4E2OA

Crystal structure of alpha-amylase from geobacillus thermoleovorans, gta, complexed with acarbose
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
451
structure length
445
Chain Sequence
ERTWQDEAIYFIMVDRFNNMDVNVNDPKGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNMPGGYHGYWIEDFYQVDPHFGTLGDLKTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPTKKDWFHPKKEIFDWNDQTQLENGWVYGLPDLAQENPEVKTYLIDAAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKKDFFLLGEVWSDDPRYIADYGKYGIDGFVDYPLYGAVKQSLARRDASLRPLYDVWEYNKTFYDRPYLLGSFLDNHDTVRFTKLAIDNRNNPISRIKLAMTYLFTAPGIPIMYYGTEIAMNGGQDPDNRRLMDFRADPEIIDYLKKIGPLRQELPSLRRGDFTLLYEKDGMAVLKRQYQDETTVIAINNTSETQHVHLTNDQLPKNKELRGFLLDDLVRGDEDGYDLVLDRETAEVYKLREKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a compact alpha-amylase from Geobacillus thermoleovorans.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-amylase
total genus 166
structure length 445
sequence length 451
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4e2oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4e2oA01
1WDRA 2IXVA 4PCTA 1NH6A 3EDDA 4GPNA 3ARUA 3A47A 3WENA 1ISVA 2F1AA 1L8NA 1NM9A 1K9DA 1BFNA 1TMQA 4CCCA 3MS8A 3AIQA 2VVSA 2ZUNA 3EDEA 4HZ6A 3WFZA 1MW1A 4MADA 2GJXA 1OWQA 4DO4A 1W1YA 4UQAA 3HJEA 1E40A 4JFVA 1GQJA 4A3YA 3WMBA 1U2YA 1Y7VA 2BV9A 1TQVA 1J0IA 1GORA 1KXTA 2NSXA 2WHKA 1B30A 1KGXA 4W5UA 3A22A 3BMVA 2X8RA 1VEMA 3ALFA 1BYDA 2CXGA 3CGTA 3G6LA 5ABGA 2W5FA 1BYCA 4W88A 3K46A 3DX1A 2E8ZA 4FK9A 3ZQ9A 3T0BA 1M7XA 1FFQA 1UD6A 1JF5A 1HJWA 1E5NA 5IXEA 1C7TA 4GQQA 3CZNA 2D23A 1DEDA 4J28A 4HU8A 3CMGA 1VFUA 1D7FA 2X05A 1JZ7A 3BUQA 1V3JA 1AVAA 3VNYA 4D6EA 4NZJA 4L4PA 1VJSA 4X0NA 1W32A 1HL8A 5IHSA 2A3BA 1G01A 3WQWA 1UH2A 2A3CA 4H2CA 2XFYA 3QHMA 3MV01 4ATDA 1J0KA 3H55A 4JKLA 4UNIA 3VM5A 1V6VA 4NSBA 4UQ9A 2JIEA 1R46A 2OW6A 1HKJA 4DUWA 3MMUA 1RP9A 1UWQA 1B9ZA 2YLLA 4CD6A 2YDSA 4L4OA 2XVKA 4P7LA 3PN8A 1OIFA 3ARRA 1VFOA 1GJUA 1KWKA 5AC5A 1HVXA 3VGDA 1WKYA 4C7FA 2EPKX 4Z2KA 4H8HA 1MW0A 3L4YA 4B9YA 2GUYA 1R7AA 6TAAA 3AZTA 1N82A 1FH9A 1CXFA 4CUCA 3VX1A 1FH8A 2E9LA 3AISA 2BVTA 4QFUA 1W9DM 1WDPA 4FLOA 3RPMA 4LQ1A 3BCDA 3BSGA 1PBGA 4W7UA 7TAAA 3K1DA 2XN2A 3DYMA 4WLCA 3PHAA 2YKKA 1HJXA 2VNCA 3BLPX 1E5JA 3IJ8A 4URIA 3ARQA 5BCAA 5DEZA 3D50A 1CWYA 2O92A 2D73A 2C0HA 2JFEX 2XGIA 3FHAA 1BG4A 2WZHA 3NDYA 4TX6A 4YN5A 2J7EA 3VIHA 2HISA 1IZKA 3BH4A 3MKKA 2FE0A 3GXFA 3WDRA 3WH5A 1GCYA 5A8OA 2GJPA 1BGAA 4AEEA 4AZIA 3GXNA 3BAXA 1GOWA 3ZMRA 1NOFA 5M3WA 1ODZA 3RILA 1QI2A 3IJ9A 1V08A 3CUJA 1KWGA 3AMKA 3WY2A 1E43A 3ARYA 2BHYA 2OWWA 4KWUA 1KGWA 4UZSA 4AXNA 1GZJA 4GZIA 3D3AA 2V3EA 2Y2WA 1EH9A 4GKLA 3O2LA 2MANA 1VIWA 2CEQA 2WW5A 3KL0A 5DO8A 1ISWA 4XB3A 4CD4A 1OIMA 4AD5A 1QVBA 1J0YA 1V0MA 1B90A 1M03A 1Q6EA 4GI9A 1Q6GA 4AMXA 4J3UA 2WMKA 4JFSA 3D51A 3GM8A 3EJRA 1A3HA 4OBRA 2WHMA 3CHEA 3MUY1 1TUXA 1R85A 4M56A 2CITA 2WHLA 3FW6A 3AHZA 4BQ5A 4GZEA 5A95A 1HT6A 3WMCA 3WD0A 1VJZA 4PUDA 2J47A 1KTBA 4EANA 2E0PA 1JNDA 3VD7A 4M8UA 4TOQA 1LJYA 4BQ4A 4DM1A 3GXMA 4GZJA 4BZYA 1HL9A 1HVQA 1LWJA 8CGTA 2ZUMA 1CGTA 1WPCA 4JFUA 3H53A 4ATWA 1CXKA 4Z2IA 2PB1A 3MUAA 5D9NA 2YDQA 5DT5A 2GJRA 1NWTA 3MSGA 2YBUA 2NT1A 1ISXA 2NT0A 4PMNA 2QPUA 3OB8A 2ZX9A 2DH2A 2V5CA 5JBDA 1FP9A 1CXIA 3HZ3A 2VZVA 4R5EA 1E4IA 1EDQA 3AIRA 3NCOA 3DDFA 4HMDA 2JF6A 1TA3B 4OBSA 3SCQA 3AOFA 1DHKA 1NOUA 2BFGA 1WDSA 4RE4A 5HDRA 1UD3A 4D6IA 3BMWA 4D6DA 1LG2A 1ZB5A 2EACA 1PZ3A 3DYOA 3UEQA 2J4GA 2UWFA 2RGMA 3HN3A 1ITXA 3IAQA 1TQUA 1JDDA 5CZKA 1UR8A 5A6AA 1HIZA 1M04A 1WO2A 2WMIB 3PZGA 3L2LA 4JZ5A 4RE2A 2ZOXA 4EAMA 3RJXA 3MSDA 4AW7A 5GNYA 3T08A 1IT0A 3ARSA 3K8MA 4OZOA 3VGBA 1CLVA 5BXPA 4H8UA 3T2PA 4FLQA 2F7QA 2X2YA 5GNXA 4TVCA 1XHGA 2Z1SA 4PTVA 4MAZA 2XVLA 1UG6A 3QR3A 2EPNA 2XVPA 3UR8A 2WMIA 1E70M 3A23A 1W3KA 1XC6A 4B3KA 2Y8VA 2WSKA 3TA9A 2XGBA 3MUZ1 3OLDA 2DT1A 2FDMA 2WMHA 4W84A 3DHPA 2DDXA 2WVVA 2EPLX 5I0DA 1TFVA 4AD4A 1K9EA 4ZXOA 3N15A 3AIUA 1FHDA 2CBJA 3VD5A 1V6XA 4HOZA 4TXEA 1E0VA 4D1IA 2DT0A 3LX9A 1R33A 3WF4A 1IV8A 4JFWA 3GH4A 3VIGA 2XJ7A 5HNNA 5BRPA 3W38A 3HMCA 2DIEA 2F7RA 1C92A 3LPFA 1OD0A 2V3DA 4PMZA 1JI2A 5LA1A 3NIYA 2D3LA 1AQ0A 1PPIA 1JFXA 3AQUA 3WL1A 1E3XA 1FHLA 3VMOA 1MQRA 1P6WA 1JD9A 3FN9A 3GTNA 1VFFA 4DWSA 3AS3A 1ISZA 1TE1A 3SCPA 3QGVA 3ARTA 3TP4A 4UZUA 2G8ZA 5AYIA 4DUXA 4C7DA 3OGVA 2G3IA 4B9ZA 1FA2A 2D0HA 4AZ7A 5CGTA 3WF1A 1XCWA 4Z2LA 2W91A 4FNTA 1VBUA 3VUPA 2JEPA 3PZUA 2PBOA 1O7DC 3WQ4A 3SCWA 2ZE0A 1GW1A 1GJWA 1FOBA 3TTQA 4PTXA 3HU7A 1MXGA 3BAYA 2XSBA 3DX3A 4HPHA 3WF3A 5A6BA 3CMJA 3WY4A 8A3HA 3W26A 3EMZA 4WKFA 4QLJA 3GH5A 3WUGA 2DSVA 3SUSA 5CPSA 2D24A 4U3AA 4J3XA 1JNEA 2WC7A 1X1NA 2WXDM 2AAAA 4PTMA 3ZR5A 3EMCA 3M6DA 4UFJA 4UOZA 4V28A 1NP2A 2QV4A 1WB0A 4AISA 1JZ2A 1J0ZA 4V27A 3O6AA 4W8AA 3AMDA 3UCQA 1OD8A 1UA7A 3T2OA 5EFFA 2EADA 4MNMA 1KGUA 4D71A 2BHUA 4AIOA 5CLWA 3KEHA 3UR7A 2D20A 2D1ZA 4TTGA 2XVNA 4MDOA 3AYSA 3KWXA 5ABFB 2WZEA 5A69A 4U3CA 1DWHM 2VURA 3D4ZA 4CVUA 1V0KA 1QOXA 2FGLA 2J7BA 2WWDA 4BA0A 1SZNA 3GBEA 1W91A 3CZLA 4AIEA 1JI1A 1DTUA 1BF2A 3DX2A 3WD4A 1AMYA 4LXFA 4PEEA 3SCNA 1XD1A 3PZIA 1TQSA 3CO4A 4MJ4A 2YLAA 1B3WA 4TUFA 3GNRA 1EA9C 4W8BA 1BGGA 