3PZ9A

Native structure of endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
total genus 156
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pz9A00
2ZOXA 1IZKA 1NOFA 3W82A 1M03A 2QMKA 3VIJA 3FAWA 2DT3A 4U2ZA 3CMGA 3ZT7A 1DWHM 1ODUA 2J7CA 1UD8A 3CO4A 2V3DA 3SIMA 5HNNA 4X9YA 2DQXA 3CPUA 4DM2A 1F4HA 3CHCA 4OIFA 1KGWA 5A3HA 5CLWA 2YJQA 4Q7NA 1B90A 2VQUA 2XPKA 1LL7A 2VOTA 1UR9A 1J0HA 4JHZA 5A2CA 3WNLA 2F61A 4MAZA 2ZE0A 1FFRA 3T08A 1TCMA 1EDQA 2CNCA 3IJ8A 3UG5A 3SCPA 4OUEA 1KXTA 4TXEA 2G3NA 1QW9A 4XUYA 2DH3A 1GQIA 4GPNA 1EOMA 3PTMA 4D6IA 3ZIZA 3SCTA 1E3ZA 1OD8A 2E40A 1C91A 1BYAA 3QOKA 2XHYA 4A4AA 1VFOA 3W29A 3VPLA 2D0FA 5LA0A 3OG2A 1V6WA 1PAMA 1ZJAA 4V2XA 3CHDA 3NDZA 1GJWA 2OWCA 3DYOA 3M07A 4PYSA 4LYPA 1LL6A 3AMGA 3K8KA 3WF2A 1OGSA 1KGUA 4UFJA 3W26A 1ZBCA 2WMKA 5LYRA 5I78A 4UFLA 1CIUA 1D7FA 4GO9A 3OLDA 3VO0A 2QF8A 4D71A 1UA7A 3AS3A 4DUXA 3A3HA 2WC7A 5HOSA 3VINA 4HP5A 4OZOA 2Y24A 2ZXAA 4ATWA 5BROA 5DT5A 2XUCA 2ZUMA 3WDIA 4W93A 2ZX6A 4C7DA 1GCYA 1FHLA 3DC0A 3F5JA 1IV8A 1VF8A 3LMYA 5KEZA 3UR8A 4MNKA 1FFQA 1H1NA 2DEPA 1E6XM 4AIUA 2Q8XA 2EQDA 1VENA 4UFHA 3RJXA 2JIEA 2YA2A 2BV9A 2J47A 3GYCA 2HVMA 1ZBWA 1GW1A 4HU8A 5M17A 1W1VA 2VQTA 3D3AA 4HOXA 2WHLA 1KB3A 1JFHA 3OB8A 3BCDA 2WZIA 1DEDA 4BS0A 2E9LA 4TVUA 3WMCA 1LWHA 2OYMA 1J10A 4ZEPA 3L4ZA 1AMYA 1R86A 2VZVA 2VCAA 3F5KA 4IM4A 5D8WA 1WDRA 3W81A 1FP8A 1YHTA 3AMDA 4MNLA 1WPCA 2WC3A 4MNMA 1UKSA 4GQQA 3ZQ9A 5M5DA 3WD0A 5EMYA 1OGBA 3AIWA 2FGZA 3PZTA 4UQBA 2PI6A 1JZ4A 3U5YA 3W37A 1PPIA 3CZLA 5EFDA 4WKFA 1MW0A 2GFTA 4UOJA 1OB0A 1X6LA 3VGGA 4D6HA 1XSIA 1C92A 4H2CA 1W9VA 4NZCA 1E9LA 4W8BA 3VOCA 4GI6A 3CUJA 3WENA 4ZE4A 3CH9A 2AMGA 8CGTA 1E1FA 3NSXA 3DYMA 2CBJA 1QHPA 1V3HA 1HKMA 4M80A 1D2KA 1EDTA 2VNCA 3T0BA 4HTYA 1PEZA 2XM1A 4GKLA 2J78A 3PZGA 3BSGA 4WF7A 5BYWA 1TR1A 1MQPA 5E6ZA 3WD3A 4IUGA 4PSPA 3WF0A 4ZFMA 4YPJA 2WVSA 3ARXA 2YL9A 4CD8A 1QNPA 1HJSA 2XSBA 1W1YA 1UOKA 4J3TA 4J3WA 2V3GA 5LA1A 2WXDM 1WP6A 1ZBVA 3ZO9A 3AIQA 4L4OA 3MO4A 4N0RA 1MW1A 4D1IA 2W67A 1UA3A 5A69A 3AYRA 2J25A 4QP0A 1BHGA 2DIJA 1XSJA 1H0GA 3TTOA 1GVYA 4H8VA 1JAEA 4AMCA 4PMZA 2D22A 1KR1A 1QNSA 1V0LA 1QVBA 2WZHA 3MUIA 3VGDA 3WDRA 3WQ4A 3S2CA 2J8FA 4D6GA 1H09A 4Z2HA 4ACZB 1KXQA 3WQWA 1E4NA 2JE8A 3IJ9A 3K4AA 1XH1A 1J9YA 2EBNA 4PEEA 4IPLA 3UERA 4AXNA 1CXIA 5CPTA 1E6ZA 3QHNA 3LPGA 4V28A 2Y8VA 1ESWA 1V3MA 4F66A 2FDMA 3BMVA 1O6IA 2DSVA 2YA0A 2YIHA 4NSBA 3AIVA 1NOWA 2OSXA 3AQUA 4GXPA 1UR8A 4HZ8A 5BXRA 3LPFA 4A3HA 1VEPA 4FMVA 3OGSA 4W5ZA 3AROA 2FHBA 4ZXLA 1RPKA 5JBDA 3PHAA 1Q6FA 2ZXDA 3BLPX 1UYQA 1XHGA 3AIBA 3VM5A 1B3WA 1DWIM 3WQ8A 5A6LA 5D8ZA 4PMOA 2GJXA 5HPOA 1V03A 1BG4A 3PZQA 5E0CA 5A8QA 4PRWA 1PZ2A 5DEZA 1MW3A 2VO5A 3VILA 2WHMA 3CZKA 2PWFA 3A6OA 4KGLA 4KH2A 2OSWA 1UZ1A 1UQYA 1TVPA 2XGIA 2DSKA 4E8CA 4JCLA 4UZUA 3ARRA 3N18A 1H11A 2E3ZA 1XSKA 1O7AA 4M81A 3VIGA 5ABEA 4GZIA 3DECA 1AQHA 5D9NA 4D6JA 1CZ1A 1DP0A 4P7QA 1JIBA 2PC8A 4P8UA 1WCGA 1ISZA 1WZKA 3HN3A 5CJ5A 3RDKA 3TTSA 1HL8A 2D1ZA 1C8QA 3MS8A 4P7RA 1QNQA 3CIVA 1BG9A 3W38A 1BFNA 2OWXA 4PMUA 1ITXA 4Z2KA 2C0HA 5D9PA 1QPKA 2CBVA 4B3LA 1Q6DA 4X0VA 2WSPA 3TA9A 1TE1A 4M1RA 2NW0A 3CHFA 5JUVA 2NSXA 1FA2A 1K9FA 4F9JA 2GDUA 2UY3A 2WMJA 1G0CA 4ATDA 1UR4A 1V3IA 2B31A 3AIRA 5E9AA 1K9DA 2WM0A 1E6PA 1E72M 3ALFA 3TTYA 4M56A 3B8SA 2PWDA 3L4XA 4BF7A 4W8AA 1XH0A 1E0VA 2OSYA 3AMKA 1OCQA 2ZUTA 1CXFA 3ALGA 2X09A 4PN2A 1CGWA 2Y4SA 3MSGA 2DIEA 3UR7A 2NT0A 4S3KA 1B9ZA 5GQBA 1UWQA 5E0FA 3LPOA 1PX8A 3WSUA 4RE3A 3SUUA 4AYSA 5ABFB 1DWAM 4W86A 3K8MA 5A2AA 2XM2A 2JF6A 3N15A 2VX6A 2VZSA 3J7HA 2CKSA 4D6FA 1DTUA 1MWOA 4GI8A 1R85A 4DWSB 3IJ7A 5BRQA 5IXEA 1JI2A 4JL1A 4Z2LA 2D3NA 4MB5A 4OOZA 1ITCA 5F7UA 1IZJA 1GVIA 3F5LA 1BTCA 4GQRA 2G3JA 2Z1KA 2W62A 2RGMA 1E43A 5A6JA 2WYSA 2XFRA 1C7SA 3O9NA 3BCFA 4TVCA 1W1TA 2J8GA 2W92A 1TA3A 3BSHA 4WKAA 1B3VA 1EHNA 3AZRA 4QLLA 5GNXA 3RMEA 1UH3A 2VI0A 3T2QA 2YL8A 4MNJA 1FP9A 4CN6A 2G3IA 1UH2A 4F8XA 3SCWA 3MUAA 1UD5A 5I6SA 3BAWA 3W53A 1HN1A 1G01A 1E0WA 1I1XA 2OYKA 2UY5A 3AHXA 3RM4A 3L2LA 4LXFA 3WFLA 2CERA 2GK1A 1OT2A 3AXXA 5ABGA 3MANA 5A8NA 1UR0A 1PX4A 1DHKA 1GHRA 3FY1A 2XIBA 2J62A 3KL5A 1GONA 1LG2A 3CGTA 4PTXA 2ZX7A 5A95A 2E8YA 5EBAA 3GBDA 4CUCA 4UR9A 3II1A 2DSZA 2YDSA 2O9TA 4H8HA 1J11A 3KL3A 1QI3A 3CUHA 1C7TA 2YDRA 2WMIA 1JXJA 2JEPA 2JEQA 1OGGA 1JG9A 3KZSA 1B3ZA 2YA1A 1BAGA 1HP4A 1QHOA 3AZSA 1W3KA 4MPKA 3SCVA 1BQCA 3EMCA 3L4TA 4CU7A 5BXTA 3DHUA 1R8LA 1ZJBA 3PTQA 3EDEA 3MMUA 2YBUA 4KMQA 4UFMA 3ZJKA 1GOWA 1V0KA 8A3HA 1V6VA 4AISA 4CVWA 1B30A 2D0HA 2BY0A 2WCSA 1Q6EA 3NCOA 3WUGA 2X1IA 2CBUA 1GOKA 5GPRA 5JBFA 1MFUA 2CIPA 1E56A 3BAIA 4WSKA 3WEOA 3VMOA 2YLLA 4PMNA 2D20A 1NM9A 5D9OA 1PIGA 1WZMA 5CSUA 2OWWA 2CHOA 1HVXA 4AIOA 2PF0A 5FKYA 4AD0A 2VRJA 3A4AA 2WLYA 3KL0A 4WK9A 2ZWYA 3NJ3A 4BQ2A 5A6BA 2XWDA 2J77A 4U5IA 5IFPA 1E55A 2PBGA 2QPUA 1IT0A 3K46A 4D72A 5I2UA 1CGTA 1V0NA 5CPQA 1B31A 2QHAA 1GHSA 5C8BB 2FGLA 3GH7A 1BYDA 3E1F1 2DH2A 1KR0A 2BNJA 1B3XA 1KFWA 4JFSA 3FXYA 4B9YA 4UQAA 1N82A 1CBGA 3IANA 3UESA 2BY2A 2CHNA 3RPMA 1DWGM 5DFAA 2WMHA 3WMBA 1EO7A 