3PZ9A

Native structure of endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila
molecule tags Hydrolase
total genus 156
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pz9A00
5GQBA 1JFXA 4D6EA 2G8ZA 5A8PA 3FN9A 4ZE4A 1V3HA 2WANA 3BH4A 3VX0A 4DUXA 2PWGA 2VC9A 3PHAA 2YA0A 1UR9A 1X1NA 1EDQA 3CMJA 2YA2A 2J78A 2PWEA 1DWFM 2WSKA 3WQ5A 1VBUA 2TAAA 2AAAA 2UY5A 4V28A 2VMFA 1WE5A 3GXDA 1TE1A 3PZUA 1Q6EA 1XYFA 1H11A 5EMYA 2E9MA 1UZ1A 2J77A 2YDSA 3PZTA 3VX1A 3WDJA 5A2CA 1XCXA 4WJXA 1IZKA 1G9HA 3AOFA 2CEQA 1OT2A 1W3JA 4LPCA 3BGAA 3NIYA 1CGYA 1ZU8A 2UY3A 2F8QA 2PBOA 1KGXA 3FHAA 1VBRA 1H2JA 3OLGA 1W9UA 1B2YA 1GQLA 4U3CA 3IAPA 1UR8A 1A3HA 1QBBA 3ARUA 1UKOA 1Z32X 3DYMA 4P7QA 1JZ3A 2CETA 1W32A 4D1IA 1RH9A 1HKKA 2EPKX 2XWEA 4NRSA 3VILA 5A6MA 4AC1X 1J0YA 3ARVA 2J75A 3WY1A 2OWWA 1KGWA 2ZX5A 2DT2A 1WAWA 4WKHA 1H5VA 1V08A 5D8ZA 1QNQA 3NSNA 3VO0A 2XHYA 3AIVA 3B9DA 1US2A 1JD9A 2BY1A 5FCZA 1DTUA 2WWCA 2Q8XA 3WUBA 4QLLA 4TXEA 1CGVA 4MB5A 4MPKA 3BAWA 1AQ0A 2YBUA 1BG9A 5CGTA 3SCQA 5A3HA 3FNDA 3MV11 2DH3A 3WMSA 1V0MA 1C7TA 3WKZA 1MXDA 4P8WA 5A8OA 1J11A 1HIZA 1QPKA 4GZEA 1Q6CA 4CCEA 3BXWA 1IZJA 2V3DA 3MSGA 2WNWA 1ISXA 1E55A 3OIHA 1MXGA 3UERA 4CCCA 1JIBA 3PN8A 2XJ7A 4M56A 1XRVA 3CUGA 1JI1A 4CU7A 3WH7A 2UY2A 4W8AA 3AS0A 3GXIA 4F8XA 4GZIA 2RGMA 3AICA 4KGJA 3GBEA 1N82A 2JFEX 3KEHA 3W24A 4DUVA 4A3HA 2BFGA 4TUFA 2OSWA 2JIEA 4HOXA 1ZJAA 4PUDA 1CXHA 1ISZA 1TUXA 3WQVA 1MQQA 4JHZA 5A1AA 1BTCA 1ODZA 5LA1A 3OA5A 3BMVA 3POHA 2WVVB 3AROA 1A47A 1XD0A 4M24A 4DWSD 4WF7A 1WO2A 2WVUA 1ZBCA 1UWUA 5CPQA 2HISA 2YA1A 3KL5A 3WF1A 5TD4A 2YDQA 3OZOA 1FH8A 3O6AA 3PZMA 3AIWA 1E6SM 3AXXA 1M7XA 2ZUUA 3ZJ6A 2GK1B 3I3EA 2D3LA 5KZ6A 3PTMA 1YQ2A 4AZHA 2E3ZA 3L4ZA 4P7RA 2QLYA 3EMCA 4UQAA 1CGUA 1PX4A 3DYPA 1D7FA 4U3AA 2VR5A 3NDZA 3IK2A 3CHFA 3CLWA 3RPMA 5AY7A 2RGLA 3KWXA 5HXMA 1EOKA 1BAGA 1WDSA 1NH6A 2J7BA 2O9TA 2ZUVA 4J3TA 3ARXA 3O9NA 3VINA 1W9BM 2JEQA 4HU8A 2Y5EA 1EO7A 1UWIA 1E71M 3I3BA 1M53A 4Z2IA 4L4PA 4IUGA 2GJXB 3UG5A 3DC0A 3VIGA 1UUQA 3E1F1 2XGBA 3VM5A 1J0JA 5EFFA 4UQCA 2PC8A 3ARWA 3VGFA 4AD2A 2ESCA 2BNJA 1IT0A 4PMZA 1EDTA 3QOMA 2WC7A 2VJXA 1TFVA 1I75A 1E15A 1U30A 3OZPA 3AMDA 2WAGA 1VFUA 3SUVA 1BQCA 3UEQA 1UD6A 1OGSA 5C71A 3SCVA 1E4NA 1J10A 1NOFA 3N9KA 5FOOA 1OCQA 4H41A 3MS8A 1WZAA 3W4RA 1FHDA 1JYVA 4ZE5A 2X05A 5A6AA 5E09A 1QI4A 3AIQA 4WIWA 4HOWA 5IFPA 4Y7EA 3OG2A 4W88A 1JD7A 3VNZA 4GIAA 1ZJBA 2BY2A 4E2OA 4D6GA 5FKYA 2O9RA 3ARPA 4AY1A 4K68A 4AD5A 4HA1A 2A3HA 3UCQA 1KWKA 1C90A 2G3JA 3VGHA 4MJ4A 4M81A 1HVQA 3HMCA 4AZ5A 3CZJA 1GOKA 2VTFA 3AJ7A 1UQZA 2VCCA 1UH3A 4UFJA 1B9ZA 3K4AA 4OUEA 1W3LA 2X09A 2VQUA 1B3VA 3AXHA 1LWHA 1FFQA 1CLXA 1SMAA 4TTUA 3L4XA 2G3IA 5BRQA 1QW8A 3SCSA 1R7OA 2BS9A 3VD5A 1GNXA 1QVBA 3AI0A 3W27A 4JKMA 3WBAA 2O9PA 1X6NA 2ZX6A 4HTYA 4BQ4A 1K9FA 1V6XA 3PTKA 3VGBA 1ITXA 3VIJA 4HMDA 2WHJA 1W91A 4U5KA 4DM1A 3WEZA 3CUFA 1US3A 3VOCA 2GFTA 1QI0A 2WHKA 1NP0A 3CPUA 3WFZA 2ZWZA 4RE2A 4ZXOA 1TMQA 2JEPA 2CBUA 1FP8A 4ATDA 4OOUA 1S46A 3AFBA 4WSKA 2QPUA 2YIHA 3HJEA 2A3EA 3UR7A 5DT5A 2J47A 1V0LA 5M17A 2FHCA 4F79A 1V6YA 1JDDA 4PN2A 2VT0A 4W8BA 4HA3A 4PMYA 2WMIB 2OLHA 2ZX7A 3EYPA 1W1YA 3VMNA 4HMEA 3VDCA 1J0HA 2ZICA 4J3XA 3WH8A 5FL0A 3VGDA 1LG1A 4D6FA 4DWSA 3CZEA 1VRXA 3WEMA 2WPGA 1GJWA 2XSBA 3GZAA 4WKAA 2CKRA 5JBFA 2F61A 1K9DA 4Z2LA 1XHGA 5CPTA 1XV8A 1KXTA 4AZIA 5D9PA 4QP0A 2VZVA 3AMCA 3NCOA 2V3FA 3AHYA 2B31A 4UFMA 2IUZA 5D4YA 4MDOA 5HPCA 1HJQA 2E40A 4IISA 3K1DA 1W3HA 2DT3A 4JFWA 2WZIA 2PF0A 1ITCA 1XGZA 2D2OA 4H8HA 1E3XA 1EA9C 3AS1A 3VIKA 1LG2A 3SEPA 2YKKA 4W85A 3T2PA 5BYWA 5GPRA 1VIWA 2GJRA 1UHVA 2J7DA 1GQJA 2WVTA 3WBEA 1UR4A 3VVGA 3ZJ8A 2OYKA 4RL3A 1B90A 1GZJA 2X2YA 4P8UA 2XM1A 1LWJA 2EJ1A 2JE8A 1PZ3A 2W5FA 1V6VA 1U33A 4AD0A 3RCNA 5CGMA 1BYBA 5FD0A 1VFOA 4BQ2A 1LLOA 1MWOA 4PMXA 4UZSA 4V2XA 4AWEA 4CN4A 1V0KA 3WSUA 1JZ8A 3KE0A 2J8FA 2V3GA 1V0NA 1BYAA 3VUPA 1ZS2A 4UQBA 5DEZA 4QDMA 1BFNA 4PTXA 1C7SA 2BV9A 1WZLA 1MW2A 1MQRA 1WP6A 2EBNA 1GOOA 2FGLA 3EDEA 3B9EA 5LA2A 2E9LA 3BLKA 3AYRA 4KWUA 4M80A 1CZ1A 4HPHA 1LQ0A 1OBAA 1HN1A 4H04A 2E8ZA 2FH6A 1LL7A 4CD7A 4PMQA 1L8NA 3T0DA 4N42A 2AMGA 4PSRA 4QFUA 5IHRA 1UWRA 3B9AA 1PX3A 1E43A 4CVWA 3VMPA 1LL4A 3BCFA 2WC3A 2D0HA 4F9JA 1JZ6A 2WMGA 2VCBA 1CIUA 2YLLA 1HKJA 2BHUA 3W6LA 3U5YA 2YJQA 2DEPA 1UA7A 1M01A 2JIWA 4D6DA 1G01A 2ZUSA 7A3HA 3SURA 2W63A 1UYQA 4MB3A 1PAMA 1M03A 2J79A 1E40A 1KXHA 4AEEA 2VUYA 3ALFA 4AZCB 1UKTA 2X1IA 4X9YA 5I5RA 1MVYA 3ALGA 1ECEA 4R5EA 3VMOA 3TOPA 2YL8A 2QMKA 2JF6A 3CHDA 5A94A 4HU0A 3D3AA 3GYCA 2J8GA 2J7EA 3CHCA 2JF7A 2ZUTA 1KXQA 1DP0A 2DDXA 4AZ7A 5CSYA 3CZLA 1HL9A 3EBVA 1JDCA 4PUEA 4E8CA 3DYOA 1EH9A 1FP9A 1KR0A 3VKKA 3TTYA 5I77A 4GPNA 3TP4A 1E5NA 2YL6A 3WDQA 2WXDM 3LPPA 2VX6A 4W5ZA 3IJ7A 3IJ8A 1UQYA 2G41A 1W3KA 4DWSC 4W7VA 1E6XM 3RM4A 2DT1A 5HPOA 5M03A 5CSUA 3ZO9A 2VX5A 2YOCA 2UWFA 4JAWA 1Q6DA 3AYSA 2VX7A 4HZ7A 3ZOAA 1SMDA 1CTNA 1FH9A 3MUY1 4M29A 3GNPA 5A2BA 1OIMA 4BCEA 1ISWA 2WMJA 2VVSA 2CYGA 3RM8A 1JNEA 1FA2A 4P7OA 2WWDA 3CMGA 4W86A 3WNMA 2YBTA 2WYSA 3RILA 3OBAA 3UG3A 3CO4A 3QHOA 