4E2OA

Crystal structure of alpha-amylase from geobacillus thermoleovorans, gta, complexed with acarbose
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
451
structure length
445
Chain Sequence
ERTWQDEAIYFIMVDRFNNMDVNVNDPKGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNMPGGYHGYWIEDFYQVDPHFGTLGDLKTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPTKKDWFHPKKEIFDWNDQTQLENGWVYGLPDLAQENPEVKTYLIDAAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKKDFFLLGEVWSDDPRYIADYGKYGIDGFVDYPLYGAVKQSLARRDASLRPLYDVWEYNKTFYDRPYLLGSFLDNHDTVRFTKLAIDNRNNPISRIKLAMTYLFTAPGIPIMYYGTEIAMNGGQDPDNRRLMDFRADPEIIDYLKKIGPLRQELPSLRRGDFTLLYEKDGMAVLKRQYQDETTVIAINNTSETQHVHLTNDQLPKNKELRGFLLDDLVRGDEDGYDLVLDRETAEVYKLREKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a compact alpha-amylase from Geobacillus thermoleovorans.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-amylase
total genus 166
structure length 445
sequence length 451
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4e2oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4e2oA01
1QI3A 3WDPP 1A3HA 1TZ7A 3S2CA 1J01A 1GOKA 4EE9A 4TTGA 3L4VA 1NWTA 4DWSB 2WHJA 3TV8A 4FNPA 3WENA 2C0HA 2Y8KA 2Y2WA 2O9OA 4W7UA 1GOMA 3O6AA 3RM4A 5GNYA 3WF4A 5I79A 5ABEA 3L4TA 1CWYA 3UG4A 4JKLA 2VMFA 1MYRA 5IDIA 1W3LA 2JF7A 4HA3A 1WAWA 2ZUTA 1JFXA 3CZGA 1E70M 2E3ZA 3VGEA 1R47A 4AZIA 1XSIA 1E15A 1X6LA 4BA0A 1VJSA 4PTXA 3ARZA 3GH5A 3EJUA 1R7OA 1PZ2A 3NDYA 4LX4A 1NOUA 3W29A 1QW8A 3WH9A 1E0XA 3M07A 3EDJA 3H55A 1L8NA 3A5VA 4RE3A 4W8LA 3BAYA 2GVYA 1G94A 3HG3A 1GVIA 3WNKA 4Z2LA 2ZWZA 1MQQA 2X0YA 3AHTA 2OYMA 4AZ7A 2GSJA 2B31A 2IXUA 1KBBA 1V3KA 4Z2GA 2XFYA 1MW1A 2D73A 4GI9A 1VBRA 3AIQA 5BYWA 3CHEA 3D3AA 1PBGA 1BF2A 2WLYA 1B1YA 2CCRA 3VMOA 4UFLA 1JYXA 4DO4A 4H04A 4OBRA 3VMPA 1WZLA 3K8LA 1R8LA 2D22A 3PZIA 4ZE5A 2NW0A 2D2OA 3BAWA 3EDFA 3AS2A 4B3KA 4PTMA 1JF6A 2A3BA 3CZEA 1OWQA 4GZEA 4W7WA 5DO8A 2WZEA 2CYGA 3MUIA 4JHZA 4PMRA 1E6RA 4GKLA 1G1YA 4GZIA 1BPLB 4TVCA 4D6JA 3BCDA 1GVYA 4TX6A 2XJ7A 4AIUA 2FH6A 1XHGA 5A1AA 3SUSA 1HKJA 2JALA 1EOMA 4K68A 4UFMA 2ALWA 5CSYA 5A2AA 1VIWA 3CMJA 1Q6CA 3PZTA 4L4PA 1QOXA 3WMSA 2ZUVA 2CIPA 4MTVA 4GZJA 1XGZA 2VZUA 4JIEA 4GXPA 3WD3A 3IAQA 1DWJM 1R34A 3AHXA 1UZ4A 1ZBWA 2W91A 3WH6A 4QAWA 3OLEA 3PBGA 1TQTA 2ZUSA 5HPCA 8CGTA 3O9NA 2A3CA 4OBSA 1XH2A 3LRKA 2NSXA 1W3KA 3A21A 1JXJA 4W86A 1OCQA 1ZU8A 5A6AA 1XRVA 1WZMA 4M29A 4Z2HA 3ZT7A 1UWQA 4HA1A 1WB0A 4N42A 2QMKA 3FAXA 4AIEA 5E1QA 2DSWA 1JDDA 3CPUA 3GXTA 2WBKA 3PN8A 4Z2JA 1E4NA 3MUY1 4JZ5A 4XX6A 2XIBA 1W2VA 3VO0A 2VUYA 2QLYA 1U30A 4OOZA 2VCCA 3L4WA 1E6PA 2VRJA 3BVWA 2X8RA 4M82A 3UERA 4W85A 4UQBA 3NUKA 2XWEA 2BS9A 1JGIA 1PIFA 3NYDA 4L4OA 5D4YA 5CGMA 1CEOA 2ZUNA 3WH7A 1LQ0A 2W61A 4J27A 3EJSA 1UR8A 2AOSA 3EBVA 5FL0A 1QX1A 3ZQ9A 1VJZA 4H7VA 5CXPA 1QBAA 3W0KA 4GQQA 1E4LA 2J7CA 1CPUA 4ACZB 4MJ4A 1VAHA 1U33A 3QGVA 3POHA 4KMQA 3BAIA 3HG5A 2PWGA 4F8XA 1V3HA 3LXBA 3CUJA 4BZYA 5CPTA 3GXPA 1LG2A 1F4HA 4ATDA 4J3VA 4S3JA 3TTQA 2F1AA 3WD1A 4OUEA 1J0HA 2HISA 1HF6A 2CXGA 3ZSSA 2GUYA 3WNNA 4Q7NA 3ZJKA 1V0NA 1NWRA 1HN1A 1PX3A 5EBAA 3BH4A 1JYVA 1BTCA 2A3HA 3OGRA 2XUCA 3OGSA 5AY7A 4W84A 1OIMA 3PZQA 4CD8A 1E5JA 4HZ7A 2XVNA 1UD5A 2WWCA 1E6NA 3RPMA 1JNDA 3SEPA 5HDRA 3I3DA 4ZENA 3UG3A 2VX5A 5A6LA 1JYWA 3ARTA 3UR7A 5C71A 3ZMRA 1JXKA 2UY5A 4NZFA 4P8WA 3VIPA 2XGIA 1FA2A 1C8QA 4WSKA 2WCSA 1HVQA 2J7HA 2DT0A 2WANA 3WF0A 3L2MA 1C8XA 2D20A 1RP9A 4M56A 3EDKA 1SZNA 5EFFA 2CBIA 2FHFA 4YHGA 3DHUA 1QI5A 5D9PA 1UH3A 2D3LA 2JE8A 2VTFA 4KRUA 3FXYA 4B3LA 1XH1A 5GQBA 1V3JA 3A4AA 1FOBA 4UTFA 2F2HA 2VX6A 4W5ZA 4HZ8A 5A6JA 3AMDA 1DHKA 4CU8A 2UY2A 3WQ8A 4E8CA 5CQ1A 4AMCA 5ECUA 5JUVA 1EO7A 5HBFA 3WF1A 3VGBA 6TAAA 1CGVA 4HPGA 2HVMA 5DT7A 5BRQA 4C7FA 4GINA 3SUTA 3RJXA 1AQ0A 4H8UA 4JFTA 1MQPA 4KH2A 4W87A 1SFSA 4NI3A 4MAZA 3ZR5A 2QF8A 2DH2A 4OGZA 1E43A 2EABA 4E4PA 1GHRA 1VFOA 1KCKA 1KQZA 3B9EA 3AHYA 3IGUA 1MQRA 3HN3A 4U3CA 1HKKA 1HXJA 5A8PA 6CGTA 2YL8A 1TVNA 1ITXA 1NOWA 3IK2A 2W66A 3S5YA 3SUWA 1BG4A 2QHAA 4B9ZA 3CUIA 2VX4A 5M03A 2ZXAA 1CXFA 3MUAA 5IFPA 3F5KA 2CETA 4FK9A 4E2OA 4IISA 1AQMA 2F8QA 3MV11 4W5UA 3VUPA 3QHNA 3WL1A 2V3DA 1KCLA 4HMCA 1OINA 2WKGA 4WKFA 1EHNA 3WEZA 1GJUA 2W62A 1R86A 2XSAA 1CECA 2D0GA 4QCEA 2W67A 1UD2A 4MNJA 1KGXA 1K9TA 4DWSA 5LYRA 3T08A 3WDQA 5C70A 1DWIM 2D1ZA 1W1TA 1JZ3A 3EJRA 3T0DA 4RE2A 3ARWA 2DH3A 4UFIA 1E55A 3WUGA 3AZTA 1LG1A 3GYCA 1MW3A 1KXHA 5FKYA 3PZGA 1EIBA 3SCWA 1HWWA 4DUWA 1MXGA 2OYLA 1WKYA 3WDHA 4AIOA 3N13A 4PMQA 3UETA 1PZ3A 3CZSA 3JUGA 2ZX7A 3ZSTA 3W82A 4HOXA 4PUDA 1C91A 5CPQA 1QBBA 1E4MM 2J8GA 2JIEA 4JCMA 2D3NA 3BXWA 3EMQA 1EDQA 1Y7VA 4M81A 2JF6A 4UR9A 4MJ2A 5DF0A 1B31A 1QHZA 3VU2A 4TVDA 1KFWA 3WKZA 1OD0A 3GNRA 2F7PA 2W92A 5A6MA 3THDA 4AZ5A 3WUBA 1B9ZA 2JIWA 3AHZA 2F61A 1J0ZA 3AMKA 4PBGA 2PBOA 3OLGA 1WDPA 2OW7A 4HZ6A 1RH9A 4DM1A 5A2BA 1TVPA 4TVUA 4GQRA 2FHBA 1HKIA 3THCA 1B2YA 3CGTA 4X0NA 1J11A 1LWJA 2WVSA 1JZ7A 2GJPA 1UKPA 3K4DA 4UCFA 2BV9A 1NH6A 1UH4A 3FN9A 3CZKA 4PMVA 2G3JA 2DT3A 2VRQA 3EYPA 4JFWA 3WUEA 1WZKA 1OB0A 1GOQA 4IPNB 1UR2A 3HU7A 2XSBA 3KL3A 3MO4A 1HP4A 1W9UA 1PPIA 1IV8A 3GBDA 3I3BA 3WMBA 1UWRA 4F79A 1V3LA 4N0RA 