4E2OA

Crystal structure of alpha-amylase from geobacillus thermoleovorans, gta, complexed with acarbose
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
451
structure length
445
Chain Sequence
ERTWQDEAIYFIMVDRFNNMDVNVNDPKGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNMPGGYHGYWIEDFYQVDPHFGTLGDLKTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPTKKDWFHPKKEIFDWNDQTQLENGWVYGLPDLAQENPEVKTYLIDAAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKKDFFLLGEVWSDDPRYIADYGKYGIDGFVDYPLYGAVKQSLARRDASLRPLYDVWEYNKTFYDRPYLLGSFLDNHDTVRFTKLAIDNRNNPISRIKLAMTYLFTAPGIPIMYYGTEIAMNGGQDPDNRRLMDFRADPEIIDYLKKIGPLRQELPSLRRGDFTLLYEKDGMAVLKRQYQDETTVIAINNTSETQHVHLTNDQLPKNKELRGFLLDDLVRGDEDGYDLVLDRETAEVYKLREKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Alpha-amylase
publication title Crystal structure of a compact alpha-amylase from Geobacillus thermoleovorans.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
total genus 166
structure length 445
sequence length 451
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4e2oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4e2oA01
4AIEA 1CEOA 4CU6A 3ZT6A 5IFPA 1PX8A 2PWHA 3KL3A 4JFSA 1WDPA 1RP8A 4HZ8A 2JE8A 3KLKA 4U2YA 2ZX5A 1GVIA 3A24A 1V3JA 3MV11 2WMHA 5D9OA 2XVPA 1XD1A 4UOZA 2EQDA 2DT0A 2Q8XA 2VZUA 3VX1A 3KL0A 1UUQA 2F7QA 5A6SA 3EDDA 4W5UA 1E9LA 2UY2A 3SCNA 1UKOA 3WF0A 3CZJA 1HJUA 5FKYA 4ZFMA 5D9PA 4KH2A 1M53A 4WKFA 3BVVA 3W53A 1O7AA 3DX4A 5A8PA 5A6KA 4ATWA 1QBAA 3WDJA 1DTUA 4GXPA 4J3SA 1MQPA 3BVWA 3MMWA 1H0GA 3DC0A 4JHOA 3AMLA 4W7VA 1SZNA 2DH3A 4MJ2A 1B2YA 1HX0A 3WQ4A 4TX8A 1T0OA 2VMFA 1TE1A 4PCTA 3KE0A 1E72M 1K9EA 2AMGA 1FH8A 4M24A 5JIPA 4P8UA 3TA9A 3K8KA 1DWGM 1B1YA 1QI0A 1W9PA 1BG9A 2RGMA 1EOMA 1HJWA 4D6CA 3CHFA 2VJXA 3AHTA 3VD5A 5BRQA 3WY4A 1D3CA 1WDSA 4W7WA 1KB3A 3LRLA 4RE2A 3W4RA 4HPGA 2YL8A 4AD1A 4J28A 1QHPA 2XGBA 1V03A 1QVBA 2WHJA 4BA0A 4HA3A 5BXTA 3WIJA 2DPEA 3HJEA 4E2OA 1EQPA 2WMKA 3MI6A 5CZKA 3LRMA 2QMJA 4F9DA 3TTQA 4L4OA 2VC9A 4MNLA 2QPUA 1HKIA 3ZIZA 4X9YA 2DSVA 4H04A 3ARZA 3WY2A 1C92A 2JIEA 3N9KA 1VB9A 1UQZA 4QDMA 4NSBA 4BZYA 3WUGA 1HN1A 3OZOA 1BPLB 4U3CA 3A3HA 1E6QM 3VOCA 4QCFA 3ZJ8A 3HG5A 1WZKA 1U2YA 5D4YA 1H1NA 3WD0A 1FP8A 2XUCA 1DWFM 3D50A 5I0DA 3SURA 1CIUA 2DEPA 4AD5A 4XUYA 1O7DC 4M80A 3ARTA 1E6RA 5CLTA 3UG5A 4E8DA 2BS9A 2OSYA 4FLRA 1E3XA 2CKSA 2OWXA 3W25A 1EDGA 4JCLA 5LA2A 1EDQA 3B9DA 5CXPA 4B9ZA 5IFTA 3NJ3A 3VM7A 1R85A 3ARWA 2WBKA 1B3ZA 2BNJA 2WCGA 4IISA 1TVNA 1UR2A 2OWCA 1ZBCA 4BQ4A 3WY3A 5IXEA 2CBIA 3DYMA 3VIHA 4DO5A 1GCYA 3K4AA 1R75A 1JAEA 3VTRA 2ZUWA 4JFTA 4J3WA 4N0RA 4J3VA 3GH7A 4PUEA 1XGZA 1XSIA 1HL9A 3ARSA 5FL0A 4HA4A 3VNZA 3A47A 2W4XA 3PTKA 3GTNA 1PPIA 3BAKA 3NIYA 3DHPA 2F7RA 5C70A 2X0HA 3WBAA 4S3KA 2E40A 3K8LA 3EBVA 4PTMA 2PWGA 1BYDA 3MKKA 1TA3A 3GXMA 1EO5A 2YL6A 1WP6A 1J0JA 3ALFA 2EABA 3AS2A 3BUIA 2D20A 3A23A 3ARYA 2BY2A 4W89A 5DMYA 2DT2A 1MW0A 4PMRA 2WW5A 1RH9A 5DF0A 3SCWA 2G41A 5E70A 2E0PA 1V0LA 2ZUVA 2FHBA 5DO8A 2RGLA 3S2CA 3RIKA 3HU7A 1MQQA 4P7LA 3EJRA 1OGSA 3ARVA 5BXPA 4CN4A 2ZWZA 5LA1A 3F5KA 1JZ3A 4J3TA 4A3HA 3T2OA 1FP9A 4HZ7A 1JGIA 3VU2A 5FIPA 4AEFA 1KR1A 2CXGA 2DIEA 1OD0A 5GNYA 3GXNA 4M1RA 4GZIA 3IK2A 3SCTA 1OBAA 3H54A 2XFRA 3WEMA 4JL2A 4WLCA 4GINA 2DT3A 3SCPA 3WD4A 4H8VA 3CZKA 1UR4A 3CHDA 1UD8A 5I78A 5I24A 4OGZA 3SCQA 1QWNA 5I23A 3MS8A 5CJ5A 2VCBA 4PYSA 1E4LA 4AC1X 1JF6A 2ZUSA 1TMQA 1QHZA 1GOWA 3WN6A 3I3EA 5M5DA 1CTNA 1CXEA 4NXKA 2ZE0A 1OT2A 2QV4A 1R46A 3AS1A 2Y8VA 1W3LA 1BGAA 1UQYA 4PMZA 3GXFA 1OGBA 4YN5A 1J0KA 4ATLA 1HKKA 2YIHA 4R5EA 1ZU8A 3VNYA 2W61A 4JIEA 2E8YA 2CBJA 1VENA 1KCKA 2YL5A 4YHEA 1IZKA 1ODUA 3CO4A 1KXHA 2Z1SA 4AYSA 3MUIA 3AIRA 1B3WA 5HPCA 1DHKA 2WMJA 5ECUA 3UR7A 2JFEX 4WKAA 1Q6EA 3CBWA 1FA2A 3A4WA 1W9VA 1OT1A 3L2MA 1XH0A 2EXOA 4MADA 4URIA 3L2LA 3AHXA 3WBEA 3OLDA 1KGWA 1UWUA 3MV01 4ZE5A 1QX1A 3AZTA 4CCEA 2VVSA 1PX4A 3F5JA 4KGJA 3VDAA 4PRWA 2F7PA 1CXIA 1JYWA 3D4ZA 5GPRA 4AMXA 1C7TA 2WBGA 2XHYA 2F7OA 4U3AA 4E4PA 2IXVA 1W2VA 3VIOA 2XVKA 5A1AA 1W9UA 2QPSA 4DO4A 3T2QA 2PWEA 4AMWA 4PMUA 2V3GA 4IUGA 5JIWA 4W86A 2A3EA 3BCDA 3VVGA 1V3HA 1W3JA 5CPQA 4D6FA 1E1EA 4F66A 1I75A 1XH2A 3VD3A 3W81A 2J62A 1RD6A 3K4DA 3M6DA 1BYAA 3VSVA 4AZCA 3CUHA 3DX1A 4QLKA 2VNCA 1C3FA 4PBGA 4J7RA 4TVCA 3CUGA 5FL1A 5LYRA 3TTSA 2EPMX 5DFAA 2WMFA 3UEQA 2XSAA 1R86A 4PSRA 2D2OA 1E40A 1W9BM 1QW9A 1UH2A 2D3NA 1UOKA 2FHFA 3SUUA 2X09A 4Z2KA 3VD7A 4AZGA 2WMIB 4CU7A 1WPCA 3W27A 5CQ1A 4AD0A 1E15A 1WZAA 4LYQA 4WJXA 3PZNA 2GSJA 5A6BD 2FGLA 1E0WA 3CIVA 1NQ6A 2GJXB 2BVDA 3D52A 2VOTA 3AHYA 4GZEA 1MFVA 2QMKA 2PC8A 5BRPA 1CGUA 1J0ZA 3EMZA 4ZE4A 3VIPA 1MQRA 2G3MA 2WANA 2IXUA 3EDJA 2WKLA 5IHSA 1J12A 2DSZA 4AZ6A 3F5LA 5A95A 3AXHA 2MANA 3WNMA 3MUY1 3BAIA 2IGTA 1AMYA 4W5ZA 1VRXA 3LXBA 5HNNA 1YHTA 2PWFA 1JNEA 3WD1A 4CD6A 1EO7A 4D1JA 1IV8A 1C8YA 1KGUA 2V5CA 4QLLA 2WMGA 1NP0A 2VZSA 3WFZA 1BF2A 3LPFA 3WDHA 2XIBA 3VSTA 2WZHA 4W84A 4PMXA 3WMSA 3VIMA 4KRUA 3WF1A 3GH5A 1F4AA 5DEZA 1LJYA 4KRTA 3A4XA 2GJRA 2ZXBA 3MUAA 4PN2A 1CPUA 2VL4A 4E8CA 2BY3A 1W3HA 4LPCA 5EMYA 3WDIA 1BLIA 1CGXA 3L4ZA 1Q6CA 1KFWA 2DGAA 5TD4A 1PIGA 1JDDA 4CCDA 4LX4A 1R47A 2J4GA 2OYLA 2ZUTA 2YLLA 