4LYRA 5E0CA 2BXYA 4ZENA 2CERA 5I6SA 2XYLA 3UESA 2WMKA 1DWHM 1DWJM 3ARRA 4URIA 1EDGA 1PEZA 4PTMA 4UZUA 1BYCA 3WD2A 1LL6A 4M1RA 4ACZA 3OB8A 3WD4A 1CEOA 4AIUA 1XSIA 2X0YA 1XD1A 4JL1A 4PMRA 4AZBA 2DH2A 3AIRA 2XGIA 4JIEA 4AMCA 1PIFA 4WKFA 1XYZA 4TVUA 2J7HA 3WENA 3F5LA 1CLVA 2DSVA 1B0IA 1C3FA 1UWSA 2YL5A 5ABHA 2VQTA 5LYRA 3CUIA 4MJ2A 2V38A 3A4XA 3M7SA 4TX6A 4GI9A 2XG9A 1UD5A 3W26A 4M82A 2DQXA 4UR9A 2CESA 4D1JA 3PZ9A 3WH6A 3U7VA 2PBGA 2OYMA 4DUWA 1I1WA 1HJSA 2BHYA 1XSJA 1QHPA 1BSIA 1H3GA 1JZ4A 3AHVA 1UKPA 1OM0A 3WUEA 3N12A 3AZRA 2XVLA 1WPCA 2DGAA 4AZGA 3NDYA 1JZ2A 2D0FA 3MKKA 1E0XA 3EDFA 1F4HA 4ATLA 3CUJA 5M5DA 5A6BA 2CNCA 4KMQA 3L4TA 1OSEA 1AQMA 1V02A 5AC4A 3T0BA 3RMEA 3PZGA 4OIFA 3EMQA 3MV01 2BHZA 4JFVA 3MMWA 5HDRA 4LQ1A 3DECA 1KFWA 2WK2A 3ZT7A 2VRKA 3CBWA 3VU2A 3IAQA 4X0NA 3T09A 1GW1A 3MUZ1 1JG9A 4DWSB 2Y4SA 1HL8A 3VDHA 3ZQ9A 1J01A 1BLIA 3HU7A 5FL1A 3VIPA 1E1FA 4W84A 2WKGA 3OGRA 1TA3B 5BXTA 5A6LA 4E8DA 3BSHA 1CWYA 1FOBA 3RO8A 2Y8VA 2J7GA 1JF6A 5DT7A 4CU6A 2CBVA 1DHKA 2BY3A 4LGXA 5FIPA 1R8LA 4HMCA 5ABFB 4AW7A 3WF0A 3W38A 1QNOA 3WNLA 5I23A 1TVPA 1PBGA 3MMDA 4LYQA 1B30A 3WQWA 4ZEPA 6CGTA 3WDPP 3WQ4A 4UFHA 1FHLA 3WH9A 1B3ZA 1HT6A 1OB0A 1C8QA 2DIEA 5E0FA 1GHRA 2OYLA 3FW6A 4NI3A 5CJ5A 1HP5A 4ACYA 4ATWA 2BXZA 4PCTA 1BYDA 1J0ZA 4S3JA 3CH9A 4PTVA 4U5IA 3N13A 4WLCA 4CGTA 1UR2A 3LPGA 5C70A 3PBGA 3U7BA 1E56A 3LPOA 1GOQA 1W2PA 3PZIA 4CD4A 4BZYA 3PZNA 1EXPA 3ARTA 2UY4A 3TTOA 2E8YA 1XH2A 3F4VA 3GXMA 3QOKA 1RPKA 7CGTA 4D6JA 4B9YA 1CXFA 2YDRA 1QNPA 3TTSA 1G94A 1OIFA 4JHOA 2GUYA 2WZHA 2CHOA 2PB1A 4CD5A 1WDQA 2EPLX 4FK9A 4C7GA 3WH5A 5CXPA 2XWDA 4BA0A 1NWUA 4UQEA 1KQZA 3GH5A 1HNYA 4D6CA 1YHTA 1NQ6A 3N15A 5EB8A 2BVTA 2EPMX 4MNJA 4W8LA 3L4YA 1UG6A 5DF0A 1B3WA 1X6LA 3WDHA 4A4AA 4JCMA 3WEOA 3ZR5A 4MNLA 3SCOA 5DO8A 2CKSA 2J25A 5BXSA 2VX4A 2W66A 1W9DM 1CGWA 2ZX8A 2ZX9A 1PZ2A 4W89A 4MNMA 3ZT5A 1QW9A 1G5AA 3MO4A 4J3SA 4AD3A 5CG0A 4W93A 4JFTA 1E70M 1BGGA 1U2YA 3I3DA 3TTQA 4BS0A 2A3CA 5BXRA 2J4GA 2G4FA 5ABGA 2W62A 4JCLA 3FAXA 2WVVA 5CPSA 3AMGA 1EQPA 1ISVA 5JUVA 3K8MA 4FLRA 5D9OA 4JKLA 3WD3A 2D3NA 1G0CA 3W6MA 3NJ3A 1NWTA 3RJYA 4H8UA 1BF2A 1CXIA 2NW0A 2XFFA 1XCWA 1HXJA 2GK1A 3SCUA 1BPLB 3QHMA 1MW3A 2J74A 3WMBA 1HVXA 3RDKA 5IXEA 3BAJA 1SFSA 1TCMA 5JIWA 4Q22A 3AHTA 3WMCA 2WCGA 5D8WA 5ECUA 4KGLA 2WB5A 1QHOA 1CNVA 1JL8A 1M04A 3AHZA 4BF7A 4Z2HA 5C8BB 1OT1A 2W91A 4H7VA 3SCNA 2ZXAA 1BVZA 1H0IA 5A6JA 5A6SA 5IFTA 2DIJA 1XH0A 1JYWA 4YHEA 1B3XA 1JAEA 4ZFMA 1OGBA 3SCTA 2WLZA 2Y2WA 3IJ9A 1J0KA 4GQRA 4TOQA 1RP8A 2IXVA 1V3KA 5F7UA 1CXEA 1GVYA 1R7AA 4U2YA 2XTKA 1V3IA 3MU7A 7TAAA 3MUAA 2YLAA 1KXVA 1MYRA 1GOWA 2AOSA 4GO9A 4GQQA 1K6AA 3SUSA 1CECA 1OD8A 4KRTA 5A8MA 3W0KA 1EIBA 1H41A 1H09A 3VIIA 4W87A 4FLQA 2Y8KA 1CGXA 3SUWA 4HZ6A 4UOJA 4A3YA 4OJYA 4AZ6A 3T2QA 3AXIA 2PI6A 3WNOA 1E1EA 2VR4A 4QCEA 3AZTA 2VZUA 4U2ZA 4EAMA 1NARA 2WBGA 4H8VA 3TA9A 5A6KA 1HJXA 3SUUA 1CPUA 1BG4A 3S2CA 1EHNA 4R27A 3L2LA 4AXNA 3MSDA 2WKLA 3VGEA 2CBJA 3BAIA 3BAXA 3VD9A 1EHAA 1VEPA 5A69A 1SYTA 3VTRA 1JAKA 1K9EA 2E4TA 3FAWA 2QF8A 1MFUA 4CCDA 2NT1A 4ML4A 3K46A 3AISA 4KRUA 4YPJA 2E0PA 5A6BD 1UR1A 3VIFA 2ZIDA 4CUCA 5E9AA 3OLDA 3S6TA 3G6LA 1AVAA 3PZQA 2QMJA 4D71A 3UETA 4C7DA 1UZ4A 4NRRA 5JIPA 1VENA 2C0HA 4EKJA 5IDIA 4E4PA 1VFMA 1H49A 3ZJ7A 3CZ8A 4NSBA 1TVNA 3AMKA 2WHLA 4W7UA 5JBEA 1WZMA 1JXJA 4HOZA 4QLKA 4AIOA 4RE3A 4NF7A 4Z2KA 1OGGA 2FGZA 1HKMA 3BC9A 2WCAA 2ZWYA 4CU8A 2DSUA 3W28A 2VCAA 3ARQA 2D0GA 4MAVA 4J3VA 1OINA 4CKQA 2VO5A 2CPUA 1JZ7A 1P6WA 3W29A 1HJUA 4CN6A 3VM7A 2DSKA 2XIIA 1V02E 1GQKA 4JFUA 2FHBA 4PMNA 3VD3A 3WF3A 2WMFA 2VZSA 2GDVA 3WDIA 2W4XA 2EPNA 4TVCA 4WSJA 2GSJA 3ARSA 3FY1A 3A4AA 3AMLA 1E5JA 3ZSSA 3L4UA 4UCFA 2ZXQA 5GNXA 1WDPA 4WK9A 2WLYA 2ZUNA 2WMIA 4J3WA 1J0IA 1PJ9A 1ZB5A 1UD4A 4QCFA 1E6PA 1QI5A 3K8LA 5E70A 4UOQA 3GDBA 1WB0A 2V3EA 3NSXA 3VGGA 4MADA 3NUKA 1KBKA 2CHNA 1O7AA 1XH1A 1TG7A 1HX0A 2A3AA 2WSPA 1CXLA 3WF4A 3L2MA 3WF2A 2YL9A 1W9XA 1GONA 2QPSA 3HN3A 2VI0A 3SCRA 1ODUA 4B9ZA 1H0GA 4JZ5A 2O92A 1NOUA 3WFLA 3BAKA 3J7HA 5BRPA 1V6UA 1BGAA 2BY0A 2FHFA 4JKKA 4AD4A 1NM9A 2PWHA 1ZBWA 3BLPX 4L4OA 3M46A 3ZT6A 3ZIZA 3EDDA 3UG4A 3WIJA 4U31A 5ABEA 3QR3A 1I1XA 3GXFA 1LF1A 4GI6A 3SCPA 2CIPA 3GH7A 4KH2A 3U5UA 3N1AA 1KWGA 1HKIA 1GJUA 3NSMA 1E3ZA 3ZR6A 1Y7VA 5A95A 3ZJKA 1CYGA 4XV0A 4J3UA 4UFKA 4W7WA 3ARZA 4HZ8A 1PPIA 2WMHA 5HBFA 1J12A 4M8UA 2VNCA 4UQDA 1Q6GA 3A3HA 1ISYA 2ZOXA 1W9PA 3AIUA 1Q6FA 1R87A 3PZVA 3BCDA 1VJZA 1JNDA 1VEOA 1C93A 1CXKA 2MANA 3AIBA 1E4IA 2WCSA 3A47A 3BAYA 3CHEA 2CCRA 1E9LA 4ZXLA 2WZEA 1DWGM 5I0DA 4FF5A 4PYSA 1J18A 1V3MA 1B31A 1J9YA 1GOMA 1CDGA 2X8RA 9CGTA 3CZGA 4UNIA 5M3WA 1QI3A 2XVNA 2D20A 1WDRA 1QOXA 1IV8A 3KL0A 2G3NA 3L4WA 4W5UA 1UD2A 1C8YA 4P7LA 4U33A 1Q4NX 3ZMRA 2OWCA 1HJWA 5CQ1A 2OWXA 4DM2A 4IPNB 3THDA 2IXUA 1JXKA 3UR8A 1KCKA 4HP5A 3T0AA 4IPLA 5EFDA 3VNYA 1KR1A 1UH4A 2OSYA 3OGSA 5I2UA 1UOKA 4MNKA 3O2LA 1MW0A 2NSXA 3DHPA 1HF6A 4MDPA 3TONA 2X0HA 3SIMA 2V5DA 3FXYA 1ESWA 3MMUA 3L4VA 2C7FA 1W9VA 1W1VA 4J7RA 2VL4A 3WNNA 3WL0A 1V3LA 4FLSA 5I79A 4UTFA 2FDMA 3KZSA 