5I2UA 4YHEA 3VIIA 1K9EA 1E6SM 2WC3A 4AD5A 1JYNA 3GXNA 2XTKA 1X1NA 5D9OA 4AD4A 1JDCA 3NSMA 1NP0A 4UZUA 1W9DM 1G0CA 5M5DA 4UNIA 4EK7A 3WEOA 1B30A 1CLXA 2PF0A 1F4AA 1YQ2A 2VVNA 1FH8A 1JZ2A 3CZNA 2Z1KA 2DQXA 2C8NA 2X2JA 3OLIA 5M3WA 1EQPA 1W2PA 1JAKA 2WMIB 4P7NA 2WAGA 1I75A 1CXKA 3VINA 1XH0A 3OGVA 3AS1A 4NF7A 2OWXA 3QOMA 2D23A 3GXDA 3L4UA 1TG7A 3WY2A 4HU8A 4MNMA 3BLPX 3CUHA 3AIWA 1WP6A 2J47A 4QLJA 4CD6A 2AMGA 1A47A 5CZKA 3BVUA 4PUEA 2E0PA 5GPRA 1N82A 3UCQA 3VILA 2YA2A 1W1YA 2EQDA 1HVXA 1OIFA 1KQYA 3GDBA 4DWSC 3U5YA 2E8YA 4PCTA 3SCTA 1WZAA 1WPCA 5E0CA 1OT2A 2BVDA 4GI8A 1NARA 4S3KA 4PRWA 4NRSA 3MSDA 2WZHA 3OG2A 1V0MA 1BAGA 3K4AA 3VIJA 4Z2KA 1E4IA 1BHGA 1EA9C 1TQUA 1R87A 4PYSA 4MPKA 5I5RA 4CVUA 3AQUA 4XUYA 3MMUA 4UOZA 4UOJA 2YL9A 4F66A 3KWXA 4B15A 1R33A 2VT0A 2CHNA 4MDOA 1JL8A 4H8VA 1QI0A 5BXTA 1MXDA 4Y7EA 1BVZA 5LA2A 2E8ZA 2QMJA 2WCGA 4W7VA 1XYZA 1ODUA 3AIRA 2CPUA 4NZCA 2EXOA 2EPOA 2ZUMA 5GNZA 3BAJA 4AW7A 1FFRA 1OM0A 4IUGA 3SURA 3ALGA 4HMDA 2ESCA 1UQZA 4AZCA 1R75A 3MS8A 4PMOA 3AS0A 1LWHA 4PMYA 4HTYA 3M46A 2FGLA 5JBFA 1CIUA 3BSGA 1T0OA 4FMVA 4MB1A 5EMYA 4FNSA 1E6ZA 1HJUA 3SUVA 4D6DA 5LA1A 1PX4A 1H4PA 1TMQA 3LRLA 3VD9A 2F7QA 1Q6FA 4D6CA 5E0FA 3D5HA 1U2YA 2ZX6A 3FW6A 4YPJA 3CTTA 2YFOA 1Q6GA 2F7RA 1ZBVA 2TAAA 4U2YA 5IFTA 1O7AA 4A3HA 3GH7A 4J3WA 2DSUA 3DX2A 1TUXA 2A3EA 3UEQA 4PCSA 1QNSA 2BVYA 3CUGA 4FLOA 1US3A 1V6YA 2ZXQA 1UR0A 1ZBKA 4A3YA 2VCBA 4XZBA 4U33A 2BNJA 1V6VA 4V2XA 4W8BA 3WQ4A 5I78A 1HIZA 2UY4A 9CGTA 4RL3A 1VEPA 4PTWA 3BMWA 2VX7A 1E56A 3L4ZA 3SCNA 3VSVA 2NT1A 1OD8A 1M01A 4D1JA 1OGBA 5IHSA 4BF7A 2GK1A 2DPEA 3SIMA 1V3MA 2YA0A 3DX3A 4H2CA 1CLVA 3WIJA 3A47A 4UFHA 2X2HA 3ARRA 1B3WA 1WCGA 4URIA 5CG0A 7CGTA 2WMIA 4D6EA 2FE0A 3OLDA 3TTSA 3CH9A 1E5NA 2E9LA 3LPGA 5EB8A 2OWWA 3AMGA 3AISA 5A6BA 2YKKA 3WNOA 3DDFA 4HMEA 3DDGA 3VKKA 3LMYA 3ZJ7A 1ZBCA 3A22A 1ITCA 3DX0A 3ZJ8A 4H41A 5FD0A 4WKHA 3RM9A 3ARUA 3PTMA 1EGZA 1JZ8A 1V0KA 3WN6A 2BFGA 1M7XA 1UKOA 1KB3A 1E1FA 4M1RA 1CGXA 3OBAA 1HJQA 3AXHA 3GXFA 4CD7A 4MDPA 1C7TA 4U31A 4FNQA 1VEMA 5A95A 1VB9A 4JKMA 1H0IA 4TOQA 1E0VA 1KBKA 1TR1A 3DX1A 4PSRA 3WD0A 4R5EA 1XC6A 1JIBA 1J9YA 5CJ5A 1V3IA 2D24A 3WEMA 5FIPA 4MB3A 3VSUA 1E9LA 1R85A 3LPFA 3VIMA 1GOWA 5A2CA 1D2KA 3PHAA 5KZ6A 1HJSA 4KRTA 3AI0A 3SCOA 1M03A 3G6LA 3EDEA 3CHCA 3EJPA 1TA3A 1GNXA 1TE1A 1M53A 5A8QA 3IJ8A 2EJ1A 3O2LA 1Q6EA 2ZE0A 3W25A 1MVYA 3VNZA 3BVVA 2C7FA 3K8MA 4QLKA 3WBAA 4CD5A 4AEEA 4WLCA 2A3AA 3BUBA 5AC5A 1UR4A 1D3CA 1V08A 5D9NA 1I1WA 4AISA 1QNOA 2F1BA 1V6UA 3SCVA 4AMWA 3WSUA 4X9YA 4OZOA 1UA7A 2ZOXA 2MANA 3N12A 1OT1A 4BQ5A 2J77A 4KWUA 1R46A 1R7AA 3H53A 4UFKA 2WMKA 3VGHA 5D8WA 3VM5A 3BVTA 3EJTA 1JI1A 4GO9A 3WQVA 3MANA 4DWSD 3CLWA 3WQ5A 5DT5A 2VZOA 3ARQA 3AYSA 2J78A 1WNOA 4UFJA 2WNWA 2VOTA 2WVTA 1CNVA 2O9TA 1XD0A 1H41A 4AEFA 4F9JA 3VPLA 3ALFA 1B0IA 1KXTA 3WQ6A 1EHAA 2E40A 5A6BD 1NOFA 3PZVA 3PZUA 1GCYA 3W26A 5CLWA 2PWEA 3GTNA 2XN2A 3QHOA 1C3FA 4CKQA 3SCSA 2Y24A 3OIHA 1EDTA 4JKKA 3AJ7A 3GNOA 1ZL1A 1QHPA 1LL7A 1W1PA 2GK1B 3NSXA 3VVGA 2YOCA 3RJYA 2WW5A 3W6LA 4UQEA 4JL1A 1KWKA 2WVUA 2WMGA 3B9AA 3LXAA 5JBEA 1GZJA 2WHKA 2VI0A 2JEQA 4CU7A 3AHVA 3WQWA 4W8AA 3BAKA 1J0YA 1LL6A 3AICA 2YJQA 2VURA 3DECA 2Z1SA 1E0WA 4AC1X 3QOKA 4PMNA 3WUFA 2YA1A 1W3JA 1E72M 4BQ3A 2CESA 3OZPA 1TQSA 2OSXA 3AIUA 2F7OA 5IXEA 2GJXA 1HJVA 1QHOA 3W28A 3CZJA 3LXCA 3A6OA 3N17A 2WBGA 1QWUA 2J7DA 3VIGA 2G3MA 3GM8A 3DC0A 2DSVA 4HPHA 4V27A 1JD9A 3VMNA 3FY1A 1NM9A 3AZRA 4A4AA 4LPCA 3OZOA 4MAVA 3WH8A 3AMLA 3APGA 1KGWA 3HG4A 5A69A 4YN5A 2E9MA 2XFRA 1LL4A 1MWOA 3RILA 2UY3A 2JFEX 3CHDA 3U57A 3NSNA 5A6KA 2JEPA 3L4XA 2EAEA 2XVGA 1XD1A 1UUQA 4NXSA 3CV5A 3MSGA 4UZSA 2OW6A 1EXPA 3NIYA 3T2PA 1ISYA 4LYPA 2WMHA 4KGJA 4U5KA 1GW1A 1GONA 2GDVA 5CSUA 4JCLA 3VX1A 1CXLA 3E1F1 2VJXA 1VENA 4MNKA 4FLQA 2X2IA 4ZEPA 2VRKA 1E3ZA 1K6AA 3MMDA 1HX0A 4JFVA 2XVPA 2J7BA 4XB3A 2WWDA 4AY1A 1UZ1A 3HJEA 1L0PA 3BGAA 4B9YA 1UD3A 2QPUA 2WPGA 4PSPA 1YHTA 3NCOA 1EOKA 1JZ4A 2WSPA 4ATWA 2PWHA 1E1EA 2ZX5A 3FNDA 4J3TA 1CENA 1IZKA 1UHVA 1JFHA 2J75A 1LF1A 3ZIZA 5CPSA 3F5JA 3WELA 4TX8A 4DO5A 3LPPA 5AYBA 4DUVA 1V03A 5E6ZA 5AYIA 1UWSA 4D72A 1DTUA 3CUFA 5FCZA 1JAEA 1W91A 1UYQA 3I3EA 1EQCA 2RGMA 1C8YA 5BCAA 2CITA 1UD8A 5A8MA 2YFNA 1BYAA 2DGAA 8A3HA 3F4VA 3S5ZA 2ZIDA 2PBGA 3F5LA 1HKMA 1V0LA 1P6WA 3UG5A 4NSBA 1W3HA 1B3XA 1VBUA 2WVVB 2ZWYA 4ACZA 2BXYA 3MKKA 2XYLA 1Z32X 1V02E 4MNLA 3MUZ1 1UOKA 2Y4SA 4AMXA 1W9VA 5C8BB 1ESWA 2EACA 2X05A 2CNCA 3CIVA 2XVKA 3D4YA 4KGLA 5BROA 3WNMA 5M17A 1GOIA 3KEHA 1E71M 3L4YA 4ML4A 3SUUA 1PS3A 4HOWA 1JF5A 1OGSA 4U5IA 3BCFA 4TXEA 4CN6A 3W27A 1KTCA 3BUIA 1NQ6A 3GXMA 3UESA 4XZWA 1C90A 2OWCA 4AZCB 3K8KA 5I6SA 3WY3A 4B16A 1DWHM 2RGLA 4UQCA 1PJ9A 4NX0A 3TP4A 5HXMA 4U3AA 5AC4A 1CGUA 2CBUA 4NXKA 2VQTA 2XPKA 1UKTA 2J4GA 1AVAA 3VDCA 1SMAA 3POCA 5D8ZA 2WCAA 3KL5A 4WJXA 1MFVA 1UKQA 1E73M 3NJ3A 3UR8A 3M7SA 1XCXA 3WH5A 3ZOAA 2X09A 5I0DA 2WZIA 2PC8A 1HXKA 4WKAA 2WK2A 3ARXA 1GQKA 4R27A 4PMZA 4D1IA 1KGUA 1GQIA 5KEZA 1HT6A 1QW9A 1QVBA 2VQUA 2VZVA 4ZFMA 1MFUA 1CZ1A 3RCNA 3HMCA 4PN2A 3LRMA 3VSTA 2QV4A 1RD6A 1JG9A 1H11A 1BVNP 5BXPA 5JBDA 1US2A 2BY0A 3MI6A 1G9HA 1HP5A 1JZ5A 2XM2A 5DEZA 3H54A 3LPOA 2F18A 