4AY1A 2EQDA 4MTVA 2ZUWA 2J79A 2V3GA 3ZJ8A 2QHAA 3B8SA 3W81A 3W37A 1E0XA 2WANA 2UY2A 1UKTA 2WZIA 2A3HA 1FH7A 3BVWA 3WSUA 1MFVA 2OYLA 1KTCA 2OSXA 1UZ4A 2YFOA 3UG4A 4WIWA 5A1AA 3WIJA 3T2QA 1U30A 3WD1A 2ZUVA 1B3XA 3AHXA 1HX0A 2D0GA 2BS9A 2VZUA 4CGTA 1DWGM 4HZ8A 1E4NA 3VMNA 3MANA 4MB3A 4B16A 2ZUSA 2DH3A 3W6MA 5AY7A 3LXAA 2J8FA 1UR4A 1PX4A 1WNOA 4KRUA 3CPUA 5HPOA 1HJVA 3EDJA 2ZXAA 3VD4A 1E6PA 3S6TA 1VBRA 4GI8A 2OW7A 3WH8A 4ACZA 4UR9A 3AXHA 2XFFA 4M29A 1QBBA 2D0FA 1TVNA 1E72M 3UETA 1PIGA 1QI4A 2J77A 1EO5A 4PCSA 4ATLA 3PZ9A 2G41A 2VJXA 4J3TA 3PZMA 4MJ2A 4EK7A 1V3LA 1XCXA 2ZIDA 2FHCA 4KMQA 3RIKA 1E6RA 2ZXQA 4OOUA 1CGYA 1ODUA 3WDHA 2ZWZA 2WCGA 4ZE5A 1CBGA 1JXKA 3WY3A 3RCNA 5I79A 1WDQA 3D5HA 2WB5A 1QNSA 5D9PA 4XV0A 1JYXA 1V03A 3BAJA 4QLKA 1AQMA 1SYTA 4R27A 4AMWA 1V6UA 1D3CA 1WZLA 4JL1A 1TG7A 2BY2A 2X2JA 3NUKA 2F18A 2WNWA 1W9PA 1EQCA 1O6IA 3TOPA 1IZJA 3OIHA 4FF5A 3VINA 3BAIA 2PWFA 1CGUA 3E1F1 1KCLA 3VU2A 1PJ9A 2BXYA 1H11A 5DFAA 3F5KA 3POCA 3W24A 3EJUA 2F61A 2J62A 1A47A 5AYBA 3F5JA 4ZXLA 1GOQA 5D4YA 4NX0A 3VSTA 3N18A 1O7AA 2CERA 2X1IA 1GPFA 2VRKA 3CZ8A 1UR9A 3FHQA 1PEZA 3L4XA 2ZX8A 1ITCA 4BQ2A 3WQ5A 1GOOA 2OLHA 3SCSA 1HKKA 1MYRA 3KL5A 1R8LA 2DT3A 4DWSB 5E09A 4U2YA 3THDA 2XPKA 3NSMA 4MB5A 2VI0A 4PTWA 5CSUA 2EAEA 1J0JA 3IJ7A 1JDAA 3U5UA 5BYWA 2E40A 3WEMA 2BVDA 3M07A 7A3HA 2ZXBA 3LRLA 2GDUA 4H04A 4BF7A 1Z32X 5A6KA 5IDIA 1YHTA 4W86A 1KQYA 1E55A 4W5ZA 3CHFA 4TVUA 1V3MA 4MNKA 4U5KA 4AZCA 3VILA 3PZQA 3AMGA 3UERA 4ZE4A 3GNPA 4PSPA 1H0GA 3AIEA 5A8MA 5CPQA 1PAMA 2BY1A 5HPCA 1QW9A 1AQHA 1GNXA 2VX5A 3WUBA 4LGXA 2F1BA 4WSKA 4IUGA 4UOJA 2OSWA 3WEZA 2C7FA 5D9MA 5CGMA 2CBIA 3B9EA 3NSNA 3VD9A 4NF7A 3PZOA 1UA3A 1OGGA 3AZRA 3T0AA 5CPTA 4MPKA 1R75A 3RDKA 1QI5A 2VX7A 1UD8A 3CZKA 3CHDA 3VIIA 2XVGA 4C7GA 2QF8A 2PF0A 3CLWA 1NWUA 3BVTA 3H54A 1US2A 4PMDA 1R34A 1EXPA 3N13A 3BLBA 2GJXB 5I2UA 3WEOA 4M1RA 1UZ1A 2V5DA 3W25A 4EE9A 2EO7A 2J25A 2WVTA 1UWUA 4AZBA 1I1WA 3BVUA 3CH9A 4X0VA 1EOMA 3K8KA 1CIUA 5KZ6A 4D6JA 3VIFA 5JBEA 5E6YA 3EDKA 4HP5A 1BG9A 1US3A 1UWIA 3VSVA 7CGTA 3O9NA 1TA3A 2CHNA 1H41A 1CEOA 1X6NA 2VRJA 3LRMA 2CESA 4H8VA 4W93A 1UYQA 4UCFA 1C93A 3OZOA 4ZEPA 4QCEA 1S46A 4K68A 4Z2GA 2X2IA 3WNPA 3RO8A 5IHRA 3BCFA 4AYGA 4CN4A 1OM0A 2GK1B 1M53A 2RGLA 4PRWA 4UQCA 4AD3A 1NQ6A 3PBGA 4TVDA 2WKLA 5BXSA 4NXSA 3VGHA 3WDQA 5HXMA 3CV5A 4MB1A 2PBGA 1CGVA 1VEOA 3U7VA 3MMDA 4AZCB 1OGBA 1QPKA 1E3ZA 1LL6A 5EBAA 4ACZB 3CZJA 4X9YA 3VNZA 2WAGA 4JHOA 1XYZA 1VB9A 4BQ3A 2J78A 2G3MA 4PBGA 1PZ2A 1UWRA 3U57A 2E4TA 5ABFA 1H09A 2XHYA 3TTSA 3MV11 3SUUA 3UG5A 3VD3A 3AIBA 5FOOA 5I5RA 3N11A 1E4LA 3UG3A 1C90A 3IANA 3JUGA 3OLIA 3TV8A 2HVMA 3QOKA 4UTFA 3ZM8A 5ABHA 3SCOA 1UR2A 4H41A 4ACYA 4UQEA 2DGAA 2EABA 4F8XA 4UFHA 2WLYA 1DWJM 4P7RA 3K4AA 1QNQA 1RPKA 4NZCA 1B0IA 1W9XA 5I6SA 3RM9A 4EKJA 2VZSA 3ARZA 2O9OA 5E6ZA 4ZFMA 3HG4A 4AZ5A 2VZTA 1JYVA 4P8WA 3KLLA 2W61A 1V02E 4GINA 4W7VA 1DP0A 3WELA 5BROA 3F5LA 3GXDA 3AJ7A 1VENA 2E8YA 3BUIA 4OUEA 4MNJA 2VZOA 3AHTA 1KR0A 1CNVA 1E73M 2O9PA 1JF6A 1J10A 1HP5A 3LPGA 4PMRA 3RMEA 1W3HA 1WCGA 4D72A 1C8XA 1R47A 1WE5A 5LA0A 3SUWA 1V0LA 3BLKA 1B3VA 4CU8A 3HG2A 1CXLA 1B2YA 1CDGA 4HOWA 2WC3A 2W92A 3WQVA 1OT1A 1HXJA 4GO8A 3WMSA 4AIUA 4XZBA 1CZ1A 3VMPA 1ZJBA 1U33A 1CENA 1PS3A 2BY3A 3AHVA 2BXZA 3RM8A 3TTOA 3J7HA 2EXOA 1BHGA 3K4DA 2WBKA 4DUVA 4WSJA 2W66A 4LX4A 1QWNA 4HMCA 2WWCA 1JZ5A 2VMFA 1ESWA 1J11A 1HXKA 2OSYA 1QNOA 5IFPA 4DM2A 4DWSC 3L4VA 1UKSA 1KB3A 4ML4A 2FH8A 1R87A 4AD2A 1V3HA 2NW0A 4S3JA 1D2KA 3OG2A 5M17A 2OWXA 1E4MM 3AMCA 3IAPA 4KH2A 4U2ZA 2WK2A 4JAWA 5A2AA 2XTKA 1B1YA 4HTYA 3A4XA 1SMAA 4Q7NA 2YJQA 2O9TA 5IFTA 1MW3A 1PIFA 2V3FA 2QPSA 3S5YA 4WF7A 4U5IA 1MQQA 2WHJA 2W62A 2XIIA 4UQBA 4PMQA 1QW8A 1V0NA 4AYSA 4M80A 3WH6A 4GO9A 1GONA 1G9HA 1MQPA 1KXHA 2ZX7A 4HZ7A 3UESA 2WYSA 3GXPA 5DT7A 3CUHA 4A3HA 2VL4A 4B15A 5E70A 1UH3A 1LWHA 3THCA 4RL3A 1XH1A 1VFMA 2BNJA 4LPCA 2WMJA 4E8DA 4ZENA 3A5VA 2XUCA 1H3GA 5CG0A 3WN6A 3ZO9A 2YA1A 2CIPA 2QMKA 4NRRA 5A2CA 5GNZA 3SCRA 2G3JA 5A8PA 5BXRA 3T09A 3WBEA 4JL2A 3VIKA 4J3WA 1H2JA 5EB8A 1JG9A 5TD4A 4LYRA 5A6BD 1KR1A 4HA4A 4AMCA 1JZ4A 3NDZA 1KBKA 1UHVA 4GQRA 5D8WA 1E9LA 3B9DA 1W9VA 4JCLA 2JE8A 1YQ2A 1QHZA 1QI0A 3CUIA 2VOTA 3EBVA 4JHZA 2W67A 3SUTA 3L2MA 3SCVA 1XYFA 5E9AA 3EJQA 1UWSA 4NRSA 3WH7A 4J3SA 4FMVA 3AZSA 1R86A 3OBAA 1HNYA 5FD0A 5GPRA 4F9JA 1UUQA 4YHEA 2ZXDA 2IUZA 4N42A 1CPUA 3CBWA 1Q6FA 4QLLA 3BC9A 3N12A 3NJ3A 1EHNA 1E6NA 3ZT6A 2C8NA 4V2XA 2QLYA 1MWOA 1OB0A 5FL1A 1ZBWA 2XWDA 1JGIA 2D2OA 1BTCA 1CXHA 1ZU8A 4AZGA 1G1YA 1EHAA 2XIBA 2Y4SA 2CYGA 3LMYA 3CUGA 4J3VA 1CLXA 3KLKA 4GI6A 2JALA 2PWGA 1HWWA 2ALWA 4N0RA 4RE3A 4D1JA 1LF1A 3OLGA 4XX6A 2FHBA 3MU7A 3VOCA 1Q4NX 2D3NA 4CN1A 5A6JA 1NP0A 1MXDA 1UOKA 4XZWA 3VPLA 3PTKA 5CQ1A 1V3IA 3EYPA 3RM4A 2CBVA 3FY1A 3VVGA 2Q8XA 2BY0A 3WFLA 4XUYA 5CLTA 2IXUA 4MDPA 4E2OA 4CVWA 4NI3A 2F2HA 1HTYA 5D9OA 1XSIA 1B3YA 1VF8A 2ZUTA 1KQZA 2VTFA 4NXKA 1L0PA 5LYRA 4FNRA 3ARXA 3EJSA 5ECUA 3BAWA 2IGTA 4NZFA 4AZ6A 2CHOA 3LPPA 3VIOA 1EOKA 3ARPA 4IISA 4D6HA 2F7PA 1LQ0A 1GQIA 3DX4A 3WDJA 4KRTA 3F4VA 3DHUA 3VIMA 3N04A 2XM2A 1CXEA 4HA1A 4D6CA 1ZBVA 3WF0A 1E56A 1OT2A 4YPJA 3SURA 1G0CA 4PMVA 4Z2HA 1XGZA 