3T08A 2W92A 3IANA 4UOZA 3CUHA 1WKYA 2GDUA 3CTTA 4GXPA 1E4MM 5GNZA 4F9DA 1GOIA 5IHSA 1D2KA 5D9NA 2D22A 3M07A 4B15A 4BQ5A 3VD4A 1WZKA 1ZBVA 3WDRA 3WNKA 2D1ZA 3WD1A 1TZ7A 3KL3A 3AIEA 2XSAA 4IM4A 1L0PA 4FLOA 4AZCA 1W2VA 4JFSA 4CVUA 4MAZA 1VF8A 1QBAA 4Q7NA 2WVSA 1GHSA 3NYDA 2EPOA 1KCLA 2ZUMA 3F5JA 1E6RA 3D5HA 3N04A 3F5KA 3VDBA 3PTQA 2WM0A 2W67A 1JGIA 1XC6A 3RIKA 3W81A 5JBDA 5E6ZA 2CITA 4X0VA 1CBGA 3AHXA 4PMVA 3WELA 1GCYA 4MB1A 4S3KA 4JL2A 4EK7A 2Y24A 1E6QM 4FMVA 2W61A 1VEMA 4XUYA 1JZ5A 2J7CA 4Z2GA 5LA0A 5DFAA 3WL1A 2VVNA 2NT0A 4LXFA 1ZBKA 5BWFA 1C8XA 1NP2A 3GM8A 4PMDA 4OKDA 4XB3A 2GJPA 3N17A 1GPFA 2DPEA 1ZL1A 3DHUA 1UR0A 3OGVA 3MUIA 1MFVA 3AQUA 1C92A 2ZUWA 1PIGA 1UA3A 2VZTA 4OBSA 1UWQA 4RE4A 5CZKA 4TX8A 4B3LA 3THCA 5AYBA 5HOSA 4MTVA 3ZM8A 2F2HA 2EXOA 4GKLA 4F66A 1CGTA 2ZXDA 3W82A 3W37A 3K4DA 1K9TA 1JYNA 1E4LA 4CD8A 4D6IA 4EANA 2OSXA 1CENA 4YHGA 3WUGA 4OOZA 1UD3A 4CN1A 4J28A 2XUCA 3WNPA 3VIMA 1LJYA 1WCGA 2DT0A 1V3JA 4Z2JA 3GTNA 4HA4A 1V6WA 1AMYA 3APGA 4TVDA 1FFRA 2GVYA 2Z1KA 1KBBA 4GZJA 5A8QA 4TTGA 3BMWA 2XVGA 3JUGA 1E6NA 4J27A 3A6OA 2JALA 5I24A 1E6ZA 1AQHA 5EBAA 1VFFA 5CLWA 4XX6A 1VB9A 4B16A 3LPFA 4GI8A 6TAAA 3B8SA 4AISA 2VRJA 3VIHA 2G3MA 3PZOA 1EGZA 1HP4A 2V5CA 4P8VA 1D3CA 2HVMA 4AYSA 4H2CA 3EMZA 4C7FA 3G6MA 1OD0A 3CGTA 3EDJA 1RD6A 3CZKA 3K8KA 2BVYA 1W1PA 3RJXA 1NWSA 4V27A 4B3KA 1UD8A 3WQ6A 4UFIA 1BVNP 2XVPA 5GNYA 2PWDA 3WD0A 3WQ8A 8A3HA 2PWFA 4OBRA 2QV4A 1V03A 1SR0A 1VJSA 1C91A 1TR1A 1H1NA 1MQPA 2DSWA 1MW1A 2VURA 4QAWA 3SUTA 5KEZA 1R85A 2XFYA 1QNRA 4UFLA 3N18A 4P8XA 1JDAA 2WHMA 1EQCA 1QI2A 3WUFA 4PMUA 4PEEA 3VPLA 4XZBA 1UKQA 3OLIA 1E0WA 2J62A 3OLEA 1DWAM 4PMOA 1JF5A 1GQIA 1UWTA 2BVDA 2CBIA 5AYIA 1OWQA 5E6YA 3AS2A 2XVKA 5BCAA 3ARYA 1TA3A 2ZE0A 1KGUA 1NOWA 2XPKA 4LYPA 2J7FA 2GJXA 2QHAA 2XFRA 2VOTA 3CIVA 4N0RA 1E0VA 5A2AA 2A3BA 2EO7A 1EOMA 1DEDA 4NZCA 1KB3A 2O9OA 3AS3A 3WN6A 5BXPA 2Z1SA 2WC4A 3EDKA 5ABFA 1QNSA 4D72A 1R86A 4D6HA 4YN5A 1O6IA 1PX8A 3N11A 1DWIM 5A8NA 3GNRA 3FHQA 4OZOA 1BHGA 1GUVA 3GBDA 5I3DA 1E72M 1VAHA 3A4WA 3AZSA 5AC5A 1JI2A 4BQ3A 1JYXA 3II1A 1G1YA 2EQDA 4CD6A 3T2OA 3GNOA 5I78A 2DSZA 4QLJA 3BSGA 3ECQA 4HPGA 2VRQA 1E73M 2XIBA 4EE9A 3VIOA 5D9MA 2D24A 2C8NA 6A3HA 4PTWA 1FH7A 2E9BA 5HNNA 3RM9A 2WBKA 5BROA 1NWRA 1UH2A 3POCA 3VD7A 4AEFA 3MANA 3W25A 1XSKA 4AIEA 4ACZB 5DMYA 1W1TA 1GORA 1HJVA 4PBGA 1F4AA 3SCWA 4LX4A 2CXGA 4GO8A 1KQYA 1B3YA 1QHZA 3U57A 5CLTA 4PRWA 2VZOA 4MB4A 8CGTA 4P7NA 4AD1A 3VDAA 1WNOA 2EEXA 1H4PA 1RP9A 4UQ9A 3GH4A 2ZXBA 3QHNA 2XM2A 3LMYA 1B1YA 1EO5A 3QGVA 3ZSTA 3W53A 4XZWA 4PSPA 1GVIA 1UKSA 2WW5A 4GINA 4PCSA 1JFHA 3M6DA 2D23A 2FH8A
chains in the Genus database with same CATH superfamily
5GQBA 1NF7A 2BX7A 5A8PA 3G1RA 3EB4A 1Z89A 1Z41A 4JY8A 1V3HA 1FXPA 3QZ6A 4Y9NA 1Q6LA 1P0NA 3B0VC 3LM7A 1NFPA 4JIPA 4NJJA 4OWGA 3WQ5A 5AYYA 4NIRA 1N8FA 4KS0A 3P6LA 3C56A 5T26A 2VMFA 3V36A 5C9RA 1EGVA 1WE5A 1XYFA 5EMYA 4FB7A 3VX1A 1S5MA 5REQB 4QNEA 4ZVJA 4H9UA 2CEQA 3NQVA 1W3JA 1IQ8A 1KNWA 4LPCA 1T0OA 4GYPC 4LUTA 5HNRA 1CGYA 2PBOA 2VC5A 3I6EA 1AH3A 1KGXA 1KFKA 1WQ5A 1LQAA 1DTNA 1W9UA 2Z7KA 1EPXA 3C3UA 1GQLA 3CH0A 4U3CA 3IAPA 1GKRA 4M6UA 3ARUA 3LU2A 4J4KA 2YCKX 2XWEA 3I68A 2WO5A 4B5TA 2AQVA 3LK6A 4G1KA 4N9DA 4OQVA 2OWWA 2QGYA 3M4HA 1KGWA 1LOLA 5D8ZA 1QNQA 3LLFA 5FF0A 5LIYX 3RYSA 3DFPA 5IRPA 4H9MA 3KBSA 1QU4A 5FCZA 1RA5A 5DXXA 3EB3A 3UWYA 2E5BA 3N29A 6REQA 1DXEA 3C2EA 3TEVA 2D2JA 3PG9A 4Z1BA 2E28A 4MPKA 3BAWA 4X22A 1SSDA 4XKYB 1AQ0A 2HBXA 1T8QA 3VZZA 3RCYA 2DH3A 1V0MA 2OZTA 5G5IA 4Q8VA 3WKZA 1J11A 1HIZA 3QC0A 1GYLA 1Q6CA 1IZJA 2V3DA 3TMLA 3E96A 3OIHA 4CQ9A 1YXDA 3UERA 4Z17A 3W84A 3L5MA 1TJ1A 2QW5A 3GNXA 4CU7A 2VKZG 3WH7A 4X9SA 3GXIA 2ZA1A 5LGZA 1KM2A 4GHRA 5CAKA 2GL5A 2VFEA 3AICA 3GU2A 5I3IA 3DFHA 3QY6A 4JOMA 3P82A 1GVEA 1AG1O 1F8IA 5FAJA 2BFGA 2W27A 1XG3A 3KVLA 3TJLA 1BWLA 4PUDA 2Y7FA 1FCQA 3W23A 5A1AA 1J5TA 3POHA 1J5SA 3QMSA 4L65A 4DWSD 3HQNA 3P5ZA 4WF7A 3BZGA 1ZBCA 5CPQA 5AC6A 3S1XA 2HISA 2YA1A 3WF1A 4NYYA 3OZOA 5M1TA 3R25A 1E6SM 5E0KA 3AXXA 3W7KA 3ZJ6A 2ZUUA 2GK1B 3U9IA 1XYBA 4IJCA 3SR7A 2XINA 5KZ6A 3PTMA 4QJ3B 4P7RA 2QLYA 2VWTA 4AU0A 4EXQA 1JCJA 3L23A 3PG8A 1D7FA 4WOZA 3TAOA 1I2RA 4ZMGA 4JTAA 5AY7A 1PTDA 1WXJA 3QYQA 4MYAA 4IHCA 5HXMA 1EOKA 1XICA 2C6QA 1TRIA 1LLZA 2ZUVA 1KFJA 4IJRA 3T05A 4QTGA 1ADDA 2D2GA 4JTLA 3CEUA 3RMJA 1M41A 4IQEA 3NQ2A 3DC0A 4H01A 2C71A 3W83A 3HO8A 4G5DA 2GVGA 1W3IA 2YGYA 4B91A 4GC3A 1E1CA 3HGSA 1FKWA 5FJOA 3RR4A 4RW3A 3L0NA 2IQTA 3ARWA 3CQHA 2NUYA 4H7CA 3GFXA 1IT0A 5D05A 3LSCA 1S5VA 1XFBA 4JIQA 1I75A 2QUUA 3OZPA 1LBLA 4Q6XA 1VFUA 4DI9A 4E8GA 1E4NA 3SQLA 5FOOA 1OCQA 3MDUA 2YW4A 4ZQRA 3H6OA 4IMCA 1JYVA 1XLCA 4Q4QA 4GVFA 1FWCC 4HOWA 1KM5A 5CZ0A 3EA3A 5DBTA 5D02A 4GIAA 4E2OA 5FKYA 1OADA 3M0ZA 4HU3A 1YTKA 2PWVA 3ARPA 4AD5A 2TRSA 2A3HA 3UCQA 2C14A 2YXGA 3LEPA 4MJ4A 4M81A 1HVQA 4MY1A 1BSLA 3VOHA 1QO2A 5LIUX 1GOKA 3AJ7A 1UQZA 4KT2A 4OUEA 1DIDA 4KEUA 3TR2A 5KSWA 1EL3A 1FFQA 1CLXA 4NJGA 4TTUA 4YIWA 3BG3A 2G3IA 4WY0A 1R7OA 1H7OA 1DHPA 1QVBA 3AI0A 3STPA 1RVKA 4M51A 3N73A 2J6XA 