4OIFA 1PIGA 3T0AA 4NZJA 3A4WA 4CD4A 1OBAA 1HL8A 2DDXA 1TQVA 2VO5A 3A4XA 2CERA 2BVTA 2J62A 1B3VA 3S6TA 1B3ZA 2ZXBA 1C92A 3L2LA 1H09A 1H1NA 3WBEA 2WKLA 3WF2A 2PB1A 1WE5A 2J7GA 3WFLA 4C7DA 3U7BA 4D6HA 3CZ8A 2V3GA 1UWTA 2WMFA 1SYTA 5A8NA 1E3XA 3EMCA 3LX9A 1VFFA 4AZBA 3WL0A 3VGFA 2XN0A 3AS3A 3SCQA 1W32A 4IPLA 2V38A 1EH9A 3VIFA 1SMDA 1RPKA 2VR5A 4JFSA 1WDSA 1FFQA 1H0GA 1VF8A 5A6SA 3BC9A 1MW2A 1BYBA 2VZTA 1LLOA 4GO8A 1UASA 1G5AA 2J74A 3T2QA 5CGTA 3N15A 4BS0A 2YLLA 2G3NA 3GZAA 5E09A 4UQ9A 1GQLA 2WMJA 2WC4A 5JIPA 3AIBA 4J7RA 1G01A 7TAAA 2FGZA 3VNYA 3K46A 3W24A 3SCPA 1QNPA 3OB8A 3VD7A 1W9PA 1EDGA 1CXEA 1UA3A 3ARYA 1CXIA 1PEZA 3WD2A 2VR4A 3W4RA 1QI2A 4LYQA 4CCCA 4W89A 1ISVA 1UH2A 3WDIA 3VIOA 3W53A 2WVVA 1XCWA 3BMVA 1D7FA 3ARSA 3VD4A 1UWIA 1NP2A 1GOOA 3KE0A 4AD2A 1B90A 4OKDA 3EDDA 4WF7A 4FNUA 2YIHA 3PTQA 3PZOA 1KWGA 2VZSA 1AMYA 2IUZA 2PWDA 2GFTA 3WD4A 3ZR6A 3GNPA 2DSKA 1HTYA 2XWDA 3MV01 2WHMA 4V28A 4J3XA 1BSIA 4JFUA 5A94A 1S46A 1UKSA 3BUDA 5ABHA 2XHYA 4BQ4A 2WSKA 1XSKA 1UD4A 4J28A 4FLRA 4TUFA 1DP0A 1C7SA 3AXIA 3BLKA 2YDSA 2DSZA 2CHOA 3CZLA 2X2YA 5IHRA 2OLHA 1MW0A 4XV0A 5F7UA 3D50A 2EPLX 1V02A 1VRXA 4QP0A 3CMGA 4LGXA 3B9DA 1J12A 4P7OA 4UOQA 2W4XA 4W88A 3VGGA 5BWFA 3PTKA 4AD3A 1BGAA 2WC7A 2VL4A 3W37A 1NWUA 3A23A 2ZX8A 1ISXA 2UWFA 2BY1A 3SCRA 2BHUA 4EANA 5DFAA 1J0JA 3PZMA 4Z2IA 3CHFA 4ACYA 2CBVA 3IAPA 1QI4A 4AZHA 1DWFM 4QDMA 2V5CA 3D52A 2AAAA 1NWSA 5HOSA 2CKSA 4MADA 3MU7A 4P8XA 1HNYA 3WFZA 1FH9A 3T2OA 2YLAA 3ZJ6A 3VOCA 4DUXA 2D0HA 4EKJA 1TCMA 1K9FA 4GPNA 4M80A 1UQYA 1W9XA 2DIEA 3BLBA 5CLTA 1KR1A 2WM0A 4AYSA 3J7HA 3KLLA 1C93A 2VVSA 1QPKA 4Q22A 4JHOA 4WSJA 4DO6A 3D4ZA 1GORA 5I23A 2EBNA 2O9RA 3OA5A 1BFNA 4AXNA 4F9DA 1JNEA 3VIHA 4CUCA 4M24A 1JDAA 4D71A 1GJWA 2J7EA 4WK9A 1J0KA 4P7QA 1EO5A 4D6FA 2O92A 3TONA 4UQAA 1UR1A 1GQJA 2YL6A 4C7GA 2IXVA 5A8OA 1CGYA 1ZJBA 3RDKA 3VD3A 2V3EA 1CXHA 2E9BA 5BRPA 2EPKX 5HPOA 3N04A 4AZGA 4PMUA 2BHYA 3RM8A 1W1VA 3KZSA 4GI6A 1J10A 2WHLA 3VD5A 2YBTA 2WLZA 2XFFA 3DYPA 3VDHA 1CGWA 3RIKA 1DWGM 3FHQA 2J8FA 1QNQA 4DM2A 2CKRA 2FH8A 3ZO9A 2WXDM 4LYRA 2BHZA 3VIKA 2X1IA 3A3HA 2EO7A 3W38A 2XVLA 1V6XA 3VGDA 3ARPA 1UG6A 4X0VA 1ZS2A 2DIJA 1FP8A 2CBJA 4D6GA 3ZT5A 4CGTA 2ZXDA 3AOFA 2EADA 1VFMA 1HJWA 3ZM8A 1UR9A 2V3FA 3AZSA 1SR0A 2YDRA 3AFBA 2NT0A 3GBEA 3GXIA 2FHCA 4RE4A 3IJ7A 1BGGA 5FL1A 1VFUA 3AYRA 4PMDA 5GNXA 2QPSA 5ABFA 4JAWA 2V5DA 4E8DA 3EJQA 3KL0A 2YBUA 1O7DC 1W9BM 1IT0A 4QLLA 1ISZA 3T09A 3QHMA 1ODZA 4D6IA 3MMWA 1KR0A 1X6NA 3M6DA 4P7RA 2GJRA 1E40A 2FDMA 4LQ1A 3B8SA 2XM1A 2XIIA 1TQWA 4AZ6A 3G6MA 3TOPA 3DYOA 5D9MA 3AMCA 1HL9A 1J18A 4IM4A 2G41A 3D51A 2D0FA 1GUVA 3TA9A 4AYGA 3W81A 3T0BA 3RO8A 7A3HA 4ATLA 2W5FA 5LA0A 3ARVA 4W93A 1H2JA 1M04A 1BYDA 3AXXA 4TTUA 2E4TA 1UD6A 2GJXB 4CCEA 1QWNA 4H8HA 4FNTA 4NRRA 3WNLA 4PMXA 4LXFA 5DMYA 3BAXA 3TTYA 4FLSA 2J7FA 5TD4A 3N11A 4P8VA 3VDBA 1BQCA 2O9PA 4HP5A 3SCUA 2Y5EA 4ZXOA 3FAWA 4CU6A 5BXSA 3AIVA 1BYCA 4HU0A 1OSEA 3WF3A 4PEEA 4GIAA 5BXRA 3CBWA 5ABGA 1TA3B 3W6MA 3VX0A 1CYGA 2BY2A 1FH7A 3U7VA 1PX8A 1PAMA 3GH4A 3BSHA 3ZT6A 2WYSA 2XGBA 3WY4A 3BUPA 2VCAA 1WDQA 3PZ9A 3HZ3A 2EPNA 2DT1A 4AWEA 1GHSA 5E6YA 2VNCA 3BVXA 1J0IA 3DHPA 5JIWA 4CN1A 2BY3A 2OYKA 1V6WA 1GPFA 4BCEA 1OGGA 5FOOA 3II1A 3AIEA 3EMZA 1CTNA 1VEOA 4HOZA 4PTVA 1CDGA 2G4FA 4CVWA 2YDQA 2EEXA 1Q6DA 1BLIA 3WMCA 4UQDA 4M8UA 1JI2A 1H5VA 6A3HA 1AQHA 1HJXA 3WY1A 2GDUA 1H49A 5ABFB 3WDJA 3VDAA 2PWFA 2OSWA 1UWUA 5A3HA 2WB5A 2ZUWA 3IJ9A 4QCFA 1XSJA 2YL5A 3QR3A 2G3IA 4EAMA 1TFVA 1JZ6A 2J79A 4U2ZA 1XV8A 2Q8XA 3N1AA 2ZX9A 3A24A 3VTRA 5HNNA 3VM7A 4J3UA 2J25A 4J3SA 1ECEA 1FP9A 2XG9A 2ZUUA 5I24A 1CBGA 3TTOA 1KXVA 1K9DA 1JD7A 2OSYA 2G8ZA 3HG2A 1FHLA 2IGTA 2XN1A 1WDRA 1IZJA 1E6QM 3BUQA 1I1XA 1ISWA 1Q4NX 1ZB5A 1H3GA 2ZICA 3CC1A 3WDRA 1DEDA 4AD0A 3IANA 3KLKA 5E9AA 1DWAM 3PZNA 1E6XM 4P7LA 1KXQA 3U5UA 4JL2A 4MB4A 4FF5A 3N9KA 1CGTA 2Y8VA 4ZE4A 4HA4A 1WO2A 2BXZA 2PI6A 1XYFA 4WIWA 3AROA 2DT2A 4BQ2A 5E70A 3CO4A 4OJYA 1B3YA 3RMEA 2W63A 3ECQA 4OOUA 4AD1A 1RP8A 2CEQA 3DYMA 3NDZA 4CCDA 4QFUA 1LJYA 2X0HA 5I3DA 1FHDA 5EFDA 4FNRA 3FHAA 4ZXLA 1O6IA 1ZJAA 2FYVA 4MB5A 2VC9A 3WNPA 3N18A 4CN4A 3DX4A 2EPMX 1QNRA 1KTBA 3K1DA 5I77A 1BG9A 4P8UA 2DEPA
chains in the Genus database with same CATH superfamily
1LO2H 3IB4A 1SFDA 1ZXQA 2Z91A 4XCCH 2Z92A 2BSTB 2APVA 3L4VA 4F8TA 2QUTA 3IDGB 4F7CA 3Q6GL 3LENA 5KVDL 2HLAB 5ADPH 4FG6D 2XH2A 4IIEA 3BUYB 3ML8A 1DXEA 4W7UA 1FZJB 1V55B 3FJTA 3R0MA 1D9KC 4TV3A 3OZMA 4HA0A 4IT1A 1K4DB 4XG1A 1PV8A 5E1AB 1BCIA 5C0JB 5T33H 2VLRA 5H91A 2DQIH 4PJAB 3WF4A 1J8HE 1PKQA 1KG0B 1ZNNA 4P57B 1CWYA 35C8L 4G7FA 4JKLA 4Z1BA 4EZLA 4JDBA 1F2XK 1IE7C 4XPHL 1RPXA 2VQ1A 3C6LC 3SB3A 2O1AA 4LSUL 1XB8A 5LQBH 4FABH 4YQXH 3CZGA 4AENA 3KOFA 2E3ZA 1AMXA 3FCSB 4XVJH 3BKJH 2VN5A 5B38A 3KBWA 5IUSA 1ICQA 4A8LA 2DF3A 1XSIA 4JFYA 4TNEA 2AGKA 2X4OB 4NO2A 3V36A 5F2IA 1NGZA 3MBXL 1X6LA 1TEYA 4IJ3C 2JLPA 4BA0A 5C2CA 1WCQA 3QJHB 4Q4EA 3RX4A 4MA1C 5F3HB 1XWYA 4FQIL 2PPFA 3RWFA 2HRPH 4YDMA 4CVXA 5CJXA 2MOGA 4NFBA 1R7OA 4KPLA 5KINA 4BJHA 3UZWA 2QQNH 3PANA 2EGZA 5C0DA 3W29A 3BGMB 1YEEH 2LE9A 3QFDB 3WH9A 1LNUB 2OZ4L 2PYFB 4UMSA 3VFRA 1GYLA 4JDYA 1E0XA 3SB0A 1B2WL 4RK8A 