3W00A

Crystal structure of pcrb complexed with g1p and fspp from bacillus subtilis subap. subtilis str. 168
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
226
structure length
226
Chain Sequence
b'MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 76
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3w00A00
4NAFB 3VZZA 3W02A 3VZYA 3VKAA 3VK5A 4JEJA 3VKDA 1VIZA 2F6UA 3VZXA 4NAEA 3W01A 3W00A 4MM1A 4NAEB 2F6XA 4NAFA 3VKBA 3VKCA
chains in the Genus database with same CATH superfamily
1BXBA 4C6QA 4S3DA 1Q7QA 2XPKA 1R9XA 2X1SA 1NJJA 3FDKA 3I3EA 3P14A 1AUSL 3DCPA 3WN6A 5K4ZA 2D69A 2WSKA 4WOZA 4F9JA 5BROA 3HGRA 3EGJA 3UYIA 1UHVA 3DFNA 3C3NA 5JBDA 1FCUA 2J8TA 2ONEA 3M0LA 2FGLA 3TFXA 1X39A 2PRLA 1NOUA 2DSKA 4PMQA 1XJBA 1H63A 5C5YA 4TX9A 3V4BA 4B5TA 2QJNA 2W4XA 4AU0A 3ZSTA 3PJWA 1KLZA 3H21A 4I5UA 2FJUB 4S3GA 4MAZA 3L4ZA 3QMTA 3VOGA 1YNPA 3TJLA 3GHUA 4W89A 1KR0A 1W54A 4UB9A 2PDPA 4HD5A 3NQDA 4A8RA 3MANA 1K6WA 1VRDA 4A4AA 1RPKA 1JDDA 2EJ1A 2IKHA 1X8CA 3AFBA 4XIMA 1T99A 3AHVA 2GDUA 1KV8A 1WO2A 2HPIA 3THCA 1CTNA 3K8KA 4DQWA 1GG0A 2CLPA 3OW1A 3U9IA 5D03A 3RDKA 3HGJA 1J96A 4XTIA 4B2DD 2I14A 2PBGA 4O19A 1SFTA 1TPC1 3THUA 1Y7VA 4Y7EA 4W9TA 4LUTB 1JCMP 1TQXA 3PBYA 1M53A 1GKRA 2J25A 4LBSA 4ZQRA 5ABFA 3QLLA 3BCDA 1WZMA 3NQCA 4O14A 2XFFA 4GUGA 2GL5A 3VIFA 3B8VA 4D72A 4RV8A 2J7FA 2I5IA 2EPNA 4W87A 3O7UA 1QPOA 2G3FA 3WLIA 3ERPA 3GXTA 3AXXA 4UOZA 3RPTA 4PBFA 2ZUMA 3VA8A 1UUMA 1DIOA 3ARYA 3QBUA 1U33A 2X1TA 5C9UA 4H7ZA 2A3HA 1UW9A 1QATA 3V16A 3MUIA 1VH7A 3PPGA 3VDHA 1DQUA 1X7IA 4UTFA 4V1YA 2X42A 4FR1A 5GVJA 3VKDA 2Z1BA 4XV0A 1ZU8A 1DP0A 2O0TA 1ISXA 1IT7A 3DC8A 1WZLA 1QOPA 3QN3A 5D2YA 3W1PA 4LOCA 3N9SA 4LAZA 1XW8A 3MBFA 1UWIA 3E0FA 2BXYA 2RHGA 4K39A 3VE7A 3RIKA 1XDJA 2NV9A 1D3GA 1GKQA 1H51A 4XG1A 2GGGA 1IGSA 1NWTA 3TTYA 2PDFA 3EB4A 5FL1A 1ITUA 3NQAA 2X2YA 4PRWA 3TYAA 3WJZA 1JULA 3T6CA 3QKEA 3OGSA 5EMUA 2BV9A 1XIEA 2PDLA 1BXCA 1EH9A 2Z24A 4WKAA 2ANUA 3KX6A 4LSBA 3LX9A 1BQGA 1I2QA 2H3DA 1GYLA 5D8WA 4RNJA 5HANA 2R14A 3CO8A 1Q6FA 1W3JA 4Q22A 3LLXA 5G1TA 3CMGA 5EMYA 4JIRA 3LHUA 4AZIA 4QTGA 3UVIA 3TFCA 4L4MA 2VP8A 4TIMA 4WEVX 3D0CA 3SUUA 1G9HA 1XF0A 2VRKA 5G4EA 3T40A 1UZ1A 5CGQA 4B90A 1V0KA 4HNTA 1KBIA 1PWMA 1QBAA 4IM4A 2VFEA 2ZUSA 3UXLA 1P1XA 1JQVA 4QJ1A 3B9DA 4MG4A 5KMYA 3WD1A 3KBSA 2X16A 3BUVA 4B91A 1HW6A 3VGEA 1A5SA 3OTRA 3W7MA 1XGZA 3OZYA 2NQ9A 1M41A 3VNZA 4F8XA 4MNJA 4JQ1A 3R13A 1M7OA 4YTQA 2WLZA 3DGRA 3NM1A 3EMQA 3KCJA 4LAOA 3GKFA 3NURA 3QRHA 4AWTA 4FOUA 1KRAC 3G1SA 3GIYA 2J27A 1VFHA 2IPJA 1ZNNA 3AZRA 2FB2A 2VEIA 3RU6A 4RPQA 3NYZA 2VOMA 1RCQA 3VCRA 4QITA 3W23A 3QXBA 3M0JA 4IJBA 1IYXA 1XKYA 3Q67A 3SY8A 4GABA 1FOBA 1W6TA 3WD4A 4NZ1A 4O18A 4MFEA 2V3FA 4FNRA 1I45A 2V63A 3NQVA 4CN4A 4IIBA 4IIGA 4HBKA 4FXSA 1SZNA 4A21A 3F1QA 5A6KA 2YBTA 2PDKA 1GQIA 4PGLA 3MP4A 3TU9A 1HO1A 2JE8A 3SCWA 3GNPA 1JNDA 4ICMA 4UFJA 1NTHA 5D09A 1YNYA 2ZRZA 3LHYA 4A3UA 4HN4A 3WX7A 2VEGA 1THFD 2WZTA 4GCXA 1YXYA 4WGHA 3BMWA 4PE8A 3TAOA 1SSDA 1ZQ5A 2OJPA 2VNCA 4ZXOA 3QY6A 5K9DA 3LSCA 3RLUA 4WCJA 2Y5EA 2MUCA 4J3VA 4XKMA 4H9XA 3U6WA 5CC7A 3WQGA 2NVAA 3T7VA 3SJNA 2XVPA 1YXCA 2PZNA 5BW6A 3A47A 4QG6A 4D71A 4X3ZA 3LDVA 4GIAA 1PBGA 1DPMA 2E6FA 4OU1A 3OP2A 4H6RA 4AVOA 4S38A 1L9WA 3PWGA 1DJGA 2E8ZA 3AOFA 4C60A 2WC3A 2NQHA 1GNXA 2ATMA 2R24A 2CITA 1Q6QA 3YPIA 3M44A 3CPGA 3RM9A 3T2PA 1OCBA 2NT0A 2ZRUA 4IPPA 1RQBA 4KCUA 4GQBA 3HOJA 3WF2A 3DECA 1W1TA 2PGRA 1QAPA 3A21A 1POKA 3DEQA 1TVNA 3BW2A 1K03A 3UP8A 1Q85A 3CZLA 4DXXA 2WQPA 5LGXA 3LD5A 1VAHA 1EHAA 1PTDA 3L0GA 2CZVA 4DLMA 5E9XA 5I07A 2JALA 2G37A 3H7UA 3FW6A 3MB9A 4QM1A 2Y7GA 3L4TA 2VOTA 1JZ4A 1OFBA 2VCAA 4YNGA 1ZPTA 2HRWA 2RJHA 2Y85A 3IGHX 1W31A 4PMYA 3EX3A 4FPSA 3WNLA 1EJRC 1IEIA 1G7VA 2R1MA 4DWDA 1GVQA 3NZRA 1E6XM 2DJXA 3FSUA 1UH4A 5GNZA 1I2OA 1WUEA 2AAAA 1G94A 1V3KA 4YIWA 1KWGA 2YXOA 4MUPA 5I3JA 2XVGA 1W37A 1LLZA 2HZGA 4I7WA 4JYFA 3AWOA 1LTDA 1PKNA 2PDMA 4UTJA 3PN8A 3W72A 4M5PA 4US5A 4Q8NA 4TR9A 1A49A 3UZJA 4DJFD 2ZC8A 3KFTA 4AF0B 4AG0A 2ZXAA 2WSQA 4LB4A 4GY0A 4F0LA 3ECQA 1H11A 3QW3A 2ZRVA 4FALA 4O13A 1R2TA 1O1HA 2OX4A 4Q7NA 4U28A 3ITCA 3M5YA 3QPZA 3G22A 1EUNA 3E74A 1HKKA 2GK1B 2W9MA 3GAYA 1UA3A 3PNZA 3TZNA 3EB2A 4IIHA 5G4HC 4LBRA 3ZQ9A 1HTIA 2Y6ZA 3E0IA 3IGSA 4ZO8A 3GXPA 5LKYA 3WLMA 3M0HA 3TZFA 4UXDA 3KXQA 4LRTA 1OINA 2FHBA 4XB3A 1WB0A 1W17A 1E40A 2E9BA 1FHUA 4PYSA 2XFRA 5D9NA 1XSIA 1ZS2A 4RW5A 2JEPA 2JGYA 3A9BA 2ADAA 3IJ8A 1EEPA 3MUCA 4BHYA 1HJQA 3FKKA 3K1DA 4LY8A 1H1NA 4GGBA 4ATLA 2PGEA 2YBUA 4DLFA 3ABOA 4CEUC 3AQUA 1VLIA 3CTLA 5B7ZA 3AHZA 