3PZ9A

Native structure of endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
total genus 156
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pz9A00
2V38A 3QOKA 1HX0A 2ZUVA 5A3HA 1BSIA 1E6RA 1LJYA 4PSRA 3I3DA 4Q22A 2E4TA 3PTQA 3AYSA 4H41A 1E4NA 2W66A 4QCFA 2VQUA 1GZJA 2XVNA 3II1A 2WW5A 1QI4A 3BMVA 3AIQA 3LMYA 2JE8A 5LA0A 2VC9A 1QHOA 5E9AA 5CGTA 1I1XA 1EA9C 2VX5A 1GHRA 1JYVA 3CHFA 2UY2A 4C7DA 3VIGA 3VIHA 1F4HA 2WMFA 5D8WA 3O6AA 4MNKA 3OB8A 3L4YA 4IPLA 3IAPA 1E9LA 1LWHA 3RM4A 1CGWA 4KGLA 1KR1A 1E55A 4TVDA 4ZFMA 2DQXA 2A3HA 2J7GA 1JF5A 3WH8A 2VQTA 1WZLA 4HPGA 4MDPA 5LA2A 2GDUA 4BF7A 2UY5A 4WKHA 3SEPA 4AIEA 1W9BM 3MUY1 3SCPA 2CBUA 2CPUA 3PZ9A 4H7VA 3WMCA 5HPCA 1MFVA 3VD4A 1EXPA 1MQRA 3VIOA 4CN6A 1UKSA 4KH2A 5GNZA 3ARYA 2ESCA 3WQ4A 3NDYA 1EHAA 3RJYA 3DECA 5D4YA 3N1AA 1E70M 3EDJA 3MUZ1 5A8MA 3WQVA 1ZS2A 4CVWA 4MAVA 2XWEA 3VM5A 4W8LA 5BXPA 4DM1A 1BVZA 1UKPA 4QLKA 2WWDA 1JF6A 3VDHA 4M29A 2JEPA 1CXHA 3WIJA 1YQ2A 2J62A 5JBEA 1NH6A 2VR5A 3WDPP 2WMGA 1VEPA 5FKYA 3PZTA 4XB3A 2YL5A 1OD0A 1AMYA 2GK1B 2GK1A 4NI3A 5I24A 1UD4A 2CESA 4BQ4A 3PZIA 2Z1SA 4DUWA 1TFVA 2DSKA 1E0WA 5A6SA 2PBOA 2BXYA 1OT1A 2XGBA 2DT2A 5I6SA 4BS0A 4LPCA 1JDDA 5CGMA 2X1IA 3S2CA 1NOFA 1W3KA 1UR8A 3I3EA 3AJ7A 3AOFA 1V6UA 1XYFA 1E40A 1GORA 5LYRA 4HU0A 1L8NA 1NOUA 4GZJA 4LYPA 4OBRA 2O9PA 2ZXDA 4H8VA 3KE0A 3ZQ9A 4LGXA 1H0IA 3GBDA 1EO7A 3MO4A 2WNWA 2J75A 4CKQA 1HVXA 2VCBA 4CCEA 2YLAA 5AYBA 3IAQA 1UD5A 2E40A 3MV01 2YA1A 1J0ZA 4CU7A 4GZIA 2W61A 2E0PA 3WUEA 3OA5A 3U7VA 4WK9A 2WB5A 5AC4A 5BRPA 3NDZA 3VDCA 3PZQA 1QBAA 3ARQA 5FOOA 4TVUA 4UNIA 3GM8A 1O6IA 2EO7A 1MFUA 1NWRA 3HMCA 1GJWA 4JFWA 1B2YA 4PMVA 5EMYA 2E9MA 5I5RA 4TTGA 3WF3A 3CO4A 2J7BA 1C92A 3CUJA 2J77A 4H04A 1V3LA 3AQUA 3VD7A 3W81A 4M24A 1NWUA 1JG9A 2ZUTA 1E0XA 1A3HA 2WKLA 4U31A 3QR3A 3WBAA 3CTTA 1JAEA 4K68A 1QOXA 2XG9A 4Z2JA 1E3XA 5BYWA 2PF0A 3UESA 1VB9A 2DGAA 3FNDA 4CU8A 3KL3A 3VMOA 1G9HA 1QNPA 3GNRA 1TVNA 4X9YA 1OT2A 2E8ZA 3UR8A 3WDIA 1UD2A 3K8KA 2PC8A 3PZNA 1W9UA 4TTUA 3W6LA 1ITCA 1LL7A 4GXPA 4J3VA 3WN6A 2VZOA 3MSDA 5JIPA 1ECEA 2NT1A 3MV11 1BYCA 3MKKA 2XFYA 3SCWA 2YLLA 2EEXA 3RMEA 7TAAA 1XD0A 1I75A 1W1PA 1VJZA 1CXFA 4GI6A 1XYZA 1TE1A 4AD4A 2VR4A 3KWXA 1HXJA 3AI0A 5A6BD 3QGVA 3NUKA 1EHNA 1U33A 5GPRA 1H1NA 4PN2A 2Y2WA 1A47A 2OLHA 1KQYA 3F4VA 4AZ6A 4KWUA 4JAWA 1C7TA 2WC7A 5M17A 1N82A 4FLSA 5A8OA 4UFIA 1ZBKA 1JYXA 1EDTA 1AVAA 2VRQA 4QP0A 5BXTA 2D3LA 1DWFM 1V0LA 5CPQA 3RDKA 2PBGA 2EPMX 2WVSA 3AS3A 5CJ5A 3VGDA 3WKZA 1C7SA 1UOKA 1ISYA 1OM0A 1GPFA 2WWCA 2VURA 4KRTA 2WHMA 2WCSA 4PMOA 2A3AA 3RIKA 3CPUA 4YHGA 2X0HA 1J12A 2BHZA 1WAWA 2YJQA 2V3GA 3CHDA 1QI5A 4UQBA 1VFFA 1XH0A 1WZKA 2XPKA 3OLIA 2C7FA 5A8PA 4C7GA 1V08A 3VX0A 3IK2A 3WD2A 4J3UA 4S3KA 4H2CA 1RD6A 1QW9A 3APGA 4IUGA 9CGTA 1UKOA 2A3BA 4HPHA 3QOMA 4AD5A 1PX3A 1WDSA 3BH4A 1W9XA 3VGEA 1GQJA 3EDFA 4JKLA 1H0GA 2BVYA 1WPCA 4JIEA 3VGGA 3L4XA 3CBWA 4P8UA 2DSZA 3A4AA 2E9BA 2XFRA 4GIAA 4JFUA 2GJRA 5JIWA 1PPIA 4GKLA 1Q6GA 4W87A 4CD8A 5DT5A 4QLJA 5A2AA 3WELA 3VDAA 3T08A 1XD1A 1XSKA 4D6GA 1LLOA 5FD0A 4UFJA 1UR9A 2VZVA 4AIUA 4CVUA 1B0IA 4NRRA 3ZIZA 4TVCA 3NJ3A 4LX4A 4U33A 1TZ7A 1EO5A 3TTYA 4AZIA 4XV0A 5BWFA 1VEOA 4LYRA 3TOPA 4AZGA 5IFTA 1EQCA 3ZT7A 2JFEX 5D9NA 1TA3B 4BQ3A 1GQKA 4TXEA 3GXFA 5DMYA 1WKYA 4UCFA 3WD0A 1W3LA 1CECA 3CZEA 4AD2A 3ZJ7A 2JEQA 3GH4A 1HT6A 3AHXA 2F2HA 1UWQA 3VUPA 5GQBA 4D6HA 2G3MA 1C8QA 1VBUA 4AD0A 3SCTA 1ESWA 4D6DA 1HNYA 2V3EA 4WSJA 2WC4A 3CZLA 3TTOA 2ZX6A 1CXLA 1F4AA 4AIOA 4DUVA 4AWEA 3RM9A 3PHAA 1K6AA 3ECQA 1FH8A 1XGZA 2FHFA 1RH9A 2BY0A 2ZOXA 2ZWYA 8CGTA 3AHZA 1FOBA 1BYAA 3SUUA 4NSBA 4D6FA 3GXDA 3BLKA 3AIWA 3A6OA 1NWSA 1O7AA 3SIMA 2AMGA 2WSKA 2YA0A 5ABHA 1GOOA 3G6MA 3L2LA 3GXIA 2G8ZA 1SFSA 3KL5A 3ZSSA 1C8YA 3AMLA 4CU6A 3WEZA 2J47A 4W86A 5IXEA 2CETA 1JAKA 2QF8A 3AIRA 2CXGA 2D0FA 3OGVA 1OGBA 4BCEA 1BFNA 5A6MA 2J4GA 1GQLA 2Y24A 1J18A 1C93A 4J3SA 4A4AA 2CERA 5AY7A 1D3CA 2TAAA 3WNNA 4QDMA 1KWKA 3IJ8A 1V0MA 2DIEA 3EYPA 1LL6A 4FLQA 4QAWA 2AOSA 1E6SM 5D8ZA 1ISWA 1UG6A 2JF6A 4YHEA 3TONA 4BQ5A 6CGTA 3AFBA 3POCA 1EIBA 7A3HA 3K4AA 3SUWA 1M53A 3N04A 5I3DA 5E70A 4URIA 3VTRA 4F8XA 4GINA 4MB3A 3WQ5A 4MNLA 2WMIA 3VGHA 3NSNA 5DEZA 1E72M 1JXKA 1IZKA 2D24A 3VINA 3ARZA 1KQZA 3M07A 4AEEA 3K46A 4AD3A 1KWGA 2D23A 2WZEA 5A69A 2JIEA 3AYRA 2Y8VA 1B3YA 2YL9A 2WBGA 1CXKA 1JDCA 1UR2A 2X09A 3VDBA 2E9LA 4UOZA 3HJEA 1ZBWA 4XUYA 1OSEA 2WCGA 4WJXA 2VCAA 4DM2A 1E5NA 4UQCA 4NF7A 4PMZA 3W37A 2YDSA 4V28A 4PTWA 3TP4A 4HMEA 3U57A 4EANA 1Q6EA 4J3WA 3VX1A 4YN5A 3A47A 2YL8A 4CCDA 4L4PA 3ARTA 4ATWA 4PMXA 1EOKA 4WIWA 1BGGA 2JIWA 4PRWA 3EDDA 4AZ5A 3GNOA 2WAGA 4HTYA 1GOKA 3RM8A 4P7RA 1E6NA 3W4RA 3WH6A 4JHZA 3VMNA 3ARVA 3WL1A 3WNOA 1AQHA 3O9NA 5I2UA 3WMSA 2GVYA 1E6ZA 4OZOA 4CD7A 1BLIA 1GVIA 5ECUA 1B1YA 1LQ0A 2FHCA 2WLZA 5A6BA 1XC6A 4ATDA 1WP6A 2YBUA 3LPPA 4EE9A 3DC0A 4D6CA 5ABFA 4W84A 1CGXA 2V3DA 2XSAA 5CXPA 3QHNA 3WFZA 1CBGA 3B9EA 4HOXA 1CGYA 3CZKA 1QNOA 1XCWA 3LPOA 1VFOA 4PMNA 4GZEA 5A8NA 1W2VA 1X6LA 4MB4A 5CPTA 2HISA 3U5UA 3AMGA 1LG2A 4W7UA 2WHJA 1Q6DA 2WMHA 