2YIHA 2OW7A 3DX2A 2ESCA 2GDVA 1OT2A 3M46A 3WF2A 2E40A 1JGIA 3WL0A 3AMGA 2BXZA 4KGJA 3AHYA 2QF8A 4QCEA 1LL4A 3BCFA 2Y24A 5ABEA 5JIWA 1CIUA 1HTYA 1ISWA 5LA2A 1Q6DA 2WC7A 1G1YA 2WKGA 1KR1A 4MPKA 4FLSA 1E5JA 3UR8A 2QLYA 4CVWA 2YJQA 3VM5A 1V6WA 2G41A 3GH7A 5IDIA 2DSZA 1PX3A 3NSXA 2W66A 1B30A 3CIVA 3WQWA 5CSYA 2ZUWA 4TVCA 2WWCA 3AQUA 1RPKA 1GHRA 2VCBA 1HP4A 4MAVA 4ZXLA 1EGZA 3NIYA 4CCCA 4IPLA 3LXBA 3VD3A 2YL9A 3B9EA 2ZX9A 1EQCA 1H3GA 2WWDA 1B3YA 3WQ5A 5CXPA 2WMKA 2J25A 1C3FA 2CERA 3KLLA 3BVWA 2XGIA 3W27A 1J0ZA 1LQ0A 3VSTA 1W3HA 3L4UA 1OIMA 3DX4A 1ODUA 3KL5A 1W9BM 4U5KA 3PHAA 1DEDA 3H54A 3LRLA 4B15A 4FLQA 1N82A 4TOQA 5D4YA 3DC0A 1UQZA 3RIKA 1TZ7A 2Y8KA 1LWJA 1QHOA 2FGLA 3W24A 1GQKA 4LXFA 1AVAA 2VNCA 3J7HA 1TQSA 4JFUA 3WDIA 3SUTA 3T2PA 1JD9A 3D51A 1KQYA 1JG9A 2VR5A 4AZHA 2OSWA 3WUEA 2WVTA 1JZ2A 2D0FA 2OWXA 3AHTA 3PTKA 1CENA 1HXKA 5CPTA 5CSUA 1QW9A 4W7VA 3BCDA 5A6KA 1JI2A 1ISZA 2MANA 2WLYA 3QGVA 1A47A 4WKFA 3SEPA 1UR9A 1XCWA 4MJ2A 3BXWA 1J9YA 5D8ZA 4RE4A 2XTKA 3MUAA 2YBTA 3WDHA 3RJYA 2E0PA 4KRUA 1JYVA 1C8QA 2J79A 5M3WA 1HJQA 2UY3A 1XCXA 2XVLA 3LXAA 1JYWA 3AYRA 1IV8A 4PEEA 3AICA 5CGTA 1EHAA 2F7PA 1W3LA 1K6AA 3ARVA 2YL5A 1NWUA 3GZAA 4GQRA 3NSMA 3CUFA 1WDRA 4J7RA 2DSWA 1WDPA 1J01A 2O9PA 2Y2WA 3ZMRA 2XWEA 3D52A 3KZSA 1W1VA 1JNEA 3AHVA 1UR1A 2V38A 1TG7A 2JF6A 3M7SA 3TA9A 1DWGM 1XH2A 4HZ7A 1E73M 2W92A 1WE5A 4GQQA 1DWAM 1UR4A 4DM2A 1EOMA 1EOKA 1JFXA 2BY1A 5FOOA 1KGUA 3KLKA 5ABGA 1H0IA 2XG9A 1DWFM 3MO4A 3RM9A 1PZ2A 5HXMA 2DPEA 3OG2A 1T0OA 2WHLA 3WDPP 3AZSA 3W28A 1WDQA 1UZ1A 2ZIDA 4PUDA 2OW6A 1XH0A 3MANA 1AQMA 4AZ5A 5DT7A 2DSKA 2PI6A 2YA2A 1TFVA 4MJ4A 3II1A 3HZ3A 4AZBA 3EBVA 4EE9A 1YHTA 3CHFA 4NF7A 1GOOA 2CIPA 1UOKA 1QI2A 3HG5A 3N18A 4WSJA 4AMCA 3VIGA 1LG2A 4H8UA 3WKZA 4ZENA 3GYCA 1W32A 5ABFB 1X6NA 1B2YA 4JL1A 2WHKA 1DHKA 3QR3A 2J7DA 4UQCA 3N11A 4AD4A 1QVBA 1TMQA 4NI3A 1NP2A 3H53A 4OBSA 5E09A 2BVDA 2BVTA 3CHEA 2ZX7A 3OA5A 2JE8A 3HMCA 4HP5A 3U5UA 3UR7A 3SUWA 3OLEA 4AC1X 4NRSA 1JZ8A 3UETA 2NT0A 2V5CA 1WDSA 2WMHA 5JBEA 2J77A 1O7AA 4AZCB 1S46A 4MNJA 3WMBA 1JIBA 1G94A 3PTQA 1NQ6A 3GXFA 1CPUA 1DTUA 1BLIA 2BHZA 1UASA 4NRRA 1E6PA 3I3EA 4TVDA 2XHYA 5A1AA 5HOSA 3ARPA 1PBGA 1TQTA 5A8PA 5A8OA 1GQJA 4UOJA 1JYNA 1E6RA 1W3KA 1PZ3A 1GVYA 1WKYA 3IJ7A 1US3A 2W5FA 1UA3A 3D5HA 4QFUA 2G4FA 1Q6CA 2F8QA 4MNKA 3DDGA 4QDMA 3WD3A 2QPUA 3FW6A 4IM4A 4CD4A 2V3DA 2DEPA 1R85A 1QPKA 3BAWA 3EJPA 5A8NA 4PCTA 3VIPA 4DM1A 2WVVB 2V3FA 5D8WA 3RCNA 4HA1A 1HJXA 2RGLA 2VRQA 1GQIA 5BYWA 1RP8A 1BYAA 2J4GA 2X0YA 1HIZA 2XVGA 3BLKA 1SYTA 4PTXA 3MI6A 4HU0A 2JEQA 2QPSA 4XZWA 1JAEA 2O9TA 1GOMA 1ZL1A 4ATDA 4YN5A 1C92A 4E8CA 1V3LA 3SCUA 4W93A 4JFTA 2DSVA 2VRJA 2G3MA 5EFDA 2EJ1A 1CBGA 4UFHA 4U31A 4PTMA 3ALFA 1EO7A 1KCLA 3ZSSA 3WFLA 2JF7A 2FH8A 2ZWYA 1AQ0A 3VGDA 1TQVA 3N1AA 2WANA 4ML4A 5FIPA 2GK1A 4Q22A 1FHDA 5A6MA 4H8HA 1L0PA 3VIIA 4Y7EA 1CLVA 3WEOA 1HKMA 2E9MA 4W8BA 3GBEA 3ZT6A 4W85A 1ODZA 2WW5A 3W26A 2WSKA 1J18A 1MVYA 1NOUA 1JZ6A 3FHQA 3S5YA 3W25A 4FNPA 2WPGA 4HOXA 1MW0A 1SMDA 3F5LA 2O9OA 3GTNA 5A69A 5M03A 3WUBA 2J7HA 4UCFA 4J3WA 1IZKA 1HVQA 2TAAA 3VNYA 3WH9A 2XVPA 3OLIA 2VVNA 2F18A 3SIMA 2EABA 5DT5A 5M17A 1HKIA 2Y5EA 1E4LA 3KWXA 1K9FA 5CZKA 5D9MA 3GNPA 2D0HA 1H5VA 2EPKX 3HG2A 5DO8A 2G3IA 1NM9A 4UQDA 3OBAA 1W91A 4AZGA 1B3WA 2VC9A 3WELA 5A95A 3FAXA 3W37A 5E6ZA 1FHLA 2CCRA 1HWWA 3JUGA 3W6LA 1QHZA 4EK7A 4EANA 4JAWA 1V6XA 2AAAA 1WNOA 2XIBA 2IXUA 1VF8A 1V3HA 3D4YA 3CMGA 1FFQA 1OB0A 2X8RA 2W67A 2X1IA 4CD5A 5CLWA 2JEPA 1NWTA 1E40A 1W9VA 3SCRA 5LA1A 3DECA 3VTRA 3PZQA 2OWWA 1CDGA 4IPNB 1LLOA 3AI0A 4A3YA 2Q8XA 4UZSA 2EEXA 1J11A 1JDAA 1D3CA 3K1DA 3TV8A 4NXKA 3VNZA 4JCMA 3GM8A 2E9LA 4L4PA 3VSVA 1TQWA 2WSPA 2UY5A 1QX1A 2E9BA 4JFWA 4RL3A 3DDFA 5LA0A 1L8NA 4QLLA 4PSPA 2CBVA 3BAYA 4D6IA 3W82A 3WF4A 3CUHA 4N0RA 1W9UA 5BXTA 1I75A 1UWIA 1ISXA 1VJSA 1ESWA 3AZRA 1PIGA 1BHGA 1J0JA 2F1AA 2ZUVA 3WEZA 1UKTA 4M81A 4AXNA 1GOQA 1BVZA 1BF2A 1KB3A 1ZBVA 2DT3A 3DYMA 1VRXA 3CHCA 1GONA 2WC4A 1U2YA 2FHBA 4OOUA 6A3HA 1DP0A 1OD0A 1C8YA 3QHMA 5IHSA 3VDAA 3QOKA 2E8YA 5A8MA 3OB8A 3LPOA 4J3XA 3VDCA 5A2BA 1E3XA 2WMGA 1XD0A 3UCQA 2XSBA 1CGYA 4WKAA 4P8WA 3GXTA 1EO5A 4TTGA 3WY1A 4R5EA 3SCPA 1UWSA 1NP0A 2BY3A 4FMVA 4PUEA 3VD7A 3AIRA 4GIAA 1UWUA 4W7WA 1H11A 2CNCA 4EAMA 3FHAA 3SCTA 2WMIA 2X0HA 2ZUNA 1D2KA 2DT2A 3MU7A 3RM4A 5EBAA 3EJUA 2E3ZA 4MNMA 4GO8A 3WY4A 5D9PA 3K8LA 4UQAA 1PX4A 3ZM8A 1HT6A 3IAPA 4BQ2A 1TVNA 4W86A 2VUYA 3FNDA 1GUVA 2DSUA 3WL1A 1ISYA 4CU7A 2ZXBA 2WBGA 3WF0A 2ZUMA 1KXHA 1E71M 3PTMA 4AD2A 2WLZA 1U30A 1HKKA 1UD6A 1UWTA 4RE2A 4W5ZA 1HKJA 5I2UA 2GJPA 1J0YA 4HA3A 3I3BA 3GDBA 1ZJBA 3SUSA 3AHZA 3AMDA 1HL8A 4ZE5A 2YLLA 1I1WA 4JHOA 1FH8A 2YLAA 1H09A 2J62A 4WIWA 1JXJA 2G3JA 4D1IA 4UOZA 3IJ8A 