1KWKA 1B9ZA 3KLLA 2IUZA 3MU7A 2VRQA 3THDA 1HNYA 1E71M 1Q6GA 1I1XA 4UQ9A 1TQSA 4UOJA 4Z2JA 1V6UA 4DM1A 3W0KA 4AD4A 3WNOA 2WXDM 1G1YA 3CHEA 3EJSA 3GH4A 3T0AA 1KWGA 2WVSA 1WZMA 3SEPA 1EH9A 4JAWA 1GPFA 4D6IA 1E0VA 2YBUA 3SUWA 4LQ1A 4FNSA 1J10A 5A3HA 1H41A 3S5ZA 4WSKA 1NARA 5E0CA 3WEZA 4B16A 3GXIA 3VMPA 3BUQA 4P7OA 3EMQA 1ISVA 4M82A 1S46A 4R27A 2VURA 1JZ8A 3VILA 1UKQA 1ECEA 1NP2A 1QWUA 1UD6A 4BCEA 1G5AA 7CGTA 2CPUA 4L4PA 4AY1A 4FNPA 3WQWA 4CVUA 1UWIA 3PTQA 3N17A 2A3CA 5M3WA 3WEOA 3LXCA 2J7HA 4PMNA 4Z2GA 4ZXLA 2NT1A 1BGGA 4AD3A 1J11A 8A3HA 5HOSA 5I5RA 2XWDA 4P7QA 1GOOA 2X2JA 4OKDA 1UKTA 1L0PA 3AIBA 2NT0A 1HIZA 3CV5A 2JF7A 4JHZA 1XSKA 3POHA 5FCZA 3WQ8A 5CPSA 4OBRA 2WAGA 1PIFA 5I2UA 3BSGA 4ACZB 3BMWA 1GQLA 4W8BA 3FAWA 1XRVA 4CD5A 3ZOAA 4J3UA 1BVNP 2WVVB 4GQRA 2FGZA 2XFYA 3CTTA 3OA5A 1D2KA 3D3AA 2YOCA 2EJ1A 1E4IA 3T08A 3WNLA 4AD2A 4IPNB 2YA0A 4UQEA 5E6YA 3BGAA 1OWQA 3AIVA 4TOQA 3G6MA 3EJPA 3OLIA 4F8XA 2UWFA 3CZ8A 3RM9A 3AQUA 4K68A 2BY1A 3CH9A 3AZSA 2EPLX 1CYGA 1VFFA 4D1IA 3RM8A 4JKKA 2V38A 2GJXA 1V6VA 4GO9A 2ZUNA 3L4XA 1TG7A 1KQYA 1U33A 2WLYA 1V0MA 3PHAA 5BXRA 1VBUA 5BYWA 1QI4A 3LX9A 4TXEA 1W1VA 2XN0A 2VR5A 4IPLA 4J27A 2CESA 1ISWA 3EYPA 2ZXDA 5A6BA 1R7OA 2J77A 1C8XA 3GNPA 3LRKA 1JAKA 1LG2A 2PB1A 4FLSA 3WKZA 3OGRA 1JNDA 3CLWA 1ZBVA 2Y2WA 4QCEA 2V3EA 3IAPA 3W28A 4X0NA 4AZHA 2EPOA 4GZJA 2WCAA 3PN8A 3B8SA 3WUBA 3WENA 1JZ5A 4UFJA 4EKJA 1CLXA 5JBDA 1XH1A 1GNXA 3N1AA 3AISA 3T09A 2WLZA 1FFRA 5FD0A 4JKMA 3UG3A 4V28A 1G94A 1MW3A 1MXDA 1OSEA 1W32A 3L4UA 2X2IA 1X1NA 1OINA 3L4TA 4W7UA 3ZM8A 4PCSA 2A3HA 3VGHA 2DSUA 3AMGA 4DO6A 3GNOA 4UFIA 5KZ6A 3WD2A 2NW0A 3VO0A 1E0XA 2WZIA 3VDCA 2NSXA 4JFWA 5E9AA 3BAXA 2XM2A 1JYVA 1K9TA 4AZBA 3ZJKA 1PX3A 3MMDA 3WELA 2BXYA 4HPHA 2HVMA 3B9EA 1UWTA 3PZMA 5C8BB 2C7FA 3WUEA 2VZVA 4P8XA 1K6AA 1E6PA 1FH7A 1B90A 3K46A 4HOWA 3VGGA 3A22A 1NWRA 3FAXA 3W37A 1MFUA 4TVUA 1FHLA 3U5YA 5GNZA 4P7RA 3N11A 2WHKA 1LWHA 4UFKA 2VZTA 3OIHA 3WH8A 3W38A 2D1ZA 3AMCA 1GOMA 3UG4A 1VF8A 2AAAA 4UCFA 3ARPA 4TUFA 4FNRA 4NZFA 2VX7A 4DWSB 3QOMA 2W62A 3GBDA 3CZGA 1UWRA 3W6MA 1W9DM 4ATDA 2V3DA 4MB4A 4UQDA 3ZMRA 1CENA 3CHCA 1HL8A 3VM5A 2ZUMA 3AIWA 4RE4A 2D24A 4J3XA 2YKKA 4B9YA 2VTFA 2VCAA 1DEDA 1V0KA 3RCNA 2YLAA 2DIJA 3DX3A 4OIFA 3PZIA 3GXPA 1CGWA 3CPUA 4ACZA 2W91A 3N18A 3DX2A 3CZSA 3NDYA 1JG9A 3EMCA 1CXLA 2CEQA 1UD2A 2WVVA 2XN1A 2O9OA 2X8RA 4TX6A 1JDCA 4MNMA 2WHMA 4EANA 4NF7A 5A2AA 1NOWA 3SCRA 4P8VA 1J0YA 3GDBA 4FF5A 4JZ5A 1E3ZA 3PZVA 1MW1A 2XM1A 1E5NA 1BFNA 2CITA 1C93A 1RPKA 1EHNA 4XZWA 1M01A 2JIWA 1H49A 1US3A 1CWYA 3VIIA 4BQ3A 3ZJ6A 4F79A 1E6SM 4AZ7A 4PTWA 4W93A 5IDIA 2X2YA 4PTXA 2YDQA 2WSPA 2ZICA 3VIKA 1E4MM 2J47A 3WNKA 3VPLA 1ISZA 1W91A 4CGTA 4TTUA 1SFSA 4GIAA 4GI8A 3VDBA 2BY0A 4JFUA 3AXXA 4QAWA 4HMDA 5JUVA 4C7DA 3KL5A 2EACA 5CSYA 4AZ5A 3VIJA 2UY5A 3LXAA 4NRSA 1TQWA 1QNOA 3DDFA 2BV9A 3NCOA 1E55A 2Y4SA 1H11A 4MJ4A 3PZQA 3HMCA 1XHGA 1UZ4A 3AROA 3VGDA 4AYGA 5A6AA 5D8ZA 4QFUA 3MSDA 1JI2A 4UNIA 3VDHA 1QNPA 2XJ7A 2XVNA 1KXVA 4NRRA 3LMYA 5AYIA 4P7NA 3L4VA 5KEZA 2E9LA 4HOZA 5A8MA 5E09A 1CGTA 4M56A 2VCCA 3U57A 2V5DA 2Y5EA 4HA1A 1LL7A 2QF8A 3U7BA 3SCSA 4GPNA 4H7VA 1ITCA 1XSJA 4CN6A 5CLWA 3EDFA 2Z1KA 3HG4A 2PF0A 1H09A 2J8GA 1JZ4A 2EBNA 3ALGA 3TV8A 3ZSTA 1JF5A 1JFXA 3VMOA 1XCWA 3FN9A 2WKGA 1FFQA 3VGFA 2G3IA 1TZ7A 3D51A 5HPOA 5FOOA 1E73M 3M46A 4S3JA 3BAWA 4H8UA 2WHLA 1V3IA 1WCGA 4U5IA 1C90A 2GDUA 2GK1B 3BVXA 3K1DA 3EJQA 4WF7A 2J78A 3VSUA 3MSGA 1NWSA 1CGYA 4LYRA 3N04A 4JL1A 1OIMA 1JZ7A 1V6WA 2F61A 4GI6A 1EOKA 2D23A 3TONA 1HXKA 1BTCA 3BVTA 1PS3A 1C91A 2ZXQA 1GQIA 1E6XM 2FHCA 2UY4A 5A2BA 4M81A 3RO8A 2EPKX 3AHVA 3OBAA 3WQVA 4FNTA 2O9PA 1W1YA 1XCXA 3PZGA 1LQ0A 1ISXA 1KR0A 3JUGA 3W24A 2ZXAA 2VX5A 5ABHA 4TVDA 3SCOA 3NYDA 4AIUA 2YDRA 4UQCA 3MO4A 2F8QA 5CGTA 3OLEA 2J7DA 1CDGA 3AIUA 2OW7A 1CXKA 4GO8A 2WC4A 2BFGA 3VMNA 2CHNA 1XYFA 3MUZ1 4Q7NA 3ZT7A 2EO7A 2GFTA 5HBFA 2XVGA 2V3FA 3ARRA 4Z2HA 3WF4A 4CD4A 3BSHA 5A94A 1JYNA 3WUFA 3ARUA 1ZBWA 1U30A 3II1A 5DT5A 3QHOA 1G9HA 2X0YA 4XV0A 3WSUA 5CSUA 1WAWA 4PUDA 4HOXA 3VX0A 3AI0A 2XGIA 1AQHA 3WH6A 4TTGA 1ZJBA 2YBTA 2ZX8A 2BXZA 2FH8A 5F7UA 4MDOA 1NOFA 1H3GA 3RDKA 4GKLA 3WQ5A 1QW8A 3UCQA 4Y7EA 3I3DA 1A47A 1CGVA 1C8QA 4OOUA 1JYXA 5A69A 3CGTA 4X0VA 1B3XA 3NSNA 1E6NA 4UQAA 4NZCA 3A21A 1H5VA 1HF6A 5EFDA 3EDEA 3L4YA 8CGTA 1KTCA 1UH4A 3AIQA 3NUKA 4ZXOA 4V27A 2ZIDA 4OUEA 3G6LA 1UG6A 2BHYA 3AHZA 4MPKA 4ZENA 1WNOA 1Q6DA 4JKLA 4UFHA 1UA3A 3IANA 1N82A 1K9FA 4PMDA 3QHNA 3RJXA 2D0HA 4KWUA 2D0FA 3W82A 3GZAA 1GUVA 2E9MA 1LF1A 4NX0A 2WK2A 2XSBA 1GW1A 1X6NA 3MMUA 5DT7A 4ACYA 4UOQA 1ZL1A 1UD4A 2YA2A 5AC4A 1OIFA 4OBSA 1IZJA 3A4AA 1H0IA 1WB0A 4PMYA 4GI9A 3PZTA 3WF2A 1KXQA 2XWEA 5A6JA 3ZR5A 1TA3B 3DDGA 3ZR6A 1R7AA 3W29A 5CPTA 4AISA 1RP9A 3VIFA 3T2PA 2VVNA 1MWOA 1VEPA 3WD3A 4HU0A 3AMDA 4LGXA 4D71A 4MAZA 2WB5A 3AJ7A 3PZ9A 2A3AA 4WKHA 2WCSA 3LPGA 1TQUA 2VI0A 3TTOA 4LYPA 1J18A 3GNRA 1FOBA 3ZJ7A 1LWJA 5A8NA 3AOFA 2ZX7A 4FK9A 5A6LA 3A6OA 2AOSA 2XG9A 1M03A 1KBKA 1QNQA 3CUJA 2PWDA 2PBGA 1ZJAA 1JDAA 3FW6A 1B3VA 3HG3A 1YQ2A 4W85A 4JFVA 3WL1A 2OYKA 1DP0A 1V02A 4D6HA 1SMDA 3RILA 4AZIA 3BCFA 4A3YA 2WC3A 2O92A 2GK1A 2VUYA 2VX4A 1J01A 3WDQA 