1J0JA 2XVGA 1V3KA 2Z1KA 1J0KA 3UEQA 3UG3A 2PB1A 5FIPA 4MNJA 2BHUA 1H49A 4NRSA 3N15A 4Z2IA 2NT0A 4MB5A 4D6IA 4V27A 2ZX8A 2DH3A 2JALA 4U3AA 3L4UA 1VAHA 3N13A 1GQIA 3VNYA 4M82A 5HNNA 2QPSA 2CITA 2WMIB 3CZGA 3PZMA 4RL3A 1JZ3A 4TOQA 3L2MA 4JL1A 1H3GA 3BAXA 5LA1A 2PI6A 2WM0A 3FAWA 3TA9A 1XV8A 1BYDA 4R27A 2OWCA 2BY3A 2EXOA 2V5DA 2J79A 3SCQA 3KL0A 1GVYA 2ZX5A 3WSUA 4XZBA 1P6WA 4AYSA 4HMCA 1X6NA 3BAIA 3AZRA 2YL6A 1OIMA 1PIFA 4CGTA 1EGZA 4E4PA 2D2OA 2CIPA 3PZVA 1HKMA 3N12A 4U5KA 4X0VA 4CD6A 2J7HA 2YBTA 1FA2A 2VUYA 4NZCA 2VX6A 3FN9A 4XZWA 2W92A 3BXWA 3AXHA 4JL2A 5KEZA 3CUFA 2FHBA 1CIUA 5JBFA 3A3HA 4F9JA 1UH2A 1XSIA 3L4ZA 5C8BB 2GJXA 2DSUA 4PMRA 2WVVB 3EDEA 2X0YA 1KXVA 4P8VA 2O9OA 4ZEPA 2ZWZA 1ZU8A 3EBVA 4HZ7A 3NSXA 5EFFA 3SCUA 1WCGA 3WNKA 3K8LA 2G3IA 3DHPA 3WNMA 4PUEA 4D1IA 1MW1A 4UFLA 4P8XA 2G3JA 3GZAA 1JL8A 3S6TA 3POHA 4ACYA 3OBAA 4P7OA 2YKKA 2WSPA 3VU2A 1HKKA 4MPKA 2WLYA 4PTXA 1UQZA 4BZYA 3K4DA 4W89A 2VZUA 4GQQA 1U30A 2CBVA 2XWDA 5I23A 2Y8KA 1J11A 3CLWA 3MMUA 2ZUSA 4PMYA 1E1EA 3I3BA 4W5UA 3ALGA 5BCAA 5CSUA 4H8UA 4CN4A 3WFLA 2X8RA 2EPNA 4UR9A 3T2PA 3WD1A 3VILA 2ZE0A 3VIPA 4ZE4A 1WZMA 1W1YA 3T2OA 1JFHA 3VD9A 2XVPA 3L4TA 3OZOA 2QHAA 1MYRA 2ZXQA 3FAXA 1B3XA 3W6MA 2DDXA 4UQAA 1JZ8A 2XIBA 2VMFA 1HL8A 3WEMA 2FH8A 1JI1A 3B9AA 1W3JA 3EMQA 5BROA 3AIBA 2VVNA 3CGTA 1M01A 3VMPA 3WQ8A 4MAZA 5AYIA 2QLYA 4MJ2A 1U2YA 1CLXA 1PIGA 3RILA 3GTNA 7CGTA 2CCRA 1Q4NX 2J78A 1JYNA 3ARRA 1V6YA 3UG4A 2DEPA 2DT3A 1LL4A 1B30A 5BRQA 2VO5A 1QW8A 4QCEA 5E6YA 1FP8A 4H8HA 2F61A 2W67A 2G3NA 1W91A 3VD3A 5IHRA 1J0HA 1QPKA 1UKTA 3PZOA 3M6DA 1G0CA 1JD9A 2WMJA 1J01A 2BVDA 3DHUA 4CCCA 3AMCA 1TA3A 2WK2A 3EDKA 4B16A 3OG2A 1BYBA 1FH7A 3T0AA 1ODUA 1NWTA 1QBBA 3NYDA 1KFWA 4J7RA 1XH1A 2CEQA 4P7NA 4MB1A 4TX8A 3BGAA 3L4VA 5DT7A 5A2BA 5EBAA 1TG7A 5DFAA 2PWFA 3D5HA 2D0GA 4JFSA 2IXUA 4MNMA 3SCNA 2XTKA 3RPMA 3AXIA 1JZ7A 1OBAA 1LF1A 3WNPA 1H09A 1MXDA 4UFKA 4CD5A 1OD8A 1G01A 1L0PA 2WZHA 2BHYA 1OGGA 1UHVA 1XSJA 3IJ9A 3CZ8A 2PWEA 2BXZA 2D3NA 1KXTA 3DYMA 1V3HA 1TUXA 1E73M 3WUGA 3VOCA 1HJUA 1E5JA 1H4PA 1M7XA 1ZJAA 4L4OA 1DEDA 1QI0A 2UWFA 1MW0A 3GDBA 3F5JA 1CXIA 1KGUA 2F8QA 3RCNA 1KB3A 3ARPA 1NP0A 3NIYA 4ZENA 4M81A 1W1VA 1W32A 3WNLA 3EMZA 1IZJA 5I78A 4F9DA 4AISA 1IT0A 4HZ8A 2VTFA 5JUVA 3WENA 1GOQA 1FH9A 4M80A 4J3XA 3N11A 1JXJA 4RE2A 2ZXBA 1J0IA 4AZCB 1MQPA 1K9FA 2WVTA 4JKKA 3WEOA 1E43A 2FDMA 4GO8A 5I0DA 2ZICA 3L4WA 2WC3A 3BC9A 1KGWA 3UERA 1PZ2A 2J8FA 4GPNA 2YDRA 3VGBA 1UWRA 1W9DM 1VEMA 4F79A 3ZOAA 2NW0A 4GI8A 1BAGA 3WY1A 2RGLA 2GJXB 3T0BA 3WDQA 3WL0A 1BHGA 4OBSA 4Z2HA 4UQEA 1R86A 1H11A 1W3HA 4W8BA 1H2JA 2CNCA 1ZL1A 5A6JA 3HN3A 4UOQA 3FHAA 2QV4A 3RJXA 3W24A 1PAMA 1B90A 4U3CA 3AICA 1TR1A 2WKGA 1OB0A 2O9TA 4E2OA 1JDAA 2VZTA 1X1NA 5CSYA 3AS2A 4DWSA 4RE4A 1VF8A 6A3HA 3N18A 3WH5A 3N9KA 3K8MA 1JZ4A 4PBGA 2GJPA 4W7VA 5ABGA 1QNRA 5HXMA 1UA7A 5EB8A 1JNEA 3GH7A 4GI9A 4JHOA 1IV8A 1EDQA 4AC1X 2CHNA 3ARSA 4PTMA 2A3EA 3VPLA 4A3YA 4D6JA 4Z2LA 4AY1A 4PCSA 1UH4A 2OYMA 3PBGA 2O92A 1H5VA 1UD3A 5HDRA 1NQ6A 4AW7A 1EDGA 3MANA 3DYOA 1WO2A 1HJQA 1E56A 1VIWA 1G94A 2CYGA 3IANA 1JFXA 3THDA 5C70A 4EK7A 1QI2A 3U5YA 4B15A 1C91A 3FHQA 3W0KA 1ISZA 2XVKA 4PMDA 1CYGA 4PSPA 2EBNA 4R5EA 4S3JA 3TTSA 1ISXA 1XHGA 1UKQA 2RGMA 1J0YA 2FH6A 4OOUA 5E09A 1VRXA 2XM2A 1BGAA 2WCAA 3VM7A 1FHDA 4GQRA 1FFRA 1GNXA 1KCLA 1Z32X 1GOIA 1G1YA 3ARXA 2DIJA 3PZGA 2C8NA 2PWGA 4HA4A 4GO9A 4RE3A 1CEOA 5A94A 5TD4A 3WDRA 2CBJA 3PTMA 2ZUWA 2XJ7A 3T09A 2NSXA 1HJVA 2Y4SA 3ZR5A 4ACZB 2OWXA 5BXSA 2W5FA 3OGSA 4DWSD 3SCSA 2UY4A 2WVVA 1V02A 3EMCA 2GDVA 3F5LA 4D71A 1JIBA 1DWHM 1K9TA 1BTCA 4QLLA 4AMCA 1KR0A 3M7SA 1HKJA 2ZIDA 1V3MA 5CPSA 3SCOA 4W93A 1UR4A 3AIUA 2GFTA 3ALFA 4PMQA 1NOWA 1BG9A 2E3ZA 1WZAA 2VZSA 4HA1A 3CUGA 1Y7VA 3BAKA 4TX6A 2OSXA 4HA3A 1KBBA 1CTNA 2ZX7A 1OIFA 1ITXA 2YA2A 5E6ZA 1V0NA 3K1DA 3U7BA 1J9YA 1R7AA 1DWIM 3PN8A 3WF1A 2WHKA 3W25A 3MS8A 1UR1A 4ZE5A 1FFQA 4D6EA 3ZJKA 3UETA 3OLDA 4FLRA 3SUVA 1UWSA 3CHEA 5FCZA 4WLCA 1C3FA 2EPOA 4Z2KA 1JD7A 1UR0A 3ZMRA 2XM1A 1K9DA 3IJ7A 2D20A 1C8XA 5DO8A 3LPGA 3WF2A 1GUVA 4MTVA 3MU7A 2W63A 2VNCA 3ZT6A 2BNJA 1YHTA 1UUQA 5HBFA 3N17A 5D9OA 5M5DA 1E71M 2QPUA 1WNOA 1H41A 1VFUA 1R7OA 2WHLA 4PCTA 1FHLA 3PTKA 4QFUA 1HJXA 2BFGA 4AZCA 1E4MM 3GNPA 1DWAM 3UR7A 1R87A 4U5IA 3VNZA 5C71A 2V5CA 4FF5A 1PEZA 3WH9A 1W9VA 1WDPA 1MW3A 4AD1A 1M04A 4E8CA 3W82A 1AQ0A 1W9PA 2YIHA 1BPLB 5KZ6A 1US3A 5CLTA 4UOJA 1RP8A 4Y7EA 1R85A 1MVYA 1KCKA 1V0KA 3AXXA 1CENA 3M46A 4HOZA 2J74A 5A6AA 4Q7NA 3CH9A 4U2YA 4F66A 1OINA 1ZB5A 4EAMA 1CNVA 3SCVA 1SYTA 1EQPA 1UWUA 2ZX9A 3ZSTA 3WMBA 4HU8A 3BAJA 1CDGA 4JZ5A 1CGTA 4W5ZA 1DHKA 3GYCA 5D9PA 4Z2GA 3CHCA 1E6PA 4FK9A 1E1FA 1GOMA 2W91A 5FL1A 2VL4A 4UFMA 4BQ2A 3MSGA 1UZ1A 3AHYA 1GCYA 3MUIA 2FGLA 4CD4A 1JZ2A 1BVNP 3BAWA 2XSBA 1OWQA 3E1F1 1LG1A 4B9ZA 5GNYA 4UQ9A 2VRKA 3AMDA 3A4XA 2JF7A 3KEHA 2BS9A 1HL9A 1BQCA 1I1WA 3TTQA 3WD4A 3WD3A 4WF7A 3T0DA 2PWDA 1QHPA 2IUZA 3W28A 3FW6A 4HP5A 1NARA 8A3HA 4AZ7A 3AISA 2J7CA 2WANA 3CIVA 2VX4A 2J7DA 3J7HA 3CZJA 4AZHA 5IDIA 4P7QA 1US2A 1JYWA 2ZUUA 3WQ6A 