2J7BA 1W3LA 4JIEA 1J0YA 4CU6A 1CXEA 4CN1A 3WDHA 1LLOA 2CEQA 4PTMA 1E4IA 3WNNA 1HX0A 4OOUA 4R27A 5AY7A 4LX4A 3AS1A 1VFFA 1E71M 2VMFA 4V27A 1VJSA 3CUIA 4EK7A 1J0IA 1VJZA 5FOOA 1BLIA 1VAHA 4XV0A 5GNYA 1W91A 3ZJ7A 1W3JA 4UNIA 5CG0A 1QBAA 2EEXA 3AHTA 1JYWA 1FH7A 1QHZA 1W9PA 1ZS2A 4HMEA 1JFXA 3VD5A 3WL0A 1UWSA 1GJUA 3VTRA 1HF6A 4MB3A 3CBWA 1HJVA 3ARPA 1E40A 1QNRA 4M82A 1JDAA 3VNZA 4CCEA 4KRTA 1EDGA 2UY4A 4AZBA 2CESA 2W5FA 1HKKA 4BCEA 5CPSA 1VIWA 5CXPA 4NI3A 3W6LA 4HA3A 3APGA 3FN9A 2XSAA 1M01A 1E3XA 4ZXOA 1JYXA 3VD9A 4MB1A 1J18A 6TAAA 3L4YA 2FHFA 2EPLX 2BHZA 1LG1A 3WUBA 3NSNA 3VD3A 4NF7A 2O9PA 4YN5A 6CGTA 5D9MA 4GIAA 3VU2A 3WF4A 3AZTA 4AD5A 1UD3A 1UKTA 3A4XA 2E8ZA 5AC5A 4CCDA 2PWEA 4LYRA 3AFBA 2XJ7A 4UFIA 3ZJ6A 2QMJA 4BQ3A 2ZIDA 2CITA 1EO5A 1RD6A 3THCA 4DWSC 1W9XA 3O2LA 4AD3A 3NYDA 1XYZA 2GDVA 2AOSA 4TOQA 4OBRA 6A3HA 1X6NA 2VVNA 1J01A 3LPPA 3CMJA 2A3EA 2W66A 2Y8KA 2XGBA 3WH9A 2WCAA 4J7RA 2BHUA 2A3BA 5DO8A 2J7GA 5I23A 3U7VA 4MB4A 2JIWA 1JAKA 1H49A 2XIIA 3UETA 3WNOA 4K68A 4EAMA 2PBOA 3A4WA 1U2YA 2CBIA 4ZE5A 3L4WA 3U5UA 4DWSD 1WZAA 2BY1A 4AZCA 2XWEA 4UOQA 5M3WA 4U3AA 2VVSA 2O9RA 1CXKA 3WH5A 1WDPA 4MDPA 1CLVA 4PTWA 4UFKA 3MV01 7CGTA 4J28A 1R7OA 4LQ1A 1WE5A 4FLOA 2NT1A 4Z2GA 2MANA 3TONA 2OLHA 1HKIA 3OZOA 4PSRA 3PZMA 2Y2WA 1ISXA 3ARYA 3WNKA 4NRSA 2WVUA 1LWJA 2ZXQA 1A3HA 4WJXA 1HJUA 1C90A 1TFVA 2WW5A 4AZ5A 2OYLA 1AVAA 1KWKA 3PZ9A 3BXWA 3WD1A 1QOXA 3SUWA 3VKKA 3MMDA 2WWDA 2XVGA 1E6SM 2A3CA 2VZOA 1HIZA 2WMGA 3PTKA 4PMRA 3WKZA 4XZWA 1BYBA 1J12A 5CGTA 3GZAA 1H0IA 2VC9A 5ECUA 1RP9A 4JFVA 4U2YA 2WVVA 3BAKA 2QV4A 2WHKA 3GTNA 4BZYA 4Y7EA 3GXFA 1XYFA 1SMAA 4HMDA 4W8LA 1B3YA 1W9BM 3WNPA 4QCFA 1V6UA 3JUGA 1NP2A 2FH8A 2J4GA 3WUFA 4KWUA 4B15A 4TTUA 1B1YA 4W89A 3THDA 1JF5A 4CVUA 7A3HA 5IHRA 4AEEA 5BRPA 1GZJA 3AXIA 3AI0A 4J3VA 3RM8A 1XCXA 3A47A 4CU8A 1EOKA 3EDFA 1VFMA 2G41A 3WH6A 3WDQA 1G1YA 3GH4A 4QLKA 3NUKA 3WUEA 2JFEX 1B0IA 2A3AA 3WD2A 2F8QA 3EYPA 2VX5A 4Z2IA 4UQEA 3WEZA 3VIIA 5A6KA 3VMNA 2PWHA 1UG6A 4EE9A 3QR3A 1XC6A 2O9OA 3NSMA 1QI5A 4Q22A 1E5NA 3M6DA 1TUXA 1JZ3A 3WF3A 3VUPA 3SEPA 1EGZA 4CKQA 3VIPA 2WPGA 1ZB5A 1V3JA 1G5AA 3VGEA 1S46A 3B9EA 4KRUA 1FH8A 3VMPA 3GBEA 3WNMA 2BS9A 1TMQA 3ARSA 4H7VA 1M53A 2BHYA 4EANA 2XVPA 3WQ5A 3AYSA 4FLQA 2GJRA 2YLAA 3L4UA 1TZ7A 5CSYA 3CHEA 2CXGA 4QAWA 2QLYA 3WY1A 2J74A 5DMYA 3OLGA 3BC9A 1JZ2A 3VGFA 1JGIA 3IK2A 1NWTA 1EIBA 3OLIA 3EMQA 5JIWA 1MW2A 3DHPA 1W2PA 1JXKA 1QW8A 3FHAA 4W7WA 4CGTA 3MKKA 2GJXB 3W24A 3OGRA 4GZEA 2YL6A 2UWFA 1V0MA 1P6WA 1LQ0A 2DPEA 1BSIA 4U5KA 1GUVA 1NQ6A 1WDQA 1PBGA 4URIA 1W1PA 1E6NA 3ZMRA 3T09A 4YHGA 2WBGA 1NWSA 3PZUA 3SURA 1XD1A 2ESCA 1C8XA 1UD4A 4UZSA 1KBKA 2VURA 4S3JA 3W4RA 3CLWA 2E4TA 3ZM8A 2J7EA 4AZHA 1XRVA 1J0ZA 4TUFA 1CGYA 5BWFA 1NARA 1BF2A 3GNPA 1E6QM 4LPCA 3ZSSA 1ISWA 4IPNB 4P8WA 2PB1A 2VZUA 4CN4A 2CETA 3K1DA 2V3EA 1R87A 3BMWA 4JL2A 3WQ6A 1E70M 2VCBA 3VGHA 2BFGA 3AXHA 2VRQA 1XH2A 3KEHA 3OZPA 1SFSA 1VBRA 4B9ZA 3AISA 2BY3A 2WNWA 4TX8A 1UKQA 1RP8A 3M46A 1BVZA 3VD4A 2JF7A 4BQ4A 1C3FA 1U33A 2WKGA 5A8MA 3VIFA 3CZJA 2E0PA 1UD6A 1NWUA 1QNOA 4D6EA 1GQKA 3T2PA 2WSKA 3WELA 2W4XA 1U30A 2ZUSA 1G94A 4OJYA 2J75A 3OLEA 1UWTA 3AS0A 2BVTA 1QI0A 2ZICA 4E4PA 1NWRA 2FH6A 4MADA 2YBTA 2XTKA 4ACYA 2PWGA 3SCUA 5CQ1A 4M8UA 1PJ9A 5KZ6A 3U7BA 5AC4A 2G4FA 2TAAA 1SMDA 3N13A 1XCWA 1V3LA 2X2YA 3CZGA 4JKLA 2GVYA 3O6AA 1GQLA 4LYQA 5BXPA 1BGAA 3WH7A 3MUY1 1MQQA 4FLRA 4AY1A 3UG4A 3ARVA 1I75A 1HXJA 1EQCA 3BAXA 1X1NA 4W85A 1CGVA 3B9AA 1Z32X 3PN8A 1JL8A 4MJ4A 1MXDA 4JKKA 4QFUA 2Z1SA 4PCSA 4QDMA 2VCCA 4UCFA 3WMSA 4ML4A 3RJYA 2BVDA 1GORA 4EKJA 1E1EA 1MYRA 4L4PA 1GOQA 2BXYA 3N04A 1DWJM 1UH4A 4C7GA 3AHZA 4FF5A 2WWCA 1VRXA 3FW6A 1YQ2A 1HVQA 3WFZA 1HT6A 4QLJA 4HA1A 3EDJA 4PBGA 4W5UA 1KXHA 1TA3B 2WMFA 2DT2A 1JZ8A 4PMVA 1KGXA 4MTVA 4D1JA 3GNRA 5I79A 4M29A 2GJPA 5TD4A 5A6MA 4PMXA 4XB3A 2WC4A 1GNXA 1EH9A 4RE4A 3SUVA 2ZX5A 1L8NA 3EDDA 3PZIA 3WF1A 1BPLB 3WL1A 2GK1B 1KCKA 2J7FA 1M7XA 1HP5A 1OIFA 1CXLA 1FOBA 3WN6A 3CTTA 4Z2JA 1Q6GA 4HOZA 1CPUA 1J0KA 3I3BA 3MMWA 1CNVA 4JKMA 1UUQA 4JFTA 1US3A 2VX4A 1CEOA 3FAXA 4AEFA 2W91A 2WVTA 1J0JA 4P7NA 4GI9A 2ZUNA 1WDSA 4FK9A 3G6LA 1CGUA 3ZOAA 5EB8A 2ZX8A 2RGLA 3UEQA 1I1WA 5AYIA 3VNYA 4PMDA 2WMIB 3ARQA 1E4LA 5BXSA 1OT1A 4E8DA 1ZU8A 2D23A 2GUYA 4J3XA 4AWEA 1ISVA 3SCRA 3UG3A 2V3FA 5A1AA 4FLSA 4XX6A 1KQZA 2XYLA 1V08A 1VB9A 3N17A 3PZNA 1CTNA 4F9DA 2CKRA 3BAYA 5E70A 4HU0A 1EHAA 2J79A 5GNZA 1OINA 2IXVA 1V6YA 2J7DA 4D6DA 4LGXA 3WBEA 4MAVA 1LJYA 4UQDA 1JZ7A 3AMCA 3BH4A 1V02E 2XG9A 3CZ8A 4GO8A 5JIPA 4JHOA 4DM1A 3OGVA 3MSDA 4H04A 2WBKA 2CCRA 1H41A 5CLTA 5BCAA 1C8YA 2EPKX 3BAJA 3ZSTA 1CYGA 3DYPA 4IISA 4CD5A 1W2VA 3F4VA 4ACZA 2F2HA 3RO8A 3ARWA 3SCQA 4B16A 9CGTA 4HOWA 3FNDA 2XFYA 2HISA 2VT0A 4JFWA 1BYCA 4AIEA 5C70A 2UY2A 1TVNA 1ECEA 3EBVA 1GQJA 1XGZA 4PUDA 4J3UA 4P7LA 1OIMA 5A8OA 1XV8A 2ZXBA 1WO2A 2WHJA 4AD4A 2YDQA 4RL3A 3W27A 5HXMA 1VEOA 1QBBA 1E73M 3ARZA 2EXOA 3AOFA 3N11A 4RE2A 3RCNA 3GNOA 1CGXA 1MVYA 4CD7A 3HU7A 5E09A 2VTFA 3ZR5A 5E6YA 4R5EA 1K9TA 4H8UA 5D4YA 4W7UA 4N42A 3KWXA 