5I5RA 4L4OA 4ZE4A 1CXHA 2XFFA 2ZICA 1E15A 2YDRA 2J7BA 3G6LA 3NUKA 3VGFA 2QV4A 2D0GA 3CZNA 5D9OA 1BG9A 1RH9A 4BS0A 1UZ4A 1CWYA 3VPLA 1TVPA 1VENA 1GVIA 2VRKA 5ABFA 1BQCA 5HDRA 2J78A 2ALWA 1BAGA 1E6XM 3O6AA 5C8BB 2VX7A 2B31A 1EDQA 4XZBA 3I3DA 3ZR5A 4M29A 4H41A 3TTYA 3U7VA 1ITXA 1QNQA 1VEOA 3WNMA 4CN1A 1E6SM 1JI1A 5IFPA 1SR0A 3WN6A 1TA3B 3ARWA 4AW7A 3S6TA 3ARUA 1W9DM 3PZNA 4N42A 4M24A 1CEOA 3RMEA 4J3SA 4AZ6A 5A8QA 4AZCA 1VBRA 3GBDA 5IHRA 3AMLA 3ZSTA 2X09A 3ARXA 2DT0A 1QHPA 4AEEA 3RPMA 2ZXQA 2WYSA 3HG3A 3BMWA 4WSKA 4U33A 5D9NA 4ACZB 4P7RA 3BAJA 4GPNA 3VDBA 5A94A 2GDUA 2WNWA 2WCAA 3EYPA 1VFMA 3IAQA 4W8LA 4W7UA 1YQ2A 2PF0A 3A3HA 1B3XA 1E1FA 1CXKA 4IUGA 3WBAA 1UR2A 2JALA 4UTFA 1OGSA 1E1EA 1E3ZA 3CTTA 2EACA 1W1TA 4GI9A 5GNYA 5I3DA 5KEZA 2WCSA 1XD1A 1QI4A 4UQEA 1Q4NX 1B1YA 3BVVA 4PMRA 1XSJA 5F7UA 4WJXA 1CTNA 3PZ9A 2WVVA 2D24A 2J8GA 1ZS2A 3BSHA 5GPRA 5I78A 3ZT7A 1H2JA 4PBGA 3T0BA 4UNIA 4TX8A 4KGLA 2XSAA 3AMCA 3D4ZA 2OWCA 4AISA 3ZO9A 3L4YA 4P7OA 2ZXAA 2VI0A 5E6YA 4D6CA 2A3HA 2X2IA 3AS0A 4HZ8A 2BFGA 1GCYA 1KWGA 6CGTA 1F4AA 3VX0A 3FY1A 4CN6A 3N9KA 1C8XA 3KE0A 1OINA 3A4XA 3VIOA 3EJTA 2Y8VA 4DWSC 1JL8A 1UH4A 2FE0A 3WQ8A 4FNQA 8A3HA 4JFSA 1C7SA 1IZJA 3L2LA 3ARYA 1C90A 5CPQA 2GJXA 3AXIA 2UWFA 2GJRA 1ZBKA 1WAWA 3NCOA 1BYDA 2WZEA 3K4DA 4FK9A 1W1PA 4D6GA 1HVXA 1UR8A 2OLHA 3VILA 3O2LA 2G8ZA 4YPJA 3L4VA 3HJEA 3GXMA 1V6VA 2F2HA 1X1NA 3OZOA 2VZTA 3D3AA 2D1ZA 4E2OA 1JFHA 1G9HA 2PWHA 1R46A 4CGTA 5HPOA 1TE1A 4M56A 1E55A 2J7FA 2Y4SA 4MAZA 1WCGA 4PMNA 3W6MA 4CCEA 1O6IA 2ZX6A 1CGTA 1G5AA 1B31A 1M01A 3AYSA 4D6EA 5AYBA 4W88A 3TOPA 3VOCA 4UOQA 4FF5A 3W53A 3AIEA 3BUIA 4AIEA 4XUYA 1MXDA 1ECEA 3W38A 2WCGA 2OSYA 3L4WA 4MB4A 4DWSA 2DH3A 1U33A 2ZE0A 1JZ4A 1KGXA 3G6MA 1HJSA 2C7FA 1UKSA 4X0NA 5E0FA 8CGTA 5I77A 4P8VA 4F79A 1WZKA 3MMWA 1NWSA 4AYGA 2WVSA 4W89A 3EMQA 3RO8A 3GXNA 2YOCA 4X9YA 3N12A 1KBKA 1PAMA 1AQHA 1VEMA 1OGBA 1W2PA 3FXYA 1HJUA 4V28A 4B9ZA 2EXOA 4J28A 4LGXA 4UFJA 4YHGA 4XB3A 3ECQA 1V02E 2WC3A 5CLTA 3TONA 3A6OA 2O9RA 3UG5A 2XM1A 1QOXA 1MW1A 2GSJA 3VGBA 1CLXA 4UR9A 2VT0A 3WY3A 5I0DA 3PZIA 4PCSA 5EMYA 1WZLA 3ZJKA 1ZJAA 4PMQA 2J7CA 1KXQA 5I24A 3L4XA 2F7OA 4A4AA 2WVUA 3BLPX 2VL4A 1OD8A 1JDDA 4WK9A 3IJ9A 1J0HA 4AIOA 4OGZA 4FNRA 3CO4A 1VBUA 1CYGA 3A4AA 4CUCA 4FNUA 3AROA 2EPOA 2WMFA 4OIFA 2YDSA 3IANA 1KFWA 3EDKA 3EJRA 2ZX5A 3PN8A 1R86A 1V0MA 1V3KA 2CETA 3ZJ8A 3NDZA 4J3UA 3PZVA 3AIWA 1EA9C 2J7GA 2YDQA 2FDMA 3BC9A 1V0KA 1E4NA 3CBWA 3OIHA 4MB3A 3BUPA 5JIPA 4URIA 2VZOA 2QMJA 1KQZA 1I1XA 1E0WA 3ZJ7A 5E1QA 1Y7VA 3ARQA 5DFAA 1GZJA 4NX0A 2DGAA 1E4IA 2OYKA 1UWRA 1W2VA 1OM0A 3SCSA 3OLDA 4AD0A 1HL9A 1MFUA 1BGGA 2GFTA 1KGWA 2PBOA 3WQVA 2O92A 1FH9A 1HXJA 2CITA 3VIKA 4JL2A 1CGVA 2D20A 1QWUA 4LQ1A 2YL8A 4AD5A 1UD5A 3WD2A 1XYZA 3VDHA 3SUVA 1LJYA 4C7FA 1B3ZA 4TTUA 2XVNA 1W9PA 5C70A 1R7AA 4UFLA 9CGTA 4H8VA 1NARA 1W1YA 1UQYA 1CGXA 1HN1A 1SZNA 1G01A 1DWJM 2VOTA 1WO2A 3DHPA 3DHUA 4CD8A 1HX0A 4OJYA 1GQLA 4BQ3A 3AS3A 3VGHA 4QLJA 2PB1A 2VQUA 1WZAA 3F5JA 5ECUA 3RJXA 4DO4A 2J47A 3CZKA 3EDDA 2WKLA 2W63A 1VB9A 1XC6A 5FCZA 4K68A 2YA0A 4JFVA 2JIEA 2EQDA 4XX6A 5FKYA 3AXHA 4MDOA 4FLRA 3VGGA 4KRTA 2W62A 3EDEA 4Z2LA 2J7EA 3W4RA 1OGGA 3CUGA 3EMZA 4PMUA 5FD0A 1M53A 1QBAA 2EAEA 3W29A 2IUZA 1V08A 1OCQA 3VIHA 1EXPA 2ZXDA 2CHOA 2VX4A 3GNOA 3GNRA 4UQBA 4MB1A 2IXVA 3HG4A 3QOMA 4HA4A 4CKQA 4AD1A 1MW3A 1Z32X 5A6BA 1B9ZA 1P6WA 3FN9A 3A21A 3AIQA 3POCA 5IXEA 3GH5A 2E8ZA 4RE3A 4JKKA 1K9DA 3SCVA 4A3HA 1KTCA 4J3TA 2NSXA 4D71A 1Q6FA 4H2CA 4B3LA 5BROA 4LYQA 1MWOA 3F5KA 3CUIA 3BVXA 3PBGA 4DUXA 1XGZA 1LL7A 3IK2A 3HU7A 4W5UA 1EDGA 5A6JA 3ARSA 1E43A 3BAXA 3TTQA 3VM7A 4JHZA 2GK1B 3AS1A 3EDFA 1UD4A 3EJQA 1VIWA 1LL6A 2XVKA 1V03A 3MMDA 3LRKA 2XWDA 4M80A 4GZJA 4HOWA 5EB8A 3AIUA 4W87A 1EQPA 2VO5A 4ACZA 2CXGA 2PBGA 4HTYA 1PEZA 4QLKA 2XYLA 4AMWA 4PMDA 3GXPA 4CU8A 4U2ZA 3BGAA 1MQQA 7A3HA 4TVUA 3AIBA 3UEQA 1QW8A 3PZUA 2NW0A 1UG6A 2EPLX 4PTVA 4F9JA 3B9DA 3WH8A 4E8DA 4FNTA 2X05A 1GOIA 4WF7A 2CESA 3CC1A 2WXDM 3LRMA 2CHNA 2VZSA 2W4XA 4GI8A 2DT1A 2D2OA 4NZCA 3T09A 2D22A 1E6ZA 1BYCA 3VX1A 4DUVA 1ZU8A 1GJWA 2YKKA 1E56A 2CBJA 1GOKA 1JZ7A 1VJZA 2EO7A 1MXGA 3BUQA 1CECA 4GZIA 1CGWA 2XN0A 2NT1A 2VX5A 5A6AA 1ZB5A 4LX4A 3UERA 4AZ7A 3PZOA 3VO0A 5IFTA 2J74A 2CPUA 1ISVA 4B9YA 1R7OA 1E6NA 2ZUSA 2FHFA 2ZUUA 1M03A 4ZEPA 5DF0A 2C0HA 3VIJA 3BAIA 2F1BA 2V3GA 3DX1A 4DUWA 3O9NA 4H7VA 4QP0A 4F8XA 4QCFA 4KMQA 3W81A 3HN3A 3D50A 2BV9A 1VFOA 2FYVA 1OWQA 4PMZA 2PWFA 5E9AA 2BNJA 2WB5A 1ZBWA 2DQXA 1KTBA 3S2CA 2OYMA 3U5YA 1KBBA 2YL6A 4PMXA 2GVYA 1CXIA 1DWHM 4HMCA 3WUFA 1XSKA 1MFVA 5AC5A 1TQUA 3NJ3A 4U3AA 1E6QM 5TD4A 1XRVA 2AMGA 3BSGA 2J8FA 1UKOA 1AMYA 4HPGA 3L4TA 5A6SA 2WZIA 1F4HA 1CXEA 5A3HA 1K9TA 1V6YA 5AY7A 3ARTA 1V0LA 