4JTJA 1V79A 3C0QA 4GIRA 2CLEA 4H9VA 1XYAA 5C9XA 1PDYA 1L6GA 3E9AA 4HK5A 2OMAA 4U4MA 3UZWA 4GJJA 1O6IA 1GONA 1J01A 1RK6A 2FTYA 3BW3A 1MQPA 4LEFA 1GK8A 4DXVA 2O55A 4U10A 3AALA 1SR0A 3M4HA 1J0JA 3BV7A 1EA0A 1A3WA 4GPNA 3POHA 1GPFA 4Y9NA 2QCMA 5AFDA 3S2LA 3SW6A 5DCDA 4NHVA 4Q4KA 4FP1A 3G1FA 3ZLGA 1MEIA 2Q3OA 3IJLA 4MVAA 1KBLA 3ANVA 2RGLA 2ZRXA 2EQDA 4C6FA 1FCQA 1KR1A 3HGSA 4HHPA 3OYZA 2NW0A 2VDGA 4M82A 3M41A 3C56A 5TBOA 4DJEC 5FJJA 1AH4A 3H22A 3W53A 1F4HA 3RR4A 2HEJA 1R46A 1XH0A 3UJRA 3PUGA 3VPLA 3CV2A 3TMLA 3TYZA 4N9DA 1QVBA 1EJVC 2WW5A 4ZOAA 2CEQA 4PUEA 5KINA 3P2VA 4QR6A 4J7RA 1OX4B 1EPXA 1A5CA 4Q8UA 2FZ9A 3EBVA 3F7JA 5G2HA 4AY8A 3EEGA 3DFSA 1W1A1 4OBSA 3ARXA 4LF1A 3TCSA 3N2BA 4AWUA 4PR4A 2DEPA 2NVCA 3ZT7A 1IGWA 3VOIA 5BNKA 3H12A 3EPOA 1O5KA 5CBIA 4AMCA 4BK9A 2CXGA 2PF8A 2IPWA 4CGTA 4KEVA 1BRLA 1SJAA 3CS2A 3O07A 2ISVA 3NEVA 5DXXA 3W1QA 1OK4A 1J2BA 4WDXA 3UR8A 2EGZA 1YBQA 3S6TA 2WV8A 2PU0A 5EPDA 5CLTA 2PWDA 4R33A 4IXHA 2Q8ZA 2UY4A 2WCGA 2OTDA 2PLJA 3LHVA 1Z48A 3EX6A 4XZLX 3W7OA 1H2JA 3WLPA 5I3FA 2L5HA 3KTCA 4LU0A 1JCTA 3L2IA 3VZZA 2V5KA 2DZVA 3B9AA 4PMRA 4CUCA 2BS9A 1QI5A 3PZUA 1CPUA 1SU5A 4GKTA 1J93A 4C6CA 3FJ6A 4C6DA 4YYCA 3V18A 3UWZA 2QCGA 3WBXA 3SB0A 2O56A 3C8FA 4AIOA 4FO4A 1BKSA 4DO4A 1ECEA 3CAKA 1I4NA 2CLLA 2ASHA 1Z89A 4LBUA 4F40A 4D6DA 4J2PA 3OVQA 1B2YA 1QNRA 1HN1A 3FSTA 1QR7A 4Q4PA 4JY9A 5A6AA 9XIAA 3THDA 1D3HA 2VD9A 3L68A 3WL0A 3G1YA 4O54A 3GG1A 4ACZB 1AG1O 3D3FA 3AYVA 3T55A 3N12A 4EP8C 5FSEC 4JTKA 1AW5A 1JZ7A 2HV5A 5AYYA 2V5DA 1C8XA 2Z1SA 5BOEA 4GE8A 1P6BA 4L6HA 1UJPA 3OZOA 1ZY9A 3LG3A 4JFVA 2XGIA 4DB7A 1QNQA 1WXZA 4MM1A 2R9RA 2IKGA 1OFRA 5LIYX 2OSXA 4XZBA 5AHEA 1CB2A 2KZHA 2FZ8A 4RZBA 1E5JA 2O4QA 3MUZ1 1TZ9A 2Q02A 3KLKA 1Q2RA 1ICPA 3VABA 4G7EA 3P81A 5A2AA 1L2QA 1UWTA 1F6PA 2W67A 3B40A 5HR6A 2QKFA 2HS6A 1E0XA 4CU7A 2AQVA 4H4IA 3EXRA 4JN7A 3KBJA 4K2SA 1REQB 1OGSA 3DBNA 4AXKA 1XCFA 4MPKA 4FIRA 3AS0A 3TYEA 1BAGA 2WWCA 1GZGA 5DMYA 3BANA 4JTGA 4EKJA 5JXQA 4GJIA 2VZVA 2Y7FA 4Q4OA 2FPYA 1HF6A 3U3HA 4B3ZA 4H01A 2INFA 1VBUA 5JBFA 4REQB 1UKQA 5BOOA 2A79A 1UH3A 3FYYA 4IG2A 1WDWA 3BL3A 2V67A 4NJKA 3KOYA 3VTRA 3NG3A 1PIFA 2OODA 4G56A 5I03A 3EKZA 1FDJA 3E5BA 4BF7A 4JTUA 5F2IA 3ARUA 4KWVA 4V27A 5KZEA 2P76A 4NZJA 4FLSA 1JPMA 4XISA 4R9OA 1GOWA 1TSIA 4K36A 4UQCA 2QT3A 4ASTA 2DVXA 3NO5A 3VGFA 4PUKA 4LYKA 3RHGA 5C9ZA 1FP8A 1C93A 5A2CA 5CPQA 3DYPA 2KAUC 1PDZA 3AMCA 2OQYA 3M0MA 3MI6A 2C3ZA 1KRBC 3C6CA 3W7QA 3WH8A 2GVYA 1EPVA 3PSWA 1A5UA 1AK5A 3Q4DA 4C6BA 1JCYA 1F8MA 2QJMA 3U5UA 4LVDA 1AZ2A 1HP4A 3NZGA 2CNCA 4LUTA 3UXIA 3A4JA 4PMJA 1H41A 5LIWX 4S3BA 3ITXA 2XIOA 2F2KA 4CCCA 1A0CA 5AC6A 1L8NA 1Y5XA 1IEWA 2I9UA 4MWAC 9RUBA 2FFIA 4QS6A 3L23A 4D6EA 5HMEA 4ORIA 3PZMA 2VRQA 4B5NA 3B06A 3L5MA 1ZL1A 2J7EA 2VGFA 2BX7A 4OBTA 1NDVA 3G0UA 3NL2A 2DDXA 4F48A 3M7WA 1JPIA 4G5DA 7ODCA 2UV8G 1OC6A 1QHPA 2EO7A 3MU7A 3R58A 1XLAA 4Q7IA 4Z1YA 1DV7A 3SGZA 3MMDA 3QPEA 4QLKA 4JGDA 3GTFA 4ERAA 3MY9A 3VIGA 1XIBA 3GB6A 3IJIA 2JKAA 2ZRWA 2KX9A 3OLGA 4BF9A 4PTMA 1TMQA 2Y4SA 3W6YA 3W7EA 4I5XA 4UTIA 1ZJAA 3PNUA 5K9XA 1NM9A 3HG2A 4GLEA 4U5IA 5AZ0A 3LGGA 1UOZA 2EBNA 4XSMA 3P61A 3GO2A 5ABGA 4R7OA 3PR2A 3V0UA 2ZRYA 4M8UA 4GY7A 1RJQA 4CCZA 1DWJM 2A85A 3N11A 4DM1A 3PFRA 2WMIB 2YCLA 3V0TA 3S5ZA 1EOMA 4A8NA 5ABHA 1BF2A 4OKDA 1JCLA 1XM3A 1NQKA 4HZ8A 1VFTA 5T26A 3QMSA 3ORWA 2JIWA 5LIUX 3VIJA 4YTRA 4JNZA 4DZHA 5HNUA 2R6OA 4IFOA 1HKVA 3RILA 4F0KA 3B0PA 3I68A 2UZ9A 3R4IA 4ACYA 2YSWA 4H19A 4Q7BA 2CZFA 4R3UA 4AQLA 2Z2UA 4TO8A 2VI0A 2GZXA 1MYRA 2RH9A 2CC0A 3BWWA 2GUBA 3GXDA 2QCNA 3KBNA 3NGFA 1H4PA 3FA4A 1EF2A 1B54A 3GR4A 1Q6DA 5I6SA 4X63A 5DMNA 2CFFA 3B8IA 1R3YA 2G41A 4DBWA 4ZB0A 1R7OA 4HKPA 3TH6A 4O0KA 1J18A 1JEZA 3POCA 2OT0A 1JUKA 4NU7A 4S1FA 4OOUA 4LCRA 2OOFA 4DX3A 2FPTA 1RBLA 4BQ2A 3WQ8A 1R3TA 1RXOB 2X05A 1C90A 1E6ZA 5CLWA 2J77A 2VGIA 4W88A 4YVPA 1PSCA 4Z08A 2FGZA 4OQVA 4XZIA 5HOSA 3AC0A 1QW7A 1MEWA 1KD0A 4WVXA 1Q5MA 4NF7A 1PXGA 3MJYA 1LWHA 3D6NA 1XKJA 2QJHA 4Q4RA 4FLRA 4R9XA 4CKQA 2QVHA 1IZJA 2F7FA 5IBXC 4H2CA 4GVIA 4ZGYA 3M9YA 4ZO9A 4L4OA 3SI9A 3TX9A 1LCOA 2QW5A 4WGXA 1QFEA 2OYKA 3QC0A 1V02A 1TR9A 3IVSA 5CPOA 3E1F1 3N4AA 1K8YA 2PC8A 1SUXA 1DWFM 4DJDD 4DJFA 3B0UX 2W27A 3ANUA 3WBYA 4AB4A 3DBPA 2BOFX 5K2ZA 3IGXA 4XQ6A 5F1UA 3CGTA 3C2FA 3CH9A 5AB3A 4LAUA 5FIPA 3LUTA 1JXJA 1GQKA 5FJIA 4ES4A 2BWGA 4JD4A 3ZYZA 4IWWA 1PX3A 3B0YA 2Q71A 1KXHA 4U2YA 1LOQA 3QVQA 3OGRA 4A6GA 1B4KA 1Y8BA 2OT1A 3W87A 2YLAA 4HA1A 2PTDA 2YCJA 2CXEA 5FL0A 3RLVA 2PD9A 4OTKA 3GFXA 1GORA 2XM2A 4UTUA 1EGZA 3AJ7A 4G8TA 2Y8KA 4C1NB 