3WD4A 2J7HA 4AZIA 4JAWA 3VIKA 2VR5A 4TVDA 4ZENA 5IDIA 3WQVA 1Y7VA 3AIUA 2WAGA 1UR2A 3IAPA 4A3YA 5ABHA 2YOCA 1FH9A 3POHA 3G6MA 5LA2A 3WDJA 3K4DA 4U33A 5CGMA 1JYNA 1Q4NX 4U31A 4B3KA 2G3MA 5HBFA 1XD0A 1OM0A 2WANA 1EA9C 3RM9A 4H41A 3QHOA 3T0DA 5I5RA 1H5VA 2DT1A 2YKKA 1B2YA 1QI2A 4UTFA 1JDCA 4BQ5A 1KXVA 1BGGA 4C7FA 2EPOA 1LF1A 2DSUA 4CCCA 3ZR6A 4W88A 2YL5A 4U3CA 5I3DA 4UQ9A 3SUSA 1JNEA 3L4VA 2EJ1A 4J27A 1MFVA 1E6RA 4AD1A 1C93A 1JD9A 1WB0A 1LL4A 2IUZA 3ZT6A 5A6AA 3EDKA 3OA5A 3AHYA 3RIKA 1H3GA 3VIMA 3I3DA 4HZ7A 2X05A 4AD2A 3ECQA 3VDBA 3HMCA 5A2BA 4NRRA 3W6MA 2WK2A 3QGVA 5A8PA 1F4AA 1HJWA 4PUEA 2XVNA 1JZ5A 1OBAA 1KQYA 1CENA 3WH8A 2E9MA 1ZL1A 3AMLA 1AQMA 5AYBA 1HKJA 2DDXA 4AZ6A 5I24A 2DGAA 4P8VA 4PTVA 4JCMA 1K9EA 3VGBA 1G9HA 1PX3A 2IXUA 2CYGA 4TX6A 2Y5EA 5I0DA 5IFTA 1HNYA 1UR1A 5FCZA 3POCA 3KE0A 3SCOA 2JALA 3VX1A 2BVYA 1ZBKA 2A3HA 1UQZA 1R7AA 5EFFA 5HDRA 4J3SA 2D24A 3AJ7A 3NDYA 3BLKA 3TP4A 4CD4A 3IAQA 2DSWA 3HJEA 4MDOA 5FD0A 1NH6A 3AICA 7TAAA 3MU7A 1L0PA 1CXHA 2D0GA 4TTGA 1A47A 4DUVA 5ABFA 3VM7A 1UWRA 5A94A 1NOUA 3SCNA 4HA4A 4P8XA 1CWYA 3VD7A 5I77A 1JYVA 3W28A 4WKHA 2VUYA 1JZ6A 4AZCB 2O92A 4WSJA 2W63A 1US2A 4DWSA 3EMZA 3QHMA 1JI1A 1GOOA 4UQCA 2EPMX 2ZUUA 4AW7A 1WAWA 2E9BA 3NIYA 1JF6A 4X0NA 1ISYA 4W87A 1WNOA 4OKDA 4DUWA 2ZUWA 2D3LA 1E5JA 1JDDA 4AZGA 1W9UA 3AHVA 1V6XA 1K6AA 4F79A 3ZJ8A 1UWUA 1CDGA 2W61A 2WLZA 4E2OA 1HJQA 1E4MM 3SCSA 1PZ3A 4HPGA 1EQPA 4GZJA 3S6TA 3N12A 3I3EA 2WVVB 4XZBA 1EXPA 3AS2A 5FL1A 2XFFA 2FHCA 4QCEA 2VRKA 3WIJA 4UOZA 4HZ6A 1KCLA 3CUFA 2V38A 4P7OA 3VDHA 3VIHA 1UWIA 5M03A 4OBSA 2VJXA 4AZ7A 2VZTA 3ZT5A 2AAAA 1QI4A 3GXIA 1GPFA 3WDPP 2WZEA 5CZKA 3VDAA 5C71A 4JZ5A 4YHEA 3N1AA 3ARUA 1VFUA 3GXDA 2WKLA 4HMCA 4MJ2A 2VL4A 3K8LA 4JFUA 1KBBA 2WB5A 1W9DM 3AIEA 1DWFM 5IHSA 4D6CA 1ODZA 1UZ4A 5DF0A 1H4PA 1W3HA 3PZVA 3GM8A 4WIWA 1HL9A 3U57A 1JD7A 5DT7A 3WEMA 2V5CA 2X0YA 1BVNP 2QPSA 3B9DA 1UD2A 2G8ZA 3CZEA 1NP0A 3TOPA 1RH9A 2ZX9A 2EO7A 3VX0A 1UHVA 2C7FA 2XVKA 3GXMA 4KGJA 2X0HA 2X8RA 2C8NA 5A6BD 2EPNA 2ZWZA 4PMQA 3W0KA 2D2OA 1E15A 1VBUA 3PZOA 1OSEA 3TTQA 5HPCA 5JBEA 3OIHA 1HJXA 5A6SA 1TG7A 4ATLA 1SYTA 3T2OA 4PCTA 3N9KA 3UCQA 3L2MA 1MQRA 1OD0A 2ZUVA 4PMYA 2BXZA 1E0XA 1V02A 2VR4A 1CECA 4W7VA 3MUZ1 1VEMA 1SR0A 2V5DA 3BGAA 1UKOA 3MV11 3FHQA 3GH5A 1FHDA 2CPUA 1WZLA 1GOMA 1Q6CA 1KWGA 1D3CA 3ARTA 2VX7A 1H2JA 4HPHA 1WKYA 4M24A 2WCGA 3VDCA 4AC1X 1UKPA 3GDBA 4WLCA 3OBAA 1MXGA 1GOIA 3VIOA 5FIPA 1V3KA 3RILA 3D5HA 3M7SA 1AQ0A 1W32A 2GSJA 3PBGA 2XVLA 3VVGA 3W25A 3WBAA 2DT0A 3QOMA 1CLXA 1JNDA 4CD6A 5FL0A 1OWQA 3CUGA 4W84A 1M04A 4BA0A 1PIFA 4GINA 3SUTA 3T0AA
chains in the Genus database with same CATH superfamily
1NOFA 3W82A 3SFKA 1M03A 3IS4A 2Y85A 3FAWA 3CMGA 1JDFA 2Q6ZA 2R1NA 4JDBA 2Y61A 1POJA 4XZHA 3SIMA 3TR2A 4Y9MA 4X9YA 1M7PA 3CK5A 1F4HA 4NJGA 4OIFA 4GCAA 3WK1A 4ZA0A 3MB9A 4Q6JA 4DPPA 5PTDA 3MZ2A 2F61A 1KNWA 5HAOA 3B3DA 2FB2A 1TCMA 3UG5A 4OUEA 4AQLA 3RR1A 3LGEA 2V2DA 4FAMA 3MPGA 4GPNA 1EOMA 4D6IA 3IUIA 3ZIZA 3S1WA 1H62A 2E40A 4H9MA 3QOKA 4UTKA 3VPLA 4JN8A 3OG2A 4XISA 4GXMA 4NZJA 3CHDA 3MHUA 1A5NC 1GJWA 3KWSA 3M07A 1VPYA 4PTNA 5LYRA 3PS7A 4GUHA 4UFLA 4IXXA 3OLDA 2VDGA 4Y9AA 1UA7A 4DQWA 4BR1A 2AQWA 3MI3A 1PCKA 2ZXAA 3MBFA 1K7EA 5BROA 1Q4WA 1E9ZB 4DBEA 4MZ1A 4W93A 1W5MA 2ZX6A 4MM1A 3LLDA 3DC0A 3W7GA 1VF8A 3M5XA 3QR1A 3IGHX 3N9RA 4DJDA 5KEZA 4GBDA 4XO6A 1QPNA 3LBOA 3ORWA 4IIFA 2YA2A 3S1GA 3VCCA 4A8LA 2IS7A 3N4EA 2QDDA 1PHQA 1ZBWA 1VCVA 1UC4A 1RK5A 4X22A 3CM4A 4CQDA 4QG6A 1FVPA 2OT0A 1YPIA 1JFHA 3CL8A 3NZPA 1F2JA 4N9EA 4ZEPA 1OEPA 2GDQA 4XIMA 1R3SA 4LRSA 1PSCA 1G67A 4XD3A 5D8WA 1WDRA 4B5VA 3BQ5A 5JQ9A 4MKNA 1C8VA 3USBA 3S1UA 4MNLA 2V67A 4MNMA 4E4UA 4AHQA 4GUJA 3OHMB 5EMYA 1OGBA 2QXWA 5FEXA 1TWDA 3FGCB 4AX7A 3W37A 3QMRA 4GY0A 4WKFA 2GFTA 4UOJA 1YDYA 3VGGA 2GUUA 3V5CA 1W9VA 1BQGA 2J88A 1LBLA 8CGTA 3JZUA 3R4IA 3DYMA 3FJ4A 1TPUA 2XH0A 3GXPA 3V5FA 2YW4A 1W31A 3C0SA 3HGSA 3OW1A 3TE9A 4HTYA 3LB0A 3LBCA 1IZCA 2XM1A 4NZ3A 4MHBA 2PDLA 1S5WA 3GUWA 4IIEA 1TR1A 4OV9A 5E6ZA 4IUGA 4Q8WA 3WF0A 3TW9A 4F40A 2YDAA 2QCFA 4RLIA 3URAA 2WVSA 4Q32A 1DHPA 4KEUA 3S2MA 4CD8A 2ISSA 1QNPA 3DG7A 4US5A 1OVDA 1BVWA 1HJSA 4GK8A 5DMMA 3IJLA 1W1YA 1A3WA 1LLWA 4J3TA 4J3WA 3F03K 1VYRA 4D8ZA 4XVEA 1F3TA 1WP6A 1ZBVA 3C3UA 4L4OA 3MO4A 3OVGA 2W67A 4LNCA 5A69A 4WOQA 3BLIA 5G1MA 3AYRA 4QQ3A 3G3DA 3VCNA 2H3DA 1XSJA 3N6HA 4IL2A 2H9AB 1H0GA 1GVYA 1H51A 3QC0A 1AG1O 3SO7A 3TN3A 3S2CA 3E0WA 5U7SA 4Z2HA 1A50A 5GJPA 4Z42C 4O8AA 4M6QA 1XP3A 9XIMA 3G0UA 4MJZA 3W7NA 3M1ZA 1UCWA 3FIGA 5CPTA 1E6ZA 3GZ3A 3CQ0A 5HMEA 3S46A 1F73A 1ESWA 5I02A 4U10A 2OSXA 3RR4A 4B2DA 1FX6A 1X6UA 4HZ8A 3LPFA 3MJYA 1VEPA 1U1HA 3OGSA 3NOEA 2FHBA 2C1GA 3QKZA 4HCHA 3UP8A 4ZXLA 1RPKA 3BLPX 1XHGA 3AIBA 1UIPA 2L5HA 1UBSA 1DWIM 3V16A 5A6LA 4PMOA 3STEA 2GJXA 3NQBA 4I5RA 1V03A 4BI7A 2FTYA 5E0CA 5BOOA 3DG3A 5DEZA 1MW3A 1TIMA 4Q4MA 2OO6A 2DVUA 4KH2A 1PKLA 3M0MA 4IGHA 2CW6A 3WFAA 3M5YA 2DSKA 2ZYFA 1O60A 4OHQA 1WDWA 4M81A 3WX7A 2BTMA 3HGRA 5FI8A 4AY7A 1S3HA 1POKA 1WCGA 1ISZA 3BJSA 4HK6A 3ZLFA 4K8HA 1QNQA 