3WDRA 3M07A 3WF3A 4KH2A 2WHJA 4ACYA 3N15A 5M5DA 3W0KA 4DWSD 2D3NA 2FHCA 3VMNA 3OZPA 2FGZA 2YFOA 3MUY1 2DIJA 3M6DA 3APGA 1LF1A 3LX9A 4AIUA 4M82A 3T0AA 1QBBA 5AYIA 5A2AA 4HMDA 3A23A 1C7TA 4MNLA 4DO5A 3A47A 4GINA 2X2YA 3THDA 1BFNA 3CLWA 3CZSA 2W91A 5ABHA 3VGEA 3MMUA 4WLCA 2D73A 4QAWA 3VD9A 1FP9A 4B3KA 4OZOA 4UFIA 5JBDA 5AC4A 4C7DA 2VVSA 4S3JA 3IGUA 2VR4A 4JCLA 3F4VA 3WD0A 2YA1A 3BUDA 3PZGA 5EFFA 4BCEA 4P7NA 1UUQA 3VIMA 3B8SA 4ZFMA 5E0CA 3A5VA 1X6LA 4CCDA 4BF7A 5I23A 2X2HA 1BVNP 2AOSA 4MDPA 2WMIB 1WZMA 2CBIA 4Q7NA 3VMPA 3EMCA 1QNSA 3T2QA 1IT0A 3UG4A 4D6JA 1VFUA 1FA2A 2A3BA 1OIFA 1EIBA 1QWNA 3OGVA 3SURA 4D6HA 2BVYA 1KCKA 4LYRA 2XN1A 4E4PA 2WMJA 2JIWA 4F9DA 2XN2A 1GNXA 1C91A 2A3EA 2A3CA 3WMCA 3GH4A 3ZOAA 1UD2A 3WUGA 3CZJA 4TX6A 4BA0A 4Z2GA 1R33A 3E1F1 2VJXA 1UD8A 5CJ5A 3VINA 3OLGA 3AISA 3L4ZA 1HJVA 3A4WA 4U5IA 1V02A 1NWRA 4PSRA 2WK2A 1NH6A 3CUJA 1UKQA 1H41A 4W84A 3WY2A 3WNPA 1PPIA 3ARZA 3VIFA 2E4TA 1R87A 3BUBA 1V3JA 3CZLA 3WFZA 1E9LA 5HBFA 4AWEA 2ZUTA 4V27A 3SCWA 2XPKA 1B0IA 1V0NA 3WNLA 5E70A 3TTSA 3KEHA 4M8UA 3KL3A 4TXEA 1UH3A 3MSGA 3VSUA 2ZOXA 1FOBA 2QHAA 3MSDA 4UFMA 3WH5A 2D3LA 1HP5A 3CPUA 2A3AA 4V2XA 3LMYA 1E5NA 3N04A 4UQ9A 1NOWA 5A2CA 1R8LA 2GUYA 3WENA 3VUPA 4D6DA 2F7QA 1FP8A 3QHNA 4LYPA 5CQ1A 7CGTA 4M1RA 1W3JA 3EJSA 7TAAA 1MW2A 4NZJA 1Q6GA 1BGAA 3T08A 3AHXA 1K9EA 2DDXA 4Z2IA 3L2MA 2VX6A 4NSBA 1OT1A 2VCCA 3TTOA 1J10A 4DO6A 1LG1A 1WB0A 2IGTA 1E4MM 1QNRA 3WD4A 1JXKA 1JZ5A 3ARRA 5A6LA 3CZ8A 3OGRA 3POHA 1TR1A 5JUVA 1CNVA 1VEPA 3FAWA 4HPHA
chains in the Genus database with same CATH superfamily
1NCJA 3TO4B 3WD1A 4C4KT 5KVGL 4RH4A 1J8VA 4J5NA 3ENLA 3FBQA 3E9UA 43C9A 1I8KA 1R3IH 3OIXA 5HMSA 3TGXA 2EGZA 1GIGH 3WQ6A 1NGXA 4BQ9A 4JFEA 1JV2B 2X4QA 3SCOA 1BVOA 2NUXA 1NSJA 5EU6E 1HHHB 5I82A 4J5VA 5D93C 1XSIA 5I66B 4YGVA 4UTIA 3MLVL 2DPKA 3GHPA 4CMHC 3N34A 4F7TA 3GI9H 3K46A 3WEXA 3PV6A 4GX9A 4Y5XB 1UHVA 4QDWA 4F66A 1YDPB 4A63A 5HJXA 3MROA 4EN3B 2K9FB 4N28A 3JV5A 5C0RH 3QUMA 4HG4K 3SCMC 2PR4L 3K6FA 3DOIA 3EO9L 1ZHAA 1ADSA 2BS9A 2APWA 1ACZA 1JGUL 1EZUA 3WH6A 3UXKA 1D2PA 5DHDA 2XFXA 1AXSB 2ZXGA 3KWWA 2JKSA 2I9TB 4U3SB 1S7SB 1U8KA 2IQ0A 2PDXA 1CGUA 3SCNA 2EG7A 3N2BA 2BY0A 2H7WA 2TSAA 1E9PA 5C0JA 5XINA 3RTQC 4JZ5A 4DXXA 2OCCB 1HF6A 1HK6A 1E9QA 1D5IH 1NDVA 1MCOH 4JNYA 4HC1A 4IICA 3MFGB 3BWUF 3SE9H 5HI3D 3GSNL 4PJ9C 5BW6A 4JQ3A 1K77A 2AQTA 2QQQA 2AEPL 3WLBB 1W72L 2IMNA 1LP9F 2G3NA 4K8RC 4LP5A 2Z2AA 4GOAA 4GQGA 4QTFA 3CZEA 3WNKA 4XT1C 3U57A 4A2RA 4DEUA 2NY5H 3MRGB 4MOZA 2MHAA 4XXWC 1T0MA 3BLBA 3NQGA 2FEEL 2Y6SC 1TG8A 2UY2A 2X42A 2KZHA 5IEHA 5J8OA 3ESNA 4L29A 3HN5A 5HYJD 2OQJB 4ADJA 5IWLC 3UO8B 5B3JF 4X7SL 4O11A 2Z4QA 3TQKA 4JRFA 3BH8A 1O6SB 4HCLA 3TC3A 3LG3A 4RLDA 1FZJB 1QI5A 2AVFA 3TV3L 2BSEA 4Y4FC 2O6FA 4RCXA 3TC7A 1CO1A 1XB3A 3HAEB 1EYEA 4MZYA 4MWAB 4QOKE 3U7WH 2PUQT 5D1ZC 3IXTA 4HS3B 2HS6A 3ET9F 4J27A 1XIJA 3EWXA 3CV5A 5ESQB 6PAZA 3GMQB 1I60A 2I5QA 4JX0A 2VOMA 3CHDA 1R3RA 3MXWH 1QNIA 3NK3A 1UZGA 3V52L 4M7TA 1A3HA 5IF0B 2W1NA 3R79A 5FF2A 4U2YA 2AK1L 3SADA 3OB0K 4RGND 1C93A 3C6SB 4EDXB 2YZ8A 4G6MH 3CPRA 1ITCA 4CVUA 2YPKA 3BEWB 3WKQA 3QO1B 3TC9A 1CXLA 1MCNA 2FH6A 3GS7A 2WXPA 3FCPA 1FVCA 2XX0A 5BJTA 4LLAA 1ND0A 3HZYA 5MP6H 5CR1A 4JDTH 5KOMC 3WL0A 2PGFA 1BWWA 1WUFA 4BELD 5JIWA 2PGEA 5IBXA 4I2XE 1H6TA 4NQED 3FSUA 4IFRA 3VXPA 1IIIA 1HZKA 3RHGA 1K8DA 1V4YA 1OB1B 4PB4A 2YL9A 4WEBH 3I10A 5LCVA 3B9EA 2NXZC 1H3GA 3F6LA 2Z92B 4Z3TA 1R3LA 2J25A 3X11B 2ICEC 3KLAB 3EYVA 1X9UA 3UZEC 3DX4A 3KL5A 1W9BM 4U5KA 4IBSA 4KKPA 4JG1H 5AOIA 5BPPA 2C9QA 5CBEA 3IJYB 2RD0A 3S35X 5E2TL 1W6WA 1DN0B 2HJPA 1CR9H 3D3VB 5LDSA 1OW0A 4AKPA 2YWYA 2NV9A 5CPTA 1QW9A 2OLAA 3SKNA 3FT3A 2A9MH 3P84A 2AGTA 3ARGD 1OF0A 1NM4A 5ESVB 5E5LA 3VXNB 4QE5A 1FLRL 2XWXA 3IGAA 1JYWA 1EHAA 3ARVA 3OXRA 1NFPA 3EADA 4WO4D 2NYYD 5I19H 4WCJA 3SE3C 2XWEA 4PP1D 4PGBB 1HSBB 3S2LA 4IPJA 4MAYA 4QF1B 1DWAM 3MV9A 4KFOA 1RXOB 4Y4HA 4Y8DC 3QUYC 2G2PA 3JTTA 4LU0A 4IG2B 3CSGA 4KKBC 3NMEA 2OV0A 1XLJA 4JFFA 3PIQA 5TH2A 2P24B 4EE9A 1TEYA 4DN4L 1HNGA 2CIIA 2F54A 1SHWA 4B9CA 1RSFA 2J7DA 3WNIA 4AD4A 1LD9B 4XXCC 1MPAH 3OA5A 2MOQA 1JZ8A 5DQPA 4TTDD 3CVDA 5TF0A 1WDSA 2RHGA 4YVVA 1X5YA 2JKEA 3O6DA 1WDWA 2PF6A 3EYOB 3SQOL 2IJ0C 4DP2X 2YC1A 3SY6A 1ETA1 1XH3A 1PV8A 2X3CA 4HJ0D 2XHYA 5KW9H 3ARPA 4D9PA 4NENA 1TQTA 1MIMH 5EGRA 2ABAA 3AXMA 4L1HA 4PRDB 2G9HB 5IR1A 3BQVA 4DSYA 2YZ5A 2BRQA 3DDGA 2VC2H 4X7CC 2PCFB 3FCUB 4PCTA 3FSTA 4W9GC 4EZMA 4XD3A 2NUPB 5EU5B 5FFGA 2YGYA 3UP8A 4ADSA 1ICTA 2QJNA 4GJTB 4HU0A 2O9TA 2FIKB 5KVFL 1YQVL 1FF5A 3BHBB 4QG6A 3TWCH 3NZGA 5FOBA 5KAQF 2VRJA 3EYFB 2M26A 1KFJA 4XP1H 5AKSA 1IFHH 1GZHC 4HH8A 1A6VH 2R4RH 2XA8H 2GK1A 4WW1B 2VW6A 2FEDC 4XOCA 2NNXA 2QT6A 3QT2A 4X5XB 4YLWA 