1IGML 1TKKA 3H7RA 3MV7D 3H55A 1WBHA 4XTDA 5A3HA 4PGDA 4Y96A 5FO7A 2DORA 4U6HA 4CJ0A 1KM5A 1KM1A 4P9HL 4XN5A 1ITBB 1CB4A 5IW3A 3ZKXC 3B9KB 5F7WC 4KO5A 1ZP3A 4RE0A 4A63A 2XT1B 1Z9NA 3HG3A 1AGEB 3TC9A 1DSFL 5IFAL 3RIFK 1MQQA 2QUVA 2FPVA 3BQUC 2XGZA 1NCGA 2CHXA 4R83A 2XACC 3CDZA 3G1VA 2MHAB 2DI8A 2GSJA 2NQCA 2B31A 3E3QC 4IUOA 1KBBA 4UM9B 1XRTA 2OOFA 3SRFA 3TH6A 3KCWA 5FO2A 1R2TA 4MFEA 4JO3H 3F7JA 6PCYA 4YK4C 3CLFH 2WLKA 3B5HA 5ID0A 4PD4K 3MXWL 2GZXA 3DV6B 2ON3A 3AIQA 3D3AA 3L5AA 1PBGA 4IQJA 3MBWA 4NO5A 5EU6D 4AQAB 2BNQB 2CCRA 2EIBA 5C1MB 2GIXA 2UZXA 3Q01A 3SE3C 4UFLA 1A7BA 1JPMA 1WUZA 1JZHA 3OMAB 4OBRA 1RZIB 1Y6KR 2PABA 3PJXA 4KHXH 1DQIA 2X88A 1C5DB 1UWEH 1RJLB 3QW9A 5I6KA 5C0AB 2D22A 1EO8H 1HEHC 1T6BX 1BRLB 3RBGA 5HHPB 4NHCH 4P2QE 2CA4A 3CZEA 2QSVA 1IBZA 4NKQB 3ZKXB 2MCPH 3MCMA 2RALA 3K81A 1PS9A 5D9SA 4PJGE 5EZOH 1I8JA 1L5GA 2CYGA 4PMRA 1SOQA 2X6VA 4LLYA 1E6RA 1Q66A 2HRWA 4AEIH 5JQ6L 2H4EA 3HUJB 4R5XA 1FWAC 2IFGA 2BNQD 3U83A 2POTA 4GZIA 4QO1B 4XMPL 4YSUA 1KV5A 3FT1A 4TPRH 4BF9A 2DJXA 4MYXA 2XJ7A 2WBJC 3U2JA 2FH6A 1T89A 5A1AA 1FFNA 1W8EA 2JALA 2XZQL 3RWCA 3RCYA 3LQAL 2ALWA 1ETZA 1PYWB 2BCKB 2YC1A 5D1XA 1G4MA 3HG1A 4OZ4A 4POZC 3RZCC 1JQXA 5FF7A 5IJVA 2C1OA 4OCRH 5FUZH 3CN4A 5G5DA 4GG6B 2R1WA 1CI3M 4R4BA 3KZ8A 1VJIA 5EEXA 2V2HA 2CIPA 4XPTH 3W57A 1E2VA 2FZ9A 1Q0XL 1T3FA 3FSVA 1XGZA 4S0TD 5DRWB 4MTVA 3GNDA 4JO4L 4DJED 4EP8C 4J8QA 3ES6B 3DFYA 4OFQA 4ODTH 4GXPA 4JPIA 5EPDA 7TIMA 1E27A 3KBPA 2GSEA 1S7UA 4NENB 1E6OL 1TELA 4FQQA 4TLUA 2ONEA 1TEFA 3L3JB 4RDZA 3OZ9H 4UU9B 1KLGB 1YA5A 3AWFA 1OF0A 1ZPTA 1E4XL 2R2EA 3OLEA 1NAKL 3MLUL 1NJ9B 1DVUA 1NFIA 4WOZA 1JPTH 5HPCA 4GVIA 3O9NA 3ZZSA 2YCKX 4N2LA 5IT2L 1EO8L 1IEHA 3NIDE 1D9KB 5HDLA 3KP0A 1QWKA 2DYSB 2D4FA 1ZLSL 3HMXH 3VXME 3C5QA 1TPH1 3HBZA 5CLZA 5FEXA 1Z7AA 2VE6A 3G3MA 3HJ0A 1XGTB 2BRQA 2E59A 4OZHE 2FL5B 1TNMA 4W86A 1G6RB 2Y1YA 2X4QA 1EHXA 5D05A 5AENA 5A6AA 4GACA 1WZMA 4M29A 5B3JF 1HSBA 3HE6D 5ICXB 3OKOA 1S2VA 4Z2HA 3GGWA 3C2AL 3UJJH 5LB1A 4RZBA 5JO5A 2E5DA 4O10A 2QADB 3RRAA 3G04B 2AJUH 2EYRB 2KZWA 2NNCA 3VYOA 4IJCA 3HMJG 3WL9A 4X8JB 2DSWA 2VIRA 4XZIA 2UZYB 1G7PB 1QUMA 2JMRA 3ORJA 3GXTA 2WBKA 3PN8A 2EG7A 4H6RA 3TNOA 2EG6A 1SZRA 3NURA 2XBZA 1PG7W 3INUH 4NKIH 5CIPB 4F91B 3ZLHA 3SN6N 3C8HA 2NXIA 1KLGA 5LHDA 4NKDB 3WE6A 1W2VA 4JZ5A 1PB0A 2ATPB 2GQ9A 3D6GA 4FOKA 4FYQA 4OOZA 3LKQA 3IVTA 3T55A 2GSMB 2CO6B 1A3XA 3QWOA 1FO0A 3VYLA 1ROWA 1NANI 1GG0A 1H51A 4O11A 2E68A 1VHNA 4APQA 3UERA 3LD8C 4ZO7A 1MJ7H 2XFXA 2VLJA 1NFDB 4UQBA 1T7LA 1A1NA 4N5ED 2XWEA 2QADD 2OMUA 4PJ5B 3JWOC 2W81C 4F33A 5CGMA 3DUUB 1NBYA 3QEUB 4WI8A 1E6OH 1EC7A 1RD5A 1YUHB 4QCIB 1LQ0A 3U0WH 1SJAA 2W61A 2HVJB 3N2CA 4LWWA 4HK0A 3WXWH 1RUSA 2PAJA 3BP7B 4GJTB 3V5HB 3WLTA 5KAQF 2Z28A 3JUZA 3UO1L 1J8RA 3EBVA 1V8HA 1VPYA 1AL8A 2MCG1 2Z34A 4JFFA 4WNJA 5HYFA 3S4TA 3NDZE 5F7AA 1KCZA 4Y4HD 1YRRA 4OGXH 5ICUA 3VVWA 2EDOA 1QBAA 3MRKB 4A66A 5IFHL 2NVDA 4FFWD 2F6UA 4IJRA 4WI0A 3IWPA 3ITYA 1RZFH 2J7CA 5D55A 3P0WA 1U33A 3HEIB 5H6HA 2XKNB 2WINB 3BAIA 4OD3L 4GY4A 3SBRA 3DMMC 4OLVL 2VUOA 3NTYA 2PE4A 5KSAC 5DMGD 3S3PA 3TWCL 3SN0A 1W6LA 5E99L 3V4BA 1ZK5A 3ZDZB 1R3LA 1KLFA 1RHHA 4AVIA 1MUJA 3OBKA 4AIZA 2CZ5A 4HIEB 1N12A 5FGCB 1P84K 2FATL 5T1LD 2F1AA 5E2VH 4R7OA 4XP1L 3SDDA 2NY4C 4N5UA 4U6YB 1XQKA 5A5WA 1ICSA 4KFMA 1S6NA 5AD0B 3LQMA 1TPEA 1I8MB 1SXBA 3GMOA 4GUPB 3PY2A 4GA8A 4GY0A 4A8RA 4BEQA 2DMGA 3Q37A 3D25A 4FB7A 3GFUA 3PABA 4FFVC 5JHDB 4HXAL 1RZJC 2FIKA 4LVNB 3WUWG 1HF6A 1RA5A 2R69A 2XA8H 2Q3RA 3O3AB 4BWLA 3MV7A 2H47C 4EPSA 4NQEA 3EGSA 5IBTL 4MZ2A 1PD6A 4XWGH 5KVEH 1HN1A 1PX3A 2DN7A 3H56A 4AM0Q 3BH4A 3FO9B 2QHRH 4KNUA 2PR4L 1JYVA 3IV3A 1UBSA 2HS8A 5AVXB 3PUUA 5AZ2L 3OGRA 2VLME 3V0FA 2YR3A 3ARBB 4JY8A 1KW1A 4KIRA 3SDXB 1BLNB 1NSNH 1OIMA 1SVDA 3PZQA 4WHDA 3NL5A 4XBGB 1YN7B 1GKRA 1YMMB 3HCVB 1UJ3C 5IBXC 3L1OH 3ZTJG 1E6NA 4GUIA 5DHVH 5I17B 4NJIA 3BW2A 2IQAB 5HDRA 1LP9F 4MJIE 3H9YA 4GO6B 4N20A 2V9QA 4JN2B 3WNJA 4ZENA 4GLRI 1R4XA 4EN3C 1LQBC 2B1AH 2GVJA 3L9YA 2WBJD 1O5RA 1XPGA 3HQOA 4S0HA 4Q7DA 5GISL 3KYNA 1RPUA 1R3HB 2FJGB 1TZIA 3FSOA 4EOWL 5C71A 3UR7A 2Z8SA 4YE4H 1JXKA 1ZLWH 3TBWB 4MY9A 4NX5A 2I7SA 4HUVB 4HMNA 3C6LA 3ARFD 3VCLB 4IM8A 4YFEA 1YMME 4P2OB 1JGDB 5FYLL 3KEDA 4MTMA 3IPBA 4O1AA 1Q94B 1FA2A 4WSKA 4QXWA 4FXJA 2ITDB 4YVVA 2ISFA 1HVQA 1M7PA 4AK2A 1BAWA 4CILA 3KDMA 4E42A 4GIYA 5DSCA 3GMLA 3QV6A 4BM7A 1AHWC 2R29A 2PZ0A 2DT0A 1LROA 5C6TH 3NFSH 4GEIA 3RR4A 3ZE0E 5TDOA 2HT2C 2D20A 2YQ2A 2AVGA 4M56A 2DZSA 1UR3M 3ES8A 2OMVB 4QEEA 4WU7A 3K6DA 4YBQC 3IJYA 4S2SA 5G4HC 3DHUA 4QHMA 5IMKA 3FGCB 4GMSL 2JE8A 4RLDA 5AVNA 2YWYA 4OQTA 1KBIA 1TSRA 3QXVA 4KRUA 4NLAA 4LIQL 3AGWA 2X6UA 4HPXA 2IGFL 5DZAA 5FDWA 4GMTH 1XH1A 1IXOA 3GLEA 4G8AC 1H60A 1QFWH 3Q1EA 4P57A 4X5WB 1JOIA 4DEPB 2ATSA 1BQGA 3N9RA 4L05A 3HI1A 2APXA 1OY0A 5ICYB 2F2HA 5REQA 1T1WA 5TF1L 2W3ZA 3WHXA 4Z7UB 2JK5B 5MEQA 5IB3A 4HZ8A 2BP0B 5F4WA 5A6JA 3AMDA 1Z48A 2VUNA 4CU8A 4I2XB 5ABDE 2VXUL 4PBEA 2UY2A 2HMIC 4JHBA 1FYHB 3AG1B 5CQ1A 4Z1CA 3GD6A 5ECUA 4LVOB 3HURA 4XNQA 3UYRL 3K74B 3UGXA 3VGBA 5JHMA 4X6DF 1YNQA 1CR9H 3FJLA 4HPGA 3TA3D 1MFAH 1UVQA 1PKOA 4LYKA 4C7FA 1FKXA 2V9UA 4I9XA 1WDDA 