2X1UA 3UYIA 1ICSA 1DVJA 4HNOA 2DZUA 2R82A 5D9PA 3NM1A 4DXKA 2C91A 2WSPA 3TYAA 1J2WA 4GOAA 4Q7IA 2FVMA 5KZMA 5SWUA 5JUVA 3QVQA 4KEZA 5BZAA 4PCNA 3EX1A 1EBGA 4HYWA 5K4XA 2ZE3A 2NVDA 2CZ5A 2UY3A 1G0CA 4DJEA 1V3IA 3AIRA 5E9AA 1K9DA 4HYVA 4O4WA 3BLOA 3DFHA 1GKPA 4YU1A 3TFCA 3P62A 2IKIA 3L4XA 1XH0A 1PL9A 3AMKA 5CC5A 1OCQA 3DFPA 2ZUTA 1CXFA 4PN2A 4PBFA 2W6RA 4QE5A 4GQGA 5GQBA 1UWQA 1PYMA 4F4RA 3LPOA 4BKNA 1PX8A 3WSUA 2B7NA 2AL2A 3TJIA 3K8MA 2PU0A 1H7RA 3N15A 3E0LA 2VX6A 3CQHA 3WJWA 4GY1A 1R85A 4GXWA 3W76A 2UZ9A 4BI6A 5C5YA 4DWSB 3IJ7A 4NU7A 5IXEA 1JI2A 4JL1A 3TOYA 2D3NA 1XF0A 3CMFA 4AMAA 3F5LA 1OCBA 3E0FA 2W62A 1E43A 5A6JA 2WYSA 3W00A 3BCFA 4TVCA 4HA0A 1AD1A 4O57A 2YCIX 4QLLA 4ZQNA 1UH3A 4KFNA 3GNDA 4HKPA 4XKYB 2INFA 3NG3A 1HN1A 1G4PA 1E0WA 5C6MA 3ZYZA 1GVSA 2CERA 2EHHA 1SUXA 3MHGA 3AXXA 1EJRC 3KLKA 4FPSA 4C1LA 3SY8A 2PDGA 3PJUA 4HU3A 4ZO6A 2XH4A 4WRHA 1TPWA 1LG2A 4E3VA 5EBAA 4CUCA 1TR9A 4NAEA 3BW2A 4H8HA 2I5GA 4AU0A 3KZSA 4L9YA 8TIMA 3UJEA 2YA1A 1BAGA 5LNSA 1BQCA 3EMCA 3MYOA 2WNNA 3I6RA 3DHUA 1R8LA 3MT1A 2NQJA 1ICQA 3W7RA 3PTQA 3KBJA 3EDEA 4HMNA 5EU9A 2YBUA 3ONBA 3NOYA 4UFMA 5DCDA 1GOWA 1I6NA 1P1XA 2BY0A 4S3GA 2CBUA 2AMXA 5HINA 1MFUA 1KKOA 4PC8A 4S3AA 1E56A 5AYYA 3VUSA 1WZMA 1HVXA 4AIOA 5FKYA 3SN0A 2GQ9A 2I17A 1F8MA 2A0NA 4GJJA 4Y9PA 4AVOA 1KV5A 1Y5VA 2B81A 1K8XA 3DCPA 4U5IA 3G77A 3VK5A 2PBGA 3H21A 1IT0A 1QOQA 4O4VA 1V0NA 5DBTA 2NX3A 4DZ5A 3L23A 1VC4A 2GLKA 1DJYA 4AHPA 3IIVA 1BYDA 4PUJA 3W72A 2BNJA 2G0WA 1QASA 1KFWA 4JFSA 5J5DA 1SO5A 4WZHA 3OVPA 2ZZ6A 3M7WA 3THQA 3V0UA 4B9YA 3WZ0E 3F1QA 2IKJA 1ZZMA 5F4XA 5I3HA 3IANA 3ISIX 2HXTA 5B80A 2NQZA 4EWND 3UZ5A 1JULA 3VOIA 1A0DA 4JIEA 1CXEA 1UUOA 3WDHA 2Z4GA 1P48A 2E6YA 2VFFA 4NI8A 4R27A 4LX4A 4H1ZA 2ONEA 3DFYA 3CUIA 4JX6A 1P7TA 1PTGA 1VAHA 5GNYA 4K38A 3CYJA 3LCXA 2VUNA 1QBAA 2HVNA 1FH7A 3BV4A 2EPHA 1W9PA 5H8UA 1QDSA 3I6EA 4HMEA 3SRDA 1GJUA 1GEQA 1B57A 3WLIA 1NIUA 4YCPA 3FA5A 1HJVA 1E40A 3ATZA 5FJJA 1AMKA 4IFRA 1OX4A 1QJWA 3RRXA 3ES7A 1W3TA 1RQBA 3ABXA 2P0IA 3R0UA 4ORIA 5F1VA 5CPSA 3MCNA 1MEWA 4ERGA 2IKGA 2CLHA 4PMJA 4NI3A 1LWIA 4GFSA 3B0YA 3APGA 1XC4A 3FN9A 1M01A 1SW3A 3NL3A 1MSSA 4MB1A 6TAAA 2FHFA 3WUBA 3CQIA 4YN5A 2HS6A 3CXOA 2HK1A 4B5SA 4HQVA 5LNVA 4GIAA 1W1A1 3NNTA 8XIAA 3VU2A 4NT0A 3AZTA 2NQ5A 3AUOA 3E5PA 4V15A 1EX1A 2Z1BA 5AC5A 2ISWA 1TWSA 4CCDA 4NX0A 1ZY9A 1A4LA 1W1B1 5C2CA 1S38A 4UFIA 4BQ3A 1GVOA 1E9YB 1IGWA 1RD6A 4E5TA 5AC6A 4ZOEA 3O2LA 2WSRA 3NYDA 1D8WA 4X63A 3LZ3A 2E5BA 2CLIA 1A5CA 3LPPA 4O16A 1RSCA 4PA8A 2A3EA 4X60A 3WH9A 1P5BA 4J7RA 3IJIA 5FACA 5E93A 4LVBA 2HEJA 3U7VA 1NY1A 2JIWA 3R5EA 2CHRA 2FQIA 1CT5A 3ITGA 2PBOA 3A4WA 4Y9OA 4XTIA 2BY1A 4NNCA 5M3WA 3TNOA 3WH5A 3LG3A 4E8GA 4UFKA 4DRSA 7CGTA 1LQ2A 1R7OA 4FLOA 1YIXA 1N55A 4B5UA 4MKVA 1R30A 4LBSA 1JCYA 1HKIA 3OZOA 4PSRA 1VJIA 3KBWA 2FLIA 3N3TA 3O06A 3M0XA 4LAMA 1FKXA 1B54A 1A3HA 2YXGA 1HJUA 3RFAA 1TFVA 4AZ5A 1AVAA 3WD1A 2DZWA 3PANA 1Q8AA 1W5NA 2WWDA 3LHZA 3NYZA 2A3CA 1A5AA 4O28A 4LYKA 2BLEA 4L1GA 4IQJA 2WVVA 3BAKA 3EOSA 4JN7A 2WNZA 5T26A 2WHKA 1ZP3A 1H50A 4EPKA 4Z1DA 4BZYA 2WPBA 1XYFA 2DZAA 4C91A 4XD4A 3A3WA 1ZENA 3JUGA 3LI0A 2J4GA 4KWUA 4B15A 1XG3A 4LFYA 3THDA 1JF5A 3C0QA 4ROQA 1UPPA 3BE7A 3ZZ1A 4NAFA 4AEEA 3AXIA 1C9DA 3OZMA 2EG7A 2NXIA 1EOKA 5CJNA 4Q8OA 3URBA 1BKSA 3WDQA 3GH4A 4RXFA 4QLKA 3NUKA 2HWGA 3Q45A 3HFTA 4EXAA 2A3AA 4BEUA 4LANA 3WD2A 4KCTA 3MW7A 5J04A 2HSAA 3C52A 1FXQA 1VBHA 3ITCA 3TUUA 3M6DA 1W3IA 2BB0A 4UTTC 2E5DA 1A5SA 1EGZA 3W84A 4B92A 1ZB5A 1K70A 4LUSB 3BZGA 3SECA 3VGEA 4J4KA 1FH8A 3GBEA 1TMQA 3NEVA 1E9IA 2IQDA 5BU9A 1M53A 1IR2A 4EANA 6REQB 1D3GA 4FLQA 3UWQA 4WUIA 5CSYA 1TZ7A 1IEIA 3LOTA 2CXGA 2QLYA 3WY1A 4CNSA 3QMTA 3CO8A 3W07A 1KKRA 4ZO9A 1ONEA 2ZFAA 1OK6A 3DHPA 1OZQA 1ECQA 1LP6A 3CH0A 1AZ1A 1QW8A 3FHAA 1O94A 4W7WA 3MKKA 3W24A 2WJEA 3GIPA 1IXQA 3OZYA 3GS6A 1OG6A 4TU1A 1BSIA 4IMGA 1WDQA 1PBGA 1BRLB 1XPYA 3OIXA 1E6NA 3ZMRA 4YHGA 3KP1A 1GZGA 1US0A 2ESCA 1UD4A 1LTDA 1H7WA 4JS3A 4V33A 4QTGA 2G95A 4UZSA 2FZDA 3IJQA 2E4TA 3H2MA 3W7IA 3E6EA 3MVTA 3Q37A 1X7IA 1TELA 3PFRA 1MUCA 4IPNB 5EYWA 3C56A 3AYVA 3SY5A 4K6AA 4CN4A 3K1DA 2V3EA 4YCOA 4X2PA 2J9ZA 4IQEA 3WQ6A 1E70M 3KCJA 2VCBA 1OX5A 3QFWA 3WLKX 2VRQA 5HWNA 3KBVA 3OZPA 1E1CB 3QBUA 4JIRA 3AISA 1DBTA 2BY3A 3ITYA 4GIRA 2R1PA 1BVZA 3VD4A 4YJ5A 1JPKA 4O8RA 2WKGA 4UNLA 3GKFA 3VIFA 2ZVRA 3UXAA 4ERAA 1UD6A 3AWNA 5L9FA 4DLMA 4S38A 3T2PA 2W4XA 4IHCA 4A8IA 1G94A 4GFIA 3FVDA 4E4PA 2GOKA 3FK4A 1M68A 4ACYA 1Z41A 2PMQA 4DJDC 2PWGA 1XRFA 4HK7A 3SCUA 4M0XA 3MMTA 3U7BA 2FTWA 4YIWA 3W7QA 2TAAA 3T8LA 1XCWA 2X2YA 4JKLA 3O6AA 4LYQA 1BGAA 1EP2A 3E12A 4LB4A 4FLRA 2OLAA 3UG4A 3B8WA 1ADDA 1I75A 3H2AA 5T8GA 3I7RA 3B9AA 4IG2B 2QUVA 2GVGA 4IMAA 1HL2A 5K4ZA 4PCSA 3NL2A 4ML4A 3RJYA 6TIMA 2EKCA 3S1VA 1E1EA 2Q3OA 4L4PA 4WCJA 1VR6A 3AHZA 5I3IA 3CAWA 3GNNA 4I9TA 1YQ2A 2BBFA 1OFBA 1XFCA 4QLJA 2Z7GA 1JZ8A 3AWOA 4LBRA 5JH1A 5TD4A 4M7SA 2VGIA 4Q4SA 5I09A 2WC4A 4LT9A 4NKCA 3APYA 3NQAA 3SUVA 1L8NA 1Z8AA 3U2OA 4GUIA 3DFQA 1KCKA 5G2HA 1HP5A 5ECVA 1CXLA 3UNTA 1FOBA 4ZL1A 