3KWSA 1Y1DA 5T91A 1SW7A 5HSFA 4PYGA 3IN0A 3DRTA 4JFPB 2BZCA 1RPQA 5EA9A 1W56A 4R7VA 5IG7A 3TA4D 5CZKA 1V51A 3ANYA 4IJRA 2NSOA 3G04B 1AD0A 5FCSH 1OGTB 3O6FA 1EHLL 1LBLA 3NA9H 2VLRD 3WIFA 1IQ8A 1G7QB 4UF7C 1W31A 4RW3A 1F41A 1E2VA 2OTUB 3QNZA 2BODX 5I5MA 5M95B 3C2YA 1OAJA 5IVXB 3KPTA 2VFIA 3WK0A 4G11A 4DJFA 1LLOA 1VSCA 5EKYA 3QORA 5F7EH 5ERWB 4AUBA 2Q8XA 4POYA 1D3CA 4UXDA 1YNPA 5GGSY 4OZGA 4HJGB 1JEZA 4MWAE 4JFWA 5EYWA 3B9NA 3TZVA 4AQ1C 4HHMA 3QEQB 4RLIA 3GSWA 2J6VA 4QGYA 5JDSB 5JLZA 4M6VA 2IBBA 2XKUA 3CAFA 1J5TA 3KPMB 2YXGA 4D3CL 3KS5A 4LSRL 2W38A 1KJ2B 5K9KB 1ETZA 1U2YA 2J6EA 5GZND 1JGLH 1OD0A 3VI3A 2E8YA 3WFHB 4APQB 2YCKX 1KLUA 4Y2OB 1XD0A 1ZDQA 3LM3A 4YLCA 4IS6B 5C0FB 3M1BA 4G6JH 2QT3A 3VCLA 4PJBF 1FWSA 1H11A 3R13A 4PD4K 4J6RH 5K5YA 1WAPA 3WI9A 4EF3A 2QDVA 2NDFA 4LH8A 1U58B 2H4EA 5I8OH 5EEXA 4AB4A 3IAPA 4W86A 3IJSA 5JNYB 4XIMA 3ULSB 4KUZL 3JBG7 5D05A 2IDSA 2CXKA 2D03H 2WLZA 1AFVL 1QRKA 2HN7B 3ZVIA 3TO4C 3WMLA 2X1UA 5IVNA 3MRMB 5ITBL 4HWZA 5FF7A 4JHOA 4QIUA 1FH8A 1H7RA 4DXKA 3VG9B 4RETB 1W54A 3T77B 4TF4A 5CCJA 2HNHA 4C6MA 1X5JA 1W8EA 2FLIA 2N7BA 1ID5I 2J7BA 3GUWA 4FFTA 4IX2A 5F8RC 1TVBA 3V36A 1P4CA 2ENYA 3LQAH 1Q9OA 3NEHA 3MLSL 3D3VE 5BUPA 3IF1A 4IRSA 1F6LL 1TWZA 2VO8A 1QOPA 1B4EA 1MJ7H 1QNQA 3N6YA 4Y5XC 1JI1A 4Q4IA 1CL7L 1AIFB 1QDSA 5CILL 4RKAA 4NU7A 3EYUH 1W9DM 3IDNA 1CEOA 2WLKA 3QIBD 4J3SA 3S9DB 3GJFB 3IDUA 4EN3C 4MNQA 2JKPA 4UIKL 4L8SB 3B03A 3V5HB 3QDHA 1IEXA 2NTFB 5HNRA 3ZLFA 2PMQA 4LF1A 4C6PA 3A3HA 3TJHC 2A74A 1OPGL 1UR2A 3GIVA 1T04A 3SY1A 4R7DA 3RVTD 2VLKD 3IACA 1J8KA 4JIIX 2MRYA 3GTHA 3CMOL 1MRFH 3M5XA 1B1YA 4PMRA 4OT1H 4BZ2A 1TFHA 3UC2A 2KERA 4N9BA 4M03A 1L3WA 1G87A 1E4KA 1KELL 3T0BA 3B05A 3ABOA 1JP5A 5E6YA 3GB7A 3PXHA 2FYYB 1CLYH 3GLEA 2DORA 5DJZB 2IPWA 5SWQA 2AZUA 1YAIA 4R9HA 5EDSA 1QK0A 1TITA 3EJTA 2ITDB 3IIVA 2OMZA 3FK3A 2ZKHH 5EU4A 5T3ZH 1DBTA 3P77A 4JO2H 4E2VA 1G0YR 2O7QA 1F3EA 2J9XA 5EY5A 3CSYB 5I1LB 3N2XA 1HVXA 5EDXA 2OODA 4DZHA 3C3UA 1RSYA 4ORIA 2D1ZA 1TTBA 4WUUB 4E41E 4E2OA 1S2EA 1CCWB 4LF3A 4M5TA 3BQ6A 4ZXBB 1A5FH 3RAJL 3VW3L 1M01A 4G1EA 3WLLA 3EO1A 3BUIA 2UZXB 1N64H 4A2HA 4JTEA 1BIHA 3FXIC 4F0RA 4MA7L 3KLDA 4MWAC 2JCCF 5TE7L 3MBEB 2CLRA 3W1NA 5ISZD 4YIQA 5A2LH 2GZXA 3BQUD 4UYQA 4GC4A 4N5EC 3CV6A 2I32A 2VN4A 2VERN 1ZLSL 2YGNA 1DQJA 4KDVA 4AC7C 1GYVA 12E8H 2E77A 1N67A 4XRCB 1I4FA 4TSCH 2CA3A 4NIYE 1XQ4A 3KPNB 4XB3A 1MCQA 1V02E 4TQIA 3BG3A 1KULA 4Z95H 1K8IB 4B3EA 5CPOA 1S7TA 3PZIA 1S5IH 5ICXB 5CSRA 2D7QA 1BOGA 3L4XA 3DG3A 3FEQA 3QULA 3QI9A 3BK0A 1J0HA 5F96L 3A4AA 3P7YA 2ZWSA 3DUUB 2CDEA 1KFWA 4DVOA 2CO1A 4AEHL 4DW2H 4BWLC 3EPNA 2I5YL 2O0TA 1REIA 1E4NA 5C55A 1YLVA 3L95B 3SN4A 5U4NA 5FEZA 5T1LA 3ZJ7A 3WLJA 3TIEB 1Y7VA 2AXGA 1Q94B 4ZS6D 5C09E 1E4IA 2DVXA 1HHJA 3GUTA 3FDGA 4F7PB 4OGXL 4FG6D 4BK5A 4DI9A 4MXWL 3VRLF 3SKOA 4PBVC 1YJDL 4KK5D 3U30B 3PXJA 3IRSA 4L48A 1VZHA 2GSGA 4KI1A 4EEEA 2YD1A 2IV8A 5IVXE 3D3FA 1CGXA 4IIQA 2G5BA 1HN1A 3UX9B 1QSEA 3S3SA 4Q6KA 1FYHB 4JRYD 4N7QA 3MLRH 5HINA 3TLQA 3TYEA 3WZ0E 3MP3A 2OXGA 3FU5A 1T6BX 2ZDRA 3L5XH 3SDYH 3FB6A 2CGRH 3QEQE 2XWRA 4JFEB 3TCTA 1DVJA 1A4MA 2V5MA 4YGVB 2V82A 3NM3A 4F7TB 3T4CA 3W29A 4EAEA 1T80A 1T96A 3KBMA 4P3CH 4NCC2 1MH5B 2WYIA 3PJSB 3GDLA 5SX4H 4CLMA 2VX4A 1KC7A 1YEEH 1JNNL 2YD9A 2NRDA 5A6BA 2Z34A 2D2JA 3MROB 1WXZA 2A3TA 5H35B 5DK2B 4L5FL 3FMGL 2DJSA 4P2OB 3QUMB 2QPXA 4WFGD 1Z8AA 2WIIA 1K70A 1IXQA 2NSMA 3CLFL 1XGZA 4W5UA 3ARSA 4MBRA 3DMMB 1ZT7A 5F9WB 2XFXB 1V03A 3KWWB 1T66C 2VO5A 1CCZA 1U8KB 3PBVA 3R6IA 4FERA 3BDKA 2IAMD 3ZKSD 3MC5A 3IWPA 3CL7A 4N2DA 3PZUA 2AQ1A 1E9PB 5C0JB 3H24A 3LRMA 4XD5A 4IMAA 1P1MA 2XZAH 3SD5A 1E9QB 5B39G 4DUVA 1GJWA 4P9ML 4BV1A 1I6NA 3LKRA 3L67A 5KSUB 4LX4A 1V6TA 4Z7NF 1S9XA 2XSKA 1A6PA 4KUCD 4P2RA 3O9NA 2A9DA 1PZCA 3IU4L 3D50A 4AEIH 2DBJA 2BV9A 5G1YA 3TASA 2BNJA 1X1OA 3P82A 2DQXA 2NV2A 1KYUA 1WBXA 1WVZA 3SKJL 2MHAB 2FZMA 3S5SA 4U3AA 3R8GA 3AAMA 2CPCA 4A7QA 2EEAA 4B5UA 5IEHB 1NLDL 5GRUH 4L29B 3B37A 3KHQA 1KV8A 1O6VA 4HKJB 4R6UA 3NIGF 2Z4QB 4I5UA 3WF3A 2HH0H 3W0WA 1OFAA 2G60H 5EU3B 2XFGB 3BH8B 1JBJA 1T2XA 1OYBA 3KD4A 1RKRA 5BVJB 5EZPA 5I16A 4HIXL 3NFPA 2ICWI 4LDOB 4Q6XA 3E5BA 3LBOA 1S8DB 2REQA 5A2AA 2GGHA 1F6YA 4WAFA 3I9PA 3IXTB 1RQBA 2AGKA 1S38A 2OR7A 4UFIA 4KK6D 4YVPA 1Q72L 4TUUA 4MS8D 3EGDB 1KCUL 4L4MA 1EMTH 1S3HA 4Q8BA 2YA1A 2HMCA 3VIMA 5E8NB 3QTPA 4TULH 3BFOA 1QNSA 3NA8A 3MCOA 1MFAH 3EH4B 4HUVA 3TE9A 1GPOL 1DQLH 2YPKB 4BINA 4D6HA 4AXWA 1Q2SA 1KCKA 2Y7MA 3R0KA 4QDGA 2JIWA 3X1FA 1FVCB 5BZAA 3CZJA 4Z2GA 3LERA 1ND0B 3HZYB 3LN4B 1W3TA 3TNOA 3JVGA 4PSRA 2ZG2A 4B0MM 3KPLB 4RDZA 2E6DA 2ZUQB 1CG9B 3V0FA 1OALA 3DH7A 2ZUTA 1NCNA 2YAOA 4WUUE 4Z0BL 3NFNA 1UH3A 1FOBA 3NQVA 2A3AA 3W07A 4AH2A 3BDXA 3P0VH 1NOWA 