3R58A

Akr1c3 complex with naproxen
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
317
structure length
304
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of three classes of non-steroidal anti-inflammatory drugs in complex with aldo-keto reductase 1C3.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 304
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3r58A00
4GIEA 1SM9A 3EAUA 2HVNA 3LD5A 1GVEA 4LB3A 4QBXA 2DV0A 4WDTA 1IEIA 1Q13A 1R38A 4JQAA 2PDIA 4R9OA 2PD9A 4XK2A 2PEVA 3LNMA 5C7HA 3UG8A 4GA8A 2INEA 5KETA 3MC5A 2PDKA 4JTCA 2PDUA 3LBOA 3WBYA 1RALA 4PR4A 4WDUA 2IPGA 3WG6A 4WRHA 3QKZA 2AGTA 1MZRA 1PZ0A 2IS7A 4XO6A 3ERPA 2PDCA 3MB9A 5DANA 3ONBA 1MRQA 4ICCX 2I17A 3CAVA 3O0KA 1ZGDA 4PUWA 1LQAA 2CLPA 4Q7BA 2HE8A 3BURA 4IGSA 3O3RA 2HDJA 3BCJA 4LBRA 3R94A 2P5NA 2HV5A 1UR3M 4GABA 2PD5A 3CMFA 1A80A 4LAZA 2BP1A 1YE4A 1ZUAX 4JTDA 3UYIA 2IKHA 4GQ0A 3P2VA 1AFSA 4DZ5A 3KRBA 3R6IA 2IQ0A 3S3GA 2PDFA 4H8NA 1EF3A 3UZYA 2PDWA 4I5XA 1PWLA 3GHUA 2PDHA 1Z3NA 3R58A 2HVOA 3LQGA 4JIIX 3DOPA 5LIWX 2IPFA 3C3UA 3H4GA 1IHIA 5JH1A 2HEJA 2FZDA 2QXWA 3RX2A 5AZ0A 3COTA 3RX3A 1S1PA 4HBKA 2ACSA 2I16A 4HMNA 2BGSA 1YE6A 2WZMA 4FAMA 3V35A 3R7MA 2A79A 3N2TA 4IJRA 2PDMA 1ADSA 3WBWA 3BUVA 1YNQA 2ACQA 1RY0A 4F40A 1EKOA 4XZNX 2PDGA 4GACA 3H7UA 4DBSA 2PDQA 2IPJA 3RX4A 2IPWA 3R8GA 1PYFA 4JQ3A 3T42A 4ASTA 1RY8A 2PDJA 4QR6A 4YU1A 2PF8A 3UGRA 4PMJA 4ZFCA 3EB3A 3U2CA 3GUGA 4GQGA 3BV7A 3D3FA 4WEVX 2NVCA 1S1RA 4G5DA 4XZHA 1FRBA 1T41A 2FZ9A 4OTKA 4Q3MA 1XF0A 3UZXA 1VP5A 3WBXA 1QWKA 3F7JA 1MI3A 3GHSA 3M64A 1XGDA 1Z8AA 1XJBA 2R9RA 3N6QA 4PUUA 2DUZA 4JQ1A 2FZBA 1JEZA 4H7CA 1S2CA 3LN3A 4JTRA 3NTYA 4DBWA 1US0A 4DBUA 3R8HA 3UZWA 4JTQA 4IJCA 3WCZA 2PDYA 4FZIA 1J96A 2C91A 2IKIA 5JH2A 1X96A 1Z89A 1AH0A 4L1XA 5HNTA 3M0IA 3UFYA 2PDBA 4JTAA 1YNPA 1AH4A 4XZLX 4FA3A 1X97A 3LEPA 3ONCA 1HW6A 3R43A 1VBJA 3VXGA 2F2KA 1S2AA 1T40A 3DN5A 2R24A 4JIHA 4XVEA 1ZSXA 1X98A 3LZ5A 3UZZA 3CV7A 3FX4A 2PDLA 1PWMA 4WDWA 3V36A 1M9HA 2ACUA 3LENA 2DUXA 3CV6A 1C9WA 5LIKX 2HE5A 3Q65A 3V0SA 3LUTA 2PDNA 3M4HA 4YVXA 5M2FX 4MHBA 2FVLA 4NKCA 3B3DA 4LAUA 1AH3A 4XZIA 2IKJA 1Q5MA 3UP8A 4EXAA 2ALRA 4RPQA 4WGHA 2FGBA 1EL3A 1Z9AA 4PRRA 4QXIA 4YVPA 3LQLA 4JQ4A 2NVDA 4XVDA 3EB4A 4JQ2A 2PZNA 2IKGA 4LBSA 5LIXX 4YS1A 5HA7A 3G1RA 1PZ1A 3LZ3A 2WZTA 4YVVA 2J8TA 4GCAA 3GHRA 2ACRA 5HNUA 1EXBA 2F38A 4WDXA 4JIRA 3CASA 2INZA 4XO7A 4PRTA 3V0UA 4L1WA 4XAPA 1OG6A 1AZ1A 2ISFA 2PDPA 4XZMX 4FALA 1ZQ5A 1LWIA 2PFHA 4LB4A 3FJNA 5LIUX 1AZ2A 2BGQA 3G5EA 3CAQA 3H7RA 1QRQA 4AUBA 4QX4A 4EXBA 1K8CA 3GHTA 3V0TA 2IQDA 5AZ1A 2VDGA 2PDXA 3Q67A 5LIYX 2FZ8A 1HQTA 3UWEA
chains in the Genus database with same CATH superfamily
3AMDA 4GIEA 1YQ2A 3IARA 3S1WA 4O10A 1QMLA 3PJWA 4B5VA 4NX5A 1WOAA 3WQ6A 5FF3A 3UJFA 4GFIA 3KUMA 1OIMA 3VCNA 1QBAA 3NXFA 4LVDA 3R79A 4RPPA 4QG9A 5EPDA 2C0AA 3DYPA 1DYSA 4GA8A 4XIAA 1HJSA 2HBVA 4DYEA 3TV8A 1AD4A 2V2CA 3NZPA 3PBGA 3ANVA 1MZHA 2J27A 4A3QA 3IVSA 1SJCA 3GTNA 1LG1A 4W8BA 3ERPA 3AMCA 5DANA 1MW0A 1UKOA 2FZNA 2ISWA 3LCFA 1KCLA 2PGFA 3EBVA 1LQAA 4O18A 2G0WA 4XZWA 2WMIB 1Q8AA 2XIBA 3E49A 1CB2A 3IS4A 4HNVA 3N2MA 1PZ3A 1RZMA 4K7YA 4EKJA 4GABA 1YLVA 2WJFA 4GGBA 3P0WA 4IMAA 3UYIA 1NEYA 3TC6A 4DN1A 1QHPA 4B5NA 2Z1KA 1V3JA 5B7YA 1V3HA 1CI1A 1PBGA 4PEEA 2WQDA 3I6RA 5CJMA 3HPZA 3GHUA 1FP8A 3G3MA 1LBMA 5HQEA 2VM8A 4Q4SA 2JFEX 1MXGA 5BU6A 1KLYA 3SJNA 1OCQA 4J5NA 5T91A 1FCBA 1KFCA 3AHZA 2V6AA 4AX6A 2E6AA 4F8XA 1XDMA 5JH1A 2D2HA 4KCUA 1A5AA 4JIQA 4HBKA 5CSSA 1GW9A 3H2AA 5K9DA 1DP0A 1XCFA 3G18A 3OYXA 4IOTA 4D1JA 3S9IA 5HATA 3KRSA 4FAMA 3GTFA 3DG6A 3W1TA 2JIWA 1CW2A 2ZZ4A 4DXKA 1ISXA 1TPDA 4HNTA 3M07A 4RXFA 1S5NA 4PN2A 3STCA 5AC4A 3OW1A 3WMBA 4ZL1A 2B7QA 2FQIA 4JIEA 4RZ5A 1WKFA 4H8UA 1ISZA 2VO5A 4I6KA 4MNLA 1NDVA 4JN8A 2GWNA 3QW3A 2JGYA 3PS7A 4O8RA 5DX7A 4A35A 2WLYA 3RM9A 2GQ3A 1IXPA 3C0JA 3UGRA 3S6DA 1QAPA 3E74A 1DJZA 1QU4A 5C9RA 4LEFA 4Q33A 1P5BA 5KITA 4DLMA 4LYPA 5BWFA 4PMXA 2TSYA 2FZ9A 1W1YA 1WKEA 1TVPA 3STPA 2G37A 1XH1A 2D2JA 3RLHA 1XF0A 3G3DA 3L7RA 4YMZA 1IR1A 4ADTA 1S2WA 5FI8A 1P6WA 4DXVA 4PUUA 3B40A 4JQ1A 2NSXA 1MW1A 3M9YA 4GISA 3ZFHA 1JCTA 3HPAA 3LPPA 1Z69A 1ENUA 1UA7A 4P8UA 3UF9A 1TIMA 3SRHA 4DJEA 4B92A 3EWDA 1BYBA 1QNSA 3ARXA 1ML1A 2IKIA 4HNNA 3G0SA 3I4EA 2QCEA 4E8GA 1VFOA 1V0KA 1RPXA 4XTIA 2NQLA 1UD8A 4JN7A 4WXZA 3CUGA 3V18A 3W1QA 1SO3A 2VJXA 3R2GA 4MB1A 3N4EA 3MCOA 4Z0JA 3VM5A 1X7FA 4FNRA 3IIVA 5IFPA 1JGMA 2HS8A 1TPB1 3KOXA 1T99A 4IQEA 4GUJA 4GKLA 4TXEA 3P80A 1Q45A 3CZJA 3VMNA 3S1XA 1KV5A 4IL0A 3RCNA 4CNPA 4FNPA 5XINA 3RJYA 1C9WA 1VEMA 4GI9A 1C8VA 1Q6CA 1TTIA 1TRIA 1XYCA 3NVTA 1V6VA 4UBPC 2AL2B 2WZIA 3BWWA 1TPH1 1TSIA 1I0DA 2W92A 2NLYA 1AQFA 3AJXA 1XC4A 5FJOA 4DY1A 3TYBA 3N15A 2BXYA 3S47A 1IXNA 1P0KA 4AISA 2BG5A 3L0KA 3PUOA 4GXPA 3WLMA 4QROA 1LBFA 2SFPA 3NPVA 2YFNA 4A22A 2Q6ZA 4HOZA 1Z9AA 4PRRA 2PU0A 2UZ9A 4EF9A 3EB4A 1O60A 1U33A 4Y8EA 1XLKA 4E5TA 4AVNA 3CT7A 1VFMA 3WSUA 3BDKA 3U2OA 4A3HA 2CBIA 5I0DA 4NAEB 1XISA 3UZ5A 3VK5A 1G6CA 1HX0A 4MWAE 2G96A 3L2IA 4UMCA 1JPMA 4D6DA 1BF2A 1BGGA 5DQPA 1K6AA 