1J12A 1BYAA 1OBAA 4CU7A 4P7QA 1W1PA 2J7CA 1OGSA 2BVYA 1GOKA 5EMYA 4QP0A 3VDHA 1Q6CA 4CD7A 4CD5A 4DWSD 4Q22A 4HOXA 3GYCA 5E0CA 4AWEA 2YL5A 1JXJA 2XFRA 3VDAA 2ZX6A 4E8CA 1TQTA 2DSUA 2YA0A 2X0YA 2J74A 3VGEA 3SIMA 1DWIM 5CXPA 1KXQA 3L4TA 4P7OA 1CYGA 2BHZA 3CIVA 3WUEA 5I78A 4MAVA 1J18A 2DEPA 4HPGA 1CTNA 4AD0A 1JIBA 2VC9A 3A21A 2ZX5A 3VDBA 3A4WA 1G5AA 4OJYA 1KBBA 3GNOA 1GHRA 1WAWA 4BCEA 3FAWA 3WKZA 2J8GA 3SUVA 1E6QM 2W4XA 2XSAA 2DSWA 2UY5A 3AFBA 2Y8KA 4PMYA 5FIPA 3T0DA 3AICA 1E15A 3WDIA 3KE0A 1JFHA 1UWTA 1WZAA 3N9KA 4IPLA 5BWFA 2WVSA 5A2BA 1E0WA 2VCAA 2F7OA 2WMFA 2WMGA 2ZUUA 4OOZA 3ZR6A 2G4FA 4FNQA 3ZT5A 3ZT7A 4MB4A 4UFMA 4P8VA 4FLSA 4U33A 1BYBA 3W28A 3ZJ6A 1W3JA 2GFTA 5I23A 2WSPA 4AEFA 1GOMA 1UR1A 2VQUA 2YDRA 3FXYA 5F7UA 3POHA 3GDBA 3ZOAA 1KFWA 2YA2A 4UOQA 1QI3A 1UD4A 3WQ6A 3PZVA 1FFRA 1BPLB 3IK2A 4WKHA 4TTUA 2X2HA 2E3ZA 3EDFA 5FKYA 1KCKA 5BRQA 3WQ8A 3VX0A 3AIVA 1TQWA 2VVNA 2YBTA 3I3DA 4W89A 1EGZA 4A4AA 4PUEA 3AXXA 3CC1A 3PTMA 1QWUA 4OGZA 4JFTA 3ALGA 3D52A 3S5ZA 3W0KA 3WD2A 2FYVA 1K6AA 1HF6A 4CKQA 2J7HA 4Z2JA 2UY3A 5A8QA 1JDCA 1SFSA 2J7FA 4AC1X 5FL0A 1UKQA 3II1A 2YL8A 1XH0A 3OLEA 4CCEA 1QX1A 2YL9A 1UQZA 1F4HA 1JYWA 4HMEA 1EIBA 1HJQA 5I77A 4M81A 3QHNA 2CBUA 2Y24A 3GH7A 2F8QA 1V6YA 1HN1A 3RJYA 4UQDA 1ZBCA 1EDTA 4KGLA 1HJSA 3A3HA 5M5DA 4D6GA 1UKPA 1V3KA 3CZGA 3OGRA 3HG5A 4BS0A 4D6FA 1FP8A 1JYNA 2QMJA 3ZJKA 2ESCA 4HU0A 5BXTA 5JBFA 4P8XA 4LYPA 4DO5A 3L4ZA 3NSXA 5C8BB 1H5VA 3MMWA 3CZSA 2DT2A 1MW2A 3M7SA 3EMQA 5C71A 1RD6A 1PX3A 4W85A 2AMGA 2YOCA 2FGZA 3W82A 4F79A 1W9BM 3BUPA 1HJUA 1H1NA 1I1XA 1TZ7A 2GK1A 1J01A 2A3EA 3WL0A 1BLIA 3GXIA 1QNRA 2X09A 5DF0A 3KZSA 1ZBKA 3W27A 2XN0A 4J7RA 3BUDA 2ZICA 1M01A 1W3LA 1T0OA 4AD1A 1SR0A 1VRXA 1B3ZA 4E4PA 4CN6A 4HA3A 1KXVA 3N1AA 2V38A 3AS2A 1GHSA 3TONA 4DO6A 2E9MA 1QHOA 2DSZA 3QOMA 3GXTA 3LXBA 2DQXA 3AS0A 3ZSTA 4Y7EA 1Q6DA 3WNNA 1BQCA 4PMOA 3BVVA 4UFIA 2CPUA 2FH6A 3WNKA 1QHPA 1MVYA 1ISYA 3WF2A 1ZL1A 1WZMA 5C70A 3VGGA 1E1EA 1GOIA 3VSUA 3AROA 2PWHA 1G94A 4AZHA 1JL8A 1V02A 1BVZA 1NWSA 2CKSA 1K9FA 2W63A 4PMUA 1C91A 2VQTA 1UD5A 4UFLA 3GZAA 3AHYA 3DECA 3U7BA 3MI6A 2XYLA 1E1FA 5ABEA 1V6WA 1UASA 3BSHA 1WZKA 2O9RA 3MUIA 1ZS2A 2XM1A 3NYDA 1DWFM 3IGUA 1W1TA 3WNMA 4LYQA 3GBDA 2WVVB 3AI0A 1OCQA 1WP6A 4QDMA 1C7SA 5I24A 3OZPA 5JUVA 5D8ZA 1UKOA 1H0IA 5HBFA 1HKIA 4PMXA 2YL6A 4JIEA 1LL7A 5LA2A 3W6LA 3VGFA 4WKAA 3BXWA 3ZJ7A 2JF7A 3A4AA 3FAXA 1EO7A 2VO5A 1K9TA 3LPOA 2VCBA 3FNDA 2XG9A 3VDCA 2WVUA 1JZ3A 2B31A 1F4AA 2OWCA 2ZWYA 3AIWA 5A94A 3ZIZA 3VO0A 2PI6A 3EJTA 2WM0A 4H7VA 3AXIA 2WCSA 2GVYA 5M03A 4QAWA 3M46A 1JD7A 1JZ8A 2GDVA 3VKKA 3TTYA 2PWDA 3WNLA 4IM4A 3W4RA 3DX0A 3W53A 4F9DA 2VX4A 3PZTA 1TR1A 1C8QA 1VAHA 4P7NA 1HKMA 3AS1A 5DMYA 2VR5A 2OYKA 3HG3A 3VIJA 1CGWA 1X6LA 1NARA 2G3NA 4MNLA 1GQKA 2E9BA 4JKKA 2PC8A 2VCCA 1I75A 1XV8A 1EQPA 3AMLA 4P8UA 2WPGA 1H4PA 1QBAA 3VTRA 2WC4A 2WLZA 3WY1A 4CU6A 2CKRA 3DDGA 1TCMA 3D4YA 1E71M 1ECEA 3ARWA 4TX8A 2DSKA 3B9AA 3LXCA 1JZ6A 3A6OA 3WDPP 1XD0A 5FCZA 1PX8A 3BVXA 3DYPA 3APGA 3WNOA 1E6XM 1GVIA 2YIHA 3WH9A 4W7WA 2VUYA 3G6MA 4CCDA 5A8NA 2OYMA 1EDGA 1NWRA 1W2PA 2GSJA 4W87A 2VR4A 1W1VA 3BGAA 4WJXA 2XWEA 4UFKA 4CD8A 3ECQA 1GUVA 3CTTA 3L4WA 4GIAA 1JAKA 5KEZA 1W9UA 2J7DA 2JEQA 2CNCA 3K8LA 1R7OA 3I3BA 2XN1A 3MO4A 5JIPA 2FHFA 1H49A 6CGTA 5A3HA 3CHCA 3QHOA 4W8LA 5A6LA 4QCFA 3EJPA 5JIWA 4FNUA 2DPEA 3DC0A 9CGTA 1RH9A 5CJ5A 4IPNB 1XSKA 4PSRA 3PZNA 2D22A 3WUFA 4FNPA 3A24A 1XSJA 2CETA 2VRQA 3WD3A 3U5YA 1BAGA 2EPMX 5I3DA 1C3FA 2WCAA 3VM7A 1ZJAA 4KGJA 2X0HA 3SCUA 3ARVA 3BAKA 1E6ZA 4U31A 2AOSA 1QNPA 1UH4A 3CUFA 3SCTA 2Y5EA 1MFUA 5E0FA 1SMDA 1W2VA 5CSYA 2J7GA 3S2CA 3BUBA 3AYRA 4PN2A 1NOWA 1GQLA 5E1QA 6A3HA 2DIJA 1OINA 4JKMA 1C8YA 1XH2A 3WBAA 2CCRA 2EEXA 1UR0A 2A3AA 3N17A 2EJ1A 1RP8A 2UY4A 2VX6A 1GVYA 1DWAM 4FLRA 1OSEA 5A6MA 1TVPA 1JAEA 2PWEA 2TAAA 1UD2A 1BVNP 3I3EA 4WK9A 3LRKA 2J75A 2EBNA 4GXPA 4PYSA 4M82A 1E6SM 1CGXA 1LL4A 2WKGA 5AC4A 2EPOA 5HOSA 2YFNA 1BSIA 1CECA 1VEPA 2VT0A 4B3LA 5A6SA 4F66A 3CZEA 1LLOA 4YHGA 1J9YA 4FNSA 3W29A 5EFDA 1HP4A 1XRVA 3KL3A 3L4UA 4J27A 4S3KA 3VIPA 4OIFA 1UQYA 3OA5A 3PTQA 2WBGA 3SEPA 1LG1A 2JIWA 3ZSSA 4OKDA 3OGSA 5GQBA 1J0HA 1B31A 2Z1KA 4M24A 4JCMA
chains in the Genus database with same CATH superfamily
4TSBL 2TRHA 4Z5RB 4N24A 4JR9L 1I1FB 4GG8A 4M6ML 1KFAL 5L8KB 1EJSC 1D8WA 1WDRA 4GXUM 4CILA 1OGAA 5C1MB 4X5RA 3EDDA 5LHDA 3MO1A 3A47A 4CQDA 4NL1A 3WENA 1R2TA 4N9OB 4P2QD 2VXSH 3VFTB 1TMQA 1J2BA 4LH8A 1ZV9A 1QRNA 3L6FB 2WGNB 3VKCA 2YO3A 5DGQA 3AIQA 2V37A 2OTUB 5T3XD 2XV3A 1ZLSL 1XGEA 4YVPA 2OLSA 1BG1A 4RAUA 3QDGB 4ZODA 4QQUA 3GSXB 2IJ0C 2XA8H 3NRQA 3TNNB 1ONEA 4HZ6A 5BPPA 4KEUA 5D6DA 3VKJA 2QHRL 1MW1A 4MADA 3LEYH 4P57B 2D4DA 2GJXA 3X1BA 2KZHA 5IB3A 3IMBA 1OWQA 4TUOA 3HQ1A 4DO4A 4R2GC 3TYUA 2QPXA 2WO3B 1BQRA 4HOMA 5A3IC 4GJ1A 2PO6A 2VLME 3KPTA 1REQA 4BKNA 4HUUA 4JFVA 4S0TD 3W9DB 3MNZB 1GQJA 3FMGL 4ORZC 3KS0H 3VWKC 4YPGA 1EFZA 3QYNA 4P2OC 1PS9A 1W37A 1V05A 2PKDA 4LV9A 3L3IB 2OA9A 1XMEB 1Y7VA 1TQVA 1J0IA 1YMHA 4WWKD 3TBWB 1LM8V 3HS8A 1KXTA 2NSXA 1GORA 2WHKA 1KGXA 4GAJL 4I6KA 3D18B 1JK9B 5ACMA 4M1GL 2X8RA 1A65A 1SFHA 1ZLDA 4JY4B 2WHVA 3VI4B 1U95B 3R5EA 1EZWA 5LNGA 