3FGCA 3M0JA 4GYFA 4LOCA 3R89A 1Y8BA 4Z2JA 4GWEA 2QVNA 1Q6GA 3LX9A 4HOZA 3L65A 1XIBA 1CPUA 3I3BA 3MI2A 3FA3A 2EJAA 1CNVA 4W4QA 3CLMA 1UUQA 1DXFA 3NWRA 3GAYA 3R58A 1TPB1 4P7NA 1MUMA 2Z26A 1WDSA 4FK9A 4H6KA 1XL9A 2QCCA 3PVFA 5DMNA 2RGLA 4E0CA 3WQCA 5AYIA 4PUWA 4PMDA 1E4LA 2FPYA 1OT1A 4XAZA 3SSJA 2G37A 4IMEA 2D23A 2GUYA 4H4IA 4DAFA 3N73A 1OF6A 5A1AA 2RDXA 3WQFA 3PPHA 1RK6A 2PDHA 2CKRA 5MHBA 1NF7A 2J79A 3P6LA 5GNZA 3PC0A 1ITUA 1SPQA 2ACSA 4G8TA 1EA0A 3WBEA 1QW7A 3E5BA 3BO9A 3EPMA 4UQDA 1ONWA 4LUIA 3MBDA 1V02E 4AFYA 1W6TA 2H9AA 3CZ8A 4GO8A 1NF0A 3QZAA 4H04A 3AALA 1SW0A 2WBKA 3CT7A 3P67A 3MA8A 5BCAA 1CYGA 1Q6RA 2YGYA 1K3UA 3W86A 4CD5A 1XX1A 3RO8A 3I65A 3FDKA 4S3FA 4RXGA 3GLCA 1CB2A 1EJXC 1YXYA 4B16A 3CAKA 1IWBA 2IPFA 2V5KA 5A8GA 3SM0A 3QW4B 1TV5A 1ICPA 1BYCA 1SM9A 3APTA 2UY2A 3N2XA 1OFDA 3LM7A 2QCNA 1XGZA 3W1LA 2QJIA 4ICCX 3KHDA 4P7LA 1YPFA 3O63A 1ZJHA 2DY3A 4X3ZA 2HV5A 5TBOA 2TSYA 1LOSA 1WO2A 2GWNA 2WHJA 2V5JA 1KW1A 4ZO8A 1Z3NA 2E25A 5AYZA 4AD4A 2YDQA 1QBBA 1E73M 1IXOA 3ARZA 2EXOA 4Y90A 1CGXA 1OG0A 3H4XA 1M7JA 3ZR5A 1S5MA 1K9TA 4N42A 3UGRA 2WJFA 3LN3A 5HJYA 3G1FA 3FYYA 3UVAA 1W8SA 1DXEA 4KWVA 2WAGA 4UNKA 3G6MA 5LA2A 3UG8A 3K4DA 4JTTA 3VKAA 3P80A 1Q4NX 2Z6JA 2R1LA 1PZ1A 3HQNA 2WANA 2PPGA 1ITQA 1H1ZA 4O54A 3T0DA 4DJEC 1J79A 4YVXA 2ANUA 2DT1A 3KDNA 4GACA 4BQ5A 3ZR6A 1WUEA 3SUSA 1I2RA 5C7HA 2QV5A 1WB0A 5A6AA 2PD5A 2QCDB 3RIKA 3P0WA 2F6KA 1S5VA 5EMJA 3I3DA 4XSMA 3GUGA 3ES8A 4JEJA 3W6MA 2WK2A 1GOXA 2XFWA 1OBAA 1JPDX 1IWAA 1ZL1A 1F3WA 3EX3A 2DDXA 5HK4A 1XGDA 2GVJA 4X2RA 1MO0A 2BGNE 1FWTA 2OELA 1K9EA 4F0KA 3LNPA 1IWPA 3P5ZA 1GZ1A 3PNUA 4TX6A 1JUKA 5I0DA 1C9WA 5IFTA 1KFJA 5FCZA 1IEQA 2DZVA 1U83A 3SCOA 4AB4A 1S5TA 2XSXA 1A5LC 1T6MA 4JNYA 1R7AA 4CD4A 4G5DA 2X40A 3HJEA 4HPJA 1XIGA 1P0KA 3MU7A 3C2YA 4Y9NA 4C6EA 2GWGA 4TTGA 4GZ7A 3CTLA 5A94A 3SCNA 4P8XA 1JYVA 7REQB 5LHFA 3UCCA 2VUYA 4MZYA 2W63A 2V63A 4DWSA 3N14A 3EMZA 4WY0F 4MIMA 4AW7A 1XLBA 1L6SA 4IP7A 4L7ZA 4CQCA 2GPTA 3EWZA 1F6PA 3L12A 3NQ2A 4XBKA 2ZUWA 4F0SA 4K7VA 4UR7A 4XKYA 4R9XA 4XZNX 3UJRA 1NFBA 4AZGA 1JQVA 1K6AA 2XZ9A 3ZJ8A 1UWUA 2JBMA 2YYUA 2W61A 1QU4A 2C1IA 4PULA 4E2OA 1HJQA 2OX1A 3S8HA 3NQDA 1PZ3A 1E0TA 4TIMA 4C6MA 1L9WA 3S6TA 4WJ8A 1O5XA 3AS2A 5K2ZA 1Q63A 5H8MA 2FHCA 5CBIA 1TYGA 3O0FA 2V38A 2C14A 4P7OA 2QEZA 3AXMA 1UWIA 5M03A 4OBSA 1XPGA 3ZT5A 1EF2A 4HNTA 4J35A 1GPFA 1IYXA 3EZ4A 1GQNA 4HMCA 3PBMA 2E67A 2WB5A 4G6CA 3CB3A 3EOUA 5IHSA 3R2GA 1UZ4A 4FIQA 1ZLPA 1PYFA 3P8JA 3S5YA 1VS1A 1J6OA 4RKAA 3VABA 3CB8A 1FRBA 4I7UA 5BRBA 4NX5A 2PP0A 3TIMA 3WEMA 2V5CA 1BVNP 2OKOA 1RH9A 2ZX9A 1TV4A 3VX0A 3RLHA 1UHVA 3EX6A 1DIOA 3WLTA 1OADA 3WBXA 2RHGA 2X0SA 1YE6A 4LSBA 1AD4A 4ERIA 4B4FA 4LF1A 4Z17A 1VBUA 1EEXA 4MMWA 4ROPA 3NO1A 1TIWA 3TTQA 3S0CA 4JX4A 1QO5A 3L0KA 1SYTA 3H2EA 1DORA 4PCTA 1MUWA 3UCQA 3ZWTA 2X1SA 3NQGA 1OD0A 3OA3A 1RA0A 5C7VA 1W5PA 3QRHA 3KXQA 1ML1A 1VLIA 3H22A 1KFCA 5E1QA 1WZLA 1ALDA 3TWBA 2VX7A 1H2JA 3IVUA 1WOBA 1LBMA 4AC1X 3OP2A 3L5MA 2ZC1A 3VIOA 1V3KA 3RILA 1QRQA 1W32A 2QGYA 1WOAA 3WBAA 1GWJA 3W2UA 3CUGA 4JQ2A 3GU9A 5CPLA 2X30A 4QBXA 3W75A 4QEHA 1SO6A 4GVFA 2QMKA 3KVKA 4DF2A 3VIJA 1ODUA 3LCLA 2FJUB 1XQLA 2V3DA 3CYVA 3N2CA 1WKFA 3PG8A 1T8XA 4FNTA 3CPUA 3CHCA 3NQ8A 2X7WA 4Q7NA 2VQUA 2XPKA 1U22A 1TX0A 1FWDC 4Y8EA 2VOTA 1AH4A 3IV8A 1UR9A 1J0HA 1V77A 3HTWA 3WNLA 1AJ0A 4KQNA 2QZRA 1FFRA 2PEVA 2CNCA 3V3WA 3QSTA 1KXTA 4QG9A 2PGFA 4H9YA 2H6RA 4LRTA 2FZ8A 1QT1A 3PTMA 1FCUA 3BANA 3OQ8A 1F07A 3SCTA 4FSAA 3OU8A 5KINA 2PRMA 1BYAA 4S3CA 3NL6A 1FWNA 1YYAA 2P1FA 3ZLHA 1VFOA 4J40A 2D0FA 5LA0A 2DZPA 3RX4A 2RDTA 5T9BG 1W17A 4JTDA 3NDZA 4PYSA 3WLMA 1U1UA 1LL6A 3AMGA 2BWGA 4UFJA 1KGUA 1ZBCA 2NX1A 1GVEA 2BDQA 2QDGA 4V1XA 1LOQA 1FDJA 4QXIA 4QGCA 1CIUA 1D7FA 2QF8A 1GT8A 4D71A 4F3HA 1VYPX 3BCJA 3HG2A 3AS3A 4DUXA 3A3HA 3GVGA 4K8GA 4WSHA 4ATWA 1FTXA 1BF6A 2ZUMA 3ITOA 2Z1XA 4C7DA 3KBSA 1GCYA 3W74A 5C2GA 1FHLA 3A9BA 4YTUA 1IV8A 5CG7A 1TE6A 2Z27A 3UR8A 1FFQA 1H1NA 1QPRA 2JGQA 3IIOA 4XSLA 1X8FA 3LGGA 1XQKA 2Q8XA 4FX8A 3RJXA 4EF9A 2O0TA 3CT2A 4MG4A 1CLKA 3CJPA 5HJXA 3NPVA 4ADTA 2DUZA 2E9LA 1TPVA 1J10A 1A53A 3GW3A 3DBPA 4K1GA 1R86A 2VZVA 4KEMA 2VCAA 1KD0A 4C6OA 3F5KA 2HBVA 3AMDA 3UZZA 3OEXA 2WC3A 4Y96A 3ZQ9A 3BURA 5M5DA 4FNRA 3E49A 2QUTA 3BJTA 1PWLA 5C2XA 2YW3A 3PZTA 4UQBA 1JZ4A 2VEGA 4E2DA 2NUYA 5EFDA 3LU2A 1Y5XA 3LI1A 3LGDA 1YTEA 1OB0A 4J3ZA 4H2CA 4NZCA 2Z00A 4GI6A 3CUJA 3WENA 2POZA 2AMGA 4O0QA 3ZXWA 4I9JA 3KTCA 3ENLA 3BLLA 2BVWA 2HRWA 1HKMA 1D2KA 1EDTA 1BWVA 2VNCA 4QDPA 3BQ6A 2OOFA 4GKLA 2J78A 3PZGA 3R25A 5BYWA 1MQPA 4GX9A 1WA3A 3W6YA 3MTWA 2FVLA 2YYTA 2ABAA 4MY9A 1A0CA 3R11A 3CWNA 3P8IA 4I8DA 2XSBA 3O6DA 3WK3A 1UOKA 1SJCA 2PRHA 2V3GA 3LXAA 3V5OA 3UNDA 3NQEA 4QG8A 2Q8LA 4O50A 4BK9A 2W27A 1RBOB 2DIJA 3W70A 4H8VA 2D22A 1QNSA 4M7TA 2WZHA 4O10A 3WQ4A 3RITA 4D8AA 4L6DA 5E0KA 3GE7A 3M47A 5EMMA 4Y6GA 4HHLA 1KXQA 1E4NA 2JE8A 3BGJA 4YYFA 3BZJA 4LUSA 1JRBA 1R47A 4PEEA 3UERA 5DRCA 1EIXA 1ZGDA 3QHNA 1XLKA 3LPGA 1B4KA 3ZLGA 3RK8A 3M41A 4ZO7A 1V3MA 1XUUA 3LK6A 3SQSA 1KO0A 2DSVA 2PDBA 6REQA 