5D38A 3V0UA 1RSCA 4WSHA 2ZE3A 1PE1A 1S2VA 1RD6A 3PBUA 4J3ZA 5BRQA 1AZ1A 3GNNA 7PTDA 2EPNA 4D6IA 3LBCA 1DJQA 2GGIA 2ZZ1A 3FYYA 2EQDA 3M16A 1OHLA 2G3MA 4YN5A 2ZX5A 4J3XA 3WDIA 5K3VA 3WLPA 1VPYA 5GVJA 4XD5A 2VDGA 1X6LA 1OF6A 2W66A 4HPHA 3ZLGA 4N6EA 3QZAA 3RDKA 1ZBKA 4KF1A 1RJPA 3LD5A 3U48A 3S2JA 1KD0A 2ATMA 5AHIA 2H8ZA 4Z1CA 4GBUA 3FGCB 1ITCA 2J75A 2E40A 2PWUA 3VVGA 2P1FA 4JFUA 3THUA 2PD9A 4DM2A 5JIPA 3PG9A 3OVRA 3OZMA 4MADA 3O6CA 4PRWA 3AAMA 3KEHA 4Q4PA 1NJJA 4P8VA 1ZY9A 4HB7A 1S5VA 2V3EA 3OQ8A 4EAYA 1G69A 1E1FA 1V93A 3CZEA 3F4CA 4HNLA 3ZJ6A 3PTKA 3WNOA 4MMWA 3VIKA 4P8XA 1ITUA 2FMOA 4JKKA 2PWHA 5A3HA 1MZRA 5I3GA 3VFLA 7REQA 4NUWA 2IS7A 3V4BA 3LCLA 1OK4A 3EKLA 4MNJA 4E4FA 3VKAA 3LTSA 5ABEA 3W70A 4NI3A 3HOJA 2VX4A 5LSMA 1B0IA 4J3UA 4MJMA 3DZ1A 1V6TA 1M03A 1EJXC 2PAJA 1QNOA 3TCSA 4UUIA 2OQHA 3BSMA 1EPXA 4MZ8A 1EO7A 5AHNA 3NPXA 2VEKA 3UA3A 3GFXA 1OY0A 4KCTA 3W1UA 3PBWA 3QFEA 4CU7A 1DOSA 1GQKA 2CWNA 4O0QA 3WQ4A 6A3HA 1WPCA 3GDLA 5C6MA 3C2VA 4DLFA 4BI7A 5LIWX 3GG7A 1BVWA 1EJRC 3C3UA 2QLYA 3ID7A 1QFEA 4I3GA 2HEJA 2QXWA 4ROPA 4DWDA 2Y5SA 3EWBX 4LUIA 5K2ZA 2MANA 3P7YA 5I77A 1XKJA 2OTDA 3BJSA 3QPYA 4L80A 3ZR4A 2A79A 3VGEA 3L4VA 5FCZA 1E3XA 1W9XA 1R9YA 1MW3A 3N73A 3AXIA 3DGRA 1J4EA 5H91A 1R3VA 2JEQA 3UY8A 1UWIA 4HU8A 3RX4A 4H7ZA 4K8EA 1KV8A 1QI0A 5CZ0A 5FJJA 3ANYA 1TPUA 3L12A 3VM7A 2UY5A 4JQ3A 3DYMA 2QGHA 3WMCA 1B3VA 2Y1HA 1TWIA 1GG1A 1IT0A 2DVUA 3EB3A 2XINA 4GUIA 4E2BA 2D0HA 4AZGA 1F07A 7ODCA 3AFBA 2NUWA 1GYNA 1AODA 1A50A 4HCLA 2FHBA 4B16A 3EX3A 4LVGA 4AYSA 1BWVA 2PRHA 2KAUC 2GDVA 3EOUA 3MANA 3EXSA 1VBUA 3CHFA 1XJBA 9XIMA 3E5BA 1A0CA 2Q3RA 3KRZA 2ZDSA 3MDWA 2NX3A 4REQA 3VDGA 2WHMA 4PEKA 1NU5A 1SMDA 2Y5JA 3CLWA 4D1IA 2D20A 1US0A 1IEQA 2YFOA 4RDYA 4WY0B 2V68A 4AIEA 3RCYA 1EB3A 1HKJA 2YDSA 1Q63A 5JH2A 3O9NA 4DO4A 4P5UA 1AH0A 3M0IA 2C19A 3RLVA 3KXQA 1T8QA 4U2YA 2A7NA 5A6LA 1G0CA 4GMEA 2VI0A 3WK1A 2EG6A 1NF7A 4ZEPA 1UR9A 1V7AA 3TKFA 3E12A 1N2VA 4AZCB 4F2UA 1CXLA 2YA1A 4J9JA 4KS0A 1NWRA 4IP5A 2CEQA 3BO9A 3WFZA 2DT2A 3EDDA 2OYKA 2Q71A 2YL9A 1AA1B 3APTA 1CGYA 1GVRA 3GZ3A 5D04C 2GOKA 2FFIA 4Q8PA 3ELFA 2XWEA 4HN4A 3L2LA 3UT0A 1OGSA 5HMDA 1V08A 3UYCA 1JF6A 2XIOA 2YCLA 4QCEA 4O17A 2TODA 5BXTA 4NT0A 4XAGA 2I9UA 1VAHA 2F7FA 5M2FX 4L9YA 4TV5A 4YL2A 2QAFA 4BA0A 4IWWA 2PWFA 5HNNA 3EKGA 1V02A 5T9BG 2PTDA 2VX7A 4LBUA 4U3AA 1DQUA 1IGWA 5DT5A 4NNAA 4XD6A 3FVDA 3Q2DA 4LWWA 4R33A 1L8NA 3U4FA 4B5UA 3ZQ9A 6REQA 3D0CA 3BOLA 4GY1A 1JCXA 3MS8A 3WEMA 1A3WA 1XYFA 1G7UA 4B5SA 2DDXA 5HNUA 2XPKA 3TMLA 2P3ZA 3HGRA 2DEPA 3ZR5A 3ISIX 3GAYA 4RDWA 3M0JA 3LS9A 2Y8KA 2FDSA 4XZMX 3T9PA 4BZYA 4FOUA 1VJZA 3WY1A 1GVSA 1MUCA 3UJRA 4ILSA 3SCWA 4Z2KA 1XSIA 3SCOA 3ZOAA 3RO6A 1JDAA 4GIRA 3GBEA 4XTDA 4C6BA 2BMBA 2Y88A 1V0NA 2GOUA 5REQB 4RZBA 2CLMA 3PF3A 4JTJA 3CM4A 1ECQA 1F6YA 2HXUA 2YDQA 3B0UX 3LK6A 1FWCC 3VKKA 2FMNA 4JEJA 3FV9A 3SQLA 1JULA 3ATYA 5HMSA 4H9TA 5HANA 4XK2A 1GOQA 2HTMA 3G8RA 3B4UA 2XFWA 3PUDA 4UTUA 2GQ9A 3TE9A 1BVNP 3FEMA 2ZTKA 3SUUA 4KWVA 2DZXA 4MJ2A 3AMKA 4BQ5A 3LBOA 4H01A 4RV3A 4PR4A 3NA8A 3WDJA 2CLHA 1VFSA 1H0IA 3HZ3A 3L21A 4NJJA 5F7UA 5E9XA 1PZ0A 4XO6A 3UNDA 3MB9A 4C6JA 2VRKA 2PGRA 3QW4B 2FJUB 1ZGDA 1RLCL 3RF9A 4PBGA 3P14A 2R14A 4PUWA 1NAL1 3DG3A 1BWLA 3AOFA 5E93A 5A6JA 1EEPA 2Z6JA 5BRPA 1W9PA 3LSCA 2VCCA 5EB8A 2G95A 1Q6EA 4EVZA 2CLKA 2YCEA 3AYTA 4QG6A 1J0JA 3PC0A 3R94A 2Z7GA 2WWDA 5A2AA 3UG3A 2P5NA 4ACYA 3K13A 2VGBA 1C90A 3KL0A 1GKQA 3MWAA 1WDDA 1E9IA 4OBRA 2OG9A 1Y5WA 5BOEA 4IGHA 2I57A 3U8GA 3P2VA 2E8YA 5EBAA 1CXKA 1V6XA 3SBFA 4PSRA 1BXNA 2PDFA 4BS0A 2Y85A 3SJ3A 1U2YA 4J3TA 2VFHA 1EFZA 1T96A 3TOPA 3EX1A 3KBJA 4S2CA 2HVOA 3NQMA 4F79A 2ZRVA 1XQKA 3W7GA 3NDOA 4OFCA 3AHTA 4GNJA 4Y2WA 3ZJ7A 2X40A 5C70A 3FDGA 2CHRA 3UWYA 2QQ6A 1JGIA 3PNZA 4DX3A 2AAAA 2F9RA 2E4TA 3UESA 1JCNA 3GR4A 4YLWA 3LRLA 3SECA 2VDIA 3Q4DA 3SCUA 4EPKA 4IISA 3NM1A 1XYBA 2HNHA 1SGJA 4DQWA 3CNYA 4N9EA 1WYIA 1XIMA 2QF8A 4PL1A 5FAJA 4MNKA 1CX9A 2PDGA 1MVYA 3S46A 2X16A 1XQLA 2GGEA 4V28A 3QH2A 5EMLA 3HQPA 3RU6A 1X1NA 4R7OA 2WV8A 2W79A 2J7FA 3WQCA 1AVAA 3WH7A 5KSWA 5A8NA 1R3WA 1UA3A 4BR1A 2PLKA 1V3MA 4S3FA 2X2GA 1TKKA 1JCLA 4LV9A 1TTJA 4GVIA 1T6MA 4PMJA 3VNLA 2VOTA 2QPXA 1NM9A 4GQGA 2NUYA 2O7SA 3POHA 2E6YA 1XFCA 3D3FA 4WUIA 4G5DA 2PS2A 4EOUA 3G2GA 1WZAA 1XL9A 2BOEX 3NXLA 4JHZA 1NFGA 3N14A 3W6LA 1OYBA 2VD8A 4R27A 1E6ZA 3CPUA 3QQ1A 4RX0A 3NYDA 2QUNA 4NAFB 2ZIDA 3HQ1A 4B9ZA 4HZ8A 1HF6A 3TAOA 3REQA 4GYJA 1AQHA 3CMGA 1GCYA 3DFQA 5KZ6A 5A8OA 2QDGA 4QIUA 3WLIA 3C56A 3GNPA 1GG0A 1UWRA 3VA8A 4AH7A 3QR0A 3U2EA 2WSQA 1A5OC 1ZRQA 2WLZA 4V1YA 2D0FA 1XDJA 4QS5A 3B8IA 3DHDA 2JBMA 4LY4A 1OT1A 5C9UA 1TWWA 2QJJA 2WYSA 3P5YA 1B3WA 1GEHA 1W5QA 5FJUA 1KR0A 1SFLA 3PM6A 3W00A 3GFZA 3R12A 1PCWA 3BLOA 3SSZA 3VNIA 3BLFA 1OIFA 1TA3A 4MAVA 3MTWA 2OEKA 2DZTA 4QG8A 4LY8A 1EHNA 3BE7A 3TCEA 3A12A 1W37A 1KXVA 4J27A 3AO0A 3CUZA 3TN5A 3QFWA 1WOBA 2WPBA 3G1YA 4O16A 4GVHA 3OBKA 2WJDA 2WM0A 4AY1A 1IT7A 4GYPC 4TVUA 4DYKA 3QR1A 2O7QA 3TFXA 2XSAA 4JFVA 4M19A 4DO5A 3AROA 4WHBA 2DUXA 3KW3A 3LY0A 3NQFA 3MPGA 3V0SA 3CWNA 1GGOA 1BEUA 4LYRA 