3ARBC 2QGDA 3HZVB 3DSFL 43CAB 3GZPA 4US5A 2NY7L 1LLWA 1H8NA 5KS9A 1EHLL 5IB2B 4L1GA 1M6OA 4Z7UE 1KV3A 1TZ9A 1JBJA 3MJ7A 1E4HA 4G8TA 3TBVB 4RMQA 3I6SA 2QF8A 5HYSA 5HY9A 3H9SE 1ZHLA 2AK1H 2EABA 5JUEH 3R5EA 3GPEA 5DEJA 3KTXA 1ANUA 1W0WB 1SO5A 3F1QA 4L37A 5BWAA 4IWWA 1HCZA 4PB0L 3N40F 4DRSA 5EYWA 2EEFA 5TE7H 3C3NA 3WE1A 1NOAA 3P3TA 4IFRA 1A21A 1IGCL 4TSBL 1EJUC 1MQRA 1RZJH 4Z76B 5CCZA 4U3CA 5A2FA 3P0GB 4YZWA 4TMPA 2JI2A 3LAFA 2HJLA 3FV9A 2GTZA 4F1ZA 1PFCA 1AD0B 3BKCL 5ESQA 5CFHA 3GQFA 1SO4A 3KFTA 1K4HA 4LALA 5A8PA 2GVLA 4JO3L 5CGBA 4HIBA 4MJID 5FAAA 1TVNA 1ZALA 2IH1B 4UTTC 2QCDA 3NCJL 1XL6A 2WM1A 3EWXA 3GVWA 4XK2A 2HLFD 1IEVA 3KD4A 2J7LA 1XIBA 1JPHA 2BNQE 1CD8A 4AGPA 4ONGL 3QCTL 3LTSA 25C8H 3W1XA 4K5OA 2QHAA 5EU3A 5GZND 2F7FA 1UGNA 5KOVC 3ZPDA 4B9ZA 4PRNB 1ZJIA 4MNHB 3QRGL 1WKFA 3MUAA 2H26A 3WI9A 5LXEA 4FK9A 4E2OA 2BWIA 3U46B 1WBYA 3EXLA 1I8KA 1KBWA 3MZNA 1AQMA 5GGVY 5DUBB 5GS0C 1Z0NA 2XHNA 4MGXA 4PJEA 1OW0C 4JQIL 4OKVB 1GIGL 4U3HA 3VWJC 3TYBA 2J43A 3VKCA 4EXQA 3UTTB 4RNFA 3AUWB 3MLZL 1OINA 3CAKA 2G3ZA 2P4AB 2WKGA 1FGNL 2WW8A 4L9LC 4LBUA 4WKFA 3WUZA 3ITTA 2Z9TA 3HUJE 4YBHA 3FYOA 2I5YH 4HU3A 5EU7C 4ZPTA 4CNIB 4PTUB 3VWKC 2E27L 4CC0A 1HCVA 1DLHA 1IU1A 1NBVL 1HFUA 3PGFH 5JYLA 4M7KL 5B7FA 4AWUA 4OKVA 1KM6A 1UWFA 2HXUA 1KGXA 2DKMA 4E68A 4JTTA 3TDFA 4GXWA 1SY6H 4WKXA 1MIEL 5I66A 4JIQA 2B5IC 2JJUA 2X9WA 4YO0A 3O6YX 4UC5A 2COQA 5HHOE 4GP4B 4XO6A 3S0PA 5D7KE 2N56A 1JZ3A 1P5UB 1IGFL 3ORWA 4XPTL 1CICB 4MQ7A 4WWKD 5HMSA 5HJXA 2NY3D 3ARWA 4O2CA 3CPLB 2CRMA 5C0BA 1A9EA 3DUSB 5LDSA 1FAIH 2WZ6A 3DWTA 1TQBB 2W9MA 4IU2B 3WUGA 4ELKA 3M1OA 2RDWA 3AZTA 3QYQA 3QDMD 1A5MC 5FESA 1C5BL 1FUNA 3GYCA 2X44D 4D0CB 5EUOB 2K3TA 1XEDA 3AWNA 1EIBA 3DU0A 2OR9H 5AYXA 4A3RA 2TYSA 1C1EH 4PI0A 1UM4L 3RG1C 3UIZA 1E5YA 3KPNA 4TL4A 5KVGE 1WKYA 4R5TA 3WDHA 4AIOA 4LW7A 4PMQA 3UETA 5B80A 3VXPB 1KO0A 4DPBX 3CFUA 3N2TA 4E41E 5J3HC 2BNQA 5C07A 1WTGT 2F38A 4IU3B 3RIAK 4XVSL 3QMTA 1U8NB 5EUKA 3RIAF 2DQFA 1IGWA 4R90L 4WFEE 4JTHA 4POYA 5A8GA 1RZIA 4JHWH 5CPQA 3PG8A 1GYUA 3SJVB 5IVOA 4MUPA 4YWGL 4Z7UF 4ADJA 3UU0A 3LB6D 1EPFA 1A53A 4YNGA 2NZ1A 5HI5C 1D9KA 3WTUA 1C5CL 3GBMH 3KXFD 5E8EA 4HBCH 3SQLA 1DJIA 1PTDA 5AEAA 1E51A 3U7WL 4IFKA 1YXDA 2QTEA 1QUPA 2PXYA 4KZDH 1NSJA 2ZWNA 2JF6A 4ZFCA 3ATBA 2DZWA 4DXXA 3TU9A 4M8QA 3HO8A 3HC4L 1GGBH 6FABH 1B31A 4O2CB 1QHZA 3B4UA 3I65A 5K7JA 3L2NA 3IRSA 2E46A 4HJSA 4OJDH 1N5AB 1BIIA 2VDOL 3EJZC 3SQRA 2IS7A 5KZCD 3TC3A 3GNRA 4IRZA 5FWRA 4KKZA 3QTGA 4OZFA 4B0MB 4FXLA 4LBEB 4ZTPL 2BNRD 3PRZA 3E6HB 5K1NA 1REQA 2EDBA 3SJVD 4NNYA 4TU1A 3QEQD 3PWPE 5CBBA 3ETSA 4PBGA 3G1YA 1IXPA 3TEXA 3BW9B 2VWSA 4O19A 4C5YA 4OLWL 4ZXBB 2WZAA 1GZHC 1GW0A 2C1OB 2W0LA 4N0FB 4XZ4A 4HZ6A 2SODB 3PWNA 4DBEA 4E4UA 1Q9KA 3AY4C 1Z7JA 5F7BA 3W2DL 2TSYA 4JZJA 2ESVB 3LH9A 4U1NA 2XWBB 1RIHH 2OMYA 1TVPA 4F7KA 5I16A 4H6KA 1GGTA 4NNCA 4LT7A 1EP3A 3B5TA 3LZOA 4MF4A 3CXOA 3CL8A 1NPNA 3NFNA 1ONQB 5LLIC 2QKIC 1A1NB 2LU3A 3QZ6A 3WLPA 4C90A 2WVSA 3TFKC 2BH0A 5H8MA 5DMKA 1F02I 2OMNA 3ELAT 1LWRA 3BAEH 4J3OH 3EGDA 1RV6X 4MMXB 4FYTA 4HUWB 5HJ3A 4XSLA 1NH6A 5L4IA 3FN9A 3DTDA 1DBBL 4ZXBD 1VCVA 4J4KA 3WQFA 1IKOP 3CZKA 4JRXB 4M5YH 5AZ1A 3WEXA 2J1XA 4JGJA 4N1HB 1PAZA 4NN7C 2QJGA 2A73A 2OR8A 4ZOBA 5TGBB 3KPPB 5G1MA 4NP4H 3RWHB 4R3SA 2CHZA 4JTAA 1SUJA 1HKWA 1TTAA 2CFFA 2ERJB 4OLUH 5HD8C 4GQBA 4R97B 1Q6QA 5D2LA 4S3CA 2QVIA 3I3BA 3WMBA 3PWNB 3IRCA 4NKMB 1AJ7L 3IF1B 4JLRA 4UTBL 4GKNA 3S37L 4DN3H 1ZTVA 1IGTA 2J8OA 3P11H 5FW6A 5HDWA 3S98A 2QZRA 4IMFA 3VIIA 1LLAA 4YGVA 3L5LA 3QPKA 2XTKA 3L1EA 3M9YA 1KNOA 2P28B 3F7LA 1X1NA 1MHPH 1AZNA 4JPWH 2Y1ZA 4YSAA 3O05A 3WS6A 1S9KC 1FWBC 4RNHA 4UZUA 3H2WA 1MCEA 3SO5A 2QUNA 4GVGA 1BMZA 4TF4A 4MX7B 4IBQA 3STPA 1NL0L 1W2KT 3MJ8A 1HOCA 4PHXA 1J4EA 1F4AA 3XIMA 4LDEB 2G3FA 5DT1L 2NVAA 1SDYA 1OFOA 3DK0A 4D8PB 1O75A 3CZNA 4DPCX 1MCNA 5DBUA 1Q85A 3VG9B 3F05A 3FHEA 2DI9A 3F5WA 3P0VH 3PPSA 4NYLA 2G0WA 3DIPA 3SPVB 4LRSA 2X2JA 1DQQA 3FMGH 1J5SA 5M3WA 3DTXB 1KCVH 1UVQB 2K9UA 3EYUL 2I85A 5DEGA 5LXXA 1NZRA 1KTKE 2DYRB 3PULA 4A7TA 4PV9B 3P3BA 3REWA 2RTTA 1NCCL 1VADA 4RISH 2F5BH 3K5RA 1YDYA 1UJTA 2W94A 3JVGC 4YDJB 5DRNB 4BQ9A 1B4RA 1FWSA 4BI5A 2R69L 3AS1A 3GQYA 1XGPA 2HKHH 3ARDD 2OWXA 5AZ0A 4RGMC 3GKAA 3LMJL 4YHKL 4LK4A 3WY2A 3NO3A 2DQWA 3G04A 2LU4A 4IOSD 1RY7B 3OKDA 3BUTA 4K07A 2DL2A 2FEJA 2HP4A 1P4LA 2DYPA 2IH9A 3RFZC 3D0AA 1NDGA 2HKAA 4YGAB 4ZOEA 1T5XB 3RX5A 3VG9C 4Q7IA 1WP6A 4BKSC 3W7DA 3NEHA 4LCWB 4OUIA 4YMZA 1POJA 3BVUA 1M7IA 1EIXA 1AMKA 2F54E 3EWBX 3T4YA 3P60A 1W1YA 3EOEA 4KTDH 5MHBA 3T2NH 1HVXA 3E6FB 4AV4A 2HNHA 4ZMPA 3OJ2C 1LP9A 5AZUA 3BDYL 1KQYA 3GMLB 4JPWL 4NJAL 5DRXA 4PRPA 1F3DJ 5DD0H 1KYUA 2VDLL 2P8MB 3TVMD 2BINA 4M1DH 4OFYA 1E8YA 3U5YA 2EIEA 4GX8A 2X4TB 4I9JA 4HKXA 4LASL 3B2UC 2PP9A 4KDWA 4GAFB 3KHJA 4GI8A 1U3ZA 5BS0B 5IR1B 1H7OA 4LY4A 2L5HA 4PRWA 1ICPA 3SSZA 4MRCA 2QZ5A 2Y61A 2VLKA 1T3FB 5DRWA 2D8KA 2PW1B 3VIJA 1I8UA 3KCPB 3GTTA 4A38A 1U1UA 4GYJA 1BFVL 1XBYA 4YXGA 3NIFE 2JCCA 2RFGA 2A6JA 3LVTA 1V54B 4WHCA 3T8XB 1F05A 2C13A 4M3JA 5AZEH 4C47A 4RA3A 4Y2DD 2YCJA 1KLYA 1EA9C 1NDMB 3EBGA 1MLCB 3L7EB 4A6YH 4BH8A 1G87A 1TRIA 3DIDA 1IT7A 1N7ML 3IMVA 4OQTL 4QRQB 