1MW2A 1HP5A 5CQ1A 4JFVA 3ARUA 1HN1A 2EJ1A 1V6WA 2CKRA 2PWHA 1QVBA 2Y5EA 2XGIA 1DWGM 1WDRA 4WKAA 3ZJ8A 3QHMA 4TUFA 4A3HA 1UQYA 2IXVA 4ZXLA 2EPLX 1VJSA 3UCQA 4ACZA 4JKMA 4W7WA 2V3FA 1SMDA 3VIJA 1J10A 4UZSA 5A2CA 3THCA 3AZSA 1JZ6A 3NSMA 5EFDA 5M03A 4JCMA 1QNQA 3ZR6A 5GNXA 1MXGA 3WH7A 4KGJA 1KBKA 2BV9A 1DP0A 2DT1A 1S46A 4ML4A 3AROA 2Q8XA 4CN1A 4JCLA 1K9EA 2E8YA 1QHZA 5IHSA 3AZTA 1MWOA 4J27A 4LYQA 3BMWA 3RO8A 3D3AA 1OCQA 1B9ZA 3VKKA 2OYKA 1GONA 2CHOA 5M3WA 2X2YA 2DPEA 2J25A 1E15A 3F5KA 3GXMA 4KMQA 4PUDA 3AHVA 4J3TA 1JI2A 1G5AA 4N42A 3AMKA 4OOZA 3VIKA 3SUSA 1E4IA 1HF6A 2EQDA 2QMKA 3BCFA 3T2QA 1UYQA 3OLGA 2BVTA 4ATLA 5HPOA 1PX4A 1XH2A 4OJYA 4ZXOA 3B9DA 1UZ4A 3GH5A 3WQWA 3AIEA 1JZ5A 1E0VA 2EPKX 5IFPA 2VJXA 2AAAA 1PX8A 3ZT5A 1B3ZA 4X0NA 4KRUA 4LXFA 3VD5A 1DWJM 3ZJ6A 3OLEA 4M1RA 4EKJA 2J8GA 3G6LA 5E0FA 1LWJA 4AZBA 2O9RA 1BF2A 2A3CA 4D72A 2B31A 4B3KA 2BY2A 2UY3A 5CG0A 1CGVA 1CPUA 2XFFA 1WB0A 1GHSA 3GBEA 1JGIA 4J28A 2VI0A 4IPNB 1CZ1A 1ISVA 1KXQA 4M8UA 2YOCA 2WYSA 4MDOA 1V3IA 3W26A 3UG5A 1HJWA 4DWSC 1VENA 4HMDA 3VIIA 3BLPX 1V02E 4IM4A 4BA0A 2W62A 2WXDM 4OUEA 1TVPA 3WUBA 1TMQA 2XYLA 1HJSA 4C7FA 3HU7A 1E6QM 2ZUNA 4UQDA 3AHTA 3KZSA 2ZXAA 3AS1A 2W4XA 2ZUMA 3ZO9A 3CMGA 5I79A 1W1TA 3BCDA 1PZ3A 4AEFA 1RPKA 5A95A 1UH3A 2DSWA 3SUTA 5CZKA 1Q6CA 4P8WA 3PZUA 1FP9A 1SR0A 3ARWA 4CUCA 1JNDA 3SURA 4N0RA 4DUXA 5JBDA 1W2PA 3BSGA 4DWSB 4JFTA 1V6XA 5A6KA 1HP4A 1RP9A 2J7EA 1HVQA 1UWIA 2G41A 2WMKA 4PYSA 3WF0A 2XIIA 1BG4A 4PMUA 2DH2A 2MANA 1ODZA 3WDHA 1V03A 2GUYA 1WDQA 2WBKA 2XHYA 1D2KA 4B3LA 2X05A 2WZIA 2YDQA 4UTFA 3FXYA 3A4WA 1M03A 4WKFA 1QI3A 1UD6A 2CKSA 1SMAA 3CMJA 2WVUA 2VCCA 3VIMA 1CLVA 1OGSA 1NP2A 1KGXA 2D1ZA 1VBRA 5ABFB 4HZ6A 3VVGA 2VT0A 3W29A 3O2LA 3AS0A 1WE5A 2DSVA 4HOWA 1PBGA 3BAYA 4IISA 5F7UA 4YPJA 1D7FA 3WBEA 2J7FA 3VO0A 1EH9A 3B8SA 3W53A 3WUFA 3CUIA 1ZBCA 3LPFA 2QMJA 4PTVA 2OYLA 4MADA 2C0HA 1VFMA 3OZPA 1V3JA 3MMWA 5BXRA 4MJ4A 1GJUA 1B31A 1CWYA 1ZBVA 2XUCA 2OSWA 1B3WA 5A6LA 4FLOA 1R8LA 5A1AA 2XVLA 3FY1A 4AXNA 4LQ1A 1NM9A 2VOTA 1GOWA 1HKIA 1CXEA 3WF4A 5ABEA 3BSHA 3DYPA 2G4FA 2FGZA 3CUHA 1UA3A 5AC5A 4XX6A 4W8AA 2WPGA 3VGFA 2D22A 1EOMA 4W85A 3NCOA 4WSKA 2VX7A 1MQQA 5I77A 1E4LA 5A8QA 1E6XM 1KXHA 2HVMA 3MUAA 4D1JA 1GW1A 1AQMA 1B3VA 3OGRA 1XCXA 2GSJA 4B9YA 5D9MA 6TAAA 1Q6FA 3VIFA 2VRJA 3JUGA 4UZUA 3ZM8A 2OSYA 1QNSA 4U2ZA 1ZJBA 5FL0A 5DF0A 1UD8A 3W38A 2DT0A 3W27A 3QHOA 5E0CA 3SCRA 2BY1A 3MMDA 4M56A 2VVSA 4V2XA 3WDJA 1UWTA 4W88A 1TCMA 4E8DA 3AIVA 1PJ9A 1V6VA 4P7LA 5HOSA 1E3ZA 4OIFA 2OWWA 1DTUA 4UFHA 4FMVA 1C90A 4OKDA 1CGUA 5CLWA 4PEEA 2D0HA 1HIZA 1XRVA 2CBIA 3OIHA
chains in the Genus database with same CATH superfamily
1T8XA 3C0JA 4RX0A 4KW2A 1BTMA 3EX1A 2R1LA 3NL3A 3RU6A 1E6RA 4B5WA 3UWWA 3O15A 2NVAA 2E4TA 5XINA 3PTQA 4IFRA 5F2LA 3AYSA 2IPJA 1PYMA 4DPPA 4CCZA 2VQUA 4N4QA 5HR6A 3AIQA 3LMYA 3H21A 5E9AA 1I1XA 2OPJA 4KS0A 3LGEA 1OFBA 3TC3A 1JYVA 3CHFA 3VIGA 2FZNA 5F4XA 4C65A 5D8WA 5CZ0A 2VGIA 2AQWA 3BICA 3LCIA 4LAOA 1LWHA 5KSWA 1IEWA 3UCDA 4RZ5A 1E55A 3M47A 4UBPC 2J7GA 3WH8A 1WZLA 4KEUA 1ADDA 1DYSA 1I2QA 1XG3A 2OGJA 2UY5A 2NWRA 3SCPA 4BF5A 3MSRA 1XRTA 1OYBA 3HPSA 4HJWA 1MUCA 3TV8A 2J9ZA 1KRAC 4HCDA 1RUSA 1NDZA 1AQFA 2ESCA 3WQ4A 1EHAA 3KCLA 3NPWA 3RJYA 3QPYA 1HTIA 3M5XA 1ZS2A 3M5YA 4MAVA 3KP0A 4DNHA 2XWEA 3VM5A 3QY8A 4DM1A 1BVZA 1IWAA 4M29A 3RX4A 1CXHA 1YQ2A 1QPQA 1POJA 4L1WA 1BD0A 2QYGA 3A9IA 1K3UA 1UBPC 1EB3A 2V30A 4ZTYA 1OG0A 3PAJA 3S4TA 2YW3A 2V2DA 2X1SA 1TFVA 2PBOA 2Z7KA 4IOTA 1OT1A 2DT2A 4LPCA 1JDDA 2X1IA 4M1BA 1NOFA 1UR8A 3I3EA 3AJ7A 4US5D 1GJPA 2DORA 1GZGA 4LUJA 1L8NA 4GZJA 2DVTA 2O9PA 5FJUA 1YTDA 4H8VA 5AYYA 1ZLPA 3VOFA 4XBKA 1T7LA 4ICMA 3DOPA 1LRNA 2WNWA 3S6OA 1A5UA 2I14A 3LQLA 3IEBA 3WBXA 4CKQA 2YLAA 5AYBA 1X8CA 1HL2A 3MV01 1XP3A 1J0ZA 4CU7A 3MHFA 3I65A 1EA0A 2OZ0A 4XZNX 3V35A 3G1FA 3U7VA 2WB5A 3CQHA 3NDZA 4I7WA 4XBJA 1QBAA 3ARQA 4AH7A 5LSMA 2YB4A 1O6IA 1S2TA 4WDXA 3CWOX 4M6UA 3HMCA 1X7IA 4GY7A 1GJWA 2ZQ0A 4PMVA 3KCOA 5I5RA 1OC7A 3IGSA 3O0KA 3CUJA 3LI0A 1A4MA 5C9RA 3OYZA 2J77A 3QV8A 4KWOA 5M1TA 1R47A 3VD7A 4RNIA 4UTTA 1E0XA 1A3HA 2WKLA 3KDOA 3KFTA 1V79A 3UGRA 3E2RA 3CTTA 3QC3A 4QDWA 2RDXA 4ZOBA 1Z7AA 1YXYA 1QOXA 2XG9A 1E3XA 3UESA 5LGZA 4CU8A 1TVNA 4X9YA 4J9JA 5E5CA 3SQLA 3ZVIA 1KFJA 3WJSA 4OBTA 1J79A 1REQA 3PZNA 3W7JA 1W9UA 3PY2A 1AW1A 1Q5MA 3TN6A 1LL7A 3CT2A 3E3HA 5BU6A 4GXPA 1JPKA 4GBUA 4NJJA 3MV11 1BYCA 4F0SA 1KCXA 3MKKA 3S83A 4FNSA 2BWGA 3RMEA 7TAAA 4BI7A 4GVGA 3R94A 1N2VA 3ZLHA 4XD3A 3CPGA 2PGWA 3E5BA 3LA4A 2P88A 3O16A 3CB3A 3KWXA 3AI0A 4UR8A 1GG0A 1QK0A 4PN2A 5TNVA 1A47A 1XRFA 3F4VA 3V1HA 4KWUA 4JAWA 2WC7A 2GJLA 5M17A 1XISA 5A8OA 3GLCA 1ZBKA 1JYXA 2VRQA 5BXTA 1V0LA 2VEGA 2WVSA 3VGDA 1C7SA 1UOKA 1FWNA 4S1FA 1GPFA 3OZMA 3SN4A 1PTDA 3BARA 4PMOA 4LS1A 3AXKA 1EP2A 2DZSA 3RIKA 3T8LA 3K13A 3CPUA 3IIPA 2E68A 2X0HA 1H62A 4UQBA 4NT0A 4PBFA 1WZKA 2XPKA 4C7GA 3IK2A 3UWEA 4J3UA 4H2CA 1RD6A 1QW9A 2R1NA 4EX4A 2PDUA 4GYPA 9CGTA 4Y9OA 2R8WA 3JR2A 1W9XA 3BE7A 2F6KA 1M1BA 5JQ9A 1O60A 3E74A 5HUOA 2DSZA 3A4AA 2XFRA 4GIAA 5CSRA 