3L67A 3LCXA 3IGHX 1AD1A 4AX7A 4HTYA 4W89A 1ZJHA 3O2LA 4MYXA 1PB0A 1KXHA 4KGJA 1OFRA 3TNBA 2CWXA 3F4DA 3MKVA 1A0DA 2Z1SA 2XDFA 7REQB 1EH9A 4IICA 4FX6M 1EL3A 2QUTA 2NLIA 1RUSA 1ZPTA 4Q6JA 3WLJA 4GWEA 1D8WA 5C9XA 5CLTA 4OOZA 4RCXA 4ZO9A 2EKCA 3WQOA 3GLCA 3CAKA 1IZKA 4IX0A 3B9AA 4H9VA 4W5ZA 2DH2A 1PXGA 4MDOA 1TV4A 3QJAA 5AC6A 1C7TA 2MUCA 4C1NB 1KQYA 4WDXA 5LNVA 3FDKA 4XO7A 3SIMA 1WX0A 3AICA 1ME7A 4JDYA 3QMSA 3JVAA 6TIMA 4ECLA 4P2VA 4X3ZA 4RKAA 4AU0A 1PTGA 1KNWA 4NJHA 1AQ0A 1R3QA 1XYAA 1LROA 4L61A 1MWOA 2XGBA 1C9DA 3MUY1 3FFSA 4QX4A 1LQ0A 4L65A 1AL7A 1XUZA 3ABOA 4Q8QA 3AWNA 4O1EA 3CWOX 3UR5A 2DVTA 5D4YA 2G3IA 2NV9A 3AXHA 1E6NA 2A7PA 1H63A 2H90A 3GXDA 1MSSA 3EOLA 3SCNA 3PTQA 3BLLA 1MNZA 3ARWA 1MO0A 4ZSUA 2C14A 1UKQA 1TQJA 5I07A 2E7FA 5BMXA 1IEIA 1R38A 1TTPA 3QV9A 1MUWA 3G22A 1EA9C 1I2RA 4YJ5A 2ABBA 3CPRA 4BEUA 4DJFC 5DT7A 4HYWA 1ADOA 4QEHA 2EHHA 4C6OA 3QY8A 4RK8A 1Z48A 1YEYA 1I0BA 2W5FA 5I78A 1FWFC 3A3XA 4KEVA 5U7SA 4OZOA 1US2A 3IIOA 5HR6A 3DDMA 3BMVA 2AGTA 3TEVA 3B9NA 3VYLA 1M7XA 3TLLA 1PDZA 4HK6A 3SUWA 2OB3A 2X1IA 2V38A 4QAIA 3OZYA 1IZJA 1W1VA 4Y9OA 2CLPA 2YL5A 3T0BA 1OWQA 2VGGA 1QO2A 1KWGA 3PG8A 4US6A 2FLIA 3SFKA 2Z24A 4O13A 4LT9A 3IIPA 2X09A 2XSXA 2VD9A 3W7KA 5HMEA 1BG9A 3KVMA 3EWYA 5C2XA 3DENA 1UR3M 3S42A 3TYUA 3ZXWA 2GK1A 3W25A 2BY3A 1XCWA 2A85A 3NQ8A 2FFCA 3LCHA 1LT8A 3VMOA 2IXUA 3W2LA 1UR2A 3UERA 1ZL1A 3KRBA 3QTPA 3WKZA 4PMVA 4LOCA 3CHCA 3MMUA 1SFSA 2RH9A 1Z3NA 2FTYA 1D7KA 1XRFA 4CN4A 4HOWA 4Z2LA 2ESCA 3C0QA 4EK7A 1TREA 4LNYA 3AS3A 2CESA 4MYAA 2R1KA 1LG2A 3HMJG 1H2JA 3N18A 1FH9A 3B8UA 4US5D 1M53A 3RAOA 2F6UA 4ATDA 2J8FA 4R85A 1RK5A 3DXIA 3WF0A 1SZRA 4AEOA 1WKYA 3BUVA 2YSWA 1S3HA 1YNQA 1TUFA 4LEQA 5FIPA 1NDZA 1W5MA 4FIQA 1GORA 3PN8A 1J0ZA 2WQPA 3M43A 4N9DA 4PBEA 3MU7A 2ZDRA 1DQWA 4X2RA 5D02A 1EC8A 1W8GA 2VURA 3E2VA 3PULA 2PA6A 3ARTA 1LORA 1ONEA 5I3FA 5FJIA 3LI0A 3VNKA 1PZ2A 4Q4OA 3U2CA 1I9CB 3GYEA 3S8HA 4UQBA 3S6OA 2PU1A 3BSHA 2OODA 4LVAA 1R30A 3OP2A 4PA8A 4WQ6A 1GPWA 4BWLC 4PUJA 6REQB 4I7UA 1H41A 3GVQA 1OYAA 1QTWA 1Y5VA 3SRKA 1HT6A 4KWUA 3N6QA 4LXFA 3C86A 4F9DA 1VYRA 4U4MA 4CVUA 4PB4A 5AC7A 1TPEA 1OADA 4JTRA 1VR6A 5IDZA 1Q6GA 3LG3A 5I5RA 1LP6A 1E6QM 3D47A 1RBLA 4IQJA 4K68A 3M0XA 1EGVA 1GT8A 1V3KA 5JQ9A 4LRSA 3U9IA 1QI2A 2ISSA 5IXEA 3TIMA 2E9LA 3FN9A 4JTAA 4Z2HA 1AH4A 2Q8XA 4LS0A 4TO8A 1QOXA 1XSJA 3IJQA 2QYGA 3WH5A 2YA2A 5FF2A 3R43A 4CU6A 2XGIA 1YADA 3M7WA 3NL6A 4BHYA 3QHNA 1VLIA 1UQZA 3WN6A 3EWZA 3QC3A 2CLOA 4JTIA 3T55A 3SEPA 1NP0A 4UQCA 3P8JA 1REQA 3KP0A 3LA4A 1GZGA 4YIWA 2D3NA 3H12A 4W7WA 4PTNA 4XSLA 2ZYFA 4ZQNA 4KWOA 5F2IA 2FYMA 4Z1YA 3K2GA 2OCZA 2YX0A 3GDKA 4YTTA 3TH6A 3LUTA 1DIEA 4A8LA 4JTLA 3TA6A 3P60A 3C5QA 4MLRA 1CXIA 1M7PA 3NR0A 3I3EA 2TYSA 2VCBA 1UR0A 1SPQA 4QJ3B 3WELA 3WD0A 1C7SA 1BKSA 1XKYA 4YXGA 2OEJA 4JQ2A 1YDNA 2RGLA 3C8FA 3F2DA 3N17A 1M7JA 5G2HA 4P7QA 1JYVA 1SO6A 1ZFJA 5BYWA 4FNSA 4MWAA 4AWTA 4PL2A 3VE9A 4RW3A 4AY8A 1N8IA 4IIBA 4M6VA 3BAXA 3WX7A 1FQ0A 4UQAA 1QHOA 4KRZA 2W61A 1E4MM 2E1DA 2PRMA 3BTNA 4PTDA 3SN4A 4L1WA 1HKKA 4YTUA 3O07A 3AS1A 1CXFA 3A47A 4K1WA 2PDPA 1J6PA 2Q02A 3JS3A 3EDJA 3OIHA 5E6ZA 4AD3A 1B90A 1YTDA 2YPIA 1KRBC 1XSKA 4GIAA 3E2RA 3BARA 3UY7A 4Q4QA 4DO6A 4LTSA 2IUZA 4RDVA 3CEPA 1KM6A 3LHWA 2GJXA 4QE5A 5C9ZA 4CQBA 1XIEA 1VRXA 4GC3A 3E0LA 3T44A 4ATLA 3TW7A 2JKAA 3W73A 3L5AA 4ORMA 3IUHA 1E55A 5LHFA 3O06A 2FZMA 2NQ9A 2GJNA 2P8CA 1Q13A 2VZSA 1AJZA 1E0VA 4R9OA 5I00A 3CH9A 2ISVA 2DFAA 1CWYA 5LGZA 1G4TA 1HFBA 3DC0A 3M5ZA 3QF0A 1KRAC 4LYQA 3CB8A 2GSJA 4Q32A 2CITA 2GPTA 3Q45A 1Q4NX 3T05A 2VGFA 3E0IA 5G1TA 2ZZ7A 2OOFA 3H4XA 4QCFA 2IPGA 1WXZA 3TSMA 5TQLA 4KIEA 4DWSC 1DWHM 3F1QA 2XISA 1PS9A 1ZB5A 2PPGA 1I2OA 3HU7A 4M29A 1B4EA 5CGQA 3UXKA 4BK9A 2DZBA 1SYTA 4OBSA 3CQHA 5GNYA 4IGSA 1XW8A 1TX2A 4XX6A 3UWUA 3VDHA 3GNRA 7TIMA 1UB3A 2FGLA 4ZO7A 3LHVA 4ZOAA 4TX9A 4A8NA 1DORA 3T6CA 3ITTA 3N6HA 3UXDA 1CXEA 3VNYA 3EZ4A 1BYCA 1KFKA 3R6IA 3QBUA 3FJLA 3URBA 3KCLA 1YNYA 3OB8A 2EPMX 3R58A 2Y0FA 1DWJM 1QCWA 2FTWA 2WK2A 4O52A 3LPGA 3I65A 4LVFA 1JRCA 2QS8A 1IHIA 1TA3B 2HXTA 1A3XA 1MUMA 3TU9A 2ZUSA 3VO0A 2AQWA 2DSVA 3AZSA 2ACSA 3PAOA 3AIUA 5DN1A 3NPUA 3WLLA 1WCGA 3GB6A 2A3BA 1UUOA 1UC5A 3TYAA 2NQZA 4AWEA 3MVIA 4IL2A 1KLZA 1JR1A 4TVCA 2J9XA 3INPA 2VRJA 3BAYA 5IBXA 3W6YA 3BICA 1XLFA 1R86A 1LUCB 4XAZA 3P93A 4W5UA 2QCDB 1EYWA 1W9VA 5A95A 1FHDA 1K9FA 4IIEA 4B3ZA 3SCPA 1LZOA 3W85A 3WDHA 3Q58A 3H24A 4GGHA 5G2IA 3H2CA 3LRMA 3W3OA 3SN1A 4MB4A 4PMNA 3VKBA 1EXPA 2ZTJA 5MKGA 4Y9MA 1I1XA 4RZ6A 4DJFD 2W91A 1HGYA 2YDRA 3H55A 3T0DA 2OLSA 3VIGA 1GQNA 2CKRA 1D3HA 3A4XA 1UP3A 4Q6XA 1EUAA 3B06A 3W23A 1YX1A 3VNZA 3XISA 3MYOA 3LN3A 5AYIA 4O28A 3T0CA 4HSHA 4FR6A 5A6SA 1XI3A 1Z42A 4C91A 3KHDA 3RO8A 2PDYA 1NSJA 8CGTA 1L6SA 4CD4A 4AF0B 4QISA 3VZXA 2DT0A 1UD4A 3ALGA 3RHGA 1QO5A 1W32A 1CPUA 4RE4A 2PB1A 2Y70A 1ICSA 1H7PA 2Q8LA 3DBPA 4NJKA 1RD5A 2CU0A 3ARZA 1S2AA 1HL2A 3GO2A 1OFDA 1FWGC 4DNMA 3FJ6A 5XIMA 4W4QA 2ZUTA 4TMBA 1W1ZA 5DRIA 1UZ1A 2ZX6A 3U6WA 1M65A 3CU2A 1O5QA 3MUXA 5LYRA 4R34A 2REQA 5LXEA 1NVMA 1R46A 2OPJA 3R11A 1UC4A 1QOQA 