1KPRB 3WBDA 4ZNCD 4NNYB 2CXGA 4I0CC 1BYDA 4P5MB 4RDZA 3U2ZA 2BC4A 3XIMA 3U2IA 1VLXA 1OGAD 3FOKA 1BYCA 4W88A 5CILH 3GAKA 2ERJB 3IWUA 2OM5A 1QO3B 3SPHA 4K8GA 4FXKA 1YAIA 1AZUA 3ZQ9A 3ROLB 1H7PA 3DBXB 5EA0L 4BWTA 1UD6A 1JF5A 2NQZA 1E5NA 3V52H 2H32B 4CC4A 1MKFA 4XVUD 1S2CA 2XJKA 3P30L 2ADJA 4WEBL 3UH8A 4HJEA 1AH4A 1DJQA 4RDWA 1HZHH 2X05A 4L4MA 2GK0A 4L3ED 1OFEA 2NYYD 2Y1VA 1JZ7A 4JEJA 4TR9A 2VC6A 3G5YB 1V93A 1VJSA 3T77A 1HL8A 3B3IB 5C0BA 3NSFA 35C8L 4JN8A 3WQWA 2VDOH 1EF2A 4B15A 4LVNB 5MEPB 4N9GB 4H2CA 3MKGA 5JU6A 2QIIA 5CC7A 1KJVB 4KERA 3I02A 4RAVB 3OR7B 2Q87A 4ATDA 4G5ZL 1J48A 3TNNA 4PGDB 1YAZA 4FQQA 3DIFA 1KIUA 4LCUB 4OIBA 3VB9A 1EJ8A 2VAAB 3WFAA 3QA3B 3A3XA 3RR1A 1IM3A 4LNRB 3RX9A 2Z92A 1FDJA 4PYHA 3VM5A 3RFZC 3LK6A 4NSBA 4HGWA 4S10A 4REQB 1MRDH 3TC7A 3UT0A 5CC6A 1UEYA 2YZ8A 4L5FE 2A9NH 1S3KH 3NYKA 4JFFA 4UBDC 1RP9A 3DJZA 4N1CA 4A7SA 1Q7ZA 3W1UA 4CD6A 4KJQD 3UC2A 5FDWA 1ZAJA 1VCGA 3D09A 4K4KA 4P7LA 4LS0A 4OQTH 3ULVE 1XQLA 3LQGA 1KWKA 4WEVX 2CJ3A 4XWGH 3TQKA 4KY1H 4DVOA 2EPKX 4HN8A 5DELA 1OM3H 3GVQA 1JZGA 5T8GA 1LO0L 4RMUA 4LK4A 4MUZA 1I8KB 3N3MA 3DV6A 2K8MA 2EIZA 1RZIA 5KOVC 2VFFA 2CGYA 1SU5A 4OLXH 4K39A 3QDAA 3FSAA 1MREH 3T04D 1A64A 5LBSA 5H91A 2NXZD 3FQXA 3MRMA 1FORL 3VX1A 3TJIA 2LFGA 1YNLH 3HMJG 1JF1B 5CINH 2CK2A 2GTZA 3GSRB 5I17A 5KS9B 2E1WA 4LQ1A 3FYIB 1DVYA 3O6FB 2IDUA 1AG6A 1W8NA 1AZBA 1H60A 3CHVA 3UXFA 3Q3GA 3K1DA 1CK0H 1O6VA 2Z7WA 1WDWA 25C8H 3IDMB 4XMVA 1HJXA 1ZGDA 3BLPX 3IJ8A 4BFEA 5B1AB 5BCAA 4Y0GA 4QRPA 2BVOB 2J9ZA 3VH8B 3NJMA 5TQ2H 2B0MA 2D73A 2YN3A 2JFEX 3FHAA 1J1XH 1BG4A 1IEWA 3IS4A 2C79A 1BYNA 1FCGA 5C9ZA 2WNKA 4S3BA 5C8JB 4Q4PA 2EDWA 5DD5H 2VGBA 3QQWA 5EU5A 1UM4L 3URAA 2FE0A 2WXIA 4WTXA 1F3EA 4IKIA 3S36H 1VC4A 4G56A 2PO6D 5CZXC 3PAYA 1JV2A 1Z5LA 4TSBH 4CC4C 1IBYA 2BZDA 1MNUH 1ZA6B 3WDJA 5LKNA 1P7TA 5G1TA 4R4ND 1QSFE 3NTCH 2QCNA 1QI2A 3IJ9A 1L7TL 4MS8D 1P4UA 4ONHA 4QYAA 5KYYA 1KWGA 2EIEA 3CJPA 3UXKA 4PUKA 5JOPD 3S1WA 3BARA 2FBOJ 2XQ0A 4PUBL 4Z7WF 1ZE3C 4LBAA 4KO7A 4IBUA 1E43A 3BD4A 5IJVB 4LLMA 3OXSA 2BHYA 1LT8A 3LM3A 3O2DA 2ZXCA 3GRGA 4Y5YB 2QVKA 3X14A 4PVMA 4XR8C 2DD8H 3HRZC 4K38A 3HC3H 3M0VA 4GZIA 3VIMA 4AXNA 1IEAA 4DSYA 3T4AB 1J88A 1IC0A 4XP1L 4WCYL 5HYJE 3RLHA 4GBXC 4OU1A 3S5OA 3ZVIA 3PNRB 4E8GA 1C1EH 1Z9SA 2XBDA 1B0RA 4AIZA 2VFHA 3UACA 3AG3B 5GRYA 2F5AH 2P24A 3G9VA 1E4WH 1EH9A 2ENSA 3LKQA 4QCIA 4Y7OC 1K4GA 3BDKA 3O2LA 1ZHLA 3DX6B 1VIWA 5KSBA 3KL0A 5F9JB 3L7RA 5HULA 3ATEA 5F1NB 1UCBL 1MPAH 5TNVA 4NO0B 4GXFA 4G6JH 1QVBA 3LTSA 3C0SA 1M57B 2H6OA 3BKCL 4DZ8A 4WEMB 3MRHB 5DVMA 2NNRA 2HBXA 4JM2A 4PGBB 3DMMB 1RIHH 5E6UB 4DF2A 4PIRF 2BFVL 4KNSA 2H32A 4J3UA 1A7PH 3MRRA 4AMXA 2WMKA 1ZT7B 4QDPA 3S3PA 4X8XA 4N8VG 4G7FA 5F6HI 3LG3A 3U9UB 3EGSA 1NAMB 4EP8C 1U8JB 3AU1B 1MCRA 4YHIA 3L5JA 3IDMA 3OKOB 4B5UA 3PAZA 3P8IA 2VABB 3RVUC 2VMEA 1R2RA 1YNYA 4UAOB 3LB6D 5F72S 2A5HA 2WV3A 1Z7JA 3SE6A 3KBHE 4ZX4A 2CITA 4KXCA 4KVCH 4OFYA 4PLOB 5FM4A 3FW6A 3MC0A 3HCVB 4Z7OF 4RISH 3BPNB 5BW7C 1S9VB 1QOQA 1A5FH 3MV9D 5B8CB 2JFCA 3L2NA 4JHVA 5C08A 2I57A 3UZZA 3WMCA 1PD1A 2A9ML 1VJZA 1F11B 1RXLA 3GMMA 1WEJL 3FTGB 2EP6A 2GC4C 3H4HA 3SKOB 3UGUA 3DEQA 2E0PA 1KEMH 1JNDA 4W9KC 4NKMB 5LAXA 4MKVA 3P02A 3KLHC 3UGXA 4S2BA 4M8UA 3F7LA 3L9RB 4KI5E 1LJYA 3HQOA 4TOQA 3EJCA 1MHCB 3BZ4A 3WL9A 4K2SA 2Z8SA 3LZPA 4YWSA 3TH6A 4JTQA 5KINA 2A3TA 4GYBA 4HPYH 2JI2A 4EVNA 4DM1A 2J21A 3QZWG 2OS7A 3ITGA 4UT6A 1HL9A 2WUCL 4FQ2H 3P4MB 1LWJA 1SXAA 3LKPB 3W2DH 4PS4H 2VR9A 2XETA 4A7GA 4AGLA 4DT2A 2WNXA 1CBVL 3WE1A 1TREA 1OIOA 4ILDA 4PJHB 2MQ3A 1KG0B 3KBSA 5IROD 5AC6A 3EOLA 3B3DA 4H6RA 2CPCA 1W1A1 4PLJC 3THMH 2YDQA 1VLWA 3D25A 4ADIA 1CFNB 1G9EA 3MSGA 1FWWA 4P3CH 2JKRM 4IGBC 3MLSL 1NJ9A 2UXTA 5CZ0A 3GB7B 5ESAB 4G5DA 2AQQA 2YAQA 3SD2A 2XZQL 3VXUE 4QNWA 1QG3A 3GVWA 2VERN 4AV4A 4DAGL 2X4PA 1E9OA 2ZF9A 4FQIL 2ADAA 3P74A 4OGYL 5D1QD 3GSNL 3MREB 1P43A 2DH2A 5CCJA 2V5CA 5DYOA 4R7JA 1FX6A 5KJRH 1HWHB 1B6DA 4G1KA 5CJ8A 5BO1H 2A7BA 4IRSD 3JWNG 5FW8A 2P5EA 3VRLF 2P28B 3HB3D 2PPDA 2P4AB 4XO5A 3CHOA 3AIRA 3DDFA 1RK0A 3GUTA 4S1DD 3WFBH 3SCQA 2Z91B 3AOFA 3PPGA 1DHKA 1KF9B 3RYSA 4OZGE 4LRIC 4YE4H 3I6KB 5K9JL 1HSAA 5I0XA 3G5VB 1DUYB 4R7XA 1J1PL 2E27H 5AOIA 1KG0A 4M8QA 4ZPTA 3B0PA 3IAQA 5GGSB 1F02I 4Q8MA 4P2CG 3HGJA 1ET8A 5CZKA 5BOFA 5FF2A 2Y9RT 3CXFA 1HIZA 1M04A 4K7VA 2EIBA 1P4IH 2WMIB 3MRDA 1O6SA 2VDOL 2OL3H 2B59A 1OX6A 1W72B 5I8EB 2J8TA 3QR1A 2ZTKA 3PZGA 3UWYA 5TF1L 5A8NA 1NC4D 3WAKA 2B1AH 1NGPH 1A02N 4FQXA 3BDBA 4EAMA 4XKMA 3N40P 2QPEB 1RV6X 5FW7A 3MV9A 2EKSA 1BD2D 2ESVE 2AFNA 4UTIA 1HZHL 2FQGA 1AHMA 1IQDB 2BK8A 3KPRA 3ES8A 1UWEL 3IVKB 2R39A 3U2OA 3HG1E 1IT0A 3DG6A 3UGRA 3PGDA 5D7IA 2WYZA 4DEWA 1RY0A 5FO9B 1ICPA 5KS9E 2WWNA 1OL0A 3GMRA 2DN7A 4HWBL 4UV4L 3ULUF 4O13A 2AJSH 4XO7A 2Q8BH 2CGRL 3ABXA 4WK0B 2CO4A 3GNMH 1S1PA 4FLQA 4YEFA 3VFOB 4LCIL 4RMRA 4I9XA 3S8GB 4Z23A 1SUHA 2DS4A 5TE4H 4PTVA 2XVLA 3OX8A 1TSIA 3LQAH 5DJ0A 2OOFA 2WINA 3GSUB 4L4TE 1AR2A 3C6LD 2JV6A 5TPWH 4ALAH 2Y62A 3CV6A 3QWRD 3QR3A 2X4OA 1D5ZA 1DBJH 5KYWB 2XVPA 2R4SH 1T03L 3UBXA 2BM3A 4DN4H 2DIKA 2ZOOA 5SWQA 1QSFB 3EUDA 3O9WA 1AOZA 3JZEA 4R2GB 4B3KA 3GB7A 5HHPB 4L64A 3MB9A 2XUCA 4OU3A 1QRNB 