1KKRA 4GQGA 3HGRA 1ITXA 3QRHA 3NGJA 2IW0A 4HYVA 2FMOA 2WHJA 4DM1A 3SRKA 3WEZA 3W2KA 3EB2A 3HF3A 4ZXOA 1K8XA 2CBUA 4GUJA 2NV9A 1S46A 1V0LA 3DKJA 4V1XA 3THUA 5I00A 2ZICA 1GWJA 3TYCA 3WQFA 1AUSL 3WO8A 2PGWA 2NX1A 3F1QA 1GGOA 1GJWA 4GXMA 8RUCA 2CKRA 2A6LA 4A6GA 5KINA 3H55A 1VIZA 1E0UA 3I6RA 2V69A 5CPTA 1XV8A 3EA2A 5LSMA 3FSUA 2G5WA 5D9PA 4MZ1A 1ZCCA 3NCOA 2DQWA 1GT8A 1IGWA 4GIYA 1EXBA 2V3FA 3W2UA 3WQCA 5CG7A 3W2NA 5D4YA 4QITA 1DJXA 1HJQA 4IISA 1VGAA 3K1DA 3UY8A 3GFYA 4QEHA 3HPSA 5H91A 4EF8A 2XN2A 4H8HA 5LXXA 1E3XA 4WUIA 3SEPA 1JCMP 1S38A 7TIMA 1TPC1 1Q6OA 2H9AB 5GPRA 2P76A 3LTSA 4LCRA 3RLGA 3AWOA 2OYKA 4RL3A 4P8UA 3VNJA 1XINA 4QIUA 2NQ5A 2JE8A 1PZ3A 2X41A 3A12A 4S23A 2BOFX 1V6VA 3EPMA 1XS2A 3RCNA 5FD0A 1VFOA 4BQ2A 4GIRA 4V2XA 4IG2A 4AWEA 4CN4A 1JZ8A 1GTEA 2ALDA 2V3GA 4LAZA 3W2MA 1E0TA 3P8JA 4L9XA 2YCEA 3H53A 2VD8A 2BV9A 4DBSA 4HPJA 1MQRA 3NL2A 1WP6A 3G24A 3KFTA 3NVTA 2FGLA 4FNRA 2QULA 4DRSA 6TIMA 5F2LA 4JTCA 4KWUA 3GTIA 3F2CA 4DJFC 4NZ3A 1OBAA 3TFXA 4IPIA 3AYVA 3WJWA 4RXGA 3USZA 4CCZA 4PC8A 4PCNA 2AMGA 5XIMA 3B9AA 7REQA 1EJWC 1ZHAA 1DJIA 3WBXA 1HO1A 4S3DA 3DBNA 1CIUA 2ZDSA 4XZIA 3U5YA 2YJQA 2DEPA 1TZ9A 1M01A 2JIWA 4M1BA 2ZUSA 4XZLX 2W63A 2ZZ1A 2PLMA 4MB3A 5LNSA 3TMQA 4JYDA 5MHBA 2J79A 4F0KA 2D73A 1DXFA 2Q8LA 1R3SA 4AEEA 3INPA 2VUYA 3ALFA 3UA3A 3N2OA 1QT1A 4UTHA 3H12A 1ECEA 2JQXA 3U2OA 3ITGA 2YL8A 2REQA 3D3AA 3FEQA 4XZHA 3HPZA 4FO4A 2BXVA 1J8VA 1QUMA 1Z44A 1KXQA 1DP0A 4PR4A 4HNNA 3CZLA 1HL9A 4B4FA 5CCZA 1FP9A 4DF0A 5I77A 3PPHA 1XG4A 1N7KA 2XIJA 4PB5A 2CLEA 3WDQA 2NX3A 2ZC8A 2Q3OA 3SRFA 1JCXA 2R1PA 3DOPA 1DE6A 2GGEA 3OYXA 1UQYA 4QHRA 3TJXA 4E3TA 1W3KA 3R6IA 4DWSC 3GKFA 2PDWA 3SFWA 4L1GA 1RAKA 1P6BA 5HJXA 4FA3A 3CL6A 4LNYA 2C1IA 4Q4KA 4NP7A 3ZOAA 1A3WA 2VEFA 3NXFA 3QTGA 5D09A 1FH9A 4M29A 3H2EA 4XISA 4C6LA 3HM7A 5K4ZA 4BCEA 1WAUA 2V67A 3CV6A 2CYGA 1F74A 1O1ZA 4P7OA 3WNMA 3TW9A 3UG3A 3CO4A 2JKEA 3SO7A 1S5NA 3OTRA 4ZENA 2PSNA 1UBSA 1AW5A 1N55A 4NHVA 1DWJM 4R88A 4JS3A 4PTMA 4UZUA 3LRMA 1V5XA 2VDHA 3SN0A 3C0SA 1RCXB 3S1VA 2OX4A 4UR7A 1XSIA 4QQ3A 4JL1A 1QOPA 3O15A 2YZ5A 3KP0A 4WDUA 3UVIA 2Q6ZA 3L66A 1XYZA 4TVUA 2DSVA 1X38A 2NVCA 3T4WA 1UWSA 4INFA 5ABHA 2VQTA 1XGEA 1VBGA 5TBOA 1H63A 2CFFA 3CUIA 3NZGA 4MJ2A 3A4XA 4MWAD 3M7SA 4Y6GA 4O8AA 3W26A 3PSVA 4UR9A 3GB6A 3PZ9A 2KZHA 3VC6A 1Q2SA 7ODCA 3IJLA 1B5TA 1XSJA 4H6EA 3BTNA 3WLIA 2CW6A 3N6HA 1UKPA 4AX6A 1FX6A 4S1FA 1WPCA 2DGAA 4AZGA 3NDYA 1JZ2A 3MKKA 1E0XA 4LBRA 4ATLA 3UYIA 3CUJA 4BFAA 1AQMA 1V02A 5AC4A 2QYGA 1JPDX 3EMQA 1Z69A 1CCWB 3DECA 3CBWA 2H90A 2C91A 3O7UA 4Y9PA 1EF3A 3MI2A 3N34A 1JDFA 3MUZ1 3W75A 4DWSB 2Y4SA 3VDHA 3ZQ9A 3LRLA 2HK1A 1E1FA 3OGRA 2C18A 3MHFA 4S2CA 3RO8A 3HPXA 4JQAA 1VPYA 4L80A 2YW3A 3TYDA 1UP2A 4HBKA 5AZ0A 1DHKA 4JQ4A 2OOGA 3FGCA 1Y0EA 1ZQ5A 4HMCA 2OGYA 3W38A 2QCDA 3TDFA 4LYQA 3WQWA 4HB7A 1XW8A 5L6UA 3SSJA 3WQEA 3V5OA 3E6EA 1B3OA 3OQ8A 3HTWA 1XIJA 3U0HA 1C8QA 2DIEA 5CJ5A 4NI3A 3M5ZA 2BXZA 2PPGA 3OJGA 4PCTA 1BYDA 3UWWA 3N13A 3PJUA 4CGTA 3H2AA 3GAKA 5H8MA 3LV5A 1E56A 4RKAA 1F3TA 3PZIA 4BZYA 1YBQB 5HULA 3PZNA 4E38A 2E8YA 1PO9A 4XZMX 1KLZA 3NM1A 3F4VA 2QIWA 3GXMA 5CC3A 1BXNA 1RPKA 2AQOA 2XSXA 4B9YA 1LYXA 3VYLA 3VE9A 4X2PA 4C6DA 1GVOA 4YLWA 2OPJA 4C7GA 3WH5A 3PF3A 3C8NA 4BA0A 5HQLA 1NWUA 1EPVA 4UQEA 3A9BA 1KQZA 1HNYA 1KO0A 2NXHA 4W8LA 1UG6A 4RV3A 3WEOA 4I3GA 5FF2A 5SWUA 3LGEA 4P5UA 2FGBA 1CGWA 3QGKC 2ZX8A 1F6PA 1PZ2A 3Q58A 4RDVA 3MO4A 1Z42A 3MBDA 1S2AA 1DPMA 2VC7A 4KEZA 1GYMA 3TTQA 2A3CA 1SSGA 3LCWA 1K7FA 4MM1A 3FAXA 2WVVA 3AMGA 4XK2A 3TQPA 1EQPA 1H7WA 4R7JA 3KOZA 4D8ZA 1OFRA 3K8MA 3LZ3A 5JQ9A 3W6MA 3CPGA 4KEMA 1VCGA 3RJYA 4H8UA 3NQAA 1PVNA 1CXIA 4AWSA 4R85A 2NW0A 4EWJA 2J74A 3L12A 3CK5A 1AMKA 1JGMA 1M9HA 1SFSA 2Z2BA 4AIBA 3U4AA 3GS6A 2WCGA 4FS9A 5D8WA 5ECUA 5BZAA 1L6GA 4ZOBA 4NU7A 1DVJA 1JL8A 3AHZA 4BF7A 3ITVA 5HWJA 4XQ6A 1S5WA 4DLFA 1BVZA 1H0IA 4RZ5A 5A6SA 2GLKA 3T55A 1ONRA 2OELA 3ZYZA 1B3XA 4UMBA 4ZFMA 1OGBA 3L0GA 3SCTA 3IJ9A 2VYOA 4TOQA 1RP8A 1NAL1 2IXVA 1GVYA 1YPXA 4U2YA 1A3XA 1V3IA 3MU7A 3KDNA 3TV8A 3GDTA 4N6EA 1Q7ZA 4GQQA 1TREA 1K6AA 2ACQA 2F84A 3GC2A 3LGGA 4L9YA 3LCXA 1VD6A 1OD8A 1V77A 5JH2A 2GGGA 4XZNX 4DNHA 3T42A 1CGXA 4YU1A 3G1HA 4AZ6A 1REQB 1V7YA 3HOJA 3IWPA 2DIKA 1H60A 4EAMA 5G1TA 1K6WA 3N3MA 3TA9A 1NSJA 2PZ0A 1CPUA 6XIAA 1LUCB 5JU6A 4PB4A 4AXNA 4J35A 1FVPA 1EX1A 2X1RA 4N4QA 1IEVA 3SSZA 1GZ1A 1GYNA 3VD9A 1VEPA 2RAGA 1SYTA 4R7WA 3IPWA 3LRKA 3QQ1A 1QXLA 1W31A 3FAWA 1XDJA 1MFUA 4Q32A 3RU8X 4HMNA 1YNPA 3ISIX 3AISA 1GG1A 2E0PA 2GUUA 4R9XA 5E9AA 3BW2A 3TK7A 3PZQA 1KLYA 2OQYA 4ASTA 3QGAC 1A53A 2HSAA 5JIPA 4A2SA 1VENA 3HQ1A 2C0HA 4FI4A 1FWEC 1N8IA 5IDIA 1QRQA 3CZ8A 3ANVA 1PCWA 2NSOA 1S2UA 5EA9A 2WHLA 3BLOA 5JBEA 1RALA 1D8CA 2DUAA 4IMAA 4LUSB 8TIMA 4QLKA 4S3AA 3WZ0E 3WQGA 3LLDA 4WSHA 3N9SA 3KDOA 4MAVA 1OY0A 2CPUA 3KCOA 4R7OA 2EG6A 3UBPC 3W29A 3A13A 2PFHA 3P3BA 3GX9A 2DSKA 4GNJA 1GQKA 4JFUA 4I8DA 1WDWA 2TYSA 5LIKX 2VWSA 3WF3A 4JX4A 3WDIA 3M0HA 3TN5A 2VC6A 4BWLC 3ARSA 2ABBA 2Y1HA 1W6TA 3ZSSA 3L4UA 2ZXQA 1WDPA 4AYGA 3QV9A 3T81A 2WMIA 4J3WA 