5KEZA 3K13A 1TZ7A 2QIIA 2ZADA 1VFSA 1Q6OA 4N6FA 1KM1A 4ZTYA 1OBAA 3TQVA 3P84A 3VD3A 3WK0A 1FWIC 3BJFA 4RPPA 3HMCA 6ENLA 4DAIA 4ZO6A 4V33A 5D04C 5EKYA 3EB3A 4K8HA 3H26A 1V6YA 4LCSA 3N15A 3B8WA 2ZIDA 3KL5A 4RE0A 3N2OA 4IP5A 4JPGA 4OWGA 3WNNA 3T2OA 3V5CA 2FFCA 1E4NA 4KQNA 1XBYA 1TPH1 1ZBVA 2HDJA 4IMFA 3DERA 5CSYA 1KRCC 2Z2BA 3JU2A 4HZ7A 4JQ2A 3G0XA 3O2LA 3LI1A 1TVPA 3E0LA 4JS3A 3PWIA 3E5PA 3BPWA 4AHOA 1HUVA 4QJ5B 3WJXA 3UPBA 4AF0A 1XGDA 2NX3A 1BLIA 3N4FA 2QV4A 3PBUA 1BWVA 4C5ZA 2GSEA 3MPGA 1IR1A 1U22A 4ZL1A 2DQXA 4QQUA 4GG9A 2R1PA 1UYQA 3U57A 2GJRA 2POTA 4K6AA 1CLVA 5H8PA 3GTHA 2GK1A 3K46A 1YTEA 3SCNA 4I3GA 4XTDA 2C13A 1T0OA 4CEXC 3TW6A 5I00A 2OSWA 3NOEA 1DJXA 4ZZ9A 1V3IA 3CUFA 4JZ5A 3BCJA 4PZVA 4BA0A 5MKGB 4EPDC 3PB0A 1UD6A 3WY1A 1GQJA 3L2LA 3W84A 4TTUA 5BU9A 3EPNA 3M0ZA 2WXDM 4RNFA 2R8WA 1E6RA 2YLLA 4GI9A 3HPXA 4GCAA 1GOXA 2YB4A 4MSSA 4LYQA 1OD8A 2PODA 4JR5A 5D2VA 2HJPA 1JI1A 1ONWA 5CKSA 3PTQA 3CWNA 1TV4A 1W5QA 1ZBKA 4MWAB 3SQMA 3S47A 4DF1A 3QV6A 5AHNA 2BASA 4BQ5A 3B9OA 4NJHA 3P8IA 4FOKA 5DBTA 3ABXA 4EPBC 2UY5A 4R53A 4PMNA 4HPXA 1WE5A 4O16A 2GSJA 2PU1A 3QEZA 5BU6A 4JHOA 2NSXA 3WLKX 2YCIX 3S46A 5KZ6A 4IMEA 1VPQA 2PGWA 1EDGA 1OQFA 4NYUA 3WF1A 2OVLA 5FEXA 2GJNA 3NYDA 1XX1A 3NQGA 4XUYA 2QDEA 3GDMA 5FKYA 1ME7A 3TSDA 3R1ZA 5BRQA 4YJ5A 3KVKA 3N18A 5L9FA 1E43A 3ARWA 5LHEA 4LC6A 1F6KA 1XYZA 1RD6A 3WJSA 4A2SA 3UWQA 4O4WA 1SMAA 2DP3A 4GINA 3HG4A 3FNDA 1HL9A 4TX6A 4C7GA 2J74A 2H8ZA 3L4UA 2PTWA 2YL6A 3VFLA 4LJ3A 3TIMA 3AROA 4MIMA 4FNQA 5TF0A 3PZGA 1P0BA 3N04A 3OLEA 3TMQA 1PIIA 4CCEA 4KRZA 1LQ0A 2BVDA 3C61A 3WO8A 5EFDA 5C2GA 2J9ZA 2PF0A 4LNYA 2WM0A 3GX9A 3ZT5A 1OX4A 1HKJA 5D30A 5FACA 3QHNA 2J9XA 4BKNA 1GZJA 4LS0A 4HYRA 1XH1A 2ATSA 3SY1A 2VELA 3KS5A 1HJXA 3CZGA 1ESWA 3H7VA 3M0KA 1Y65A 4K38A 4M24A 2A1YA 3W01A 4MWAD 4DWSC 3VD9A 3GVVA 5BXRA 2HVNA 5T8GA 3BLPX 2GJXB 5CSUA 2WAGA 3AMGA 2CIPA 4CD6A 1LL6A 1EXBA 2Y88A 3SSZA 3RN6A 2ZKMX 2W66A 4H6KA 1OEPA 5TD4A 4FF7A 2VFDA 4FK9A 5CC5A 4IQDA 1H50A 1G01A 3L9CA 3UCQA 3SGUA 3MZ2A 3H4WA 2OPJA 1SZRA 1O5XA 2ZXDA 4C5YA 4MJMA 2WM1A 4Y8FA 2Y62A 3B8TA 3VGBA 1Q63A 1TTQA 1KGUA 2I56A 4GNVA 4W4QA 3UERA 4GZIA 4Z42C 2BSLA 4L6DA 3MV11 1IV8A 1HG3A 1AL7A 4N9EA 4CQBA 2OZ3A 4K1WA 4BQ3A 2PUZA 5SWUA 2A7PA 1UB3A 2TAAA 4GI6A 2J24A 3WF4A 2YYUA 2OB3A 4ZA0A 1VHCA 3DG7A 3F5JA 3S1UA 3NQ8A 1KV5A 4ACZA 1Y0EA 4XZNX 3UR7A 5CC3A 4HA4A 2BMBA 1LT7A 4U33A 1Q2SA 3DHDA 1QU4A 3VGDA 2AKZA 1M68A 4URIA 3W2LA 2NVDA 1X6UA 4E8GA 3L4WA 2Y89A 4NAEA 3B03A 1GVRA 3U5YA 2IXVA 3CHEA 4J2MA 4PFHA 5A3HA 3BXWA 5HNNA 3CC1A 5F2LA 3S42A 4X60A 1WUFA 2OXNA 2EPKX 4MNLA 3NQEA 3VNJA 2BHUA 1FTXA 2R91A 3CQKA 2WSYA 3H4XA 3STGA 3USBA 3ARZA 5HQMA 4Z17A 3PY2A 2VCBA 1UOKA 3AU2A 3CAWA 3M0IA 4QE5A 2J7BA 5B7YA 5E1QA 4BI5A 2NWRA 2H6RA 1CIUA 3N6HA 4YHGA 1U1JA 5CG7A 1REQA 5EYWA 1YNQA 2QPSA 3GU9A 4PL2A 3ABQA 3RLGA 5DFAA 2RDUA 3R12A 1KCKA 3T0CA 2W92A 2R82A 4W5ZA 1J0ZA 1HVQA 5D37A 1W1VA 4LUJA 4LQ1A 3MUAA 4UTKA 2Z1KA 4H8UA 2FTWA 4AISA 1OX5A 4A3YA 5CJ5A 1FKWA 2PB1A 4MGGA 3PBMA 1QW9A 3C86A 3R25A 4HMCA 4EXQA 3WNOA 4K1GA 1IEXA 4HSHA 4FMVA 4IGSA 4PUNA 3BAWA 3N2TA 1V7AA 1CLXA 5AC5A 4BEQA 1CGWA 1JGIA 4NZFA 4RL3A 1H62A 3MYPA 1Q6GA 2EG8A 3OO2A 4L61A 1XGEA 1LWJA 5A8OA 4JXCA 3G1AA 4O0ZA 1JJKA 2D1ZA 4FLOA 1QK0A 1FWBC 4B5SA 2ICSA 1XLLA 2V68A 3IVTA 2PC4A 1JZ5A 4A2RA 2WHLA 1D7FA 3CMFA 4JTCA 4QEHA 3P62A 2VUNA 3W71A 4LS2A 5EL1A 3B4UA 3O06A 4IPJA 4I7VA 4DXKA 1WZAA 4NJIA 5AHLA 3IVUA 3NQ6A 3W6LA 3L2MA 3GHSA 1XICA 4Z0JA 1BSLA 1BVWA 1QI0A 1RALA 3CB8A 4AEFA 2VRJA 3LBCA 2JEQA 1TTIA 1VFMA 4P8VA 1X96A 2C71A 2BFGA 4JTDA 1NVMA 1NOWA 4LH8A 5E09A 4TU1A 1ME9A 3SEPA 1K4HA 1KC7A 2E68A 3PC0A 5M5DA 1A4MA 1RP9A 3NL6A 4JN6A 3DXIA 3HB9A 3P60A 4Y6GA 4FZIA 3W9ZA 5JU6A 4OVXA 4H83A 1V02E 5HPOA 1FWGC 5FEZA 1M01A 4EX4A 1C3FA 3CUZA 3TQ0A 4GVGA 1XFBA 2E6YA 4UFMA 4XSLA 2ACQA 4ZE5A 3P74A 3CNYA 3I65A 3GTNA 1RJPA 4YTUA 4D1JA 1DQWA 2WMFA 3H8AA 1CZ1A 1TV7A 4PB3A 2VEKA 5FEPA 2XIMA 1P6CA 4DN1A 4TX8A 1V3HA 1DTUA 1CEOA 2OEKA 1R3WA 5H8UA 2YIHA 1GCYA 4KS0A 5FOOA 3KOWA 3ZVIA 4N7QA 3QY7A 1LRTA 2DZUA 2QXWA 6XIAA 5A8MA 4GK8A 4YWSA 4E4FA 4QX4A 2NUXA 3RXZA 1FDYA 2J7DA 1ONRA 1YX1A 1DKWA 2I17A 4ERIA 1R2RA 1CGXA 1CW2A 3BG9A 3W74A 2ZXBA 4IMGA 2GOKA 3WL1A 1OVDA 1TV3A 1TPEA 4KWWA 4JIEA 1BF6A 4V28A 1UR0A 4PTNA 5JBEA 1OFOA 4PFMA 4DJEA 3BQ6A 4XVDA 1H1ZA 3GG7A 3W00A 4ZCWA 4GYFA 2H9AB 4LVAA 2OYLA 1FWCC 3AI0A 4D6GA 3GDLA 1D8CA 4F2UA 4CVUA 2ZWZA 2XSAA 2VC5A 1VEMA 3KP1A 2V30A 2XVNA 1QT1A 1OK6A 3V75A 1HXJA 3ZT6A 3LBOA 5FF0A 3OJGA 1F2JA 3W7IA 1W1B1 1UKSA 1U1UA 2X1UA 3AHYA 