4E2OA

Crystal structure of alpha-amylase from geobacillus thermoleovorans, gta, complexed with acarbose
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
451
structure length
445
Chain Sequence
b'ERTWQDEAIYFIMVDRFNNMDVNVNDPKGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNMPGGYHGYWIEDFYQVDPHFGTLGDLKTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPTKKDWFHPKKEIFDWNDQTQLENGWVYGLPDLAQENPEVKTYLIDAAKWWIKETDIDGYRLDTVRHVPKSFWQEFAKEVKSVKKDFFLLGEVWSDDPRYIADYGKYGIDGFVDYPLYGAVKQSLARRDASLRPLYDVWEYNKTFYDRPYLLGSFLDNHDTVRFTKLAIDNRNNPISRIKLAMTYLFTAPGIPIMYYGTEIAMNGGQDPDNRRLMDFRADPEIIDYLKKIGPLRQELPSLRRGDFTLLYEKDGMAVLKRQYQDETTVIAINNTSETQHVHLTNDQLPKNKELRGFLLDDLVRGDEDGYDLVLDRETAEVYKLREKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase
publication title Crystal structure of a compact alpha-amylase from Geobacillus thermoleovorans.
pubmed doi rcsb
source organism Geobacillus thermoleovorans
molecule tags Hydrolase/hydrolase inhibitor
total genus 166
structure length 445
sequence length 451
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4e2oA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4e2oA01
2CETA 1EQCA 1JDCA 1L0PA 1C91A 2WMFA 5I3DA 2WBKA 1GOQA 3ARTA 1VJSA 1FA2A 1KXQA 3GZAA 1JNEA 1LG1A 1OGBA 2D0FA 4FLRA 5AC4A 4CVUA 3T0AA 4CN1A 5EFFA 4GKLA 3T0DA 2AAAA 1ZB5A 4P8WA 1B0IA 3ZT6A 1HP4A 2G8ZA 4N42A 2YFNA 1PX4A 1UQZA 1LG2A 3MMWA 4M8UA 4JCMA 4BQ3A 1VFFA 2DH3A 3UG4A 1V0MA 4D72A 2WC3A 4FK9A 4CVWA 3EDKA 1WNOA 2EADA 5A6SA 2V3GA 4PMDA 1V0KA 1K9EA 4KGJA 4ZEPA 1B3ZA 1UD2A 2DH2A 2D0GA 4HOXA 3MSDA 3UR8A 2W4XA 5I78A 4JCLA 3WN6A 3MV11 1V6WA 2ZUSA 3OA5A 1FP9A 4A3YA 1BAGA 1LL4A 2PWDA 4HP5A 4UFMA 4D6IA 3A4WA 3A5VA 5EFDA 4XB3A 3BMVA 3BUQA 1I1WA 1L8NA 3THDA 1CGTA 4GI9A 2PC8A 4W89A 2YBTA 3W53A 2DT3A 4PMYA 3WEZA 3WF2A 1R7OA 4FNRA 5TD4A 1PX3A 4TXEA 1NH6A 1W1VA 3NSMA 3SUVA 2VZOA 1EQPA 3H55A 3WH5A 3ECQA 3QGVA 3PZ9A 1WPCA 2YL8A 4AZBA 4UOZA 3CZ8A 4HU0A 4CD4A 3VD4A 4MTVA 2XVPA 2OW6A 3LRLA 2ZXQA 2WMGA 1E6RA 4HZ8A 1VBUA 2IUZA 4AD1A 3AJ7A 3VIPA 2GUYA 3GM8A 3II1A 4AD4A 3PTKA 1HXKA 5I79A 1HKIA 1UR9A 3VMPA 1E55A 3GH5A 1YHTA 3ZJ8A 1G01A 1MYRA 1AVAA 2E9BA 1HJXA 4D1JA 1XH2A 3PZVA 3HU7A 2VCCA 4PN2A 1VIWA 2DPEA 3T2PA 3VGGA 2D2OA 1LWHA 3N17A 1BYAA 4CCEA 4S3JA 2XWEA 1XSJA 6A3HA 3CZJA 2QF8A 4D6DA 3O9NA 4F9DA 1UASA 1BHGA 1ZJBA 1TCMA 1CXFA 3WFZA 2W62A 4L4PA 4J7RA 3OGSA 3AHTA 1UA7A 1QX1A 2EJ1A 1UKSA 3W24A 4KMQA 4UNIA 2W91A 3W27A 2WANA 2OYKA 5HBFA 4AZGA 2DIEA 1H09A 2JALA 4LPCA 1RP8A 1HL9A 3ZOAA 2XFYA 3BCDA 3DX4A 4PMUA 1N82A 3W82A 5IFPA 1B3VA 1DHKA 4CGTA 2PWHA 4M29A 1WAWA 1XH1A 4LYPA 3BUBA 1R34A 4FNPA 3HMCA 3BAIA 1AQHA 3AIQA 2ZX8A 4HOWA 3CHEA 4JFSA 1PS3A 3AOFA 2DT0A 3AZSA 4NZFA 4M82A 1HTYA 3AXIA 1JXKA 2YIHA 2XM1A 3W26A 1HKKA 4U31A 1O7AA 2ZWZA 1CPUA 2JIEA 3NYDA 4M1RA 1DTUA 1G5AA 4A4AA 3WEOA 2E0PA 2PWEA 2GJRA 3D50A 4W85A 4CD7A 1QNSA 4B3KA 4UFIA 4DWSD 4CKQA 1JDAA 1US2A 1GW1A 3WD0A 1MQQA 4GPNA 3WQ4A 4H8VA 1WZLA 1GORA 3PZUA 1WDQA 1H0GA 1G0CA 4UR9A 4EANA 3U57A 2WVSA 1UR4A 1PIGA 2X09A 1XD1A 3J7HA 1J12A 8CGTA 4JL2A 1Q6FA 1HKMA 2V5CA 3PTMA 3GXNA 3VIHA 2EBNA 3N04A 3WQWA 2DGAA 1GQLA 1W9BM 2VX6A 5CPSA 2X05A 3D4YA 4OIFA 4F9JA 2D0HA 2Y4SA 3CZGA 5IFTA 4P7OA 2VRJA 4V28A 1J0JA 1OM0A 1JZ4A 1KBKA 3VSUA 1IV8A 2X2HA 2VL4A 2VJXA 2BFGA 2GJXA 4FNQA 9CGTA 1UKQA 1ISZA 5IXEA 5D8ZA 5AC5A 1NP2A 2VI0A 1B3XA 1H1NA 5AY7A 1YQ2A 3MSGA 1PBGA 1JF6A 4M24A 3WH8A 2EPMX 1EA9C 2OYMA 1UR2A 2YL9A 2XVLA 1CGXA 3CGTA 4WJXA 1XYZA 4YHGA 4AD5A 1E3ZA 3FW6A 1C8QA 3WD3A 1C92A 4Z2KA 3SUUA 1WCGA 3UESA 3VD5A 1FFRA 2ZICA 1O6IA 4U3CA 5A3HA 1E6SM 1V3LA 3OGRA 2VVSA 1UR0A 4HU8A 5M5DA 3U7VA 3D3AA 3I3BA 3NDYA 1OB0A 3PBGA 3WQ5A 1UR1A 3FNDA 4GIAA 5IHSA 4D6EA 2UY3A 2BV9A 4AZIA 4L4OA 4JFUA 2XG9A 4DM1A 5CPQA 2CKSA 4WF7A 4DWSA 3CPUA 1AQMA 3JUGA 3PZGA 3CUFA 2JF6A 1CXKA 2OW7A 3VIIA 1E71M 3ARXA 2AOSA 2PB1A 4PRWA 4P7LA 4PCTA 2ESCA 1ZU8A 2VCBA 1ISVA 1A47A 1V02E 1E4LA 2UWFA 3ARPA 2YBUA 1BG4A 3I3DA 4JIEA 2BXZA 4UQEA 2E8ZA 4AIOA 4OJYA 4GO8A 5DEZA 3MUZ1 2GK1A 1CLVA 1LF1A 2W66A 3VIJA 3GXPA 3VD7A 2F7OA 5CJ5A 1D7FA 3BVXA 4W87A 1NQ6A 2ZX6A 1QHZA 3VD3A 3RIKA 1V0NA 4ML4A 1BFNA 3ARZA 3ZT5A 5HPOA 3WFLA 3WNLA 3WF3A 4NI3A 4W8LA 2JFEX 2WBGA 4B9YA 4UQAA 2J77A 2D22A 3GBDA 3MV01 1MWOA 3L4WA 1QI3A 3L4XA 4D6JA 1OIFA 2DQXA 2GSJA 2O9TA 1NOFA 2WVVA 1E70M 3EDEA 3WMCA 4LYRA 1JI2A 5A8MA 4CCCA 1JZ6A 5BXTA 2OSXA 2EO7A 1GNXA 2CXGA 1TQSA 1E6ZA 1PPIA 4UQCA 1M04A 4AC1X 1TFVA 3WDPP 1JNDA 3VIKA 3HG4A 2WCGA 4UZUA 3VNZA 3ZSSA 5AYIA 3WNPA 3CMGA 2OWWA 3PZNA 4DO6A 4C7FA 3VGDA 1B3WA 4CN4A 3M7SA 4J3UA 3S5ZA 4PMNA 4DWSB 3A6OA 3AXHA 4ATLA 3F5LA 4Z2JA 3FAXA 1E6QM 2HISA 2J79A 2IXVA 3TTQA 3EJTA 3IAQA 5I2UA 4DUVA 1KR1A 2YLLA 4RE3A 2J8GA 1LLOA 1C90A 3WY2A 3HZ3A 4AYSA 3A3HA 4FF5A 3BSGA 4X0VA 2VZSA 1TUXA 2CERA 2XPKA 2Y8KA 3BVVA 2Y2WA 3H54A 4MDOA 5I24A 2D24A 2GK1B 1BG9A 1BLIA 2DSZA 1S46A 3MI6A 1UD8A 4IPNB 3UG5A 2BHYA 3BC9A 1B3YA 3VX0A 4Z2LA 4GO9A 1GOMA 4HOZA 3SCVA 5D8WA 4NRRA 1PAMA 3IGUA 1MFUA 3ZR6A 1JG9A 3KL0A 4UFLA 1GQKA 1UYQA 3SCNA 2YA2A 4KRTA 4MNKA 1GOWA 5LYRA 5A2CA 3WMSA 2DEPA 2WZHA 3WUBA 2X8RA 3SCUA 1UD4A 1KWGA 5I23A 2DT1A 1OIMA 4AD0A 5A2BA 4JAWA 3W4RA 5E1QA 