5IQ9A 3WIIL 4L4TE 3UC0H 5I5RA 5DMGC 4MPKA 1HH6B 3FUFA 4WV1A 1AGEA 4XNQB 3AQUA 5I3HA 1P1VA 2JNZA 4YDKL 5CWSB 4DKAA 3LEYL 3GB6A 1QEWB 5FGRA 3IJSB 4BZ1A 4GBXC 5CKAA 4F66A 1L3NA 4BF7A 2DY3A 2CHNA 5IMMB 1RK0B 4MDOA 4NQCE 2BVPA 4ZFZA 5D6DA 4QDGA 1BVZA 5CP7B 1R24A 1ZVYA 2E8ZA 2OTWA 3GJFB 3LKOA 4I0CC 3WK1A 3QUZD 1EA0A 4JZOA 1WIOA 2C3VB 3CXDL 2DV6A 1AGCB 5IVXE 3H2CA 4NZCA 5K3VA 1S9YA 1XGRB 2EXOA 2QPEB 4GG6F 1IC5H 4CVZA 4ZMAT 1IAOB 3ULVC 3W7CA 4LSTL 1IT9H 2Y63A 4W9LC 4CBPA 1YJDC 1GEQA 3K5XA 3PG2A 5TNVA 3TT3L 1JPGB 3CLEH 4ECNA 4EIUA 4C59B 3D39E 3BZ4B 1AXSA 1Z5LA 4PGJA 1Q7QA 4XN4A 3VXSA 1BEUA 2ZF8A 4PMOA 1KPVB 3NJXA 1F3DH 2ZUXA 4N87A 2FGBA 4Y5VA 3MI2A 5AYYA 3VRIA 4WDUA 2X4RA 1T7VA 4M6NL 5FYKL 3IU4L 5INDB 1MLCA 1RU9L 3L7EA 4PGEA 3NJNA 1AW5A 4G42B 4AVJA 1G7HA 3HAEB 4KDTC 3T0EC 1QK2A 2Z27A 2IH1A 3V9EA 3VKJA 4QQUA 2LQRA 4FMVA 4MB1A 5IWLC 1E6ZA 3DGBA 4DK5A 5F9JB 3GU1A 3SUVA 3WLIA 4DN4H 2H2PC 5IVNA 4HV8A 1ZHAA 2V7NB 3CVIH 3LRLA 4HYTB 4IBTA 1XLCA 2G5WA 1GZQA 2F7QA 4D6CA 3DX7B 2Y72A 3H2NA 5E23A 1IKFH 3U9PL 2ZX6A 4YPJA 1OW0A 3VWJA 2C3ZA 2G5BA 4HJ0D 4KUCD 5IFJA 2ZZ4A 4HIXH 1GGYA 3GIYA 1SN5A 4DZAA 3EKGA 1FCGA 2F7RA 1TVBB 4KF1A 2TAAA 4U2YA 3RNDA 5CWSA 2J12B 3H6AA 4KAQH 4K3EH 3PVFA 5C0IA 3DX2A 1TUXA 4Q9CA 2A3EA 2X4SB 5EU5B 3BPCB 5AVQB 2ZRXA 4MWAC 4U6VL 2VFFA 5AYIA 3F7RA 1H5BC 3QC3A 3CUGA 1OAUH 2V5TA 2JIXD 4FLOA 4OF7A 1OGTB 5JOEA 5I1JL 4JXCA 1X5HA 1PDZA 4XP9H 6TIMA 3MR9A 4QHLA 4TQEL 3KBJA 2AK4E 1VGEH 1FH5L 2DJUA 2BNJA 3S8HA 2AQ1A 1IGFH 3LYRA 4GYBA 3AYTA 2WWNA 4JX4A 1HIZA 3KYAA 5DLMH 1I6NA 3AYVA 2W9EL 4KO6A 4DKEL 4XH2B 5KSVB 3B9KD 2UY4A 3HV9A 3LHVA 4RL3A 1VEPA 3ZVHA 2CKNA 4IIBA 2LV4A 2XVBA 3BMWA 1F5ZA 2VX7A 3QOMA 3KH3A 3S2NA 1UUNA 3DV6A 3VSVA 1NCNA 3U6RA 2PCXA 5A7BA 2EXSA 5FDYA 3RDTD 1EUAA 3T0TA 4D1JA 3F12B 5IHSA 3FOLB 3KGRA 3OPZL 3TS8A 4MRBA 3TN0A 5I7GA 2QPFA 3M45A 1KFCA 3OODA 3W00A 3SIMA 3OP2A 4ZO9A 1YSOA 3NJGA 1MREL 3C6SB 4L4VA 4K6AA 3WIJA 5AHIA 2Y5TA 2GUOB 5L4FA 4URIA 1B3WA 3PC0A 2CK0L 3M0ZA 3BL3A 5GGSB 2ACUA 3NQGA 4HIXL 4PR5A 5I6NA 2CKBL 1IIIA 2O4EA 5JXED 1L9WA 1TJMA 4NAEB 1NLDH 3DERA 4L56A 3O2DH 4D6EA 5IEHB 2Y8UA 3RDTB 5F0PB 1KPUB 2G2RA 2X12A 3K2MC 1KTDB 1O5PA 4NZRH 1UA6L 1I7RA 1I9JL 4V2CB 4MSWA 1D3GA 3O2VH 2I16A 4Y9EA 2YEQA 2OWWA 1MFBH 1N4XH 3PUCA 3QZLA 3QZAA 2QCFA 1F3JB 3U36B 2YKKA 1EJTC 3IJ6A 4M6VA 4QQ3A 3KYNB 3WNOA 2WZMA 3TLQA 4I3SL 1ZVHA 1RZGB 2BP8B 3FRUA 5KJ4A 4QOKA 3LMYA 3VKKA 4M02A 5D1ZC 4DYEA 4ERAA 1L7IL 1MH5A 3OD3A 1XYBA 1YNPA 4KFNA 5KZEA 3IJQA 1ITCA 1UZ8B 4MCNA 4JR5A 5IJCC 3WLBA 1L9RA 3TXAA 3GSMA 1I60A 5BVPL 5FD0A 2AKRA 4RZ5A 1MZYA 4GW4B 5FUCE 3KAOA 3M5VA 4RXGA 3W2DH 4RZCA 3JWOL 1ZIAA 2PDFA 1V0KA 2X1OA 2VKZG 5E4IA 4A2EA 1FNGB 1D7CA 3O2WL 2ZZ6A 4QG8A 3C6SA 2NYYC 1M7XA 1PUDA 1UKOA 1X5FA 2ZJSL 3CVHA 4Q6KA 3UFIA 4J3ZA 5BPPA 3S37X 4LP8A 1I9CB 2GGIA 1TTJA 1E1FA 3NYKA 1CGXA 3OBAA 1Z42A 3OOQA 2YPLE 3WO8A 5B4MD 2Y7LA 5CG7A 3F12A 3INUL 2MNRA 3CL7A 4U31A 1T0NB 5I1EL 1KEGH 1TJ2A 1DQDL 2BOCB 3B9VA 4FNQA 3WUWA 1R0AH 4DP2X 4I0PA 1ONQA 3L3OC 3B2VH 4D9PA 1OTTC 5DBTA 3RGVC 4JKMA 2VE6B 3R0NA 1E0VA 1SJEA 4TL5A 3GG8A 3STLB 1CIDA 3A12A 5LIKX 1JIBA 4FQPA 4IGBD 5JW4M 3L3OA 2DEYX 2AXGA 1UG9A 4AYDC 1V3IA 2D24A 3LV5A 3CSPA 1DEEA 4JIRA 3WEXB 1H7NA 1R85A 4PS3A 1CTMA 1MUJB 1O7VA 5JIKA 4EI6B 1P1XA 1Q63A 1KJMB 1F6YA 1GOWA 2CZDA 2VP8A 2ZVRA 4F27A 1YNTB 4KRTA 3I6EA 2WXRA 1U92B 2WXNA 5BMFH 3SCOA 1ITQA 5D2WA 2PTUA 4LGPB 2ZCKH 3EDEA 2O30A 3QQ4A 3T2LA 1RULL 3US1A 3FRUB 1DORA 3TMLA 1BIHA 4GHRA 3MUJA 3E0GA 2OM5A 3DO3A 4PRRA 2F15A 1WAAA 4YSTA 1HE8A 3QQDB 1GNXA 3PXLA 4FO4A 3CSYB 1M53A 3WTSA 3OHXB 4ODVH 2UWEB 2RAGA 5CILH 5A8QA 1T99A 1FYTA 5HGBA 3MRRB 3H42H 4KUZL 2DBLL 3O2LA 3LZ5A 2A3TA 3QS2A 4N4YB 5CEYB 3EOUA 1TTRA 4AG4H 5FHBH 4KVCH 2CR0A 3W25A 4WSGA 4HNUA 4MVBC 4FG2A 2ADGB 3CSTA 2YARA 1VC4A 2O9OA 4WWOA 2DVUA 4P2QB 4RQQB 4ZSUA 1J1XH 5I71B 1OPGH 3VRLF 4EN3B 2VR9A 3OKEA 4UMBA 2IDSA 5D7IA 5AC5A 1UR4A 1KBGL 3UPWA 4N2KA 4JN1H 1RJRA 4AITA 3BKYH 2Z35B 4ZW5A 1UWYA 4NYUA 2ZCLL 5D9NA 3RWGA 3GTFA 4NJ9L 1ONWA 2GGHA 4PJ9C 2WJ5A 3GY1A 3UTSA 1LWIA 4FF7A 5FJJA 1LO5A 2KQNA 5DLLA 3V4PA 4LPYA 4JOMA 4RIRB 5IJKC 2AQOA 4X9YA 3X14B 1AH4A 3UMTA 1P7TA 2NZ9C 3QR0A 3HUJF 4KESA 1TENA 3RI5F 2Z2UA 4HN8A 5B7MA 1WTLA 4O8AA 1KJ3H 4IPIA 9XIAA 1G6RL 3L8QA 5E7FA 4PUJA 1ZRUA 2JXMA 3QQ3B 4AL8L 3R4DA 3SKNA 5EC1A 4WHYH 3CYVA 4O0ZA 3TFXA 3BN3B 3I6TA 3WQVA 4Q2ZB 4LEFA 3WQ5A 4ZSOE 4DWSD 1OHZA 5D04C 3AYSA 4I9WD 1W0WA 2WNWA 4HJFA 1GWJA 3NM1A 4NERA 4L1WA 1HZLA 4JMXA 1FZMB 5DDHA 1CNVA 2YD5A 5K9XA 5AC8A 3CBJB 4UM9A 4F8PA 3HGSA 2CJTA 4MHHG 3SE3A 1J86A 3D48R 1BD2A 1TPDA 1PLAA 3NVQA 4N2IA 5F1OB 3WQ6A 4Y4FB 3DMMB 1EHAA 2YXWA 2X6MA 4CMHC 1A9BB 5DHMC 2E40A 2J9ZA 4WW2A 2YB1A 1YDPA 2ICWJ 3QG7L 3K5SA 1A4JA 5IR1A 3QAZC 5I09A 2Y24A 4N2AA 1NC2B 4JKKA 1RALA 1A8ZA 2OKTA 4G9PA 2AV1B 4E0RA 1IAIH 2GC7C 4J1UA 4KNSA 2E86A 3QEHA 4ZTYA 4QR6A 3UC0L 1JWSA 2WV3A 3QZMA 1LL7A 1W1PA 1RVFH 2G4EA 4MCMA 1AO7E 3VVGA 4H6EA 4P5SA 1FWRA 4YDKH 1U5HA 4TQIA 3DGRA 3W6LA 2WXQA 2DDQL 3UC2A 1JXFA 2CJUH 3QFDA 1D5MB 3B9AA 2WVUA 3SDYH 4XO9A 4QRRD 3IU3B 1KWKA 1L6GA 3LNEA 1ADQA 1ZEAL 5FCSH 4FQXA 5EIIG 2PMZA 3LXAA 4GCXA 2VI0A 3GIQA 3CVHL 4CU7A 