1C8VA 3F5KA 3W7RA 4GXPA 3I7SA 1UC4A 2MNRA 3URQA 3KOXA 4K7VA 2D3LA 2ZVRA 3TVAA 1WCGA 3AIRA 4DUXA 4ZFMA 4ICCX 3TR2A 2FKPA 2J78A 1NU5A 3TJXA 4QLJA 2W61A 5D8ZA 3W2MA 3KHDA 3NDZA 2OYMA 4RXFA 3COTA 5CGTA 1J0YA 5D32A 4DIAA 1H09A 3HGOA 4WQ6A 3E2QA 4IGHA 4NRRA 2P53A 3IS4A 4UBPC 4HMNA 7A3HA 3TTSA 1MVYA 1MW2A 1GKPA 5HK4A 2ZYFA 4GFIA 4FF5A 1KXQA 3RO8A 4RE4A 3FX4A 3RCMA 2C19A 1YPXA 2BVTA 3GUGA 1XC6A 3N13A 2WHJA 4MHBA 3S5NA 4IIEA 1AW2A 1ICQA 3W88A 3BURA 4AFYA 2BXVA 3KL3A 4D6HA 3DENA 4GYPA 4KETA 3AXHA 1H61A 2A3AA 2XSXA 4Z2GA 7TIMA 2WJFA 1W1IE 1P1MA 2XHYA 3O6CA 3MKVA 2NQLA 1Z41A 4JX5A 3EWUA 1FWWA 1PVNA 4O1CA 1AQFA 3O05A 3U48A 1BGAA 5JIWA 4HT3A 4ZQOA 3LB0A 5FF7A 2P5NA 5REQB 4RDZA 4AWSA 2FVKA 4IP7A 2ZA2A 4D9PA 1U5JA 3QW4B 2OO0A 1EZWA 3LOTA 3PAJA 3BLOA 3DN5A 2DY3A 3ABZA 3T1GA 2DH3A 2VT0A 3SIMA 4XZMX 1QWKA 3EKLA 1Z32X 3ITGA 1ISYA 3LMZA 1V3MA 5B80A 3DX5A 3GK0A 4LPCA 3CQJA 4I5RA 4C1NA 2Q8XA 2DIEA 2P3EA 2CHRA 4ZR8A 3DC0A 1LRQA 2QR6A 1XL9A 1SW3A 1AODA 2V81A 4MB5A 2VC9A 4IPNB 1WOAA 4E2VA 2WKJA 3LV6A 1J6OA 3TA9A 2DSWA 2DQWA 1XYCA 1KFCA 4TUFA 4FNUA 3I6TA 3VD4A 2ZZ4A 3W1LA 3M16A 4M0XA 3HZ3A 3GQYA 8TIMA 1XLIA 4I9TA 3HO8A 3LHWA 4M81A 2D22A 3NM3A 3K4DA 3EEZA 3ATZA 1P4CA 1W3LA 3GAKA 4MPQA 3TLLA 4OIFA 1XBXA 4PEKA 1ICSA 1ZP4A 4QNWA 4YVXA 1UC5A 3MCOA 4QBXA 3MVTA 2G4FA 3FGCB 2DUZA 3PUDA 4ZBCA 5A69A 1KM3A 4X61A 2GWGA 1UWUA 3CT7A 3KHJA 4HSNA 4WDWA 1DXFA 5C6MA 3LQLA 3VNDA 3AO0A 3PBWA 2QNEA 3QC3A 2FMOA 1O68A 3IIVA 4C6MA 4YTTA 1LUCB 1HP5A 5J8LA 5TQLA 5KSWA 1H0IA 2QCDB 3UF9A 1E55A 3Q65A 1ZFJA 4Q8MA 3PHAA 2J9YA 4JFWA 1LQ2A 1N55A 5ABEA 5K3VA 3Q94A 1HJVA 3Q2DA 4KGJA 4K7YA 3RG6A 3LCWA 4JX6A 4RNHA 5MKGA 3FXYA 5TNVA 1S2VA 1XLCA 4ZFCA 1UZ4A 4PMDA 4A3QA 4IUOA 4FXRA 4GX8A 3C52A 4W7VA 1LORA 3C0LA 5I0DA 1A5KC 2NXIA 2PP1A 1J2WA 1VB9A 2Q09A 4WSJA 4N2YA 5CQ1A 3VKJA 4D6CA 4Z2JA 4JFTA 3CTTA 3C8NA 2HXTA 5D33A 3W4RA 3NR0A 3BGGA 3WDJA 3GW3A 1PTAA 2UY3A 4MWAA 3L4XA 1TPUA 2P0OA 4S3AA 4H04A 1D3CA 3CUJA 3PZVA 2YYTA 3IUDA 2FVMA 4ZOCA 4RCXA 1CGVA 3UESA 1ONXA 2AL2A 3M07A 3SCTA 5DT7A 4WX2A 1VHNA 3HURA 2OFJA 2PURA 3B3DA 4DM2A 2J4GA 3SFKA 1OC7A 3PZIA 1EWDA 1T5AA 3RUBL 2X7WA 2ISDA 5D05A 3W7JA 1RVKA 1NDWA 4J1OA 4HZ6A 4WDUA 4IFKB 1A80A 3F4DA 1KRMA 2YFOA 3SFWA 4C90A 3W7DA 1E71M 1P0EA 5AVNA 5FEWA 4Z1AA 1EZ2A 3C2VA 1IWBA 3V3WA 2PTYA 2Y8VA 3B97A 5AHMA 3T0TA 2BVWA 4B4FA 4QG8A 3DYOA 7REQB 1L6WA 5I24A 1B90A 3N9RA 1CX9A 1GT8A 1W5NA 2V8ZA 2CBJA 2ZX8A 3VMNA 3PSVA 4W8BA 3BMVA 1S1RA 2IPGA 2ZX6A 4PSPA 1PX8A 3LM3A 3HFYA 1FFRA 3H2AA 1LYXA 2C79A 4Z1CA 3D47A 1L6YA 5IFTA 1JRCA 1T6MA 5IDIA 4ATDA 2WVVA 4UQBA 4DZAA 1ZJHA 4GO8A 1H7XA 5HNTA 2RFGA 1PE1A 1YW1A 4GC3A 2PMQA 2VC6A 3LCGA 1V6WA 3LCLA 1F3WA 4I7UA 2EF9A 3I7QA 1R2SA 1MZRA 3PVFA 2OLAA 3ME3A 1B30A 3W2NA 5DXYA 4UQ9A 1W1YA 5AYZA 4YMZA 2ACUA 1M03A 4H9TA 1FH9A 3CYVA 1K8ZA 3O6YX 4DI8A 2NZLA 4JL2A 4JIHA 1UQZA 3QY8A 3MHUA 2IQDA 4HU8A 4O8RA 3GR7A 1VFFA 4KIEA 1I75A 1PKMA 1FCBA 4EVZA 3KWSA 2GJXA 4I8YA 3LTPA 4R34A 4JTTA 3GC4A 2AL1A 5AYBA 1CENA 1XDLA 4OUEA 4C6KA 5T91A 4ZE4A 1ZALA 4FS9A 3KW3A 3I4KA 4V15A 1B57A 2A7RA 2HCVA 1AQ0A 4JBRA 2NQ5A 4S3EA 1BSIA 3DFTA 2WKGA 1VQTA 5CJNA 3NPVA 3HBLA 3WYZA 1V6TA 2V3DA 3ZSSA 1MZHA 4AW7A 3EXSA 4KCWA 4H00A 1NY1A 4KW2A 3T0BA 1I8JA 3PAOA 2AQWA 5D2TA 3MTWA 3KCOA 4LVBA 1EEXA 5KITA 1Z6KA 3E3HA 1NDYA 2QCCA 2YX0A 3IACA 4TTGA 1JPKA 5C0QA 3QHOA 3ITYA 2QUMA 4L56A 1VCVA 4OECA 1CXFA 4EE9A 3WUFA 4C7FA 3UWUA 3ABSA 1B3ZA 3LTSA 1AH0A 3U2ZA 5A6LA 1KNWA 4JCMA 2NUWA 2BY0A 2VVSA 3O9NA 5IBXA 1NDZA 1W3IA 4YCOA 3ZVHA 1SW0A 1M3UA 3WJWA 5BMXA 5T9BG 2DUAA 1FHVA 2PRHA 5E5CA 3A9IA 1IEVA 4KCTA 4LVFA 3TQKA 1SO5A 4C6PA 4HMDA 1PZ3A 4F4RA 2J79A 2Y63A 1XD0A 1DOSA 1TV8A 3L5LA 4EANA 5A95A 3BE7A 4UOJA 2HNHA 3L0NA 3NDYA 3W1XA 1JDEA 3O3RA 3EDEA 1KFKA 1NF0A 3UJSA 3QF0A 4JTLA 1VPYA 1KFBA 2A5HA 2WJDA 3W0KA 4DI9A 4Q4SA 1WX0A 3GNRA 2J7CA 1UR1A 1W9VA 3CLWA 2NWSA 3EZ4A 1KBJA 3W2UA 1W0MA 4A3RA 3U7VA 1CGUA 3QM3A 2J6XA 3EX4A 3W82A 3M47A 5FF3A 1SM9A 2GPTA 5FA5A 2CESA 2QVNA 3EOUA 1R47A 4TMCA 4DYJA 4Z2IA 4YYFA 1DWGM 2WZHA 1QI4A 2VJXA 2QZRA 2DT2A 3QTGA 3SGGA 1ODUA 2XWDA 3CMJA 2AKMA 4M51A 3RX4A 2PD5A 1KBKA 3N3MA 1C7TA 3SUVA 2NLIA 1GZ1A 3UVAA 4NX0A 4ZO7A 4EF8A 4ZQMA 1YQ2A 3PPFA 3S0CA 1GVSA 4DNMA 5BXTA 4V2XA 1DHPA 5HXMA 4J3WA 1MSSA 3H2CA 2D24A 4WUIA 1MXGA 3BV4A 4H8VA 2WJEA 1OM0A 4HOZA 3VD5A 4C65A 4HPNA 3GXIA 4EK7A 3BGAA 2V9DA 3EOLA 2TRSA 3BAIA 4WLCA 4QFUA 4E4UA 4W93A 4WKHA 5MHBA 4U3AA 1F3EA 4JNYA 4NVTA 1D7KA 4O12A 1GJUA 4G6CA 5CAHA 3LGDA 1NWSA 2PDWA 4PA8A 4WJ8A 2W3ZA 3O15A 2WLYA 1E72M 2J8FA 3ZR6A 1C8QA 3PZOA 