3O6AA 1WZLA 4Z2IA 3UERA 1LG1A 1GQKA 3ZSSA 1VFUA 4KMQA 1B0IA 3AXIA 1R8LA 3B9AA 1UKPA 2VRJA 1V6YA 4HTYA 2O9TA 4ZEPA 1B31A 3VUPA 2J79A 1TQTA 1I1WA 1ZB5A 2VT0A 3SCVA 1K9DA 4HP5A 3W26A 1DWHM 2BHUA 3ZT5A 2WMIA 3CZLA 3RM4A 4RL3A 5D9NA 2CERA 1Q4NX 4XB3A 1O6IA 1PAMA 4CD8A 3N12A 4OOZA 3T0DA 3VIGA 3BVUA 4DUXA 4MNKA 2ZX9A 1BG4A 3CC1A 4UFMA 4OZOA 1EGZA 1VJSA 1EQCA 5I79A 1GOKA 2OYMA 1JZ6A 1W3KA 3FXYA 3EDKA 3WL0A 3RPMA 3A5VA 3AYRA 2OSWA 1HXJA 3AZRA 1TR1A 2E3ZA 1WKYA 4H2CA 3W6LA 1VJZA 3U5UA 3RJYA 3HG2A 1HKMA 1LL6A 1JXJA 3DYOA 3OZPA 3AIEA 4DUWA 5A8OA 4W8AA 5GQBA 4H8HA 3ARQA 3CMJA 2B31A 4Q22A 1DWAM 1UR0A 1HJVA 2WM0A 2XYLA 4U31A 3TTYA 2ZOXA 1JD7A 1SYTA 2EAEA 3S5YA 1NH6A 1E70M 6CGTA 5I77A 2X2HA 4A4AA 4D6EA 3BUBA 3UESA 3WMBA 2CBUA 1XC6A 1AQ0A 4D6GA 1Z32X 3BMVA 1W1PA 3QOKA 3TP4A 5A6MA 3IGUA 3OGSA 1E1FA 4EE9A 2EEXA 1L8NA 2OWWA 1P6WA 2CIPA 1ITXA 3WH5A 1UD3A 3WNPA 2PI6A 2GVYA 1E43A 1UYQA 3SUSA 4NZJA 4FNUA 1JZ2A 3WMCA 1US2A 1V0NA 1DWIM 4PMOA 4HMCA 2YFNA 4LXFA 2J74A 2W67A 5JBEA 1EHAA 2WVTA 2CYGA 1FH9A 4H41A 1Y7VA 1UZ1A 2WC7A 1UH3A 2DDXA 4AIOA 4WSJA 1V3KA 2J25A 3SCUA 2DSKA 3FNDA 4AMCA 4D6JA 1KQZA 5E0FA 1C7SA 2HISA 1HWWA 3DX0A 1CXFA 1ZS2A 2Y24A 4DWSD 1AVAA 2C8NA 1MW2A 1R33A 2YL9A 2DQXA 1TQVA 4AZCB 4CVWA 3D5HA 1WDRA 1UR8A 4CN1A 2ALWA 5M03A 3UETA 5EB8A 4WIWA 4BF7A 1GHRA 1QBBA 3SUVA 1CLVA 3GXTA 1HP4A 1UR9A 5M17A 3PBGA 3IJ9A 2G3JA 4UZSA 3NSXA 1NWUA 4DM2A 2W63A 2E9BA 1QI5A 5I3DA 1J0HA 3ZO9A 1NWTA 4CD7A 2PBOA 2W66A 3I3BA 1OB0A 5IHRA 3APGA 3EJTA 3QHMA 1KGXA 2D3LA 3WNNA 1GHSA 3UR8A 2ESCA 9CGTA 3THCA 3BAYA 1HVXA 2WZEA 1EDTA 1G01A 2ZX6A 5CGMA 3D4YA 3AFBA 4JCMA 1GJWA 1CNVA 4BQ2A 5A8QA 2JEQA 1TUXA 4C7GA 5AYBA 1EA9C 2DT1A 3OG2A 2D0GA 5C71A 2Y8KA 1E6ZA 3BUPA 1D7FA 1H2JA 3AICA 2G4FA 1GZJA 1VEOA 1BYBA 2DSWA 2O9RA 2OLHA 2XN2A 3SUTA 3QR3A 2FDMA 1WDQA 1EIBA 5ABGA 1ISYA 2ZWYA 1MVYA 1GJUA 1V3LA 4MB3A 2EPNA 2D73A 5ABFB 2A3BA 2XIIA 1WO2A 3BLPX 2YA1A 4RE3A 4ML4A 4NXSA 3POCA 3FHAA 3KZSA 4CUCA 3FY1A 3IJ7A 2FYVA 4P8WA 1KXTA 4KGLA 4W8LA 3DHUA 5D8WA 3VINA 3CZNA 3GXDA 2J7FA 2JF6A 1CECA 5ABEA 3LPOA 2JEPA 2JALA 1V02E 6TAAA 1XYZA 4B3LA 2F1AA 2YJQA 5CG0A 3DECA 1UWQA 4MB5A 1J0IA 4V2XA 1VEMA 5GNXA 1XD0A 2G8ZA 2CETA 2XPKA 2XTKA 1QNRA 4F9JA 1WE5A 1MXGA 4DWSC 1UWSA 4FNQA 2TAAA 2DH2A 4PMQA 3EJUA 4W88A 3MANA 4MNJA 3WH7A 4HZ6A 3ARXA 1KTBA 4HU8A 5E6ZA 4M29A 1HT6A 4UQBA 1HJSA 2J7CA 1UHVA 5BROA 3PZOA 2GUYA 2OSXA 2CBVA 1B3YA 3QGVA 4B3KA 2BVYA 3VGEA 1VIWA 3F4VA 3RMEA 3WFLA 1SMAA 2VRKA 5EFFA 2VQUA 3WH9A 1KCLA 2CNCA 1G0CA 4EK7A 2F18A 3VKKA 5A2CA 1GOQA 1HVQA 4U5KA 1ZBKA 2E4TA 1TCMA 2WYSA 3CMGA 3AS3A 2J8FA 1CXHA 1R87A 2VZOA 4FMVA 3M7SA 3H53A 1GVYA 3IJ8A 4AEEA 5JBFA 5HDRA 6A3HA 1HKJA 4UZUA 4PSPA 1UA7A 1BQCA 3WQ6A 2C0HA 4MTVA 3AS0A 5BCAA 4MDPA 1B30A 2VO5A 2YDSA 1QNSA 2CKRA 1V3MA 4AW7A 1HTYA 1JI1A 3LPPA 1JIBA 3VD4A 1OCQA 2CCRA 3AMKA 3T0BA 3BAJA 1JL8A 3HZ3A 4OJYA 1BHGA 3PTMA 2X05A 4B15A 3GM8A 1TVPA 3NSMA 3AYSA 3L4WA 3SIMA 1NM9A 5D9MA 2D22A 4MAVA 2WWCA 3IAQA 3VD9A 2J7EA 1UR1A 3N13A 3DYPA 1QHOA 5E1QA 4UFLA 4UTFA 1GQJA 2J7BA 1OM0A 4M8UA 1NOUA 1QPKA 3K8MA 7A3HA 1H4PA 4NI3A 3O9NA 5LA0A 2BHZA 1AQMA 2GDVA 3BH4A 4HMEA 4Z2LA 1BVZA 3E1F1 5AC5A 4DWSA 3BXWA 1GONA 4EAMA 2XVLA 3CZEA 1PEZA 4IM4A 3TOPA 5I6SA 1VFOA 1CBGA 1VFMA 1UASA 4BS0A 1XV8A 3M07A 5BWFA 3BLBA 3PZUA 1J9YA 3WDPP 4N42A 1VBRA 3ECQA 3KEHA 1QOXA 4PTVA 4D6DA 1E4NA 1GOIA 2VX6A 4YPJA 4AWEA 1IT0A 2QLYA 1W1TA 1HJQA 3CUFA 4PMVA 2YFOA 1BSIA 1UKSA 4AXNA 2W92A 1LL4A 3FHQA 1MYRA 1M7XA 7TAAA 1V08A 2XFFA 4QP0A 3S6TA 1W2PA 3BC9A 1Q6FA 2F2HA 1OGGA 3OGVA 3GBEA 1PBGA 2X1IA 5HXMA 1FHDA 2J75A 2GJPA 3NDZA 1CZ1A 4FLOA 3CUIA 2CHOA 4U33A 4PEEA 1HP5A 2ZUUA 3OLGA 5EBAA 2OW6A 3ZQ9A 5ABFA 4YHGA 2QHAA 2W5FA 1SR0A 1JFHA 1E56A 1ESWA 3BUDA 2WSKA 1F4HA 1HJXA 1QI2A 2VQTA 2WWDA 4WK9A 3H55A 3WY1A 4U2ZA 1BAGA 1EXPA 5AY7A 4C7FA 1JXKA 1JD9A 1E5JA 4BQ5A 1BYCA 3N15A 2WVUA 4GQQA 3O2LA 4XX6A 1UD5A 3GYCA 1OD8A 3BLKA 2J7GA 4FLQA 3J7HA 4W87A 4XZBA 2WNWA 4MB1A 3U7VA 1ODZA 3KWXA 2FH6A 4UR9A 1W9XA 1DWJM 2G3NA 2FE0A 1X6LA 3HN3A 3WDRA 2WPGA 2F1BA 1GORA 1A3HA 1R34A 4D72A 1M04A 3OB8A 1LLOA 1PJ9A 1QI3A 3VGBA 2EADA 2UY3A 2E8ZA 1PZ2A 1V6XA 4QLJA 1KBBA 4CKQA 4DUVA 4CU8A 1TFVA 3WF3A 4CCCA 2BVTA 1PZ3A 2VR4A 1VAHA 5BXSA
chains in the Genus database with same CATH superfamily
4QDPA 5FA3B 1CE6B 2DL2A 4FLHA 3ZFHA 2AJSL 2G9KA 4DP7X 5D9OA 4UOZA 1YEEH 3LLXA 5AWNL 1OHZA 2NR6D 1UUQA 3OC5A 5E08L 4LTSA 3SCNA 4RK8A 4F3FB 3KBHE 1QYGH 4KH2A 3MNZB 1JEZA 3KTCA 1NELA 4H0HB 4K38A 3T0VA 4NKIH 4LVBA 1N7MH 3PWPD 2YKLL 5BMWA 4IOIA 1G9ML 3QJOA 1HX0A 2Y7FA 4PM1A 3C5ZD 3E2HC 3ABQA 1TEYA 1P7TB 1RHFA 1E72M 2HH0H 2BOFX 5ELIA 5JIPA 4TNFA 3DO7B 1DWGM 5BV7H 1E1CB 3IDJA 2JQMA 4ECLA 2RGMA 2CJTA 3FB5B 4M9PA 4IOTA 3T8MA 3E1ZA 2ZZ4A 4ALAL 1MFMA 1GVQA 1S5WA 3H7BA 3W4RA 4Q33A 2YL8A 1A8JH 3RUGF 4DW2H 4X5QA 1M4KA 3TBYB 4LPVA 3G6DL 2YGQA 4GUJA 1ZQ5A 5DD0L 1Z3NA 1C1EH 3GVVA 4W9FC 3GI9H 1Z8AA 3H56A 2WUBL 4Z7QE 2FDSA 4OZIA 5F7DA 5F7EL 2INFA 3SURA 1ZP4A 2OLSA 5C55A 4HGWB 5C8JA 2DZWA 2V5YA 5I74B 3L1OH 4OCMC 5MENA 2QJNA 3NJ3A 3DROA 2ZOKA 4UBDC 4A1RA 4BQ4A 3PGFH 5GRUH 4ANUA 2OR2A 3VZZA 3T44A 3S35H 1S2CA 1UTDA 5F7YC 5C9WA 3ARSA 5FL0A 2ZRYA 4JO8A 