1J0IA 3JS3A 4IMGA 2DVTA 4XO6A 2I5IA 1P4CA 1YDYA 1QI5A 1YNQA 2ACRA 4UOQA 3GDBA 1WB0A 2XIMA 3SADA 4MPQA 5H1WA 5KMYA 2GDQA 2VFIA 4KCUA 3NUKA 2CHNA 1XIFA 4A05A 1CXLA 2PP3A 3S2NA 3AALA 3HN3A 3DKLA 4RDWA 1ODUA 4G56A 3VC5A 3HQPA 3W7NA 1BGAA 3EX1A 2BY0A 3K5XA 1Q3NA 3BLPX 4L4OA 1GW9A 2ISDA 2VD9A 3DFYA 3UG4A 4UTIA 4UNKA 3GXFA 1QOQA 1LF1A 1OFPA 5HMDA 4GZ7A 4QISA 2IQ0A 3GH7A 3U5UA 4N4PA 3L2IA 4FALA 3N1AA 1GJUA 1F2JA 3NSMA 1Y7VA 1UCWA 4XV0A 3DGRA 2NQ9A 4YTRA 3ARZA 1KCZA 3A24A 1A50A 3QY7A 1PPIA 3UU0A 4RNHA 3LZ5A 2VNCA 4Q8PA 2D2HA 4D2JA 1M7OA 3NWRA 1W9PA 1SVDA 2YR1A 1R87A 2O4MA 3M0IA 3BCDA 1XPYA 2MANA 4GA8A 3AIBA 2WCSA 3BAYA 5K9CA 1JJKA 4REQA 3OYZA 2CCRA 3CUZA 4B5NA 1H5YA 1W8GA 2KX9A 1J18A 1AZ1A 2O4QA 5M3WA 1Q6RA 1YX1A 5FA5A 1L9WA 4OU1A 3LNPA 4NL1A 4PEKA 4LOCA 4NXSA 2Z7GA 3P8IA 1S1RA 3JZUA 3TSBA 5CBBA 4C1NA 2ACSA 2Z25A 4HYRA 3QV8A 1A5NC 4R3UA 1HF6A 3CL8A 3SIMA 4YJ5A 2V5DA 3CYJA 1ESWA 1Q7QA 2C7FA 3M5YA 4Q6JA 1W9VA 1W1VA 4QDPA 1Z48A 3RR1A 1V3LA 3VKCA 1K70A 4HKPA 2X40A 3MW7A 3N3TA 2FDMA 3T08A 3IANA 4UOZA 4MWAB 2GDUA 1THFD 4K37A 4EP8C 3O0KA 2VDIA 3B0UX 1EP3A 3H2FA 5I07A 1D2KA 4NVTA 5D9NA 3IIPA 3BE7A 1TTQA 4NZ5A 1TZ7A 2F38A 3AIEA 3P60A 5HJYA 3E0IA 1YKWA 1AD1A 4FLOA 4AZCA 1W2VA 2I56A 4H6QA 3W1PA 2Y5JA 4O0KA 4O15A 3MKVA 1VZWA 2EPOA 3F5JA 2FZDA 3VDBA 4DBUA 2WM0A 5EGRA 1NY1A 5E6ZA 3S5SA 3MP3A 4GVHA 1CBGA 5EBUA 3AHXA 1GCYA 1HFBA 4KF1A 3W7CA 1XIDA 2Y24A 2PAJA 3AAMA 2WSYA 5DELA 2A2IA 2V5LA 3UT0A 3WL1A 1GPWA 3KAOA 2NT0A 3IIXA 2DFAA 4JTHA 3AJXA 4XB3A 1KM4A 2GJPA 1SU5A 3HV8A 1GPFA 5EYWA 2DPEA 3Q67A 1YIXA 2VR2A 4XKYA 2R14A 3MUIA 3I10A 3AQUA 5IM51 2X16A 4OV9A 4I6VA 2VZTA 3KCJA 4B3LA 5CBJA 1KM6A 4J2PA 3ZM8A 4OTKA 1K03A 3B4YA 2FZMA 1LRNA 4GKLA 3WJSA 3K4DA 3C0QA 4RPPA 4ZQMA 4U28A 3N4FA 2OSXA 3G0SA 3S9IA 1S5TA 3M0MA 1UD3A 4GFSA 4JN7A 1NF0A 3O63A 3OBKA 1LJYA 1WCGA 4J9JA 1V3JA 1V6WA 1SO6A 4S3CA 2Z1KA 4IFKB 2HZGA 4MIMA 4ZZ9A 2JALA 1NEYA 2QCNA 3TN4A 3ES8A 1XISA 4FXRA 2FB3A 5EBAA 4N7QA 2PDYA 4LT9A 1EUAA 4O10A 2VP8A 3CV2A 3MB9A 1XCFA 3LPFA 4GI8A 3BPWA 1EWEA 2G3MA 2TPSA 4XSMA 1I2NA 4LVGA 4P8VA 1VFTA 1AA1B 3UW6A 4GYPA 1SQ7A 3EMZA 3CGTA 1RD6A 2AKMA 3K8KA 4J1OA 1UD8A 5K3VA 3T40A 2FVKA 4D9PA 4UFIA 1BVNP 3WQ8A 2QV4A 3N4EA 4MUZA 1TR1A 1JUBA 1H1NA 2DSWA 2VEGA 1MW1A 1SZNA 4FOJA 3HJZA 1DIOA 3EX3A 1R85A 5T9CE 1JPHA 3MCNA 3RX3A 5CSRA 2LLEA 1JDAA 3RF9A 2WHMA 3UZXA 4FIRA 4B90A 3VI2A 2XFWA 2ZRVA 2F6UA 3WUFA 4PMUA 1EJRC 4JQ1A 1CT5A 2J62A 5CKSA 1UWTA 3W7JA 5D04C 2OEKA 5E6YA 3NG3A 4ZGYA 4MFEA 3UFYA 3BICA 1GKQA 1TA3A 4O16A 3CIVA 3MO7A 3MZNA 4F4RA 1ML1A 4N0RA 1E0VA 2YCIX 5A2AA 3U2ZA 4JGDA 2I5QA 1DV7A 1EOMA 3E2RA 1ADSA 1KB3A 2O9OA 2PP1A 4KW2A 3U8GA 2Q8ZA 3EDKA 1OX4B 4LBSA 3IVUA 3GHTA 5KTLA 1ZAHA 2ALRA 5K2ZA 4YN5A 3KXQA 1O6IA 1WKDA 3N11A 4K3ZA 5JVLA 4XAPA 2CWXA 3LM3A 5A8NA 4XO7A 5I3DA 3N6QA 2GVLA 5EU9A 4BQ3A 3O05A 5AHFA 1OJXA 1JYXA 1TELA 3CAQA 2PRHA 1EJSC 3KLLA 3STFA 2DSZA 4HPGA 4QGCA 1ECQA 3VIOA 4S38A 5D9MA 3ZVIA 1TCDA 1V8EA 2WBKA 4PE8A 1I8JA 3NEVA 3MANA 5C2CA 1XSKA 2NV2A 3GDKA 5DMYA 1W1TA 5J8LA 4DIAA 1GVQA 3SCWA 1SO4A 1ZFJA 2CXGA 1EIXA 3B8UA 4HSHA 5CLTA 1LT7A 5FSDC 2Y89A 1WNOA 1RP9A 2Z1VA 3ZLGA 4UQ9A 2ZCGA 1BKSA 3NZPA 1XLIA 1P0KA 2GSHA 3QGVA 3ZSTA 1O60A 2GJLA 3RITA 2P3ZA 1DIKA 1GVIA 3BANA 4N6FA 3R7MA 5I7GA 4I9AA 3E12A 1HQTA 2VOMA 2FH8A 1OZQA 4ZE4A 3THAA 1DE5A 1UB3A 3S6DA 4TQTA 3VZYA 3BH4A 4DUXA 3HPAA 4YCPA 1RQHA 3PHAA 2VELA 3GG8A 4TR9A 3UD6A 4Z42C 2DZAA 2H3DA 1UR9A 1X1NA 1EDQA 1F3WA 1DWFM 2WSKA 3GE7A 1OCNA 1HZYA 3H7RA 3VNKA 1WV2A 3GYEA 1X8CA 4OVXA 3GXDA 3DESA 3WBYA 1TQJA 4ZB2A 1UJQA 3WDJA 1V93A 3PNUA 1PYFA 1IZKA 1OT2A 3W7OA 3TN3A 4GVIA 1TE6A 3HQOA 2OODA 3FHAA 1ELSA 3NZ1A 4YNGA 1RVGA 3G2GA 4LB4A 1A3HA 4S3GA 1Z32X 1OC6A 3C2OA 3F03K 1MMFA 4A3RA 3AXMA 1RH9A 3VILA 5A6MA 1D9EA 3ARVA 1A5UA 1KM3A 3MYOA 2R91A 1WAWA 4WKHA 4FEZA 3ITYA 3NSNA 3AIVA 1EP2A 4HNCA 1JD9A 3R8RA 1VPQA 1BKHA 2FTWA 4RX0A 2Q8XA 3DG7A 1YYAA 4QLLA 1CGVA 4MB5A 4HK5A 3MYPA 2V2CA 5A3HA 3MV11 5F4SA 1EEPA 1MXDA 4P8WA 5A8OA 4FNTA 3KRSA 4JBRA 1GTHA 4CCEA 2OKOA 1ONEA 2WNWA 1E9IA 4O4VA 3IVTA 4CCCA 3PN8A 3HFTA 1QASA 3GHRA 1O5QA 2ZC1A 2RGMA 5HR6A 3W2JA 2W6RA 5C2XA 1FWFC 1W3TA 1XLAA 3TKFA 3R5EA 4A21A 2POTA 4TUFA 2JIEA 2KAUC 3N9RA 3K4WA 3NPUA 1ZJAA 1WA3A 4B5XA 1PWLA 3SIZA 3W1MA 2A7PA 3SRHA 1XIMA 4EXBA 3WQVA 3URAA 3H7VA 4GACA 3W7IA 3C2RA 3V16A 4MJMA 4MSSA 3TH6A 2VEKA 1IEQA 4IQJA 1P7TA 1EYEA 5I3KA 4IT1A 3AROA 2MUCA 5FAGA 1KBLA 2BTMA 3FA4A 3CU2A 1UWUA 1SJBA 4ZFCA 2Y85A 6PTDA 3T9PA 2NUWA 2PGFA 2YDQA 3O6AA 1MRQA 3QSTA 4M3PA 1M7XA 2PTZA 5CGQA 3I3EA 4NNAA 3KTSA 3LD5A 2P0IA 1JCYA 4LB3A 5C54A 1OX6A 3B0PA 4AZHA 5FJRA 4GY0A 3EMCA 3TIMA 3KCLA 3LHZA 4E0CA 4A8IA 2VR5A 3NDZA 4QE4A 4HN8A 3IJQA 1LOQA 2RGLA 3C0JA 3KWXA 3IUIA 3QQWA 1BAGA 4TMBA 3K2GA 4QG6A 2O9TA 3T78A 1ITQA 4V15A 1ZY9A 3VINA 3KP1A 3O6CA 1EO7A 1W37A 3DHFA 1M53A 5CAHA 2PCEA 1GQNA 3VNLA 4MZYA 4IUGA 3V0TA 1X7FA 1AK5A 3VIGA 5HINA 1T5AA 4HZMA 4YL2A 2XGBA 2R82A 1AW2A 3VM5A 1EB3A 1XIIA 1V51A 1RJQA 1Z9AA 1J0JA 1I2QA 5EFFA 3ATZA 4DJDD 1A4LA 4EAYA 3ABXA 3GLCA 1TSIA 4PMZA 