1UKPA 4J3UA 2HMCA 3CL8A 2HSAA 3O63A 1OIFA 3M64A 3VKAA 4EPEC 4IT1A 1R6WA 1P6WA 1US3A 3L66A 4N4PA 5I2UA 4WHBA 1LBFA 4AY7A 4AZ7A 4L9YA 2ZXQA 3KDNA 5H1WA 5CXPA 5E6YA 4IPLA 3G77A 1DJNA 2QHAA 2YCKX 4RDYA 3GHTA 3GVQA 2W6RA 1FWTA 1S38A 2ZZ2A 4GQRA 1XYLA 5F4WA 5A8QA 2GWNA 3JVAA 1S5MA 3P0WA 5AN7A 3VFCA 1AZ1A 2ALDA 4JHZA 1EL3A 3BOFA 1IWPA 1WXJA 3EDJA 3PULA 3OHMB 1T7LA 2JKPA 3DZ1A 2PWVA 1QO5A 2FB3A 1WYIA 1FX6A 1W5OA 1K8CA 3NO3A 1UROA 2Q6ZA 3CZJA 2R1KA 3WDQA 1EJ7L 2BGSA 3GYCA 1BYBA 2FLIA 5CZ0A 2XM1A 1ZBCA 4JQ4A 1NIUA 1TPB1 4IZGA 2QPUA 5JUVA 3RJYA 3W07A 3W76A 5IRPA 1EF3A 3N6QA 3FOKA 2YA0A 2CKSA 3AMDA 3HFTA 3KWXA 4B3KA 3TWAA 1W9PA 1MW0A 1A0DA 4LS1A 4DF0A 4MY1A 3ICJA 3C2RA 3SRDA 2SFPA 3PBGA 3EKGA 3VCNA 5LIXX 5A6JA 1U5HA 2ZA3A 3NL3A 4UZSA 4E2DA 4YPJA 1EQPA 1GTHA 1SJBA 3R43A 4RR4A 4UTMA 2PS2A 3GDKA 4QP0A 1JCJA 2CZEA 5EMLA 3WQWA 1XRTA 1IZKA 1OT1A 2QMJA 5K4XA 3H2FA 3LCIA 1EFZA 3IEBA 1JGMA 3ZJ7A 4BS0A 2DT3A 3TP4A 5CSSA 4HVXA 2H9AA 3LK6A 1N7KA 2OU4A 1A3HA 2V5LA 3M6YA 4HHLA 2BODX 1S5VA 5LHFA 4M6PA 3W26A 7ENLA 1KM6A 1UPPA 4MF4A 4M80A 2AMXA 2GQ8A 1O4UA 5G5IA 4YTSA 4RZ5A 4UMBA 3P3BA 4L1GA 4MDPA 2D23A 2NV1A 4D8AA 4HTYA 1RY8A 1VR6A 2ZE3A 3WEOA 4GYJA 3PG9A 1X7FA 1C8YA 1TRIA 4E0CA 3TSMA 2GUUA 2GVGA 3L65A 2OLHA 4DWSA 1NARA 4J40A 4GXWA 1ZGDA 2G96A 3FAXA 4GA8A 3CAQA 4ZXLA 1O94A 1G5AA 3ZLFA 2A3LA 3UR2A 4JQAA 5EGRA 1X38A 4R7WA 2ZUWA 5HWNA 3RNDA 4KRUA 3B8SA 3PJTA 1OCJA 1GVFA 1E3ZA 3WUBA 3CYJA 1FKXA 2Z1VA 5JMUA 2WMGA 2WHMA 4XAPA 1DEDA 3PJXA 1TV5A 3VIOA 5D9PA 1QHZA 1YTDA 2P10A 4UNKA 1UUQA 4B4HA 1BG4A 3ITVA 3TR9A 1CXKA 5JH2A 2UY2A 1UA7A 2OWWA 2DT0A 1M7PA 2FGBA 3JR2A 3MWAA 1FY6A 3MT1A 1J0IA 4UFKA 4XD4A 4H41A 1OCNA 1MRQA 3MW7A 2C18A 1R9ZA 2VO5A 1TE1A 2VR2A 2UBPC 3F2CA 2H8XA 3WMSA 2ZZ5A 2YXGA 1TG7A 2HWGA 4CNPA 1JVNA 4PC8A 5E9AA 1EXPA 4O1FA 3OZPA 3LMYA 2F2HA 2BTMA 5T9CE 2BHYA 4UR9A 3ZZ1A 3GS6A 1E9ZB 4ZVJA 3KL0A 3QR3A 1XSKA 4L1XA 1RUSA 5H2ZA 1F76A 2WZIA 1G6CA 3M5ZA 5E70A 3SCPA 3G3DA 2CZDA 4MJ2A 2J7GA 1F3TA 3BO9A 1GHSA 4WSHA 1E9LA 3CEPA 2ZUVA 4F0SA 1VBGA 1HT6A 2I57A 3N6JA 1BVZA 2J7HA 4HK6A 4M29A 3VNKA 3WD3A 5C54A 2XISA 3PJUA 1KXTA 3MMTA 1DQXA 4AXNA 3ZJ8A 1PV8A 4D8LA 2W91A 3W86A 3KOFA 5BXSA 3VVGA 4GX9A 1BVNP 3R79A 1HX0A 3VGHA 3A13A 4D6JA 2QJGA 4MAVA 3W85A 3KRSA 3RMEA 4JN8A 1LBMA 1TWWA 1XLJA 5I3HA 1TIWA 3APYA 2QUTA 4NZCA 1KWKA 3OIXA 2IUZA 4NAFA 3BLLA 5D9MA 2OLSA 3M0VA 3FA3A 2A4AA 5HR7A 1WDRA 4GQ0A 5ENLA 4HHMA 4ZTXA 1PUDA 3NDOA 4AVFA 5FD0A 2QDDA 5A8PA 2DV0A 2ZOXA 2F6KA 4G9PA 1TA3B 2PCQA 1UKTA 5AECA 1PEZA 4NRSA 4S3FA 4ZB5A 1UBPC 3OZMA 2QF7A 3R8HA 1RLCL 3ABRA 1O5RA 1E6PA 3IJDA 3UW6A 3TYDA 3FGCA 1B31A 3H2NA 5ECVA 2VC7A 4AZGA 2EAWA 6CGTA 2ACRA 1OFAA 1W2PA 1TVLA 3VDGA 1S39A 4F9DA 2EJAA 1E51A 1GQNA 2OGJA 3S9IA 2P3ZA 1WPCA 3KZPA 1PPIA 3I3BA 4ZSUA 3U2EA 4Y96A 1LUCA 3GXMA 2UWFA 1B3XA 3CIWA 3IWPA 2VGBA 2W62A 1UASA 2Y1HA 3A4XA 2WMJA 1YKWA 3BJTA 3EMZA 2F61A 4JDYA 1W3KA 2YA1A 1H49A 5IHRA 5EY5A 4EXBA 3GNDA 5AVHA 4IJRA 4IMDA 4PCNA 2FQIA 1GEQA 2V3GA 3GH7A 3SUWA 3AYRA 3G0SA 2V5JA 1RBAA 3TONA 4IQJA 3ALGA 3FN9A 4OV4A 4L7ZA 1CI1A 2ZQ0A 3DIPA 2AGTA 2ZX5A 3AS2A 4MKVA 4AH7A 2B7NA 4JOMA 1NSJA 1GEHA 1G1YA 1ZCCA 2GGJA 2CERA 1WDDA 3WLSA 1VP5A 5DCEA 3UG5A 3CBWA 1O5QA 1I9CB 3UXDA 1F74A 3O0FA 2BXZA 4NIRA 3E12A 2BLEA 3CQ0A 1HGYA 3WF3A 4M7TA 1EO5A 2I1OA 3UETA 4RK8A 1J79A 2HE8A 4B9YA 4I8DA 3OVPA 5E6ZA 4F3HA 1AJ0A 2W0UA 3V1HA 1EA9C 2ABBA 4WXZA 3VI2A 4LTSA 3APGA 4M3PA 5I02A 2ZCGA 3KTSA 4JTQA 3NO1A 2F84A 1V51A 3W7HA 1AMYA 5BXPA 2F9RA 3PM6A 3WLQA 3WLLA 1E0UA 4IFKA 4J4KA 1C9DA 3UA3A 3SIZA 1DIKA 1GGOA 1ONEA 3QOMA 1B1YA 4N9CA 1B9ZA 5C70A 3WQFA 1E15A 5CBJA 4JY8A 3MO7A 3EOOA 4JYEA 7REQA 3FV9A 3BICA 4IH3A 1CLKA 2PDGA 3WUEA 2XZ7A 1MW1A 3M43A 3GRIA 1K1DA 2D0HA 3VX0A 1EYEA 1PYFA 1KO0A 2WSPA 3LBMA 6TAAA 1BPLB 3S8HA 3WFLA 2NSOA 1IZCA 4GRSA 1VZWA 3BLDA 4Q33A 2WNNA 3SR7A 2GVEA 2Z2AA 3KM8A 4JICA 2GQ9A 5CZJA 3ZWSA 3STPA 4W5UA 4XK2A 1LLOA 4GBUA 5HWMA 1E0TA 1ISZA 1GYMA 3SN4A 1LOSA 1TFVA 1KM0A 3FLUA 1VGAA 2YKKA 1GW9A 1WAUA 1EX5A 1S2WA 2OZ8A 3CHVA 1PZ1A 3R8RA 1LBLA 1PB0A 2FDSA 4AEOA 1Q8JA 3HQOA 4IQLA 4A29A 3BOXA 4Q4MA 4QGCA 2A3EA 6TIMA 4KRTA 3SCVA 4O15A 3OBAA 1B9BA 4BFAA 1OSEA 1YXDA 3L7RA 2WHKA 3CPUA 3VZXA 3C3UA 1I2NA 5GJPA 2Y5SA 3O6AA 1KCLA 9CGTA 2DZWA 3VE9A 5HMSA 1TMHA 4PUUA 2VFHA 2ZA1A 1ZUAX 3TYCA 3U0HA 1NOFA 3GDRA 3GTXA 2A6NA 2PDNA 4XO7A 4BWLA 1RY0A 4AYSA 3QSRA 7XIMA 4HOWA 5LA1A 4AIBA 4ALDA 1CYGA 3VC5A 4FIQA 3EWBX 3LEPA 1D9EA 4HCDA 1MFUA 1W9BM 4CLMA 1M7JA 3DG3A 2HVOA 3LPPA 4M56A 4PUDA 4WY0A 3BSMA 4IL0A 5DY2A 5AZ1A 2P0IA 1PKLA 4DJDC 