2J27A 3AIVA 3AQUA 1ZALA 3EOEA 4JQAA 3GR8A 3UZXA 3TLQA 2Y63A 2VP8A 3W7CA 3QY8A 5FJTA 3R43A 3VM5A 3H2FA 3VZYA 2F2KA 3LMZA 5HPOA 3I7SA 1GPWA 4OUIA 1BG4A 5AB3A 4H9TA 5A8QA 4PRWA 3C0JA 1BRLA 2OEJA 2VEKA 3CZKA 4L5ZA 3F4CA 3BLEA 2OSWA 3RU6A 1UPMB 1UQYA 1PTAA 3IGXA 1P0DA 2XGIA 3UA4A 1QOPA 4Q8NA 4JNMA 3QY7A 2PGWA 5BMWA 3ARRA 3N18A 2AQOA 3VIGA 4HZMA 5ABEA 4C1KA 1LRNA 1TUFA 3DECA 4GZIA 1AQHA 5D9NA 4WDWA 2MUCA 1CZ1A 1K8ZA 4P8UA 4L1WA 4J9JA 1WZKA 5CJ5A 1UOZA 3EWUA 3RDKA 3TTSA 3T55A 2D1ZA 3P2VA 1C8QA 1RBLA 3MS8A 3CIVA 5G5IA 4G1KA 3FVMA 4A35A 4PMUA 5AHIA 5HWJA 4MFEA 1QPKA 1E1CA 4B3LA 1Q6DA 4LS2A 3TA9A 4M1RA 2J9XA 1XYMA 4CCZA 4IL0A 2NSXA 1FA2A 4F9JA 2J66A 3N9SA 4ATDA 4I3GA 1JPMA 2B31A 3EXSA 3HPSA 2WM0A 4A05A 4MLRA 1E72M 3VCRA 1O12A 3G8EA 3M0KA 3LRLA 3FEQA 1KM2A 4M56A 4BF7A 4S2CA 2BOEX 5EMUA 4BF9A 3EKLA 4EF8A 4DNHA 2X09A 2Y4SA 3MSGA 2DIEA 3TEVA 1S2AA 4LAOA 4S3KA 2B7QA 1B9BA 5E0FA 3B97A 1RALA 1JCJA 5AFDA 2A6LA 3SUUA 4IG2A 5ABFB 4C6KA 1LUCB 2XM2A 2Y0FA 3KTSA 3N34A 3J7HA 4WDUA 4XG1A 2G3FA 2A79A 4ZOCA 3VFCA 1K02A 4Z2LA 4MB5A 4OOZA 1IZJA 1GVIA 1BTCA 1Q66A 3IUHA 2G3JA 4Q33A 4GY7A 1EZWA 4IIGA 1B3VA 3AZRA 3O15A 2CZDA 5LNWA 1OC7A 3MC5A 4EIVA 3CEPA 1OFEA 4XTDA 5K9CA 1UH2A 4F8XA 5EL1A 3MUAA 3SCWA 4AVFA 1JPIA 5I6SA 3QTPA 2ZTJA 1G01A 2OYKA 1IE7C 4WGXA 4LXFA 3WFLA 4KERA 2EKGA 2D2JA 3UT0A 1OT2A 5KMYA 3EPNA 4OU1A 1LQAA 4NJHA 4BI5A 2H8XA 3MANA 5DMLA 3T7VA 1V6TA 1EKOA 1XIMA 1N8WA 2YPIA 1UR0A 3K1GA 1U5JA 1XGEA 2VGGA 3KL5A 4QM1A 5HJLA 5LIKX 3CGTA 2ZX7A 4DAIA 2Q01A 4CNTA 3UU0A 3II1A 3UPBA 2E5CA 1KTNA 4MY8A 2YDSA 2FDSA 3CUHA 4RNFA 3FXGA 1JXJA 4DF0A 1ZCCA 5F2IA 2HS8A 3GFZA 1B3ZA 4UTUA 1K7FA 1W3KA 4MPKA 3SCVA 1R3TA 4NL1A 3M0VA 4GE8A 2A6NA 3G8RA 4KMQA 1V93A 1TREA 8A3HA 4IUOA 2D0HA 2WCSA 3NCOA 1DTNA 1G69A 1GOKA 5JBFA 1SO3A 4HU4A 1QCWA 1ZP4A 4EWJA 2CIPA 3BAIA 1UR3M 3U0HA 5HR6A 2D20A 2VOMA 2CHOA 3SN1A 2VC7A 4N4QA 4C6FA 3A5VA 2PF0A 3A4AA 4ZQPA 2WLYA 1VFTA 2NQ9A 4QS5A 4BQ2A 3QPYA 3COTA 1YRRA 1GVFA 4KRZA 2QPUA 4D72A 5I2UA 4O17A 4CNPA 2QHAA 3F2BA 3NDOA 3PULA 2VFGA 3VNKA 4JOMA 2FGLA 3TQKA 4C6BA 3QV9A 2NV2A 3V36A 2NUXA 3C0LA 4O11A 4EPEC 2EAWA 3FXYA 1SR9A 2BG5A 1TPFA 1CBGA 2TRSA 3UESA 1KLZA 3RPMA 3BARA 3BLDA 2WMHA 4XBSA 1IGSA 1DJQA 1EO7A 4GNVA 2I9UA 1IR1A 1TPEA 3TXVA 3REQB 2CEQA 4PTMA 4DYKA 1CB7B 3N3MA 1HX0A 4OOUA 3F4NA 3UZWA 1J2BA 1EC7A 2G5WA 5FF0A 1E71M 4V27A 1VJSA 2FGBA 3B8DA 3IIXA 2GGJA 1W1IE 1BLIA 4XV0A 4AWTA 1W91A 2B7PA 1NSJA 2HMCA 1OFPA 3XIMA 4JIQA 2EEXA 2OLSA 1AL7A 1ZS2A 3VD5A 6PTDA 3MWCA 3TZFA 1ONXA 4A29A 3VTRA 3G1XA 1R2RA 3FOKA 1EP1A 1HF6A 4KCWA 1B3OA 2V6AA 3ARPA 1QNRA 4AWSA 3LHVA 4CCEA 4Z0JA 2RUSA 4K7YA 3NTYA 1EDGA 4AZBA 5I3JA 3H24A 3HGOA 2W5FA 2DW6A 3PPCA 3TYBA 1HZYA 1IIHA 1VIWA 1Z42A 2QCDA 4UCGA 4GYKA 4CNUA 3G22A 1R0MA 1EJWC 3D47A 1E3XA 4ZXOA 1Z48A 4XD5A 4KESA 2WZMA 5LIYX 4CLMA 2EPLX 2BHZA 3NSNA 1M65A 3M4HA 3CV2A 3H4GA 2Q3RA 1WX0A 3WF4A 4AD5A 3TSDA 4AY8A 4GQBA 1TPC1 3HB9A 4R53A 2YCLB 4HVXA 1M7OA 1EO5A 3THCA 4DWSC 4TO8A 1W9XA 2DU2A 4AD3A 5A6TC 1XYZA 2AOSA 4TOQA 6A3HA 1X6NA 5DXXA 1J01A 4GNJA 4UR8A 3GTFA 1Z7AA 2Y8KA 2R14A 2BHUA 1R5YA 5CZJA 5DO8A 3OODA 4JTSA 4Q4OA 3LV6A 1MZHA 4HHHA 1Q3NA 3E02A 1X97A 1VD6A 3BMXA 4EAMA 2PZNA 3U5UA 1WYIA 3C8FA 7REQA 3NXFA 1T8QA 2IPGA 4N6EA 1G7UA 4UOQA 1CXKA 1N7KA 3W22A 1H7XA 1Q45A 1Q2RA 4XIAA 3MV01 3B4UA 4PR4A 5AHLA 5D05A 3GSMA 5AVNA 2HNHA 2C1HA 2NT1A 2MANA 3H23A 2OLHA 1XRTA 4H2HA 2PUZA 5CSRA 2Y2WA 1ISXA 4R88A 3WNKA 3GHTA 4NRSA 4WJXA 2G97A 2OX4A 3NQ6A 4LVDA 3OO2A 3UJ2A 1QOXA 3SUWA 4Z1YA 2GQ8A 2XVGA 2VZOA 3PTKA 5LNUA 1TV7A 3WKZA 1EB3A 3W2MA 5DCEA 3GZAA 4MUPA 3TQPA 4C6DA 2VC9A 3TAOA 1TB3A 4A2RA 4JFVA 4U2YA 4BFAA 3LYEA 3H54A 3SRHA 2PWVA 1OQFA 1LORA 3GTNA 1Q5MA 4LUJA 1FUYA 1SFJA 5FA5A 3PP7A 4HJWA 4LUTB 1V51A 1AJZA 4HMDA 1B3YA 4FF7A 3WNPA 5EPDA 2R1KA 3LCFA 4UTWA 2CXEA 1V6UA 5IBXA 1NP2A 3WUFA 4O1CA 1TV3A 4WXZA 5LXXA 4TTUA 2HDJA 7A3HA 4PL1A 5IHRA 3ITLA 5BRPA 3PUEA 3A47A 2YB4A 3ELFA 3EDFA 3KP0A 2VWTA 3PFMA 3KS6A 1VFMA 2G41A 1Q13A 1QO2A 3UZJA 4OT7A 3CIWA 4DXVA 4D8LA 1XW8A 3PWGA 4I7WA 2JFEX 3DGBA 4XAFA 3VFLA 1OYAA 2PSNA 3AU2A 4HK5A 3SQLA 3EYPA 2VX5A 1FDYA 3PWAA 4HIBA 3VIIA 2AAMA 4IICA 4RR4A 3VMNA 2V82A 4EE9A 2ISFA 1XC6A 3V18A 1E5NA 1VKFA 1JZ3A 3GD6A 3SEPA 1REQB 4GX8A 3SR7A 1G5AA 3MUCA 3LY0A 2VEIA 1S46A 1R9XA 5LGZA 2G50A 4XAPA 4WR3A 3QKEA 3LZ5A 3ITVA 1YDOA 5J5RA 3WQ5A 3QPEA 3S9ZA 2GJRA 2YCJA 3IVTA 4QAWA 3RPTA 4GI4A 1IEXA 4ZQMA 5DMYA 1J93A 1TVLA 1KFLA 1JZ2A 3IK2A 1EJUC 1KFBA 2ZBTA 2KZHA 1EIBA 3OLIA 3EMQA 3N2MA 1RQEA 3DFNA 1J96A 4MWAB 2ZDSA 5JU6A 2OJPA 3STPA 4LAUA 4FI4A 3OGRA 2UWFA 1O5QA 1NQ6A 3LCWA 2PTZA 3WLJA 4QNWA 1Z69A 5FF4A 1C8XA 2QCLA 1KBKA 3QR0A 3UW6A 4S3JA 3FLUA 3CLWA 4FO4A 2ICSA 1CGYA 1NARA 3B8UA 3GNPA 4LPCA 3ZSSA 4PRTA 2MNRA 3LRMA 1PUDA 5D38A 2JGYA 4FNQA 2VZUA 4M19A 1R87A 3VE9A 3DI0A 1XM3A 3EA2A 2IKHA 3VGHA 4UMCA 3AXHA 2C16A 1AW5A 3W2KA 1XH2A 2RH9A 5E9XA 1SFSA 1VBRA 2XINA 3KX6A 3B05A 1U33A 5A8MA 4IPJA 2OXNA 3LRKA 1JVNA 2P5NA 3RLUA 1VCFA 4D6EA 1P0BA 4QS6A 3PBUA 1UWAA 3PPGA 4GVGA 4OJYA 1LCOA 3OLEA 2BVTA 