4OSUH 3UZXA 1R3LB 1MY5A 3KBFA 4A66A 3RWJA 3QBUA 3EYVB 3D4CA 1CB4A 1ED3A 1SN2A 5CBEB 2ZRVA 2IGTA 2ODHA 3FSAA 4Q4QA 3WV0A 2ZZ6A 1EB3A 3NFUA 2N01B 4KDWA 4HPHA 1HINL 3S9IA 3U1QA 3LHPL 2GFBB 3W1QA 5C71A 3OJDB 2GITA 2VWEE 4PN2A 1ME9A 5C2UB 3SKNB 3FT3B 4ICWA 1RIVH 4APQC 3RNKA 1S2TA 4TPRL 5DK0A 5A7EA 1ZTMA 3IGAB 3KM1A 1CU4H 4IJBA 3OXRB 4OECA 4RJEA 3R89A 3MBDA 4R4BA 3U2EA 1JGMA 1E5AA 2WLJA 4P59L 1ZSHA 2F61A 3U6XS 2NOYA 3WQOA 3MV9B 4AKQA 2WXKA 3S0PA 1IRAY 4Y4HB 2L0DA 3MWAA 4NKQB 2X6UA 2JCWA 2NSQA 2OI9B 2QVIA 3ZUCA 3CE1A 4JFFB 3QR2A 4E5XA 5J7CC 3PIQB 5TH2B 5M2FX 2CIIB 4V1XA 3VG9C 4DLMA 2FZ8A 4BQ4A 2PYFA 1G1KA 4P5UA 2ENPA 2YSTA 2OXHA 3SZKC 4IOSA 1NF0A 3ITVA 2OYLA 1BWKA 4UM9D 2R1XB 1PZDA 3ZE0F 1AQFA 1UKPA 1M7DB 1M04A 2CW6A 1KBVA 4HUUB 2YC1B 4JFEE 4DB7A 4XHJD 5CP7A 1QHQA 4YE4H 4G7SB 3BGMA 4FQ1H 1TYEB 5CUSL 1YEHL 4L8SC 5IR1B 2R1KA 4G7RB 4G7FA 1DQML 5J89A 3U6RB 2AEWA 4HBCL 4EXKA 4W4OA 2JI2A 1NGZB 4PB5A 2CEQA 4C1NB 3WFBH 2JKLA 2YUXA 1IKNC 1C12A 3B2UC 3M5ZA 3BWUC 3LBCA 3Q1SH 3VZZA 3HLKA 3NDOA 4Q9BA 2ZYHA 4N2YA 2FB3A 4PFHA 5FOBB 1VFSA 3E02A 4D9LL 3KPPA 3S5ZA 4PMVA 2DLHA 3SR7A 1VBHA 4JTJA 3WH7A 1DSYA 1NDTA 5HI5D 2F74A 4M3PA 3W7PA 3PFRA 3LDVA 4J2XA 4KAQL 3AMKA 4FZ8H 1E50A 1NC2B 5E1AA 3MOBH 2GIYA 4ABQA 3WLRA 2DQIH 2VMFA 3ZT5A 1XHHA 1UB6A 1KIQA 2D2CC 3OPZL 5I6SA 4QAMB 1OX5A 3DRTB 1RV8A 1W17A 4UUJA 1Z9AA 1MYRA 5IG7B 2JCCB 3GXDA 4HK7A 2RDTA 1IAIH 1EJXC 3QDMA 4D8LA 5LAXA 4ZXBC 3O6FB 3NPWA 1PB0A 1U2CA 35C8L 4FFZA 3WIFB 4D8PA 1FQ9C 3L1EA 2GDVA 1OT2A 3I6RA 3E3QE 3QNZB 1JTOA 1NSNL 4QCEA 4BFIB 3MBEC 3QORB 1LEGB 3V1HA 5AZ1A 1ZCOA 5HNUA 1UCWA 1XM3A 2PTWA 2ZG1A 3ILPB 2X7WA 3TZVB 4ICCX 4YLBA 4ICXA 3N14A 3AU1A 3GSWB 3OKDA 1ML1A 3TDFA 1W3HA 3RJOA 3D07A 5JLZB 3B9KD 2RKXA 3DRQB 3F58L 2CO3A 1R0MA 4JDZA 1QHOA 5T3ZD 4JTQA 3F4DA 3U46A 3SUTA 1ETZB 1FHGA 3T2PA 1FBAA 5BRZD 1FIEA 1Z1WA 3PTKA 2RTTA 4AUUA 1EAOA 4F57L 4S1RL 2DBLL 3M1BB 4DKAA 4AIXA 2ZYRA 5FM8A 4WHTB 3KZ8A 4C4KO 3MZ2A 5T5FL 4ZUUA 3CQFA 3D39D 4KCTA 5LG6A 3ONCA 4HPJA 3MFFA 3IJSB 4G1MA 1WDPA 1J01A 3U30C 5CIPH 3D52A 1JNEA 2DAVA 4FQHA 1D9KA 2VQ4A 3N42B 5EEWA 1YC8A 5F97E 4JX4A 5FOOA 2VISA 4W68A 3MO4A 4PBDA 4HWZB 3KCJA 5IGXH 1HDMA 1FNEA 1M5WA 1P0NA 2QTEA 4AZ5A 2DSKA 4UTBL 4TMBA 4MA3A 1CK0L 3CEPA 4IX0A 3GU2A 1TVBB 2CIPA 3VFMA 5AHNA 2XWBA 4PRIE 3FYIB 5K1NA 3IF1B 3MA9L 1MQKH 4IRSB 3N11A 1NZRA 4PJBE 5JZ7D 1DQVA 1NP2A 3DJ9A 3CHEA 3SDDD 3H6AA 4V1DD 4ZQOA 3OLEA 4LCIH 4LUSB 1JCYA 2FEEI 4K0OA 4AXKA 3TYUA 3MMEA 3OZLA 5FPIA 3U2ZA 3IDNB 4YWGL 4MNJA 4P2OC 4MNQB 1CPUA 1TVDA 3HJZA 3G9VA 5HYSB 1UASA 4MJJA 4JG9A 3Q2CA 5DS2A 4ODVL 4WUKL 1GQJA 4ZZFA 3TQPA 3RY4A 3OHIA 3DI3B 3DMMC 4AQOA 5F9WC 2EXWD 2W5FA 3QDGA 2A74B 3D5HA 4JN1L 3JUYA 3GIVB 4R7DB 1KYOJ 1L7IH 3M0ZA 1NEUA 3BAWA 5A8NA 1LOLA 5BOEA 1DXEA 3PAVA 4JN2A 3GJEA 4YO0A 4Z7NB 3HA1A 1T7WA 1N6UA 4LEQA 5BYWA 4A39A 3KOZA 5D7SH 4PTXA 2W5PA 5IQLA 3GB7B 1V3LA 2G3MA 3C09B 4HYRA 1UCTA 2VWTA 4X9IA 4DX3A 1HJBC 4LCCA 1PF3A 4Z9KB 5SWZB 4S0TD 2OMZB 3WO4B 1A0QH 1HIML 5EU4B 1IM9A 1IGFH 3GBML 1O66A 3VGDA 3EX3A 1TQVA 3UTOA 3B8VA 3P77B 3K6OA 3UAJD 1CB7B 3NIGB 4R2GB 1L0PA 4C6DA 2OBGA 3NK4A 1HKMA 2WNGA 3GBEA 1TSIA 3BT2H 3KMDA 2ZYSA 4CJ1A 1GGCH 3KFTA 2VXQA 4FI4A 3W25A 4H26B 3ZL4L 3E3QC 5DBUA 4HNCA 2O9OA 3GTNA 3RL1B 3R2GA 5LNSA 2DQUH 4Z1AA 1XF3A 3E6EA 5CGBA 4QTIH 4K1WA 3RB7A 4G1EB 1RZGA 1B54A 2HQAA 1UQSA 2AQ3A 5FAJA 3WTWA 2KC0A 2VDPL 4DAGH 1MNSA 4JHBA 1P5BA 3JUGA 3W6LA 3C0SA 4JAWA 3SBQA 2CLRB 2OTWA 2R29L 3EFFB 4FQQA 1S5MA 3RUGF 2FWOA 3PBMA 3HC4H 2VEKA 1DQJB 3H0TA 3E2HB 1I4FB 2XQBH 2VIRA 3UYPA 1QFOA 4P5TD 1HHKA 1S7TB 2A6IB 2O6PA 2IFGA 3WKML 2YRBA 1NGYA 5FO7B 4YDMA 5BU9A 4E41D 5F0LB 3QULB 3QI9B 4HS6B 2ZC1A 2I60L 5K39A 3ABSA 4JW3A 2X2UA 1Q5MA 3B7SA 5J06A 3PF2A 2AK4A 1ASPA 1ZAHA 4X6EA 4GIYA 2WYZA 1INEH 4KKQA 4ODTH 3DYMA 1A1NB 4GCXA 5DJDB 2V8MA 1VA9A 4KFPA 2AJSL 5IBXC 4ZPVB 2ZUQC 4RRPA 2JCCE 2AXGB 1XBVA 2LE9A 1HHJB 3GUTB 3TXVA 4TL5A 3W70A 4F2TA 4AHOA 2LW3A 2X9WA 2G95A 2ORBL 2VDNB 3GIQA 3SKOB 1F97A 1FWTA 3KR3L 2X0HA 5ESAA 3VD0A 1FFPA 3LN5A 4OCWH 1ZANH 4GO8A 2F58H 3OKYA 3CPGA 5AW7B 4YSSA 1KGYE 2R56H 3LCFA 5I03A 1TVNA 1F2XK 3V4PL 3CG8A 1FYTB 4XNMA 5D6DA 4LLQA 2WXNA 3HUJA 1JCKA 3CQKA 2MFNA 1RJRA 3ROOA 4NZ1A 1OW0C 3TBTB 1QFPA 2DLEA 3FB6B 1A2YA 4Q32A 1Q45A 1BPVA 3IGHX 4W9TA 2OJ1A 1YBQA 2VLMD 2ZICA 5EORL 2V2CA 3RQ3A 3V8OA 2FZBA 5E4EB 4P23A 3OODA 4OV9A 4XO9A 5D02A 1HQ4A 1UWXH 4U0RB 3RVVD 4PMEA 3NP3A 4H41A 5AW5B 3VRLE 5DRWA 4HWEH 3M0XA 3QZPA 4CN1A 3LMZA 3VXMD 3WN6A 2WIIB 3BZDA 4Y4HC 4B92A 4D0CA 4WHCA 4NQCA 1PKQB 3ZSTA 4M00A 2DZAA 5IB3A 3CHPA 4AEEA 3EYSH 2OI9C 2WYHA 2ZXWB 5DI8A 4H8WL 3MODL 4KMTL 3FYEB 4BIKA 1BFOA 3ZE0B 3HO8A 3PFUA 3FJNA 4W8LA 3EG9A 3GG1A 3ZVHB 1B3XA 1CXKA 4GBXB 1D6EB 