3P80A 1ZP3A 3UCCA 3STFA 5LSMA 4HHHA 3KP0A 1ITCA 1W3HA 3WQCA 4IICA 3WUGA 1XINA 2VYOA 1K7EA 3VM5A 3LCHA 2BY3A 2P88A 4GZJA 1DYSA 4XKYA 5HINA 4NUWA 1KKOA 1LWIA 2WZEA 4LUSB 3ALFA 1Z44A 3BJSA 3WF0A 1YRRA 2AAMA 4WKFA 2JIEA 4UFLA 3T07A 2QUVA 1FWAC 4Q8PA 5DRCA 4HYWA 5K9CA 4WY0F 3RRXA 3MS8A 4NI3A 1MUMA 3G6MA 4CD7A 3TOPA 4GKLA 1J0KA 1G67A 3CQIA 4LYRA 1JCNA 4DPQA 3WH6A 3STCA 1EJTC 3VZYA 4B5UA 4GUHA 3WK1A 3AUJA 4MJZA 5CEWA 5AOUA 2PGFA 3VO0A 3P0XA 1FWDC 3G18A 4KF1A 2G0WA 5FJTA 4GJ1A 5E0CA 1C29A 5LYRA 4F2BA 1S5WA 4HSOA 1UD5A 2POZA 3DFYA 4ZSTA 2QUNA 3S2CA 2JF6A 4MTVA 2JGQA 4Q32A 4FA3A 1W91A 4H3DA 4C6EA 3UFYA 3MSYA 2HISA 3FYOA 1FFQA 4UFHA 1GPWA 1EBGA 3HQ1A 4ZODA 1JAEA 2DZXA 3S5YA 2G8ZA 2OWCA 1BG9A 3F2BA 5K7JA 5FESA 4JKMA 5C2CA 2NQJA 2PDBA 4E38A 3MV01 4IIFA 1QNVA 3AIBA 4UUIA 4LCQA 2ZTKA 4I90A 1AQMA 5CPMA 1F6YA 4LW7A 1CXIA 3EA3A 1VIZA 1W8SA 1OT2A 1KW1A 1RP8A 3B0XA 4OUIA 1XUUA 3NPUA 1LLWA 1A5NC 3FFSA 2XDFA 1UZHA 4AD3A 2EKCA 4OV9A 1E1CB 2Q8LA 1JDFA 1IHIA 4KWOA 4LYPA 3PTDA 3CU2A 1XRSA 2GUYA 2HS8A 2VX6A 4B2DA 5M17A 2FZDA 1PO9A 3FDGA 3T78A 1TJ1A 3HIJA 2GJLA 3AHTA 2WWDA 2PDXA 2DZBA 2BOEX 1T8QA 3IUIA 1H7NA 2WQDA 4FR6A 1QK2A 3AZSA 4IGMA 1BEUA 3TLQA 3DI0A 1QHOA 4H9UA 3PZQA 3ZMRA 4B5VA 4HGXA 1I2RA 5HWJA 5BWFA 4DO5A 1F5ZA 1QNSA 4P2VA 4R27A 1RLDA 3WFZA 3MQTA 3W37A 1K9FA 4G2DA 5E93A 1WDSA 3AXMA 4TMBA 1FWNA 1GVIA 1H5VA 1J0HA 4LWWA 3WDHA 1KA9F 4LANA 1YPFA 1IIGA 3RX2A 1JUBA 2WCAA 4RZ4A 4O28A 4GXMA 5DEZA 1MW3A 1B3WA 5AHFA 1TTPA 4NQ1A 4MB1A 5D2XA 1LG1A 4Y90A 1OY0A 1EGMA 4XX6A 1E9IA 2F6XA 5FCZA 4KWSA 2QCLA 1Q4NX 3UGVA 4J9JA 4U31A 4DO6A 5DQPA 5DCBA 3VIKA 3I6EA 1TPFA 4HMEA 4E6MA 4DHGA 2ZZ3A 3B05A 2VEMA 4R7JA 3SN1A 3CLMA 3WBEA 3UXKA 1FWFC 3CV1A 4BCEA 1JZ6A 7CGTA 1O60A 1R3QA 4XVEA 5BWAA 3I3DA 2FDMA 1XCXA 4PMXA 3GC5A 4HU0A 4ZOEA 3II1A 2WPGA 1FQ0A 2A6LA 5F2MA 8XIMA 2VR5A 3BH4A 3EWXA 5I3DA 4AHPA 1WDPA 3R8GA 1W9UA 1LL4A 1G4EA 4S3JA 4IHCA 4GC4A 4JYDA 4YXGA 1I0DA 2WSRA 1JFHA 2PLCA 3T08A 4FOJA 3S2NA 4RE3A 1L6SA 3CUIA 2OSYA 2IQTA 2Q3RA 2IW0A 3OBKA 2EPOA 1G4TA 4BEUA 1UMLA 2QIWA 1GJPA 1V0LA 4PCPA 4C6OA 3N29A 1HKWA 2DGAA 5A94A 3ZLHA 4TVCA 3LLDA 3NQFA 4QNEA 3W6MA 1MNSA 1XP3A 2ESCA 1TELA 1TWZA 1K9TA 3HU7A 1LM1A 3IRDA 4P7RA 2OKOA 3OIHA 4MYAA 1YIXA 5G2WA 4NJGA 1KXVA 2XGBA 3BSGA 1EDTA 2E5DA 1EKOA 1K4GA 2XUCA 4O1BA 1XUZA 4WD0A 3H4GA 2FH8A 1MQQA 4O1AA 3SQSA 4HNNA 4HNUA 4MYXA 2C7FA 3BLIA 3K8MA 3CWOX 3HG5A 2H3BA 1VS1A 2OKTA 1JPDX 4O4VA 1IQ8A 5HMFA 2V5BA 4OT7A 2BOGX 2V0TA 1HGWA 3UWWA 4S23A 4OE7A 5M03A 4V1XA 3MSDA 2PWEA 3A23A 1BGGA 4M1RA 3EAUA 1FXPA 2OEMA 4PBGA 1BKHA 3GHRA 2HXUA 4UOQA 1OX6A 1K77A 3ONCA 1OYAA 4AEEA 1B0IA 3VD7A 4N9BA 5LA2A 3HQNA 4XBSA 5C8BB 2CU0A 1K02A 3ZOAA 1X6NA 1Z8AA 1A53A 3TE9A 4UR7A 4RDVA 3WLHA 3N1AA 4JFSA 4GISA 2W79A 2A2IA 4PCSA 5DY3A 3VC6A 4JX4A 4GUFA 3MCNA 4MFDA 4QEEA 2WPBA 1GVEA 4MB4A 3KRUA 1VFLA 3W27A 1BXNA 1KFJA 1MUWA 2D0GA 1ISVA 1XLHA 2QCFA 2Z7GA 3HQPA 3K8LA 8XIAA 3N34A 4XUGA 1IF2A 4IX2A 1T8XA 3LPOA 4JEJA 3K1GA 1GHRA 3W1MA 4XAZA 3R5EA 2EXOA 1EC8A 4XZWA 2NUYA 3Q45A 3WG6A 1CXEA 3M0XA 1K6AA 2HNEA 1VCFA 3DHFA 3FYPA 4IG2B 3H2EA 2NLYA 2BZNA 2PWHA 4AC1X 3QZEA 3WSUA 1SJCA 2A21A 2EKGA 1JD9A 1QPKA 4EOUA 1GQLA 1YHTA 3RM8A 3XISA 1ZBWA 3WK2A 1DBTA 5AC7A 3WLRA 3WH5A 4LVGA 3UYCA 2E5CA 1R86A 3R0KA 3IARA 2YZ5A 5CPNA 4CNOA 5CG0A 3R89A 1TWIA 3NL5A 3W7PA 4G7FA 3P5YA 1Z69A 3M6DA 4M7SA 3G8RA 3SM0A 2CLMA 3T4CA 1W5MA 5IDZA 1GTEA 1H7OA 4Q3MA 2J8GA 3RLHA 4N4QA 3TUUA 2YDAA 4WXYA 1QJWA 5DF0A 2YDQA 4CCDA 4H7VA 5CGMA 4H1ZA 3GKAA 4C91A 1SSGA 2E0PA 4EPKA 4BJHA 1A5AA 2REQB 3SZ8A 3A3WA 3WD0A 1XIFA 2DH2A 2WBGA 4NZ4A 4LV9A 1U5VA 3WEMA 1DVJA 3MVIA 2VL4A 3TXVA 1GVOA 1S5NA 1V0MA 3OG2A 4A8LA 3WBWA 1G0CA 3HPSA 4NNBA 1JL8A 1FA2A 4K8EA 4XAFA 3NOYA 1SFSA 4J3XA 1TA3A 1QI2A 5TIMA 2DFAA 1F8IA 3VNLA 1XIGA 3FJLA 5GJNA 2ISWA 4KH2A 1Q6LA 4QE1A 4DYKA 4UZUA 2X1IA 3O6DA 1CWYA 4TOQA 3OVGA 3QYQA 3E96A 5DRIA 5IFPA 2WNZA 1JF5A 4LAMA 2DZTA 2DPEA 3I6RA 3AIEA 4EAMA 4O50A 3Q58A 4IF2A 1P0NA 2BBFA 3GDTA 1MDLA 4GNKB 2G97A 1YADA 4RDWA 2DZAA 4BZYA 4IUGA 2ZC1A 3ZIZA 4HB7A 2MANA 3T05A 4JL1A 1TB3A 4X9SA 2YXXA 4XZ9A 1JG9A 4H6QA 1VLWA 1CCWB 3KZSA 3T0AA 4H2HA 4HPHA 2P1FA 4HA0A 4PUMA 1ADOA 1Q45A 1EO7A 1R87A 5HULA 5DMMA 3B8DA 3RPDA 2BG5A 1WDQA 4K3ZA 1MI3A 3RRAA 3UPMA 3M46A 2YCLB 3KE0A 5E0FA 4QISA 2QLYA 1XLFA 4NXSA 3GH4A 3PG8A 2V2DA 2B4GA 1XR2A 2PLKA 5GJMA 4F0RA 3P6LA 2XZ9A 3CK5A 3TNOA 1VD6A 3G8EA 2QEZA 2ACSA 1O7AA 2FH6A 2J6VA 1US2A 3NQ2A 3F03K 5CSRA 2YW3A 1FWEC 4LC8A 3ID7A 3M0YA 3C0SA 1ZJIA 3RGTA 2PDJA 3E2RA 3F4WA 1E1FA 2NV2A 4GUJA 4ERGA 2HBXA 