3TBVB 2D2GA 1WCBB 3C0QA 4U6YB 1F11A 3K8LA 5EOCH 4GW4B 1WP6A 4JHBA 4UM9B 5KITA 2VFEA 4F57L 4HJ0D 1XEUA 4H9YA 3HMWH 4PMRA 1FYHB 4X80H 5DR5L 5E70A 4C59B 1QUMA 4LLDB 1AD9A 4RRPA 2AXFB 3SDDB 3HU7A 2X9XA 3EJRA 2J8HA 1T0MA 3V1HA 2I24N 3GJEB 4OCWL 4LNCA 1NFBA 2BVOB 5GNYA 1O68A 2IOOA 1ZIBA 4YL4A 4HCHA 4QXUH 4OGXL 5C92A 3H54A 4Z7WF 3M44A 4ZO6A 2VDKH 1TENA 3CQFA 4O50A 4MMZB 3RUGB 1OAQL 2WTRB 2IANE 4YL9A 4EZJA 3B4NA 1T1WB 1OP5K 1CD8A 4OGZA 1NMCC 5DLML 2DKMA 3BLIA 1FZMA 2WN3A 3LQLA 1TMQA 3BW9A 1UADC 1K3IA 2ZE0A 3H8AA 3ITVA 2WZ6A 1FWHC 3U6XA 3TZVB 5F8RC 1ONWA 2XWRA 1GK8A 2YL5A 2GQ8A 4AYSA 1BQGA 3PHOA 4EOWH 1C08B 4J2QA 4ICCX 3UR7A 1KFCA 3NZQA 5KVGH 1BQUA 4MLIA 2Y2TA 3AC0A 2XWBB 2VVSA 4TUJA 4JY8A 1P2CB 2A5UA 1NCIA 2YK1H 4MJ6A 3VWKB 3BPWA 3EOUA 5CPOA 4JEQA 3A3YB 1DJSA 4LNRA 4U1GC 3DWTA 1W5OA 1TVHA 4ZO9A 4IUGA 3MX0A 3OM3B 2H90A 4HAKA 4XC3L 4DVOA 3W81A 1GCFA 4KPLA 4H7CA 3PBMA 4OQTL 3KVKA 5ADOL 5KJRL 1VR6A 5DD3H 5DGQA 4XZMX 2Y7EA 1D9KB 2IBGA 1G0DA 5D4QA 2Z2UA 4NVTA 1YMMB 5DEGB 2I14A 2D3NA 4F20A 3SUUA 1NLDH 5I2IA 2BTMA 2J1YA 3SN0A 1S9KC 1WAAF 3T0TA 3OKEA 1CK0H 1WZAA 4KT2A 1E7UA 1ED3A 3QDMB 5ALBL 2PGFA 1CJYA 5DVKA 5F1KC 5AENA 2EUVA 3O07A 2PC8A 4BFRA 1KTLB 4XODA 4Z7WB 4HK7A 3VXUA 2AC0A 2AVGA 3BAIA 1IAKB 5AG9A 1M9SA 2ATKB 2FIKA 3DAQA 2E28A 4LLYB 5FX3A 3NPSC 1JPHA 3WUZA 3WFEH 3QI9C 4ZFOL 1T04A 2PCFA 1UR3M 1DLFH 3V4VB 3A4XA 4GUGA 1O6VA 4JNMA 5FAAA 3DENA 1TZZA 1IT9L 4Z9KB 2NSMA 3SGGA 1BLIA 1PIIA 1YDOA 4D7PA 1CC3A 4JPSA 1E4HA 4CCDA 2W59A 5DUBB 3BP5B 1U8HA 3UXKA 2WJZA 5KUMA 1L6WA 3KFTA 1RURH 1E71M 2OI9C 1V6UA 3C9NB 5KSBA 3OV6A 5DUPH 4CQBA 4LQ1A 1RIHH 3ABMB 4APQB 1JVKA 4R27A 5AVUB 1ECEA 1NP2A 5TPWH 3MO1A 3D0CA 4P05A 3N4EA 4M7KL 5D7JB 3UEZA 4AUUA 3LXCA 3UIYA 4Z2GA 5EU9A 1N7KA 4P23D 2FL5A 3FUNA 1Q45A 5K9CA 3FUEA 1XCFA 1ERNA 5D2TA 4OCYL 5LXXA 4JHZA 5IEKB 1XSKA 3D69B 3QI9A 2WAGA 3BSGA 3BMWA 3TPUB 1XISA 3SRHA 4H7ZA 3B9KC 2OMTA 1INDH 3MYJB 4XXDA 1T7XA 3MBEC 1U3YA 3CTTA 4I9WE 5DRZA 3WNLA 2PPDA 4JDTH 4UT6H 4DVRL 1DSYA 1WFNA 1GGYA 2IWEA 1SO4A 3RM9A 3AQUA 1YBQA 4S1QH 3F5WB 2AANA 5I1DA 4PRPD 3IGFA 4OSUL 4N5UA 2Z4TA 3VXRA 5LNUA 4RFOH 4MA1B 3O3EA 1KQYA 1DJNA 1WV7T 4Z0XB 4O02A 4KKRA 4IPLA 2OMBA 1MFAL 5B3JF 1HILA 2J77A 1YE6A 1BD2A 1C8XA 1LG2A 3QXUA 2Q10A 1NGZB 3TFCA 1DLHA 2V3EA 4X50A 2AHIA 1RUKL 2KHAA 1BJ1H 1OB1A 3AQYA 3LTPA 2R7EB 2VLLA 1JCNA 1AK5A 1LWIA 2ZZ7A 3ABZA 4A6YH 3B9KA 3P0VL 3L45A 4PCSA 3TWBA 2Z35A 3MBEA 3IMTA 3DLQR 2QT6A 3MLVH 4HK0A 5DS2A 2F8XC 4OU1A 1VLXA 2IFFL 1JCTA 3EXRA 4BFAA 4PCFA 4KTEL 1A7OH 1UWEL 4IOSD 5JHLL 3SGZA 2J24A 3PP3H 2XN9A 3C61A 4AGPA 2F6XA 1CLZH 3EA3A 3GTXA 3I6KA 4WDIA 1RUPL 3W84A 3CIQA 4POUB 5FA3A 1J8SA 2WM1A 2DQJH 2WBJB 3D2UD 1THCA 2OJZL 4XTRD 3UVIA 5E6RB 4UQDA 4F3FA 5EF0A 3PHQB 3IU4L 5GGRB 3MNZA 3CHCA 3QBTB 4X9FA 1C9SA 5I17B 1NAML 4B9YA 3BV4A 2DUZA 5HI5C 4XMPL 2O5YL 2DS4A 3VVWA 3AXLB 3ABRA 2FB4L 5I74C 6XIMA 1AR1D 3A3WA 2CEQA 2L7QA 2YR3A 3O6FD 2VSMB 1P7TA 3I74A 3Q4DA 4JFPB 3LEVH 4MNGE 3JTTA 3P4OB 4LOEA 2R0KH 3DO7A 4CMHC 1E1CA 2KDGA 1BFNA 4ZCWA 1EHNA 1V6TA 3FB5A 1S7RB 5JMOC 1SM3H 2NXYD 1X9QA 2BLEA 4FP8L 4FFVC 4W93A 5B7YA 2O93L 3EJYD 1EX5A 2YDQA 3QJUB 4WOQA 3U4BH 3UXIA 4CGTA 4FS0A 1L6GA 5LAXB 4S3EA 3TBYA 3GIQA 3NVQA 2Q2EB 1TQWA 5HI4C 1ADOA 5DFTA 1UEMA 1TPEA 3O2WL 3VGDA 1P9MA 3U30B 4P4KD 5DY2A 2GQHA 2J20A 1CUOA 1HCYA 4BFFA 3SDDC 3THQA 3ZTNH 5JUEL 4MGGA 3STPA 3FMGH 4LLUB 1T03H 3WFDL 2YLHA 3TVMD 1N55A 1A50A 5HGAA 3QH2A 3ZE0E 4IX2A 2A4ZA 5FWRA 4HGWA 4HH8A 3ABKB 4XCYB 3BE7A 4PUJA 4F7CB 3L54A 2JCWA 1L9MA 4L6DA 3UNTA 5H37H 3VMOA 4MMZC 1XG3A 3U0PB 4TVPD 3GTFA 2GHWB 3ZK0A 4A05A 1CLCA 1F5WA 3EO0B 1QOKA 1TV8A 3P0YH 3OTTA 3WBDA 4OUIA 3TBVA 5IQNA 3GVQA 1HXKA 1OJXA 1WCBA 3BVTA 1KV8A 3CBRA 3MRCA 1F8IA 3D4GA 1SVZA 2NX5D 3TZVC 4D9RD 4UM9A 2G5UA 1G7JB 3OR7A 4GI4A 4DIAA 1YEFL 2GJ6D 1Y07A 2F7IA 3P3RA 3MLTB 3S5LG 2AXFA 3FN3A 3CPRA 4W4OC 3VGAC 1RBOB 4P2RB 3INUL 1UEYA 4O5LL 4PBXA 3GJEA 1BWMA 4CD4A 1EGMA 2CBPA 1O9WA 2C16A 3WUFA 5CN1A 1HIML 2YX0A 4PTTB 3VWKC 5FHAL 4YHOL 4HPJA 3DJTA 4MMZA 3RUGA 2B4GA 4I2XE 2WTRA 1YEYA 1I45A 1B0RA 4OFIA 5D09A 3AQZA 5CZJA 3N6JA 2OXGA 4WCYH 4HBCH 5L9DH 4L4VE 1C5CL 3FDGA 2XZAH 4G8EA 1N2RB 3PFQA 4KKZA 5JIQA 2IJ0C 3PBVA 2DV0A 5BW6A 4NIRA 1D9KC 1UG6A 4MPKA 3G7TA 4ZENA 3Q48A 4I5BA 3KCOA 3KGUA 1MG3C 3TZVA 1D5MA 4DO7A 1K9FA 3LY0A 4PYHA 2PRMA 1LYXA 2KDYA 2QQLL 3W5MA 1FWAC 4NO0D 3NP4A 4JX6A 2IXQA 4CW1A 4W4OA 2YA2A 4RGMB 5L2KB 4GI9A 3ECWA 1F3RB 7XIMA 3PZTA 3WF2A 2XWEA 2M8XA 2B59B 3O3RA 2XWBA 5I00A 5EEYA 1P2CA 3V4PL 4IOFC 25C8H 2EDNA 3VWKA 3WIFA 4WKHA 2V9DA 5ALCH 5LBSH 1JNLL 3O16A 3H70A 5K9JH 2E1DA 4DFIA 2DZEA 1U3HB 3NJHA 1AGCA 2FQDA 3FJ4A 4AZIA 3BCFA 1EBGA 3GDMA 3ZN6A 1J01A 4C4KO 4JM0A 2A6NA 4N6RB 4NRZB 4Z2IA 1T8QA 3BGFB 5IOKA 3ZSSA 1VFUA 2VM8A 5F3HB 5AZ2H 4M8RA 2E67A 1D9KA 5GISH 3MVTA 3BSMA 3GS6A 1YEIL 4K9EC 1A53A 3RVWD 1AE6H 4PYGA 4HT3A 2EDMA 3QDMA 2Y5TB 4H1LG 4MNKA 4APQC 1NDZA 3UTSB 2C9VA 5I79A 3H3BC 4Z7WA 3W1ZA 1RFDL 1T3FA 1GOKA 4ZNEA 1IM9B 5AVXB 1OFPA 2VLKA 3RVXC 5F97E 2ARWA 5D7JC 1G43A 1TQJA 3UAJD 3WK3A 2D7QA 4NZRH 1MPAL 1WC7A 3BIKB 4LLYA 5HHVL 2MHAB 3DK0A 4S2SA 4FQLH 4WUUA 3BKYL 2GJZB 4QHKI 2D7TH 4YGAB 4GAYA 4QRFA 