3QOMA 4NXKA 4PUWA 4GNKB 5TAOA 1U30A 4AWUA 4GX8A 2WAGA 1BQCA 5C71A 4H41A 3MS8A 4OV4A 1FY6A 1FHDA 3UWQA 4WZHA 1T96A 2X05A 4KESA 1SZFA 3VUSA 3IJIA 4O53A 1WDDA 4HNOA 3BOFA 1QI4A 2OLAA 4Y7EA 4C91A 3UCCA 2V8ZA 4W88A 2FFCA 4KIRA 1G4PA 4L6DA 3QZAA 1ZJBA 2BY2A 4DJFA 3KLKA 4AY1A 3T4CA 2OR2A 4K68A 5HJLA 1J6OA 4DY1A 5BWAA 2ZRXA 4RZ4A 3EWCA 3P80A 3OVQA 3CZJA 1FWNA 3TQVA 3OIXA 2RDXA 2CWNA 5ECVA 1B9ZA 5EPDA 2QDHA 3B9NA 4A3QA 2X09A 1ZLPA 1EJ7L 1BD0A 3OOQA 4GYKA 4B4HA 1B3VA 1FKXA 3AXHA 1LWHA 2E7FA 3R8HA 1P43A 1Q66A 3L4XA 2YYUA 3SCSA 2BS9A 4AF0A 4CQDA 4PTDA 3VD5A 4NI8A 2W0UA 4K7VA 1ITUA 5CSSA 4JKMA 3WBAA 4UTTC 3S2LA 1C29A 4HTYA 4BQ4A 1K9FA 3CC1A 3VGBA 4HCHA 3FDGA 3H21A 2RDTA 4R53A 2DJLA 3DFNA 1US3A 2GFTA 1JEZA 3IV3A 2BB0A 2V81A 5FF7A 2JEPA 5C9WA 3UJEA 4WSKA 2QPUA 2YIHA 3HJEA 1TV8A 2A3EA 2NWSA 4IFOA 3EKGA 1V6YA 1JDDA 2PDFA 3VMNA 4JNYA 3VDCA 1QWGA 4DXXA 1WKEA 3NXLA 2G50A 1LLWA 3W7RA 1B54A 4K1WA 1LG1A 4D6FA 2BWGA 4DWSA 4G7EB 4O50A 4ROQA 3WEMA 5EKYA 3DFQA 1UBPC 4CNOA 4UR8A 2XSBA 1K4GA 3P14A 4WDWA 5JBFA 3EGJA 2HJPA 1FCBA 4JY9A 1XHGA 1FWAC 5CZJA 4QP0A 2CZVA 3OVGA 3PP7A 2QAFA 1QPNA 1A5AA 3UNDA 1FDZA 1W1A1 1CW2A 2AGKA 3RPTA 2ZTKA 4YVXA 1RD5A 3UXLA 1W3HA 3JZEA 4JFWA 1XJBA 2PF0A 2BGNE 1GVRA 3HGJA 1XGZA 2A79A 4C6IA 4W85A 3IGXA 4HPXA 2DZBA 2QJNA 1VFSA 2AGTA 1UUMA 1UWAA 3PK7A 3DHDA 2OZ3A 1VIWA 3ERPA 4HU4A 1L6SA 5FI8A 3CB3A 1UHVA 2J7DA 1O95A 4AH7A 4I7UA 1UR4A 1WBHA 3VVGA 3ZJ8A 1EA0A 1B90A 1GZJA 2X2YA 2XM1A 2EJ1A 4OUIA 2P5NA 1M7PA 1IT7A 1ICQA 3LHWA 1W54A 3L65A 2I1OA 1JULA 4O8RA 2O56A 4LBUA 1BYAA 2VGBA 1ZS2A 4QDMA 4LAUA 4YTQA 1QW7A 3D6NA 4J2MA 3UZ5A 5CBIA 3V3WA 4GK8A 4WVXA 1EBGA 2G0WA 2PTWA 1M3UA 4C6KA 2YBVA 5LA2A 4M80A 5D03A 3G1FA 1TB3A 2QJHA 4E4UA 2ZVRA 3T07A 1TV3A 4H04A 2H8XA 3GNNA 1LL7A 4CD7A 3HZ3A 1L8NA 1O94A 3MQTA 3EA1A 1YW1A 3E38A 1SGJA 1XDLA 3CWNA 1PX3A 2X1TA 3K13A 4UCGA 2C3ZA 4CVWA 3S9YA 2WC3A 4F9JA 1XYAA 2G3FA 2YLLA 2CC0A 4GKTA 4AVFA 1UA7A 1ME9A 2ANUA 3BCJA 1I6NA 1PE1A 3SURA 2BDQA 1TMLA 1XI3A 3ATYA 4BJHA 3R0KA 1B4EA 3XINA 1MZRA 1PAMA 3TC3A 1M03A 4FAMA 4UB9A 1Q85A 5DQPA 3ZVHA 3V35A 1BWKA 1KXHA 3E0VA 4DN1A 3MVTA 4X9YA 1VYRA 2X1IA 5I5RA 2BSLA 4NZFA 2HNHA 1PKNA 1MVYA 3ALGA 3R8GA 4R5EA 3IUDA 3TOPA 2QMKA 2JF6A 5A94A 4GCXA 2Q02A 3GYCA 2J8GA 2OOFA 1UP0A 1QDSA 4LW7A 3IJ6A 2JF7A 4UTJA 3KOYA 4UIOA 3EBVA 4PUEA 4S39A 1QNVA 1EH9A 1Q6QA 4NZJA 5DLCA 3VKKA 3AWNA 5HQMA 3N2CA 2ZA3A 3TP4A 4PUUA 3ANUA 3SI9A 4I5XA 3IJ8A 2G41A 4FZIA 1E6XM 4A2RA 1ZSXA 4C6PA 4LC8A 5CSUA 2VX5A 3FK4A 3NQ7A 1I45A 3PB2A 1RCOB 1REQA 2IS7A 3MUY1 4TO8A 3GNPA 5D2TA 4C60A 3ANYA 4BR1A 4EVZA 2AQWA 3KW3A 4DF1A 1W1IE 2WMJA 1LWIA 2VVSA 3SW6A 3RM8A 3GQYA 2DZVA 3QMTA 3OBAA 1W8SA 3C61A 1I9CB 5LXEA 1LBFA 3QHOA 3PC0A 5E0CA 1SFLA 4QSHA 1DWHM 3ARRA 2R1KA 1EDGA 1XLHA 3LXCA 4M1RA 2I9UA 3OB8A 2X0YA 1XD1A 3Q65A 2XGIA 4MMWA 1XR2A 4KRZA 3F5LA 1IXQA 1B0IA 4WRHA 4FSAA 3B03A 1KRAC 3WK0A 4DJDC 1EC8A 3B8VA 4Y9MA 4H19A 4JTSA 4GI9A 2XG9A 4M82A 3BO9A 2CESA 3SJNA 1EP1A 1NJJA 2OXNA 1RQBA 3U7VA 3HG4A 2OYMA 3DEQA 2FJUB 3IARA 4I9JA 1RY8A 1RY0A 3NDOA 1V6TA 1QHPA 1QATA 1OM0A 3WUEA 3N12A 4CNSA 4YTTA 2XVLA 2VFHA 1TPWA 5M5DA 3V0UA 4KMQA 2A6NA 3MP5A 3PZGA 3MV01 1Q8AA 3DERA 3MMWA 1BWVA 1KFWA 2WK2A 5AHMA 3PPCA 1VYSX 2VRKA 3VU2A 3IAQA 1XIEA 3RRAA 4X0NA 4DQWA 3L9CA 1JG9A 1HKWA 3E9AA 1HL8A 2ZZ4A 1BLIA 3VIPA 1OCJA 1M6JA 1VJIA 4K8HA 4E8DA 3BSHA 5I3GA 3H22A 4Y9OA 2ZRWA 1HUVA 3FCPA 2RKXA 3TYEA 4CU6A 4GGBA 4XD6A 3UR5A 3REQB 4XIMA 2O7SA 1NDWA 1GKPA 5ABFB 1FWIC 1YMYA 3QKZA 3WNLA 1L8PA 2ADAA 5I23A 1TVPA 1PBGA 3MMDA 4CQ8A 1B30A 1X96A 3P61A 2ISSA 1XKYA 3WDPP 1G6CA 3PFMA 3SZ8A 1HT6A 1E51A 5E0FA 4KWVA 3TN6A 5DCDA 1HP5A 1UASA 5J5RA 4PTVA 3CJPA 3NQCA 4XVDA 1UR2A 2E6DA 5AOUA 3U7BA 1KBIA 1T6MA 1W2PA 2ZFAA 4CD4A 3FXGA 3Q2DA 1NELA 3ENLA 2UY4A 3R0UA 3QYSA 1VBJA 3MHGA 3RLVA 2PURA 2CLFA 3OG3A 3RG6A 3QOKA 7CGTA 3ZXWA 5F1UA 5MKGB 3RX4A 1XIGA 1R3YA 4CEUC 2CHOA 2FMNA 2VDGA 4Q4OA 4ADUA 1WDQA 2A5HA 5CXPA 4KETA 3NOEA 1PDYA 3I7RA 1IIHA 4WJ8A 3FSTA 1ENUA 1NQ6A 2BVTA 4MNJA 3B8TA 1FWGC 2A4AA 1B3WA 4EPBC 4JCMA 4MNLA 4KIEA 3F4CA 5DO8A 2EAWA 4GE8A 2ZX9A 3SAZA 4RNFA 1Z8AA 1B9BA 4BWLA 3G1SA 3ME3A 1KBJA 4KWSA 4W93A 3QW4B 4JFTA 4PFMA 4F0MA 4BHYA 3I3DA 5BXRA 2G4FA 3BLIA 5ABGA 4GQBA 4LAOA 3FS2A 5XIAA 2C1HA 1N8WA 3M16A 2DZUA 4E2VA 4FLRA 5D9OA 4JKLA 3VCRA 1NWTA 3P0WA 3S46A 1BF2A 3UVAA 3TR9A 1UC5A 2ZADA 3OZMA 4FNPA 3KHDA 4Y9AA 4Y8FA 3BAJA 1TCMA 5JIWA 1BEUA 4Q22A 3AHTA 3WMCA 1TV4A 3XISA 4LUTB 3SGGA 4IP5A 3M5VA 2NLIA 5T9BG 3E0WA 2Q01A 3WLQA 4GJ1A 1FBAA 1DJNA 3MI3A 4PUNA 4EIVA 3IVSA 1JAEA 2WLZA 2Y2WA 3BL3A 3MDWA 1MUCA 4O1EA 3RAOA 2XTKA 5D2YA 2YFOA 1KXVA 1MYRA 1TPVA 2RJHA 3TA6A 1CECA 2PDMA 5A8MA 1WUEA 2W3ZA 5DMMA 1H41A 6REQB 2BOEX 4W87A 3SUWA 4QS5A 1U5JA 2PTYA 4NJHA 4OJYA 4CNPA 4PODA 1F73A 2BG5A 4YCOA 2PDLA 4NKCA 2VZUA 4U2ZA 4Y90A 1PZ0A 2CXEA 3CIXA 4JN6A 3QSRA 3OZYA 4HT3A 4ERIA 4H9XA 1FXQA 2CBJA 4KCTA 3R4IA 1EHAA 5A69A 8XIMA 3VTRA 2CU0A 3FX4A 1K9EA 2QF8A 3TLQA 3GR8A 3GW0A 4CCDA 3B0XA 5E5CA 3K46A 1D8WA 4XVEA 1H61A 5RUBA 3VIFA 2R1MA 3OLDA 4AFYA 4D71A 