3N19B 1YBQB 1PPIA 1JCNA 4UTLA 3DHDA 5DT5A 2JBMA 3WELA 3VDAA 5EMLA 5H8UA 4GVFA 4D6GA 1LLOA 1PYFA 1UR9A 4CVUA 5IOBA 4I7UA 5F2IA 3ZIZA 2QGHA 3ANYA 3NJ3A 1TZ7A 3T1GA 4ECLA 3BZGA 3BG3A 5BWFA 2V63A 1N8WA 1QR7A 3UJEA 3W7LA 3DKLA 3LRLA 3PANA 4BQ3A 1TV2A 4TXEA 1WKYA 4TQTA 4UCFA 4B91A 4LANA 1KM3A 2OO0A 3UYIA 2PU1A 1VJIA 1UWQA 3VUPA 3PBYA 1XLJA 3P2VA 2VC5A 2DZPA 3PFRA 1ESWA 4QGCA 4D6DA 3M0XA 3EX6A 1P0EA 4AY7A 2NUXA 4E0CA 3AYVA 3G1YA 4DO4A 4JTHA 3UVIA 4QG8A 1K6AA 1SM9A 1SZNA 3WYZA 3LD5A 1DXIA 2ATSA 3ECQA 1RJPA 1FH8A 4Z1DA 2V2HA 2G37A 3TW6A 1UWAA 1N55A 1AD4A 1L2QA 2OELA 2YW4A 4DZHA 3SUUA 2AMGA 2YA0A 2UZ9A 1F3WA 1PUDA 4DBEA 3G6MA 6TIMA 3L2LA 3NZPA 3A3XA 3KL5A 1C8YA 3AMLA 4CU6A 5K9XA 4XUGA 1JAKA 2E7FA 3AIRA 2CXGA 2D0FA 2J4GA 1W5OA 4QEHA 4J3SA 5AY7A 1D3CA 3IIOA 2HRWA 3KOFA 4QDMA 1K03A 1AJZA 1UJPA 3EYPA 1LL6A 4FLQA 1GVQA 5D8ZA 1ISWA 1UG6A 2JF6A 4YHEA 3XIMA 1FCUA 1EIBA 3MI6A 4WQ6A 3K4AA 3I4KA 4C6CA 3N04A 2QQ6A 5I3DA 3VTRA 3OW1A 4J2PA 2NX3A 2EGZA 4IIEA 1E72M 2NQJA 3KBMA 3CS2A 1P6BA 1X39A 2OJPA 3F4DA 3MCOA 3M4HA 1FBAA 3W75A 1X8FA 3ELFA 3CWNA 4DI9A 4KQNA 4NILA 1W3NA 3LBOA 2PE4A 1YNPA 3HG3A 1CXKA 1JDCA 4OFCA 4UOZA 1XLLA 4XUYA 4WJXA 3SO7A 1E5NA 2I16A 4I8YA 4JTTA 3RPTA 2Y7EA 4O11A 2YDSA 4GNJA 4JTLA 4V28A 2VENA 3TP4A 1Q7MA 1Q6EA 4J3WA 4NYYA 3T6CA 3W88A 1BXCA 4YN5A 5CC6A 1J4EA 2YL8A 4CCDA 5AHFA 4O8RA 4HJFA 1JDFA 2Z00A 4F2TA 3R2GA 1EOKA 3WQCA 4GY1A 2JIWA 3GR7A 3EDDA 4AZ5A 3GNOA 4JIPA 1GT8A 2HVOA 3RM8A 2OZTA 3SSZA 3W4RA 3WH6A 4JHZA 3NQBA 3USBA 3AXMA 4WGHA 3GWQA 3LHYA 3LCXA 1GVIA 1KFKA 1B1YA 4NJGA 1XC6A 3CWHA 1J2BA 2YBUA 3LPPA 4UR7A 3DC0A 5ABFA 1T40A 4W84A 4LBUA 2V3DA 3QHNA 3RX2A 1CBGA 4QJ1A 3B9EA 4C1LA 4HOXA 1FHUA 1YNQA 3LPOA 5AVNA 3SIZA 3RX3A 3E02A 2QCGA 5AHEA 2JKAA 3I6EA 3M0VA 3NQFA 5CPTA 2HISA 3WQPA 1IT7A 4MZYA 2A0NA 1LG2A 3V5CA 1J0JA 2XVGA 3CB8A 3F03K 5T8GA 4ZSUA 1R3QA 2XN0A 4ZQCA 3UG3A 3BL3A 3OU8A 3R5EA 2FMOA 3V1PA 2BHUA 2CLIA 1TREA 5CSSA 3LZ3A 2PDPA 2E28A 4BEQA 4D6IA 2ZX8A 3L4UA 4IP4A 3K5XA 1U1JA 4HIBA 1O1ZA 1KFBA 4PH6A 2CITA 4A35A 5AC8A 4DJFA 5EBUA 1SU5A 3HG2A 5MHBA 4ZO7A 4JQ1A 4NJHA 3GIQA 4UNLA 4JL1A 1H3GA 3GNNA 5LA1A 4PODA 5LNUA 3WFAA 4DBDA 2PI6A 2R94A 4UTKA 3CQJA 1YPIA 1XDLA 3TA9A 4GABA 1XV8A 1S5WA 4WJEA 2EXOA 2V5DA 1GKRA 4O15A 3W1RA 4LV4A 3U2OA 3WSUA 3SGZA 3AZRA 2HPIA 5CZJA 2H8ZA 3GUWA 3IRSA 4CGTA 2D2OA 2EAWA 2CIPA 4X0VA 2YBTA 4XZLX 1TYGA 2VX6A 1NU5A 2ZVRA 3BXWA 4JL2A 3VKBA 4XD6A 3TKFA 3PF3A 4O4WA 1CIUA 2E6AA 3MUXA 5BWAA 4ZQPA 3MZNA 1IYXA 4RZ4A 5JBFA 2OZ3A 1TZZA 2XIJA 4Z0JA 4P8VA 3T07A 2ZWZA 3EBVA 5D2WA 3NSXA 4NX0A 5LXXA 4F2BA 3WNKA 3FS2A 4JTGA 4D1IA 4KRZA 3GZAA 4EVZA 5DX7A 5TIMA 3GFZA 1LROA 4P7OA 2DP3A 3DENA 2IQDA 3U0HA 1XWYA 3K4DA 3SJNA 4W89A 2VZUA 2OQLA 4L6DA 4PUNA 2HE5A 4X3ZA 1TWIA 3R58A 3KTXA 3S1UA 3CLWA 5KITA 3REQA 1W8SA 3W72A 4IJRA 3I3BA 3ALGA 1EC8A 4QJ3B 1QAPA 2B7PA 1K02A 2NQLA 3GW3A 3Q94A 3VILA 2ZE0A 3ZXWA 1PWLA 2C1GA 4NZFA 1K77A 4AWSA 3FJNA 3UXIA 1MDLA 3QMSA 3DESA 4DX3A 4WEVX 3C8NA 4ZFCA 1B3XA 3M9YA 1EKOA 4GJ1A 2INFA 3KP1A 3T0CA 3S8HA 3CASA 1JZ8A 2VMFA 3I10A 2FH8A 4HN8A 5D02A 3H54A 2PDGA 3EMQA 2NXIA 3NR0A 3AIBA 1GVRA 4X2RA 1M01A 2HBXA 5AYIA 1DV7A 4DNMA 1CLXA 1Q6LA 3WG6A 2J78A 2HROA 2QJIA 2ZRWA 3T78A 1LUCB 1V6YA 3KS5A 1P0NA 3GFXA 4Y96A 4LT9A 4EIVA 5E6YA 1P1MA 3NURA 3S46A 1TTJA 5IHRA 1J0HA 1VBHA 4OV9A 5IM51 1A5MC 2VFHA 3M6DA 3PVFA 1RSCA 4XAYA 5B80A 3C86A 4O4VA 1P4CA 3DX5A 1JD9A 2Q71A 2WMJA 5C7VA 3H2FA 3RG6A 3UZ5A 4B16A 1FH7A 1V6TA 3UWZA 1NWTA 3DH7A 2VD8A 3L66A 5A2BA 5EBAA 3UWVA 4JR5A 5DFAA 3PPCA 3C2VA 2AKMA 2D0GA 2IXUA 3SQMA 4K6AA 3H22A 5B7YA 5CKSA 4UFKA 4CD5A 2PF8A 1OD8A 1KV8A 1Y8BA 3IJ9A 1H5YA 3CZ8A 1H7XA 2D2GA 1R30A 1O12A 1OCBA 1TUXA 2FIQA 3VCRA 1E73M 1XW8A 2PSNA 3GC2A 3L7RA 3W01A 1Q6OA 1ZJAA 5I02A 2EG8A 2V5LA 1QI0A 3EZ4A 3U4AA 4YNGA 3U48A 4QSHA 2Z6IA 4QS5A 4C91A 1KB3A 1SJDA 5CPNA 5LIYX 4F9DA 1W5NA 5I03A 3PJTA 4M51A 1FH9A 3GS6A 1W3TA 1SSGA 3GFYA 4ES4A 4E3VA 4HPJA 1JXJA 4RE2A 2G3FA 4XIAA 4LNCA 4YTRA 1WOAA 5HAOA 1K9FA 4PUUA 2WVTA 3C0QA 1E43A 4J3ZA 5I0DA 3L4WA 4EWND 1LOLA 3QEZA 3UERA 4NXSA 4L1XA 4GPNA 3W23A 2HJPA 4LOCA 1QOQA 1FUYA 4M7TA 3VI2A 1MEWA 4NI8A 1RQEA 2NW0A 5J8LA 4GI8A 2RGLA 3WDQA 1BHGA 4R88A 1Q13A 3INPA 1XBYA 3RRXA 4XTIA 3EGJA 4XG1A 3UA4A 2IQ0A 1NELA 2PUZA 3HN3A 1I6NA 3EX2A 2F38A 3W24A 1B90A 3AICA 1QTWA 3IVTA 2GGGA 4R7JA 3O3RA 4PCFA 2QCHA 5CSYA 1V7AA 1VF8A 1BEUA 2O4QA 3N18A 1VLIA 4L6OA 5FEZA 3WH5A 4ZTXA 3K8MA 3SRDA 1LRTA 4JTKA 2VKZG 2XH2A 5EB8A 2C71A 4JHOA 3W71A 2CHNA 4PTMA 3K30A 3DFQA 4AY1A 3PBGA 4K38A 3OP2A 1PKMA 1S1PA 1HJQA 3VYLA 1G94A 3JW7A 3RAOA 2V5BA 3THDA 3UG8A 3STGA 3FHQA 5IBXC 3UA3A 3PNUA 2C13A 4MPQA 2XVKA 4PMDA 4PSPA 3DUGA 2EBNA 4R5EA 4S3JA 1MUWA 3TTSA 1ISXA 2FTYA 1UUMA 1OG6A 3T55A 1UKQA 4C5YA 2FH6A 3U2ZA 1XXXA 5E09A 3NQDA 2GQ8A 3LDVA 1XYBA 1FHDA 5LKYA 3AAMA 3Q37A 3W7MA 2RUSA 2V6AA 5A94A 5TD4A 2Y5SA 1GKPA 2H6RA 4HT3A 2ZUWA 1EC7A 3T09A 2NSXA 3VDGA 1QK2A 2ALRA 2OWXA 4RDVA 4NAEB 2WVVA 1NFBA 3F5LA 4NNBA 1JIBA 3GAYA 1DWHM 4U28A 4XAPA 5JH2A 1K9TA 1BTCA 1YXDA 1SZRA 3S6DA 1FCBA 