1GJWA 1TQVA 1GZJA 1H2JA 3TP4A 4TTUA 3GNOA 1UG6A 3WF0A 2ZXDA 3ALFA 4AD3A 1D2KA 3PZIA 1SR0A 2Z1SA 5FKYA 4PTWA 3W29A 2ZIDA 1JYXA 5BXSA 2WKLA 1CZ1A 5A6MA 3MS8A 4PMRA 1UD5A 3NSNA 3BAYA 3AROA 2PBOA 1KBBA 4QCFA 1DWIM 1UH3A 1B2YA 1JFXA 3ZM8A 4B3LA 2XSBA 3SUTA 1TR1A 2CIPA 1H3GA 2W92A 1BGAA 1HKJA 2XN1A 1X1NA 2DSWA 1MW1A 1W9UA 3O2LA 3TTOA 2J7FA 3BUDA 5IDIA 4R27A 3VIGA 1VENA 2X0YA 2E8YA 5CQ1A 3U7BA 5KEZA 3AQUA 4AD2A 4Q7NA 4U3AA 4W7VA 1TVPA 1UWIA 2DIJA 4AY1A 1Q6CA 3SCWA 3DHUA 5A8PA 1UOKA 1HXJA 3AYRA 2FHBA 5AYBA 3VINA 3GH4A 3WUEA 3GXDA 3L4UA 4MNLA 1OT2A 2FGLA 1FH9A 1V3HA 3WIJA 1W32A 1VEOA 3DX0A 4QDMA 3WDQA 4XUYA 3LXAA 1C7TA 3SUSA 4PEEA 1XCXA 1U30A 4TVCA 1CXEA 3EMZA 2DT2A 5LA0A 2VX5A 4AEFA 5GNXA 1UR8A 5CLTA 1BGGA 1WZAA 3EDJA 1EHAA 2GDVA 5BXRA 1J0ZA 1CYGA 4IM4A 3ARUA 3LPGA 4J3WA 3ZJ7A 3ZIZA 2A3BA 1MQPA 1B90A 1H41A 3VSVA 4W7WA 7A3HA 4Z2HA 4URIA 3VDBA 1SMDA 4XV0A 5DT5A 1QPKA 1J9YA 5ABFB 3OIHA 2X2JA 4Z2GA 1ESWA 4GZIA 4ZE4A 3W6MA 1CXLA 3AIEA 1WE5A 3VVGA 2W61A 3MUY1 4AW7A 2RGMA 2ZUUA 1EDGA 5BRPA 3OLGA 4TTGA 1KB3A 1OINA 3WENA 5CXPA 3MMDA 1WDSA 3UCQA 4N0RA 1A3HA 1KTBA 1ZBWA 3IJ8A 1QHPA 1E73M 3LXCA 1K6AA 5BXPA 1NOWA 2XYLA 3B9DA 4ZXLA 1NWRA 3LX9A 4AMWA 3WUGA 1UWTA 3CV5A 3QOMA 1E1FA 3BLPX 4PMVA 3S5YA 1QOXA 2WNWA 5GPRA 3I3EA 5BYWA 2ZUMA 2G41A 1JZ8A 2V5DA 2BHZA 3D52A 3ZQ9A 1CBGA 3GXIA 3BUIA 5E6ZA 4E4PA 4PSRA 3K4DA 1J18A 2WAGA 3VDHA 3T08A 5ABEA 2XJ7A 5E0CA 2G3NA 3A4XA 3ZJKA 4UFHA 2HVMA 1V6UA 2D3NA 1BVZA 4PSPA 2JIWA 4AEEA 3OLEA 4TVDA 1VBRA 3CO4A 4GZJA 3A47A 5A8QA 5A8NA 2YA1A 4MJ2A 3O6AA 2Y24A 4QLKA 2TAAA 2J7EA 3OZOA 3SCPA 2J78A 4K68A 1HWWA 1QBAA 3L4YA 3RO8A 3SCQA 1F4HA 1AQ0A 3D51A 2BY0A 3EDDA 4V2XA 2EPKX 1CEOA 5JBFA 2EPOA 1XH0A 1B30A 4CD5A 4HMDA 3EDFA 2D23A 4EAMA 1JD9A 3CZNA 2YFOA 3WBEA 1UZ4A 1GPFA 3L4VA 1OBAA 1JYWA 1HVQA 1XSIA 3AHXA 2J7DA 3APGA 1VFMA 3M6DA 4AWEA 3RCNA 4IUGA 3AZTA 2WLZA 4P8XA 4OBRA 3MU7A 2WXDM 3THCA 2F2HA 3F4VA 3UETA 3AMCA 4D71A 1BQCA 4W5UA 4JKKA 2CBJA 4UCFA 2QMJA 2RGLA 1V3MA 1TVNA 2BY3A 2XM2A 2GJPA 1JDDA 1GVIA 4QLJA 1HJSA 2CITA 3VU2A 2G3IA 2WSKA 3GNPA 2C8NA 4GXPA 2QV4A 4DO5A 5I0DA 4NXSA 3GNRA 4BA0A 4PYSA 3W81A 3ARRA 3LRMA 5I77A 3CZLA 4CUCA 2EACA 3VUPA 4ATDA 4ZE5A 2VZVA 3SURA 1E0VA 3VOCA 5CPTA 1M7XA 5E70A 3A4AA 1X6NA 4AIEA 5GNYA 1GOOA 1ODZA 3MMUA 2WHJA 4YN5A 1CENA 1UWQA 3W6LA 4P7QA 2ALWA 4AMCA 2V3FA 3FHAA 5A6AA 5A94A 2VZUA 4DWSC 2XIIA 1ITXA 1UZ1A 1OWQA 3WDIA 5JBEA 4UQDA 3AHYA 3LXBA 3E1F1 3TTSA 5E09A 2CPUA 4H8UA 1W91A 2XFRA 1W1YA 4PTXA 3GXTA 4RL3A 1BYCA 1H0IA 1U2YA 3QHOA 4MAVA 1V3IA 1QVBA 1CDGA 3OZPA 2CEQA 3BAWA 4MB4A 2XUCA 1ISYA 3WH6A 1EOMA 2QLYA 3AIUA 4MJ4A 2XIBA 1UKOA 4FNTA 1C8YA 3CUGA 4AXNA 4UFKA 4D6HA 1TA3B 1KWKA 1BYDA 3EMCA 4WIWA 3WD2A 2Q8XA 3EBVA 3PZQA 2XSAA 1K9FA 2DDXA 3WL1A 1JAKA 1T0OA 3ARWA 4MB3A 1M01A 3W37A 1ECEA 1PEZA 1W3LA 3ZSTA 2EAEA 2WC4A 1HIZA 2E40A 5CSUA 4NX0A 1XCWA 4UFJA 3WBAA 4P8UA 3EJRA 1KQZA 1TQWA 1SZNA 1JIBA 2WK2A 2NW0A 3K8KA 1F4AA 3WDJA 5JIWA 3ZMRA 3WSUA 2VQUA 1ODUA 2WMHA 1VFOA 3KL3A 4CD8A 1NOUA 2ZX7A 3BLKA 4W88A 1H49A 3IK2A 1UKPA 3QR3A 4A3HA 2VR5A 1I75A 3WY1A 5JUVA 1E6PA 1JYNA 4UQ9A 2YKKA 3AMKA 3AFBA 1BPLB 4C7DA 2QMKA 3W28A 1GOIA 3D5HA 4QLLA 1TG7A 1GQIA 3NJ3A 1FHLA 1KQYA 2BS9A 5CZKA 3CHFA 1VFUA 3NIYA 2EABA 3WQ8A 1PZ2A 2WMIB 1FFQA 3OBAA 3G6MA 2JEQA 3EJQA 4MPKA 1QNQA 5IHRA 3QHMA 2WKGA 3AIWA 3LPFA 4B15A 4WSJA 2NT0A 1WB0A 4GZEA 2OSWA 1HT6A 3VSTA 3UR7A 4WKFA 3TONA 4PMQA 3WH9A 1KXTA 3A23A 4QFUA 3ZR5A 4HA1A 2XWDA 6TAAA 1R86A 2MANA 3GYCA 2OWXA 3CH9A 4CD6A 3IJ7A 4PUDA 1JF5A 4CN6A 2VURA 1I1XA 1E5JA 1BYBA 2VVNA 1UWUA 3WELA 2VQTA 4OOZA 2CHNA 2YDRA 2V3DA 1WZMA 4ZFMA 1ZS2A 2J8FA 2ZUVA 1H5VA 2X2YA 1J11A 3RM4A 4H8HA 1MVYA 1CTNA 2VX4A 2DSUA 3MANA 2WWDA 4JHZA 1EXPA 4V27A 2ZX9A 3RM8A 1XRVA 1J01A 1TMQA 1DWJM 3SCSA 5BCAA 2PWFA 4D6FA 1UA3A 1J0IA 2ZUTA 1UQYA 4MDPA 2D3LA 1BVNP 1LWJA 3QHNA 3WQ6A 1LQ0A 1J0YA 4FMVA 2PI6A 3AS2A 1E0XA 3N13A 1V6XA 2G3MA 4WK9A 3VKKA 1E72M 5D9PA 4TX8A 4JHOA 3KE0A 1EDTA 1WDRA 4R5EA 3W25A 4PMXA 4YHEA 1ZBKA 2D73A 5I5RA 4U2YA 3WL0A 3KL5A 1W9XA 1OT1A 4H7VA 2VRQA 3DX3A 1BSIA 2ZWYA 1V6YA 1G9HA 1W1TA 3S2CA 2A3EA 1E15A 2G3JA 2OYLA 5LA1A 3ARSA 3AICA 1M03A 3CZEA 4FLSA 2FH8A 2VOTA 4EE9A 1UHVA 1C8XA 1W2PA 1XGZA 4HZ6A 1HVXA 3CTTA 3EJSA 2ZOXA 5LA2A 2O92A 1MXGA 3EJPA 1FP8A 2WC7A 1PZ3A 3BLBA 2CBUA 5CG0A 1XV8A 4IPLA 3K8LA 1UH4A 1R33A 3VX1A 1GHRA 1UD6A 3VGEA 1OGSA 4X9YA 1JAEA 2CYGA 4GQQA 2FHCA 3M07A 4X0NA 3KWXA 1E1EA 3K8MA 1R87A 4LX4A 2NT1A 3WD1A 1KGXA 1W9DM 3HN3A 1E3XA 1KTCA 1HJVA 4PMOA 5ABFA 2PBGA 4KGLA 5CGMA 4AZ5A 3RM9A 3CUJA 3ARVA 2UY5A 1CLXA 1E56A 3VIMA 4W93A 5BRQA 1CIUA 1H11A 3UERA 4UOJA 4AZ7A 2E9MA 3VIOA 1V03A 1TQTA 3N1AA 3WNMA 4LXFA 1R8LA 2J7GA 4XX6A 2Y8VA 5FD0A 3T2OA 1KCKA 2F8QA 3IAPA 1BF2A 3D4ZA 2QHAA 2ZXBA 4HZ7A 4W84A 1DEDA 4GQRA 3VM7A 2VX7A 1HP5A 3ZJ6A 3WY4A 4YPJA 3UG3A 3WD4A 3GXMA 1V3KA 3NDZA 5C70A 3VGHA 2QPUA 3AMLA 4QP0A 1B9ZA 1QI4A 2CBVA 1E4MM 2VMFA 1GJUA 1JZ7A 3PTQA 1JGIA 3VMNA 5HDRA 4P8VA 3T0BA 2DSKA 4Y7EA 2GVYA 1R85A 1VJZA 2XVNA 2VT0A 5A6JA 3GTNA 2J47A 1TQUA 3OLDA 2DSVA 5ABHA 5DT7A 3M46A 5ABGA 2WM0A 4BQ5A 3RMEA 1KXVA 2FHFA 1NWUA 1Q6DA 3FXYA 1KFWA 1DWFM 3AS1A 3KLKA 3POHA 3VDCA 1R75A 4C7GA 3L2MA 