4I5RA 2Y7QA 4NUWA 2H3XC 3UWZA 4PQXA 3NRFA 4DSYA 3MDWA 1AE6L 1XLLA 4OI9A 5KVMC 4W8AA 4QXIA 3AICA 1I7TB 1DQXA 2IKJA 4OZIF 1IGIH 1I9RL 3DECA 1EEUA 2HTLC 1XR8B 1E0WA 3TA6A 2C4XA 2OR9L 4DXKA 3AG4B 2R83A 1AGCA 4P5RA 2YEVB 2HWGA 4W9TA 4LLQB 1Z66A 3FCSA 4BQ3A 1T41A 4TX9A 3MODH 2CESA 4LS1A 5CCJA 4HNCA 1TQSA 3X1EA 4LOUC 4JFQA 3DI2B 4B3EA 4NHUA 5JUEL 3LLFA 1OCJA 5E4OA 3QIUB 3D69B 2QV5A 2W65A 4PRPE 1QHOA 2VR2A 4ZMYA 1W80A 3P4LA 3G1XA 4Y16B 1M3UA 4X9SA 5IDIA 3LXCA 4N26A 4GAGL 4DLMA 1YEJL 3IDXL 4MFHA 2Q6ZA 1FZOB 2RIKA 1QWUA 4JMNA 1E6JL 5KITA 4RWHA 2W0PA 1LTDA 1H0DA 2J7DA 3CFJA 3IS4A 4K3JL 4XPGL 3VYPA 4L8CA 2OELA 2VLLB 3FQUB 5IQOA 2Y6ZA 1PZ1A 5GHWL 3H4HA 1JD9A 4FP8L 3CUXA 5DD5L 4V27A 3V6OC 4CBZA 4A4AA 4IPPA 4MAVA 3WH8A 3AMLA 1AFVH 2NXZD 2EIMB 4YHOL 5B39B 5M2FX 3ABQA 4MDJB 2HPIA 1TPWA 2E9MA 1FV1B 1CLYL 1M6OB 3O63A 4JFXA 1X5YA 4I8YA 4YHNA 2XFRA 2J88L 2EHHA 3QJVB 4NOBA 1UZ6E 3OR7B 1MRFH 1K4CA 3BTNA 4XX1G 3FTUA 2JFEX 2A74A 4U6VH 2X3CA 2YXGA 2YAPA 4YWGH 2XX1A 1G9MC 3PP4L 1INQA 1KLZA 2WLLB 1XO8A 2BASA 2JEPA 2HRPL 4AW4A 1K5NA 5EU7E 4ZMWA 5C8JA 3RGBA 4G7EB 4GWEA 2W65B 4FNLH 1R24B 3GJFA 1OVDA 3CV5A 3ZR4A 4UTHA 4GKOA 1U8OB 3A6CL 4R3SB 5EF0A 3F85A 3ZX1A 3QJFA 1VPXA 3MSGA 5CSGA 4G72B 3S35H 4XKMA 4YMPA 3VABA 4JHUA 3NIYA 2AQRA 2DBJA 1AD0A 5ESQB 2WMHA 3GZOA 4KGJA 2Z8VC 4MQXC 5DVPA 2E7LC 3NNTA 4WJKB 4QNPF 1GONA 2Z7ZA 2ZF9A 3U79A 2GDVA 3DX9A 2OJEA 3MQTA 4RR4A 4JTDA 1MELA 3M4HA 3NIGB 4O1DA 3TE9A 3CHSA 3VX1A 4NP9A 3WIFB 2X0UA 4XISA 5F9OH 4I1RA 4XMKL 2H1XA 1KFEA 3RITA 3GLAA 1K7FA 1TWWA 1XX1A 3PREA 3ML9A 1XLGA 1FV1A 1YXCA 2F68X 1JPEA 5EU4A 2VQ1B 4XD4A 4X60A 4MLSA 1K6AA 1XI3A 5BZAA 3D3FA 3C8KA 1UOVA 3B40A 4N0CD 3CDGB 4F7MA 2J7BA 1B0RA 4HIHA 2XC8A 1KCWA 1E5CA 2VMCA 2WWDA 2CALA 3UCDA 2E74C 4NYLB 5TFSH 1WIPA 1S3TC 1MCBA 1AG1O 1UZ1A 3HJEA 1PY0A 2PYEE 2QSTA 1UEMA 5GSRB 1ZLVH 1TLMA 1L0PA 1E9IA 2FTYA 2O4MA 3TSBA 5CJXC 1FWJC 1RZFL 1M05A 1PCSA 2CWRA 4JR9L 4YX2H 1FWDC 2K78A 4G11A 1DBBH 3LCXA 1SYSB 3UOAB 1AJ2A 5A40E 1M6UA 2WSPA 1BIIB 2Y22A 3KJ4B 1E1EA 3I6LE 4QPEA 1JSYA 1K2DB 3FULA 3FNDA 1R3IL 1UEYA 1WEJH 4J3TA 4DWDA 1KFLA 3V6FA 1IZKA 2UZYA 1UHVA 4KWWA 1XFPA 3MNDA 4KI5F 5DA4A 1XW8A 3M5ZA 4WFED 4X9FA 4KT2A 1Q9WB 2Y7MA 3GMOB 4GUPA 3RB7A 2F8XC 1T83A 4M48L 5AYBA 1DJNA 4DUVA 1N8FA 3K4ZA 1E0TA 3U9IA 4D72A 1SYVB 3QKEA 5MENE 3W1AA 1DTUA 5DZOA 1EXBA 3CUFA 4NAQA 1OLZA 1NUGA 1QABA 3O6MH 4PRPB 5IOPB 3L5MA 2D7TL 3WO4B 5BV7L 1M71B 4WENB 4EZMA 1F90L 4H20L 4I85A 1BXNA 1JXDA 2OMZA 2WQVA 4EVNB 3C9NA 3EXSA 5I1DA 4NP7A 1W1ZA 2O6EA 1GKPA 4GS7C 1UD8A 4HHAA 5KW9H 1IKNC 4H26A 2DQTH 1YBQA 3URQA 4ADSA 8A3HA 5DQ9B 2DV0A 2VGLM 3AXLB 4TUKH 3GLDA 4FI8A 3N14A 3PWJB 4X4MA 4N22A 3DTXA 5L4JA 1KCVL 4X6FA 5L6YH 2EKSA 4PVMA 1V0LA 2W07B 1WA1X 3LB6C 3UG5A 3V0DA 5BW7C 1W3HA 3MLXL 4JN6A 1JRBA 2Y3AA 5GJTL 3V4VL 3MKKA 4PLNC 4G7YL 3SBPA 1SVCP 4ODWA 4AKQA 1S5VA 2HKHL 3PV6A 1LE9B 2V4LA 4P4KA 2OEJA 4IQEA 3GSXB 2J8UB 2IADA 5E00A 5BW7A 2VFEA 1IGTB 2Y4SA 4AMXA 1I8LA 1T5AA 1UROA 3BE1L 3HMXL 4W9DC 1LMKA 3GRGA 1AR1D 4APQB 1JPDX 5AKSA 2OZ4H 1TR9A 4UT6A 4NM4H 2Q01A 3MGTB 2EEBA 5BROA 1E5ZA 3RPDA 1GOIA 5DR5L 2WBJA 2EYSA 5EZLA 2JI1A 3WOVA 4LUIA 4AIXA 5JW4N 1KYFA 3QUML 5EO1A 4XIAA 1HL2A 3QHOA 4HOWA 3GDRA 4ALDA 1ZLEA 3O0LA 4DP8X 1XTLA 3BHBA 3ISWA 1KCXA 5AC6A 3GK0A 2WYZA 3CMOH 2BNRB 3HE6A 3U1PA 2NY3B 4MMZA 5A6TC 3R79A 4XOCA 2WXPA 3ROLB 4GSUA 2ZTKA 3BSZH 3CHPA 3B8IA 4LNRA 1GGCL 2CXKA 4QMEA 1A7NH 3GXMA 1NQ6A 4ICMA 4P06A 3OG6B 4HCRH 1C90A 3APNA 4L9ZA 2OWCA 5C0NC 1LYQA 4AZCB 3C08L 5AG9A 4FCAA 2ZOLA 2R1XA 3WY3A 4B16A 4UI2A 4JGUA 1M9SA 2KZ1B 3B0XA 3P61A 1GKOA 2ZKHL 3P1VA 5J3HD 2C1IA 5HR6A 1HHGB 1UM6H 3UNTA 3CBRA 5HXMA 1R9FA 4ZSOB 3IGHX 4R9XA 3MV9D 5GGQL 1GIGH 3CCHB 2UXVA 1WC7A 4YZFE 5I8EB 3V0HA 3ZO0A 2O4QA 3OF6A 5E56A 2GL5A 3D3VB 5DD1H 5B1BB 3NQ7A 5PTDA 3MRLA 1ONRA 2AKMA 1SLVA 3VDCA 2YBVA 1F73A 4IHCA 4F0MA 3P0VL 3ARDC 3ELFA 3EOBB 3OEXA 4P9MH 3WKNA 5JIIA 3T7VA 3KL5A 4DK3A 2ED6A 1FYTD 4WJXA 2P8PB 3MRDB 5ESVB 4ZOAA 5KYYB 3D9AL 5D2TA 5BS0E 1UKQA 2AQTA 4P5TD 4Z0BH 1Y07A 2WZ0A 1UZ8A 3UR8A 3M7SA 4FOJA 3TU6A 1I7ZA 4G9FA 3HQNA 1SUHA 3R18A 3CASA 2PPGA 2OKOA 1DDHB 3TR9A 1HNFA 1DZ0A 2WK2A 3EH3B 5IM51 3LN5B 3D3VD 4OFDA 5TDNB 1GQKA 1OTUC 2FEDC 4MX7A 4MXQD 3U9UA 3C6CA 4D1IA 1CR9L 3HG1B 2GI0A 4OZ4B 2R0LL 4OTXH 2DTML 3WX7A 3DV4B 1QLFA 1QFEA 3SHSA 1FYTB 3QARA 1N5YH 4O52A 2K45A 4DBWA 1SFJA 4OH2A 4XP1H 2GJLA 3G5YB 4KTDL 4ZCWA 3RCNA 2DIBA 1RIUH 5EC2B 2UUDK 1EZSA 3VSTA 2NNFA 3TW6A 1QLRA 5CD5C 2VDPB 2X6AA 4QUOA 2Y5QA 4AHPA 4EOUA 2GTWA 2RH0A 3LZPA 2VR3A 1H11A 3L3HB 1BVNP 4AYFA 1MCOH 2Z31B 3L16A 1MFDH 4IGBC 3DVFA 4PJIB 2RHEA 4FZEL 1YYML 1E8ZA 3OAWA 3TLRA 3ZHNA 4IICA 3EBIA 1LRQA 1MQ8A 7XIMA 5H2BB 5T1KA 5AAWA 1RK1A 3U7WH 3MBED 2XM2A 4LKXB 1UQSB 4R7VA 5DEZA 1YEDB 3KCOA 5FYKD 3KPRA 3NRPA 5D71L 3RL1A 3VH8B 4HSOA 2WUCH 1NGQL 4PV8B 2FSDA 3MLWL 3B8TA 3T0AA 2PPDA 4RX0A 3O9WA 4CD4A 2PDIA 2IANB 1IC7L 1HL8A 4EF8A 1QP1A 4LVAA 3FPYA 3V0JA 1LP6A 3W1MA 3WD5L 4BJLA 3MLRH 2NYYD 1TVBA 5F88A 5IK3A 4H8WC 4A6YL 4XNDA 3B3IB 3N55A 4L4JA 4HWUA 1E42A 3TA3A 3F7KA 4ZZFA 1X44A 5FO8A 4XKYA 3O8XD 4MGGA 2HYMA 4EIZC 2ZXBA 1CDUA 4FXKB 5HHNA 2DWDA 1XXFC 2BZDA 4IBSA 4JY5H 