5EY5A 2ZIDA 1UR4A 4C5ZA 3LGGA 4IG2A 3ALFA 3GDTA 1TWZA 3QXBA 1TJ0A 2OSXA 2YXGA 1DHPA 4C6FA 4FOUA 3RLVA 2VXNA 3PFMA 1A0EA 5CC3A 3BLIA 4XTDA 2RJHA 1K70A 3QMRA 3PN8A 1SO5A 2YBVA 3W25A 2E5DA 1UR1A 4ZE5A 3W7NA 1EUAA 3GY1A 3OLDA 2OZ8A 3TQ0A 2PDFA 2TRSA 4Z1CA 5D2YA 3KBWA 4MIMA 3DDMA 2D20A 2WQPA 5DO8A 1HFBA 3CAVA 3S3GA 1GUVA 4MTVA 1XPGA 1UUQA 4X22A 3N17A 3BWWA 1TPVA 5M5DA 3AUJA 2QPUA 5C7HA 1WNOA 1HJXA 4AZCA 2B4GA 3H7RA 4HMNA 3UR7A 3NYZA 6REQB 3CT7A 2ISWA 3VNZA 4GY0A 1ME9A 2OOFA 4DXXA 3AUOA 3ATYA 4AD1A 1RBOB 3UVAA 1M04A 3S42A 1FDJA 1B54A 4LEFA 3VCCA 1DE6A 3NEVA 2BOGX 1BF6A 4Y7EA 1Q65A 1V0KA 3AXXA 3QQWA 1OK6A 3GHRA 3LB0A 3M46A 3ME3A 4Q7NA 4MLRA 3CH9A 1HQTA 1RQBA 2ZA2A 3LBCA 4JTCA 4LCSA 3KX6A 4QS6A 3LK6A 1ZB5A 3PSVA 3A22A 9XIAA 4RDZA 4Q4PA 4DN1A 3ZSTA 5G2HA 4HU8A 2FJKA 2J88A 3GYCA 4FNQA 4FK9A 4CQCA 3WLRA 1GQNA 4NZ5A 4BY3A 3W1MA 2VL4A 4JYFA 4UFMA 4BQ2A 2EG6A 5EMKA 3A23A 1KTCA 3Q58A 5D37A 5BOFA 2FGLA 1BVNP 3BAWA 2UV8G 1Q8JA 2XSBA 2R82A 5GNYA 1DXFA 4B5XA 2C1IA 3I7QA 3TN4A 1MMFA 1DXEA 2QUNA 3T0DA 2IS7A 2IUZA 3FW6A 3M7WA 2X7VA 3R10A 4AZ7A 2J7CA 1K7FA 3CV7A 1DKWA 4KBXA 4AFYA 2DY3A 3OVRA 3LV6A 4P7QA 4YCOA 4QG6A 5T91A 3V0UA 3ARUA 2FZDA 1W0MA 4JTEA 2PWHA 1SW0A 5D05A 4FX7A 3UPBA 1DWGM 3OTRA 4HHPA 4A3HA 1UQYA 3NQCA 3TR2A 4JKMA 1OFDA 2JQXA 1US0A 5DRIA 3SY5A 4XVEA 5HWNA 2VWSA 3NSMA 5M03A 4JCMA 4LW7A 3ZR6A 5GNXA 3MW7A 1QWGA 5C0QA 4NP7A 4KGJA 1KBKA 2CWXA 1DP0A 4YU1A 1XIHA 4ML4A 4ONVA 4CN1A 4JCLA 2E8YA 3W76A 3AZTA 2YCKX 3BMWA 4DJDC 2ZZ6A 1H61A 1GK8A 4RPQA 1B9ZA 2PPGA 5CC7A 3ABXA 2CHOA 3NWRA 3L0NA 4ZO6A 3AHVA 1JI2A 5AOUA 2P8CA 3GR4A 3NA8A 4LUTB 1FWRA 4PB5A 1A53A 1AH0A 3PP7A 3SUSA 3BCFA 4NJIA 4R7OA 2ABBA 1PX4A 4B3ZA 2REQB 4OJYA 1UZ4A 2BGNE 2O0TA 3AIEA 3ITTA 1T8QA 2AAAA 3QQ0A 3ZT5A 1U5HA 5PTDA 4FOKA 4ERGA 4E8GA 4GX8A 4DHGA 4EKJA 3DFSA 1LWIA 2J8GA 4UNKA 3G6LA 4AZBA 1O68A 2OQHA 2R1KA 3WJYA 4GUFA 1OZMA 4UIOA 1VBJA 4B3KA 3QKEA 2BY2A 5CG0A 4GACA 2X41A 4R85A 3N6QA 1CGVA 1WB0A 3FK4A 1AZ2A 2VEKA 2OB3A 2VI0A 3SY1A 4IPNB 2E6FA 1EL3A 4FNRA 1KXQA 3MTWA 2YOCA 2WYSA 1ZGDA 3UG5A 1E1CA 4DWSC 1VENA 4HMDA 3VIIA 2PLJA 3TSMA 4DJFD 2WXDM 4OUEA 2VGGA 4ZOEA 3S5YA 1TMQA 4WRHA 1QW7A 3KS6A 2ZUNA 3GZ3A 2ZXAA 3AS1A 2W4XA 1TJ1A 3UY8A 3GR8A 3BCDA 2R6OA 4C6EA 4AC7C 4P8WA 2VM8A 1SR0A 2ZRZA 4K36A 4N0RA 2A3LA 4DUXA 1BXNA 5JBDA 3BSGA 2G0WA 1M3UA 1HP4A 2J7EA 5HK4A 4MWAA 1CX9A 2G41A 2WMKA 2JKEA 4PYSA 4Q4KA 2DH2A 3KOXA 3WDHA 3APYA 1JUKA 3Q2DA 1WDQA 2XHYA 4MG4A 1D2KA 3QFWA 4B3LA 4GUHA 3E2VA 1SO4A 3IV3A 1M03A 1R38A 1R2RA 2CKSA 3M43A 1PTGA 3CMJA 1XINA 2FPYA 2VCCA 3CXOA 1NP2A 1VR6A 5BNKA 2D1ZA 1VBRA 5ABFB 4MVAA 1OZQA 4HZ6A 5FSEC 5C9XA 2VT0A 1V93A 3W29A 2AAMA 4IISA 4QNWA 4YPJA 3BOLA 3QR0A 3VO0A 2QVNA 1O5XA 1ZBCA 3CUIA 3UR5A 4M5PA 1WYIA 1K1DA 2PDHA 3Q65A 1T96A 4O17A 2OSWA 4NQ1A 4OE7A 1R8LA 3FY1A 4C6QA 2V2CA 4BJHA 2NUYA 1HKIA 3GW0A 3NFUA 3DYPA 4HK5A 3PG9A 3OQ8A 8XIMA 3VGFA 3GK0A 3IGHX 4MM1A 2OT1A 4JNYA 2GOUA 4O0KA 1E6XM 1KXHA 3UXDA 1A5NC 1LBLA 4ZOCA 4BI5A 1B3VA 1IHIA 1GEHA 1ZUAX 3THUA 6TAAA 4Z42C 3LXBA 4DELA 3JUGA 1GGOA 3FKRA 1ZJBA 3H2CA 1D7KA 4IXHA 4HTBA 5DF0A 4A3UA 1P43A 1XLHA 4Y8EA 3UJ2A 3L23A 2CWNA 2VFIA 1B3OA 2BY1A 3MMDA 1TQXA 1UWTA 4WR3A 4E8DA 4IF2A 4UMAA 5HOSA 1E3ZA 1N7KA 3FOKA 4RJEA 2HCVA 2D0HA 4LVBA 4GFIA 1DJHA 4PULA 3TYAA 1XFCA 2V38A 3KVJA 1UB3A 4QDPA 5K9CA 1Y5VA 2ZUVA 3WCZA 5HWMA 1UPPA 2PDNA 1LJYA 1N8FA 2AQOA 1RALA 1E4NA 3BQ6A 1X38A 3W7DA 5FESA 2YCLA 1R3VA 1SVDA 4L9YA 4C1KA 2XVNA 3LOTA 3BMVA 1A5KC 2X42A 2JE8A 2VC9A 5E9XA 1PHWA 1RLDA 5CGTA 1YDVA 1EA9C 3HURA 3T8QA 4G6CA 4C7DA 2Z29A 3VIHA 2XIQA 3O6AA 1FWAC 2P3EA 1XIEA 3IAPA 1E9LA 2CLLA 3RM4A 4HU4A 3PAOA 4WD0A 4FB7A 5J5DA 2J8TA 3W2MA 2H9AA 1JF5A 1PL9A 2PTWA 2PGRA 1C9DA 1Q45A 4NZ4A 3SQSA 3LERA 4GWEA 5LA2A 1SZFA 2GDUA 3GU2A 1WQ5A 3MUY1 3W2UA 1MFVA 3VD4A 1K7EA 3QYSA 2R24A 4CN6A 1UKSA 3EEZA 3P81A 4LVDA 4H9TA 1NDYA 5D4YA 3W73A 4I5UA 3W83A 3QY7A 3ATZA 3MUZ1 3WQVA 3LRMA 4CVWA 2ZRVA 4MFEA 1XIIA 2ZC1A 1QRQA 3G3MA 5C6MA 1EC9A 1UKPA 3WO8A 3R25A 2WWDA 4KKXA 3WIJA 2VDGA 2OLAA 3HJZA 4H00A 2W79A 1V4YA 2QUTA 1SR9A 2NZLA 3PZTA 1RBAA 2J66A 3G2GA 2GK1A 1UD4A 2QEZA 2CESA 3PZIA 3ITGA 3DIPA 4UCGA 1VQTA 5CBBA 4XZMX 2C3ZA 3TYZA 4XKYA 1ELSA 5CGMA 5FI8A 3S2CA 5HANA 1OC5A 5TF0A 3QJAA 1XYFA 1E40A 1NOUA 5AHIA 3GBDA 4ZB5A 3D47A 1EO7A 4OQVA 3R11A 3HGOA 2QIWA 1HVXA 2VCBA 4CCEA 4H8NA 1MXSA 4OECA 5FACA 1YRRA 3MT1A 2VGBA 3EXTA 4GZIA 1OCJA 4RE0A 4HZMA 4WK9A 1O5KA 3PZQA 5FOOA 3WJWA 4C6MA 3DZ1A 4AF0B 4UNIA 4UTIA 2E6YA 4Q6JA 1NWRA 4UC5A 3U8GA 5T9BG 1DBTA 4JFWA 3ZZ1A 1B2YA 1UPMB 3RXZA 2V68A 2E9MA 3VZZA 3WF3A 3N73A 4N6FA 4JNZA 4HPNA 2XZ7A 3K1GA 1U5VA 1NWUA 4MWAD 4H9ZA 2ZUTA 3IGUA 4LRSA 3WQFA 4F0LA 1OFPA 3HOJA 3M5ZA 3WBAA 2QCFA 2A6NA 3LM7A 3GTXA 1LLWA 3QF0A 4Z2JA 2PF0A 2DGAA 4RV3A 3VMOA 4AG0A 1OT2A 2E8ZA 3UR8A 3WDIA 5E93A 1UD2A 2DW7A 5HJLA 3HPZA 4MWAC 4TTUA 4XWUA 2PP3A 1LQAA 3RR4A 4PE8A 4DO6A 4TMBA 2NX9A 1OQFA 2F6UA 1AFSA 3VNKA 4F2UA 2ZA3A 2WKJA 2ON3A 4WY0B 2MNRA 1CXFA 3UJSA 1XYZA 3BOFA 1TE1A 1RA5A 3GDLA 4OHQA 1HXJA 3VKAA 3NUKA 5GPRA 4BEUA 4GI4A 