3FY1A 2YA0A 5ECUA 3NSXA 4NRSA 2XHYA 4OBSA 3U5YA 3CHDA 4GINA 1DWGM 3AYSA 3MUIA 3N18A 2W63A 4GI6A 4CU8A 1QI0A 1FH8A 5A69A 2X1IA 3BUPA 5FIPA 1R47A 1CGVA 5A1AA 3DYMA 5JIPA 1Q6EA 4MNJA 3CHCA 1JXJA 4F79A 3VGFA 4NF7A 3VILA 4DUXA 5FOOA 2FDMA 1HJQA 1VF8A 5M3WA 4P7NA 3WMBA 1HL8A 3T09A 2F7RA 2F7QA 2WHMA 2OLHA 3BAJA 2C7FA 4GI8A 1SYTA 1EGZA 1NARA 2BVTA 1DWHM 1ZBVA 4XZWA 3WDHA 1VEPA 3N9KA 1SMAA 1DWAM 4FNUA 2CHOA 4S3KA 5BROA 4AYGA 1RP9A 2UY4A 3LPOA 1JZ3A 2YJQA 3DECA 2XVKA 3TOPA 3SCTA 4E8DA 4BCEA 4OOUA 4D1IA 4UTFA 1IT0A 1VB9A 4J28A 4IISA 1ITCA 4WKAA 3WF4A 5M17A 3TV8A 1HJUA 3K1DA 1B1YA 4LQ1A 3MKKA 3A21A 1MW3A 4AZHA 4ZXOA 1QWNA 1FH7A 3BSHA 1C7SA 1WKYA 1UUQA 4NZJA 4UQBA 4W8AA 4W86A 4AIUA 4H41A 5GNZA 1LL7A 3UEQA 3TA9A 4E8CA 2XGIA 2WPGA 4MB1A 4ACZB 2JEPA 3ZO9A 4ACYA 1OD8A 1ZJAA 1KCLA 4HMEA 4J3VA 2FGZA 1IZKA 1H4PA 2Z1KA 1WP6A 4OUEA 2OWCA 1XHGA 3GH7A 4F8XA 1HNYA 3EMQA 4U33A 4HMCA 3IANA 1G1YA 1R7AA 1TA3A 4MAZA 3VGBA 2J75A 3WKZA 4LGXA 1Y7VA 5DMYA 2JF7A 1WZKA 4CU6A 2F1AA 3OB8A 1JFHA 2VRKA 4Z2IA 5GQBA 3AS0A 4BQ4A 1XD0A 2YL6A 1E9LA 3WDRA 3AS3A 3PHAA 2CCRA 3CUIA 4JL1A 1E43A 2A3CA 2VR4A 1OSEA 2BHUA 1J10A 3AMDA 3VDAA 1EOKA 1FOBA 1QNOA 2ZUWA 2O9OA 4EK7A 4RE4A 4TVUA 4HA3A 4U5IA 7CGTA 5D9OA 5F7UA 2J25A 1SFSA 4BQ2A 1K9TA 1W3HA 3CMJA 2WHKA 5CGTA 4JFVA 1O7DC 5KZ6A 1C93A 4PMZA 2ZUNA 5A6LA 2EXOA 1K9DA 4FLOA 1NWSA 3EJUA 2FE0A 2VCAA 4E2OA 4BF7A 2Y5EA 3S6TA 3OLIA 2GFTA 2XGBA 3WUFA 2YDSA 5A6BD 4KRUA 2BY1A 4HPGA 2WMKA 1E40A 3WH7A 2WMIA 3WNKA 3VIFA 1TZ7A 2J62A 1XC6A 3N12A 2FH6A 2IXUA 2C0HA 1PJ9A 3T2QA 3AI0A 5DFAA 4J3SA 2WMJA 4AZCA 2WCSA 1UWSA 1P6WA 2X0HA 5D9MA 5BWFA 4U5KA 4J27A 1D3CA 2WLYA 5HPCA 3VD9A 3ARQA 3A22A 3NCOA 4MB5A 1FHDA 2W67A 2ZE0A 3ARYA 1EIBA 2X2IA 4WSKA 3LRKA 1OD0A 2J4GA 2XFFA 3K46A 4HTYA 2VUYA 1V0LA 5EBAA 2E3ZA 3PN8A 2WVTA 5C8BB 1W9PA 3SCRA 1JYVA 4P7RA 1HX0A 1Q6GA 1JI1A 3B8SA 3AXXA 4M81A 1QI2A 1PX8A 4H2CA 2EQDA 4QAWA 1V02A 1AMYA 3CC1A 2F18A 3G6LA 5CSYA 1KXHA 2BY2A 3VO0A 3PZTA 3SEPA 1QHOA 1V08A 3PZMA 1MQRA 2A3HA 8A3HA 1CGWA 1CWYA 3OGVA 2CKRA 1EO5A 4HA4A 1W3KA 2J7HA 3VTRA 3HG5A 3NUKA 3CBWA 3L4TA 5DF0A 2CBIA 1R46A 1EHNA 1E0WA 1CGUA 4MNMA 1ZL1A 3CZSA 3RJXA 3KZSA 1GHSA 2ZX5A 1QNRA 1UWRA 1Z32X 3K4AA 1US3A 4ZENA 3WNNA 1ISWA 2IGTA 1E5NA 3MO4A 5JBDA 2GDUA 1QW9A 4U2ZA 2B31A 3LPPA 2JE8A 2A3AA 1GVYA 3DDFA 1V6VA 5HNNA 3WNOA 5A6BA 4DO4A 1EDQA 1XSKA 1Q4NX 3AISA 4M56A 2O9PA 5FL0A 1NM9A 2F7PA 3CUHA 2WCAA 4NZCA 2WSPA 3CZKA 2FYVA 1LJYA 4Q22A 3HG2A 3TTYA 3DYOA 2WYSA 3WQVA 5HOSA 1IZJA 1QI5A 2D20A 3HG3A 2YOCA 2J74A 4FLQA 2XTKA 5A2AA 4AMXA 1VEMA 4AZCB 4KWUA 1VRXA 3EYPA 2VO5A 2YL5A 1E4IA 5D4YA 5CLWA 1MFVA 4LYQA 1XYFA 1VAHA 1RPKA 2WW5A 3WEMA 2WZIA 1C3FA 1RD6A 1ZBCA 4ATWA 2GJXB 1MW0A 1OCQA 1E6NA 2YLAA 1GOKA 3W0KA 1EH9A 2V38A 5FL1A 4NXKA 2EPLX 3OG2A 2NSXA 3RJYA 4WLCA 3DC0A 1JZ5A 1TE1A 4PTVA 4D6CA 2WVUA 4OKDA 1LL6A 3RPMA 4M80A 3PZOA 1WO2A 4OGZA 3W38A 2CESA 3MUAA 3DX2A 1UD3A 1CXHA 3BAKA 2F61A 3FN9A 4AISA 2UY2A 2XVGA 4TUFA 5E0FA 1J0HA 1ISXA 2VC9A 1BTCA 1MXDA 3AIBA 3DYPA 3B9EA 2VZTA 1UH2A 4PBGA 3BVUA 4JFTA 1KGUA 3AZRA 2OSYA 3BXWA 4RE2A 3BVWA 1JD7A 4JFWA 1JL8A 3AHVA 3KEHA 5D9NA 4BZYA 1X6LA 2CNCA 1NP0A 1EO7A 3DX1A 3RILA 4TOQA 2PWGA 4B16A 3SIMA 5DO8A 4J3TA 4PTMA 4PCSA 1WDPA 6CGTA 1RH9A 1NWTA 3VM5A 4HPHA 3L2LA 3BMWA 2G4FA 3AHZA 4WKHA 4W7UA 7TAAA 1CXIA 2J7BA 4TX6A 4BS0A 1GCYA 1V3JA 4JZ5A 5E6YA 1KR0A 4H04A 4AZ6A 2VTFA 2WZEA 5I6SA 1QNPA 2J7CA 1B31A 3F5JA 4B9ZA 4QCEA 2BNJA 3ALGA 3ZT7A 2EEXA 5A8OA 3QOKA 3GXFA 1QBBA 4UZSA 1DP0A 4DM2A 2V3EA 3KLLA 3L4ZA 4XZBA 3VMOA 2WHLA 4JKLA 3VNYA 4J3XA 1HJWA 1W1PA 4W5ZA 1JZ2A 4EKJA 3H53A 1OGGA 3A24A 1W3JA 4F66A 1G94A 1GQJA 5M03A 2XN2A 5A6KA 2XN0A 1CGYA 3SUWA 3CLWA 3GBEA 4UOQA 3WY3A 4FNSA 1CECA 2VNCA 2YDQA 1E6XM 3N11A 1W2VA 2QPSA 3DHPA 3DDGA 3AIVA 3B9AA 1U33A 2BXYA 3FAWA 3N15A 4D6GA 1QWUA 2W5FA 4MADA 3BAXA 5C71A 2WB5A 2AMGA 5E9AA 4OZOA 3POCA 2E9LA 1QW8A 3AIRA 1MW2A 3VPLA 2PF0A 5EB8A 1J0KA 1CNVA 3GDBA 2BVYA 2F1BA 3BH4A 5FCZA 2E4TA 3CIVA 5EMYA 1HN1A 4CU7A 2O9RA 3SCOA 4W8BA 2WVVB 1W9VA 3WF1A 3U5UA 4NSBA 2BVDA 3HJEA 1GONA 4DUWA 1GUVA 4CCDA 3BVTA 1E4NA 1M53A 1HF6A 3BCFA 3F5KA 5HXMA 1KGWA 1UKTA 3AMGA 5A95A 2ZXAA 3BGAA 2D1ZA 2EPNA 2WWCA 3FHQA 4KH2A 3LMYA 4PUEA 4ACZA 3IJ9A 1PIFA 3RDKA 4JKMA
chains in the Genus database with same CATH superfamily
1IT9H 4GVIA 3GYEA 2WSDA 2VDPH 4C1LA 1V5XA 3T6VA 4YDLC 2GPZA 1AHWB 4NRZB 1PYMA 4ZYKB 3THAA 1OPGL 2WLIA 1UWEL 1T7WA 3GSOB 1M41A 4MZRA 2UZXB 5I6KA 1WFIA 3P3RA 4ACTA 2SEBB 3TO4B 3SBWA 1UD2A 5DYOA 4PUUA 4WW2B 3UIYA 3W3OA 2P7TA 1LNUB 2AV7A 2GBVA 1ETJA 2J8UA 3RIFK 2YBTA 4HD9A 3MN8A 4N25A 2ITFA 2C9QA 4ZZ9A 4OQ1A 3NSMA 1YEDA 5DJDA 1YNYA 1NWOA 1G9NH 3FA3A 4IOSA 3PZ9A 4HU0A 4MTVA 2OW6A 3TBBA 1E6RA 4CADA 3M43A 1FWBC 3GM8A 5F96H 3PSWA 2BOBB 1NSNL 3ZJ8A 3VXUE 4EF3A 1HFUA 4F92B 3HU7A 4I1RA 4MNQA 4Z7NB 1GYNA 2R51A 3SDOA 1MUJA 3T2PA 1SYVB 4DETA 2H2SD 4F8NA 2W9DL 4BE5A 3L48A 4PJGE 2FDSA 5IBTH 3BZFA 1S7UA 1PB0A 1U1UA 1S7QA 1L5GA 2PDUA 4MHHG 1BTMA 1IQDA 4TVPD 2VEIA 1MFEL 2KS0A 1FC2D 4G7FA 1WIPA 4C6NA 3QIWB 3FS2A 3RCYA 3T04D 4CA4A 3BUBA 2ZQKA 3VOHA 3TPKA 1YHPA 1IARB 1TREA 4QCIB 5HVHB 4XMLL 3V6FB 1B88A 1JXKA 3TA4D 1TJMA 2PXYD 3VA8A 