4ZDHB 2N7SA 4KUCF 5D04C 3V4VA 4MNQB 4S3CA 5F1UA 1ADQH 4AWTA 3RNKB 2OWWA 1QG3A 3O15A 2GVYA 5DUBA 2A0NA 3BP5A 4F8PA 1F3DH 3JSSA 1H63A 2XWTA 3PPCA 3QUKB 3GM0A 4QRQB 2PTZA 2TYSA 3C9NA 3KLQA 4MZ2A 4H9TA 3SYCA 2LHAA 5IMKA 1V3KA 2J25A 2FZ8A 2F53E 5EFIA 1Z5YD 1KCRH 3UBXG 4APQA 4J3OG 1A4JB 1JPGB 4ZQPA 2GG1A 4CVWA 4ELDA 4MA1C 5D7SL 3RJOA 3BDKA 2VMEA 1AHWC 1GKRA 4IWWA 3ZL2A 2BZDA 3SUVA 2EZ0D 1VCFA 4Z17A 2VWEE 3L5XH 3QY7A 4UTTA 5E9DD 1LDPL 1U8MA 3NZ8B 3MJWA 1CLYH 3UTTB 2CBQA 3ZLQC 3UR8A 2ESCA 5IEKA 1OY3B 3D69A 5IZ7A 3TPUA 4WK4B 4MY1A 3SPGA 3NN8B 4NJIA 3H6JA 1SO6A 3JZYA 3MYJA 4HUKB 2P8CA 3HB9A 3FOKA 3G5ZB 4AU0A 1WAAA 2G4FA 1Z7AA 4TQTA 4ZQCA 2NLJB 2BG5A 4FTDA 1VZIA 3JWNE 3OPZL 2CIIB 1PAZA 5EG6C 2LGNA 2Z2BA 2P76A 4RE3A 1TQCB 2HJKB 2XWCA 1UXWA 4NJ9L 3WOVA 3LDBB 4BZ2H 4X5WB 1CECA 2F54E 4F40A 4N0FB 2E7FA 2PDIA 1AHWA 3VRJA 4X6BB 5AFAA 3HGSA 4Z0XA 4X9SA 1UWGL 3P9MB 1QEXA 4DJFD 2PYEB 4JW3A 2GOUA 3EPMA 3BLDA 3D85D 3ESMA 1X3DA 1NGZA 5DHEA 3RLVA 2ZYIA 4ADIA 4Q8BA 3DX9B 5FC9A 3UYPA 1B0GA 1ZTXE 2R7EA 1SMAA 4QCIB 2VQUA 1KCLA 4HCDA 3LRSA 3SRDA 3VKKA 5ECVA 5GGUB 3AS3A 3LS9A 3UU0A 3ZHFA 4IIZA 1WUZA 2GJ6E 1KJVB 5FUOL 4NBZB 1GC1C 3FV9A 1R1CA 5EDXA 3EA1A 4NAEB 2R2HA 4K36A 4B5XA 4WFFD 3FU8A 2CCRA 2HRLA 3MODH 2VDOL 1DQKA 1F58L 4XBKA 5B80A 3GIPA 4DNLA 2ODIA 4K94H 2OR9H 5T8IA 3ZQWA 1JUKA 1HCZA 4HFWB 4XP1H 3LS5H 4PLJD 4GJ1A 4H25B 2ITCB 2HS6A 2X1UA 1PVNA 2BHZA 1BTMA 5IB3B 2QUVA 3SJVE 4GHRA 2O1AA 3REQB 4Y4KB 5CPLA 2JJTC 2W27A 3O45B 4ADTA 5I6SA 5GGRA 3ZHNA 1FVCB 3DNKA 5GSRB 5I17A 5B4MC 4RFEB 5I26A 3TIEA 1XIEA 3C8DA 3GTIA 3I9GH 5E4AA 1GOIA 2VX6A 3AXLA 4HWBA 4L1TA 4R7NA 2YCLA 2YAMA 1VIZA 4PW3A 5DVMA 7TAAA 3V8OA 3PWLB 3TEYA 4P3CH 1NGPH 2EDQA 4N2LA 3TEWA 3UGVA 3ULUD 1TTAA 3TESA 5AD0B 1S7RA 4U33A 3APCA 4ZMTA 1REQA 1EZWA 2CLHA 4CQ9A 3BUDA 1Z9SB 4KY1L 1IQWL 1TTQA 4DB7A 1V10A 1EWHA 1JZIA 4LSSH 4RDYA 4JVPA 4HJEA 1PO9A 3T4YA 3U7VA 4DZIA 3QDJB 4JFED 4W9ZA 4UR9A 3SDYH 4AY7A 2JJTA 1SQ2N 2E8ZA 2A1YA 3BRDA 3JWDH 4LLUA 2XWXA 4CU6A 1F4XH 2YSSB 3KL3A 4JFSA 4JY5L 4XCYA 3O0LA 3I9IA 5HK4A 3IMBA 4N2OA 4F7CA 3DHFA 1MHHA 2DT0A 3ME3A 1BWWA 1YAIA 4ANKA 1ZOXA 3SBPA 4NQDA 3WF0A 3U0PA 1POJA 4OLXL 2WWKT 4GMEA 3E12A 2CHRA 5A6KA 3EO0A 3SE3A 1AG0A 2P1YA 3BVNB 4IMFA 3MJYA 3G3DA 1SJVA 3SN6N 3QCUL 2YD0A 3ML9A 3QQ3B 3BFOA 1T0OA 3F2BA 1OCNA 1Z6JT 2XA8H 4TPRH 2BNQE 4CNPA 4L1LA 2CUMA 4K3DL 1JPIA 4GG9A 2J55A 4P3WA 1G7IA 1SXZA 4RGMC 5DWPA 3E0IA 1YNKH 3HMXH 4JHAL 2R4SL 3I85A 1GH7A 4YXHH 3MI6A 4GG6F 2VXUL 2X4SB 3M0HA 1KIQB 4GB9A 2ZCGA 4X0KB 3UPAA 2VXQH 3WJMB 1F74A 1NBCA 3R7QA 3HC0B 4I9XA 4R3UA 4U3CA 3ZDXE 3EFFB 2DV6A 1R3IH 1U3HC 3HBPA 1XYBA 4PJ8B 1LBLA 4U0QB 1SYSB 2A38A 1DWFM 1T1ZB 5JTWA 4US5A 3ARTA 3BGFC 5TH2A 3V36A 1T7YA 5F9AC 1UCBH 3RL1A 3DYMA 3VIHA 2XZ7A 2D4FA 1SHXA 4ZFCA 2EVHA 1QNIA 2I26N 4J3VA 4F7EB 2BC4B 2AK4E 3WJLC 1HXYB 2NZIA 5IW1B 3C8FA 3VFMB 1HO4A 3VFPA 4LOCA 2QQNL 4JQIA 2PWGA 4ZRGA 3MKKA 3GXMA 2B59A 4XP6H 1SPQA 1KB5B 4EUPB 4LSPH 4PJ5D 5I8CA 1XDMA 2W0KA 2BY2A 2WXFA 4Y8AA 1DJQA 1U1JA 4QOKE 2WW5A 2WB7A 5H2BB 2GI7A 3IJLA 4ZUTB 3WLMA 4MJID 4P7LA 1SYVB 1U3HA 2UZ9A 4AVOA 2WHVA 4QIUA 1JZ3A 2LU5A 3GKFA 2QYGA 2P5ED 1DSFH 4N6RA 3CUZA 1O1ZA 1BLNA 2HT3C 3L95B 5D2LA 1NANH 4BH7A 2ESVE 3W7HA 2ZZUT 1XCTB 3MRRA 3P6LA 4LDEB 1EC8A 4HCRL 2X89D 3S3SA 1X44A 4AQEB 4GG6B 5I23A 3WJLA 3LKOB 4LPXA 4GZ7A 3LS4L 2Y5TA 1HYSC 4JK0D 3M1CA 2EUZA 3N3TA 4NHVA 4WEEA 1VESA 3MVIA 1LO5B 4XNYH 3NJIA 5IJKC 4PMZA 4YN5A 1J0KA 5D7EA 5EMMA 1HKKA 3VNYA 2APVA 3ZKXB 1MQKL 4Y0GA 1OGTB 2PF6A 3N2XA 2GHZA 4LSTL 2OODA 2WJ5A 3QEGH 4PL1A 3CHSA 5HPCA 5IB5B 1DHKA 2R1NA 1Q6OA 2WXJA 5AAWA 1E0UA 5JOPE 2GJZA 5IM7A 4XNUH 3PANA 4ZDHA 1YYLH 1MCCA 2X1WL 2VXNA 2AJXL 2WQRA 1NCGA 1A6AA 4PHXA 4HJIA 3QHTC 2C71A 4PRWA 1I7UB 5CZ0A 5TE7L 2F7PA 2WTPA 3O4LA 4PS4H 4RMWA 2Q76B 5IVOA 3QUKA 4KZDH 1W2VA 5A1AA 3UH8A 1PZCA 2QW5A 2YXFA 3JVAA 1TQCC 4AMWA 1NKRA 4LLWB 5BVJB 5D70H 2GT9B 1XH2A 3U2SB 2J62A 3HBGA 1HXMB 1JPGA 3H7VA 1KJ3H 1ZLSL 1TJIL 1DQJA 5IJKA 2XLLA 5EIQA 3ZTJG 4PSRA 5ILTL 2B7PA 3VK5A 1UOKA 4C56E 4JFHD 4AZGA 32C2B 1E15A 4WJXA 4LS1A 3NZ8A 3UPBA 4ZODA 5I30H 4WHBA 1CGUA 3FOMA 1CG9B 3UZJA 3VI4F 3R4DA 3VIPA 2PUZA 4FXFA 2P48B 3WN5B 1FE8H 4K3EL 5HNNA 2A9ML 5TK4A 4HWZA 3L9YA 5MEND 1KGUA 3KTSA 4WI8A 2JLLA 3KPRE 2CIIA 1MUJB 4W84A 2UZYB 2Z1XA 1RZIA 1QR1B 4EIUA 4C54A 4XCFH 3MCLL 1N6QH 2O26U 3GC2A 3RHGA 4KRTA 1FYTA 5AKSA 1YDVA 3MUXA 4PU2A 4FGMA 3NCFB 1F97A 3ATAA 3L4ZA 4N0FA 1BXAA 2V30A 4E9QA 5G2NA 2NUPB 5HHNB 2EDYA 2PZNA 4PJAE 4AQ8C 4FS9A 1C16A 4XO8A 2O5NA 4JO4H 3CCHB 2JELL 3P9MA 1Q0EA 2PYEA 3P40A 4Y4KC 1DOSA 1AXSA 2KZBA 2PD9A 3GDLA 1XBXA 1GPFA 4WHTB 4BE6A 3UOAB 3DX9A 3BEWB 4GK8A 3WFAA 4PWJA 5KYYB 2WKOF 1E2WA 5GGUA 3TM6A 4H5SA 5E4OA 4RLDA 3V6FB 1KJVA 3GK8H 4UBDD 1GOOA 4ETQA 4OKDA 5F9OH 1H3UA 1L0PA 2W9DL 1ZZMA 1A7QL 5CPSA 2A6JB 1K3ZA 5DTFA 1KN2L 4WQOA 3CUXA 2XRAH 3NVTA 2J8UB 3GSNH 4US6A 3OVQA 1DVXA 4F5CA 4WI3A 4H25A 1E4IA 1ZALA 1U8KB 1XGTB 4AQ8A 2ODOA 3T08A 2CAKA 3PSVA 3JVGA 1YZZA 4JTDA 2NZ9C 4RGND 3NQ6A 3VI4B 2G37A 1ZPLA 4Y4KA 3BPNB 1MCNA 3L3OC 4K39A 1EGJL 3QK0A 2JKPA 1FVCA 5GSRA 3V9CA 3DUGA 2PDHA 4RFEA 2B1HL 3F7JA 3VXOA 2X4TB 2ZUNA 4L29B 4I0CC 4IK6A 1PMYA 5BXRA 