2Z1XA 3A5VA 3TH6A 2Y2WA 3CQKA 3SFWA 1IWPA 2OLHA 1KQYA 1CB7B 3VC6A 5GJMA 4FLSA 1TX2A 2C14A 3S2NA 5CPQA 2H3DA 3VC5A 5CEWA 1EEPA 3ORWA 1QATA 3EXRA 1YYAA 5CJ5A 5BU9A 3E96A 4IQDA 3R13A 1OM0A 3TC7A 4HHLA 2G95A 5EYWA 1J12A 4K8EA 2BHZA 1WAWA 2QUUA 4O1DA 4GMEA 3N9RA 4M7SA 3FV9A 1XH0A 3BOXA 4GBDA 1JCMP 4IUGA 1UKOA 4N02A 3B8UA 4HPHA 4H7CA 3QC0A 2INEA 4N9BA 2P10A 3KVLA 4MY8A 3IV8A 3FEQA 3G77A 3CBWA 4P8UA 1AW5A 3ABQA 2ICSA 3S5OA 3SB0A 1BSLA 4IQJA 5JIWA 4GKLA 1Q6GA 4CD8A 2YCIX 4QLJA 3FDKA 5A2AA 2PEVA 4QRNA 3EOOA 4Y90A 2WJEA 3HQOA 1XSKA 4IZGA 4KCVA 5FD0A 3LCGA 3VOJA 4UFJA 4AUBA 3UBPC 1VBGA 2ANUA 1GYNA 1B0IA 3EPNA 4TVCA 2ODOA 4U33A 4ORMA 2C6QA 1EO5A 4AWUA 3TOPA 1LBFA 5DMMA 5IFTA 2KAUC 2VYOA 5CBJA 1MI3A 2V8ZA 4LUSA 1Q6QA 1SFJA 3QH2A 2OR2A 2DZXA 3WD0A 1W3LA 2NVDA 1CECA 3RYSA 5KMYA 3LHWA 3CZEA 4IXXA 3ZJ7A 1GW9A 1LT7A 3GH4A 3AHXA 4F0MA 2F2HA 1JPDX 4NJKA 3MMTA 5GQBA 3UWQA 4DF1A 1VFLA 1VBUA 4AD0A 1W5MA 3CTLA 4DZAA 2ZE3A 5CG7A 4WSJA 4BKNA 3CZLA 1H7WA 1CXLA 2VUNA 4GUIA 3P3BA 4E3TA 3CJPA 3I68A 3R0DA 4M6VA 4L65A 2VEIA 1PWMA 1L9WA 4Q8MA 2BY0A 3I7RA 3S5ZA 1Z44A 1OVDA 5CGQA 3AHZA 2F7FA 1FOBA 1BYAA 2BG5A 1DJIA 4XZ9A 5I3GA 4D6FA 3O6CA 4N9CA 3MCMA 1P7TA 3L5AA 4NYUA 4ZQOA 2OTDA 1GOOA 1WBJA 3WBYA 5HA7A 3GXIA 4GH1A 2G8ZA 1SFSA 2YZRA 3H23A 4WX2A 1QO2A 1R9YA 4W86A 3DGRA 1OGBA 3OGVA 1DJWA 5A6MA 1GQLA 2O7QA 2J24A 1J18A 3SADA 1SFTA 2ZDSA 1MO0A 1UW9A 3RRAA 3WNNA 3G8RA 1KWKA 3IJ8A 3CUZA 1NJJA 3GXNA 4K2SA 3BMXA 3B97A 3TONA 3AFBA 1M68A 4ZVJA 3GB6A 1M53A 5E70A 5TQLA 3WLOA 5C9ZA 2WMIA 4OVXA 3MHUA 3N2XA 2A85A 1JXKA 4XKYB 4Q33A 1ZRQA 4IPPA 2D24A 5LNSA 3SJ3A 3ARZA 4X61A 3ABSA 3M07A 1KWGA 2X1TA 2WZEA 5A69A 2JIEA 1ZAIA 3AYRA 4ZB2A 1WX0A 1KM4A 3UZWA 4WY0F 3RITA 1UR2A 3DCPA 3W1PA 2QVHA 3SI9A 2Y70A 4O19A 2OOGA 2VCAA 3NQMA 4UTUA 1TQJA 3W37A 4YYCA 4PZVA 3P14A 3NGJA 5FF2A 2RDWA 3LCWA 3U57A 1O95A 3APTA 4K39A 2FTWA 4ATWA 4QM1A 4RK8A 2E5CA 4K1GA 3WX7A 4DZ5A 2NV9A 1JCLA 5HNTA 4ZO9A 1AK5A 2PRMA 4PA8A 3ARVA 1KD0A 1UASA 4JN6A 3WMSA 5FA5A 2A6LA 3IJQA 4OZOA 4CD7A 1AJ0A 1XYCA 2E77A 1F61A 2FHCA 2WLZA 5A6BA 1G4EA 3OPSA 3H2EA 4FX6M 4M0XA 4EE9A 3T4CA 4D6CA 3H7VA 2XSAA 1TZ9A 2DZAA 4B5TA 2Z4GA 1X7FA 1VFOA 4PMNA 4LNYA 4C90A 1B4EA 4GZEA 2PURA 3EKZA 1W2VA 4ADUA 3WLQA 2WMHA 1RR2A 2H8XA 1RV8A 2Z1KA 4FNUA 3TA6A 4MWAB 2GVGA 3UEQA 2PB1A 4Q4SA 4O57A 4S3CA 4NRSA 2ACUA 2CLFA 3N15A 4QE4A 5U7SA 5FSDC 4GE8A 4PTNA 1I0DA 1E0UA 4XO7A 3SSJA 3GC5A 4LUTA 3N13A 5JH1A 4M82A 1EJWC 4N9DA 1X1OA 3G8EA 4ICNA 3SN1A 3WLLA 4Y8FA 3FA3A 4Q3MA 5RUBA 1EWDA 3VNLA 3GTHA 4F0HA 2PDQA 2TSYA 1OX6A 2P8BA 3ANVA 1OF6A 3A24A 3I6RA 3TSDA 3KBJA 3BG9A 3KL0A 2ZX5A 3SCQA 4XZBA 4AYSA 1X6NA 1TJ2A 4KETA 4QAIA 3PBWA 2YCEA 4H2HA 1EGZA 4E4PA 3PULA 2FLIA 1SO3A 1FA2A 3FN9A 2W92A 3AXHA 4JS3A 3F7JA 2FHBA 4H6QA 4L1GA 3G22A 4EXQA 3JU2A 3CV6A 2DSUA 1IR2A 3W87A 4PMRA 2WSYA 3EDEA 3E0WA 3TXZA 1DJQA 2VEFA 4HZ7A 2PP1A 3SCUA 1W1A1 1WCGA 2HNEA 2PDCA 4UTJA 4DJED 4G9PA 3K8LA 3B0UX 3DHPA 4TMCA 3WNMA 5FJOA 3V0SA 1TV7A 4RZBA 2D2HA 2G3JA 3WZ0E 5CZSA 3OBAA 5BZAA 2WSPA 1TMLA 3T7VA 2LLEA 1UQZA 1QPRA 4BZYA 2AQVA 4DY1A 3VNJA 3UP8A 4X63A 1IWBA 4GQQA 1U30A 2XWDA 1J11A 1Z42A 3MMUA 2ZUSA 4PMYA 3TQVA 3CHVA 3IJ6A 5CSUA 4BK9A 3TVAA 5TBOA 3QPZA 2H90A 3TYEA 4GIYA 4H8UA 4CN4A 3M0MA 3WFLA 2XGZA 2XSXA 3T2PA 3FLUA 3IPWA 3WD1A 1MNZA 3VIPA 2OEKA 4ZE4A 1W1YA 3W7QA 4LAUA 2A7NA 1JFHA 3BURA 4KIEA 3KHJA 3FJ4A 3UW6A 2QS8A 2AL2A 4G56A 2OX4A 1MSSA 2WNQA 1MYRA 3W6YA 3FAXA 3MB9A 3C6CA 4G5DA 1P5BA 3FJ6A 2DDXA 3H2NA 4G7FA 4GQ0A 4QSFA 1LRQA 4GC4A 2VC6A 1W3JA 1OX4A 3UGVA 1KRCC 3VMPA 4I6KA 5KTLA 1KM5A 3THAA 3N2TA 2GQ3A 1L8PA 1U2YA 3KVKA 4NZ1A 3GTNA 2PU0A 1XCFA 2V67A 4HNTA 5LHFA 1YTKA 3W7OA 3PTDA 2DEPA 2P50A 1LL4A 1B30A 3R4IA 5BRQA 3N29A 6ENLA 2VO5A 1QW8A 4QCEA 4IMDA 4YL2A 4H8HA 1SW7A 5F2MA 4MUPA 2QUVA 3VD3A 1KTBA 3ZFHA 1QPKA 1KTNA 3PZOA 3OODA 1JEZA 1G0CA 5HUPA 3LHZA 4UTWA 4N9EA 4IGHA 1J01A 3FIGA 4CCCA 3CL7A 4FAMA 1FWGC 3P84A 3PJUA 3T0AA 2Y89A 1E9YB 1KFWA 1L6YA 4MB1A 4H1ZA 4C6OA 4Z0SA 3ZR4A 1TG7A 3WK2A 2PWFA 6ALDA 5DCBA 1JQVA 3GUGA 5DCDA 2WSQA 3AXIA 4WXYA 3PWIA 2V69A 1MXDA 1L0PA 2BHYA 1UHVA 1NDWA 4JIIX 3GO2A 3F1QA 3UYCA 4F0RA 1KXTA 2BXVA 3CAWA 3DYMA 3WLIA 4S3GA 2P1FA 1HJUA 1H4PA 5C2XA 1DPMA 1WUEA 3WBWA 3GDBA 1AODA 4LH8A 4V33A 1CXIA 5H91A 1HW6A 1W37A 2X30A 1I2PA 3RCNA 4YWSA 1ZZMA 4RKAA 1NP0A 3C52A 2OODA 2WZTA 3TMLA 3DG6A 3URNA 1IZJA 3S2JA 5CZTA 3V18A 5JUVA 1GOQA 4PMJA 3BO9A 3JZEA 3N11A 2ZXBA 2TMDA 3U4FA 1ADSA 1FWJC 4KIRA 4GO8A 2W6RA 2ZICA 4LWWA 5EMUA 2OQYA 3N14A 4W9TA 3GIYA 1SO6A 4XVDA 4OUIA 4I5XA 3DC8A 3G1AA 1BAGA 4H9VA 1NTHA 3A5FA 4ZQNA 1QWKA 4WCJA 1H11A 4JQ3A 3CLMA 3CL6A 1H2JA 1DL3A 1HG3A 5T9CE 2XU2A 4P5UA 3FHAA 4LSBA 4YIWA 4DRSA 1PAMA 4GLEA 1XR2A 4U3CA 3S9YA 1XKJA 4O1CA 1JDAA 1IIGA 1M5WA 1XQLA 2VZTA 4DWSA 4MY9A 4IG2B 5C5YA 5H6HA 3N9KA 5REQB 1WAUA 4PBGA 2GJPA 4GGBA 5ABGA 5LIWX 1TELA 1GVOA 4PBEA 1UA7A 1M7PA 1IV8A 2OLSA 3BGGA 3TYUA 3ZWSA 3TE9A 2WJDA 2J27A 3VOHA 4D6JA 4Z2LA 3DFNA 1UD3A 4AW7A 2PTZA 1VCFA 3DYOA 3P8IA 3CQ0A 1VIWA 1WDWA 2CYGA 1JFXA 3U2EA 3PBVA 5C70A 4QX4A 