4UTFA 3HG1A 1CDIA 5G2IA 2X89A 2MH4A 1WTLA 2P43B 3BVVA 2UZYA 4IMKA 1TTAA 5A16A 2D7TH 1X5ZA 2AVGA 4A35A 3P2TA 5I78A 3GXUB 5IVXF 5DQ9A 3GR4A 2ABBA 3X14A 3LKRB 4ALAL 1LORA 2ZG3A 3ZO9A 1ZAIA 4JFDA 3JS3A 4ZO7A 1FGVL 1JZIA 1S9XB 4I5XA 1OAUH 1LO4L 5D03A 4P2RB 4HZMA 1WBXB 4NCDA 3WQ8A 5DSCA 1IC4H 4LC6A 3CDGA 3FS2A 2W0FA 4B5EA 1LILA 2BX5A 3QFJD 3K4DA 1J8HB 4JPGA 4C65A 4D6GA 4KWOA 3OQ3B 1BD2A 3W0WB 4OFQA 2QJHA 1KENL 1PIIA 2GVJA 2BJMH 2ATMA 4KJYB 3OZOA 2I56A 3CXFA 1J8RA 1RFDL 4ICMA 5HPOA 4G71B 3IKCA 2HZHA 4PMNA 1RUMH 4CCEA 1NEYA 4J8QA 5DZNA 3GAKA 4CCZA 4OM0L 4YH6A 3W53A 4ZW7A 5AKRA 4QEGA 3EX6A 4AJYV 3B83A 4XAPA 4K7PX 4NT0A 4J4PA 4R7OA 4WZ9A 2BP0A 1JZ4A 2W9EL 3G6MA 4Z7NE 1I7UA 5E0FA 1OGAA 4XG1A 4ZOBA 5C9ZA 5T1KD 3VFRA 5F1VA 1OGBA 3EPMA 3A6BH 2JLLA 5IB2A 2DQJH 4P3DB 4B9ZA 5IREA 5B4MD 4UFJA 4YHGA 3ZXAC 4HUVB 5SWZE 4AXWB 5GGVH 4KEMA 1U8HA 2EUWA 1WZLA 4PMQA 1ZJAA 4TUKL 2J7CA 3NIGE 2ZZ7A 2PYEA 4D9QD 3O11B 2HUEA 3STBA 5C6MA 3O6FC 4K8GA 2YDSA 4UT7L 5M94B 4JM2A 4DZ8A 3ZTNH 3CX2A 4HMNA 2BFVL 3NFNB 4N4QA 5JIPA 3QORC 4Q4EA 2IH9A 3BJ91 3NT0A 2FX9H 1EXUA 1UWRA 3RWJB 1XBYA 1DBAH 1OAKH 4GQ0A 4PJAA 2QJDA 1ED3B 3RF9A 3TZVC 3TVMD 3MVSA 1TWSA 4XX5A 3N3TA 1RR2A 3FQWA 1TIMA 1DVFD 2O6DA 3EA1A 2UUDK 4XD4A 2EC9T 2GITB 2VN5A 1DVZA 3F84A 1LHZA 4MLSA 1L6SA 1OHLA 4QXTA 1PEWA 1AGDA 5F9OL 4ZYKA 3VFWA 3UWWA 1XC6A 4K8RH 1CL7I 1E4XH 4EPBC 5TQLA 5DK0B 4R8WH 3TX9A 5BOOA 2JBMA 2XKNB 3ZZLA 5F1IA 3MBWA 4KZCA 2OZ4A 3UMTA 4G6FD 4ACPA 4DIXA 1AY1H 4RSVA 2NQ5A 4R4BB 4AOFA 5J3HC 3BZEB 4MQXC 1KLGA 3PAYA 2PETA 3BOLA 1ZLWH 2CHOA 3FTUA 4XMLH 3H2QA 1EX1A 4MB1A 5H4YA 2UX6A 3AM8A 3GH5A 4JKKA 2BZDA 5FYLH 3BD5A 1OY3B 4CDGC 4GKZA 3N9GL 3QCUH 2EDJA 3GWQA 4DUXA 4ZFOA 5I1IL 5LNRA 5HHQA 5L0QB 3HU7A 3LRHA 4GXWA 3NSDA 4C59B 3AS1A 4YOKA 1FUYA 2FEJA 3RKDD 3WFAA 3W2UA 4NSKA 1DVSA 2KX9A 2PYFB 5EB8A 2VITB 2LFGA 2OX1A 4QLKA 5EOCH 4AMWA 4PMDA 1FYTE 1E5YA 3BGAA 1A9BB 2XTLA 3AIBA 1MKFA 4WU7A 3VXUD 3UY7A 2WQXA 1ACCA 4IRSC 1PSCA 4WF7A 5IHZA 3Q2LA 3W7CA 2VXUH 5CU9A 5CP7B 4JRXD 4BZ1H 5C9WA 3E8UH 4ZPTA 2EO7A 3BGMB 3QCTH 4DJEA 5LBVA 5IFTA 2CZNA 1DJZA 4M48H 2FHFA 2NY6D 1MWAL 5DF0A 5I6XB 5FYJL 4UV7H 5DEFA 2YQ3A 3G1RA 4WCYH 2X40A 5FCUH 2OYMA 5HMEA 2YL6A 3HGRA 3OBEA 2A74C 1TQUA 4OF6A 4YDZA 2HFTA 4ZS7L 5LGJA 2GGEA 2AXHA 4LUTB 1C12B 3Q6GH 2BP8B 1AMYA 3GTIA 2VMCA 4G5AA 1CXEA 1E5BA 4KKXA 5AY7A 1FRGH 1X6UA 4BFOA 1PKQE 4IMEA 3NSCA 1V0LA 5DJXA 1RBAA 2YRZA 2BSSA 4D0BA 3KPPB 2NZ9C 4H4IA 2PP7A 3ZE0E 1LF1A 4ELDA 2F74B 2R8WA 1ZOXA 3C09C 2WTPA 1K6WA 1FDJA 5DQDL 3L3OB 4FTDA 2X6BA 5E1AB 3MMUA 3WO4C 4N1CA 1S7RA 5IROA 2DQEL 4CQBA 2B1OA 4OZOA 4YHKH 1UB6B 5BNKA 1XUZA 4R2GC 3GINA 1KIQB 4KH9A 4KCVA 2Y36H 3TVAA 3ELFA 5K1VA 2BSRB 4UUJB 4X4KA 4F0SA 1XO8A 5MHBA 1IEBA 1AD9B 1PZUB 2JNZA 1WQVT 4EI6A 3QDMB 5DR5L 5LAXB 3RUGB 3SGDH 5GJSH 3K5SA 1M7PA 5EUOA 4MLIA 4NN6B 4D8PB 4XNYL 1C8VA 4QYOB 1LTDA 1II4E 4CVXB 1MEHA 1JUKA 1J8HE 2DZWA 1XF4A 2OJPA 1GSKA 2QVKA 3IBEA 1H6FA 3EWUA 3EH1A 1OCBA 3SCWA 4KKLC 3GVRA 5EUKB 4X3ZA 4TXEA 3FQ2A 4YYCA 4HPYH 2V5TA 3E2HC 5REQA 1EPXA 2DVUA 4CNTA 2CLIA 1ZSDA 1XRTA 4OLUL 1AMXA 3AU1B 3WENA 3S1XA 4WZHA 3QHNA 4M1RA 1RULH 1D7CA 3L2MA 2VX6A 3O2VH 4JDZB 2V5KA 4HHHA 1AH3A 4ZUVA 1QNRA 3QI9C 4PW3A 3S36L 1IQDA 5LBSA 1XF0A 2JI3A 4XN9A 4PRPD 4U1HB 5D04C 1NGWA 2F53D 4A8LA 2Y7EA 1ET5A 4IBZA 4BSWA 3EBHA 2G2RA 3DSFL 4IOFC 2K45A 3L5AA 2HRPL 4BFGA 1B4TA 1PTZA 5KG9A 4ZUUB 1XLMA 2XXGA 3D6GA 4BK5C 3UTSA 8FABA 3BPCA 4ZL1A 1MRCH 3MFFB 2X1XR 4G1MB 2DW7A 4PA8A 1DJGA 2VDKH 3BVUA 4L0PB 1FLTX 4O0KA 3O3EA 4FQHB 1V6UA 3FUMA 3V10A 1EGJL 3E0VA 2VEIA 1RUKL 2VISB 1ME8A 3UG3A 4A6YL 2F7IA 2BXYA 1YEFL 1FBIL 5C6TH 3BUYA 1HDMB 1FNEB 4JDEA 4KV5E 2XIOA 2ZCGA 3PPHA 5EF0A 5KYXA 4MA3B 3PBWA 3QFGA 3S3PA 3VFMB 3DU0A 3HQOA 4F7MB 2XWBB 4LGPB 1KIUB 4X0VA 1CFVL 2WO4A 4TOYH 2XWJA 3AAZA 3KH4A 3CN0A 4PJ7A 4UIOA 4D1JA 4N2GA 3H4WA 4NJHA 4FABH 5FYKL 5E4EC 3O2DA 4B60A 3MMEB 2XN9A 3ITLA 4U0RC 5HNNA 3LZFH 2Y85A 4FOKA 2QQNH 4O4WA 3LS5H 3DIDA 4KVCL 5JDJA 5JPMB 2DQGH 1G0DA 5C2BH 3H8NA 1DJQA 3QNFA 4D2JA 1GTNA 4M1CC 3RG6A 2LT9A 3QDGB 4YHNA 4X5QA 3WG7B 2X4TA 1XMWA 4DYKA 3X17A 4O28A 2XM2A 3MBXL 1N2RA 3EFDH 4PTNA 4HZ6A 1X4YA 4NP9A 3ULUE 4GBXC 4JN2B 4Y5YA 2HLEB 3MV8D 1FG2A 1KXVA 1F7BA 3CT2A 2QNEA 1FGNH 4NUGH 1QRNB 5CPSA 3SCQA 3C5SA 5AB1A 4C6QA 4NO3A 4OM1L 4K5PA 4LCCB 1T6WA 4HMEA 1TA3A 1PY9A 5IBUG 1IM9B 4ZO9A 1E6OL 3M7WA 1WJ3A 4LEOA 4G8GB 2KH2B 1T7ZA 3MV11 5DZLA 3LH2H 4L80A 3ESVF 4IM8A 4S1DD 4HHAA 3OMZA 1RK0A 3PUGA 4Q4KA 1P7QD 3KLQA 1U6AH 4U3CA 4IRJA 3QVQA 1QI3A 4BGDA 1XF3B 2P8LA 5A43C 4LLVA 3GXIA 4HOZA 5DUPH 1UQSB 2G3XA 1H1ZA 4JO3H 3CMJA 4LEBA 2EH7H 4A6GA 3GZQA 1K85A 3GR7A 1BSIA 1U8LB 2CYGA 5FECA 2OTWB 4HFUH 4YXHL 3E9TA 5SWSA 4FQQB 3RX2A 3S6CA 2YXVA 