1SW0A 1WYIA 4FX8A 3PBWA 4EKJA 3W00A 3NL3A 1VFMA 3ZJ7A 3CV1A 1QR7A 2E68A 3AMKA 5BU6A 4KWOA 5FESA 3I65A 4HNVA 1WZMA 3LTYA 5E9XA 2RDUA 2PLCA 1TJRA 4AIOA 2HRWA 3CWHA 2FGZA 4ZR8A 3BC9A 3W71A 2ZWYA 3HV9A 5G4EA 2D0GA 4J3VA 1OINA 2VO5A 1HJUA 1T7LA 4IIFA 4LYKA 4IMEA 2XH0A 1V02E 1PHWA 3W70A 1OG6A 2ZDRA 4NILA 2VZSA 2GDVA 2W4XA 2VXNA 3P74A 2XIQA 3B04A 4WSJA 4TVCA 3FY1A 1HG3A 3AMLA 3NR0A 1E5JA 1US0A 2C79A 1UC4A 4FXFA 3P81A 4UCFA 4E5TA 1I2OA 4RK8A 4WK9A 3CL7A 3BOLA 3NO1A 1PJ9A 3NPWA 4FXJA 2HROA 1E6PA 1MI3A 4JIRA 3G18A 4HYWA 5E70A 2Y70A 5HMEA 1QAPA 2V3EA 3VGGA 2GVEA 2IKJA 2NLYA 3QR0A 1P0EA 3KX6A 1XH1A 3OQEA 3C2FA 5AYXA 4GY7A 1X8FA 4J40A 3FYOA 1K8YA 5BRBA 1W9XA 3EWXA 4XG1A 4B9ZA 4JZ5A 4UTWC 2O92A 3WFLA 1G4EA 1HTIA 3UWZA 3B9OA 3J7HA 3LCHA 3DI1A 1OX4A 3V5CA 2FHFA 1AD4A 4IPJA 3PBUA 3ELFA 3M46A 1B57A 3MJYA 3EDDA 3ZFHA 1OK6A 4U31A 4AG0A 5ABEA 4PRRA 4K2SA 4GI6A 2CIPA 1ZNNA 3OODA 4KH2A 4HTBA 1HKIA 4I6KA 4IP7A 3MI6A 4O17A 4LV9A 3UF9A 3UWVA 4JR5A 1XRSA 1K7XA 3SY1A 3EPOA 4W7WA 4GUFA 4JX5A 5TIMA 2DU2A 2QGHA 3N2TA 5HBFA 3M0JA 3QBUA 1QMLA 5B80A 4QNWA 2ZOXA 3BARA 4FP1A 3GC4A 3MP4A 1KTBA 1C93A 4A3UA 1E4IA 3CHEA 2DUZA 4RUBA 3LHVA 4ZXLA 1DWGM 1FHUA 3LA4A 4IX0A 4MY8A 1X1ZA 4XWUA 1V3MA 1GOMA 3BSMA 5I02A 9CGTA 3CZGA 3IV8A 4Q8MA 4UNIA 1WDRA 4WY0B 1I0DA 1QOXA 2RHGA 3QPZA 4L64A 2ZYFA 1M5WA 4OECA 4U33A 4Q8UA 3PULA 1Q4NX 4RLIA 1HJWA 3NQFA 1DJWA 5G4WA 1DBTA 4HJWA 4IPNB 4ECLA 3P7YA 1Y65A 3CAWA 1JXKA 4X63A 4X60A 2OMAA 4HP5A 4IPLA 1UH4A 3WLJA 1P1MA 4TX9A 3JW7A 4MNKA 1MW0A 1P5BA 4WR3A 5AHNA 1TPFA 4MDPA 5HK4A 2X0HA 4GD0A 1FWSA 1KW1A 3BK0A 3BG5A 4US5A 5L9FA 3ABOA 4J7RA 3G1DA 1RCQA 4FLSA 3O3RA 5I79A 1A5BA 4UTFA 3U2EA 1RR2A 1YDNA 1UZHA 3CUHA 4GYJA 1E4MM 4YWSA 4IOTA 5IHSA 3RRXA 3UQNA 2E25A 1J2WA 2OT0A 3TCEA 3W1UA 2D22A 2VFFA 4BQ5A 2D1ZA 4PCPA 5FJJA 2Z1XA 4TMCA 3U6WA 4D8AA 3JVAA 4EPDC 4IM4A 3D3FA 3E2SA 4N9CA 3CAVA 4JFSA 4CVUA 5C9ZA 4JDBA 4FX6M 1VF8A 4MAZA 1CB7B 4MVAA 2WVSA 1OHLA 4HSOA 3GDMA 3F5KA 4DLMA 3IK4A 3RIKA 1A5SA 5CPLA 2CITA 4X0VA 4XBSA 4Q7IA 4MB1A 4JL2A 1RA0A 1E6QM 4C6JA 1TUFA 1WBJA 1IXOA 2ZZ3A 1JZ5A 4Z2GA 2V5KA 5LA0A 4I5RA 1R47A 2FB2A 3T8LA 3UYCA 4LXFA 3GVRA 4FNQA 3WQPA 3GM8A 4MYXA 2DJXA 3GU9A 2A21A 4Q4PA 1GK8A 3DHUA 1A0EA 4KQNA 4WHBA 3I7QA 2ZUWA 4QROA 1IZCA 1UA3A 3BUVA 4LANA 4RE4A 3LHUA 3UPMA 1T40A 4GBUA 4H2HA 4MTVA 1AJ0A 3NNTA 4F66A 3CT7A 2QF7A 4FHAA 5C0QA 1K9TA 2QVNA 1KCXA 4CD8A 1MUWA 4D6IA 3TW6A 3CQKA 4YHGA 2C15A 3DFOA 1AL8A 4M6PA 4OOZA 5AB3A 5KETA 4CN1A 4PMJA 2XUCA 5A6TC 1OC7A 3WNPA 2DT0A 3H7UA 3CEPA 2ATSA 3GTNA 4OGZA 4HA4A 1TWWA 4N9BA 1O66A 4TVDA 2GVYA 1W5OA 3CQ0A 5A8QA 4TTGA 1W0MA 3JUGA 4J27A 3A6OA 1E6ZA 3ABSA 1VB9A 3PBVA 5TQLA 3BDKA 1XLJA 2VGGA 6TAAA 4AISA 3SJ3A 7REQB 4AVNA 1OYBA 1S2CA 1SZEA 2GQ8A 1EGZA 1M7JA 4YTSA 3KUMA 1OD0A 3O06A 3GSMA 1XUZA 4V27A 5PTDA 4IGMA 2VGIA 3DENA 4TV5A 3WD0A 8A3HA 2ZVIA 2WOQA 1V03A 3HGOA 4GH3A 1SW7A 3W02A 1OCBA 3OHIA 4QAWA 4PUMA 4L6HA 4P8XA 2REQB 2YPIA 4BI5A 4XZBA 1OFEA 1R3TA 3GUWA 2DW7A 3OLIA 3NQMA 3P5YA 3IGSA 3PAJA 4GNVA 4IICA 3GVQA 2XVKA 5B7ZA 3ARYA 2A0NA 5BW6A 1J93A 4QQUA 1G67A 1ZUAX 2XIOA 5LNWA 2XFRA 3QZEA 3V1PA 1F6YA 1A5LC 2DZSA 2EO7A 2F7FA 2V2HA 3A4JA 3NQ8A 3AS3A 2Z2AA 3A3WA 1FHVA 3UPWA 1K1DA 1R86A 5AC7A 4ZSUA 3OVPA 3CAKA 4PUJA 2E6YA 1DWIM 5A8GA 4O11A 1O5RA 3H2MA 4JQ3A 3FHQA 4HHHA 4OZOA 2C19A 1BHGA 1GUVA 2PDGA 4TIMA 1GVFA 1E72M 3A4WA 1TR9A 2VFDA 2IKGA 4CNNA 3ITLA 1E73M 3BWWA 4EE9A 1WXZA 1XQLA 3O6YX 3M64A 3BLDA 4PL1A 2C8NA 4ZO6A 3TLLA 1MRAA 2E9BA 1UH2A 3POCA 3VD7A 3STGA 3IUHA 4XUGA 1L6YA 2G37A 1ZAJA 4PBGA 4LX4A 4F0LA 4YVPA 4GO8A 3EWZA 5LZLA 1B3YA 1IEIA 3UP8A 3MT1A 4LCQA 3A22A 1EWDA 4B3ZA 3UGVA 4PRWA 2PU1A 2EJAA 2VZOA 8CGTA 4AD1A 3MMTA 1XLMA 1EEXA 5T8GA 3VDAA 1BXCA 2BBFA 2CZEA 2I57A 4RNJA 1LRTA 3GH4A 1W1B1 4FPSA 4WX2A 4C6EA 3LMYA 2DVUA 2PDHA 3V0SA 1K8ZA 2JKPA 5CJNA 1UKSA 3BJSA 3COTA 1JFHA 3M6DA 1JFXA 4ERGA 3HG3A 2XDFA 4D6EA 1ONXA 1T99A 2WANA 3VX0A 2VC9A 1UMLA 2PD5A 3Q4DA 4GIEA 1H1YA 4C6CA 1A80A 2CLKA 3RN6A 3W7MA 2D69A 1MUMA 3CMJA 1A4MA 1VBUA 4IIDA 4DXVA 3ID7A 2TAAA 3GD6A 2AAAA 4B2DD 3LDVA 4I9TA 5CPMA 4K1GA 4NZ1A 2CZDA 1H11A 2R8WA 2J77A 5F4WA 4HVXA 3A9IA 3PZTA 5A2CA 1XCXA 4LS2A 4WJXA 3BGJA 4X2RA 2I14A 4AUBA 3VABA 3PM6A 4JTEA 4L1XA 4CNUA 3EPNA 3NIYA 1ZU8A 2QZRA 4MZ8A 1UOZA 1ME8A 4WY0F 3FGCB 3AO0A 1FCUA 1B2YA 3TNOA 1FQ0A 3EEZA 4B5SA 4C6OA 2JKAA 1QBBA 2QCDB 2RJGA 3UXKA 4R34A 2IKIA 1ADOA 2CETA 2PDPA 4B5VA 4AC7C 4JNMA 3RU6A 2ZRZA 3FJ4A 1EC9A 4NRSA 3PSWA 4AC1X 1J0YA 2ISWA 2J75A 3WY1A 5FEWA 2DT2A 1H5VA 1V08A 2PODA 2YXXA 5CPOA 3QXBA 2I17A 4Y2WA 4WOQA 3P62A 3USBA 1CX9A 3VCCA 1CI1A 2QEZA 2WWCA 4H00A 1GJPA 3WUBA 1P1XA 4TXEA 5HUOA 4GVGA 4IQDA 4E2BA 4M7TA 3SCQA 2DORA 1C7TA 1BXBA 5CZTA 3WMLA 4HK7A 4GRSA 4LY8A 1QPKA 5KZDA 5HWNA 4GMEA 3BV7A 5I09A 3QTPA 4A8RA 1ISXA 1E55A 3BW4A 2P8CA 1HW6A 4NASA 3TC6A 4GUHA 3S2MA 3CUGA 1LT8A 1JI1A 3EAUA 1OFQA 5G1MA 4GZIA 3ABQA 1QPOA 4QJ1A 4NY2A 1ZJIA 3TSDA 3KEHA 1LROA 3LERA 1XQKA 3S1UA 2X1SA 1TYGA 3VE7A 2OSWA 2V5BA 2X7WA 3TOYA 3MHUA 3MWCA 1X98A 1D7KA 3OHMB 1MQQA 4RZBA 1BTCA 