4C1NA 4GYPC 1OK4A 3N6JA 3E6EA 3W0KA 1FWSA 5KINA 3TAOA 3A21A 3KVMA 4C1NB 4GFSA 3F4NA 4K3ZA 1J0YA 4OOUA 5LNWA 2XM2A 3OHMB 2Y85A 2VEMA 3VM7A 1S38A 5EMMA 4LU0A 3WQOA 5I7GA 4QQUA 3NL5A 1Z32X 3ARXA 3ITLA 4GO9A 4RE3A 1FWHC 4IUOA 3GSMA 3WDRA 4GHRA 5KZEA 4CNOA 3PTMA 2XJ7A 1AL8A 3IRDA 1E9ZB 2R1MA 5F2GA 4HNLA 4MZ1A 4ACZB 5BXSA 3OGSA 1X98A 1UC5A 3SCSA 1OCNA 1V02A 3EMCA 3AU2A 3PUOA 2TODA 1JUEA 4QLLA 5AVHA 3R0KA 4IPJA 1ECQA 5CPMA 2Z1BA 4W93A 2GFTA 4PMQA 1NOWA 3HF3A 4AQLA 3W7HA 3BAKA 1HO4A 1OEPA 4TX6A 3LUTA 3EWWA 2DQWA 4FP1A 4Q32A 4CQDA 1DWIM 3WLKX 4ZBCA 3WF1A 3UPWA 2WHKA 2H3BA 1XBXA 4I9TA 3NOEA 4QG9A 3MS8A 4XZIA 4D6EA 1FFQA 3ZJKA 3UETA 3MUCA 3LU2A 2EJAA 2E5BA 3PK7A 2QR6A 4V1YA 1C3FA 1EPVA 3UNDA 4Z2KA 3BGJA 1EP3A 3ZMRA 1K9DA 3IJ7A 4AU0A 4JX6A 4DAFA 2P53A 1K4GA 3MU7A 2W63A 3TW7A 3ZT6A 2BNJA 2FFCA 1YHTA 4DYJA 4QE5A 2CZ5A 3H2OA 5D9OA 4Q8VA 3O6DA 4LV9A 1E71M 1IXNA 2PDLA 2CZFA 4PCTA 4QFUA 3BW3A 4XD5A 1FWEC 2BFGA 1A50A 3NQGA 4LY8A 2X16A 2ISDA 2YX0A 1L6FA 5FAJA 4H9MA 2V5CA 4FF5A 4CQAA 1XM3A 5I3IA 3MJYA 4OU1A 4AF0A 3UXKA 1MW3A 4YVVA 4IX0A 3W82A 3FDGA 1V7YA 4IQLA 3NEHA 3NNTA 1TSIA 1US3A 4UOJA 3B03A 3OJGA 4DF2A 1R85A 1KCKA 3UXLA 4JY9A 4MYXA 2J74A 2PD5A 5A6AA 7TIMA 4Q8TA 3RLGA 4F66A 1YE4A 4GX9A 4EAMA 4YTUA 3LHUA 1EQPA 1W3IA 2ZX9A 3RFAA 3WMBA 3M64A 3BAJA 1CDGA 4YWIA 5D9PA 1DHKA 3KXQA 4LS0A 1W5PA 1E6PA 4UWMA 4RCXA 1I4NA 1GOMA 4US6A 3HZ3A 1A5OC 4MUZA 1MZHA 4NIRA 2QULA 3MQTA 3QTPA 4IMGA 4WSHA 3MUIA 3WLHA 4GVHA 3E1F1 3ZWTA 3CH0A 2VRKA 2WO5A 3A4XA 2JF7A 2PCEA 2BS9A 3BUVA 2A4AA 1I1WA 1RCXB 1XLFA 2GQ9A 4A8IA 3LLFA 3WD4A 3PBUA 5D04C 2CC0A 5D33A 4GZ7A 4NG3A 3HPAA 2GVJA 1QHPA 2PWDA 1TCDA 1G7UA 4HP5A 3QZ6A 4Q8UA 5LNRA 4JDBA 3AISA 2WANA 2VX4A 3ES7A 3J7HA 5BOEA 5IDIA 2NLYA 4LAZA 3HM7A 2ZUUA 4HHHA 3WQ6A 1PE1A 2Y7FA 5FF0A 2OU4A 1SZEA 1HN1A 3KAOA 1W56A 3CIXA 4XO6A 3M16A 3UFYA 1EF2A 1C8VA 3C61A 4XAFA 1IZCA 2NV1A 2EKCA 1VJSA 2F84A 4W7WA 1VYPX 5SWUA 1H60A 4O28A 2HK0A 4C6IA 2O7SA 4G2DA 5EFDA 3DBPA 1AH3A 5DMNA 2BZNA 2Q09A 3P60A 4DJFC 1XLGA 3C2OA 3BDKA 1VH7A 4EP8C 1EZWA 3TX9A 2IKHA 5IHSA 4XIMA 4Q7BA 3R0UA 1MWOA 4J27A 4LYQA 4O14A 1PDYA 1OCQA 3PBMA 4JTQA 1LORA 1GONA 4LCRA 5M3WA 4IMCA 3RUBL 4JYDA 2J25A 1PHQA 4IGMA 4QQ3A 4ZOAA 4KMQA 1CB2A 4PUDA 2GUBA 3C56A 3KRUA 2PDYA 3GG0A 3AMKA 1IE7C 3LQGA 4OOZA 3G1HA 5A8GA 2EQDA 1TV4A 3T2QA 4B92A 2BVTA 1E9IA 4ATLA 3HFTA 4R9XA 4ZXOA 1EX5A 3B9DA 5IFPA 5A5WA 2VJXA 1WA3A 2VGFA 1PX8A 1B3ZA 3VD5A 1DWJM 3OLEA 3BANA 1LWJA 2O9RA 1BF2A 2A3CA 2BDQA 1G7VA 1UC4A 1EBHA 5FAGA 1CPUA 4S3BA 3TAKA 2J13A 7REQB 4IIBA 4ZGYA 1GHSA 3M6YA 3M0ZA 2CLMA 4ZA0A 1CZ1A 4HHMA 1S3TC 1NY1A 4M8UA 1RY0A 1H51A 3THQA 1V3IA 3W26A 2WPBA 1HJWA 1XLBA 2ZTKA 1MZRA 3O05A 3BLPX 4ERAA 4IM4A 2W62A 1TVPA 1T41A 1VS1A 3WUBA 4V15A 3E0FA 3UT0A 1KLZA 4B2DD 4KPLA 3MC5A 3NZRA 4C7FA 3HU7A 3KZSA 2A21A 2ZUMA 3IK4A 4U10A 3ZO9A 3CMGA 5I79A 3LS9A 1XG4A 3NQAA 1WKEA 3LNPA 3SUTA 1Q6CA 2XISA 3FKKA 4CUCA 3SURA 1W2PA 4JFTA 1V6XA 3BLLA 3RK8A 1HVQA 1UWIA 2NQZA 3A12A 4O1EA 1VHNA 2XIIA 4FA3A 1BG4A 4GYJA 3QVQA 4RNHA 1Q2RA 4QBXA 2X2GA 1ODZA 3FGCB 4O52A 1V03A 4K37A 3EWYA 1QMLA 3PM6A 2I56A 4NZJA 4OTKA 5K7JA 4XISA 5DXYA 2SFPA 4NNCA 4F0KA 1VFTA 1M7OA 4JBRA 5JXQA 4WKFA 3XINA 3ZYZA 1TV8A 3BQ5A 4EACA 1XGDA 3EB2A 4XZHA 5K4XA 2QUMA 4BFAA 3VVGA 3EB3A 3O2LA 3AS0A 1WE5A 3PWAA 3ZLGA 1D7FA 2J7FA 3TXVA 4ATDA 3LPFA 2QMJA 4JEQA 1GVEA 4MADA 1VFMA 3OZPA 1EEXA 1GJUA 4PRTA 1B31A 5TAOA 2XUCA 3QGKC 1B3WA 1EX1A 4FLOA 4UMCA 1OYAA 4GGHA 4BI6A 1XLCA 3Q67A 2VDHA 3BSHA 3URBA 1IQ8A 2ZCGA 3LTPA 1EZ2A 5AC5A 4H01A 4G7EB 1P48A 3HGJA 2CHRA 3EOEA 4WSKA 1YXCA 4LY4A 1MQQA 4K8GA 2A79A 1E4LA 1NFPA 1VHCA 1K8CA 2HVMA 4Q4QA 1VIZA 2ZKMX 1GW1A 3MO7A 1AQMA 3KCJA 3HQPA 1XCXA 2GSJA 3W22A 3DFPA 1Q6FA 4UUIA 2VRJA 1DTNA 2OSYA 1R9ZA 1GVFA 1XFBA 1XUZA 4NAFA 3W27A 1FWTA 3C0SA 3SCRA 3MY9A 2XFWA 4V2XA 3UZZA 2BBFA 3AIVA 4M3PA 4XAZA 2GL5A 4FMVA 4OKDA 1K8YA 2QCDA 1CGUA 1HIZA 4K7YA 3QOKA 2ZBTA 4KWWA 2PA6A 4RV8A 1HX0A 5EL1A 1RK5A 4IHCA 1PKYA 1O5RA 1P7TB 1BSIA 2GWNA 4DPQA 2I57A 3NQVA 4PSRA 3B9NA 1ZENA 3TDFA 1Y5WA 3FFSA 1VCVA 2TYSA 1PS9A 4H41A 5AHLA 3GTFA 2NX1A 2B7QA 2YYTA 4QCFA 3N2MA 2FZ8A 4QXIA 2FMNA 1XYAA 2PTDA 1VPQA 3KRSA 3GRIA 5LA0A 2VFEA 1QHOA 4LTSA 3VFCA 2VX5A 3NOYA 1SSDA 3IVUA 1H50A 3B9OA 4L4LA 1Q3NA 1F4HA 2WMFA 1R46A 4MNKA 3W2LA 5M2FX 3MP5A 4IPLA 5HULA 3BG5A 1CGWA 1A5AA 3M44A 2ZRYA 2QAPA 3ANUA 1ZP4A 4TVDA 3OG3A 4ZFMA 2A3HA 4EXAA 3BV4A 1OFEA 3L5MA 4MDPA 4BF7A 1XBVA 3SEPA 4AIEA 2ZC8A 2CPUA 3PZ9A 4H7VA 2QCDB 3WMCA 4HKPA 1PZ1A 3VIOA 3BZJA 4IFKA 1UR3M 1QDSA 3ARYA 1AUSL 2PZ0A 1XL9A 5IBXA 3N1AA 2NLIA 1E70M 3EDJA 5A8MA 4W4QA 4MKVA 3OVQA 1TV3A 4I9AA 4DEFA 1U83A 3OA3A 3UD6A 2GGJA 4Q8OA 3H4GA 2DJXA 2NWSA 4W8LA 1JF6A 3HV8A 1AH4A 1U1UA 1Q8AA 3NAVA 4HYVA 1YDYA 4YTTA 2VR5A 1TPDA 1A3WA 4LF2A 3WDPP 2WMGA 1VEPA 3R8HA 5FKYA 3M0JA 2YL5A 1AMYA 1PKNA 5I24A 2HVNA 1TB3A 1W17A 3W9ZA 3IIVA 4YLWA 3GVQA 4Q8QA 4AYGA 1YIXA 4DUWA 3VOIA 4NXKA 1ICSA 2DSKA 1E0WA 4XAGA 2BOFX 3QV9A 4BS0A 2QCMA 2BASA 1W3KA 3DFTA 3QYQA 4YTQA 1SJCA 3AOFA 3V36A 1V6UA 2G97A 2FYMA 3NQ6A 