2FWOB 5GGUA 3RLVA 3H0TB 1MY7A 2Y24A 3ES8A 3UJJL 4HXAL 2QLYA 3RP1A 2YSSA 5IB1A 3WO8A 3U1PA 4TVCA 4N25A 4I6VA 1INDL 1D3GA 4ZXLA 4GXMA 1HHKB 3RR4A 1EPFA 2OA9A 1KBPA 1NGYB 3DG6A 3NZ8A 2YQ2A 1HQTA 3NL5A 3K6NA 4PMFA 4Q14A 3O0KA 2V9DA 1OIMA 1QBML 2P48B 5JIQA 3KW3A 4WK4B 5K39B 4WWNA 2I16A 4FF7A 1U41A 2XJKA 4X6EB 3S8FB 5KWYC 3J7HA 3JVGC 4LSQL 2F84A 3M0VA 2HCZX 3FONA 4QSHA 4H1ZA 1O7SA 4OTXH 4TUOA 4HISA 4N3TA 2E56A 4YSPA 2MANA 3QDME 3G5VB 4LOFA 3RUGE 2ZYIA 1BVNT 1CQKA 5D2TA 4MJ2A 2VENA 1NCAH 1LP6A 3MUAA 2X7VA 5ESAB 3O06A 3S47A 1FFPB 3LN5B 2X53A 4UINH 4FZEL 1SQ7A 2EEDA 5CINH 3LXAA 5KBPA 5HJ3A 3WU1A 2ETWA 2ROXA 3WXVH 3IWVA 1KB5A 5KVDL 4HGMA 2WAHA 5ILTL 4UAOB 1I53A 3FSWA 1TZGL 3CL6A 4XNMB 5KSAB 2QHRH 4U1LA 4LLQB 2V38A 3HUJB 4GC3A 2A3LA 4PWGA 4GG8A 4QBXA 2NW2A 4KBXA 5C7XL 1OT4A 3DLQR 2B59A 1UZ6E 3G24A 2KZ1B 4LKCA 1T2QL 1A2YB 5FR3A 2K7QA 5ECGA 3Q1EA 2J5WA 1U1UA 1MI5D 1TZIA 5GS1A 1YBQB 4DYEA 4MSWA 3URAA 4O1CA 3II1A 4XP6L 4PODA 4L65A 4BFAA 5BO0D 1LZOA 1QI2A 5AHLA 4XNDA 1EYWA 4JL1A 4QHUA 2WHKA 4OCRH 3MR9A 3RVUC 1HQ4B 5EF3A 2VR6A 5FO2A 5DRWB 4HP5A 4HULB 3SUWA 3SCMD 4GW4B 4G6AD 1ZA3A 4EKXA 1P7HL 1Q9LA 4D0CB 3ULUC 4KC3B 4YSDA 3P93A 5IB3B 3W83A 1LWRA 3ZLQC 4DK6A 4WY7H 2GBUA 3HAEH 5DI8B 2PF8A 1Y65A 5L0QC 1I8IB 1AH0A 1BFOB 3N6JA 1V7NH 5F93C 3KOXA 4AY8A 1GVYA 3GG7A 3EG9B 4PJCA 1A6ZA 2OS7A 3SN6N 2CRYA 4X22A 1NGPL 3UXAA 4NJGA 3HG1B 2R9RA 4N6EA 3WD3A 5I3HA 4R26L 4JAMA 1QKZL 3ITCA 2J2ZA 5C2CA 1SOKA 2UZYB 4QRUA 1SM3L 4XNUH 4M7KL 4WGHA 5DQ9B 5AAPA 5F7HA 4PJ9D 4OLYL 2ZWLT 4JFDB 3PY2A 2C13A 4GW1A 2H1XA 4K8RD 3INUL 3SBRA 1F86A 1CBGA 2FLMA 5I30L 3QYSA 4OZGF 2YAPA 4XVJL 1AGFA 1KCLA 3LEVH 2EE0A 3V7MA 3VWKD 4HKPA 1YEKL 1KG0A 5DSCB 5I6XC 2Y6SD 3CDGB 4P2YA 2AABH 1ZVHA 2E74C 5DJCA 2ITFA 1AZUA 5LGZA 1RZIA 4MF4A 4LSVH 4W4OC 4IDJL 4IWWA 4HOXA 4QHKJ 3IFNH 3VI3F 5FYLD 4Y4FD 5ALBL 1UUSA 3IKCB 2Z2BA 4BRVA 3RCMA 5LGHH 2F18A 3KYMA 5D7LA 5EC2B 4DZIA 3KWXA 5D1ZD 5D9MA 1IJ9A 2YZRA 2G3IA 2CUAA 2P52A 2FQEA 4HJEA 3W7IA 4BSVA 4JTHA 4E0RA 2WQ8A 4DHLA 3FAXA 3L21A 1DQUA 3N4AA 1R5WA 2ZA3A 3W2MA 4EANA 2BP0B 2WO3B 1I7UB 3L3OC 1OGAB 43C9B 2X1TA 1I8KB 2KZKA 1KBGH 2JI1A 2Q3XA 3VFRB 4FXKA 4XP5H 1BBDL 1LQSR 3OKOA 1NGXB 1QRNE 3G1SA 2YWZA 3N42F 2X4QB 4E9XA 3T8LA 3VSVA 1U8HB 1A5NC 4RL3A 5C0NC 3WEXB 1T7YA 3B56A 3PV6B 2PYEB 1GGBL 2ZF9A 3QEGH 4G8GE 2LVCA 1KYAA 2VSKB 1AL8A 4JM4H 5IHUH 1QPOA 3UF9A 3A12A 4NN6C 4GNKB 4JM2B 3WEZA 4DZ8B 3OSVA 3IMUA 3KNBA 5CFHA 1NAKH 3V0DA 1QWGA 3MO7A 5IFAL 1KZQA 4B9JA 4KIEA 2PR9A 5A8MA 2NXZD 5JHLA 5JH2A 2JGYA 1EXUB 4NNPL 1H50A 3HR6A 3CB8A 2VR2A 4Y6GA 1B4JH 3PJNA 1W3IA 3HKZA 3LMJH 3CFMA 4RXFA 3PNRB 5EU6D 1WYIA 1I8MA 3PNZA 3CJPA 2BDNH 4KIRA 1R5VA 5H6HA 5ITFA 2DSUA 1ISYA 3L9RA 5EOCJ 3WFEL 1OZQA 4NYUA 4DVRH 4HV8A 5D7KE 1E51A 3VFWB 1L6PA 1INQA 4TQ8A 2G0LA 1F58H 4N87A 3CV7A 2EKGA 1DBML 4XN1A 3MBWB 3QPXL 5FJJA 4FX8A 3TJXA 3GMNA 1X5KA 3PP4L 1T0MB 3NUKA 1LMKA 3ZBMA 5EEVA 5D9OA 4IK6A 4HX1A 3TT1L 1VENA 2VRKA 5DA0B 2DI9A 3UBPC 3JTBA 4C6KA 5FUCE 3QUYD 5E2VL 3TTYA 3U7VA 3QPEA 4KKBD 2AJZA 2BOFX 1Y6NR 4HQQL 1IAIM 3GTTA 4GKZB 4JKPH 3ZIYA 5KTEH 4W4QA 3DO7A 1JZJA 5HHQB 1FORL 4OCLC 2C9SA 2J7LA 3RU8L 3CVIH 4O4YH 3BEVA 4MKNA 4K7YA 5F7FA 3MYOA 1KCVH 1UCBH 2ZXQA 2E25A 3V5FA 1BEUA 2C3GA 1JERA 4G3YH 3SE6A 4Q4OA 5LIUX 2IC2A 3BAJA 1XT5A 4YTSA 1OTUC 1KRBC 1BZDA 2OLSA 1N0XL 1J2WA 4LBAA 2IWGA 2QPDB 3LXUX 3BN9C 3NCJH 4JO1L 2B1AL 2Q7YA 4TQHA 4OFYD 5IHZB 2GEEA 4R84A 2CZ5A 1R4XA 2C9RA 1H7WA 3PPCA 3UBHA 1J5CA 4ZPTB 4KGLA 4FFYL 4LQFH 3H2CA 2G0WA 2R1MA 4A2EA 5BJTB 5GGTH 5JPMC 4AC4A 3KOFA 3BKYL 1KM6A 1IC7H 1NCWH 3IFPA 5G4OA 2B81A 1DSFH 1ZGDA 4QOKD 4N4YB 3D4GA 5LGJB 2FECL 3IGKA 4ZQCA 2GJXA 3VXPB 1K8DB 2JH2A 3NCOA 2QKIA 4IFOA 2Y1VA 5DJXB 2BSSB 4NRXA 3DTDA 2I26N 4D0BB 4IP7A 4CGTA 1TE1A 3U4BL 1T7XA 2A6DA 4MAZA 5DD0L 3FFCA 5JXAL 4L1XA 2FEDD 1RCXB 4HPXA 4LCCC 2VR9A 1ZP3A 3WD5L 1S7RB 1MHHA 2WQWA 5CEXA 3OZ9H 1KJ2H 1IYXA 4MB4A 4DWSA 5I1CL 2L7EA 2W3ZA 1QA9A 4Z7AA 1Q1JL 1RK7A 2V2XA 1HI6A 1WZKA 2B0SL 3MRLA 2HPOA 2X88A 3OMIB 3FQTA 3LNIA 1SM9A 4JFDE 1WXYA 3FTVA 4MPQA 2R69L 2WLNA 1IEBB 5B39A 1T22A 2VXSL 4EI6B 1J9RA 2YJLA 3HC3H 4XPGL 5EUOB 4QKXB 1MCWW 1Z3RA 4G7YL 4HUKB 3OM3B 4JANA 4GFSA 2PAJA 4MAYB 4OLZL 1CD8A 4U1GB 1VBUA 1FCCA 1BYNA 1H7NA 4AUYA 3AUWB 4MZ2A 1PWLA 3JTTB 5FF0A 4YX2L 3IEAA 4I77H 5AWNH 5C6WH 1V0MA 4ZQPA 3AIWA 2XLLA 4B9GA 1NCBL 1R3JA 3NVTA 5REQB 1OOAA 3NQBA 1KJVA 4MMYA 1ZSDB 3RA7H 2P1FA 2F54B 4IOTA 5TE4L 4QIRA 2VGBA 5AG9A 2XQYK 4JL2A 1CGVA 1QWUA 1SLUA 2V30A 1GYLA 2GVGA 5JYLA 1W9PA 3DHJA 3RGBA 1DORA 2EEBA 2XWZA 4UILH 1NGWB 4FKHA 3PANA 1LO3H 2I25N 1OSPL 1DUYA 4BK8A 2Z00A 3GJFH 1XH3B 2G2RB 1Z48A 2EDMA 1XDLA 4O58H 5ENLA 4NENB 1DLFL 5F1SA 1SY6H 1L9TA 1MIEH 2CLKA 5FUCC 2BG5A 5TQ0H 