4X6EB 5JLZA 3KYMA 1J9QA 4XVJH 4YDIL 5IROC 1LEIB 2DT1A 3G9AB 1HXYB 3DHPA 1TSRA 4PV9B 3U9IA 3VAVA 2JKNA 1TFVA 4H1ZA 1GKQA 4AD4A 2XC8A 4ZXOA 1H1ZA 3N15A 2PMZA 2QUNA 5E4AA 3PHQB 3VE0B 1OQFA 5A40E 1OX4A 1YLVA 3AIUA 2OXGA 4CVXB 1VLIA 4TLUA 5EU6D 3V5HB 1WKFA 2CBJA 5CIPB 4PRTA 2X5PA 3DCPA 3RRXA 3F01A 3VFCA 3TXVA 3EO0A 3ZTEA 5E93A 3UADA 2BSED 5D6CA 3V5OA 1Q4WA 3SB0A 4D1IA 5EO9A 4JHWH 1A14H 5I5MA 1R33A 5KAQG 4HT3A 3P4OB 3HC0A 1MIEL 4XIMA 1PYMA 1F11A 3VRLE 5GS1A 3GH4A 2I5QA 4E9XA 4A3UA 1PTZA 2VEKA 3D85B 2XJ7A 3VIGA 3HQNA 5LBVA 4XK2A 2OMZB 2F7RA 1KYAA 3QYMA 4WUIA 1G9MC 3LPFA 4AHQA 1CTOA 5FGCB 1OD0A 4HMNA 4MKNA 4NKQB 4AH7A 1JI2A 3FT3B 3IU3B 1BPVA 4H9UA 4BE6A 1R38A 1RPXA 1AGBB 3LB6C 4I8YA 1A8ZA 3TEVA 1AQ0A 1F58H 2NOYA 1Z0MA 5KBPA 2GYSA 1JFXA 2VDIA 2GFBB 4HC1L 4BSWA 1R3IL 4ONGL 2HSAA 3G22A 4G7EA 3IDIB 1ZSDA 2Z0BA 4ZR8A 4RMSA 4Z77A 3P5ZA 4AC7C 2AQRA 2VMDA 3LQMA 1P6WA 2EIZB 4KXDA 1LDCA 2NSOA 1H3UA 5K7JA 1G4MA 3GTNA 1W0WA 5F7EL 3QJFB 5TPWL 3SYOA 1ISZA 1TE1A 4GP5B 4GOSA 2ISVA 1U93A 1E8WA 3DJ9A 2XQBL 1HESA 3FUDA 1MJJB 5AYIA 4YOKA 5HGGS 3LKOA 1F4XH 5ESQA 1B0GB 3D2TA 4LSTL 1RHFA 5FAAA 1BJMA 5GHWL 1I7ZB 4HH8A 1J8HA 5B3JF 1QR7A 5LVEA 1R6WA 3EEGA 2YPVH 4RW3A 3V5KB 1UM6L 3AU6A 5EIIB 4UIOA 5CGTA 4JTRA 4A8NA 1X9RA 5IEKA 1XCWA 5FEWA 2PABA 1OOWA 1W15A 1NBYB 4HIQA 4U1GC 5F1SA 3L5AA 4M6AA 5HHMB 1VYSX 3KXFB 2GIYA 4L9LB 3P2TA 5I1KH 3F7PC 3NCWA 1FNAA 3VUPA 5BRZD 3ZL4H 2G5WA 3PZUA 2PBOA 1OFBA 2KZWA 3WHXA 2DVTA 1GW1A 1GJWA 4N4YB 2EIDA 4WW2A 3FSOA 1FOBA 1AXTH 3TFKD 4GRLA 1X5HA 4HPHA 1XG3A 4B53A 3IBEA 4F2FA 3OQEA 1RZKC 5CEYA 4WKFA 2XV0A 3GH5A 1DUZB 5EZPA 4UTWC 2CO6A 5INCB 4AGNA 4LPTA 4UQ2B 1NEZB 3WFHB 2JKPA 3N2MA 5CPSA 2OMTA 3RX2A 3FT4B 3RWCB 1NLDH 1EFXD 4C4UA 3HGRA 3VNMA 4U3AA 4C6QA 2JCCF 4J3XA 1X1NA 4FEMA 2WWOA 1PUDA 3R58A 1NPJA 3M6DA 3EMCA 3QQ0A 1RUPL 3VWJC 5L2KA 1YEIH 3D3VD 1IVTA 1DYSA 1NP2A 1E65A 5HINA 4A2SA 3NFPB 2Z8WC 1TVPA 2EKSB 5AHNA 3GLEA 3SPCA 5B7FA 3WTUA 3AY4C 3KYKH 5FO9A 2RTTA 3WFEL 3UCQA 4V11A 1EHLH 2IPJA 4NZ3A 5JVLA 1O12A 5GRUH 2Z28A 1EJUC 2E6DA 1TV8A 3HV9A 3MRGA 1T6MA 4QEGA 5LGJB 3FTXA 1NVMA 2WNGA 3OKEB 2XN9B 4IJ3B 3TXAA 3HR6A 1IT9H 4Q4KA 4D71A 1NGXB 5SWZB 4AIOA 4LBSA 3MU3A 2CCWA 5GS2D 3ZO0A 2RDXA 4MY1A 2CFFA 4S1SL 1XKJA 2D1ZA 1POKA 3BE1L 2Z00A 3GDLA 3AREB 3PQYD 2H8PB 3SY0B 5C9JA 1BVLA 1FN4A 4FZ8H 5J1TC 3AYSA 3C56A 1WV7T 4LAJH 4ZAKC 1RJZA 3HHMA 4PJAA 3DX7B 5IVNA 1UM5H 5D32A 4PWKA 4U3CA 1FHGA 2VURA 4AM0Q 1M4KA 1RUPH 3M5XA 5I6KA 1QOXA 3A67H 2YCLB 1CLYH 4Z7NF 5IEKB 2UXVA 1VFSA 5BXFB 3SDCD 2J7BA 4KKAD 4E2BA 3VD2A 5DR5L 1SZNA 3GBEA 1NSNH 3OJDA 4G6AC 5GRWA 4KJQC 5KYXB 2ZPKH 1XFBA 3EHBD 1JI1A 3FCPA 4GQBA 3C6SB 5C07B 2YWZA 5AFDA 3U2CA 3WD4A 3QDGA 3ZIMA 4I9MA 3PY2A 1Q8JA 3BQUA 1BBJA 4PEEA 4YO0B 3SCNA 3TQ0A 4P99A 2ZONA 4FXFA 1TQSA 2HFEA 1I3UA 3FTGA 5CEZL 5JXAH 4GKZB 4IIQC 3CO4A 1G4PA 5CCGE 4J35A 1B3WA 5IQMA 5L2KE 4LDCA 2E6YA 4TUFA 2ZZ6A 3MZ2A 1A4CA 4F1ZA 5M7QA 1TPB1 1EA9C 2E3VA 3LTYA 2R8SL 4AH2B 2C9PA 4KV5E 3C9NB 3MACH 3VG9C 3FFOA 4HUUB 5EORL 4ATTA 3CWHA 3FYPA 4JBSA 2IWFA 2C4FT 3ZJ8A 3FO0L 4TM9A 4XX5A 2CUMA 5GGVH 2WANA 1E0XA 1JVNA 2C9XA 5E8EA 2UY2A 1UKTA 4R90H 5LN8A 1YEFH 2WZIA 2UZXB 1X5ZA 4PJHA 1RIHL 3UMNA 1FWEC 4HK0B 3WEXB 4ADJA 4ZQPA 2QV2A 4GJTB 3TC9A 3WSUA 1MFVA 1RZFH 3VQMA 4UB9A 1AHKA 1XGRA 2NZ9D 2IQAA 4NKIH 1JCNA 4PJFF 2WKOA 4C55A 5L2KD 5IBLC 3OTRA 2V2XB 5K39A 3AJXA 3W1PA 2DQFB 2LU7A 2PR4H 2E27L 4UANA 4HHGA 3UG4A 3DMMA 4B5EA 3WIJA 2HTLC 4L18A 3WTWA 1FDLH 1KBJA 3QPYA 2FATH 3VFUB 3CQFA 2X4PB 4GW5A 2AKMA 1B3XA 3LSCA 3AHXA 4LVFA 1FXPA 4YFLI 3KPOA 1RVFH 5JORB 3TWCH 3WLKX 4RFOL 2BS9A 2VZUA 3IJQA 2BRRH 2RB8A 1G7LB 3CX5J 2IBBA 5CP7B 4HZ8A 1YJDH 1YEDA 2X0UA 3VMNA 2PW1B 2ZZ3A 5C0JB 1AHWB 1JCLA 4OFYD 4NWUL 4TTDC 5B1BB 4QQ3A 2DH3A 4U49A 3BZDA 15C8H 1OCZB 3BIKA 4HJJL 2VXUL 4FJYA 4LFHG 1R5VA 3LXAA 4NRYB 5AY7A 3DFTA 2BC4B 2AS5M 3DSFL 1QSED 1UR4A 5J57B 4OZHE 3FT1A 1QPOA 3C0JA 3ZJKA 1UB3A 4JX0A 4KRUA 3CPUA 2PCFA 1CUOA 4XXCA 3UPBA 3BLOA 3VD4A 3S6TA 2GBTA 2V0AA 4ZTPH 1LL1A 4KRZA 4WW2B 3K4ZA 1JTOA 2OW7A 3UJJL 3WH8A 5A8GA 1ZAIA 4L6DA 3A3YB 3SJVB 4P2AA 3VWKD 3AXHA 2ZKWA 2OMWA 4MJJA 5F3HA 3ZXAC 4H20H 1ONQA 1TVNA 1E72M 5D2LE 3S96A 2J77A 1A4LA 3UZXA 3NJLA 4JM2B 4OUOA 1EO5A 1JWMB 4PCSA 5D2LF 4H9TA 5DRXA 3TJPA 5FJOA 2G41A 4LAUA 4A67A 2PW2A 3O6FC 3LMZA 4UUIA 1XEDA 4UNUA 3MCYA 1XCXA 5E9DE 2A74A 2RHGA 3UXAA 5JO5A 1M9SA 2FZ9A 2FHCA 3QEUA 2RH9A 4IFRA 3RIKA 2O5YH 2ZXQA 3FRUB 3KTCA 4LDLB 4OOUA 1CGYA 1D9KD 1T1WA 3DUSB 1NIDA 1DANU 2J71A 2KH2B 5ES4B 3HB3C 3I6GA 2GHWB 3HZYA 4LRIA 2G4GA 2ABAA 1JXKA 5KVFL 2WQPA 4GMEA 4HSOA 4ZE5A 1IAIM 2X1QA 2R6OA 4HGKC 5FLUA 4PJ6A 1BECA 1YPZE 2Z4QA 4UM8A 3D0AA 1A5KC 1HG3A 1I9CB 3KWVA 1WDQA 3H2NA 3EA3A 4DXXA 1JHLH 3IFPA 1TPWA 5D9PA 2XUWA 2D69A 3RITA 3SDAB 1JYXA 4V1DE 5F9OL 4UR7A 4E3TA 4YBLB 2AABL 2VZ3A 4PJFB 3K1KC 3VA6A 5JHDE 1TV3A 5I1KL 1SZFA 2ADIA 3H4WA 1AQMA 1WT5A 4P2RA 5C0EB 2Y06H 4R27A 2WXGA 4AMWA 5IUCA 2QSCH 1BFVH 1P7QB 2ZRWA 3N4FA 1IGYB 4RWYL 4J1UA 1TG7A 2HLAA 1A21A 2OQJA 1YQVL 2VSKB 3MJ7B 3NUKA 4GKNA 4GSDL 4LCCA 2A0LD 4KAQL 5B39G 1IQWH 3C2VA 4N0CD 4U1JA 3TOPA 1NCNA 2P26A 1O6IA 4WSHA 4APQB 3QUXC 1Q7QA 3P77B 3RZCB 3QWOA 4XCNB 