4MKMA 4HVBA 4XAPA 4YO0B 2VEIA 3ZLQC 3NO5A 3PHOA 4XP6H 1IMHC 4RGMB 2R23B 4OVUA 4R88A 4LVHC 1H9VA 3FNKA 1NMCB 3WFLA 4HS6B 4PB9L 4LAQL 5DUMH 4WGXA 1DHPA 3IAGC 3ULUD 2CLVA 3CZ8A 5C7VA 4OTXL 1UWTA 1A9EB 3DUSA 5DD3L 5C0BB 2WMFA 1E8WA 5GRYA 3STCA 3TW7A 5HBBA 3G5VB 3S88H 4X4KA 3LX9A 5HVHB 4HPYH 3CFKA 5LG6A 5C97A 2XN0A 2AJYL 4XAZA 3VZXA 2ZXWB 1W32A 2VWEE 4IPLA 3QSTA 2Q2EB 1NC4B 4KCVA 1GZQB 4P04A 1K8IB 1SMDA 1K1DA 3QW3A 1F6LL 1RPKA 5GHWH 1BZ7A 4JFSA 4AQOA 7PCYA 3W7MA 1F58L 1SJVA 1FFQA 5I8CA 1H0GA 3AO0A 3USZA 1F3WA 2MFNA 5ABZA 4XVSH 3C2SA 2ABBA 3ABXA 4JFFE 3IGSA 4C6LA 3LGGA 4LRTA 1V7NL 3G5XA 2VZTA 5K9OB 1LLOA 4P2YA 1W31A 1GY2A 3R4IA 3GRWL 5FYJE 4DQWA 5TQ2L 1JRCA 2YQGA 2WTRB 5LIYX 2J74A 1TWDA 3WJZA 3P8JA 1G7QA 1K5WA 3EKZA 4M4PA 4ILSA 3N15A 3EADA 3E38A 5E6UB 3LQGA 4HWBL 4NZ8A 3VB8A 2YLLA 4PRIB 4JE0A 1IC7H 4E41A 3GVVA 2FD6L 3S2MA 4DJDD 2HJLB 5AVRB 4X7TA 3WMPA 5E09A 1P1ZA 3QUZC 4KPHL 3ALWA 1GQLA 4GW1B 4P5TC 2Y36L 5F7YC 5M94B 5MI0B 1Q3NA 2O5YH 4G7VL 4L8BA 1NGXB 1QO3A 1AXSB 1YMYA 2R7EA 3IDMA 5AUMA 5EZIL 3CUPA 4NAJA 1KN4H 1JK8B 4TTDD 4X6EB 3QUXA 3JBG7 3NGBB 3QJFB 3VOGA 2I5GA 4B2DA 3B2VL 2QGBA 3C5ZC 4FFVD 4WZ9A 3IT8D 1CXEA 1BZ7B 1U36A 5I75C 5E2VL 1L0YA 1KCUL 3DNKA 5GRXG 2PLJA 2VDLB 4PRID 3TX9A 4OIIL 3VFTA 4E3VA 3AU0A 2VDIA 3JW7A 3RNQB 1W3IA 5DJXA 3BRDA 3GD1C 4YAQA 3SIKA 4WGHA 3W4RA 3WLWC 1Q9OB 1UH2A 4KJYA 2KC0A 3SE8H 1XG3A 4JN8A 1N7KA 1GY1A 1YEKL 4XNYH 2WKOA 2A99A 5IBTH 4BBWA 1PKMA 3H8AA 5JXAH 2AL2B 5FJOA 3VIOA 4P8QA 4QGCA 1BLNA 2AK4D 4LKCA 3MACL 2VDQL 3ARSA 5F7LB 1FL3B 1EAPA 1NP2A 1UWIA 3E0LA 1VF5C 2PWVA 4I5XA 2QCGA 3HPJA 2W8CA 1E9YB 5J1TC 5K59F 1B90A 3KH4A 4E2VA 2QBWA 5C3IA 4PWEA 5I74C 1AS8A 3GTVA 4Z7WA 1QJWA 4MWAA 2BG5A 4PMJA 3FQXA 2YRBA 2B0SH 5DGRA 1EEPA 1HHKB 4FNUA 3QDAA 1WFJA 4KHTL 1OF6A 2REQA 2X0SA 2CMRH 2VIRB 5D38A 5B3NA 2HJKB 1OAQL 1KWGA 3IETA 4KNTA 1SW0A 2WN3A 1J05A 3VXQA 1FL6A 1KTJA 1PW3A 2CA3A 2ZADA 4Y90A 2EIKB 5HHME 1ZQ5A 4FZIA 4JFQB 3ZR6A 3BARA 5MF5A 4PJDB 1S7QB 2FJFA 1AZZC 4X8XA 2J2ZB 1RZ8B 3GHBH 3IDMB 3QIWD 5AUMB 2WHMA 1G43A 3D85B 4JFUA 5DSCB 2CXEA 3LYEA 4C83A 2HJKA 5AW8B 1GCFA 1KG0A 1I1CA 1UKSA 5DMMA 1FWEC 4RW5A 3WN5C 1J8VA 1T1ZB 5LGJB 2GWGA 2J6VA 5ABHA 1EJ8A 5CINH 4Q6IA 1DBAL 4Q8OA 4PODA 3Q5OA 5ACZB 4HS8H 1UD4A 5C0CA 2Y6TE 5EG6C 4OFKA 4OIIH 3DENA 1KJVA 1ZA3A 1EAPB 4PUKA 1NGPH 1HI6B 3HPJB 4M7JL 5IMOA 4F2EA 1S39A 2A0LC 3T8VA 3BLKA 4DW2L 1YE4A 5IDZA 1GYWA 2EC9U 2XN9D 5DEGB 3FO2B 3SPIA 5IHRA 1RKRA 4F0SA 1OX5A 4QSHA 2WO2B 1NTDA 2OLHA 3FFSA 1MW0A 4XC1L 1KB5B 5F7UA 4Q4QA 2IPKA 4R85A 4YDJA 5DRNA 1V02A 3F2LA 1NF0A 3RX3A 3V0UA 2Y69B 3K2KA 4YE4L 3OC5A 4CSZA 1DVXA 1NC2A 5ITBH 3FCBA 2BDNL 4WI3A 3P0XA 4FKKA 2ZYSA 2PDNA 2W4XA 4G9FB 2ZCLH 4HCGA 4BELD 5BWFA 2R91A 4J2MA 1FRBA 3SDDB 3TO2B 2YBRB 1FHNA 5D1XC 1T6MA 4PRIE 4NUJA 5F72S 4JFDD 3A23A 3KYMB 1KZYA 2R29L 4P2CG 1ISXA 2UWFA 3UL4A 3SCRA 1L6YA 3HI5H 3X1GA 5ID1A 1VA9A 2BZ7A 4EANA 4NQED 4PJBB 3BP4B 5I9QC 1XQ4A 1D9EA 1T6WA 2ACSA 4RW3A 3LKNB 5GRJL 4Z2IA 1OG0A 4RDYA 2GQHA 1HKLL 4JUSA 3DOHA 1DBJL 4GB9A 4IYKA 4N0YL 4Z7VB 4QJ1A 3UY7A 4AZHA 2QQKL 3GF8A 2KT6A 2BIHA 4XMZA 3L1FA 2PFHA 3MOAH 3F7PC 4UV7H 3Q1SH 2E77A 1DWFM 1GVQA 2YXOA 1SF3A 2ZDSA 3PFQA 4L3ED 1PQZA 1C9WA 5FM8A 3SDDD 2L0DA 3B2MA 1QNIA 4DJEA 3RL2B 5L4MA 3VXMA 2PR4H 1UMLA 3QDGB 5BJTA 3HMXA 4YEFA 2PLTA 2R4SL 1KM4A 1DVYA 5CJ8A 5F9DC 3GFXA 2Z3FA 3QWRA 3QZWB 4IQLA 1FE8L 1TMCB 2CZNA 3VFCA 2YOAA 5I1GL 1VKFA 3HN5A 3T2OA 1KCSL 1AP2A 3AM8C 4L7ZA 4PFHA 3MRFB 2QIIA 1TCMA 5LAPA 3KLSA 4AYMC 4O00A 3LRSB 2VJ0A 5KUMA 2QCCA 5JHBA 4M80A 2CWXA 1O94A 3BLBA 4QIRA 4FOUA 2DQ6A 3QWQB 4K71B 2Y85A 4Z7AA 2YPKA 3LQZA 2WM0A 3KVKA 3CQKA 1BXVA 4NPYA 4Y4HA 3SQOL 3CIQA 3FQUA 3U1SL 1UZ6F 2V2CA 3M17B 3E0WA 5FF4A 5JMUA 4A35A 1KJMA 3KLLA 1C93A 2OI9C 4MQXD 1OAUL 2W0FB 3JV6A 3BMXA 4MSSA 3QRGH 2C9SA 4DO6A 1BFOB 1XF1A 3KPRD 2RH9A 3TZFA 3NQKA 3JV0A 3LCHA 4M7LL 4H5SA 4F15B 5CPNA 4F9DA 4NQXA 3NRQA 1FO0H 4GUHA 1VPQA 4TSBH 1FTXA 3VIHA 2DJLA 2H45A 3TEYA 1S2WA 3RWCB 3DC8A 4IOTA 3APYA 2CWNA 5F1KC 1JDAA 3OHXA 3GHSA 3M16A 3MP3A 4LSTH 1FLTX 5CZVH 2Z8RA 3QA3A 3W2JA 1NCDL 3VQ1C 6XIMA 3E74A 4MZ8A 2HVNA 2V82A 2ZZ3A 4P7QA 3M5YA 4LBEA 2GDQA 5J11B 3BWAA 4YBLC 4UQAA 4CNNA 1BQ5A 1YCSA 2J6EH 4ALAC 5I1DB 1OP3H 3EW3B 1N5YL 5T5FH 3G6JE 5E7BA 1HXMB 4MAYA 2EVHA 4ORIA 5MERB 4YCOA 2YJLA 4IU2A 4LNVA 5L2JA 5DJCA 4IFOA 2J88H 2R15A 1K6QL 1FWNA 1NFIB 2V5LA 2EH8L 4MNQE 2V3EA 2VDNH 2W80C 3H85A 1FORH 3LPWA 4HXBH 4PJXA 3U30B 2D7MA 5BRPA 4A2LA 1QRNB 5HPOA 3NQMA 4AZGA 4F2TA 3S9YA 3R8QA 3CX5K 1TJHH 5CCKL 2IWFA 5KSAD 5IMLB 4S1RL 1A6ZB 4MA8H 2WKJA 5CHNA 1I85A 4PJHE 3O2DL 4XTRC 3LUTA 4JG5A 2FYYA 3DYPA 4F2FA 3UDWA 1CGWA 4M7LT 4YHLH 5T1JA 3FHQA 2YRPA 1DWGM 1QNQA 2PRMA 2FH8A 2YLKA 4NQDA 1AD4A 2WXDM 4YPGA 4F2BA 3AVEA 3O2VL 4S1DC 3RQ3A 1H8SA 1U1JA 2BHZA 3HIZA 3ONBA 2F58L 3EOSA 1GKQA 4OZIB 1RJZA 2EO7A 1E3FA 2A83B 3S47A 1OFDA 1UCTA 3SDDC 4H5SB 1ID2A 1FFNB 4BK5C 1O60A 1FDLL 3I6RA 3V6ZB 5FLUA 4HUXB 1B4JH 1JHKH 2OP4L 4MD4A 1UG6A 2Q71A 4GISA 4K7PL 1M05B 4XR8C 1I3VA 4B3VA 3BHBB 4FX6M 1C08B 4YHKH 5FEZA 1BXBA 2X4PA 1ZENA 1S1RA 1DSWA 3BQ5A 3HUJA 3LCYA 4HJ0C 3GUWA 2V2WA 3MUGB 1SW7A 3QBUA 2EADA 4MWFA 3VZZA 3YPIA 2A83A