4DGIH 4KI1A 2W07B 1ISWA 3EYPA 2Y7SA 3VTTA 1KGYE 3PWLA 5H35B 3FKUS 1PNDA 4X0NA 1VLWA 4ODUB 5AD0A 5BOPA 3HQOA 2VR9A 4FF7A 3MW7A 3MJGX 2DORA 1Z9SA 1XUUA 1DBAL 2ZWLT 1X1NA 3E3QE 3TN6A 5AVZB 4ORGB 4V2BA 5FGCE 4R8WL 2Y7OA 3VE9A 3GAKA 1UZ6E 3LBMA 4XQ6A 2FBOJ 1A7NL 1QPXA 2NYZA 4F8NA 3QDJA 4U10A 5FECB 2Y70A 4C4UA 4FFYL 3EYVB 3B9EA 4RDBA 2QTEA 3P84A 3L3OA 2RH9A 1AXIB 5I8EB 3TYGH 3QIWC 3A22A 3FAXA 4UMSA 4HQQH 3BP4B 4UTCA 3W3OA 1C5DA 3VXUD 2YSSA 3KTXA 2VZTA 4XVTL 1BEXA 3AMCA 2JJWA 4CQ8A 2P9RA 1HINH 1NGXB 3TW9A 3VZXA 4TVPL 5D71L 3MJ9H 1LOLA 4QG9A 4BV1A 4PJ8C 1N0LB 2Y88A 2VTFA 3BT2H 2QTVA 2K0RA 2WLLB 1LO4H 3BVNA 4QRBA 1IFHH 3AADB 4UDTB 3QQ3A 1BX2A 2BOLA 4U1SB 1UD2A 1LT7A 3NT0A 4DEUA 5FK9B 3L5MA 3F2CA 1PFCA 5DX7A 4PLKD 3ULVH 1US3A 1PD1A 3OKLB 1D7DA 3C2RA 3QIWA 5L7XL 4Z1CA 1BVWA 4LSRH 3FB6A 3VXMB 1CFSB 4ODWA 3LZRA 4DF2A 4JFUA 4ROPA 3IJIA 2HLFC 4YEEA 2JKSA 2X4SA 3IDGB 2B5IC 4FQJL 3V8CA 4X0KA 3NCOA 4C5YA 5DUMH 1KMGA 1ONQB 1ZCOA 3HMCA 2XPZA 4UTBH 5E8EB 4QFUA 3W2LA 3EFFA 4B41A 2XJ7A 2XVNA 1WDDA 1G9EA 2XU9A 1HQTA 2P47B 3QI9D 2J9XA 1SYSA 4WUIA 4HEPA 1T1ZA 5DURD 3RX4A 4G1NA 4PB0H 3UNDA 4IL2A 4GPNA 2XSKA 4O4VA 3HG4A 2PF0A 3IIXA 2QDVA 2E6FA 4F24A 4N0YH 1U2CA 1CD1B 1M9HA 1LGVA 2OLDA 3UTPE 5E8OB 1W0MA 1C90A 1CBVH 3P2TA 1HXYA 1Z0MA 1Z48A 2AGJH 2D23A 3VFMA 3TA3C 3BURA 4O10A 4RXGA 3VXRD 5B39A 3QEHB 2UY4A 4O1BA 3AT8A 2EPKX 4ZQOA 2CK0L 3QZPA 1KB5A 1GW0A 1EK3A 3ZKXC 1YDYA 3O4OB 4WK0B 2ARJQ 2K45A 5H2BA 3DC8A 4NQEE 3EX3A 3BDYH 1RIUL 3BUTA 1QP1A 5DJ8B 4I90A 1H6TA 1JNHB 3FRUB 2DZUA 4XWOC 4B5NA 5BRZD 3B9KD 3LQAC 2C9SA 3WD5H 1RZMA 4ANWA 3NJVA 1ZEAL 1YIXA 1ZKAA 2Q02A 3L95A 4MXVF 2VYOA 5LNWA 4PJ7A 1XCTA 2A7PA 4JDZB 3C5XA 1NGWA 3KJ4B 3QEUA 2R1WB 3KLHC 4AQEA 1KJMB 4GG6A 3UCQA 2WZTA 5K2ZA 4J4KA 2XN9D 4IIHA 3TA3A 3BO9A 2GOKA 5XIAA 1WAPA 2OZ4H 4GAJL 3IEBA 1LO5A 5IGXH 2PGEA 4MA8H 3IANA 4R9HA 5I15L 1OGTA 4PRHA 4R9XA 4NX0A 1ZL1A 1SXSA 4UDUB 4G7RB 4HBQA 3UXAA 2BVEA 1XI3A 4Y8FA 4P99A 4QQUA 5T1KB 2UY7B 3LCWA 3WN5C 3VIFA 2VVNA 4AUJA 3AMDA 1N9PA 4HD5A 4LGXA 1I7UA 3LCLA 3QM3A 3EWCA 4E8GA 1MEHA 4RGNE 4PB9H 4OIIL 5HVGB 5EEZA 2X6BA 1QNQA 2PWDA 1G1OA 1RHCA 3WLBB 4LB3A 2FAUA 2ITDA 5BVJA 5LNDA 3U2SA 1WZLA 5GJTH 5DJZA 3GR8A 2EE6A 4UIMA 1R8LA 2ADGB 1FVDB 1LO2H 2LV4A 3B05A 4FJZA 4RL3A 32C2A 2XI9A 4FKEA 5FYKE 1NAL1 3N12A 3EYFA 3WLWC 3WS3B 1CG9A 4X8XA 2NV9A 3GSRA 4PMEA 2J72A 1X1ZA 4IPIA 2XWZA 4FR1A 5HI5D 1P69B 3WN5A 3RWIA 2E3ZA 3W6LA 4JGNA 3RJYA 4R4FH 3CX5K 1AI1L 3DYOA 1FHNA 4DUWA 1O7SA 4H8HA 2B31A 4OZ4A 1YECL 3L7EB 4BXSV 2FZ9A 1UR0A 4TOYH 4X8CA 3O6MH 4IXXA 1QR1A 2BNRA 3HQPA 1WAEA 1JPTL 3MRFB 4KJYB 1RA5A 5FF4A 5JDSB 4FFVD 1HCVA 3IGUA 5FYLL 3NOEA 4JN2A 1Q6LA 4HMCA 3CCHA 4WDTA 4UM9D 2CYGA 3TU6A 4HU4A 2YQ3A 4KJWC 4EWND 3RGBA 4BSVA 2VRAA 3I7SA 1CXFA 1VYRA 3BLOA 4KTDH 3JR2A 2NQ5A 4KAQL 3PNUA 1VADB 1KFAL 2ALWA 8XIAA 1INEH 4NNBA 3MXWL 3MA9L 4UQ2B 2FSDA 2PXYB 2GGJA 2YXWA 3IUIA 4UTAH 2G3JA 3KM2A 4UZSA 3HFML 4PUKA 1CF8L 1BXUA 3V6FA 3W2MA 3F64A 4UANA 3EJTA 3TH6A 1U5JA 4WFEE 1VFBB 5CGMA 2A6JA 4Z7AA 4F2EA 4IYKA 2VDIA 3HB3C 2FTPA 2HRPL 3FTVA 2R8WA 1GY2A 3SUTA 1QRKA 2AQPA 3V0VB 4XC1H 2ZWYA 4JRXB 4FX7A 3VI4A 1TJHH 4ZQNA 1MFDL 5KS9E 4FXKB 3VH8B 1MWAB 4NQSB 1UOVA 1TQBB 1FPTH 4E9RA 2AJYL 3BW3A 4RZCB 5I8KH 4GW1A 1JE6A 5SWZB 3DKLA 4F1SA 4W9KC 4M48L 4YDMA 3EWWA 4TSAL 1ZLUK 4AG4L 4Z7NF 3IWVA 2X4TA 5CG0A 4L29A 1RCQA 2ATAA 1ZTMA 3EWBX 3RPKA 2XPKA 3K3QA 4DPPA 1E5YA 4QEHA 5IBUB 2W07A 2EXTA 2GEQA 4NZUL 4Y9MA 4W88A 2AQTA 2QNEA 1WF5A 3VWKD 1HJSA 1KM5A 3PZOA 3ULUL 3TOYA 4ZFZB 1UCWA 3LZFH 1Q90A 3UGEA 1Q3NA 1SHWA 2CNCA 4QYAA 3TJHC 3M0MA 2G2RA 2NY1C 3R1GL 3ESVF 2E6QA 3CMGA 4K7YA 1RULH 3IYLW 3KHJA 3NFPB 5CJQL 5F2FA 1YY8B 4NUMA 5EA9A 2VZOA 2NDGA 1NCCL 2A73A 4ORGA 5GS2D 1BV8A 1GTFA 1HKJA 4PSPA 5CEZD 1R3SA 1D9KD 4LOUD 1CS6A 4U6XB 4LVDA 1J9SA 1V3MA 1HTYA 4NENB 4QNPF 3S98A 1ZHKA 4ZPVB 3RX5A 2Y63A 5I8EA 4MAVA 3MRMA 3QDMD 3ZS4A 2RCSL 2Q71A 4XX1E 5ITFB 4MJ5B 5BRZE 3BP4A 2A83A 5E1QA 3K8MA 3N40P 3O9NA 4HK3J 2MEJB 2VLKD 1MUWA 3F7RA 1SBSL 3GX9A 3BXWA 4IOFD 2IDTA 5BVPH 1VFMA 4HF5H 4MYWB 2VR6A 1WFIA 4WUUD 1IEQA 4E9SA 3HVDA 1MNSA 3TS8A 3RR4A 5T33L 3KEHA 4AV4A 1QOXA 2P3EA 4UDTA 4JO3L 1OK4A 5C7HA 4GGBA 2FIQA 3QY6A 1UKSA 3BUYB 2K6YA 5A7BA 1XR2A 4LBSA 1RLWA 2F2HA 1IM3B 3IFLH 3KR3H 1PBGA 3P02A 3OZ9H 4Z7NB 3PL6B 3H22A 1JUEA 4KFOA 3WLIA 1GTNA 4DN4L 4OM1L 5E0KA 3OKLA 1AAJA 2VQTA 4M4RB 3X1NA 4QSFA 3H7RA 1WA2X 3SOBH 1VYPX 4APQD 3VXMA 1CFSA 2VDNL 3N15A 3CLEH 4NGHH 3IDGA 4ZD3L 5I18L 3O4OC 3GW0A 3RVXD 4WI0B 3KBJA 1ONQA 2J6EH 4KCVA 1I3GH 2VDQL 1M6OA 5E99H 3K6DA 2NVAA 5E8EA 5JIDA 2AABL 2H8ZA 2KZKA 2B81A 1LO0L 1OSZA 3UJJH 5I19L 4K1WA 1EPXA 5FF7A 2BIPA 3PWPE 3UP6A 3S4SB 3O1NA 3X3GH 3AT0A 4KESA 4HZ8A 4LEOA 1R0AL 1JVLA 4GY1A 4QISA 4DNMA 4B9PA 4RNRB 4PG2C 3EDDA 4Y9BA 4ZX4A 4P3DA 5ANMB 4ZFMA 5D9PA 2PW1B 3SJNA 3ZRSA 4YTUA 1N8ZB 3KJ4C 3QQDB 1RL1A 3GF8A 3GNXA 1QBAA 4ATWA 3NIDB 3HURA 3EYSL 1YYAA 3VKBA 2B2XH 3ZUNC 1JRHH 1MJ7H 4BEUA 4FEMA 3QEHA 4B95C 1A1NA 3T0EB 2YMXL 2A6IB 2DZSA 1BWKA 2R69A 4AYFB 3NCXA 5D2NE 1G6RB 4YSAA 2YN3A 1EDYA 4N8UA 4YWSA 4O18A 1D3CA 4KCUA 2A6DA 3EGXB 2XGBA 1PZBA 5DJ8A 3FFCD 1JNHA 3FRUA 4S3FA 1E27B 2NUTB 4RWHA 1EQPA 3OA3A 