2QV5A 1ODZA 4KFPA 3A21A 2WVVB 2Z6IA 3BLEA 5H8UA 1XD0A 1TV5A 3N2MA 1WO2A 5I3JA 2INZA 3EOUA 2CLIA 1K77A 5TD4A 2WPBA 1Y8BA 2FQIA 1YDVA 4DVOA 2QUVA 1F05A 3C6CA 3L4ZA 5HAOA 1OF8A 2GWNA 4UQAA 1CGUA 3DYPA 4LS0A 1P6CA 4IGSA 3VFCA 3CHFA 3LI0A 3RPMA 2FYMA 3L67A 4HNTA 4XD3A 1PV8A 2QPXA 1NH6A 2FIQA 4GLEA 3APTA 4C65A 3O9NA 5FEXA 2JEQA 4K38A 1F61A 2Y5EA 3VDGA 1SO5A 1UWIA 1QO5A 2BASA 3I3BA 3LX9A 3YPIA 4EWND 2B7NA 4Z2IA 3CXOA 4L4PA 3S1WA 2GJXB 3WLMA 4DZAA 3E2VA 3IIZA 1UUQA 3E1F1 4ZODA 5C7HA 2PP0A 3TYUA 3B3DA 2YFNA 3E3HA 4UQCA 1CLKA 4Z1AA 1OVDA 3W7LA 3H4WA 1G4SA 3L0KA 2QJGA 1TFVA 4MGGA 1E15A 2ZZ6A 3S3GA 3AMDA 3KZPA 3A5FA 5AFDA 1UD6A 3W7HA 1J10A 2MNRA 3R89A 3N9KA 4K39A 1V79A 1F3XA 4MLRA 1WZAA 3DDMA 1MDLA 1L6WA 4QM1A 3W4RA 3SQSA 2WNNA 3GVVA 4ZE5A 4CLMA 2HE5A 2QVHA 4A29A 5A6AA 3RLUA 3M5XA 2OQLA 4QE1A 4WIWA 5IFPA 1JD7A 1Q63A 2JBMA 2BVWA 4MHBA 1EX5A 4D8LA 3TWBA 4HA1A 3STEA 1XLBA 1C90A 2G3JA 2G96A 4YWIA 3VGHA 2QCGA 2FVLA 4AZ5A 2I16A 3M0LA 2NZLA 5BMWA 4DHGA 2VCCA 1UH3A 2O55A 1DL3A 5DRCA 1DXIA 3K4AA 5AVHA 2E09A 1W3LA 3DFSA 1VCVA 3HMJG 3TYAA 1Q5MA 3KBVA 2NQLA 1TWZA 4QAIA 5BRQA 1A5CA 4ZTYA 2PDIA 2PUZA 1GNXA 4IIHA 4RXFA 3W1XA 2Z00A 3B8DA 1P48A 1TPH1 1X6NA 3EX2A 2XH2A 2OEJA 5G2IA 1V6XA 3PTKA 3VIJA 3IEBA 1W91A 2DZPA 5IDZA 3CUFA 3SBFA 3VOCA 1QI0A 2WHKA 3CPUA 3WFZA 2ZWZA 3W2LA 4ATDA 2Y5SA 1LP6A 2V68A 3AFBA 3H2OA 1EYWA 1YADA 2R24A 2J47A 2FHCA 4NX0A 2VT0A 3CWOX 1NVMA 3GG7A 4W8BA 4PMYA 2WMIB 2ZX7A 3QEZA 3L5AA 4HMEA 4ZOAA 3EWUA 4J3XA 1ME7A 5FL0A 3N14A 3NPVA 1KFEA 4JTFA 2QUMA 3CZEA 1VRXA 1XLEA 3NFUA 4NAEA 1TPEA 2WPGA 2VUNA 2X7VA 3NVDA 3HG5A 2AAMA 2PDBA 4WKAA 4S3EA 3GXTA 3REQA 3LV6A 4B5UA 1KKOA 4G1NA 1F3EA 5AYZA 3SQMA 4F2BA 3IIOA 4XAFA 3TTEA 2HEJA 4LY4A 4DO4A 2QT3A 3AHYA 2IUZA 5HPCA 2E40A 1PKMA 1E9ZB 2DT3A 4ZOCA 5U7SA 1VC4A 3LBMA 3GR7A 1VR6A 2OFJA 3HBLA 2D2OA 5FJPA 4WGXA 3VOJA 3AS1A 3VIKA 1LG2A 3W07A 2Q09A 4O1DA 4C1LA 2GUBA 3PFRA 5BYWA 3W9ZA 4BEUA 4YTUA 5GJNA 3T1GA 2QUTA 1GQJA 2WVTA 3EX4A 3WBEA 4ZA0A 1HGYA 1XUUA 1LWJA 2XH4A 4Q8TA 2I9EA 4ZO7A 3Q94A 5MKGA 4QJ4B 1U33A 3S83A 1M65A 4G9PA 4M19A 4AD0A 5CGMA 1BYBA 2NQHA 3RK8A 3EWDA 1MWOA 4L1WA 4PMXA 4UZSA 3W7GA 1HL2A 1V0KA 3WSUA 3KE0A 1ZRQA 1TO3A 2J8FA 2FFIA 3GXNA 4LFYA 2ZE3A 1PDZA 4JDYA 5DEZA 3F4NA 1BFNA 1C7SA 2FZ8A 4IIGA 1MW2A 5HR7A 3NAVA 3CMFA 1D3GA 4K8EA 3EDEA 5F1VA 1KV5A 3B9EA 4UXDA 5HA7A 2ZA2A 5IBXA 3BLKA 3AYRA 5B7YA 2FPVA 1CZ1A 4C1NB 4O1FA 2YCJA 2FH6A 4O1BA 5A5WA 2PDJA 4PMQA 1PCKA 1MNSA 2OCZA 3QKEA 3GU1A 4PSRA 3TSMA 2FJKA 3UJ2A 3K30A 2PS2A 2PDUA 3BW3A 3BCFA 3U4FA 1A5MC 1VLWA 2V30A 3W6LA 3N25A 5LIWX 4PGLA 1R46A 3NEHA 3VOIA 1UYQA 2HDJA 1IEWA 1Q8JA 1YE6A 2QCEA 3W72A 5D38A 2VEIA 4HHPA 3C3NA 3ITTA 2AL2A 4ORIA 1XBVA 4M7SA 1PXGA 2CLMA 4AZCB 1UKTA 3B8WA 1AW1A 3TJ4A 3GR4A 3FV9A 3DCPA 3PJWA 5FJTA 2YZRA 5XINA 3VMOA 4FR6A 1S39A 4KBXA 1OC5A 4HU0A 4YYFA 1JDEA 1KD0A 1O68A 4GI4A 4JEQA 1UPPA 2ZUTA 2GOKA 4LS1A 2RFGA 5CSYA 1UIOA 1JDCA 3DYOA 2OZ8A 3GIQA 2H8ZA 2OO6A 5HMSA 4GPNA 2WZTA 4MY9A 3PUGA 4DJFD 3BJTA 4MWAC 4HGXA 3LPPA 2TSYA 3IJ7A 1TV2A 5D37A 3GO2A 3W1NA 2DT1A 3ONBA 4GY1A 1EFZA 5HPOA 2VGFA 5DXYA 5M03A 2R94A 4LCSA 4H4IA 3R11A 2UWFA 3TXZA 1Q6DA 3ITXA 4LH8A 5MF5A 4LC6A 2VEMA 5FF4A 5A2BA 1DJGA 1IWAA 2ZZ2A 3KBJA 4LVDA 1GZGA 2CZFA 5AZ1A 3CMGA 3LXBA 4YYCA 3M0VA 3MY9A 1O12A 2CLOA 4NQ1A 5BOEA 1V4YA 3W7DA 4JXCA 2P10A 3M1ZA 4LYRA 1L2UA 2B7PA 3O07A 2QCMA 2QKFA 3UESA 2V0TA 1XGDA 5BMXA 3BJFA 3NZQA 1BYCA 2I7GA 4ACZA 2PGEA 1CEOA 4AIUA 3PUDA 1WOAA 4AZBA 4HN4A 3AIRA 1MDRA 4HCDA 2INEA 2E1DA 3NQDA 4JIEA 3KWSA 4KWWA 5JH1A 2HXUA 1PIFA 1MO0A 2ONEA 3WENA 2GYIA 2DVXA 1PIIA 4FNUA 1C3FA 2C1GA 3MVIA 5FEPA 2NV1A 2YL5A 3E49A 4O19A 4TX6A 3QR1A 1UD5A 4L61A 4K8GA 2HVNA 2PRMA 2G4JA 1FUYA 3NQEA 4DJED 1I1WA 2UZ9A 1RK5A 2BHYA 4DAIA 1ZCOA 2PDKA 1JZ4A 4M5PA 5DY3A 5CC5A 2P88A 3AZRA 3W7EA 4Z08A 2WJEA 4JNZA 1YPFA 2D0FA 5C7VA 3EDFA 1SR9A 3WLOA 5A6BA 2CNCA 4NUWA 3L4TA 3QW3A 4RDZA 3BQ6A 4O57A 3ZS4A 4OIFA 4GISA 1R9ZA 3WX7A 2BHZA 4JFVA 3G1VA 4OBTA 4WXZA 4GUIA 3ZT7A 3G3MA 2G95A 3M47A 4Q8NA 5H6HA 3T09A 2B0MA 1GW1A 1S2VA 4JHMA 3PBMA 1U83A 4HQVA 2R1NA 4PB3A 5FL1A 3FVDA 5REQA 4UC5A 4C6BA 1FTXA 3APYA 3TCSA 3LCLA 3HPFA 4A35A 1TA3B 1TVLA 5A6LA 1EJXC 4S2BA 1CWYA 1FOBA 4BKNA 2J7GA 1IWBA 2PDCA 3HB9A 1YTEA 2OB3A 4LAMA 1LQ2A 4NG3A 4YXGA 2BY3A 4LEFA 3B05A 4LGXA 5FIPA 1ZP4A 1R8LA 3UPBA 4WQ6A 3WF0A 1TRDA 5K7JA 3LUTA 3C5QA 4ZEPA 1X6UA 3U48A 4UFHA 3H26A 3VKAA 1FHLA 1TTJA 4XD4A 2F2KA 1B3ZA 1JQXA 3DC8A 4H6KA 1UROA 5KZEA 4K36A 4LTSA 1GHRA 3FW6A 4ATWA 1J0ZA 4S3JA 3CH9A 3DAQA 4KKXA 4U5IA 4WLCA 5C70A 3GZ3A 3H23A 2PTXA 2CLPA 3PBGA 4G6CA 2ZZ5A 4HCLA 1GOQA 2X0SA 3LPOA 2RUSA 3ARTA 4MG4A 4WCJA 3G8EA 4AAJA 3CT2A 3KVKA 4PULA 3LXAA 2YDRA 3HFYA 1G94A 1OIFA 3WLTA 2V6AA 4XTIA 2GUYA 4UWMA 4IH3A 2PB1A 1IT8A 3IGUA 3HIJA 2EPLX 2XZ9A 4FR1A 3CASA 2XWDA 1EC7A 3HA1A 1RLCL 3SN1A 4UTLA 1TIMA 1XWYA 3GH5A 3QMRA 4FXSA 4D6CA 2HVOA 1YHTA 3R1ZA 3S5OA 4C90A 3L4YA 5DF0A 1X6LA 3WDHA 4A4AA 2FPTA 4J5NA 3SCOA 2CKSA 5BXSA 4RDYA 2W66A 2ODOA 3QVQA 5C2GA 2O0TA 4W89A 1SZGA 3ZT5A 1QW9A 3BG9A 3Q45A 4LF1A