2CLOA 5EKYA 4LYPA 4OBRA 2ZXDA 3ZQ9A 1AW2A 4LGXA 3TJ4A 2QNEA 2VFDA 5EGRA 4CEXC 4UTMA 3N4EA 3P61A 1PDZA 4DVOA 3R43A 3B3DA 3MO4A 1NVMA 2J75A 3UR2A 4L4MA 1I45A 3IAQA 4RUBA 1UD5A 1JULA 2NSOA 5C55A 2W61A 4Q8WA 1TO3A 3TCSA 2E0PA 4FPSA 4A2RA 5AC4A 3VDCA 4NAEA 4FIRA 2A7RA 1TUFA 3GM8A 3I6TA 2EO7A 3DHFA 5HQEA 2O56A 5EMYA 4TTGA 4JTIA 4X2PA 3DU0A 3CO4A 1C92A 4HNUA 3DFHA 4H04A 1V3LA 3W81A 4M24A 3VOGA 1JG9A 1WV2A 2ZZ5A 1NAL1 4U31A 4F4RA 1JAEA 4K68A 2C19A 2AMXA 3GTIA 1ZALA 3ERPA 3R8GA 5BYWA 1VB9A 2R91A 5AZ0A 3FNDA 2WZMA 3KL3A 4GIRA 3TROA 1G9HA 4JTJA 4ZQRA 3U2CA 1FWDC 2FPVA 4HU3A 3QZEA 3K8KA 5GJPA 3B4YA 4HD5A 3W6LA 5LNVA 1ITCA 3B8VA 4S2CA 3S2LA 5I06A 1JGMA 2Q6ZA 2OEMA 3WN6A 8XIAA 2VZOA 3MSDA 5JIPA 3NXLA 1ECEA 2NT1A 1S5TA 1ONEA 2XFYA 3SCWA 2YLLA 5EA9A 1R5YA 3SBFA 2FFIA 3V5OA 2Y8UA 2CLEA 4LS2A 1IF2A 1GOXA 4LUIA 2VR4A 1UMLA 3QGVA 3P74A 1DIKA 4AY8A 1ZY9A 4RW5A 1ZCCA 5JVLA 4KWVA 3HTWA 3RHGA 1TWSA 4AZ6A 3EKLA 4EF9A 1C7TA 3ONBA 1N82A 3WQDA 5BRBA 1EDTA 4QP0A 2O4MA 2QJJA 2EPMX 4LC8A 3WK1A 3WKZA 4JNMA 4PTDA 2HNHA 4KRTA 2WHMA 3LYEA 5K4ZA 1LZOA 5D32A 3N2OA 1Q4WA 2V3GA 1JVNA 4IQEA 1VYSX 1QI5A 1VFFA 1XBZA 1Q66A 3FEMA 5A8PA 1V08A 4PGLA 4O12A 4S3KA 3APGA 3NO3A 4IPIA 2YXOA 1B4KA 1JCJA 5HWJA 1QFEA 3KBVA 4DWDA 4IICA 5MKGA 2Q3RA 4AD5A 1G4TA 1PX3A 1SQ7A 1WDSA 2XDFA 2QCLA 3BH4A 1I2OA 1VC4A 3RR1A 3TWAA 5LIUX 4REQB 1H7PA 4A05A 3MPGA 4FXFA 1WPCA 4JIEA 5DLCA 3VGGA 3L4XA 2G5WA 4O0ZA 2CU0A 2Y62A 1SZGA 3TYBA 1LDCA 2E9BA 2P0OA 2GJRA 1XYLA 3OO2A 4W87A 1XRSA 4FNPA 3TQKA 1RY8A 1F6PA 1RK6A 1THFD 3EWZA 1XD1A 1J5TA 4K8HA 1VGAA 1S39A 3G0SA 4AIUA 4NU7A 1TIMA 2GVEA 4LX4A 3TTYA 4UMBA 1I8JA 3HFYA 4XV0A 2Y1HA 2WNNA 1VEOA 4LYRA 4R7WA 4DJDA 2A1YA 1EQCA 1DJGA 5D2TA 3ZT7A 3IJLA 5EMJA 5D9NA 1TA3B 1GQKA 5DMYA 3GXFA 4AMAA 5FF3A 4ORIA 1PKLA 3M41A 1OX5A 2HWGA 2CXEA 4PCPA 1HT6A 2Q8ZA 1EUNA 3E2QA 2QDEA 4D6HA 3EKGA 3SCTA 3TJIA 3CO8A 1HNYA 4S23A 5EU9A 3NDOA 4DAIA 1MEIA 3TTOA 7PTDA 1SJAA 4AIOA 3LXCA 3PHAA 4E4UA 1T99A 1CT5A 1F9CA 1XGZA 2FHFA 1F7BA 2ZOXA 2ZWYA 2OEJA 4JY8A 4QJ5B 1ZCOA 4NSBA 3QR1A 4B5UA 4C6KA 3A6OA 1NWSA 1O7AA 3SIMA 3VE9A 3M5VA 1PV8A 4N7QA 5ABHA 1PB0A 1LOSA 2FKPA 3OBEA 3PSWA 4O54A 3ZSSA 1EJ7L 4E38A 2PRLA 3MBFA 1PIIA 3NQ2A 2CETA 2XN2A 2QF8A 3IVSA 1GWJA 5DRCA 4JQAA 3PUGA 4BCEA 4O50A 1BFNA 1JUBA 3KBNA 5F1VA 1JCTA 2DVUA 4FZIA 1EGMA 3TQPA 3QLDA 1V0MA 3AWOA 5HR7A 2DIEA 1WDDA 4QAWA 2AOSA 4B4HA 4S3AA 6CGTA 7A3HA 5H1WA 3C3NA 1JCXA 2E25A 4URIA 4BWLA 4M6QA 3MSYA 1XS2A 3WQ5A 4I5RA 3TZFA 3VGHA 2YDAA 4GXMA 2F9RA 1KO0A 1IEVA 4Q6XA 3ABZA 5G2WA 2V82A 4YMZA 1TTIA 1KQZA 2X40A 1OYCA 4AD3A 3W7PA 2D23A 2HZGA 3C2YA 2QZRA 2Y8VA 2YL9A 2WBGA 3B40A 3FYPA 4Q4RA 1F76A 2X09A 5L6UA 3VDBA 1ZBWA 2PGEA 1D3GA 1LQ2A 2OX1A 1W6TA 4UQCA 3NQ7A 4NF7A 4PMZA 3U9IA 4GQBA 2Z1VA 1PCKA 1F8IA 1TE6A 1E1CB 5G1TA 2FB2A 3RO6A 2QPXA 1BKSA 2CZDA 3S9ZA 2KZHA 3S1XA 4I9JA 2DUAA 3RU8X 3QQ1A 4ILSA 4WIWA 4E2BA 4PRWA 2Z2UA 1UIOA 5LIKX 4HTYA 1GOKA 2X7WA 1E6NA 5K2ZA 2AL1A 3W7IA 3TOYA 3D46A 3L0GA 4WZHA 3L2IA 3WL1A 1AQHA 3O9NA 4C6DA 4UTTC 3QRHA 3MCNA 5DCEA 5LZLA 2VP8A 3W3OA 4OT7A 5DY3A 5DELA 1CGXA 4A3RA 3WFZA 3QW4B 1OADA 1HO1A 3VABA 1ZAHA 1XX1A 1XCWA 4LALA 3MHGA 1ITUA 5HMFA 1FWBC 4Q7IA 4GCXA 1E51A 1J8VA 1X6LA 3VFLA 4KF1A 1Q6DA 3EWCA 3CNYA 1FWWA 1V3KA 4O53A 2HMCA 1J0KA 1DQUA 1V5XA 4Z1BA 4Z2IA 2NT0A 4MB5A 4JTAA 4UTWC 4V27A 4U3AA 1VAHA 1BWKA 1GQIA 3VNYA 3ICJA 3B8DA 4IX2A 2QPSA 4AEOA 1R3SA 3GHSA 1OX4B 1JZ3A 3L2MA 4FR6A 6PTDA 4FIQA 3BAXA 4MZ8A 3P82A 2BTMA 1NQKA 3M0KA 3P93A 4R27A 2OWCA 2BY3A 1XLEA 2J79A 4Z08A 1HUVA 4TO8A 2P76A 4OGZA 1RCQA 3CK5A 4AIBA 4KEVA 4S2BA 1IT8A 3W07A 3BJTA 4NZCA 4IFKB 1OFAA 4RPPA 4MMWA 3A3HA 4F9JA 4NL1A 3L4ZA 2GJXA 1Q63A 3UZXA 1NFGA 2WVVB 3ITCA 4TR9A 1FWFC 2X0YA 5ABTA 1F2JA 1KXVA 1U5JA 5FEPA 5G4EA 3EOLA 2O9OA 1S2AA 1RJRA 1ZU8A 1UP2A 5EFFA 1I0BA 4HGXA 4AB4A 2G3IA 2P3ZA 1Z8AA 1MW1A 4O13A 4UFLA 4P8XA 2DUZA 1TPUA 3S6TA 3POHA 2GVLA 1IEXA 3VU2A 1HKKA 3SRHA 4FHAA 1TPEA 1NEYA 2ZRUA 1A0DA 5D30A 4W5UA 1TTQA 1R3WA 5BCAA 1V8EA 2Q8LA 1UBSA 2EPNA 2BMBA 3RF9A 3WJZA 3W70A 2RDUA 3W2JA 1IEQA 1WZMA 1S2WA 3EA1A 3ID7A 3E0LA 4UB9A 2XVPA 3L4TA 5XIAA 3OZOA 6REQA 1AZ1A 3QMTA 4E4FA 4GJIA 2E67A 2Y6ZA 1XYMA 1PXGA 3IUDA 1DIOA 1WKFA 1F05A 4PRRA 4UQAA 2Y5JA 2XIBA 3UQNA 3WEMA 5AFDA 1F6KA 1JI1A 2POTA 5FEWA 1RLCL 4HN4A 4MOZA 1KFLA 1N8IA 2J6VA 1QU4A 1PTAA 3WQ8A 4MAZA 4MJ2A 1VKFA 3L67A 1VCGA 1Z3NA 3HB9A 3RILA 3OQEA 4I90A 1KKOA 1Q4NX 3ARRA 4XK2A 1PSCA 4IGNA 4DBSA 1P6CA 1GVSA 2GUUA 1ME8A 3LCLA 5FJPA 5DBTA 4ZZ9A 1FP8A 1L6WA 1XLIA 1AD1A 2G3NA 2Q02A 1KM6A 3N34A 3W00A 2YCLB 2PFHA 1GG1A 2BVDA 3DHUA 4POCA 4E5TA 3NPXA 1UJQA 5JMUA 3GKFA 1J6OA 1BYBA 1ODUA 1Z9AA 1JCYA 4J7RA 2YFNA 4P7NA 4TX8A 3BGAA 2Z26A 2QJHA 4C6NA 4DUOA 4FR1A 5K3VA 3L21A 3CU2A 3D5HA 2Y88A 2RHGA 3SCNA 5CPLA 5FJRA 2QDDA 3RPMA 4G1NA 1OBAA 2XN1A 3D0CA 3M1ZA 5CJMA 1G01A 5F4SA 1FRBA 2WZHA 4JDYA 3IUIA 1UP0A 1S2CA 1OGGA 3JRKA 3EEGA 3QLLA 1YPXA 3WK3A 4HK7A 3TSBA 3BV7A 1QPNA 4J4KA 1FDZA 4CQ8A 2ZFAA 3WUGA 4NNAA 4LAMA 5AHNA 1E5JA 3VCNA 1M7XA 1DEDA 4IGSA 2UWFA 1TTPA 5AECA 1MW0A 1KGUA