5CZKA 4L8CB 5TK2A 1QPOA 3DKHA 2VC9A 2INZA 3G6JF 4FKHA 4YDJB 5DLCA 5HR6A 2GUUA 1YY9D 3EG9B 4PG2A 3QXDB 2QSCL 2R9HC 1SF5A 2BGSA 1QMUA 1OCOB 4JDZA 2MCAA 1HE8A 2ISSA 3B37A 5D30A 1BBDH 2XTJB 2R1WA 2BP5M 2GC7C 2DEPA 1QBLL 4FF9A 1E6RA 1WXYA 4IHBA 3NYKA 3NR0A 4EBQH 4IICA 1NFIB 3DSFH 5E2WL 5JMUA 2C14A 1X5IA 3T2NL 2Z25A 5IXEA 1XGYH 4AHOA 2Z8WC 1RUSA 5JDJA 1RXOB 3FS9A 4P0DA 2DLFH 2X70A 3DHPA 4UDUA 5J04A 3R10A 5JORB 5H4ZA 5T1KA 1MCWW 2UY7A 3F05A 2PODA 3KJ6L 4YHNB 3QJAA 4OD1L 1ADWA 1UB3A 4TNVF 1UENA 1CE6A 5DMYA 5EYWA 2NY3D 5DF0A 1KENH 2IQ9L 4HDIB 4IUOA 2G41A 2YW3A 4C1NB 3T4CA 2ICWB 5DRCA 4OCXH 3ARVA 3WLBA 2ZWZA 5LA1A 3PUUA 3HQ1A 4QRPB 1P1ZB 1JGIA 3ABLB 2J2ZB 3KPSB 2QHRL 5FF0A 1E67A 3PP7A 4QQ3A 2BWIA 2QSVA 4OCNC 2ADGA 1EYEA 2W80C 3TWCH 3H42H 4CEXC 4ES8A 1FVDA 4Q8NA 3QXTA 3RX7A 3WD4A 1CLOL 4CL7A 3FUHA 2W9MA 1E4LA 3FOLB 3G6JB 1QHZA 3QORB 3P0WA 3WKQA 1DIEA 2K4WA 4XO9A 3WS3A 2X0UA 3WGUB 2V81A 2XQYG 4EMZA 5J9PB 1PE1A 3VCRA 3PNZA 2Q3AA 5B4MD 1NCWH 3LI0A 1AFVL 1E9QB 1ZDSA 4Q4EA 3ALWA 4AEIL 4OJCA 4Z0JA 3VJ6B 1ZU8A 3G2GA 4S3GA 4H88L 2QQKL 4IMCA 1B3WA 2WMJA 4G6FB 4NQDD 1T80A 2PYFB 1AZ2A 3NJJA 3AHXA 3H3PH 3RF9A 4KJYA 4NO3B 3IBOA 3CQHA 4Q7DA 2HCVA 1CN4A 5DJYB 4XXWC 5TFSL 3E6EA 4XAKD 1PTZA 1WGVA 5K9OB 4C1LA 2DKSA 1JYWA 3QC5X 1UXSB 4J1OA 4EKXA 3SB0A 5DMGD 3W0WB 4FXKC 4R3SB 2V3GA 1JRHI 5FESA 1W3JA 1TQBC 4F66A 2OEKA 4KXAA 1J05B 2XBZA 5F6IB 2PU1A 4QRUB 2BW5A 2VNCA 3K1GA 3QPXH 1VADA 1RJCA 1O5PA 4U6YA 1J87A 4UQ2A 2DZBA 4GW4A 3ID7A 5C7XH 3ULSB 1V7YA 2WMIB 5CWSB 3GSMA 3LZPA 2W8CA 2FGLA 2BVDA 4LLDA 2MMXA 1VFBA 1KKOA 3SDDA 2BCMA 2PCQA 5ICUA 4LC8A 1FHVA 4XO5A 2QGDA 1UP0A 5AYZA 4US5D 1XAKA 4XXWA 2BVOA 1G0YR 5T9CE 1KNOB 3F01A 3V0VA 3FQXB 2XU2A 1LEGB 4ILDA 1WICA 2WZHA 2KZHA 1DFXA 4MAUL 1MWAA 4NQSA 4O8RA 1T1WA 1GWJA 5K59E 2D8KA 5SWZA 4Q2ZB 3TW6A 1T4WA 4QUOA 3RWJB 2XQBH 1UGKA 3IE4A 2H26B 5AL0A 4KHXH 4EF8A 4BWWA 2BRQA 2MTAA 4H8QA 3EJZC 2I25N 4HKBB 1EXHA 5C07B 1KLYA 4M8QB 2UVFA 3ZX1A 3B8YA 4S1RH 4KW2A 3JV6B 1A0QL 1W17A 4ZFZA 1C08A 4NZ1A 4P7OA 3P3TA 4LO9A 1U3HD 3GC4A 4BFGA 1RCOB 4JKNA 4AHQA 3SKNB 3NL2A 2ZZ1A 1UJ3B 1YY8A 4MNHB 2YRZA 4OLZL 5LO7A 2YO3A 4V1DB 2X2JA 2R8SL 3V0IA 2I60L 4J9JA 2E9WA 1HIZA 1HHIB 3PL6C 4ZPVA 5IR1B 4PREB 4L0ZA 1G4RA 4PRPE 1OL0A 3F62A 3UBHA 1NIUA 3RIAF 1OE3A 5ITFA 4S39A 3DSNB 1D2KA 3LNFA 2FNWA 3KW3A 4X5RA 2VDMH 3QSRA 1OZMA 4YSDA 1YMMA 5DEGA 4QKXB 3G6MA 3QV9A 3FQTB 2WBWB 3UJFA 2EIZB 3B1TA 1KBLA 3BSZH 5J8OA 2B4CC 1OM3L 1KTLA 3ECBB 3MCMA 1BEYH 2DZXA 3QH3B 4O28A 1EEYB 4B3VA 4UMAA 3HNVH 3X1BA 1IAKA 3GNPA 5KYWB 3O4LD 4IPPA 5FB8B 4N2IA 4RDZA 2ATKA 4HOMA 4N1EA 1IM3A 1X8CA 2BIQA 2H41A 4GZJA 4NUQA 1OWWA 4NWTH 3PL6A 3AISA 1MOEA 2ZPKL 1TVBB 5FD0A 2XTSA 4NT6B 3H23A 2JLPA 3FUJA 3LGDA 2F5AL 4M4RA 3C2AL 3VA8A 2NUYA 3PE9A 1P0DA 3C60B 4W7UA 3LQGA 4JANB 1UT1A 1HYSD 5KZ6A 3A6CL 3J8F7 4GY7A 4BINA 3T0EC 4DQOL 5IBTH 4GSRA 35C8H 3ZJKA 1LVEA 2BXYA 4WI0A 5KZCD 1ZGLP 3WUEA 1CO1A 3IEAA 2H6PB 1A14L 2HTKD 3NCJL 2YPIA 1BPVA 1FHLA 3O7UA 1EJOL 4I3SH 3S4SA 5MF5A 4UT9A 3SCMB 3P60A 4MXWH 4UCFA 1XKYA 3JWOC 5D7JA 3UAFA 4EIBA 1GGBH 2CLVB 4BYHA 1NDVA 5I6LA 1U2HA 3RGHA 3N55A 3SOTA 2PW1A 3VXQB 1N8ZA 4YHYB 5D2VA 1UOWA 1K85A 2XTJC 2DQFB 2YLAA 1O5QA 2WO2B 1FYTD 2DI7A 1W3NA 5JIKA 4ROQA 3I4EA 1JK8B 4TX6A 4ADGA 2NQ9A 3T0EA 3L67A 1E3ZA 5U7SA 2A6IA 2ZAHA 3SKOB 4KBPA 1RPKA 4YPGB 4O02L 1G6RA 2KQNA 2RDUA 2PYED 3M47A 4KUCD 3H2QA 1W1IE 1KEGL 4AZ7A 5TQ0L 1F42A 5E2UL 1F90H 3EGXA 2H9AB 3G0UA 1UMLA 4N22A 3F5WA 1SFSA 1TWZA 2G5BB 1BZDA 1E27A 1HL4A 1ORQB 5FYLD 1RJYB 4LPYA 4L8CA 3PBWA 4LVNB 2ANUA 1MNNA 3IJQA 2X9YA 2Y4SA 1VPYA 2V67A 2WBJC 1F6YA 4YXLH 1LM8V 3EG9A 5I1CH 4TVPE 2Y1YA 3QXDA 4QXGH 1E4XL 1EDHA 2WQPA 5B8CB 1JZGA 2CDGB 2W0LA 3L4VA 4EF3A 3GSOB 4M0XA 4M1CD 4OLYL 2QF8A 3CQQA 1HHGB 2DM7A 1NFIA 3S97C 4Q4KA 1K8IB 2BSED 4CN6A 2NX5E 4D9RE 2A3TA 2W95A 1HUVA 1QSFB 2AGKA 4XT1C 1WCGA 4Y4KD 3K1DA 1SJAA 4XCNB 3QORC 2QPXA 4LVFA 2E27L 4NCC1 1TTFA 2C4XA 1C91A 4TTDC 2XY1A 3WLJA 5A2BA 1N18A 1EUNA 5GRXG 4JGJA 3T78A 2BM3A 1KR0A 1NCHA 2P7TB 1AGEB 4K23L 2J6WA 2A9DA 2WBJA 3B9NA 2G96A 2W0PA 3U30C 3FUDA 5L8LB 3PHQA 1C9WA 2VDRB 1UFUA 4HIBA 2WC4A 4MHBA 3W3BA 1P1ZA 1YJDC 3MUZ1 3ZT7A 2QPEB 4HIQA 5AOLA 3WF4A 4X2UA 3KPSA 1S3HA 1TTIA 3KRBA 1E0OB 1ZY9A 2ILLA 4AOFA 4JFPA 3P4OA 2J1XA 3IF1B 3QDJD 2NZ9D 2ZXCA 3RDKA 1ZV5A 4GKLA 5CZVH 4QHLB 5FO2A 1C8QA 3WLQA 2C3GA 4KRPB 1IGTB 4FMFA 4V1YA 5F6IC 2R94A 3W72A 4S1SH 3AIQA 5J9PA 2YRLA 1A66A 1ETJA 1PDKB 1FWBC 1S78C 4PCYA 1I8LC 3L1GA 1PLGL 2GY5A 3CDCA 5LAXA 5T91A 2ZCHL 4JMNA 3GD6A 3FSOA 3IMVA 3VJ6A 2AKZA 5CKAA 3W82A 1GYLA 2YEQA 1IX2A 3MMUA 2Z4QB 4URTB 2BK8A 3RA7L 1J5SA 1RZKC 3A4AA 4YN3A 5F1VA 2JKTM 4TQIA 1KXQA 3ZR5A 4A8RA 1JOIA 4BKSC 1IAIM 2VW7A 4HKXB 3ZKND 5DJYA 2QJMA 3AG4B 4GMSH 2WB5A 3AJ7A 5E03A 3U36B 5K9OA 4XN7A 6XIAA 3TTOA 1UXSA 3WFBH 2GWNA 2DYSB 4Y19B 3SQOH 4R3SA 4B4FA 5IUCA 4N4PA 4KO6A 1ID2A 3Q8BA 2AGTA 1MY7A 4ODSL 2VX4A 1IC4H 1J05A 2JI3A 3F8UB 4O2EB 3GLDA 3QIWD 4QRUA 4AKOA 2ZRXA 4WVXA 2C6QA 4NZ8A 3AXIA 4Z3JA 5E8PB 4BFEA 1I8LA 4ZEPA 1SDAB 3GNMH 1WXZA 4OB5H 3N40F 4LEFA 2DQGL 1M2OA 3U7WH 1D6EB 4E9TA 2AF2A 1KXTB 4I18B 4GBUA 2WMIA 3CZLA 1G7JA 4UMCA 4QXVA 1KG0B 3MLTA 4AVKA 