2ZICA 1NWRA 3LS9A 1IXPA 4NY2A 1Y5WA 1EJVC 3H70A 4M8UA 3O1NA 5AC4A 1MEIA 3FJLA 4NXKA 1SMDA 3H7RA 4MUZA 5G1YA 4E3TA 2P10A 4AH7A 4JGDA 4AY1A 3ARVA 5EY5A 4E2BA 1ENUA 1JGMA 4W85A 1O95A 3EXTA 3GQYA 1UBPC 4U28A 2A7NA 1JL8A 4MJ4A 1MXDA 4JKKA 4QFUA 2Z1SA 4DJDD 3DDMA 4DI8A 2VCCA 2NWSA 5K7JA 2X16A 2A5HA 5IRPA 1WBHA 4I9AA 2ADAA 1GORA 4C1NB 1EF3A 1UH4A 4C7GA 3DEQA 1VRXA 5FJOA 3OBEA 6XIAA 2YXXA 4XAGA 3Q65A 4W5UA 3GG0A 3G1VA 4IPPA 1BEUA 4JYFA 7TIMA 3TYZA 1KGXA 1OJXA 2PP1A 4D1JA 5I79A 2CWXA 2RDUA 1Q2SA 4GYJA 2ZX5A 3HMJG 5C9ZA 3WF1A 5IDZA 3WL1A 3QYSA 2PGEA 1M7XA 4JIIX 2Q02A 5I7GA 1XBVA 1JCLA 3CTTA 5CAHA 1J0KA 4NNAA 1R9YA 4JKMA 1QUMA 1S2TA 2ZKMX 4JFTA 2A2IA 1US3A 6ENLA 1H5YA 1CEOA 5D2WA 2WVTA 4GI9A 5HUOA 1OHLA 3KBNA 3ZOAA 2ZX8A 4ES4A 3UEQA 3NEHA 2FZNA 4HNVA 3QFEA 2OFJA 2OZ3A 2WMIB 3L7RA 5F2LA 4H6QA 3DX5A 3NZGA 4J3XA 4AWEA 4ZB2A 3SCRA 3GDTA 6XIMA 3F4WA 3NZRA 4QEEA 1Q6QA 2P76A 4MY1A 4US5D 4DZHA 1TJPA 4FLSA 1KQZA 3UWEA 4PZVA 2D73A 5REQB 1VB9A 3GTXA 1J4EA 3LXCA 7ENLA 4PH6A 4XVDA 4DO7A 4RZ4A 1K8CA 1EHAA 5FJIA 3KOZA 1J6PA 1V6YA 5D2VA 2Y5SA 3C86A 4D6DA 2ACRA 4LGXA 3STFA 2ZC8A 2OG9A 4PB4A 3SADA 4XZMX 3ABOA 5LGXA 1MRAA 3BH4A 3N29A 3H26A 1I9CB 2XG9A 3FSUA 2QUMA 2V8ZA 3W1TA 3CQJA 4JHOA 5BW6A 4DM1A 4L61A 2CCRA 5HNRA 3U9IA 1C8YA 2QJGA 3ZSTA 4YTQA 1QK2A 3F4VA 4R34A 2PU1A 2X41A 3SCQA 1I60A 1DQWA 4IMDA 5T9CE 9CGTA 2GL5A 2OR2A 1GYNA 2HISA 2VT0A 1FQ0A 4JFWA 3KOYA 3P82A 1AZ2A 3RG6A 4O1AA 1TVNA 3EBVA 4PUDA 2QIWA 4B2DD 4M3PA 2EF9A 4NG3A 2ACUA 1FDZA 4ASTA 3G1RA 1EJTC 2RDWA 3BICA 3A5FA 1W54A 2PODA 1VEOA 2IQ0A 4UIOA 1DIEA 3NQFA 3VKJA 1OFOA 2NWRA 4KEVA 4R5EA 3S1XA 4DELA 3KWXA 3UR5A 2J7HA 3DKJA 2BOFX 4JTGA 1RJPA 3JVAA 3VIKA 2VR5A 3WJSA 4ZENA 2OZTA 3DERA 2HE8A 1Y7VA 2GSEA 5ABHA 1UR2A 3IAPA 4A3YA 3JRKA 3WDJA 4H9VA 1JYNA 1KBJA 1A80A 4B3KA 2G3MA 5HBFA 1XD0A 1VRDA 2QJHA 3T07A 4H41A 1KCZA 2GGGA 3GY1A 3WLRA 1QI2A 4UTFA 1PKNA 3EB4A 2EPOA 1DQXA 3GAKA 2C6QA 2DSUA 3W1MA 3VNJA 1YDVA 4UQ9A 2EJ1A 4NP7A 5M2FX 1LL4A 2IUZA 2DZTA 2HBXA 3LUTA 3QM3A 3CHVA 2HZGA 3OA5A 3AHYA 3VIMA 3EB3A 3P5YA 3GG8A 1HW6A 4JIHA 2WM1A 1FHVA 4AD2A 3VDBA 3HMCA 4HB7A 3TVAA 4NRRA 3QGVA 4DJED 1JZ5A 2PCQA 1KQYA 3MVIA 3WG6A 3MCOA 3BOFA 3WH8A 3AMLA 5T91A 1HKJA 1X38A 4AZ6A 4PTVA 1YW1A 1F9CA 3E0IA 4S2BA 5TAOA 3P61A 3PK7A 3VGBA 4TV5A 2Y5EA 1OK4A 3DBNA 4FNPA 5HATA 1HNYA 3ZVHB 3KE0A 4KW2A 2JALA 1ZBKA 4PB5A 2A3HA 4PGLA 1IEWA 4FOKA 2P88A 3AJ7A 2ACQA 5HWMA 2DQWA 1PB0A 4QNEA 1BWKA 5FD0A 4OGZA 1NH6A 3MP3A 4QITA 3NZQA 4DYEA 1L0PA 3G1YA 4GQ0A 4DUVA 5ABFA 1MXSA 1LUCA 4JTAA 3XINA 3WO8A 1PXGA 1NFGA 4IF2A 3VD7A 1F05A 4WKHA 4AZCB 2O92A 3RF9A 3BGGA 4L65A 3HG4A 1W5QA 3E3HA 3P74A 3NL5A 2EPMX 4HGXA 4JTRA 4HPNA 1T40A 1YPXA 4UTLA 4CEUC 4YXGA 4X0NA 1JPHA 1EEPA 4OKDA 1PKMA 1FWHC 3C2VA 4DUWA 3TQVA 3QF0A 3B4YA 2O55A 2GJLA 2D3LA 1YNPA 2AGKA 3IGSA 4GA8A 2HPIA 1JDDA 4L4MA 1W9UA 1V6XA 3FS2A 3NVDA 4F79A 3S9YA 1CDGA 1F61A 5EMLA 2HK0A 2QYGA 4R7WA 4O14A 4FZIA 3W7PA 1EXPA 3JW7A 5FL1A 4UOZA 5B7YA 4YWIA 5XIAA 1F74A 3VDHA 3VIHA 2VJXA 4LS1A 2AAAA 1I0DA 1QI4A 1X96A 3GXIA 4KFOA 5EBUA 2WZEA 3UWUA 4Q7BA 1J5SA 3EA1A 4J2MA 3ARUA 2PDJA 4DJFA 4GC3A 1W9DM 2X42A 4V1YA 2XIMA 1A49A 3W1UA 5ABTA 3P93A 3DXIA 1W3HA 5CC6A 5JMUA 4FXJA 4B5WA 3F2DA 3PZVA 1RD5A 1HL9A 3ITTA 2BOGX 3T44A 4KF1A 5H2ZA 2QPSA 3B9DA 5BMXA 1UD2A 2DV0A 2G8ZA 2FPTA 1NP0A 4C6QA 2XN2A 4MJMA 2YB1A 1OFRA 3TC6A 4DY1A 1PS9A 1TJ2A 4KGJA 2X8RA 2XIQA 2C8NA 2ZWZA 4PMQA 3W0KA 3OYXA 1HGYA 1T0OA 2QCHA 2ASHA 1OSEA 5HPCA 3IACA 1HJXA 1PV8A 5A6SA 2PTWA 3M5VA 4OTKA 3RAOA 4PEKA 3T2OA 3ABSA 3N9KA 4EXBA 1MQRA 2BXZA 3KDOA 1E0XA 1TRDA 1CECA 3L0GA 1RUSA 3VA8A 3MUZ1 4AIBA 1SR0A 2V5DA 1UKOA 4KKXA 1TJ1A 1FWEC 2VEMA 1DQUA 2Y62A 1BXNA 2P50A 3K2GA 3TWAA 1JCMP 4Z1CA 3GH5A 3ANUA 4YL2A 1KWGA 3W71A 2H8ZA 5CZ0A 4G7EB 3GDKA 3VDCA 1UKPA 4JHMA 4WLCA 3REQA 4FXSA 8XIMA 4ZQOA 2QR6A 1LDCA 4NVTA 4LB3A 3PBGA 2DT0A 1JNDA 4CD6A 5FL0A 4O18A 4BA0A 4GBUA 4AG0A 1KRBC 3SB0A 5HQEA 3SAZA 2DT3A 4U2ZA 3ZT7A 3S83A 5AYXA 1DWHM 1JEZA 4H3DA 2Y88A 2VXNA 3TC3A 1TQJA 4D2JA 2Z1WA 4ECLA 2DQXA 3TCEA 3MDUA 3W1NA 3S3GA 2YXOA 5A3HA 5AZ0A 3THAA 1B90A 3TK7A 3DC8A 4NZ1A 3E2SA 1Q85A 4IGNA 4JHZA 4AHOA 4KCVA 4MAZA 5IOBA 1ZSXA 3T08A 3PPFA 4HHPA 2I56A 3BPWA 3SCPA 4TXEA 5H8PA 4XUYA 2DH3A 5K3VA 1SO4A 1O5RA 4MYXA 1YXCA 4DO6A 5D03A 1C91A 4AWUA 3EWYA 4I6KA 2XHYA 3FJ6A 3W29A 3U8GA 1V6WA 1PAMA 1ZJAA 3VC5A 4R9OA 2J24A 4LUYA 2E09A 4LYPA 4KIEA 3K8KA 4RE0A 2AKMA 2QIIA 3WJYA 2YCLA 4GO9A 3LSCA 1X1OA 3S2LA 1I2PA 4YWSA 3S2NA 3WQPA 3M6YA 1NFPA 3C4UA 3VINA 1D9EA 3CWOX 3TN5A 5DT5A 2XUCA 3WDIA 1OYBA 3L0NA 3LERA 1K4HA 3ABQA 3F5JA 4EX4A 4MNKA 2DEPA 2F9RA 1E6XM 3BV7A 4XO7A 1VENA 3TXZA 2HNEA 4UFHA 3G1DA 2CZEA 2BV9A 1WXZA 3C3NA 1FBAA 2HVMA 3DHFA 1GW1A 3SJ3A 5D2TA 2QGHA 1W1VA 4QJ5B 2WHLA 1KB3A 3ZFHA 3OB8A 3BCDA 2WZIA 4TVUA 5HR7A 3WMCA 2OYMA 4L6HA 3U48A 1AMYA 4IH3A 4IM4A 3W81A 1FP8A 1FCVA 4UTWC 4DI9A 4GQQA 5IBXC 4O1FA 4GUGA 3WD0A 1XWYA 1LM1A 2FGZA 1A5KC 3U5YA 1PPIA 4JQ3A 1OCNA 2ZADA 4QJ4B 2PDFA 2YCKX 1ADOA 5G4HC 1X6LA 1TZ9A 2VFIA 5C9XA 1C92A 4L9XA 2DZSA 2XH7A 4W8BA 