4Z3EA 5D72H 3QJRB 1ILSA 2PYEE 5KG9B 5FKYA 3MRBA 3TNMA 4WRLA 3CIXA 4M1DH 2Q9OA 2V2WA 8FABB 4U0QB 3BPCB 5B22A 1KTRL 4E0CA 2J7EA 1PKOA 2VGGA 1RUPL 4L3AA 5C1MB 4TM9A 2YYTA 2MPVA 5ALCH 4XNXL 3O3EB 4J3BA 3Q44A 5B1KA 3ZHNA 4UAOC 3TO4D 1TO3A 1Z32X 5KSAC 5HHXH 2ZT9C 1UXWA 2PCPA 1HGYA 1KN2H 4YXLH 5E8EA 1CX9A 2AQWA 3VGAB 4GSDH 5H37H 4M7JL 5KYXB 4LL4A 1EDGA 2VABA 4FEZA 3ERXA 3BJTA 3U0TA 2GK1B 4UNVA 4YLQT 2DIAA 3OPSA 1A3LH 4LNVA 4HD5A 2YUVA 3MA7A 4M80A 4WUIA 2XWJB 3AAZB 1EBPA 2LLLA 2MCPL 3NR0A 2E6PA 2XDHA 3PDGA 1KFGA 3UEQA 3J8F7 2XN9B 1G7VA 3FKKA 3GO2A 5J0BA 3CC1A 4EN3D 4MCMA 2VDLB 2VZSA 4EIBA 4YS4A 4LAMA 5I28A 1E6ZA 1BYCA 3QG7H 1SJHA 3MQTA 1AD0B 2Z29A 1BMGA 3K2KA 4AZ7A 4UMGA 5EOTA 3EXTA 1ZCCA 4FMFA 4X61A 1RVFL 1J5OH 2QEZA 3HMJG 5CMAA 2QR0A 2Q02A 4YHNB 2X4TB 5G4WA 4IMCA 1ITBB 4JTUA 2WB5A 8TIMA 1KTBA 2DI7A 4HMCA 5AC5A 4Y5YB 3DCPA 4LNCA 1BW8A 1FG2B 2W94A 1I9IL 4OZGB 1PZ0A 3NZHL 3OZYA 4XVSL 1PCWA 2WZIA 3ELAT 3P4MA 1K9TA 1V6YA 3SYOA 2YKLH 1QWKA 3WLTA 4NO3B 1EJ7L 3MGOA 3CAVA 4HCHA 3LI0A 3CFCH 4YHOH 1UROA 3PWAA 5J1AA 5AYIA 1N2VA 4ODBD 1ZE3C 2BRRL 2HEJA 2X0WA 4LEOB 4KV5F 1NIUA 3M41A 3UFYA 4FQIL 3LHUA 2FZ9A 1IE4A 4OJAA 3HFML 3VI3B 4JTAA 1OOWA 4LS0A 1WS7A 2RJGA 1KLUB 3C5ZA 4PGCA 4HHAB 2BDQA 1RK0B 4FI8A 4LEXH 1F90L 5AFAA 4IRJB 3VCLB 5E8OA 4F37F 5E0CA 2P8LB 4ZMZA 4LLVB 1OD7A 4HKBA 1O9WA 3T2QA 4AV5A 3SN0A 4AQ8A 4MWAD 4O54A 2A3EA 2A3CA 1BF6A 2Z4TA 3A4DA 1S7VA 5FECB 3RWDA 4BA0A 4N5ED 3VINA 3AISA 3ISYA 3UC0H 2P46B 1JXDA 1N7MH 4Q4MA 3LKOA 3URNA 4F0KA 3MTRA 4B4HA 1HZHL 3F3HA 1I3GL 4ZMPA 2YSSB 5IB1B 2K3TA 1V0NA 3S5LA 3Q8EA 3KL3A 4FXSA 3ULUF 1LO2L 4F8OA 3WK3A 1NBZA 2XUWA 1GG0A 4S3EA 3SQRA 3MXVL 1HP5A 3R43A 3RJQB 2VUNA 1Q9OB 3OGOE 4K7VA 2LU7A 4S39A 1K9EA 3R8BB 4KTDL 3N1FC 1I8UA 1XZ0A 3OJVC 5CD3A 1DV7A 4PVMA 1IUZA 3LEXA 3OGRA 1TR1A 4ZMNA 3QUMH 4OGYL 5GS0L 4JM2C 2Q3ZA 3FONB 2BO0A 4F33A 3DJRA 1LDCA 4TUOB 3AYTA 2AEQL 4JBSA 1J0IA 5B3NA 4P48A 3W7EA 2E7LA 5EUOE 1UWQA 3RLUA 1YEJL 4TSAH 3NGBB 1LYXA 4X7EC 1XDJA 4LSTH 1T04B 5HJ3B 3MV9E 2HPIA 2V5JA 4HK6A 3WBEA 3ZZQA 1W3NA 1KB5B 5AB3A 1ZPUA 2ZAGA 4U6TA 3AWGA 2ALDA 2BWIA 3FOLA 3D3VD 4GG8B 4CSPA 5CJMA 1MNUL 4GMTL 4JFFE 1ZUAX 3EJJX 4HC1H 4NZ5A 2B59B 2BW4A 4F40A 4LKCB 2GOKA 2CM6A 5IT2L 4WWKA 2F54E 5SWQB 1TZIB 3QO0A 5GS1B 4DPQA 3P02A 3EGSA 3TSMA 2R0WL 5E03A 4NKOA 2PTUA 3EGJA 1MJUH 4LPCA 3N2JA 4CNSA 5FM4A 1XBRA 4YHEA 5FI8A 2Z31A 4QCIA 3DYPA 1RZJC 1XLHA 2FT8A 4QHUB 5AL0A 2F5AH 5BS0A 2JKAA 1QNZL 4PMJA 5DHYA 4HUMB 4AGNA 3R4IA 3SGKA 1UYWH 3ULAB 1TWWA 1ZA3B 3AM8C 4LF3B 2FVNA 1Q9LB 3WIHA 4AX7A 2VFFA 4EPDC 3P0YH 4CD6A 2VDQL 1UACL 2H2PD 4DN3L 1DKWA 5CCHE 3EO1B 1KFAH 1VHNA 1T66D 5JW3L 4A05A 3HG0A 2WZHA 3DGRA 2F15A 3CGTA 3GNXA 1DWIM 3FH8A 1A6ZB 4H19A 4UI2A 4X0KA 4YIQB 4GJJA 1IBGL 1Q85A 3S2NA 2FBOJ 1V3IA 4IBTA 5CC7A 4JAMB 4QRRA 2J2ZB 2MNRA 3H21A 2D7MA 4HWBH 3AWOA 4Z18A 2WHMA 1DBKH 1BXXA 5DLLA 3AOFA 3N1MC 3CSFA 3P1VA 2N1TE 3JWOL 3T2NL 3TBSA 4GW1B 1BOGB 3MRJA 4PWIA 2BZNA 4B7LA 2IKGA 4Z23A 2I27N 4UT9L 4JQ1A 3DX0A 1AGFB 1UZ6F 2AGJL 4X4ZA 5I79A 1KG0B 2CDEB 1T8XA 3N4FA 2WBJA 2XINA 3TR2A 2XN9E 1RZIB 1NIAA 4JNMA 1ZALA 3O6MH 3QPQC 3FU3A 5T1LB 1FDZA 4ROQA 1PUDA 3H7VA 1XXXA 3SFWA 2WZPA 4B9IA 3ULVL 2JIXA 4H20H 3GMPA 4GE8A 4WKHA 4YHLL 1WUZA 1AR1B 5EBMA 5K59F 3S5NA 1KCRH 1W9XA 3KYMB 1UBSA 3K1KC 1YNLH 2GSGB 5H4ZA 3CV2A 1ZHBA 4BSVB 5MERA 2UZIH 4E0RB 4IIQB 2G5BB 3FT9A 3QQ9C 1QSEB 4NBXB 4TL4A 1R5WB 5E94A 4HAGA 3P80A 3A4EA 5HGBA 4P0DA 1M1BA 4Z1BA 5IROC 4OZGE 1NAMA 4K3ZA 2OXGB 3UMNA 5EOQL 4FXKB 3M5VA 3UO1H 3OKOB 2WUCL 1EEPA 1NMAH 2GQ9A 1KR1A 4FLSA 5E2WL 2GC7C 2GJ6A 5PAZA 3CVCA 2DQHH 2Z8VC 4GAFB 3KAOA 1IGML 5GISL 1L5GA 3ZKNC 1XIWA 5DUBA 4KX9A 3FO0H 1QZ1A 5C09D 4POZD 3UA4A 3PS7A 1USZA 1J1PH 4J3OF 1HYSC 5DMKA 1MFDH 4B4FA 1J0ZA 1WDDA 3KTSA 4R34A 1U9KA 1BZEA 2MCG1 3VI3E 4M7LH 1W6TA 3PHAA 2X6MA 1EJWC 1UQZA 1HWGB 1TQCB 4MAYC 1Q66A 4U1GC 3KNBB 1AVAA 4OD3H 4ZFFA 3O6KL 2POZA 1JG9A 4KJPC 4O2FA 2PDUA 3UAAA 3W57A 4YXKH 1YNYA 5MHSE 1ZT7B 4NNXA 2H6OA 2CFFA 4O5LH 3KJ6L 4KFZC 2ICWA 2P8MA 2WYTA 1RVKA 4LRNH 4PULA 4PZVA 3QEQD 1I9RH 5CEZE 2WB1A 4PBWD 3UBGA 5CZJA 5F0PB 2CC0A 4M5PA 4XVDA 4OFPA 4NHUA 2O5NA 2GPZA 5CHNA 4DGWC 3MZTA 1E0TA 1R5VB 5I6MA 3SPJA 2HRLA 3VUAA 1D5ZA 4FCAA 1WCBA 2ODIA 1XBZA 4G8IA 2W92A 5FM5O 3CUZA 1INQB 1J1OL 2BY1A 5E95B 4LK4A 5BNXD 4N1EA 3RM9A 2YGPA 5FESA 3URQA 4XQ6A 5CJOL 1XH0A 1MCIA 3MANA 1SFHA 2Q2LA 1YEGL 4KCUA 2YA2A 1TFVA 3HZ3A 3T5WA 3QYNA 3D1MC 4AZBA 3B43A 1GYWA 3LZLA 4Y9MA 4HX1B 3PAOA 5L9DL 1LG2A 2Z91A 1B2YA 1DQDH 4YFLI 1TLKA 3AC0A 2BP5M 4HGXA 4Q9QL 4OBSA 3WXWH 4MNQE 3QHZH 3P40A 1SXZA 1EPVA 3UETA 1G9NC 2R29A 3DO7B 5I16B 3DI1A 3NFPB 3QLLA 5HWMA 3M88A 2REQB 3PTQA 4IGHA 3VGAC 5AHMA 1WBJA 1HCFX 1Q9KA 3B2XA 5HHOA 4NRRA <