3TC7A 3RGTA 1GKRA 2NV2A 1JXKA 4ZXOA 2PTYA 5E5CA 1XIDA 3BAJA 2VTFA 4R9XA 2E5CA 3RLGA 5TF0A 4GX9A 4MKVA 3ITLA 5BMWA 3SRDA 3ZO9A 1MFUA 5A8QA 5FJRA 1DIDA 1JZ6A 1EZWA 1AH3A 3GNOA 2Z1BA 2IXVA 3TZFA 5A8PA 2I14A 1E6SM 4AC7C 4QRNA 4A2SA 1KM5A 4EXAA 1P0BA 2VFIA 4IQLA 1LOQA 2NVDA 1O6IA 2GGGA 4AD5A 4PE8A 2IKGA 3MT1A 3QOKA 1KFWA 5JVLA 4DEFA 3HTWA 3UPWA 1PZ1A 1TMHA 1SUXA 4NF7A 2FHFA 2CC0A 2YXXA 1HNYA 3L4XA 2BHYA 4DJEC 3RPTA 4FHAA 3GU9A 4KERA 3S6TA 4JBRA 2PC4A 1HIZA 1KQZA 1WP6A 1RH9A 4K7VA 1K6WA 1GVFA 1OG0A 2LLEA 3VD4A 1J5SA 5GJMA 2YR1A 4DZHA 4V27A 1T8XA 2DQXA 3B8SA 3A4WA 3LGGA 3WH9A 1LWIA 4X63A 3F5JA 4F3HA 1UR1A 3I4KA 2O9OA 4PTVA 1R6WA 2YL8A 1PIIA 3GHTA 5IRPA 4DPQA 3GE7A 4XKYA 3U0HA 3PPFA 1I4NA 2VEGA 1XUUA 3W7QA 2CLLA 3AYRA 6ALDA 3VCCA 1TWSA 3WZ0E 3CHDA 3IJ8A 3GVVA 4K3ZA 4QNWA 3RPMA 2TRSA 4O0ZA 3UWQA 2EPHA 3FY1A 3IAPA 4QTGA 3UVIA 4AXKA 4P7NA 1JI2A 5JXQA 1LL7A 3RRXA 3LNMA 4GH3A 2ZVRA 3TFCA 4Z17A 1VKFA 3TJLA 2UY2A 2INEA 5HJYA 2HJPA 1ITQA 2C79A 1RXOB 3G24A 3MC5A 3BOXA 2WXDM 4B3LA 3WD1A 1O95A 2XN2A 1I1WA 2BLEA 4NZCA 2B81A 3CQIA 2Z0IA 3WNMA 2FVMA 2WMHA 3W22A 2TMDA 2OQLA 4XAYA 1JL8A 1KCXA 2PP3A 1W9BM 2DZUA 3QGVA 1LLWA 1J2WA 4UTIA 1W3NA 3ARSA 1TVLA 4Q7NA 1Q6DA 2CERA 5B7ZA 3G77A 4XUYA 3SGUA 4DYJA 3SN0A 2WMIA 5I02A 2V5KA 1GYMA 5LNRA 1X7IA 2EPKX 4NG3A 4JNZA 4JX6A 3GD6A 1H3GA 4NZ1A 1PCKA 1DWFM 1FH8A 4CLMA 5ECVA 3ARPA 2QCFA 4DZ5A 5HR7A 1S3TC 1XGEA 4FXRA 3S3GA 3ZM8A 1UD3A 3FA4A 3E2SA 1TTQA 5I3IA 3VOHA 1CLKA 2AGKA 1DPMA 1OZMA 1IT8A 1EIXA 1FXQA 4AZ6A 3TQPA 1A53A 4XG1A 2X05A 3N19B 5GJNA 1XIGA 4RNHA 4O14A 4XBJA 2UY3A 3M0LA 3CLMA 3IJIA 3NAVA 1MW2A 3PZMA 3SZ8A 4M81A 3BG9A 2I16A 2EPOA 2CLFA 4HMNA 3NO5A 2ZUNA 3D46A 4K8GA 1V0LA 3O6AA 3UPMA 3V35A 1RK6A 3PPCA 4ATWA 4Q8OA 4X0NA 1E15A 4UTWC 5CAHA 1FWEC 1REQB 3H2OA 3AZRA 1A5UA 1XINA 3PTDA 2FKPA 4AY7A 4E3VA 1UCWA 4FLSA 4GK8A 5HQLA 1XYLA 3II1A 3PWIA 4PTMA 5DMMA 3T42A 4PUMA 4DBDA 3GAKA 4YU1A 1C8XA 1JZ2A 4HT3A 5DCBA 2OO0A 3FJ4A 4GXWA 1TJRA 3A5VA 4GNVA 3O1NA 1AJ0A 1T41A 1QI3A 2DIKA 3S2LA 4KH2A 4DUXA 5MHBA 1HJWA 2WCSA 3V1PA 1CGVA 1VP5A 1UQYA 4GG9A 3QLDA 3VUSA 2FHCA 4PCFA 1JZ4A 3WF2A 4YYFA 1FWTA 4MWAB 3ARVA 2CETA 3ZT7A 3ZT6A 4QSFA 4ZVJA 3CL8A 3R0UA 3BH4A 2V30A 1QT1A 1JDFA 4HQVA 4D6EA 4H6KA 4DWSD 2O56A 5CG0A 2O4MA 1ZJBA 7XIMA 3N4AA 1UP0A 3VFCA 3FLUA 3WCZA 3ARYA 4Z08A 1J96A 4M8UA 1BD0A 1FCQA 2CHNA 4L1XA 1PHQA 1DJIA 3TWBA 3S2NA 1PYMA 1YYAA 3SUTA 5FF0A 2YL6A 1A3HA 1CECA 3N34A 4JFWA 3ZVHB 5EL1A 2YKKA 3N2XA 3QVQA 3DFPA 3PJTA 1QPOA 3MCNA 3HV9A 3IK2A 1E56A 2EJAA 3BZGA 4DUVA 1L6WA 3PANA 3MMDA 3MKKA 1O5RA 1M9HA 4AAJA 4LPCA 3NQGA 4HKPA 1ZU8A 3LV5A 5G2WA 3F03K 2PTXA 4RE0A 1IR2A 3EB2A 2V5DA 2V9DA 3WNKA 1SZFA 1E6XM 2AL2A 2E68A 4M6PA 1DIKA 1V03A 5EMUA 4JXCA 2WSKA 1QNQA 1T7LA 1PIFA 3B0YA 1MYRA 5I03A 1H62A 4GO9A 1A4LA 2GVLA 3OIXA 4F2BA 4UTFA 3ZLHA 4PGLA 2Y61A 5DCDA 3WJZA 1Z44A 3N12A 1EO5A 2V5LA 2VEMA 1R0MA 1VB9A 5CKSA 3B04A 3RRAA 4PMUA 3C61A 4NAEA 3VIHA 2E6FA 3KLKA 3TYCA 3BPWA 3GHRA 3GFYA 2Z29A 3OG3A 4ADSA 4KFPA 5LNSA 5A5WA 5L6UA 2P50A 4XAPA 1X1ZA 1J0KA 1OG6A 3THDA 3UW6A 2HWGA 4CNUA 2E9MA 4TX8A 2PBGA 4FF7A 4FB7A 3HURA 1QPQA 1AZ2A 2HZGA 4CU8A 4H19A 1DJGA 1UIOA 5CPNA 3KZSA 4Z1BA 4MB5A 1QNPA 4ALDA 1NTHA 1ONWA 3V0TA 3K8MA 3ME3A 2G50A 3IVTA 3WFLA 3BLDA 4MJZA 3W1AA 4HIBA 3KOYA 2ZUWA 3WLKX 1UWQA 5I3DA 3R89A 2QUUA 2X0YA 3ALFA 3UGVA 3S2MA 1WXJA 4QBXA 4TX6A 5EU9A 1FWRA 3MUIA 3MUZ1 2KX9A 1W5OA 1QNVA 1VJSA 5I3KA 4AMAA 3DCPA 2A3CA 3A9IA 4GQBA 2A4AA 3W7EA 5KETA 1ZAIA 4A3UA 5C0QA 4X2PA 1TV7A 3FYPA 1P7TA 4PMRA 3HJZA 3N29A 2CIPA 5CZJA 4YTRA 5AVHA 4L4OA 3IV8A 4WDUA 5C7VA 4I90A 3KLLA 4OQVA 4PMZA 1JXJA 3PBVA 2P10A 4IQDA 3ABRA 5J8LA 1HKVA 3VGGA 1XPGA 5F4SA 1UYQA 3L4WA 5T8GA 5I2UA 5MKGB 1CGTA 3NZRA 4HPNA 4EX4A 4HJFA 3M6DA 3ABQA 2R82A 3BMXA 1OC6A 2RDXA 4WXYA 2QV4A 3GWQA 3EOOA 4CQ9A 5EBUA 3SCRA 1O5KA 2WVVB 4AFYA 1FWAC 1XLHA 2BX7A 3W01A 2BP1A 1YE4A 1H7RA 4GI6A 4H83A 1UASA 1O1HA 3QM3A 1TPWA 2EPLX 1MEWA 2GUUA 3DFSA 2IQ0A 3M0HA 3T2QA 3LGEA 4Q4KA 1G67A 3VIFA 4H9YA 2WZHA 4I5XA 3VOCA 4IHCA 1TR1A 2A3LA 1BXCA 3STEA 3QSTA 4AXNA 1K1DA 4C7GA 1JFHA 4UR8A 4DJED 1IQ8A 4IG2B 1R87A 1XXXA 4KEZA 2BGNE 2PMQA 4QSHA 5AFDA 3T0AA 1F3XA 3T4CA 2BNJA 2XH4A 1U22A 1XCXA 3TLQA 1SR0A 2GFTA 3BLKA 1CDGA 1D7FA 4D8ZA 1BTMA 3R7MA 5HDRA 4P7LA 4NJGA 1KC7A 4IJRA 3GDTA 4H1ZA 1B57A 5KZEA 5AHLA 3ORWA 3WUEA 1OFEA 2REQB 3OBAA 2ZA2A 4KRTA 4ZFMA 3H7UA 2XJ7A 4DBSA 1MEHA 2NXHA 1RQBA 2E25A 3LLDA 3O05A 4IMGA 4ZE5A 5HBFA 4QLLA 3JR2A 4KGLA 1E4LA 4GD0A 3QPEA 1AW1A 2PF8A 1UZDA 2WMKA 4C1KA 3NM3A 3DERA 3U7BA 2WHLA 3QZ6A 2E6DA 1DE5A 2ZFAA 3I3DA 1A5BA 2QW5A 1P48A 1SFJA 3CZ8A 1H7WA 3EPMA 1L9WA 4DAFA 5GNXA 2VGIA 2J9ZA 1MI3A 4P7RA 1OX6A 2WCAA 3SURA 4HA1A 1HJQA 2A0NA 4O15A 2ON3A 1QASA 2Y7FA 1VRDA 1JEZA 4HVXA 4GJJA 1FOBA 5I7GA 4JGDA 5L9FA 3NTYA 1JDCA 3AIEA 4PTXA 2HNEA 3DFHA 4I5UA 4O0KA 3L4TA 1J10A 4KRUA 3WF4A 4RE2A 3AC0A 4OV9A 1EOMA 5FEWA 2XH2A 1KGWA 3TMQA 5ABFA 1TWDA 2XVLA 2WVTA 3SAZA 5CPLA 2XIJA 5I3JA 4UTLA 3H2FA 3FSUA 1WAWA 4H6EA 4LH8A 4RV8A 3VINA 3CUXA 4C6PA 2OXNA 1UMLA 3HM7A 1G01A 4ZCWA 1OGGA 4Y9NA 3VXGA 