2J13A 2TMDA 3VOCA 4ZE4A 3CH9A 3BG9A 1E1FA 3EGJA 3S6OA 1DPMA 1YTKA 4M5PA 1QHPA 4LUTA 4M80A 3R8HA 3T0BA 1HUVA 3UWWA 4N9DA 4OECA 2PA6A 4WF7A 4IP4A 3RUBL 3WD3A 2QDHA 2CLMA 4HNUA 3E2QA 4RDVA 4R85A 3W1RA 3UPWA 3ARXA 2ATMA 3CL7A 3VZZA 1G4TA 1KM0A 1SSGA 1UMYA 2ALRA 1I45A 4J1OA 5LA1A 3TDFA 4N0RA 1MW1A 1UA3A 5HANA 3FFSA 4OQVA 1PE1A 4QP0A 2GGEA 2QAFA 3D3FA 4BJHA 3TTOA 4AMCA 1JAEA 4PMZA 4A2SA 1V0LA 1QVBA 4LCQA 2FIQA 5FESA 1H09A 5CPOA 5G4EA 1A5UA 4LW7A 3TX9A 1REQA 4EACA 1VBJA 3WQWA 3WLHA 3IJ9A 1TMLA 2EBNA 1TO3A 3CC1A 4FHAA 4AXNA 1CXIA 3VOHA 4GJ1A 4V28A 4DN1A 1VHCA 3A24A 3D46A 1XLGA 1I4NA 4F66A 2FDMA 3BMVA 3CUZA 2A85A 1O6IA 2YA0A 2YIHA 3INPA 4NSBA 3KLLA 2ZDRA 1FWCC 3GX9A 1RLDA 2OKTA 5KITA 4A3HA 4LCSA 1LRTA 4W5ZA 3AROA 5CH9A 4UTMA 4NYUA 3NVTA 5JBDA 2ZXDA 1UYQA 1B3WA 3PNZA 3WQ8A 4MWAA 1OC6A 3HPAA 5D8ZA 4YTSA 4UMBA 3BJFA 1AH0A 1PZ2A 2DJXA 2VO5A 2XH2A 3VILA 2PWFA 1GEHA 3STGA 4KGLA 1XLCA 3KOFA 4N4PA 1X7FA 3RLVA 4GIEA 4E8CA 4DIAA 4TX9A 4UZUA 2F7FA 4DO4A 2PDXA 1K8YA 4P7QA 2CWNA 1JIBA 1HO4A 2PC8A 3HN3A 5CGQA 2V2HA 3QXBA 2PDWA 3QGKC 4CQ8A 1HL8A 4I90A 2V0TA 1T99A 5HQLA 2RJGA 4P7RA 3IJDA 3W38A 5GJMA 2OWXA 1ITXA 2C0HA 2GUBA 4X0VA 5JXQA 1YADA 4WY0B 2IMRA 4UB9A 3SFWA 3SSZA 4IOTA 1LT7A 2GDUA 1GVRA 3KFTA 3KVJA 3ITXA 3B8VA 1KRMA 3TJLA 4NZ5A 4E38A 1E6PA 2KAUC 5CC3A 3TTYA 1OFAA 5CEWA 3IRDA 3B8SA 2WKJA 3WLSA 4WXYA 1F76A 3C8NA 3O05A 3G2GA 4W8AA 4LCRA 1IEVA 3A3XA 2OSYA 2Y6ZA 1F6YA 3GWQA 3N2BA 2DVTA 3ALGA 3DGRA 2J6VA 1CGWA 2Y7FA 1QXLA 3WMLA 3U6WA 3OTRA 1B9ZA 3NXLA 1IHIA 1RZMA 4PUNA 4W86A 1K7XA 5A2AA 4GH3A 3M9YA 3SW6A 1HFBA 3H7VA 2CKSA 1DTUA 1YLVA 1MWOA 1VZWA 2GZXA 4C1NA 5HNTA 3CWHA 1XKYA 4ZFCA 1ITCA 1R2SA 4M6PA 4GQRA 2R24A 4RZ5A 5TQLA 2O7SA 1XYBA 3F2CA 4DPQA 3O9NA 3UQNA 1UP2A 4RNHA 1W1TA 2W92A 2CZFA 3BSHA 1EPXA 1EHNA 3HBLA 4EP8C 5GVJA 3N4FA 3RMEA 2YCEA 2FB3A 4LV4A 4NJKA 2VYOA 4N2YA 1D3HA 4MNJA 3MZNA 4CN6A 4FX6M 3P60A 3AHXA 4RDYA 5DLCA 3L2LA 4R3UA 1VPXA 3GDRA 1LOLA 3LCHA 1V4YA 5ABGA 3WBYA 3MWAA 5A8NA 1PX4A 4F0HA 1DHKA 1GHRA 2J62A 1IT7A 1PVNA 4ICNA 2ZA3A 5KSWA 3OOQA 3VOGA 3GBDA 3LD5A 3PSWA 5MKGB 4IX2A 3ERPA 1F3XA 2DSZA 5IM51 4JY9A 3KL3A 1QI3A 1T41A 2FZMA 3E0VA 2WMIA 2OQYA 2JEQA 3A21A 4OBTA 1JG9A 2QJJA 1QHOA 1FHUA 4LV9A 3L4TA 1H7NA 4WEVX 3GHSA 2R9RA 3GVVA 3P7YA 4GYPA 5REQA 3MMUA 2YBVA 2Q09A 3ZJKA 3EEZA 3TQ0A 1V0KA 3VOJA 4AISA 4CVWA 1DJGA 1B30A 3TJ4A 3LHWA 1Q6EA 3U2EA 2X1IA 5GPRA 1S2CA 1R38A 2NVAA 2PGRA 4GGBA 3WEOA 3VMOA 4PMNA 3TYDA 1DIKA 5D9OA 2WQDA 4JX5A 4DNMA 5DN1A 2OWWA 3LCIA 1RVKA 3EA3A 4KFPA 1RCOB 4AD0A 1AJ2A 1JUBA 3I10A 3KL0A 4WK9A 2J8TA 1VGAA 5A6BA 4JICA 2J77A 5FF2A 5IFPA 5FSDC 3EX2A 3CL6A 1CGTA 1IIGA 4GNKB 4U4MA 1TV8A 4O1DA 1EUNA 4KWOA 2YFOA 3GH7A 3QQ0A 4HT3A 3CQKA 1KR0A 2V5BA 2HXUA 3O6YX 4O1EA 3UPMA 3M16A 4C90A 2BY2A 3QGAC 1F7BA 5DFAA 2NUWA 3EAUA 1C29A 2O4MA 1W3LA 1J0YA 4CU6A 4CN1A 4JD4A 4US6A 3R94A 3AXKA 3SBFA 4F0LA 3H12A 1DJWA 3R1ZA 4MFDA 1GK8A 4AXKA 2NX9A 1ZNNA 2V30A 4HNLA 1XYLA 3R10A 2VMFA 3W01A 4EK7A 4LBUA 4DVOA 2DUAA 3OYZA 3RX2A 5FOOA 3PSVA 1QPOA 3EB2A 3ZJ7A 4LS0A 3TMLA 4UNIA 5JH2A 2WZTA 3O3RA 1O1HA 3W23A 1JYWA 1NQKA 3V0SA 1Q8JA 1R3WA 3S6DA 1NDZA 3WL0A 1J8VA 1EL3A 1GTHA 1UWSA 1AW1A 3NQCA 5I03A 1O68A 4MB3A 3G24A 3CBWA 3MO7A 4M82A 3VNZA 1X1ZA 4C6LA 1HKKA 2ATSA 4BCEA 4HCLA 1CCWB 2PDMA 1DKWA 5CXPA 3W6LA 2TPSA 3W7OA 4GRSA 1W8GA 4HA3A 1TWIA 1MDRA 3ATYA 1Y65A 4ICMA 5C55A 4XZLX 1PHWA 1JYXA 3VD9A 3URQA 5RUBA 1XLJA 3R0DA 1J18A 3L4YA 3VD3A 1L6YA 5EMKA 6CGTA 5D9MA 1TCDA 4GD0A 2AKZA 3QY6A 1UD3A 4GISA 3A4XA 4LY4A 2PWEA 4LYRA 3AFBA 4H00A 3M43A 3LBMA 1R9ZA 3HQ1A 1M1BA 3GTHA 3ZVHA 3AJXA 3G0SA 3CNYA 4OBRA 2R8WA 4PBEA 2VVNA 2ZRUA 2J9YA 3OBKA 2W66A 2XGBA 5I23A 1XLFA 2OEKA 2C19A 4MB4A 1EJSC 2HVOA 4S3BA 3ME3A 3FV9A 4K68A 2CBIA 4ZE5A 2VD9A 4DWSD 1WZAA 3IEBA 4ZTYA 1HQTA 5D2XA 4CNNA 4AZCA 4U3AA 2VVSA 4Z1BA 3FKKA 1WDPA 1QTWA 3VNDA 2OCZA 1CLVA 2VC5A 4J28A 2CLKA 4MZ8A 2XIJA 1RLCL 4LQ1A 1WE5A 2DZBA 1ZJIA 3URNA 2I14A 5H91A 3TONA 3B8IA 1GYMA 3PZMA 2WOQA 3CUXA 3ARYA 4A8RA 3TROA 1EGMA 2WW5A 3GB6A 1H7PA 3Q94A 3PZ9A 3BXWA 2CZVA 4LTSA 1OF8A 3CS2A 1BXBA 1HIZA 2WMGA 4PMRA 4YVPA 4DJFC 3A4JA 1TMHA 1H0IA 2FFIA 3TU9A 3GC5A 4A6GA 1WKDA 2QV4A 1N8IA 2C3ZA 1P6BA 1SVDA 2CLEA 1SMAA 2BASA 3GR7A 2QJNA 1T5AA 3NPXA 1CX9A 2A1YA 2FH8A 2VFHA 3FCPA 3ANYA 5A5WA 3IVSA 1XI3A 4CVUA 4LWWA 3RRAA 2VGFA 1P4CA 3AI0A 4QSHA 4J3VA 3P0XA 3P81A 3LM3A 2WO5A 4N6FA 4B5TA 3WH6A 1XIDA 2FJKA 1G1YA 1T96A 5DCBA 1IF2A 3WUEA 2QT3A 5KZDA 3H53A 3T0TA 1DE5A 1KM4A 2F8QA 3UF9A 4Z2IA 3EKGA 3FJNA 2HE5A 1EGVA 4IP5A 5A6KA 4IFKB 2PLKA 5AECA 3QR3A 3NSMA 4FB7A 1QI5A 4Q22A 3T78A 3PF3A 1EXBA 3WF3A 3VUPA 1AUSL 4CKQA 1L8PA 3VIPA 1EJ7L 1S1RA 1LBFA 1ZFJA 3E2RA 1BWLA 2PE4A 1AW2A 2ON3A 4KRUA 3O7UA 5FJPA 3A23A 3BTNA 3N2OA 3V4BA 3ARSA 4FXRA 4H7VA 2Z6IA 4L80A 2BHYA 1R46A 4POCA 1RAKA 2W0UA 1O5KA 3NR0A 4DBUA 3KRBA 2YLAA 4KWWA 3CHEA 5C9WA 1IT8A 1BXCA 1YKWA 2J74A 3GU1A 4FR6A 3OLGA 1WUFA 3VGFA 3KVMA 1EX5A 3HV9A 1NWTA 2A7RA 3PJXA 5JIWA 2Z24A 4G7EA 4RZBA 3PJWA 3LV5A 1A5OC 1JXKA 3AYTA 4AYGA 1FKWA 4AUBA 2YL6A 1TWZA 1ZAHA