2F53A 2IAMC 5L0QB 1V79A 3FVDA 4X6DF 2ZUMA 3VINA 4DJDA 1JGEB 4LOFA 1FNEB 2JKJA 5TF1H 4ELKA 1XYMA 3OYZA 4XBPA 3MFGB 1CGUA 3ULVC 1KOAA 1ZEAH 4FOJA 2YC1B 4LVNC 3UQNA 2ZXWB 2XPGA 1UGNA 3MUCA 2BXYA 3OM3B 5D93B 4P2YA 2PRHA 3AM8C 1E27A 1MVUB 4CKVX 2GTZB 1MCSA 3GSRA 5KS9A 1E6JH 2Z27A 2X2UA 4RV3A 4G8GB 3W24A 4CQAA 2HROA 4YH6A 4Z1DA 4AUBA 1YMMD 4ZXBB 1J5TA 4PCNA 5AYBA 4FF9A 2VAAA 4NQEE 3OZ9L 4HQQL 3FYEB 4ZXLA 3W7MA 1FZMB 4O58L 1GOQA 2Z29A 1LO5A 2XWRA 1LILA 1IEBA 1BXNA 1JN6B 3N18A 3S6DA 1ONQB 4LUSB 2PP1A 1Y0LA 3KVPA 2FPVA 2QQKH 2CALA 2EVIA 1GPFA 5DCEA 3QEZA 3RCMA 2Y23A 3F12B 4GAYB 5PAZA 3TSBA 3GBML 3FHQA 3URNA 1TZIA 4DJEC 3L4XA 1ZSHA 3FPXA 3E2RA 1JMZA 4IHOA 3HMWL 5LLIC 3F4DA 3MRCB 2OLHA 2R1MA 1MYRA 3TQPA 3EW3B 1K8DA 1UWXH 4NKOB 4O1FA 3DXIA 1G0XA 3QIBA 4JREB 4HHLA 3BD3A 4DWSB 4MXQD 3PUGA 2EYTB 3GZKA 2Z92B 3GFUA 4C58B 3THDA 3NSMA 4MB5A 2VI0A 1BYOA 4TNGA 1QLRA 4M4RB 4NNXB 4I5XA 3D4CA 1J0JA 3QG6B 1PB0A 4RVBA 1JDAA 1RHHA 1VCFA 1PYWA 1H3PL 2DQ6A 4RETB 1J8SA 1OSPH 3BP7B 3M07A 3VXQB 3GWQA 4JYFA 1EHLL 4JDTH 1HHJA 1Z32X 4IL2A 2DQHL 5I17B 4BF7A 5A6KA 3DOSB 1FWRA 4KEZA 3EPMA 3G18A 4AYFA 3BPCA 1YHTA 3W3OA 1XF4B 5HVGB 2B2XH 1E55A 1KQYA 3NM3A 4W5ZA 5I3HA 1HHGB 4S3AA 3UWQA 4K6AA 4P2QE 2A1YA 4AMAA 4OCSL 5EEVA 1C5DB 1IGFL 3AM8A 3G5YA 3QZNA 2NX5A 1CLKA 3DX9A 1Y1DA 5J0BA 1ETZA 4KFZC 1M2VB 4QXTA 4Q9RL 3E0FA 4N9CA 5U4NA 2Y1AA 4TLKA 3RLVA 1X9LA 4N9GA 1ZHAA 4GUFA 1ZNNA 4AGOA 2IANB 3MV8E 5CS7A 2V82A 3AMGA 3BLLA 3EWCA 3FS2A 4KESA 3W23A 4F2TA 3T4YA 3WJMB 3DHDA 1MCCA 4BK8A 4GUJA 2QSQA 2GJZA 4QTGA 4PCPA 4P5RA 1PAMA 5D7SL 1PKQE 4FO4A 2IFFL 3EFDL 4L0ZA 4L8BA 1DJYA 2AXWA 1TMHA 1ROCA 4YK4C 2P44B 2E9IA 3SE8L 3W00A 2F1BA 1OZMA 4RDBA 3WUBA 3RNQB 4BHYA 3PJSA 1WYJA 5FEPA 1E7VA 2OSWA 1QOKA 3Q6FB 4R90L 5EF3A 5CLZA 3WEZA 3TOYA 5D4JA 4E38A 1W6WA 2I9UA 1S9YB 3PWJA 4ZK8A 1N68A 1OF0A 5IQ7L 5L2JB 3BZ5A 4OFCA 3B9EA 1NOAA 2EDFA 1QK2A 3V3WA 2KT6A 5GS0L 4NVTA 4O1AA 3KZ8A 4QRRA 1NUDA 1OSZB 2OLDA 1ZLVK 3N2TA 1JK9A 4H4NA 3W1XA 4KRPC 4PB0H 1ETZB 4QXTB 2GUBA 3CIXA 1OZTG 4MPKA 2F8XC 2L0DA 3LNDA 1R75A 1XGPA 5ICUA 1OFAA 3MTRA 2H6PB 1QI5A 4K5OA 4QXGH 4Y4HA 2TSYA 2W63A 2VH5H 1UD8A 4JZNB 3CZKA 2BSLA 3OJMB 5E99H 3C5ZB 4M5PA 2IOMA 4IHOB 3CUPB 1II4E 3CXDH 2QF8A 5FKPA 3QNFA 4K36A 4TUKH 5ISZA 3EKGA 7PTDA 2ZPKL 3D0VA 4HJTA 3PG9A 3QIWD 2VIRA 3CWGA 3V5KA 3FLUA 3GS6A 5K9JH 2GJXB 2NXZC 2B1HL 2WZ6A 3ILPA 4NQCA 3UXDA 2V5DA 4FQCH 3DI1A 4LMQE 4YSOA 3V6ZA 2EO7A 2X0VA 3T71A 3FCGA 4EXPX 2XDHA 4GW4B 2EJAA 1EJTC 1PSCA 2BWDA 4M7ZB 4L5ZA 4AZBA 2FBJL 2VDNL 3GU2A 1XZ0B 4PTNA 1P4LA 1NGWB 2CLRB 3SY5A 4H8NA 1JPGA 5DFWH 2XWJA 1I7TA 3PUEA 1DVSA 1W6LA 1DBMH 2BH0A 2PLJA 5KZ6A 1FH5L 3EGSB 4MD0B 3EDKA 2X9ZA 4L5FH 4GY1A 4FKKA 4F3FA 1EPXA 1Q0XL 3VSVA 1Q7MA 2SFPA 4CQ8A 4HUMB 2CLVB 7CGTA 5EDSA 2RFGA 4QAIA 1CFNA 1UZGA 2FO4B 1A3XA 3EX4A 4JHWL 1X6NA 1YDYA 5J9PB 2FPYA 4JX5A 1NEZA 3UAEA 4MF4A 2PMQA 4F0KA 1YUHB 3QIWC 1DJXA 3NZ8B 3EZJB 4GY4A 5CCHE 1EC7A 2FK9A 4AY8A 4FB7A 4B7LA 4ZEPA 3IPEA 4B4FA 3DPBA 4NQCE 3RU8L 4MA1B 2G4EA 4B2DD 4K3GA 1RZJL 2YAMA 4QUOA 3SGDH 4CVZB 1F76A 3F62A 3BQ5A 1LUCA 4WI7A 3Q8EA 2GT9B 1J2WA 3WEAA 2PRLA 1A9BB 1OFRA 3IU4H 4OIIH 3ABGA 4I3SL 5IVXA 3AALA 1JHTA 4AVHA 4FAAB 4OHQA 3IDYC 3SDAD 4UQCA 4PRWA 5ABTA 3GK0A 4JHAH 4MZYA 3QE5A 1GJPA 3WHXB 3FA5A 5LQBH 2FYYA 2MTPA 2WKLA 3IWVA 2PZNA 1NBVL 4FN0A 3OBKA 8TIMA 4XVUC 3OAWA 3ZYOA 4DPAX 3IKCB 3L17A 2QKIA 3T0ED 2BOEX 2D31A 3VGHA 4ZTPL 5HXMA 3LZ3A 5XIMA 2XTJD 3L3HB 4MB1A 1D3GA 4MD5A 2HRWA 1GH7A 3HTLX 2XWZA 3T6CA 4AZCB 1XLLA 3QULB 1OGBA 1U5JA 3G5XB 4HXBH 6XIAA 1E3ZA 3H2CA 4LANA 3FB8B 3W7KA 4ACZB 1FJ1A 3ATDA 3V4PA 3ECVA 4FQ1H 3ARGA 3WTYA 1DBTA 1WG3A 1NOLA 1YPIA 3IF1B 4YVXA 1CD0A 3GHEL 1PAZA 1VB9A 4Y4HC 4X98A 3MV8A 3IJIA 5AYQA 4PWFA 5T3ZE 1NDYA 2OXNA 3J27A 2NVDA 4OQVA 3Q1SH 3AXLA 2DZPA 2E4TA 4OFVA 2VL5A 3OKMA 4A7UA 4RZBA 5FHBL 1RUKL 3M47A 1H09A 2XHYA 4XIAA 2DLFH 3QORD 2HJKA 3O7UA 3TU9A 4HIBA 4H8WL 4JFZL 5D8JL 1LE9A 4WQOA 3S3GA 1UFUA 4NHCH 2GSGB 4JZJC 3V0VA 1D7DA 4L2LA 4HSQA 1S3TC 4C8XA 4FA8A 4M6OL 2ZZUT 3ARDB 3E0IA 3JUGA 2AJYL 3CHXA 4WGWB 4YHMH 4UU9B 4UDTA 3OKYA 4ODTH 2NNXA 4JDZB 1G5GA 1PEWA 5H94A 2HVMA 2YXOA 5EO0B 3U6RA 1R6VA 1UZ6F 1L3NA 2F19L 4FJ6A 5IR1A 3U36A 1DBBH 2XXGA 4H41A 4ACYA 5IMLA 3EA1A 3EXLA 3P61A 1KDIA 3AAZB 2Y7OA 3DUHA 2KQMA 3CHPA 4UINH 4F8XA 1CE1L 3NJGA 4X80L 3R79A 2G0LA 2WKJA 3JUZA 3IUHA 5C7ZA 5I03A 2WLYA 3FT0A 1AD9A 5AAMC 5CIPA 3X3GL 4LUTA 4OV4A 4P7RA 4KOBA 4RGNB 5DEFB 2NYZA 3SFKA 4Z7WE 1SYSA 1W9XA 2J8UF 1ZAGA 1NAMH 2YMXH 4MNQB 2VHLA 3M9YA 2FNBA 4EKJA 2QADB 1F2JA 3G08B 4GW5B 1KLFB 5DHYA 3CFMA 4GSQA 4I90A 3W1RA 4FQQB 2OJEB 4LCUA 5AKVA 4NUGL 1AL8A 3IYLW 3CFQA 2WINB 3GSUA 1T7VA 4L37B 4NQDA 3HA0A 3T0VA 3AREC 1KPVA 1M6OB 2VDLL 4OIIL 2XYBA 5EC1B 3KLLA 3U4KA 3UO1H 1AH3A 1FXQA 3BE7A 5G4WA 2HPMA 1W5QA 5CGQA 1DP0A 3D39B 3GSOA 2HWZH 4RDQG 4PULA 2VOMA 2PCYA 3GXDA 3AJ7A 1Z7AA 1CICA 3KYNA 4A3RA 2H7WA 4YLCA 3EJYC 1W0MA 3GDRA 1G9NH 4GVIA 3NQ6A 4XZMX 3DVGB 5FFOA 2MNRA 3FU8A 3MRNB 4NZ8A 3MFFA 1KLGA 5E2WH 3O8XC 5IQ9A 5B7EA 1BZDA 5D6DC 2NQJA 2BNQD 5DA4A 4ADGA 3LPGA 3B7RL 3QAZC 4A39A 4LHUG 3WCYA 1W3HA 2HNEA 1WCGA 4D72A 5DY3A 3MGAA 3VFWA 2HS6A 4FHKA 1X5AA 1TZGH 