3Q37A 1XP3A 3CL6A 1NWSA 3QRHA 4EAMA 3DN5A 5C8BB 4DBEA 4AZCA 1OFBA 4FI4A 2OSWA 1GVOA 3CTLA 1WE5A 4XQ6A 3W02A 1UMYA 4UXDA 1BF6A 4O57A 1S2TA 3H8AA 2XM1A 5CPQA 1B4KA 2V81A 1SQ7A 1CBGA 1HTIA 5LKYA 2OWXA 2HE5A 6PTDA 3AHYA 4KQNA 4U2ZA 5FACA 3NL3A 3IANA 3M4HA 3K4DA 4Y9AA 2Y6ZA 4AHPA 4MHBA 5BXRA 3GU2A 4N9BA 2NW0A 4OECA 4LAUA 1RPKA 5G1YA 4D71A 3BQ5A 3M47A 4IX2A 3TTOA 2OGJA 5KTLA 3AQUA 1UR8A 4JYDA 3GC5A 4UFKA 4QXIA 3BV4A 4J7RA 1WKDA 4GC4A 8XIAA 3KAOA 1R9ZA 2GQAA 2VQTA 3STFA 2J79A 2PF0A 4ZTYA 1F74A 1DQXA 3AJ7A 2WZTA 4YVVA 1HL8A 4ZODA 3OG2A 1LWJA 4GCXA 4WGXA 5F2MA 1XLJA 2BFGA 4F4RA 1MEIA 4GBDA 3SADA 3CUIA 3NZ1A 1I6NA 4J28A 3OQEA 3GVRA 1JQVA 4LUSB 4JNYA 4QM1A 3FKKA 4CD5A 1W3HA 3ITOA 2VYOA 4LB4A 1R8LA 2XU2A 4HN8A 2Y7EA 2C3ZA 4O1CA 4C6CA 3G5EA 5M17A 5I23A 2R6OA 1POKA 5ABGA 4Q8MA 1XLGA 1ZAHA 5AZ1A 5HXMA 1SW0A 4Q8NA 4JICA 4EANA 3Q67A 1CZ1A 2ZX8A 2CPUA 3UCQA 5REQA 4EWJA 3KOFA 1JZ7A 1X39A 1ISVA 4IH3A 1JPDX 1GUVA 3A4JA 5I6SA 1OFQA 4WJXA 3N13A 4B5WA 2PWGA 2XFYA 4LCRA 2CLEA 3L66A 2UWFA 2YCJA 1EX1A 2YW4A 3UR7A 1HGWA 3K4WA 1RP8A 1VFFA 1VBHA 1CLVA 2ZADA 1UD2A 2PDKA 5D8WA 4BQ3A 2F6XA 1V8EA 4W84A 1K8XA 4JTHA 3SR7A 3IWPA 2GZXA 3M1ZA 3GM8A 4V1XA 3VPLA 1JYWA 2FGZA 3HQOA 3FXYA 1FWSA 1EX5A 1FDYA 4HU0A 3TTEA 1FHUA 2WW5A 1DKWA 4HPJA 5H8MA 4GY0A 2GYIA 4Q7BA 3CO4A 2Y8UA 3C6CA 4UFJA 3ZWSA 3UJEA 2HDJA 5BCAA 2QCCA 4LBRA 3DFOA 1PJ9A 2GJRA 3LMYA 2X1TA 2X7VA 1CYGA 3EEGA 3DAQA 2AMGA 2PD5A 3CMFA 3QXBA 3P74A 2JKPA 5CPTA 1B3OA 4GQ0A 2V82A 2BY2A 1MXDA 4M0XA 1ODUA 3LPOA 1XLMA 3UZYA 5K4XA 4JEQA 5TNVA 1X6NA 1WZKA 3EMQA 4ZQCA 1V4YA 3O6DA 2W67A 1K4GA 3V5FA 8TIMA 8A3HA 3K8KA 5A6BA 2RDUA 3WDPP 4ICMA 3R10A 4JTFA 1WDQA 1YE6A 2WC3A 4YHGA 4AIOA 1WXYA 2YA0A 4CQCA 1U5VA 3FK4A 3ITGA 4IPJA 1RCOB 1XLDA 4WD0A 3VZYA 3BJTA 1TPVA 4BEQA 3W07A 3CH0A 1EWEA 3CV2A 4K37A 1VEPA 1C91A 2QMJA 3HQNA 4UTTA 4C6IA 2V3GA 3ARQA 4XBKA 2BXVA 1EDTA 3DECA 3NDYA 3OBEA 4I5RA 3AUJA 3LHTA 1KW1A 1XLLA 4CQAA 1N8WA 3W7CA 1YPIA 2I56A 1S5MA 4IIHA 4HZ6A 4JYFA 4L7ZA 5DO8A 2JALA 2X1UA 3QGKC 2KZHA 3HIJA 4JAWA 4ZB5A 4B5TA 1M6JA 3BV7A 1TO3A 3NZGA 3U4AA 2FVKA 4FOKA 2PLCA 3CT2A 1FRBA 3OJGA 1Y7VA 2F61A 4O53A 3GS6A 5CLWA 3GG0A 1FCVA 1JQXA 1DEDA 2EG8A 3KBMA 1OZQA 4NAFA 4B2DA 4JTTA 3NQBA 3HG3A 4R7WA 2E5BA 4Y9PA 3QKEA 4AD0A 4YCPA 3QHOA 1S2CA 2Y7GA 1HKMA 3T2PA 1QBBA 3HB9A 2WMGA 3H22A 2C13A 1DIOA 1RBAA 4F66A 1HUVA 1E4NA 2ZXQA 3WQVA 4DO7A 4DBUA 1ICPA 1VQTA 3B03A 4S1FA 4FZIA 2YJQA 3EOSA 3WD2A 3GSMA 1JDDA 4ZENA 3E38A 5JIWA 1VFHA 4A29A 4PMOA 2PWVA 3T1GA 3UG5A 1AJ2A 3TTQA 3WK2A 1NY1A 3MHUA 2RDTA 3W29A 3WL1A 4UTJA 1SSDA 3O8AA 4KBXA 2DVXA 4JFSA 2F2KA 4I7WA 1U5JA 1PX8A 1C3FA 1HJVA 1CCWB 3UCCA 2R24A 3GG1A 4H00A 1ZSXA 3USBA 1OC5A 1X1OA 4RJEA 5HJLA 5A69A 1H7NA 4HNOA 3DEQA 1CEOA 2XVKA 3KVJA 3WNPA 2ZBTA 3T40A 1E0XA 5AN7A 2EJ1A 4F2TA 4ZA0A 1RR2A 4K1GA 5FJPA 1P7TB 1A4MA 1HN1A 2PDNA 2DT3A 4N4PA 3RU8X 4V2XA 4IXHA 1XDLA 4I9JA 1FWWA 3CO8A 1VCGA 3R5EA 4L56A 4DM1A 4HK7A 3DKJA 4H6RA 1B3ZA 1T5AA 2X8RA 2VC7A 3BGJA 2B7PA 3HGSA 4S3GA 4QP0A 3L4UA 2BVYA 3VNJA 2E8ZA 3KWSA 3UR8A 3HG4A 4X9SA 1M01A 3NQEA 4LVBA 2C1GA 1BWKA 4MKSA 2BY0A 2P8BA 5DY2A 2CNCA 4W93A 5D9MA 3BCFA 2E0PA 3CWHA 3NL5A 5A2CA 4GNKB 3CV1A 1D3GA 4WLCA 5HK4A 1PVNA 2EGZA 4D72A 2YBUA 2POZA 4E0CA 5BOOA 4PRTA 4C1NA 1QPNA 1E0WA 2V8ZA 2YDAA 4FALA 1CGUA 2EEXA 2C71A 1LQ2A 3MP5A 1LLOA 5CPMA 3MSDA 1KR1A 1TZ7A 2Q01A 1VFTA 2X2YA 2OVLA 3PBYA 5D8ZA 4AHQA 2E77A 2O9RA 1JUEA 3B9DA 5HNRA 5T26A 2QJIA 1DV7A 3W27A 2C1IA 4J4KA 4N6FA 3JW7A 4WIWA 3VNMA 4U10A 1A5LC 3AUOA 4BQ4A 2QCLA 4IXXA 3H4WA 3FA5A 3S1GA 1H1NA 4XISA 1V7YA 4GVFA 4QITA 3P61A 1SW3A 3QR3A 1EJ7L 2H3BA 2XVPA 3MSYA 4R5EA 4MDPA 2DQWA 1ZJIA 4R7JA 1W8SA 2RGMA 2D24A 3AU6A 4WF7A 4CD7A 2YIHA 3FW6A 6ENLA 4S3AA 1LTDA 3N6JA 3H2EA 1PIGA 4IPPA 1K8YA 2OYMA 5JMUA 1EBGA 2J24A 2VFEA 2AKZA 3ZMRA 4M7TA 4S3EA 1KM3A 4UNKA 2C7FA 1V02E 1IEXA 1W2VA 4FF5A 2DH3A 4YPJA 1F4AA 2DGAA 4MWAC 3S5ZA 3NSXA 3CAVA 4CQDA 4IP4A 1TZZA 1ODZA 4QDMA 1KM1A 3YPIA 5HPOA 4NZJA 3BCJA 2QPSA 4BF5A 4GE8A 3KBNA 1RJRA 2DJLA 2A6LA 4Y6GA 5TAOA 1IXQA 2NT1A 3B0PA 3HBLA 3W1LA 1DJNA 1LT7A 1OD0A 4POCA 3VD5A 2DUAA 3ANUA 1OINA 1L6YA 3KOZA 4HNUA 1HO4A 3H2MA 3HPSA 5D05A 1UWAA 3S1UA 2GGHA 2J7BA 2JGQA 5E0FA 4W9TA 4CN6A 3EYPA 3XIMA 3EX4A 3W2MA 5ABFB 3CQKA 3TP4A 2H9AB 3WMSA 3E1F1 1P0DA 3WQGA 3M0YA 4AQLA 3DOPA 4B4FA 3H4GA 3HV8A 3MBDA 2WBGA 3VI2A 2VX5A 4INFA 3M41A 4LV4A 1Z32X 1S1PA 4MY1A 1E6PA 1JPKA 3DHFA 4W8LA 4MVAA 2YLLA 3EDEA 4RE3A 1J2BA 1EDQA 3BZJA 2VT0A 3A21A 1VFUA 2ZA3A 4DUOA 2CLIA 1MMFA 1B3XA 2Q09A 2D22A 2Z00A 3PSWA 2ABAA 2GQ8A 5FEZA 4DB7A 1EKOA 1OABA 4Q8UA 7CGTA 3A24A 4ZTXA 1HP5A 2PDQA 4KW2A 4XB3A 3NG3A 1XBXA 1R3TA 5DMYA 3GXMA 2FH8A 4ZB0A 1H7XA 4CCEA 3KCOA 5AC8A 2Q8ZA 1U1UA 3DFYA 4S3CA 2YYTA 2QR6A 1Q6OA 1JCYA 3ABZA 1W31A 2V2HA 4A4AA 2QCNA 3AXXA 4NXKA 4NXSA 3VABA 4D2JA 1XYZA 5TD4A 3UQNA 1P43A 2D0GA 4ZQPA 1J79A 4IMDA 3ENLA 4CNSA 4B9YA 5HAOA 2RUSA 4OT7A 1R7AA 3RR4A 3DBNA 2EKGA 4TU1A 4LYKA 1YIXA 3FAXA 3M64A 4NNCA 2R9RA 4IPLA 2G97A 2QZRA 2DUZA 3GK0A 2AMXA 2VVSA 4V15A 3QPZA 1BPLB 4YTQA 1JRBA 4X0VA 1VPXA 5FF7A 4NY2A 