1XIIA 1KKRA 4IGNA 3A64A 4WZHA 2X0SA 3VKCA 3MSGA 3TEVA 3UY8A 4L1WA 4C1LA 2PDIA 3NEHA 1TRDA 3G1VA 1OJXA 1A5MC 2DIJA 3BMXA 3VMOA 3IGUA 3VDCA 1UKOA 3W38A 3GNOA 1AH3A 3AJXA 4KESA 1E4IA 4YN5A 3LRLA 1PCKA 1LRNA 3VU2A 3KAOA 4AUBA 1Q8AA 2WMKA 3B04A 2PRMA 3LTYA 1B4EA 1LF1A 3R10A 3TV8A 3LA4A 3MO4A 3LQGA 3NAVA 5L6UA 3FKRA 5JQ9A 3RPMA 3T2QA 2A0NA 5CBBA 1QPRA 5AYIA 1V7YA 1M1BA 1BHGA 3FHQA 1KQZA 4BQ4A 3VNIA 1B3VA 3INPA 4GH1A 4NKCA 5JH1A 2X30A 1UIOA 4JTRA 3UZ5A 1NEYA 1S3HA 3GUWA 2W63A 4PRTA 1HKIA 3TN5A 1WKYA 3GD6A 4YWIA 3QH2A 4UQEA 4ADTA 1R7AA 4AZ6A 3OGVA 4MZYA 3LHTA 4HNLA 3UWYA 3S1VA 5EU9A 5D02A 2X7VA 1ZCOA 3DFQA 1JI2A 3STEA 2DORA 3ZS4A 1T96A 3V5FA 1B3YA 3KLLA 3HPZA 4GH3A 5G4WA 3EA1A 1K9EA 1NFGA 5EMJA 4RX0A 4UTTC 4K68A 1DIDA 1UBSA 5I23A 3C2OA 3W24A 1AD1A 2E6AA 2Z0IA 5F4SA 4R5EA 1O1ZA 3UJ2A 4C7DA 4F2TA 3G1RA 3QV7A 3WD2A 3WDIA 5BOFA 1P7TB 1E70M 1RCOB 3W70A 1E4LA 4ML4A 1O95A 3OB8A 5LA0A 1UWAA 1GOKA 3ELFA 4CD5A 4A22A 3UG4A 1ADSA 4E2BA 4OZOA 1XD1A 4DPPA 1TX2A 5BCAA 1UR9A 4S39A 3TN6A 3AAMA 4HU4A 1H5YA 2YJQA 4LUYA 4PMVA 3SBFA 4CNTA 5F2GA 2G3IA 3WQEA 3F4NA 4ZQNA 4RXGA 3WLOA 2ZUTA 1XG4A 3W3OA 4IP4A 2PDCA 3SY5A 2ZDRA 1DJQA 1VIWA 3GVGA 3LNPA 2J13A 3QGVA 3W75A 1TO3A 2A3CA 4PMOA 3NA8A 2PDYA 3PPHA 3F2DA 1PL9A 1ZAIA 3OLDA 4ZQCA 1RR2A 3EWCA 1EP3A 1DJIA 1VBHA 4J3ZA 4Q6XA 4LUSA 4Y9PA 2CLOA 3SECA 5J04A 1R30A 3LLFA 4HJWA 3C4UA 3EWWA 3UD6A 3U4AA 4K37A 2BHZA 4WF7A 2P8CA 4TVUA 5HQEA 4NZ3A 4NL1A 2Y2WA 3AS1A 4LX4A 2IPFA 3WDPP 1E56A 4ZOBA 1V6XA 3FVDA 4W85A 4UTWC 3S5OA 1J8VA 3BOLA 1JZ3A 3S2MA 3MKKA 5I3GA 2ISFA 1SR9A 2YL5A 4P8XA 4CNNA 1L6FA 5XIAA 5G1YA 3E6EA 2FIQA 3C0JA 2LLEA 1TX0A 2I5GA 2WBKA 2PDQA 4RZ6A 3LV5A 3FCPA 1QRQA 1WKFA 3KUMA 4MKNA 5J5DA 4A05A 3UNDA 3C2EA 4Q8TA 3QYSA 4O0QA 2GDVA 3IIPA 1BD0A 1QOXA 2QAFA 3NSMA 1SFLA 1BQCA 2Y7EA 1E9YB 3LXAA 1H7WA 1V0NA 4KERA 3WDRA 4P7OA 1MXSA 3LY0A 4NZ5A 4OJYA 1V4YA 3NQ7A 2B31A 3TOYA 1OABA 1D8WA 4Y9OA 1CBGA 4J5NA 3QKZA 1BFNA 3GDBA 1PWLA 3GY1A 2PBOA 4POCA 1QDSA 1JCXA 4OOZA 3S6OA 2RDWA 1DHKA 1J5TA 1TPVA 4S3CA 3W22A 3G3MA 3GFYA 2IKJA 2E1WA 4PCFA 5H6HA 4DRSA 4GI4A 4YU1A 4HN8A 3OQEA 3UG8A 4L9XA 1JDAA 1RQHA 3RFAA 4AD5A 1EWEA 3L5AA 2YL8A 1X97A 4PBEA 4FLQA 4UR8A 4QDMA 4YCPA 1XYMA 2OGYA 1E1CA 1W3NA 4D6FA 1XRFA 1KBBA 2ABAA 5C9RA 1UH2A 3TSBA 1EBHA 1MXDA 2Y0FA 4L65A 2ZZ1A 1OZMA 4Z2KA 1W1PA 3VYLA 4AC7C 4JAWA 5LNRA 1Q6EA 3NGJA 3RCYA 2CWXA 4QDPA 1IXQA 2V3EA 3SUTA 1YE6A 4PCTA 1VYPX 3J7HA 1R5YA 2O9RA 1PZ2A 3W29A 3RM4A 4WIWA 1HJSA 2WB5A 3HPAA 3KVMA 1YDNA 2E4TA 4TV6A 4B15A 4ZENA 1DE5A 4JTFA 4LB3A 1C7SA 4JNMA 4N42A 1TV2A 2X41A 3AIVA 3PUEA 1IWAA 2INEA 3CHFA 3SDOA 5FJPA 3D3AA 1QOQA 3QV8A 3HJEA 4IXXA 4M19A 2FHFA 3CHCA 3R6IA 4P8WA 3QR0A 4RUBA 4DBSA 4GY1A 4QG9A 4UMAA 4X9YA 1NELA 1ISWA 2V2CA 4JIQA 4FB7A 1UR3M 3H55A 2OCZA 4HTBA 4I6VA 3TW9A 5CC6A 3S6DA 1X1NA 2B7QA 1G4PA 4JKLA 3ZJKA 3UG3A 1YMYA 1PS9A 4REQA 5EBUA 3GZ3A 1RK5A 3EYPA 3AMKA 4ILSA 4ONVA 2J66A 2XSBA 3KTXA 2O7SA 2P50A 3DKJA 2CHOA 5LNVA 3OPSA 4AD2A 3UXAA 5LZLA 1EHNA 3EPMA 2GFTA 3BGJA 3CIXA 1M65A 3K4WA 1HL8A 2IS7A 1F61A 1DORA 1C92A 2VEPA 3AISA 4MDOA 2YW4A 3UEQA 4JDBA 4PRRA 4D6IA 1CT5A 2ZE0A 3E2VA 3LRKA 1V6UA 3KDOA 2VXNA 2BDQA 1VBRA 2I16A 3E49A 2A3BA 1EYWA 4AMAA 1FUYA 1PTGA 2B0MA 2CLHA 3LZ3A 3BW4A 4JIIX 4QROA 4XWUA 4JTEA 2A7NA 2I5QA 2X40A 3SCQA 3HA1A 1KM4A 4DO7A 1TJ2A 3JRKA 1OCQA 1XHGA 4LAKA 1JPHA 5HJXA 1SVDA 4L9ZA 3LXBA 4JTAA 4WR3A 5CPSA 1GG1A 4GYPC 1BTMA 1ZLPA 1G7UA 3N3TA 1GOQA 2DW6A 2HE5A 2Z00A 2Z4GA 5HUOA 5BYWA 1QTWA 3RITA 3MMWA 3PTKA 2VVNA 4P7NA 1X1OA 4BR1A 4JKKA 1Y5VA 2G3JA 1VEPA 3WLJA 4GIYA 1XDMA 4E4PA 1RBOB 1LP6A 5D2WA 1E6QM 3GG0A 2B81A 3EOEA 5CCZA 3V0SA 4PULA 3BSHA 3N25A 4Z1BA 2VENA 1V08A 2E9MA 4RKAA 3GWQA 1F73A 4GQGA 1TCDA 4J35A 3AU6A 2PDUA 4MY9A 3O16A 4L5ZA 3PP7A 3CAVA 1FVPA 3NNTA 1F9CA 3V7PA 3N2XA 2XYLA 1N2VA 1F3XA 2XIQA 4ZB2A 1WV2A 1B3OA 1O12A 1M6JA 2ZX7A 3KCLA 1RZMA 4NAEB 3TTOA 2VR4A 2VX5A 3JZUA 4EWND 4U5KA 2CPUA 1RJRA 1A5BA 4Z0SA 1T41A 3B9EA 2QF8A 1N8WA 1BYAA 4ENLA 1QPNA 1ZHAA 1J10A 3IIOA 1E0WA 1DJYA 2C8NA 4PEEA 1JZ8A 1RD5A 3N9KA 5EMKA 2WMIA 1OHLA 2ZVIA 3A22A 4QRNA 3VOFA 2NX9A 3IANA 4JHMA 2C6QA 4ROPA 6XIMA 3QQ0A 1TJPA 5A6TC 1DWIM 5J5RA 4KKXA 4ZMGA 3PS7A 3M1ZA 4DUOA 3U8GA 4L6OA 1CNVA 2O7QA 3H23A 1L8PA 4DJDA 4FXFA 1OADA 3WQPA 4EAYA 1UR4A 1X6LA 3KVJA 3BK0A 4ADSA 2DZPA 2EG7A 2G50A 1R38A 1FWSA 1E73M 4LRSA 1OFPA 3VNYA 1M5WA 1M9HA 4GD0A 4GI8A 4HNCA 4M6VA 1EP1A 3O1NA 4CD8A 1W32A 3OODA 5ECUA 1JQXA 2PI6A 4O11A 2VWSA 2ZDSA 3CUGA 2OELA 3OBEA 4I6KA 4TVDA 1PX4A 3KRBA 3FJNA 5GQBA 4GMEA 3UQNA 3P5ZA 5D9OA 3MDUA 