3MFFB 1XCFA 2RQEA 3QSKB 5F7EH 4RX4D 1IEAB 1RK1A 4YC2B 4WO4D 5GRYA 1W0VA 3HC4H 2WXOA 1PS9A 2QUNA 4L3EA 3S5LB 1YNQA 3J7HA 1X44A 1Q6FA 3IWVA 3W88A 2JKAA 2DGAA 1GQLA 3E6HA 3QEZA 1EHLH 3SBFA 1U8KA 3D0CA 2MCPH 4YHIB 4EIBA 4HPJA 1RQBA 1GG1A 1I9RH 3EWUA 3AWFA 2X6MA 1H6EA 2ETWA 3DHDA 1TNNA 1AGDA 3RWIB 4JFOA 4M5ZL 2X70B 3IJSA 4FAAB 3VFVB 5ICZB 1JUBA 3NJNA 4UU9B 1CGXA 2A73A 4H26B 1XYZA 4G9DB 1FGNH 2HT3C 2VW6A 5KJRL 2O55A 2XQBH 5CIPH 3OAUH 2IPFA 3PUDA 4JIHA 1N8IA 1KIPB 4UTKA 4HUNB 1N2VA 2PU0A 4HX1B 4U6YA 4HAFA 1DQXA 2GOUA 4XKMA 4AMKL 3T2LA 1A6AA 2EILB 3O6FC 1E5BA 2DBLH 2VZ1A 1RBAA 4HULB 3KJ6H 1S3KL 4K15A 4BUHA 3GJEA 4FJZA 2HYMA 2VGGA 2OZTA 4N90D 3UAEA 4XNZC 4PBDA 2GSEA 5SWZA 5ITBH 4A3UA 3O4LD 4Q7DA 1A47A 2Y2YA 2EDFA 5HHOE 3NQCA 5DEZA 1E4XI 3S36L 1O5QA 2DPKA 4OZFA 4WWID 1W8SA 4X4XB 4LKXB 1NQ6A 5HI4C 2FEDC 2BNQD 5DO2D 2XUWA 3F7RA 4IU2A 4JICA 4W8LA 4FKKA 2DTML 3CDZB 1AS8A 5HHXH 5LNGA 5KINA 3MRLB 1MWOA 2ZOKA 3QPQD 1YIXA 1L7IH 3L4XA 3AM8C 3CYJA 3OSKA 4DEPB 3EDEA 4D8ZA 5BZZA 2AK1L 2AEPL 2OLAA 3ZXAC 4JO5A 4HHHA 3UADA 3TA3A 3O4OB 3CLFL 3VIKA 4Z8FL 2R9RA 3W0WD 3E74A 1JE6A 5EUKB 5K9CA 3MRIB 3DX7B 3SKMA 1L9MA 2H4EA 4NUWA 1UP2A 4JGDA 2RH0A 4NZ4A 1AR1D 1JXDA 2WKOF 1YTDA 3MDJA 1RY0A 1UURA 3ZE2E 4OCWL 5IHZB 3D2TA 2OMTA 4EUPA 1IUZA 1KGJA 3BVVA 4NDMB 2YBVA 4BYHA 1MY5A 1BG9A 1QEXA 4MWAE 5AYXA 1TZAA 1PVNA 4K3JL 3SCMC 1XZWA 5KANG 4DXKA 4RZCB 2F6XA 3TIDA 4UFLA 1UYQA 3STEA 4ZTXA 1MCQA 3MBEB 2QQ6A 2WGXA 3B2DC 5EN2A 2ZRVA 3S42A 4K7PX 2FWLB 5HMSA 3B9KC 3TP4A 4KJYB 1DFBH 1JP5A 2WP3T 4YSDA 5E2VH 3SRFA 4A3QA 3I50L 2WKLA 1QSFE 5DJ0A 1PSKH 3SKOB 3C2AL 3AALA 4PMRA 5AYTA 4UOW0 4IIHA 3ZM8A 2R8SL 4GAJL 2ADFH 4WEEA 5FJRA 3B34A 4OGAD 2BLEA 3TTOA 3VTAA 3ZE0B 3BUDA 2YYTA 3B2XA 1MFCH 4KAQL 3MRPA 3MMEA 1UWIA 3SRKA 3LRHA 2EYSA 5GJNA 4DGVH 5E8NA 1HXJA 3D69A 35C8H 5AAPA 4LVAA 3PG9A 5E1AB 3DMMD 2QL1A 3L4UA 4NP9A 4XWOC 4NP4H 4EI0A 5EU5B 4JPIA 5CP3H 4PJBE 1FDLH 4Y1AE 4G6JL 2BNQB 1J8SA 4XZ9A 2PDXA 5DMIL 1OAZH 3BPOC 1DLFL 4M1BA 2WQPA 4E9RA 3L7FB 3PL6D 1IBHA 3RWFB 1XRFA 3HVNA 2ERJB 4K37A 4JFHD 3Q48A 4MBOA 3ZIZA 4X4YA 2ZG3A 1XIWC 5KSUA 2FB4L 1IL1A 1DQDL 2X2JA 5F2IA 2GQHA 1U3ZA 3G8RA 3QEGH 1A80A 1WFUA 3VA2C 5D30A 3WENA 5I8OL 1CF8L 3G1YA 3QQ1A 2HVKA 1BVNT 3PPCA 3LY6A 5D96C 1QK2A 4EACA 3E9UA 1E27B 2WAGA 4PGCB 4DLMA 4X9GA 2D3NA 4PSPA 4UTUA 1SBSL 1TG8A 5FIEA 3LNPA 2OT1A 3ULUH 5CSZA 4B2DD 3US1A 4QLWA 4XBMA 3DV4A 1XX9C 5CEZD 4PJFA 4HCLA 4MXVF 3UGEA 5KAQG 4EAMA 1ZS8A 1SN2A 4E5TA 1OBAA 5CNHA 5DVKA 3Q6FA 4BHUA 4RBPH 2BDNL 3F1QA 4IUGA 3PJTA 3G6AA 2R1MA 4WK4B 4I3RL 3KS0H 1KJ2B 3L08A 4JFPB 4NN5C 2DRUA 5K93A 1BV8A 1V3MA 5D6CA 3X17A 2AXGB 4O12A 2G3IA 4GJIA 2VZ3A 4DO5A 3CLEL 2OSLB 2Q8AH 4BE6A 1CVRA 2VABA 5I19H 2VZVA 3WJJC 3HNVL 1LP9A 3MJMA 1HC1A 3A4AA 3S97C 1H1ZA 2IFGA 1X8CA 1HHJB 1BVKA 2G4JA 4ZMLA 4NFDA 3IT8D 3TZNA 4G6MH 1Q0XL 1J86A 3FKUS 4KZDH 5A6AA 1TZ8A 3RUGF 1I4FA 5T3ZD 4ZFFA 3GE7A 3NJJA 1P5BA 1X7QB 2XFRA 4PS8A 3D08A 5AVZB 1MFDL 1VYRA 4FGMA 4BCXA 7FABL 1TVHA 1RR2A 1R2SA 3BWAA 5B1BB 1ISYA 3TDFA 4R5XA 4K5OA 2Z29A 1UG9A 1VZHA 3P5YA 4PRIA 3AIUA 4KTGA 1H7NA 5AW4B 4PRAA 3GIZL 4AXNA 2AKRB 3L3KA 3S9YA 2HJKA 4EX4A 3GWJA 2PNDA 1S9KC 3EBVA 3AG4B 2DDXA 2BIMA 2JJWA 2IXQB 3W7DA 1HIZA 3T40A 1EVUA 4DP1X 1QRQA 3HW7A 1HHGA 4G7QB 2XY2A 3EYOB 3AQXA 5JIWA 4OCLC 3OWRA 5CLYA 3WSUA 1GC1H 1XF3A 4X98B 4JYEA 4LF3A 1VACB 3F2CA 3EZ8A 2G9HA 4BSVB 3AMKA 3C2FA 3W28A 1OTUC 3QORC 4E4FA 2DWXA 3GNDA 1F4XH 3II3A 4FS0A 2GYSA 3WQ8A 2FL5B 3PPEA 1P7BA 3EFDL 1A9BB 2Z7WA 1Y18A 4UB0L 5KYNA 1ZGLA 1ZTXH 1UBSA 4KKBC 3WH9A 4PJ7E 2QCNA 1UZGA 4H2HA 3H4XA 2OWXA 3MJGX 3GHEL 3IJ7A 4PRHA 5CGYC 1SJHA 2EDKA 3H1ZA 1K7XA 1LMIA 2XWZA 3WLWD 3WJZA 2N3JA 3SDXB 4QYOB 1LE5B 1O6SA 4A2EA 4RE0A 2FAUA 5E4EC 4ECLA 4Q2ZB 4YDNA 2YQGA 3RK8A 3WG6A 4A63A 1ID5I 1PLBA 2PWFA 2YUVA 5HHNA 4I77H 3C5XA 5IMMA 4HK0B 4KWWA 3I10A 4PS7A 3FOKA 5IQ9A 3WUWG 1LO3L 5C2UB 1VZWA 3PB2A 1EDTA 2INEA 5TFSL 3RUBL 4AXWA 3FT2A 1ZBKA 3ATFA 1F3RB 8FABA 5I5RA 3IIPA 2FPVA 1OT1A 4RBPK 1F3TA 3H2QA 2AJ3A 2NWSA 3U7AA 4UAOB 3THML 1QWHA 1JHKH 2XIJA 3GUWA 1DVXA 4XVJL 5E0KA 2J2ZA 4F9PC 4EE9A 1UHVA 5D5ME 1N0XH 1H60A 3EJSA 5TDOA 3TFXA 3U6RB 3BLBA 1HHKB 3QYNA 3LGEA 3EYSL 3SFWA 4XTRD 4F7CA 1JAEA 1NFIB 1YN6B 4HSHA 5GZOC 6XIAA 4Y4KB 4WZHA 3RG1C 1HAUA 2ZRUA 3D3FA 5FW6A 4YHML 4Y9PA 3DFOA 3W00A 5MKGB 4Z7VE 3P30L 1KXVC 1HINL 4CNIB 3WHE1 3QO1B 5C55A 3MV9D 1DJSA 2DQDH 2ABAA 5E94B 2P24A 1FDJA 3WY4A 4YPJA 2V82A 5HGBB 3VW3L 4NZ5A 3B83A 4QRUA 1FORL 2R15A 3Q8EA 1JZ7A 1JGIA 2DSKA 2YMXH 5A6JA 5CD5C 1Z42A 2J47A 1YEFL 4EIGB 1JWUA 2HJPA 4MFDA 1NKGA 4IIDA 1Q6DA 4NYLA 2MCMA 5K39B 4C6QA 3WE1A 1SVCP 5CSRA 1EGJA 1JCJA 4M1CD 2CKBL 3AYSA 3MUIA 1A1MB 1E4HA 4D0DB 2NX5A 4W4QA 4I13B 3BPWA 3MLYL 3L7EA 1KDJA 2YHGA 2IH9A 3BEWB 1KPRB 4J4PA 4KEUA 3BESR 4RFEA 1MCOL 4C6BA 5I30L 5IROD 1DWHM 1OX6A 1V7NH 5DJ6B 5J9PB 1FZJA 3L67A 1BA9A 3DKHA 1QRKA 1EX1A 1W72B 2Y7GA 2AJUL 5DMKA 4LQ1A 2BW5A 4PJIB 4XAZA 4XN9A 4EN3A 4K71C 4HF5L 1QHQA 2ZNXA 2IWFA 1IIKA 4KVNL 2DZWA 1JN6B 4FFZH 4HIHB 2TRSA 1U8IB 1D9EA 1TTQA 1RK0B 3UMNA 3P8IA 4OFQA 3BO8A 5E9DB 4JFFA 1R38A 4OFKA 3WJWA 1EJUC 1ZY9A 4FI7A 5CN3A 5DHYB 2XKUA 3UWQA 1XRTA 2IADA 4DQOL 3FCGA 1DDHB 