1JG9A 2BB0A 4L6HA 2QUMA 4F0MA 1JZ3A 4JTQA 2XN1A 5CPOA 3NQ6A 2Y62A 4B91A 3HGOA 5EMKA 2B7NA 2HMCA 1TELA 1CT5A 5HNTA 2PDBA 3CYJA 4ES4A 3GXNA 3M0VA 4EWND 3JZUA 1X97A 2G3NA 1ISYA 1VCVA 2JF6A 4O12A 1X8FA 2R1PA 4ORIA 3SM0A 1FBAA 3PWAA 3W1MA 1XICA 2P76A 1UHVA 5GJPA 3QGAC 4QJ4B 1YXYA 3W2KA 4IUGA 1T40A 4H41A 4JZ5A 2H8XA 2AQOA 2CZ5A 1OM0A 2D69A 2OLAA 1SJAA 1OBAA 1B31A 1G1YA 4HSNA 4K39A 4PCPA 2P3EA 3NQCA 1LOSA 3BOFA 2ACUA 3H26A 2O4QA 1W1B1 1L6GA 2P88A 5FOOA 3P3BA 2O0TA 1IIHA 5DELA 4CUCA 4LANA 1NIUA 4RW5A 3RM4A 3N2CA 2J4GA 3NL2A 3CMJA 5CSUA 2FDMA 3WNLA 3WF1A 3CGTA 4NKCA 3SW6A 5D2TA 1KTBA 4M80A 2IKJA 3ZT5A 4M51A 1KTNA 4B15A 3ABXA 2HS6A 1VS1A 3AHVA 4U5IA 1Q65A 3K8LA 1K77A 2TPSA 2PZNA 4GYKA 2VR5A 4F0LA 3SY8A 1GOWA 2Z7KA 5LIXX 3I6EA 3G1RA 1V51A 3S83A 2YCKX 4FLRA 3VMPA 3GH7A 2BDQA 4WX2A 7ENLA 2BY1A 3U7VA 1LRTA 2J8TA 2PTWA 4HYVA 4HHMA 4MY9A 4WR3A 3VIIA 3RPDA 1B30A 3DX5A 1Q3NA 2INZA 5FEXA 3G1AA 3G1DA 6TAAA 2VEPA 2B31A 2WAGA 2WKGA 4DF1A 5T9CE 1P0EA 3H6OA 2PFHA 2J7CA 2FJKA 1GZJA 4OUEA 5DBUA 4PC8A 1KA9F 1JFXA 2PLMA 2FH6A 1G94A 1F8IA 4QJ1A 3WUGA 4HU4A 3VC5A 3M0KA 3G6MA 1BG4A 3W53A 4EXBA 1K8CA 2VHLA 2WNQA 5BOFA 3USZA 3KTSA 2IQDA 2YBVA 2VL4A 1SU5A 1RVGA 5LIYX 3E96A 3O0FA 1SM9A 2VEIA 4HA3A 3PUGA 1QPKA 1XLEA 1TV2A 3LXAA 1TV5A 3TDFA 4TMCA 5BU9A 3LRKA 3CUHA 3T2OA 1R2RA 2OKOA 3TA9A 1ZS2A 2F84A 2PEVA 5C7HA 4JHOA 3NWRA 4NP7A 2J8GA 5HPCA 1QI4A 1M5WA 1KTCA 1MQQA 3R0KA 1VBRA 4DAIA 2QPUA 4WK9A 3O16A 1PEZA 1ONXA 2GVYA 3RIKA 4AWUA 1ESWA 2QHAA 3WBYA 2O9TA 4NHVA 2VNCA 5H1WA 4E8DA 4RZ4A 3VOGA 1TMLA 3B9EA 1RAKA 1QXLA 1B9ZA 4AWSA 1O12A 4UQDA 2ZCGA 3EOEA 3EGJA 4G9PA 3L23A 1UH2A 3GW3A 4PCSA 1R3RA 4E2OA 2PC8A 1ZCCA 2OX1A 4ZOBA 3CTTA 3P6LA 3G1VA 2PSNA 5XIAA 3NQDA 3RXZA 3GUWA 3ZSSA 2GJPA 4IFOA 1EZ2A 4IPNB 1JF5A 1IF2A 4LAZA 1OEPA 1OB0A 1ZUAX 1W0MA 3IUDA 4GHRA 3EMZA 3ITVA 1AFSA 1KBBA 2CKSA 4JS3A 4YNGA 4FS9A 3CAWA 4CN1A 1DHPA 4AIUA 3KDOA 4C6MA 1NQKA 1Q66A 1ZZMA 3LM3A 4C6FA 4Q8VA 3W88A 3LHUA 4LCQA 3BGGA 1OCBA 3MI6A 3THCA 2NV1A 1K70A 1TR9A 3IGXA 3TUUA 4O1DA 3QN3A 4FOJA 4IGMA 1UD6A 4HPGA 5JBFA 1YDVA 1UZ4A 3R8RA 4RR4A 2E09A 4MFEA 5D32A 3ATZA 3N2TA 5CXPA 1U1HA 2XHYA 4DJDA 2Z1WA 3T09A 1KCKA 2OMAA 4ROQA 5A6KA 2VOMA 5I06A 2IPWA 3R8GA 1OJXA 4LAMA 1A5NC 3B4YA 2WSPA 2X0SA 1K7FA 3TC3A 3MW7A 4RXGA 3MI2A 1AW5A 4ASTA 3UWZA 4GZIA 1LUCA 4GVGA 1FUYA 1Q6RA 2QCDA 5HWNA 1EQCA 2EF9A 2W0UA 3HFYA 1TVNA 3SGGA 1TJPA 2C8NA 3EX2A 3W38A 2XUCA 1QK0A 1SJDA 2YXGA 4C6EA 1G4PA 1JPIA 3WLRA 2JE8A 2DW7A 1R9XA 1WB0A 4HNCA 3PJXA 3EA2A 2DZAA 3VD7A 2ZA1A 3I10A 3OLGA 5HQMA 4NX0A 3SQSA 1PX3A 3VKCA 4KEUA 2VDHA 1Z8AA 4U31A 3PHAA 2Y89A 5GQBA 3LMZA 3N2OA 2YBTA 1G4EA 3LDVA 1UPMB 3B8VA 4PULA 2XH7A 4OJYA 1K9TA 1E1CB 4I7VA 5U4NA 4DBWA 2FB3A 4RNJA 1LCOA 1LYXA 2YW3A 4L9ZA 4MLJA 3TR2A 3DU0A 4MF4A 4IJCA 1H0GA 4MWAD 2D23A 2BZNA 3MZ2A 2ZKMX 2C91A 4C7DA 3V75A 2VC5A 4YHEA 1YBQA 3DHPA 1Z89A 5C54A 3IGSA 4AF0A 4MZYA 2WKJA 3UJ2A 3DYOA 3G1XA 2JQXA 2NQHA 3ONCA 2ZWYA 4O54A 2HISA 1HW6A 1DL3A 3U5YA 1I8JA 2NXGA 3TXVA 3LERA 3D6NA 3QV7A 2XIMA 1KKOA 1W91A 3LTYA 3LI1A 5ABTA 1ZTVA 3MP4A 3QQWA 4S38A 3VD3A 3DG7A 4L6OA 1GQJA 3TYEA 1HVQA 2D1ZA 4WDWA 2WNNA 2OR2A 2W63A 1Y8BA 3QV6A 1E9ZB 1W1PA 2ZRUA 1GOMA 2ZZ3A 1E71M 3NSNA 4JTSA 1H51A 3DC8A 2X41A 3PK7A 2XVNA 1HP4A 2FVLA 4PFMA 2BHZA 1Q6QA 1RJQA 4GZ7A 3C2YA 5IHSA 4XAFA 3APYA 3AHXA 4HA4A 3NUKA 3W1XA 2QJGA 4G8TA 1M68A 2WWCA 4UR7A 3UG4A 1OYCA 3O6YX 3E9AA 1LJYA 1IEVA 4GPNA 2AL1A 3E2QA 1KO0A 4YS1A 8XIMA 5HA7A 3UWWA 3PY2A 3IK4A 3SI9A 1WBHA 2B0MA 1EP2A 5C9WA 4GO8A 2JIEA 3E5PA 2HPMA 4AD4A 2ZXBA 6XIMA 4EPBC 1O4UA 1UUQA 3CASA 4GUFA 5G4EA 1H7OA 1X38A 4UWMA 4UB9A 4BKNA 1G7VA 1NELA 4TUFA 4M6QA 2Z2BA 1K9EA 1XD0A 5B80A 4NZ4A 3L0GA 2D2OA 4U28A 3EWWA 3KL5A 1OC7A 3V16A 1Q2SA 3H7RA 2Z6IA 4GFSA 1BHGA 4AVFA 1U30A 3SDOA 1V5XA 1W1TA 5A6AA 1LLZA 3W86A 3GX9A 2PDXA 4MB3A 4E3TA 1XLCA 2BVDA 2YGYA 5FSDC 2HVNA 4AEFA 3QYQA 3DFTA 4U5KA 1GVEA 1YPXA 1FWBC 1CLXA 2ZX9A 3EDKA 1F6KA 4E2VA 3WJSA 2ZRWA 4WOQA 3OEXA 4URIA 3UNTA 1XGZA 1IWBA 3G1HA 3EWUA 1XIIA 1Q7MA 3SCSA 3VOIA 1WUFA 2QDHA 3GTIA 1Q7ZA 2QULA 2I9EA 4MAZA 3GW0A 5AKQA 3K46A 1E72M 3NQ2A 4WRHA 3RMEA 3K1DA 2VEFA 5HULA 2J77A 4G7EA 2DZSA 4BY3A 1PDYA 1NWUA 3DI0A 4ZMGA 4PMQA 1GK8A 2NZLA 1OT2A 2R1NA 5EA9A 1UIPA 4MM1A 1E5JA 3ONBA 2I17A 3F4WA 3LTPA 1IWAA 3HF3A 4QDWA 4X22A 1K7XA 3VX1A 4HHHA 1OCNA 5LA0A 4C1LA 1UBPC 4NU7A 4YTSA 1ME9A 4W85A 3O3RA 3A22A 1SZEA 1XIFA 2QAPA 3EPNA 3ARRA 5H8PA 2QUVA 3H21A 1JPHA 2VFFA 1YW1A 3GXPA 3TQKA 2OJPA 4ACZA 1O68A 2QVHA 3TOYA 4EE9A 4JCLA 2R1LA 2IKHA 4NIRA 3FVMA 3V5CA 3N04A 2ZX7A 4N2YA 4MGGA 3NO3A 1IYXA 1AQMA 2PP1A 2PDWA 3CC1A 4LC8A 3WLOA 1M04A 3WDQA 3ZIZA 4AZIA 1AW2A 5CZKA 1XRVA 3OA3A 5DLCA 2J47A 3S0CA 4TOQA 1YRRA 1I2QA 1AMKA 2EXOA 2ZUUA 3CIXA 5E0KA 4QEEA 4MG4A 4D8LA 4GI4A 5HWMA 1F4HA 1BLIA 4UFMA 3FAWA 1IZCA 4BQ2A 3F5LA 2FPYA 3V3WA 1J93A 3IJ6A 4XZ9A 3LM7A 2WZMA 1JYXA 2QNEA 4JD4A 3BW4A 2C0HA 4AMCA 5IDIA 3DI1A 5FJTA 1E1EA 3TQ0A 1GOIA 1FKXA 3WFAA 4PCTA 5AOUA 3QY7A 1RVKA 4E8CA 4FO4A 5EKYA 4UTWA 2W4XA 4ML4A 3DHUA 1F3WA 3P81A 1EP3A 3N1AA 4C6QA 2ZXAA 4AZHA 