4GIEA 1A6VH 3OL2A 5AW8B 3MC5A 4NN5C 5AAPA 3SB3A 3R06B 4JQIA 2X6UA 2CBOA 1V0LA 3KHJA 3GF8A 2CHRA 5J06A 1CDYA 1B3VA 1C8VA 1F3DJ 4B5VA 2F7IA 4QXIA 1CXLA 1N12A 4NKDB 5EL1A 2OK0H 4HHPA 1MCWW 4ZMZA 2CCLA 4XCFL 3P3YA 1OT1A 1UT1A 5KYNA 1PG7H 2NDFA 4GO8A 3LCLA 5CKGA 1IC4H 5GRVL 3T2NL 5B1JC 3O0RH 5E6IC 2CHWA 4NERA 3ZDYE 4F57L 5BS0D 5DSCB 1D5MB 1O5QA 5CJNA 1H8NA 5AG8A 3RLUA 4XBEL 2P0IA 1T21B 4PJXF 3HO8A 3FVMA 4HZ1A 1JGDA 5T5FL 1JWUA 2QQNH 3FB6A 2O5ZL 4HEPA 3QUZB 4BKLB 2EXOA 2W65A 4DUVA 5KW9H 4J3OC 3N43F 4JZJA 4WSJA 5C2CA 1V51A 2WZMA 1D5IL 3RUGE 3ZLGA 3P3TA 4XP9L 2ALRA 3Q9QA 4PRHA 3O9WC 2G5RA 1QWNA 4K7PX 3KR3H 3VTAA 2WWCA 4NIRA 2OGJA 4XWUA 5JW5B 4UOW1 5LCVL 3WLLA 2J6WA 4C56B 3RG1C 3NPXA 1MCOH 1ESWA 3N3TA 3IB4A 4LHJB 4WI5A 3IMTA 3MREA 2OSYA 1HILA 1SOKA 3ARGD 3KBEA 3AWFA 4U3HA 4Y2DB 5T3ZH 1XIWD 1KN2L 1IU1A 1L5GB 4GIYA 3T0TA 4ZS7L 4DM2A 1XHHA 1ENUA 2Z2BA 1N8IA 4L37A 4NQDB 4ML4A 4L7ZA 2ZD0A 3GHSA 4PJBA 3PAOA 1INQB 4OCRH 3EX1A 3GPSA 1V3HA 3LYRA 1PGRB 5E7BA 5HD8C 1D2KA 1P69B 4MMXB 3UY7A 4EBQL 3AMCA 3OHIA 3UY8A 1BXXA 3KLAA 4EVNB 3PNZA 1TO3A 1DVZA 4ODSL 1OYBA 4KH2A 3N9RA 4U2ZA 5D96B 3T4YB 2OXHA 3FO2A 4U0RB 3WJMA 2I60L 5JQ6H 3D69A 2V9RA 5JZ7D 1KXVC 4FI6A 3A4XA 4JQ4A 3H7LA 1N8FA 2ZUQB 1P1XA 4YS4A 1NBVH 3CH1A 3QNZB 1YBQA 1QKZL 4U1IB 1T4KB 2QPSA 4JVUA 3O2WL 3UWWA 3M1BA 4O2FA 1ITBB 1EYEA 4WF7A 4PZVA 1DQDH 4I0PC 1WAEA 1RURH 4ZUWB 3B0UX 3S37L 1IGFH 4G6KH 5CHNA 1P7TB 4F7PB 1G6VK 4XBMA 4XNDA 4JDZA 5H94B 4OTXL 3LOTA 5JDJA 5IFAL 1WRFA 2W62A 3T8QA 1G0YR 1T20A 4GRMA 3IXAB 4JKPH 5CIPH 4UILL 4UQBA 1FUYA 1OFDA 4GHRA 4IP7A 1QW8A 1J05A 3FN0L 4XNMA 1SN2A 4M00A 1QFHA 3MCKB 1AZVA 2BASA 5GRZA 2A7PA 3MDUA 4XWOD 5D1QA 4FQHB 3K2IA 1RZJH 2HKFL 1MRQA 1IX2A 4JM4L 5DVPA 2C1PB 1LD9B 2A9MH 2GIMA 3H2WA 3NGBC 5DZ9A 5I6MA 5F6IC 5MENB 4L0YA 4TUOB 1B54A 2DVXA 1FNFA 2YOAA 4N2FA 4LBEB 3FFCB 3BLIA 2VAJA 1XIHA 4NPYB 5DMKA 2GJJA 1T04B 2NXYD 2Z93A 2RCSH 1KTLB 3AB0B 3L95A 3PXJA 2E46A 2PXYB 1S9XA 1OWWA 1MUJB 4X7TB 4MLIA 4BKSC 3KW8A 3ZE2B 3HBLA 1BXAA 1NFDB 2NQCA 3C5JA 3QCTH 1D5RA 3FCTA 4A3HA 2YGQA 1SYVB 4Z1YA 2J56A 4HLZG 4I5BB 3THCA 4LFYA 4G6AD 5EU3A 5GZOC 3MRHA 3RU8H 4H1LH 3V0GA 2BNJA 4XC3H 2WMJA 4RNRA 4KKAC 2FX9L 3BGMB 3ZL1A 4N28A 3B8DA 3PHSA 5CG0A 2XG5A 1ZIAA 2A83B 4E41B 5L88L 1E4XH 4KNTA 5CP7A 2P3ZA 2A6IB 4GAGL 4S39A 2IMMA 1EQWA 3CVIH 2YA1A 3MLWH 5TDOB 5I18H 1M6UA 2UBPC 1IKFL 2DLHA 4E9RA 3SDDD 1UXSA 1JUEA 5A2CA 2A6NA 4NRRA 5EMUA 5JXED 3T09A 4PP1C 4XNXL 3WBEA 5T3XL 3MHUA 4WTZG 4MJZA 4HJSA 4LIQH 1NANH 2E7LA 3I10A 4DAIA 4DHLA 5FWQA 2FMOA 3CX2A 5TD4A 1GC1H 2J5LB 1NDZA 2AC0A 4MWAD 6PTDA 4HCGA 1KR1A 3WFHA 4IQHA 1SGJA 2OSLA 3SCMC 2J20A 3MV7E 1JZ4A 4I5UA 4NZTH 3B9DA 3C5JB 4LMQI 3A6BH 4LL9A 2KZ1B 4ZNEA 3D9AH 1YBQB 1WTLA 2BBFA 4QG6A 4PB0L 2X4RA 2EE9A 3TN0C 3RY5A 1VKXB 1QI0A 2GUOB 2W9DL 5EO1A 2W67A 3L2MA 4PCFA 1Z8AA 3D2UA 1FUNA 3OG6B 5DMMA 3SCVA 2HQAA 3OKNA 1IXPA 1X8CA 1Q6LA 4NRSA 2AZUA 2QV5A 4KFMA 5DBTA 3WH7A 4FMVA 4HXBL 4K0OA 3AZSA 3MW7A 3U8GA 2LGNA 1F6AB 1G6RL 4L1SA 3H26A 1MCOL 4AJYV 2IQ9H 1T7ZA 3SE9H 3STLA 5G2HA 1XWYA 5KBMA 5EEXA 1B4EA 3P4NB 5I74B 5JW4N 4Z7UE 3DUSA 2OMWB 1LP9A 2OMYB 4F9JA 1UUQA 3IETB 2P5WE 3EZ4A 2W9LA 3AUVA 4KXZH 2ASHA 2V2CA 3QUXB 1CPUA 2RACA 2VLLA 3QJQB 4JZOA 3LKOB 5CILL 1Q6FA 5DO2D 1TZ9A 2XGZA 3CBWA 1EHNA 4O02L 2PW2B 1XZ0A 2R0WH 3L13A 2X4UA 4G7QB 2IVFC 4L3FA 4PGCB 4PRHD 5SX4I 2AJ3B 1AG1O 1J79A 4ONFH 3VCNA 3GC2A 1IC4L 1ACYL 2PGRA 3UTTA 5GISL 3RF9A 3WUWB 5B4MD 1YY8A 4XAWL 4ETYA 5CG7A 1R3JA 3G6AA 3EEZA 1MDRA 4OLZH 1MFBL 2ADIB 2GY7B 2DM2A 3GTTA 3UAFA 1UUNA 4HUCA 4FJZA 2JCCE 5C0JA 3RVTC 3TMQA 3WFCH 3CMOH 1XYBA 1ZBWA 4H20L 4HYWA 2BSRB 2Q9OA 5HHOB 1S7RB 2ALAA 2VDLH 5GRJH 3UO1L 5JA9A 2Z7KA 4A6GA 2WD0A 2K6WA 4D9RD 5CH9A 2Z4QB 1HH9A 4J4PA 2YN5A 3PS6A 1G1YA 3P3RA 2HCZX 1EHAA 2P8MA 3FQUB 4WVXA 3TN6A 7XIMA 4IU2A 2FYYB 4XN4A 5IREA 3IDJA 4X4ME 4N2LA 5CMAB 3RVXD 5DJCA 3SBWC 3SOBH 3PPSA 1KM6A 1XM3A 3N29A 1CLXA 1EEYB 5BS0B 3H7VA 3KYKL 3WFEH 4WDTA 4KWWA 3ZDZB 5IQLA 2OJPA 3V75A 1PQZB 3PWNA 5DWPA 5KYUA 4AMKH 4FQ2L 5C6TL 2JGYA 3I6TA 5JDSA 5D1ZB 1LF1A 3PJWA 3DI2B 1PG7X 1FO0A 4MD4A 3MA8A 2R29A 4GH7B 1LO2H 4XX6A 3KAOA 1WBZA 5KTEH 2A38A 2D3NA 3NQDA 1S3KL 5A6JA 3ECUA 1PHWA 3P0YL 3CIAA 4KK5C 1H9DA 2Z34A 3EYVB 1DIOA 4S3EA 3UIZA 1DLFL 3WLWD 4EUPH 1K77A 4MLJA 1MDAA 1VFTA 1BJ8A 1VJIA 4YTQA 1NGQL 4JJHA 4JY5H 2BY0A 2Z7UA 3O11A 1A25A 3F00A 4FQJH 1PW3A 4WI8A 3EGJA 3RWJB 3S6OA 4YGVA 3WFLA 2FO4A 3E8VA 3SKJH 2ZYHA 3HRZA 1PJWA 3CDCA 1KFBA 4POUB 4W9FC 2OO0A 1EO8L 2NY4D 4MMYB 4E2OA 2C1HA 4C6OA 5EY5A 1A5UA 1P5VA 3EOSA 3PDGA 4TULL 1HTYA 5D9OA 2VKXA 2WZ5A 2B4CH 4L29A 1VF8A 4G80B 1UPPA 4JMXA 1YDVA 2VTFA 5I0ZA 2VFEA 4HV8A 1L0PA 3AUJA 4B9CA 3IRDA 3W1QA 2CKBA 4PR5B 4AT6A 3EX3A 3ARXA 4WI0A 3BAWA 2CU0A 2OO6A 5ECUA 3KJ4C 4HGMA 3S1GA 1OY3B 2APVA 4NZFA 4XZ9A 1DQVA 1E6JL 3ASWA 3P4MA 2IXQA 3CK0L 2WZPD 4AV5A 3T0EA 3I6EA 2VLJE 3MI3A 4OLUH 3LPPA 3VIOA 5T33L 1CU4L 1U92A 4XC1H 4JTCA 5H4YA 4K8HA 4LC6A 4D6HA 1KXTB 3QDME 1CLZL 1EXUA 3DKLA 4N87A 1GQIA 1WTGT 5DANA 4FYQA 1OCWH 1MCNA 1Y5WA 3RX3A 4I0PD 1SO6A 2W9EL 4YAQB 3GC3A 2XM2A 1MFCH 4ZW5A 4U6VL 1OAXH 1CO1A 4XNBA 1E56A 3HRZB 4XPHH 5DQDL 4OVXA 2H26A 3S1XA 3WF0A 