3KW7A 2X1OA 3FYIB 3ZKSD 2LE9A 2PKDA 3R4DA 4HEPG 5F7MC 3WJLA 3SQBA 4UIMA 4M03A 1LO5A 3FB8A 4AEIH 2VR4A 5KUKA 4EI6B 2X4SB 4L1XA 2VC2L 4ILDA 3MJ9L 2EEBA 5B39G 2LLGA 5LDSA 1JJUA 3MV9B 4DB7A 3B2MA 3LKRB 4FZEL 4W4OA 1NWSA 4FLOA 2FE0A 4FXFA 1QKZH 4H6RA 3EYVB 5GGTL 2ZVRA 3F84A 2X0WA 3VRLE 1U3HC 3WLBA 1XINA 2D31B 3K6SA 1A6VL 1VGAA 3S3BB 1T0NB 4L3AA 4X60A 4HIEB 1RUKH 4NNXA 1JPMA 5FUZH 4AZCA 4AK2A 4PVNA 2HS6A 3O05A 1ZVSA 1R3LA 4JM2D 3BPNB 4B96A 3WFCH 3KG5A 3ARFD 4IRJB 3CIAA 3BKCH 4ZTOL 4BXVA 2RDUA 4DBDA 1AXIB 4UCGA 1M42A 4G1NA 5EL1A 4H2CA 1FRGH 4OZGE 2PDPA 3BD4A 2DIKA 1V08A 4QRAA 4KCWA 2YEZA 2A3HA 5EC2B 3MGTA 4O52A 2V17H 1ZL1A 2FZMA 1G7IB 1EBHA 2VB5A 2E47A 5EC1A 4NIRA 3MO4A 3L5XL 4XIMA 4A37A 3CK5A 2EHHA 1LEGA 1AKPA 2HTKD 3B0UX 3G6JB 2FJHB 5FL0A 3GEWB 4XMZA 2VDNL 1JHTA 4L9DA 1JUEA 2F6KA 5AW7B 1SJAA 2D4DA 3HE7D 1X1ZA 1BVLB 1R5VA 3KWVA 3TH6A 3RB7A 1HL5A 1K70A 2B39A 2Q8LA 1Q9LA 3I6KA 2EKCA 3BWUF 4W9TA 4H83A 4Y7OC 1OVDA 5IVXA 4LYQA 1VAHA 3O9WB 4BDVB 2CLVA 3QG7L 1MIEH 3IEBA 3V55A 1U92B 3I02B 4I18C 4WLCA 2GJ6D 1JZ5A 1RZIB 1TE1A 3OJGA 2ATKB 1T6BX 4ZFOA 1LL6A 3RY5A 2VQ1B 1SXBA 1HWGB 1ASQA 4RQQB 4NQDB 3REWA 2W9EH 3ABGA 1BF6A 2QW5A 3PP4H 3N14A 3FB5B 5JHLH 1TQCB 2ZP0T 4DN3H 3L3OA 3ULVC 1T7XA 2FZ8A 1RJCA 2NW2A 3QCVL 3ALXA 4AY0A 6CGTA 2PR9A 3BMWA 2Y1VA 4QHUB 2BSED 4OSUL 4ADSA 4Y9CA 1NLDL 4BS0A 4LRNH 1GCYA 5I73C 4Z5RB 3PUGA 4JVUA 2Q0ZX 1IGIH 4FG0A 4GAFB 2X6AA 1ORQB 5ANMA 1CE1L 3F5JA 5EZJB 2DQHL 1ASPA 3OKLA 5KVMC 1TIMA 2RBLA 3DSNA 4M93B 4TUOB 3G3LA 1OFBA 4XZ4A 5HD8C 2JKRM 3I84A 1ZVHA 5EOCH 4JM2B 3FDGA 4G2DA 4ONVA 3SPGA 5JIDA 4ZUTA 3SY0B 1AP2A 2CRMA 2HSIA 4WU5A 3RJDA 2QPSA 3HG1D 3OVRA 4RUBA 1CX9A 2CZDA 4TLKA 3N15A 1Q9KA 3D3VB 5AG9A 3HZVB 1JUFA 5H2ZA 4BZ1L 2PF0A 2EXWD 1J0KA 2AEQH 1P4BL 3HQOA 1D5XB 4C6KA 2HX8A 3GSQB 3HJEA 4KETA 4OD1H 4PS4L 4IOSD 2EPNA 4KXAA 3FGCB 3LMZA 2OTUB 4NKQB 4JMNA 3RDKA 5BXFB 3MROB 4NB7A 3EWYA 2Y5TB 3L5HA 2DS4A 4MNQD 2XFWA 1ZMYA 3OG4B 3VNMA 3SBQA 1P7TB 5AC4A 4JJOA 4YIQA 3KHQA 3SN4A 1AG0A 2A1WH 1EVTC 4N3TA 2G8ZA 3D4CA 4MZIA 1P7KB 4TXVB 4NZ1A 3PVFA 2WC3A 4FK9A 4GKSB 2NQZA 1A14H 3EDKA 4OFVA 4JX0A 3B2VL 4XPBL 2VD9A 1R0AL 3TWAA 1T1ZB 3GUGA 3ARDB 1KFLA 3RNKA 3L0GA 4H20L 3A5VA 1BF8A 1QSEA 2HP4A 3FC8A 1JV5B 4JN1L 4W89A 2NXGA 2FIKA 3ARGC 1ZNNA 4P9ML 1IU1A 3D0VA 2BG5A 3MJWA 3PIQA 3CVHB 3WUWB 3IDMB 3U7YH 2NY0D 1I9IL 4Y5VB 5C09B 4UOZA 3W7NA 4CD4A 2ZXQA 3WL9A 5B8CB 3UL4A 4HSQA 3DI0A 4AD4A 4GIPD 1C5DB 1TV4A 2F6UA 2JQMA 3CH1A 3VGGA 4NOBA 1ZRQA 1T4KB 2V7NA 1NF7A 1FNEA 4ZW6A 3KBJA 4K0OA 3EJYD 1SQMA 4ELDA 1KTLB 2ORBH 5L2KA 2OYKA 3S5NA 4XZUA 1AXTH 4OZHA 4QLRA 4DF0A 1RP8A 3EX6A 3GBML 4EBQL 3HG1B 4OFDA 5FYLL 4IXXA 2C9SA 5LSMA 4IJBA 3MRCA 5KG9B 4PCPA 2XQ0A 2Q6ZA 5GHWH 5KZMA 1OV8A 5D7JB 1ADWA 3TNOA 3AXIA 2VFIA 5BZDB 3C2VA 3IVUA 3JVFC 5I3HA 4DBUA 1DTUA 3WEOA 4N0UA 1MKFA 4BFJA 2FT6A 4GRMA 3LS4H 3CIXA 2ICEC 2K4WA 5DRCA 2EE0A 1N7MH 1WZLA 3KH4A 1GORA 3PZUA 4EANA 3P3UA 4CADB 3EAKA 4X7FC 5DJAB 3VGAC 3PTMA 3W1NA 3VIHA 3K6OA 5DQDL 2CIKA 2GHWB 1NAKL 5IG7A 2X2HA 2X1SA 4W81A 1HKVA 1A6PA 4NT6B 4WWPA 1A22B 2DM3A 4XHJC 2XDHA 4I9WE 1P6BA 3TN0C 4PJ9C 4QE1A 2FECL 5IR1A 3HBZA 1JF6A 2OYMA 4JTRA 4C1KA 3DBPA 1S7QB 2W0UA 2ZP8A 4O2EB 4LANA 3M6YA 1F13A 2ADIA 3QXVA 2IFFL 5A3HA 3OMZA 5FHBH 2PRLA 2OMVB 3WK3A 4PRNA 1YJDL 3U7VA 3KYAA 2J1WA 4X8JA 3HTWA 5B1KA 5FA3B 2NLJA 3TA3D 1I82A 4LSVL 2KMWA 4UTJA 4Z78B 1UWXH 1CXKA 1AC0A 4Z0BH 3VWKA 3PK7A 1T0MB 3WQGA 4NRXB 3T1FB 3QXAA 1BG4A 4YTUA 1YY9C 4K7PL 2DQFA 2BH0A 2Z6JA 2HFTA 4K8RC 4AENB 3ES6B 1G7UA 2GK1A 4BQCA 4PG9A 1D5IH 1LCOA 4P46A 4K94L 2ZE3A 5GRZA 3PWAA 4IEFA 1LLWA 2HG0A 2YD4A 4LSRL 1N5AA 4ML4A 1YECL 3N2CA 1AZZC 4GCAA 2Z0BA 1N2RA 1UA6H 2JFEX 2XTSA 1FYHB 3MLPA 5EU7E 2X2UA 2V9DA 1N8OE 1BZQK 3ME0B 4M4RB 4ZW8A 2GVLA 2C3XA 2W9MA 1PPIA 3FQWB 4UQCA 3O3DA 1IQWL 4I5XA 1IX2A 1JNDA 1A6AB 2JLLA 2WCGA 5AZEL 4U1SA 5GS2H 3TNNB 4BFIB 3ZSSA 1F6PA 1CLYL 2UXGA 2C5DC 3GJEB 3WMLA 1Z2KA 3HE6C 4JDBA 2IXVA 1VQTA 6FABH 4U0RB 2BNRB 3EJTA 1VPXA 3T0EC 3LENA 2C1OB 4UYPA 1T04A 3FT4B 3QDHA 2AJZB 4I0CC 5CGQA 1L2QA 4OCXH 4E0RA 2NY4B 1CDBA 5I24A 2AK4A 4Y2NA 1PHWA 5T8IA 3RLUA 2X1TA 4Z2LA 2ZRZA 5D8WA 4I6KA 4M3PA 2JK2A 5I9QB 4M1GH 4MNKA 1ZA6B 1P4LA 3U48A 4A2MA 3BE7A 3GIVA 3VFGL 3IGHX 1ZLSL 2NY6C 3T42A 3ZHNA 2CGYA 4N24A 1JYXA 1CW2A 3MS8A 2CO3A 3NSNA 4GG9A 5TH2A 1KB5L 1DWIM 1B2YA 4NJHA 5J6HB 4N2EA 3H2OA 2DEXX 3ZDXF 1QMLA 1U4FA 2NV1A 4RNJA 1A21A 5M1TA 3IKCB 2DIJA 3T44A 2JXMB 2XTJD 1R3KA 3AYRA 4W9KC 3C4UA 2O56A 2X42A 1S5WA 5AYBA 1NC2A 3H2CA 2OMTB 1CFSA 3LH9A 4GYKA 5GSVA 4U3SA 3LXAA 4TVCA 4QG8A 1AD1A 3OR7A 1S7SA 3P2BA 3V1PA 3TLRA 1BGGA 1XLFA 1NMAL 1QLEB 2R29H 3L23A 2PZ0A 1YDPB 3LTVA 5CLZA 3TIDB 3MJ7B 4G8EA 5J4MA 4YLWA 4JD4A 4PMEA 5DUML 5C7HA 4E68A 3PF2A 4D9LL 1F11A 4XNQB 4KVCH 4P59L 2PR4H 4BHYA 4LHQB 3PWPD 3N29A 5E4AA 1OZTG 1QP1A 3R7QA 2DORA 4CVXB 1Q6OA 3X3GL 4DGIL 3M17A 4NZRH 2GI7A 4MA1B 5C7VA 4AMWA 4FADA 2FJGA 3NM1A 4DNHA 3MHFA 2FTAA 2J57A 3S9DB 3STGA 2JKTM 1CT8B 3IJEA 5C0BA 3TYAA 3I2CL 1TFPA 2R2BB 4G7VH 4P4KA 3P77B 4TKWA 5ESQA 3ARBA 3MRPB 4L4TB 5C9WA 3QK0A 1NBVH 3D69B 1A1OA 5A8NA 1TZ9A 3NOEA 3SE8L 1IGMH 2D03H 5L8LB 4UTWA 1HZYA 4DTGL 1AQ0A 4LCWE 2EPKX 2YARA 