2VP8A 4H2CA 2OWWA 5HUPA 2C1HA 4FR1A 3RCMA 2YYUA 2A5HA 3UETA 2VX6A 3CHVA 1KXQA 1SVDA 4GINA 3LOTA 4QNEA 2GUYA 2HROA 2OX4A 2WHKA 4QS6A 3P8IA 4XZHA 1J01A 5D9NA 4OTKA 4Z2JA 4PFHA 1XHGA 3OZPA 1VPQA 1W5PA 3F4VA 1TRDA 3EEZA 4LAOA 3G1SA 3M5XA 4GQRA 1C8YA 1H49A 5D37A 2FTPA 5AYZA 3CK5A 2AKMA 3GHSA 3RNDA 3HPFA 3P84A 5CSYA 3V1HA 4A3YA 2FZBA 1X6UA 2ZXDA 3A5FA 4JPGA 3MZNA 5CPSA 1EOKA 4NRSA 1HZYA 1Y5XA 1W9UA 2XYLA 4IMEA 4Y8FA 1WUEA 3B0VC 1F6PA 5ABHA 1O5XA 3IGUA 3AYVA 1ICQA 1W3TA 2YOCA 1O94A 1UKTA 3T78A 5CH9A 5FAGA 5BRBA 3VCRA 3IUIA 1KB3A 3MQTA 1QOPA 3OO2A 5AC5A 3J7HA 1GOOA 3WBAA 3WL0A 4FA3A 4HTBA 4KFNA 4AIBA 2GWGA 3PNUA 4GZEA 3U5UA 1V77A 4IGNA 1A0EA 4IFRA 3ZVHA 3E02A 5C2GA 3W1RA 1TPC1 4ZXLA 2CBUA 4QLJA 1TV3A 4CNOA 2X7WA 4OKDA 4IMFA 2JK2A 4PUKA 1PL9A 1OSEA 1R2TA 3UZZA 3CV7A 2FPVA 1ZALA 4RL3A 3FX4A 4PTWA 1GHRA 2PDLA 1HJXA 1QATA 3V36A 2PI6A 3IACA 5CSRA 2QMKA 3LENA 1D3CA 3WQFA 1KBIA 5LIKX 2DIEA 2Y2WA 2BS9A 2XIQA 2NQJA 3AS2A 4UMAA 1RCXB 4LUTA 4YWIA 4IUOA 3GDBA 2X1SA 1OX4B 3RITA 1QW9A 1LM1A 2PUZA 3OPSA 4ZO8A 3O63A 4GH1A 1JD9A 2DSKA 4XZIA 1Q5MA 1UWSA 1IV8A 4LF2A 3AU2A 3FA3A 3BG3A 1NOFA 3L65A 4WKHA 1GOKA 4NI8A 5AECA 2W3ZA 1V3IA 4BI5A 4MUPA 1ZBWA 4DWSB 3TR9A 3W2NA 4DPPA 2QKFA 1R7OA 1VZWA 3PZQA 2GSEA 2J7DA 3TNOA 5CZSA 5BXSA 3FSTA 1BYAA 4FPSA 3NSMA 3PAJA 5FA5A 4KPLA 3A3WA 4MFDA 4CCZA 2V67A 2PE4A 1US3A 3ZJ8A 5JU6A 4HU3A 1K3UA 4KWSA 2QEZA 3W9ZA 1C8QA 2J9YA 3TN3A 3P67A 1QUMA 2EO7A 4WCJA 1ZQ5A 2PWDA 3G0XA 4OU1A 1WDPA 4WKFA 1KXTA 3KL3A 1H61A 3MJYA 5J5DA 1DJXA 4J40A 3RFAA 2OYLA 3XINA 3QTGA 2OZTA 3IRSA 2E1WA 3Q94A 3S2CA 2A3EA 1XLAA 4JKLA 1RQHA 3GDMA 1RQEA 1LWHA 5G1MA 5BZAA 1K7EA 5F1UA 1MQPA 2NX9A 2XWDA 4RNIA 1XIJA 5CEWA 1IE7C 1GJPA 2E9BA 1JYNA 5LNUA 4WDTA 4ZO6A 4LCSA 2F6KA 2YCIX 1G4SA 1UOZA 1CIUA 1FWHC 5E6YA 4HZMA 5EMMA 3MA8A 3WLTA 1RHCA 4W7UA 3LPFA 1XBYA 4KFOA 5CBIA 1OK6A 1RALA 3N3TA 3KCJA 1F2JA 1DXEA 3QKZA 4Y96A 4S3DA 3A23A 3WJWA 3AIVA 1ISWA 3IPWA 4GJ1A 2O9PA 1N55A 3QHMA 4FLOA 4FMVA 4QAWA 2VUYA 3B0XA 3S9ZA 1DBTA 5AYXA 4IIGA 1TJ0A 7TAAA 1L2UA 4JTGA 2HE8A 2WZEA 4LF1A 2NXIA 2XFRA 3CIVA 3WH8A 1S5TA 2BXZA 3PZOA 3W75A 2RDWA 1ZNNA 5FL0A 2QGYA 2XFFA 3KTXA 3GR7A 5M3WA 2WVVA 3H53A 3WQ5A 4W86A 1V6YA 4UOZA 4PODA 3KTCA 3VTRA 3M7SA 3N9KA 2AQVA 1EIBA 1J8VA 1FTXA 4S23A 1NF0A 1EF3A 1GVYA 1XV8A 1VCFA 4UQ9A 3NZQA 1QPRA 1YBQB 3WBEA 1UH4A 3OZOA 4NASA 3AXMA 3WK0A 3JRKA 2GJLA 1JUKA 1QI5A 4WSKA 2J6VA 1TYGA 1X8CA 3W87A 4GIYA 1P6CA 2ZUMA 3UR2A 1H11A 2W6RA 4IG2A 3MYPA 3BAIA 5D2YA 1DTUA 1E70M 4FXSA 3GRIA 1DWIM 1JD7A 4J3SA 4ERAA 1TJ2A 5CGMA 1EHAA 1WZMA 2V3FA 5E70A 5K9XA 1WO2A 2ACQA 1RY0A 2EBNA 9CGTA 4LC6A 1KBJA 3AMLA 4J2PA 2PGWA 3PPHA 1Y65A 5AY7A 5DFAA 4LUYA 3C2FA 1PKNA 2XIIA 3V7PA 2ASHA 3E6EA 4JY8A 1SMAA 1OGBA 1ADDA 1M41A 1FFRA 4H04A 2XGZA 3MY9A 4HYRA 2QJMA 1I2PA 3PJUA 4DUWA 2ATSA 3OU8A 2HSAA 3IIZA 3U57A 5DMLA 1NFBA 5J04A 3EXRA 1GONA 3PFMA 3ABSA 1YTEA 1A47A 1JCJA 4IIFA 3EDFA 2OU4A 3VDAA 2BBFA 2VZOA 5M03A 3NNTA 1Q6LA 3PZGA 3KBWA 4NNBA 1ZP4A 3WBXA 4E2DA 1HKWA 4U3CA 4MJ4A 1ZENA 2WANA 3KP1A 2BOFX 3LBMA 2PTZA 4LUJA 4R3UA 4F0KA 3MSGA 1KFEA 4Q8WA 3WYZA 3NGJA 1JDEA 4JYEA 3NO1A 4DI8A 1LL6A 4Z42C 1M3UA 3URAA 4K38A 4QQ3A 3TX9A 5FESA 4CD6A 2Z1XA 1D8CA 3NOYA 4M82A 4Q8TA 5BNKA 4I9AA 1LL4A 3UZWA 4XD3A 2IMRA 1VYPX 1VF8A 2YZRA 3IV3A 3UD6A 5AHEA 3L5LA 3B8WA 2V2DA 1H1YA 1B2YA 3UBPC 4WOZA 1Q8JA 2VMFA 4HCDA 5I24A 3GIQA 3GH5A 1H50A 3KVLA 4XZLX 4E6MA 1SO5A 5EGRA 3TTYA 3LXCA 2G41A 3PR2A 2DW6A 2WC7A 1J12A 3VIOA 4DZAA 2OOGA 3E3HA 1DHKA 4GKTA 3GXTA 2DSUA 4L64A 4PCNA 3KOWA 3ZR6A 3FKRA 4JIHA 1YKWA 1BAGA 1SO4A 4DF2A 3DKLA 4X60A 4L4MA 4FLQA 3VGDA 5E09A 5D09A 4UTTC 2XM2A 3KZPA 3VILA 1Z7AA 3W28A 3EA3A 4I6VA 4O4WA 1J0IA 5CZTA 3TW9A 4JIPA 1ZHAA 4M56A 4PB5A 5IOBA 2NVAA 1TZ9A 2I5GA 4K8HA 1THFD 4RDZA 1YHTA 2P0OA 4CNNA 5TIMA 1KRMA 4CCDA 4Z1DA 3B3DA 1H4PA 4ONVA 2WOQA 3AALA 4PB3A 3W0KA 4BI6A 4OOUA 3CQ0A 3N9SA 4G7EB 4QQUA 1XG3A 2DZPA 3P5ZA 4UFHA 3W6MA 3SUVA 3LQLA 4C90A 3IJDA 4LQ1A 5IHRA 1MXSA 5I3HA 4LU0A 1VJIA 3VU2A 2D3LA 5KINA 2DSWA 4ZBCA 5G4WA 3UEQA 2F2HA 3RYSA 4G6CA 1RLDA 3C0SA 3S5NA 2BSLA 2WB5A 4XV0A 4NZ3A 1EXBA 2ONEA 4LS2A 2DZWA 4UOJA 3PZ9A 3UJSA 4CGTA 4ACZB 2F38A 4AEEA 3ES8A 1GVIA 3HA1A 3MO7A 3ITXA 4D6HA 1K4HA 1WBJA 5J5RA 3S5YA 1UBSA 5CC6A 4LUSA 3G1FA 3NEHA 1QWGA 3RLUA 5BWAA 1XRSA 1E51A 4NILA 1UKPA 1QRQA 4PUEA 2XG9A 4H6QA 1SR9A 1K8ZA 4KIRA 2O92A 4D6FA 3CZKA 4M1RA 1V0MA 4AYGA 1GZ1A 4EPDC 1JZ5A 2INFA 2WO5A 3L2MA 3H23A 1YMYA 3C3NA 1P1XA 3SGZA 1JCMP 1E5NA 4EACA 1TV8A 2XVGA 4LB3A 1Y0EA 3M5YA 2DV0A 4IIDA 1CNVA 3CQJA 1LOLA 1POJA 5E1QA 2GGJA 2Y8VA 3C4UA 1J6OA 1WZLA 1BRLA 1NDWA 4XSMA 3CUFA 1YDYA 4S39A 4IF2A 3UG8A 3NURA 3W37A 1E73M 4B3KA 1MDRA 1NOUA 3SB0A 4M6UA 3PBMA 3WNNA 5DEZA 5CCZA 2DZVA 2Z27A 4WY0F 5JBDA 4J35A 4ERIA 3HPXA 1Q6FA 3WG6A 1N8FA 3AISA 3OYZA 1VC4A 4RUBA 3SCVA 4R53A 4K36A 5GNZA 3UU0A 2BVWA 1E3ZA 3GKAA 1ITXA 4QE4A 5BROA 4GX8A 4HK5A 1F76A 4U33A 1W5NA 4FP1A 3AMGA 4ICNA 5BXPA 4LJ3A 1F5ZA 3KM8A 3MV11 3PPGA 5MF5A 3T8QA 2DPEA 4DNHA 2CBJA 3JU2A 5C2CA 3RMJA 4OUIA 1FCUA 3LLFA 5HWJA 2DT1A 3BURA 1GNXA 4IMCA 1VD6A 