1TZAA 1B54A 1QRNB 4WRLA 4UFMA 5CM1A 4R5TA 3U1QA 1JZ6A 4QI3A 4P2RA 1F8TL 2LLLA 3I75B 4JTJA 4H2CA 1UJ3C 4YL2A 2K1MA 1KNOA 2JBMA 4XNXL 3IDXL 5L4FA 2DWSA 3FQXA 4PTTA 1LEGA 2DUAA 1R5WB 2DQ6A 3NH7H 4S3DA 1JD7A 2CLPA 1YRRA 4MS6A 2EEBA 3Q6FB 1UACH 2NLYA 2ADYA 1FC1A 3L5HA 3LNGA 2B0MA 5HWNA 4P9ML 3TIMA 3CH1B 3MU3A 2EE9A 2AQQA 1ITXA 3WNPA 1N2RA 2PW2B 1UYQA 3SUSA 2H26A 3ARGB 2HLFD 1FORL 2HFTA 2BJML 3DVGB 1SSGA 5E9DE 1QUPA 4OGYH 5CN2A 4AIOA 4Y9EA 3VYNA 2X4QB 3TV3H 2CUHA 1OE1A 2O5ZH 5HGDB 3MKCA 1D6VL 4N8CH 5SWUA 3CU1A 1RK5A 3UGRA 5M03A 5L2KA 3B7UX 3C6LB 3NSDA 1CLVA 3SFKA 4OCSH 2BW4A 1UJ3A 3RN6A 5F2LA 2Q6WB 1HTIA 2JKLA 5CEZL 4HKZB 2JIXB 4HEME 1GXEA 3APGA 2YSWA 2DYPB 4AQLA 3G22A 4Q58C 1HHIA 1CNVA 4PREA 2HE5A 3OG2A 5FYLE 2VSDA 1M71B 2EDFA 1PSCA 3C60C 3ECUA 3W9ZA 1D7FA 3IIOA 5AC6A 3TA3D 2EYSB 1ZHAA 4DHLA 4NRZA 1BYBA 3L7RA 4M6MH 3DSNA 3B9OA 5F3HA 1EA0A 2IKGA 5IQMA 2H6OA 4L1DA 2R4RL 5IBLD 2OQYA 2PDWA 2W0FB 5KSAB 3EO1B 2DM2A 3POCA 2HS8A 3KZSA 4AMKH 1FWTA 4B0MB 1FNEB 4PRHD 2Q8BH 1Q1PA 1KTRL 3CZFB 1IF2A 2JEPA 2WXRA 1XICA 2K7QA 3UTSA 3ECBA 3V4VL 3WTYA 1NCDH 1MRCH 1DHPA 3GW3A 1MREL 1IM9A 3SCMC 1EEYA 5KTLA 4ASTA 4WNQB 4AQAB 1HWGB 5KJ4A 1QPPA 4MASA 1ODAA 1V8HA 1M7IB 4DZBB 1MXGA 3WGVB 4FXTA 4DAIA 2WXMA 4PMQA 3MANA 5KYWA 1KTBA 1MKFA 3U9PL 5DFWH 5FB8A 3BIKA 1BM3L 4BJLA 4WFFE 4Y9NA 2MHAA 1XLDA 3NEVA 3T05A 3B9VA 1VIWA 4YHYC 4K9EL 1QWGA 5FOJA 2VWTA 1RPXA 5EFFA 4MWAB 3V6OE 4RH4A 1NMAL 4NT6A 4B0MM 3KLHD 2E4TA 1TCMA 4MNQA 1IEHA 5HDWA 3C60A 1EQWA 4JANA 2OQJB 4I77L 3V4UH 5JBFA 2F9BT 3FH5A 4NPKA 2YGPA 3RNKA 4U1LB 1RK7A 3WBYA 3ETBF 1LE9B 4J3OH 4GQ9L 3M8OH 3LPPA 2DQCH 4KC3B 4M6UA 4QRQA 1TVPA 2H6PA 3LDBC 3AJXA 1K4CB 4EAYA 4G7YH 5IHHA 3ZE2F 4DGYH 1A4JA 3QDGB 5EZOH 5DWUH 4LVNC 4JN6A 3SCMA 4C57C 1FWRA 1UUOA 3M6YA 5D7KD 2CLVA 2J8UF 2I85A 4HGXA 3ULUE 3S9YA 3MP5A 1XB3A 1AGFB 4OWGA 4HNVA 3BGGA 3UTTA 5BUPA 2BNRD 5LIWX 2E5BA 1JFQH 3DU0A 2CCVA 3ZL4H 3ZE1E 2I17A 3LEYH 2R56L 2O5XL 1UB5B 3NN8A 2F9RA 4L6HA 1M7XA 3G5ZA 4ONVA 1JK8A 4MBRA 2BSLA 4JFEE 4A2DA 3SKOA 2NLJA 5FOBB 1UC5A 3NDZA 1F9CA 3PM6A 1Y6KR 4A39A 3KBWA 4BCXA 4P8QA 5AZEH 4DBUA 5L88L 1VRDA 3N1PC 1CB2A 4C65A 4TSBH 2HJKA 3WLWD 4X5WA 4BQ5A 4N2GA 2ABBA 3R1ZA 3P3YA 1II4E 4XIAA 1L9SA 2G5BA 3ZY7A 1ORQA 3FPXA 2HX8A 4X6BA 2OJPA 1KJ2B 2Q87A 1H6FA 3FQWB 4IBUA 3VGBA 3MGOB 4WCJA 2YPVA 5FJIA 4OUUB 2Q8LA 2CDGA 3FQ2A 4XVOA 4DUVA 1TFVA 4X6CF 3GSOA 3VXSB 4QCIA 1WISA 2X9ZA 3DOSB 4DN3L 4U2YA 1I9EA 3GSNB 2WQWA 2XVPA 3NPXA 1K8IA 3GWJA 3MFGB 5CP3A 4JCWA 1QSFA 5A6SA 1HJUA 1X9UA 5LIUX 4HISA 4IK7A 5AB2A 3VUAA 3ZE2B 4NAEA 4YJ5A 3VCCA 3MMWA 3LH2H 4LPTA 4XCNA 4KRPC 2DH3A 4KJWD 3FQ1A 2QUUA 4F58H 1PZDA 1BZ7B 4JICA 3U1SL 2WXOA 1TE1A 4HFWA 1WUFA 5E51A 2AS5M 4HWBL 4YSOA 1EMTH 4Z0BH 2ITCA 1OQFA 5IRPA 3H2AA 5IB3A 1AGEA 2VJXA 3CHFA 4O9HL 4MA7H 3REQA 2YB4A 4RKAA 1GC1L 2F6UA 3O45A 2FX7H 2DZPA 3AXKA 3MBFA 4JUSA 3CFQA 1TJ0A 1TYRA 4K55A 4WI9A 4MMWA 4WO4B 3WJZA 1DIOA 2Z6FA 5EF2A 3GIVB 3HB3D 3EKZA 4PW4A 5CG7A 4H04A 4BZ1A 5IBXC 4CNSA 1J5IA 3RU8H 4HC1A 4I9TA 2X4RB 1J1OH 1DQWA 3VOCA 2DVXA 3IF1A 2O6EA 4HJJL 1MJ8L 3ZJ8A 4OLUL 1WZKA 4BQ6A 2F5BH 1KBGL 2NWSA 4QHLA 2VSCA 4A2RA 3M64A 1H0DB 1NPJA 4RWYL 2FWUA 3W25A 3UBXI 2AQSA 1EDQA 3LKNB 1FNFA 2WBKA 3QZMA 1LBMA 1PDKA 4PJ5E 5I1KH 4X6DF 1HO1A 5IFHL 1WFUA 4N0RA 2K3TA 5HYIA 4NX5A 4I18C 2DDQH 4X6CB 3LH8A 3S34L 2XIDA 2ZXEB 4MJIE 1PSKL 2QVTA 1MCDA 2Z4QA 4R90L 1JK9B 4L56A 2X3CA 2IBZX 1FWCC 3CIXA 1AFSA 3MLSL 4LAMA 3OU8A 4PB4A 2P5EE 4PGCB 3SE8L 3OGCB 3TJHD 4HKXA 3Q2DA 2NY1D 2D20A 5DU7A 2YCIX 3ZTCC 2DT2A 3HFFA 5I1EL 3U36A 1VPXA 1KCUH 4K5NA 1LL1A 4G6JL 4HNUA 1V0LA 5DO8A 4DBWA 1RZQA 1SBBA 4Y19A 2HT2C 3MR9B 4OTKA 3GI8L 2CKBH 1T21B 4R83A 2WQSA 3HJ0A 4XZHA 5XINA 4M5YL 1XTMA 4YHZH 4O2EA 2Q5BA 1TPH1 3VXMD 5E8PA 4WLCA 3ARGC 4XO3A 4J5NA 4AWJC 1CE1H 4H8VA 3UJ2A 4F80A 1D6EA 2ITEA 2AEPL 4I18A 1LMKA 4MCNA 3BWZA 1IEBB 2DN7A 2IMRA 3N29A 2W3ZA 1KG0A 4OF6A 2ZUSA 3SSJA 1OC7A 3S9IA 1QRNA 4ORZC 2GJJA 3K71B 4A55A 4W9HC 1CXEA 1XEDA 5FFGA 2ZKXA 4X5XB 4Q8OA 3C6LC 2Y8VA 1W3IA 3I75A 4G56A 2ZAGA 5E9XA 1IBGL 3HNSH 5FJRA 4DUOA 3MUJA 3XISA 2YIHA 1DXFA 2E8YA 2NCMA 1XZ0B 1KIQA 3JZUA 4YHEA 1LP9F 5DZOA 3T3ME 5HHQB 1DANU 3MRNB 2VGFA 4CNUA 4QITA 3WJMA 5F70A 4O14A 3HC0A 4ZS6C 3Q6FA 2YMTA 5GS0C 2YW4A 3MHZA 3QPKA 4UBPC 4X6DB 4PJ8A 3C6CA 1V54B 3VDAA 1K8CA 3UZ5A 3QS2A 3CH1A 4NOFA 3B4YA 5BO1H 3IFPB 3D4ZA 4JQIL 5GPRA 2PW2A 2WBGA 2XHYA 3ARGA 2NQCA 5LG1A 4JFHE 3IK4A 3IDIB 4HNCA 4AC2A 5JIWA 2P49B 2R29H 4QG8A 3BCDA 4P5SA 4F7EA 5HGDA 4JTLA 2BC4A 5IW1A 3MBXH 3BGJA 4OZIE 3B5TA 4MAYB 2HPMA 4JPQA 3BIBX 3CUGA 4JBSA 5LYRA 3L0NA 1A6UL 3NYZA 3RY6C 4GXUN 2COVD 4OZHF 1CX9A 5MENE 3G1RA 4LEEA 4AX6A 2X09A 4EUPA 4MZ1A 2Q6WA 1AXTL 4HKZA 4N90D 2JIXA 2UVEA 4DQWA 1I2RA 1BD2D 5D8JL 1TWWA 3AHYA 4ZUTA 3TQ0A 3P8JA 1XLEA 1J0ZA 4MWAC 1SYVA 2NQ3A 2IXUA 4DESA 1M71A 1XT5A 1DBJH 1QJWA 3GVRA 4W5ZA 1VRXA 2EYSA 1KM4A 4IFRA 4CD6A 3NOIA 4PS3A 5CJNA 3F4NA 2O30A 4M3KB 4ZTEA 4G11A 4IMDA 3MBED 3UXDA 4PAZA 2ED7A 1ITUA 2W0FA 3EKGA 2ZXBA 1CPUA 3M5VA 4JIQA 3CZFA 2CGRH 3LKOA 2DM3A 3WSQH 1LP9B 3V4LA 2EG8A 1BXBA 2QDGA 1PL9A 4MOZA 1IGFL 3QO1B 4ELMF 3WI9A 2Y7NA 4XIMA 3FU6A 3RY6A 4G1EB 2ZUTA 1XYAA 1EEXA 4M6VA