4XSMA 5AOKA 5HYJB 3U4EA 1AJ7H 1JYWA 1XSIA 1NA8A 1KZYA 4ODBD 3QUYA 1T83A 3BVDB 5AVNA 1VA9A 3BKJH 3VXOA 4P8XA 4GMSH 1Z9NA 2REQA 5E5UB 3H0TA 5D2LF 2XACC 1NDTA 5KSUB 32C2A 1IL1B 4AHOA 2B9AA 1WK0A 3A3WA 4FEMA 1DPMA 1LTDA 1KY7A 3TXZA 3UTOA 4JFXA 3L3JA 4X9BA 1W8EA 3LKPA 2NY1C 5DJCA 3VTMA 5GZNC 4X61A 4JFEE 5E70A 3B1TA 1X5IA 4H1LG 4L0PB 2UY7B 3ITCA 3K5XA 3Q3GA 4MFEA 1J96A 2HVKB 5IHHA 5CGBA 1H7XA 3U79A 3PAZA 3RHWK 5DX7A 2XTJB 5D71L 1T03L 4F3FA 1UZ1A 3RN6A 4F24A 1H63A 1XRSA 2CPUA 4PTXA 4M6ML 1OYBA 2YMTA 3N42F 5C7ZA 4EN2A 2AANA 1H0IA 2CO6A 1MEHA 4UBPC 3M0JA 2WKJA 4PJFB 4HIJA 4PRHD 4FNLH 2XIBA 1UKOA 2QF7A 3HCVB 4NQVA 1ZS8B 4ZZKA 4AYEC 2ROYA 1XF5B 4X42A 2IOMA 1FZOA 3G6AB 3GHTA 1W3LA 3PWPB 4QT5A 3U9PH 4ZMNA 3B56A 2NW0A 3B7SA 1NGYA 4TMBA 1EXUA 3TF7C 5HHVH 3QUZC 5A3IC 1ODUA 2BOEX 3O15A 3KL3A 1GSMA 1MHPH 5JA9A 4M5YH 4N8UA 3DETD 4R26L 4LC8A 5K1VA 4RMTA 4JQIH 1DANU 4NI6A 3GDCA 5AZ0A 4XD3A 5I1LB 3FQ2A 2F74A 2EABA 4K9JA 3H24A 1TKWB 2XINA 1WCBA 3WKML 4YSUA 3W22A 4FQ2L 3QXUA 2VERA 3WFBH 4WSJA 3VSTA 1Y65A 1FAKT 4WKFA 1WHOA 1QLRB 2XWDA 4FZ8H 5DVMA 2DY3A 2FZDA 1K2DA 1I1XA 3QO0A 4R33A 2YDRA 3BWAB 2HBXA 2BS71 1KFJA 1BX2A 3DESA 5ID1B 4JPSA 3ECWA 1UPPA 4EZLA 4PRAB 3URNA 3MR9A 4ECNA 2EVJA 3UX9B 3L3KB 4PREA 2HJKB 1DWJM 2J9YA 4C90A 2MPAL 1TV8A 1VCFA 1JXGA 3BOXA 3CU2A 3QHNA 4ZO7A 1E0XA 2NXZB 2H8PB 1ZE3C 1Q90A 3TIEA 2IG2L 1I8IA 1U2CA 1A66A 2AL2A 2EIKB 4MXVE 4JS7A 4NQCE 2G9HB 1ZLEA 3EZ4A 1U6AL 2H6RA 2APWA 4EI5C 3VFSA 5J1AB 2AQ3A 4NC0B 5AKVA 3PDGA 2O92A 4KIRA 1EC8A 2Y07H 4EZKA 3QUGA 1KN2L 2G97A 1UH4A 1I7ZA 5ADPH 1UD6A 2VXVH 4DBWA 3RVTD 1Y5XA 5A6IA 3V5OA 1JZDC 3FU8A 4DGYL 3QW9A 3V9FA 3WD1A 4UINL 1L3NA 4X0KA 2NX5D 3EXRA 1BXCA 4KS0A 2C9RA 1SJHB 5DC0A 4XPFH 3IXAB 3CX2A 4B5TA 4J4PD 3IGAA 1PZ5A 5GS0C 4S3EA 2PAJA 1RLWA 4XZIA 3GMNA 2X4RA 2Z91B 3GLZA 3QQDA 4GIRA 1BFVL 3KLAA 1BBJB 3AB0C 1R2RA 3WTWA 2CZVA 1LWIA 3LZ5A 3RUGE 3ITGA 1V3KA 1A3ZA 2H1PL 3I6LD 5KS9B 2HN7A 4QP0A 1NL0H 1OAKL 1GJUA 5HHMD 2CO7B 8FABB 5HDRA 2BSSB 2QPXA 2P0IA 4NO5A 1IBGH 5ISZB 5E4IA 2P45B 5DT7A 4ICWA 2B7NA 1F97A 3PXJA 1DL3A 2Z2BA 2YRPA 3KCWA 3QEHA 1P4IH 1TJXA 4YJZL 3RU8X 3WK1A 4NM8L 3PBWA 4RAHA 1R75A 2J2ZB 4JFFD 5JOFA 5F97E 3N0AA 1GZHA 4I2XB 4ZOBA 4HC1H 2EDBA 3TURA 5IFAL 1IEHA 4ZUUB 5T1LB 2FLMA 1UM5L 1HE7A 1R5IA 3TSDA 1VF8A 1HU8A 4YXKH 4NQSB 3CV1A 5H4YA 1OM9A 3D8MA 3N9KA 4FO4A 4H8WL 1CT5A 2K45A 1HYSC 3ECVA 1MDLA 5HNUA 4GRWH 2KC0A 3QARA 1FNGA 2NOYA 3PJLA 3GG8A 4XP5L 3A21A 3G7TA 5J13B 1KM2A 3QZPA 1E7UA 5LO7A 5INDA 1B6UA 4LSQL 4QRUB 4JFDA 3IDIA 1MDRA 3QFJB 3LQGA 3TA9A 5EZOH 2Y23A 1JGDB 5C0EB 2A2IA 4L8BA 3PANA 1IZKA 2Z1KA 2DYSB 4JO1L 2LVCA 3GPSA 2AGJH 4TULL 1FH5H 1YNKH 2W95A 1FCBA 4JN2A 4MDJB 4YVVA 3GPEA 4PJ8A 4DOHB 1G7LA 3VI3A 3Q2VA 5GQBA 4OCSL 1ANUA 3X11A 3SBRA 3AT9A 1FWXA 1IT7A 4JR9H 3L7EB 1SSGA 1H8NA 5ALCH 1KEGL 2HV5A 2OX4A 4PUBL 1KV3A 2O9OA 3Q5TA 1EMTL 4TVUA 1ZCOA 2OX1A 1NEYA 4LPUA 1GZQA 5KZ6A 5A6LA 4C6LA 4Y5YC 1J9RA 1K9DA 1FZJB 4E41E 4JTLA 4MPQA 4HPGA 4I88A 1I3VA 3RRQA 3R8GA 1U8LA 2YD9A 3ULAB 1FBIL 2IALA 5HHMB 2BW4A 2FYMA 5DFAA 5DFVD 4S39A 5C0CE 5L7XL 4CBZA 1S9VB 2XIMA 3KOWA 5HPCA 4XOAA 4PWJA 1ZGDA 1IKFL 4ZQRA 1OOWA 1FY6A 3KBPA 4IF2A 3VH8A 3WMQA 4Q97A 2CR6A 1V02A 1XTLA 2Z8VC 3WLQA 4LEFA 3G6LA 1O1HA 2J8OA 2YDAA 1D7KA 1WUNT 3BEVA 1S2AA 1TO5A 4R2GC 3RURA 3GLCA 1IFRA 1HUVA 1ED3B 4QSFA 3RFZC 1I6NA 1M7UA 1LO5B 3IVSA 3FCSA 2RDWA 3RQ3A 2EIJB 4QRTB 3PQYE 2XETA 3H12A 4JFQA 4O5LH 1RJZB 3D18A 4RZ6A 3HA0A 3GHSA 4UMCA 5D4JA 4LCUA 3AISA 3E8UH 4LKCA 1SEBB 5DGRA 5C3IA 4EJ1C 1YAIA 3DIDA 5KYYA 2VLRA 4GBXC 2X4UA 4K5MA 4AIXA 1DVFD 2NZIA 5EMUA 2EIBA 4NNXB 3MA9H 3LEPA 4AZCB 1VEMA 1DN0A 3WAKA 3OR6A 4HSCX 4XP4H 3W2LA 3QWOB 1J48A 5HGAA 4POZD 1Z9LA 1E6NA 4NLAA 1I3GL 3OG2A 4QE4A 2QZQA 3UZEC 1IBYA 4AJWA 5FV1L 2VR8A 5REQA 1UD3A 3HRZC 5GRVL 4RGOL 2YEZB 1AIFB 1NMBL 4JJHA 4R4ND 2I17A 4HXBH 5JQ6L 4H9YA 4JFWA 1XEDA 2AXWA 4PJ5A 3OVQA 4GISA 4TOQA 2PXYB 3FO1A 5T3XL 5EC1B 4UUIA 3TO2A 4RNRA 4H1LB 2ZCLH 1U95B 3LQZA 4NQ1A 3HI5H 1MREH 2CJSA 4WO4B 4PRTA 2EH7L 1NVMA 4GNVA 1F8IA 2BTMA 4RRPA 1Q1PA 4HJEA 2BNJA 1NQBA 3HUJF 4DXVA 1AAJA 4KI5C 3QQ0A 5FF3A 1A2YA 1R5VB 1JZ2A 3MSYA 4JQVA 1X9QA 3UJTH 3JVGC 1W3JA 5AW3B 1Q9LB 5GGVL 4HBCH 5TQ2H 3P93A 5C9ZA 1ZSDA 4JY4B 5MEOB 3ONCA 5CUSH 3KAAA 3UZZA 4YHLL 1AE6L 3ERPA 1MNZA 1QSED 4KRPC 1AZUA 4AK1A 2QJNA 2OMZA 3UJIL 3VE7A 4UUJB 4S1DC 3U5UA 3BVTA 4UANA 4DBEA 3V0DA 3N3TA 1TTGA 3EKGA 3R0MA 5I06A 4ZUSA 2R4RH 2Z1WA 1KCVH 2OQYA 4B9JA 1L4IA 1EJRC 1ET8A 4MDRA 3MV8A 2HDJA 4NQXA 2WMFA 3O4LB 3S6DA 1GOQA 4JDZA 1LQAA 3GZAA 4Y8FA 4MYWB 4KTDH 1EGMA 2C1IA 1DVFB 2EC9T 4GQBA 4DF2A 3OVGA 1SDDB 3QCTL 5TE4H 2GVJA 3KBHE 2B16A 4BQ3A 1KACB 4KKNA 4FPSA 2ISFA 5IMOA 2VDMB 1WNOA 1NEPA 4M61A 2VDOB 5L2KD 2HLFC 4KK8D 3ZZLA 4WU5B 1K9EA 3FRUB 1N4XL 4HOXA 5AOJA 1XEUA 3IS0X 5IW3A 5DJ8B 2WTRA 2KZHA 5E5RB 2ADGA 3JWNG 1ZP4A 3CT2A 3HQ1A 3DVFA 2AW2A 2O4EA 3RDTC 3KW3A 5CZ0A 5EHFA 4RFOH 4XBPA 4BF9A 3DFSA 4S3DA 3PWVA 1GYUA 3W0WB 4WUKH 2V0AA 4JG1L 5C0AE 3SQRA 1OZMA 5T5FH 5G2HA 4LV9A 4L29B 2FT8A 1RUMH 1AR1B 3NA8A 5EO0B 3WKPA 1DORA 4QGCA 4CCEA 3MV7A 3D39A 1MF2L 4PLOB 2XWEA 4RGNC 3LN9A 5J5DA 4DZBB 2RH9A 3DURA 4BQ6A 5KTEL 4X5XB 5IT2H 2LGNA 