1P1MA 2H3DA 1LRNA 3WLHA 1S5WA 4QE1A 4HP5A 2CFFA 3CZGA 2P53A 3WH6A 2X1RA 2WPGA 5TBOA 2HV5A 2PBOA 3W7MA 2J7HA 1F3EA 1DXFA 3JUGA 3PZTA 3W81A 4DF0A 1BSIA 3F2BA 3T7VA 4JTDA 1EQPA 3C8NA 3TSDA 3W74A 2GVJA 3OGRA 4H3DA 4JNMA 3ECQA 3LV6A 1LRQA 5EFFA 1PWLA 1C92A 3B9OA 5AYYA 4QHRA 1EGZA 1XD1A 2X0HA 4H2HA 5HMFA 3QMTA 2OSXA 1XS2A 3FHQA 1OF8A 5M1TA 2VFDA 2YZ5A 4LAKA 1E0UA 1R85A 3AXKA 4JL2A 2Z25A 3W82A 1J0HA 3COTA 5AZ0A 1FX6A 5HJXA 1FWNA 5FF4A 2HRWA 1PKMA 2NT0A 4H8VA 3UZJA 2RJHA 2BTMA 1DJHA 4WVXA 1Z41A 4I9TA 3LB0A 2GDQA 4AZBA 3G0UA 1PV8A 1VYSX 2V5JA 4S3BA 2PDMA 3SY1A 4NVTA 1H5VA 2VENA 4UFIA 1H09A 1ZBVA 4XZNX 1YXDA 1EJUC 4O1BA 5FD0A 4UTKA 3GYCA 3TN4A 3SIZA 1FY6A 2IPJA 3I7QA 2FPTA 4EXQA 4TR9A 1ZLPA 1K03A 3JZEA 1UWTA 4LUTB 3NCOA 5A8MA 3VAVA 3W71A 1HKIA 2C16A 3E0WA 1RY8A 4DRSA 1TB3A 4GXMA 4O11A 3A13A 2NUXA 1VIWA 3IAQA 2GVEA 3LHZA 5HINA 3OVPA 3VKDA 1KCZA 3M5VA 1P6BA 5F2GA 1M7OA 4EIVA 3FCPA 1H60A 1ZAJA 3ZLFA 2VR4A 4REQB 2OZ8A 5AYBA 1Q85A 4FNUA 2HK0A 1GWJA 4AVOA 1KFBA 3MHFA 1ZCOA 4HCHA 2JF7A 1LDCA 1BSLA 2W27A 4AHOA 4D6GA 4QFUA 4UNIA 1B5TA 1R3YA 3W7NA 2WNZA 1MRAA 1E0TA 1G5AA 5F2LA 3LCWA 1F3TA 4GI8A 1YXCA 2I7GA 3DGBA 3NJ3A 2QJHA 5KZDA 3GTXA 2ZOXA 1UPPA 3PTMA 1K02A 2BHUA 3V5OA 1TIWA 1TQXA 2Z4GA 2I5IA 3CS2A 1PHWA 3WD4A 1XC6A 3QQ0A 2OZ3A 4MZ1A 2CZEA 1CTNA 3GXFA 4O4VA 3VGFA 2PWEA 4XUGA 5SWUA 3M0ZA 4Q7IA 3QLLA 2YCLB 4JN6A 1UZHA 3S5OA 4OVXA 1MQRA 2NQ5A 3THAA 3TN6A 1J0YA 3VGHA 4YVXA 1ALDA 3MDUA 3WJXA 3QOMA 4AW7A 3KWXA 5H8UA 3W7IA 1UP2A 5ENLA 4HMDA 1UJQA 1PKLA 3UP8A 5RUBA 4M1BA 1BTCA 5A6MA 4TV6A 3AS0A 1EC9A 4GY7A 4RPQA 4NL1A 4B90A 4CEXC 4L4LA 4F0RA 5I09A 4XVDA 3MP3A 1Q2RA 4JFTA 2R91A 1R3SA 4JHMA 3NYZA 2VZTA 4H9ZA 1W3LA 4LRTA 4EF8A 5C5YA 1TE6A 4C5YA 4GOAA 4P61A 5C71A 4CQ8A 4YYCA 3VIMA 2QDDA 3QEZA 3UVAA 3SCTA 1U1JA 3AWOA 3HG2A 4GCAA 4HGXA 2WNWA 5D30A 4L1GA 1EDGA 3W2UA 3VIPA 2HQAA 3K30A 4F0HA 3STGA 2RFGA 4FX8A 4JCMA 5CJNA 1XH0A 5LZLA 3FJNA 1GQLA 1GTHA 1CXHA 2Y63A 1HJUA 2G5WA 1JNDA 1KM0A 2RHGA 2GDUA 1F8MA 2QCMA 5GPRA 2WBKA 3R1ZA 1JNEA 5ECUA 3R4IA 3QYSA 4N4QA 4A8IA 2OZ0A 1XYMA 3AIQA 1HQTA 4AZ7A 5LNWA 3QC0A 4MKNA 4JKMA 3BLPX 3ARUA 4ZQOA 4NJIA 1I45A 1ZP3A 4WZHA 2A3HA 3GNXA 4PBFA 1BGAA 1Z6KA 3LYEA 4HA0A 4MPQA 5A6BD 1RA5A 1DTNA 3TJXA 1GTEA 3GQYA 1OQFA 2VELA 1WDRA 2ICSA 3WF3A 4JTCA 5BW6A 2BASA 1DJYA 3URNA 1W54A 2J7GA 4K6AA 1PUDA 3LNPA 3H7VA 1IIGA 1T0OA 2CXGA 2R1MA 3H54A 3BCDA 1OFAA 1FHLA 2E67A 1W6TA 2WSYA 3EKZA 3B8DA 1V6UA 4XIMA 2BODX 3I7SA 1EJWC 2BWGA 2DU2A 3A4AA 4ZOEA 5D9OA 5K9CA 3AI0A 4LALA 3QMRA 3SCQA 4B4HA 1PSCA 1DVJA 2EG7A 2W62A 3SRFA 1E43A 2A2IA 5CG7A 1S46A 5DXYA 2HBXA 1U5HA 1DE6A 1YDOA 4B2DD 3U3HA 2HPIA 3P0XA 1JZ8A 3N25A 3DIPA 1J11A 2PDHA 5FKYA 3LQGA 3MI3A 3NGFA 2H9AA 2J74A 6XIAA 4LFYA 5LXXA 2B4GA 3WEZA 5DBTA 5HOSA 3QY6A 3HJEA 3TK7A 4CD8A 4G2DA 3VKJA 2VFGA 3KS5A 3PSVA 3WK3A 5EMYA 3OHIA 2V69A 2NSOA 3OOQA 1E40A 2XZ7A 5D2WA 1AUSL 1B54A 4AZ5A 3MMWA 2J25A 3UWVA 1WA3A 2P0IA 4C6NA 1L2QA 4IZGA 3WBWA 3GC2A 1R5YA 1KGUA 4F40A 4GACA 3C2RA 2WSRA 4WKAA 2Y7DA 4HSOA 3WUFA 3W26A 1AL8A 1QHZA 2VZVA 3PVFA 1F9CA 1UR4A 4FEZA 5AHMA 1V79A 5CJ5A 2G8ZA 4DZIA 3S9YA 2VQUA 1O66A 2Z26A 1FWJC 5HUOA 4HHLA 3EPOA 4ML9A 4ZFCA 4O1AA 4UZUA 4LGXA 1EA0A 4UMBA 3W7DA 4WEVX 2NVCA 1CENA 1S1RA 4MY8A 1N7KA 1NQ6A 2QV5A 3BL3A 3A3HA 3LSBA 1GPFA 3BJFA 2WC4A 3GG8A 3REQB 3LHYA 3ZJKA 1XGDA 2OFJA 1BXBA 1XG4A 3WLNA 4W7VA 4GZJA 3TXZA 3CUJA 1JI1A 4ZSTA 2BV9A 3BMWA 1B3YA 1A5CA 1UUMA 3BAWA 3WQ8A 4W87A 3BW3A 4OBTA 2PCEA 3R8HA 1GHSA 4GUGA 3GDRA 4S2BA 4ENLA 3A64A 3HN3A 3C52A 3ZS4A 4TTUA 1X96A 3AYSA 2XN0A 4G56A 4IM4A 4US5A 3UFYA 1KRCC 5F1VA 1IXOA 4UR9A 3WDRA 2YB4A 3DH7A 1TX0A 5F4WA 4M7SA 4AD2A 4ZQRA 2DP3A 4BF9A 4I8YA 3M6YA 2Z2UA 2GSHA 2C18A 4DJDC 4HHPA 3MKCA 2MNRA 3N4FA 5K4ZA 3QZEA 5DCEA 1NOWA 3LZ5A 4O50A 1XLBA 1QR7A 2WVSA 3LLXA 3F5KA 2ZZ2A 3QSRA 4JTUA 4M24A 4AG0A 3I7RA 4CKQA 1PWMA 1Q7QA 4JR5A 1TCDA 1BRLB 1SJBA 5LHEA 1FA2A 2Y5EA 4N7QA 4OWGA 1JAEA 5D33A 3D5HA 3EXTA 3LU2A 3Q65A 3M44A 1PPIA 4HD5A 3THQA 4M3PA 4AD1A 4XBSA 4ZGYA 3R13A 4E4UA 3GR8A 1FWIC 4KWWA 5EY5A 3CYVA 1OCJA 2DSZA 5AHFA 4NSBA 1BKHA 4D6JA 4JOMA 2E5DA 1RP9A 3OVGA 5D9PA 3TSBA 1SZNA 1SW7A 3WENA 2FGBA 2VC9A 4J3WA 3B8TA 3CZLA 2ALDA 3E0VA 2J78A 3VGBA 4YVPA 3WQPA 3LCGA 1W17A 2QT3A 2GVGA 2QF7A 2RJGA 4S3JA 1UROA 2G3JA 4GYFA 4LBSA 3PZIA 2WJEA 2WHJA 1JIBA 3T4WA 3KBSA 4ERGA 1VHNA 3ZYZA 4F48A 1A5MC 1ME8A 1WV2A 3B97A 1HO1A 1E4IA 4NQ1A 4C7FA 1VBGA 4ZZ9A 1KGXA 5C55A 3TTSA 1PTDA 3HMCA 2BOGX 1K9DA 1JVNA 3BANA 4I8DA 1N82A 5G5IA 4HJWA 2D73A 3TROA 3N11A 4FNQA 4KESA 3WJYA 2CXEA 3W7HA 4NYYA 3KHJA 3O7UA 3SO7A 3SUSA 4ADUA 5CGTA 4N02A 2DY3A 2BGQA 4V33A 3AIBA 2CYGA 4W8AA 5JUVA 3GTHA 4B5XA 2NWRA 4XZBA 9RUBA 1O1ZA 3GXIA 4MTVA 2G4JA 3AZTA 3VNDA 1UW9A 5A8GA 3W24A 2I5QA 2OGYA 2VUNA 4TTGA 4JY9A 5LGXA 3UWEA 3FOKA 4YCOA 3M46A 5FSEC 3N9RA 3KRUA 1QW7A 1F61A 1TJ1A 3A6OA 1XWYA 3MJMA 3O15A 1W56A 4JQAA 3TYZA 4KCVA 3RJXA 4OHQA 2ODOA 3N2BA 2PODA 1KM2A 3H2NA 1XPYA 1W3KA 1WAUA 1W1A1 3M0MA 2QJNA 4G1NA 3FIGA 1XIHA 2VXNA 4C5ZA 3RG6A 4C6LA 1IEWA 3RILA 1S38A 1RCQA 3N3MA 3ZSTA 2ZC1A 1EPVA 3W4RA