3OAUL 1NMCC 2W38A 3VFPA 3CV2A 4JG0L 4UDTB 1XLJA 3SYQA 4YPJA 2QR0B 2CLZA 1DQJB 3ILEA 4Z8FL 4JY6A 5I3FA 3GS4A 5K9KA 1MZRA 1WBYA 2H3NB 1G0CA 1XGZA 2FGWH 1W8OA 3B5GA 4U6YB 4XRCA 4ZUUB 3CUIA 3VQ1C 4BWLC 4DIAA 1WCBB 1QQDB 1OBAA 2GSIA 3BH9A 4OV9A 5A6TC 2OMAA 4X9IA 2BO0A 3FUKA 1XPYA 4D8PA 2G30A 2A6KB 2X4RB 1VKXA 2IPKA 1MUMA 4P7QA 3ZDZF 5IKCB 5I75C 1OGSA 2HMIC 1TE6A 2HYMA 2YC1A 2J7CA 2Y5JA 2P5ED 3MLZH 4TS6A 3CAVA 4QP0A 4YIQA 2PXYD 3WJLC 5MHSD 3KMDA 3K2GA 4CD5A 5HVHC 2ZYSA 4XO6A 2F6XA 5DT1L 3KHOA 2FRGP 3VWKA 4W4QA 4Q8BA 1MAMH 2CXKA 3NQCA 5E0CA 1XIWC 3HNVL 1OC5A 4YSAA 1S2UA 3VDAA 5FACA 1WSST 3SRKA 5BOZG 1TPC1 5IT2H 1BQGA 2Q2LA 4PFMA 1BIIB 2DSUA 4AGPA 1A7RL 1S5HB 1NUGA 1HKLL 2J74A 5IW3A 4WOZA 3PNWB 4AQ1B 1YN7A 1J7VR 4H8PA 4JTEA 3L4TA 4MRBA 4DZ8B 3NP3A 2R9HC 1TWZA 2W27A 1NEZG 4JNXA 1L8PA 2JTDA 4P7OA 1K4DA 4KQ4H 3RIAF 4G6ML 2RIKA 3CVHB 3HKFA 4OH2A 3VOFA 4WUKL 3STGA 1HOEA 2Q7AA 3PJUA 3WUEA 2DW5A 3SDDB 5I78A 3DSFH 3L5LA 3QC0A 4DELA 5AB0A 1L4IA 4MQ7B 4WWNA 1WBXA 3Q0HA 4HPGA 2DV0A 2B81A 2GVEA 1AJ7H 1SHWA 3DN5A 1ES0B 3EOBB 1KIPA 1JIBA 4AD0A 3WUWA 1VFBB 3VXRD 5E6ID 2V7HB 2VC9A 1DIEA 2ZX5A 3QC6X 5FCSH 4OVUA 3HZKA 3EKCA 3JTTB 3MAWA 1IXNA 4H7ZA 1G5AA 1NM4A 3BKMH 4OLWL 1RLDA 3ONBA 3Q45A 3C60D 4BK4A 3GNOA 4H00A 3AT0A 3N0PB 4YGAB 1PTGA 3G0UA 2Q10A 4MVAA 1A6WH 4Y5XA 5HYSB 3TYDA 4D3CL 5CF3A 3IGFA 3ZYZA 2J6EH 2DSWA 1IC7H 3AFBA 4AQEA 4DWHA 3IJSA 3SKOA 1K4CA 4PMYA 2R29H 3AC0A 3V6ZB 6ENLA 2LHAA 1JGMA 1D5BB 4LPWA 1AC6A 1RMFL 3K0YA 4GMSL 3KE0A 3AUWB 1RVFL 1UWTA 4HF5L 1YUHA 3N9KA 4OCRL 5IG7B 2QJJA 3R0KA 3SECA 2WVSA 1ZV5A 4ICWA 3ULAB 1JDEA 3SBPA 1E0WA 3DX5A 4AUJA 3HM7A 2VCAA 3SGKA 4GYKA 2F7OA 3RWCA 1HAUA 1IGIH 4QHKJ 4FI4A 3EOBA 4P4RA 4IG2B 5HNUA 2WMGA 1Z44A 5JHLL 2H9AB 3G1HA 2G4FA 4FNQA 5H37A 4MB4A 1X1OA 4MQSB 3O4LE 5DJ8B 5T9CE 2B1HH 4L4VE 2BVOA 3W7NA 4DP1X 2WJEA 1MSSA 1CDIA 1JRHL 5C7VA 3RL1A 4ADTA 3ZJ6A 1VCVA 3G7TA 3FJNA 3L0GA 3C8KB 2DUXA 5L8LB 4R7VA 2WSPA 1QLEB 5MERA 4XNAA 1MUCA 4FZIA 4O8AA 4PUWA 4B3ZA 3IMVA 5HYSA 4KCUA 2YDRA 1FFPA 3HEIB 5F7UA 2JWYA 3PGCA 5JORA 1GOHA 4PBFA 5J11C 3G0SA 2IV8A 2NY5H 3X11B 4K2UL 1J1PH 4LDEB 3ZOAA 3ZE0B 1QI3A 4P59H 5A16B 5CD5D 1MHHB 2M1KA 4IIZA 4Z7QF 3QZAA 4ANVA 4JPQA 5L4FA 1TF4A 1EJRC 4QRQB 1U5HA 4EX4A 5I1HL 4PJBB 5K9DA 2FVKA 5J6HB 4HGWB 3RX7A 4PUJA 2Q8AH 1L9SA 1C08B 3KJ6L 4ONOA 5LNEA 5JW3H 1KD0A 4OBTA 1TTPA 3QZ6A 1QFWH 1W5OA 2IQTA 4O10A 3WK1A 2DQCH 1SXZA 4RZ4A 4GIOA 4L1TA 5D2WA 1U2HA 3IXAA 1TQWA 2NZIA 4WEBH 3I3DA 3HPJA 1BP3B 3R1GH 5HPMA 3SN0A 3AXXA 1CG9A 1NSNL 4QF1B 3UPMA 3QJFA 3FQTB 3U82B 4JFTA 4LLYA 3B56A 4YHNA 5C0CE 2R0KL 1YY9C 5FHAH 4Z7OE 4RGOL 3L1EA 1QEXA 4Z0SA 2J55A 3WD2A 3NFUA 5KVGH 3THQA 3FFCA 5BUAA 1WXJA 2ICSA 4AVIA 1T7XA 4GFSA 3AG1B 1JDCA 3F84A 3CHQA 1SFSA 2J7FA 5HUOA 3SYPA 3MLPA 3ZQWA 1J5CA 4OD3L 3LU2A 4Y1AA 1XH0A 3CLEH 4BR1A 4L2YA 4GC4A 4JJ5A 1X4XA 3OLEA 5GGTL 4CCEA 3B7TA 4XRCB 4KQNA 3S48A 4IIEA 5CM1A 3BQUD 4P49A 2H47C 3HC2A 2LU4A 4UTKA 1YEKL 4ZFOL 4UMSA 4EXKA 2R0ZH 1ACYH 2J5LC 3CZFB 3HLKA 3GSVB 4IBSA 1U8IA 4JDTL 1M71A 4K23L 4A2HA 1EPFA 1XW8A 4HNTA 2ZF8A 1TNMA 2DMBA 1HN1A 1P84J 3MRQB 1EDTA 2VLKE 3LIZL 1R9ZA 3KBMA 3S5SA 1H3XA 4JD4A 1CF1A 2DLTA 12E8L 3FT9A 1ZY9A 2ADYA 1W8GA 1PWLA 1CN4A 1FL6B 1V3KA 3GZOA 2V6AA 4P23C 2EXYC 2CUIA 5E1AA 4DK3A 1IIGA 4D6FA 5D7KE 5JR1H 2R56L 1QCWA 5KETA 4FTVB 3PIQA 4BZ1A 2O55A 2QMJA 1KCWA 1NC2A 4OB5H 2WTRA 1AKPA 3NK4A 2X30A 3R7MA 1AGEA 3E8UL 3LEVH 4ZXBA 4Q4EA 3WFBL 5FECB 3NEHA 4X6EA 4X5XA 5DZLA 2VLKD 3RTLA 4N6RA 5JLZB 3LN4B 4S1RL 1JFQH 4WHYG 4LYPA 2DQUL 3V0DA 4Y8DC 1P7HL 5EYWA 1H5VA 3QVQA 5AZEL 5DS8B 3H2AA 1M6OA 3QO1B 4WFED 1WFNA 5ILTL 2OPJA 4W85A 3SBWA 1A6ZA 1GIGH 5DLML 1NCDL 1OPOA 4LSVH 3W82A 3L0NA 1DKWA 4O02B 1U91A 2VDNB 3KPMA 4S2SB 1TZIB 1IM3D 3DJSA 3SE9L 4GUOA 4KQ0A 3NGBB 5HQLA 4LSQH 3FQ4A 3R0MA 4YQXH 5K4ZA 1D5XA 1PVHA 3B06A 3NFNA 1ILSA 1IFGA 3P4NA 1Z1WA 4UCGA 5JHBA 4D8OA 1XF0A 1BLIA 5IFJA 3HURA 3WL0A 4F33A 5DJAB 4S38A 3LAFA 2G3ZA 5I1AB 1T1XB 2J7LA 3O05A 4FEZA 2XN0A 2CO6B 1B5TA 2WQWA 5JDSB 3D0LA 4Y90A 2YGNA 5ALBH 2ED9A 2EUVA 1R2SA 3OKNB 4L9DA 2X38A 5EF1A 2CC0A 1ZT4B 2QYGA 3BUDA 3RAOA 3QUYB 4OFIA 3WZ0E 1A4JA 2V2TB 3P0VH 3HFML 1W3LA 4R9OA 2J1KA 4B5TA 3UYRH 2YKLH 2EDTA 4AD1A 4XC3L 4V1DB 4E4PA 1A1MB 4CN6A 3QQ3A 1W8EA 4HA3A 1YY8B 3N1AA 1JGLH 1H51A 4AXKA 3B3IA 5C0BB 2WXQA 4DO6A 1NMAH 1SNRA 2E9MA 1X5LA 3QPQD 1WAAE 3SI9A 4M7LH 4UIMB 4UBDD 4PODA 1DQQB 3SO7A 2HH0H 4X9GA 4N1EA 4LVBA 1IKFH 1BQLL 4U0RC 3KGRA 3FRUA 1UJ3C 6XIMA 1FZKB 5GSVA 1S7RA 4E68A 3LXBA 4C6IA 2A6JB 3AS0A 4NQTA 3P69A 2JCCA 3UDWA 3ZSTA 3WNNA 2XISA 4LOCA 3V6OC 1BQCA 1HYSC 4U3XA 4J2MA 4PMOA 1EA0A 3G5VA 5FGRA 3C09B 1PL3A 2VR8A 4NAMA 4JNMA 3S7GA 1J96A 3EFOA 5F44A 1QTPA 1ZXQA 5MENE 2QZRA 4Z18A 4FX6M 1IIHA 2BJMH 5FYJD 2P47B 4P3WA 1ASOA 1RJCA 1A3QA 4GQGA 4Z9KB 4UTBA 4AEIH 1PLAA 2CKBB 4PR5A 1E1EA 2NY1B 1GOIA 4NKMA 5LAXB 1QUNB 4KK9C 3U0TB 2NTFB 3EJZD 2JMRA 4GUQA 3G0XA 4LUTB 1OTSD 1K9FA 3PWPE 5E5LA 3WYZA 3M0HA 1JCXA 2QCDB 3EYOA 3PPCA 3SBQA 3AHYA 3SDXB 3H4XA 2Z1PA 4NOBA 4RFOH 4EDWL 4DY1A 1ZLEA 3OKEA 1UASA 4RCAA 1T03H 4XP4L 1YECL 1WZKA 2F0CA 4M7LL 5KSVB 2F53B 5DT1H 4XPBL 1ZS2A 2OFJA 3CB8A 4K5PA 2IADB 4UTUA 1BD2A 4BEIA