3GMRA 2XU2A 4E9QA 1YDOA 1X4ZA 4CAGA 2EJ1A 4CQ9A 4DHGA 1NDZA 1J87A 1GMEA 3W27A 3AY4C 2WO2B 2PDFA 1DOSA 1GZGA 4FN0A 2KT6A 1H3XA 1B3VA 1NEUA 2WLLA 3MJ9A 3QIUA 1KTDB 4WCYH 2C4XA 2NNRA 1G9ML 3F01A 1PS3A 3EX3A 3AOFA 3GQFA 4NZFA 4BI7A 3U2OA 2HVOA 2BDQA 5GGTA 5TTRA 2FIKB 3RVXD 3D0VB 4FG6C 5SWUA 3D50A 3ULVH 3IE4A 2LAAA 5G5DB 3KMDA 4GPNA 2JWYA 1FG9C 1R9FA 4P2RE 3U57A 3EO0A 3ROOA 3WL9B 5T1JA 2ICSA 5BU9A 3WQWA 4F9JA 4KKCD 2D0HA 3N2BA 1JMZA 4FXGA 5E8DL 1N55A 1OP5H 3CH1B 5DQJA 1O0VA 1I4NA 1AD0A 4DYKA 2OXHB 3QZWG 4P46D 4XODA 1YRKA 3DMMB 5ENLA 1F0LA 2RHEA 1RIUH 1YQ2A 3MSGA 1X5XA 1EA9C 1UR2A 4KITB 2PP8A 3GUFA 3SJVA 2EYTB 1UQSA 1C92A 4Z2KA 1KC5H 2KLRA 4GIOA 3FEMA 1E6SM 5CPOA 4OZHB 1V3LA 4RAUB 3N1FC 3SBPA 1S7XA 3PL6B 1ZWIB 3GVGA 1DXIA 5LXXA 4LAJH 5LAXB 4QO1A 1D8WA 4JFUA 1TTFA 1CDIA 1F00I 4KVPA 2XOTA 1HI6A 5SWSE 1XGDA 5JHDD 5DQ9B 4PRWA 4PCTA 3GHBH 1E4LA 5FYKD 2WTPA 1SLXA 2MKWA 1HO1A 4XXCA 1LF1A 4MJJA 4O0QA 4E4UA 3IK4A 1ZOXA 1V7ML 5EBMB 2CIKB 3RIKA 3DOSB 2AK4D 3LSBA 3ARZA 5T1DL 4IPJA 3SE3C 3W56A 3KVKA 1PZUB 1K4GA 2XZ7A 4B9YA 2BGQA 1AHWC 5IR1B 1XH3B 4XBGB 3ECUA 3U0TA 2GJZB 3IE9A 5GSRB 4LYRA 1IXPA 5A8MA 1JGLL 1LOSA 1RI8A 3EB3A 4IH3A 4ZO8A 1Z0MA 2IPUK 3ROLB 1OB1B 1NZRA 4MCMA 4WHBA 2NSOA 3F58L 2PPCA 3TO4C 2NSQA 3Q6GL 1W0WB 4WTZG 5DR5H 4MY1A 4X8JB 3JVAA 4O4WA 4WW2C 1OCOB 3R94A 2JMRA 3S5ZA 2XG4A 2Q9OA 3A4DA 3H8AA 1A0CA 3BZ5A 3FH7A 3O41A 2HISA 2J79A 3NPSB 3VFPA 5FYJH 3BDKA 2OG9A 4C6OA 4OF3A 3SY5A 4Z18A 4O19A 3A3HA 3UYPA 1XLGA 1RQ5A 3FT9A 3H54A 2GK1B 3QISA 4OZ4A 3MGOB 1NC2D 1H6FA 1SXSA 4P46B 2ZZ1A 4RX0A 2C4FT 3TH3T 3EXJA 3LNEA 2OT0A 2VDQB 4Z08A 4H4NA 1HFBA 2WZHA 4ASTA 4J6IA 1EJTC 3SCUA 4I7VA 3OVUB 4JAWA 5IW1A 4XRCA 2XBTA 5FF4A 4FOJA 1JDEA 3VXQB 4HQVA 1D2KA 5LQBH 1SR0A 5FKYA 2HG5A 2ZIDA 4L3CB 1OW0A 5C9UA 3ETBJ 1UEYA 3P8JA 3QIWC 5HPMB 4YSQA 4QCFA 3LV6A 1EEPA 5HATA 5DEGA 1T1XA 1BGAA 5HVHC 1MWAA 3OG3A 1BQSA 3GNMH 1X9LA 4E3VA 5JHDB 2XHNA 4S1SH 3VRIA 4XBEL 5KEZA 5EMLA 1U8CB 3KPSA 5C0BD 2YXXA 4YC2C 2JCCB 4O1DA 4P4KD 2QCLA 4TIMA 4FMKA 3Q2NA 3RF9A 2Q86A 8XIAA 1OQOA 4QHLA 3DPBA 3AWEA 4E0RB 1YYAA 2EDNA 3ZQWA 1PFOA 2IWGA 1LWRA 1VADA 1LTXA 2FD6H 2ZPKH 2BP8B 5GNXA 1RPQA 4L5ZA 1HCYA 4GWEA 3FPYA 4HETA 3MWAA 5LIUX 1AO7D 1J9CT 4XPAL 3QXWA 5AFAA 3ARUA 3W7RA 4M7JH 2EE6A 5DJ2B 1DLHA 3QUYD 7A3HA 2Y62A 4OLUL 4XX5A 2A1YA 5J6SA 1CCZA 1EO8H 2Y7LA 3B0YA 4OQTL 3B04A 4YH6A 4NKCA 1MHCA 5DVPA 4TQPA 2ZVIA 2IDUA 2XWJA 2G2NA 2FUTA 5TH2B 1E1FA 3GJFH 5L6YH 4QEHA 1G7JB 5L8JB 2CBPA 3QWRA 4QJ3B 3GXIA 4YSTA 3W2KA 1J18A 4K8RH 2OJ1A 3TIMA 3ZVHA 3IM1A 4FXKA 2A6NA 4Y90A 4AI7A 4GSRA 3O8AA 1NCHA 1EIXA 2DQIH 1WAPA 1R3KB 4GZJA 3PFQA 5FA4A 1MAMH 1EJVC 4MJ2A 3O6AA 3UYRL 1XKJA 2QVFB 1FIGL 1SM3H 3VFWA 3P74A 1YUHA 4F1ZA 3VCLA 2EPOA 4HMDA 3MLZL 2XYBA 3R43A 4FFTA 5JHAA 4ZGYA 2FUQA 3BRGC 1S7SB 5KVDH 2XWTB 4GUCA 2R1PA 5TQ0L 3EB4A 3JTTB 2JB5H 4D71A 3QC3A 3SPHA 5IJCC 3UP6A 2RGLA 4PJEA 1TVNA 3PBYA 2CO4A 2E5BA 2GTWA 3BP5A 1F3JB 3KP0A 3CCHB 2I5IA 4PB0L 3S96B 4RA3A 4DEPC 5L4JA 4JHWL 3SURA 3M17B 2HZHA 5LIWX 1GOOA 3QEQE 3VVWA 2PPFA 5ICXB 3O4OC 2AAVA 3LA4A 1CENA 1WISA 2FJGB 4MXQC 4LSTL 1YEHL 4ZFZA 3Q1SH 1IM3D 1CI5A 1IIHA 3D0LB 5CINH 3L2IA 1NICA 3BJLA 3L17A 4URKA 5AYZA 1ZP3A 4ANKA 4X2UA 5HGGS 4G1EB 1T5KA 4Z23A 1TVDA 2YD8A 4PGDB 3G5YA 4OJAA 1PD0A 2VYOA 3WLRA 1NGPL 2Q7NA 4OZFG 2PYFA 4H2AA 1ND0A 1EUTA 1SPDA 4J40A 1A50A 3TBWA 3VOGA 2QLYA 2GK0A 1AO7B 3XISA 4U1JA 3ZDXE 3SZ6A 3EMCA 2XSAA 2YAEA 1OM3L 1Z9SA 3BDXA 4PQXA 3N2XA 4AV5A 4I8DA 3VXOB 1ECEA 5I1EL 3DO3A 5F0JB 4YX2H 2REQB 5I03A 1OARL 1SUHA 3MBEC 3B7YA 5D03A 3G1HA 2KH2B 1S38A 4OUUA 1MCJA 3FU3A 2DDQL 1FI8C 1G87A 1H7OA 1GQIA 2RD0A 2QVHA 4HH8A 4JVPA 2FZ9A 5HTSA 3T55A 2BRRL 1EWDA 2C6QA 4LL1A 1WBZA 1JQVA 4OJFH 2VMCA 4OLVH 4ZXBA 4MPKA 4KJWC 1QNQA 4MBRA 1QFUL 3IDXH 1WB0A 4Z0XA 4QDPA 1E6JH 1ZHNB 4EUPG 1LL1A 2J6VA 4ZCWA 1WFMA 3W72A 2HWZH 3EGXA 4R53A 2YXMA 2I32A 1ROWA 2DYPA 1EZLA 4XNXL 4D8LA 3LZRA 4YLQT 4A7TA 3FEQA 1INDL 2VISB 5DO2C 1AD4A 4HKPA 1LK2A 3RU8L 3O81A 5I6PA 1UQYA 2N4IA 1FZOB 2VKZG 4E0CA 5G2WA 5D70H 2ERJC 2D7QA 4QT5B 5LXGL 3NN8A 3CU7A 2UWEB 4GGHA 1IBBA 4WDIB 4FTVE 3OJMB 1P0KA 3K30A 4LEOA 4BA8A 4PMXA 1EXUB 1K8IB 1JTPA 3QFWA 1IIGA 1V6YA 5GGRY 3MLVL 1SFDA 3DG6A 3TR2A 5F3HA 3AT8A 1Z3NA 3SGEI 2WYTA 3QZWB 5B4MC 2ZOXA 2CLKA 4KK6C 2YB4A 1IM3B 2F74B 4QGTA 2WC7A 3PG2A 3RWGB 4EZJA 1R6VA 4U7SA 4LAMA 2ITEA 2CYGA 5D2LE 4PR4A 1DZ0A 2MWCA 1IGCL 3ARFB 4GW4B 1RZFL 3Q9PA 2DLFL 4R7XA 3OW1A 5EWIL 3LKNB 1UIOA 3CFCH 1XB6A 4UM8B 4AQOA 2IVFC 2HKFL 4W93A 2DICA 5HHQA 3VFUA 3QO0B 1AJZA 3AU1B 1DVYA 5EU3B 4ZSUA 1BX2B 3WNMA 1KB5A 1R8LA 2Z6IA 1BF2A 1G0YR 4L4VE 4EF8A 4N22A 4W84A 3WHE0 4EIZC 1LLZA 1KV5A 1LYXA 5IVZA 4JY5L 5GISH 3BAEL 3IFPB 4FP1A 5I16B 1EHXA 4Q6IA 3RWDB 5ID0A 4FTDA 2OL3L 3BIBX 1ZHAA 3H2PA 3AG3B 4G5ZH 1U8OB 3R1GH 1R85A 4J5NA 1TELA 4JFDD 3STBA 4NL1A 3FZUD 5E2WH 3HE7B 2ADAA 3QPXH 3JZYA 3PWJA 3GZQA 4KPLA 3AS1A 4K1WA 3VDCA 1RJQA 1AANA 4NO3B 1QJWA 3SPCA 3MJYA 3GC2A 3U5YA 4GINA 1OSYA 3E1ZA 4M6VA 1I7ZB 4NPKA 3TYEA 5ALBL 2CUHA 3HMXA 4AW4A 5IHUH 3W84A 3NG5A 1DE4B 1G0XA 3VILA 5HJBA 3LM3A 4JXCA 4UDTA 3F6JA 4L37B 3L3IB 1RY7B 1YC8A 3QULA 1GGOA 1S5TA 2GJ6B 4G8IB 1EF3A 4AYBA 4UMBA 4WNJA 1K85A 5IJKA 1EGZA 2B8OT 3MCYA 2GGGA 3IGAB 2CZ5A 3DJRA 1PZ5B 2OJEA 1TIWA 3H42L 3GSNA 2GAZA 3SCTA 2RDXA 3V4PA 1NIBA 4X99A 1XL6A 2VR7A 3QJRB 3AGWA 3G1DA 4IOIA 3CAKA 1HSBB 2ENPA 3BYTA 1UWFA 3WKQA 2AQWA 4NSKA 4WFFD 1R5WA 4FDWA 5C6TL 4L3ED 2WWKT 4CSPA 3KPQA 4BBWA 2WPGA 4BRVA 3OZLA 4CKVX 5K9OB 1Q72H 3MRDA 1MCBA 4P2QE 4W9IC 5CPMA 4A6YL 1GPOL 3IVTA 1EJFA 3JUYA 2Q1EA 2F84A 4Q4EA 4RV8A 4XOCA 5CC5A 2J75A 1CBVL 3CFNA 4F7EA 3FF8A 2CBTA 3IMVA 1DUZA 2WLIB 4KNSA 2V2XA 1QTWA 1SVZA 4WR3A 1EFXA 2B5IB 1KCSH 1EZ2A 4C1NA 5I1IH 4HNOA 5DYOB 3A0OA 3U0HA 4LCIH 2FSEA 2OPCA 3B3IA 5DLMH 2P3EA 1F1AA 5JHBA 2P7TB 3K81A 4DP0X 2AV7B 1IGSA 4IX2A 2J8UB 2YXFA 3UBPC 4PMZA 3P0WA 4JJ5A 3ZWSA 1ZE3H 1FLTX 2B4CH 3O8XA 1JPGA 1LO4L 3HMWH 3Q1EA 1YEDB 5DJDB 2XQYK 2WCPA 1E40A 2RR3A 3BW2A 3VIFA 1FNGB 3N12A 3OF6A 5EEWA 3WZ0E 1Z41A 3RRXA 5SWZD 1MDTA 2YRZA 1FVEA 3QFGA 2VLRD 1CLKA 4U5KA 2WXGA 3IDIB 4PTTA 4PUWA 4MNQB 4MB5A 1MUJB 3G1RA 3MACH 4LLVA 2DVTA 4WSKA 5C6PB 3LNGA 3O3AA 3SCRA 3CHRA 4U3HA 3BZFB 1OFAA 1S7UB 2J1KA 3C2SA 4PY8J 3T2NL 1PX8A 4NKIH 4JN2B 4DEWA 1F3XA 3DRQA 1L5GB 1G7LB 2HFEA 1IQDB 4IKIA 4UV7H 2YEQA 2W5PA 3F7LA 5GS0H 3U1PA 3SY1A 1J5CA 2DZUA 1FZMA 3CZSA 1YEIH 4Y4KC 1QNRA 3GT6A 2QYGA 4JTFA 3UXIA 3O6LL 4X9IA 1U9KA 2A3AA 3IMSA 4PJ5D 5A6BA 3PJWA 4ZOAA 2NY0B 3GS0A 2J5LB 1RK1B 3CUHA 1ME8A 4ZAKA 1W0VB 1LJYA 2X4PA 1TWZA 4WFEE 2O93L 4L3EB 4PN6A 1JQXA 3KW8A 5IZ7A 3D9AL 3LDBB 1UJTA 2J74A 4XNYH 4YEFA 2Y70A 3E6HB 1U8KB 2X6VA 3BFWA 5EBLA 4TMCA 5ICUA 2XV3A 1ET7A 1AGDB 4JFOB 3KCOA 4NXKA 4X7SH 3IJSB 4FQ1L 3PS6A 1JMXA 3VH8B 1CLCA 4CVZA 2M83A 1Q7MA 2J1ZA 1WO2A 3RIFF 2A73B 3BAKA 3LHUA 2VW7A 4XCEA 1XB8A 2AKZA 1BTCA 1UH2A 4OF8A 3CAWA 3LH2H 1FAIL 3PAVA 4U6YB 4DQAA 5D9NA 3X1NA 2P8CA 3DX1A 5ABAA 1IC7L 3B43A 2QJHA 3G9AB 3UZXA 2BVQA 4QM1A 3VM5A 4WKHA 2IDSA 1J8HE 1V55B 2YD0A 4HIIA 4RGMB 3ABXA 2J7CA 1L0YA 3MV8D 5SWZB 2WQUA 1O60A 3DA0A 1H3TA 3P6LA 3TBSA 2XKNA 3N44F 5M03A 1WSST 4NCC2 2V37A 1CGYA 5FKPA 4OZFB 4J3OF 5BZAA 2X7VA 2AJYL 4M7KH 4LQFL 2A74A 3L3DA 2UV8G 1KJVA 1GAFH 5M7QA 4IU2B 5IOPA 1YEWA 2CJ3A 5E03A 3BAXA 3U9WA 2G3ZA 2ZCKL 3NVTA 3U9IA 2ZOKB 1CNVA 1OK0A 5EMYA 4GXUN 3WF1A 4WOZA 4AG4H 1ONQA 1E9OA 3N9SA 1IEBA 2A6IA 1UKTA 2K6WA 5A95A 3TA3B 1H7RA 4PJ5B 3FHQA 1GGCL 1X7IA 1DVQA 3LMYA 1XLAA 4QJ5B 3TO2B 4GAYA 1RCYA 5M94B 3ZTDC 3SKMB 4WZ9A 4PB9L 3B8DA 4UTHA 3GINA 1TTAA 5L4MA 3MV7D 3D39D 4Z95L 5C0QA 1B0IA 4GUFA 3P4OA 2KI6A 4EUPB 3MMWA 2VR3A 3R0DA 1BAFH 1UWXK 2ZKYA 4GMTL 3ZL1A 1TF4A 4PG2A 3ZLHA 3BPNC 1IGFH 4X6CA 2VXNA 3MSDA 3UR8A 3LD8B 1ZSDB 3QIUD 2Z7YA 4IRJC 1JZFA 2DUAA 3W1MA 4WFGE 1F6KA 3OZ9L 4TF4A 2AEOA 5EN2B 3WF2A 1VKXA 1R7OA 3FULA 3GFZA 2YPVH 3H55A 2W60A 5AVUB 4Y2WA 2PDQA 2OMZB 1FCQA 3E96A 5DJ0B 3WLIA 1MYRA 2Y36L 4JEJA 1IWPA 3H2MA 1AOZA 1F3DJ 3WGUB 4X3ZA 1SZGA 1LWHA 1Y6MR 3TWYA 3QCUH 3SR7A 3A12A 2QF8A 3MMEB 1B4TA 1BHGA 2EYSB 4UTLA 5E8NB 2IPTL 2W62A 1QX1A 2VDKB 4FG4A 3IWUA 1H3VA 4AZGA 3J27A 2F5BH 4ZNEA 3NR0A 3FPXA 2YD1A 3TESA 4JPIB 3QUMH 3SJVD 4M29A 3BSZH 3FTZA 4M61B 3B5GA 1BQHA 5KBDA 4GYPA 4O0ZA 4PRID 3O9WC 5HGDA 1QLEH 4O13A 4R34A 3UC0H 3V5DA 4C4UA 1E8ZA 1I60A 4L48A 4X4YB 3HUJE 1FFPA 4B3KA 3F3HA 1JDAA 3MOBH 3WFEH 4LBUA 1QAWA 3PWVB 4IMAA 2Z1XA 1XGPA 5L88H 2DZEA 4CQAA 5I8KH 3GXNA 5BMFL 1TQCC 4BK5A 2Y4SA 1IV8A 4ZZFA 4FNQA 1YA5A 2DBJA 4JTGA 1UMLA 4OT1H 1YUKB 2J72A 3EYUH 4QS5A 4XG1A 4E6MA 2NW3A 1HWHB 5K9QG 1EEQA 5J8LA 5KZDA 3IVKA 3UJRA 3RITA 3RX5A 3GMRB 3QZEA 5CSZB 3S46A 1TYEB 2ICWA 4M93C 4YHGA 3WUZA 1UWAA 3UABA 1E3ZA 1CJYA 3FQXA 3DV4B 3R11A 4JM2C 5DXYA 1WDAA 2WLKA 3SYQA 3ITVA 4S1FA 5I7GA 3Q6FB 3WQ5A 1EQWA 4AG0A 1WVZA 1IIIA 2XG9A 5KJ7E 4M6OH 5DZ9A 4DWSA 4Z7AA 3EOTH 4NWTH 2RUSA 1MVFA 5D6CB 3LS9A 1NDGA 2F19L 2VN3A 5I8CA 3NJVA 3W7KA 1GYAA 1FUYA 2VABB 4DEUA 3QP3A 2I9TA 1LP9B 4OJYA 3EO0B 2GL5A 4M02A 2HTLD 2F68X 5L9DL 2W66A 3NCEB 3VIJA 4XMTA 1BVKB 4R4BA 5CJ5A 4XAFA 4HJSA 3VXRA 3S3PA 4KHXL 4M6QA 3TXVA 4MJIA 3UOAB 4HS3A 4MWFA 3WFLA 1I4FB 5BO1L 4ZFFB 1F76A 3CASA 3C08L 4N2OA 2WBGA 3P0VL 1M05A 2HJFA 2AVFA 3EPMA 5JMOC 2NNAA 4MG4A 3GBDA 4ZPTA 1O7SA 1TVHB 1YG9A 1SNRA 4AWJC 3TEYA 3T6ZA 1D7DA 4CCCA 1RIHH 2EO7A 4PRIB 1DSFH 3HS8A 4FF7A 3SYAA 1S7XB 4OY9A 3OVPA 3EKLA 4A39A 5A2FA 1ZGLP 2J12B 2OWWA 5KSBF 3ARDC 3PZNA 4W9EC 4C7FA 5HY9A 3VGDA 5ABDE 5F9DC 3GVRA 2RCSH 1XL4A 1HHGB 5IB2A 2B4CC 2NQ5A 3TTQA 4F8PA 3N55A 1XF3B 2PRMA 5I2UA 4NZDA 4LF3B 1O9ZA 1S6NA 4RE3A 4ONFH 2WV3A 4Y5VC 1I3UA 2QCDA 3KPSD 3GC5A 1SU5A 4WDUA 2XPKA 4AYMC 4GI4A 5B8CC 1XBRA 3BLOA 3CT7A 1U8NA 3H85A 5E6IA 2A99A 2OQLA 1L9WA 3GTHA 4QUOA 1UD8A 1CB7B 4LUJA 3OPZL 2X4OA 4KFOA 3MNZA 3V6BR 1GQKA 4PCYA 2YA2A 1PZ0A 1Y18B 1UCTA 1ZGLB 1D5BA 1QUNA 3WUBA 3WLHA 4JHAH 5EN3A 5D1ZI 5A2BA 1Q8JA 1Q8MA 4PRHB 5DZAA 4TTUA 5CJXA 1IR2A 4LESA 4N5ED 1RA0A 4ZW3A 4AD3A 3YPIA 2H8XA 5BVJA 2J6EH 1FL5A 1O6SB 4PJHA 4PAZA 3CYVA 5DELA 3F7PC 1URLA 3T8QA 3BK0A 2OMAA 1JFXA 5HHNB 4HNUA 5IMMB 5D7JC 1RMFL 3PSVA 5BNXD 4RH4A 5IQ9B 1J8RA 1R17A 5CQ1A 4NGHL 4XBSA 4AD2A 4HCFA 4GC3A 4HH9A 2E1WA 4ZD3L 3FYOA 4AXWB 3FT2B 3QWRD 4EN3D 3JV4A 1ETZA 4IBQA 1SOQA 4JLRA 1MJ8L 2AJ3B 5AYQA 1W5PA 4F9LA 1VHPA 1I7UA 1C7TA 4AQLA 1XCXA 3TYUA 1VBJA 3NZPA 2QXWA 2Q3OA 5FYLD 5TDOB 1JFQH 3ESPA 2AZUA 1G9EA 4ERSH 3GI8L