3T8LA 1MWOA 2Z27A 4ML9A 1E0VA 2FHCA 3L67A 5IM51 3ZXWA 5AC4A 4CNSA 1CGYA 2QGYA 1JXKA 6REQB 1YPIA 1JFXA 3VGGA 3L4YA 3WFAA 1AA1B 5I5RA 1P0DA 3NJ3A 3GNXA 3WQDA 4S2CA 1S5TA 4H9MA 9XIMA 3MBDA 1W2VA 2YA2A 3GVRA 4Q8WA 3W1AA 2REQA 3AZTA 3ARPA 3W73A 2O9PA 2AOSA 4M1BA 1AJZA 4TXEA 4IX0A 4GFSA 1NP2A 1W8GA 3VKBA 3GBEA 3JW7A 3P82A 3BTNA 4Q6JA 1X98A 4R88A 3VXGA 3SSJA 3AXKA 1QO2A 1ZENA 3TJ4A 3CL7A 2QDGA 2ZUUA 1ZRQA 3VOCA 3BZJA 4Q8OA 5CJMA 2PCEA 2R94A 3WMLA 3QMRA 3KS6A 1F7BA 2YPIA 1SPQA 2WOQA 3IRSA 3VK5A 1XCWA 5DMLA 3LI0A 4X2PA 1J6PA 5HUPA 4NJJA 3W83A 3OEXA 4B9ZA 1CGTA 2CCRA 3NPXA 5BZAA 5LXXA 3S9YA 5I06A 2F8QA 3WH7A 2DW7A 2R1LA 2B7OA 3T8QA 4RJEA 1DXEA 1SZGA 7TAAA 3EDFA 5FAJA 1K70A 2X8RA 4NNCA 3QV9A 2NXHA 1EIBA 3F5LA 4DBEA 4WSKA 5TAOA 1LT8A 3WQ4A 2WMHA 5D4YA 4D8ZA 1EJSC 3G2GA 4BF5A 4W86A 2VTFA 2WVSA 4H7CA 4Z2HA 1SZEA 1TR1A 3QGKC 1A50A 4CU8A 1XQLA 4CU6A 3GC2A 3HG3A 3WH9A 4NASA 1KFWA 2E28A 3IIZA 2QUUA 3PPCA 2QV5A 3QPYA 1IEQA 1XI3A 2CWNA 2V5CA 3FEMA 3FHAA 1EJWC 2Q01A 1YDYA 1MMFA 3UZXA 2PTXA 2G5WA 2YCEA 4XBJA 1FHLA 3G24A 4IPIA 4P61A 1FCVA 2X2GA 4CQDA 1ME8A 4JIPA 2WZMA 3V35A 3SRHA 4J27A 1UWQA 5EA9A 2FTPA 1XISA 4KFOA 1TTJA 3EWYA 1S3TC 3G1HA 5HNRA 2GVJA 4WK9A 4M6UA 5CPLA 1SO6A 1EJUC 3QGAC 1TJ0A 4JTIA 3SCUA 3QJAA 2WKLA 4AD1A 1H60A 1E3XA 2CZ5A 2XU2A 3THQA 2WVTA 5I77A 3WJYA 2RKXA 3AUOA 4FAMA 1XIJA 3S1WA 3WNKA 4QDWA 2VUYA 4NI8A 5C71A 2OX1A 3NCOA 1SFJA 3DOPA 3WNPA 2ZX9A 3T0DA 1BWLA 3MDWA 2BGNE 4KMQA 3U4FA 3GSMA 2DU2A 1IIHA 3KBWA 2PWUA 2VHLA 3VILA 2IKIA 3TA6A 3S1GA 1YDVA 3UJEA 1V03A 5JIPA 2OZ0A 1PHQA 2YGYA 5AY7A 3V1PA 4MUZA 2O9TA 1JUEA 3WQ5A 3E38A 3TXZA 3UU0A 3URNA 3MP3A 2G3MA 4JCLA 5F7UA 1UUOA 4KGLA 3ITOA 3T9PA 4PTVA 1VBJA 4MY8A 3CEUA 4L4LA 1VCGA 4DJED 1OYBA 2D0FA 2V2HA 2XWEA 3ATYA 3LENA 4MB3A 1VJZA 2CLKA 3DG6A 4TQTA 2CLIA 4BI6A 4JEQA 1Q6CA 1US0A 3TAKA 3FA5A 2C1IA 2E77A 2E9LA 2BNJA 3RF9A 3QFWA 3H2MA 2BY2A 3DKLA 1TE6A 3HJZA 3PWAA 1W3TA 4FX7A 4DBUA 1P7TA 3GTIA 4AYGA 1ALDA 4CNUA 1KM2A 2J75A 1IT8A 1DL3A 2O4MA 4IJCA 4CVWA 2D2JA 2Y8UA 1P48A 4Y8EA 4Y9MA 4IISA 4L64A 1T40A 5FAGA 3CZKA 4I9MA 3W81A 1A0EA 1UIPA 2GQ3A 4FI4A 3MI3A 1AL8A 1AMKA 1GUVA 3I4EA 4FNTA 3VDAA 3H6OA 3W1TA 5CZSA 2JK2A 4JFUA 5G1MA 1B5TA 2INZA 1HJWA 3CO4A 3NSNA 1IXNA 3KEHA 4KFPA 2ALRA 1UR2A 3IAQA 2X09A 4O8AA 2TODA 2Y7DA 2RGMA 3DFPA 4US6A 2NXGA 5U4NA 3VIMA 2PPGA 3B4YA 4FNSA 1QNPA 5G2IA 1FDZA 4DEFA 3W28A 4MNKA 3AYTA 3MWCA 2QGHA 4LF2A 5I7GA 2DSUA 5FSDC 1QBBA 3NXFA 3PB2A 3ZO9A 5LGZA 1UP2A 3VCCA 2PWFA 3DI1A 2D2GA 2VX7A 3NPWA 4NSBA 3UWEA 4HCLA 1R8LA 4AD4A 2E25A 4JQ3A 2QAPA 1BYCA 1OFEA 3DFHA 3ARTA 3BCFA 4NT0A 1XLEA 3QTPA 2QYGA 1XG3A 3SN0A 5I78A 1TUXA 4LALA 4O17A 3B9NA 2IXUA 3MHFA 1JIBA 3AICA 2C15A 1HQTA 3TTQA 3LS9A 4DELA 4UTHA 2QS8A 4P7LA 1XPYA 3THAA 2Y5JA 1EJXC 3GXFA 1S46A 4DY1A 4NG3A 4HK7A 4D1IA 1PKYA 3EDKA 1HFBA 2H90A 3VAVA 4H9ZA 4O1EA 1NH6A 2HROA 3TTEA 5FF4A 4YLWA 5LNUA 1XYBA 4ZEPA 5KETA 4PUJA 4L80A 1E5NA 3ENLA 3G5EA 5XIMA 3PANA 2VZUA 2JKEA 3BARA 3H53A 1JYXA 1IE7C 4XD5A 4Z1DA 3BZGA 3CUHA 2VDIA 3W1UA 4GBDA 5IHSA 3N2CA 2C1HA 3R11A 3IK2A 3ZJ6A 4FXJA 4AWEA 3R94A 2G4JA 4KCVA 1V93A 4LXFA 1VRXA 3CZ8A 1FXQA 1FWRA 1TWSA 2FZMA 1DIEA 2F6UA 4B3LA 2XFYA 2R1NA 3ISIX 2C16A 1PHWA 2GGEA 1S1PA 3HF3A 4UNIA 2V38A 5FF2A 5DT5A 3RCNA 2E8YA 6ALDA 1I6NA 4N0RA 3URBA 1WA3A 4MNMA 4AVNA 4DF2A 4MZ8A 3CZEA 2AL2B 2XG9A 1XXXA 3IAPA 4GACA 4F0MA 3VKKA 2RUSA 3AS3A 2Z7KA 1R3RA 1XV8A 2E09A 4X0NA 1R9YA 3TCEA 4ADUA 4U3CA 1ZAHA 1JYWA 4HOXA 5KZDA 1PJ9A 1VFOA 4C6NA 1XRVA 2XH4A 1XIMA 2F38A 1VC4A 3IJQA 4FX6M 3QHMA 3TJIA 1XLKA 4W84A 4ZQPA 1I1XA 3A3HA 3NQMA 1RH9A 1C9WA 1WOBA 4IQEA 3SJ3A 2E7FA 2Y61A 3UR5A 2EPHA 3WK3A 2JF7A 1LJYA 4QLLA 3OHIA 4FX8A 1VKFA 1P43A 3D46A 3LZ5A 3WEZA 3K4AA 1XIDA 4DUVA 4DBDA 4QQ3A 2X1RA 3G6LA 3QLDA 3TQPA 4H8NA 3AIUA 3GU1A 4I9JA 4NYYA 3SRKA 4OHQA 1EP2A 4P5UA 1EGVA 4WJXA 4PUWA 1N8FA 1XLGA 4A3HA 1XYFA 2PEVA 3F4CA 2RJGA 1Z9AA 1I1WA 1TIMA 1OYCA 7PTDA 4F79A 3K2GA 3PZ9A 3S3GA 1KTCA 1NFPA 2WVVB 4QAIA 3VX1A 1EIXA 3LCXA 4UCGA 4AZHA 5GNYA 2Z29A 3SADA 2VGGA 1AQHA 3GFZA 4AIUA 3P93A 4QHRA 4YVVA 1ADDA 1UD4A 5E0KA 2BVYA 3TW7A 2QCEA 2EHHA 1QNOA 1YE4A 1EB3A 1KFEA 2AMGA 1WBJA 4AIEA 3ARVA 4P7QA 4RV3A 3QQWA 5C7VA 4YL2A 4N6EA 3LERA 8CGTA 2AGKA 3F4VA 3NSXA 3N2MA 5KTLA 1NP0A 4LUIA 3A24A 1X8FA 4E8CA 1DWHM 1XLMA 1R0MA 1P0KA 4KIRA 1UG6A 2C91A 3NVTA 3OVRA 5BRPA 1SGJA 1H0GA 1S2TA 1VYSX 3JZEA 4U2ZA 4AZ5A 1LZOA 4EXAA 3DESA 3AHXA 4LT9A 3IJ7A 4WDTA 1XQKA 2YOCA 2ZZ7A 4CQCA 3ZWTA 1QUMA 3QSTA 2VMFA 3A5FA 3P8JA 3W7NA 4DZIA 4A8IA 4UCFA 1Q7ZA 1X1ZA 1Q3NA 3CH0A 1AJ2A 1NWRA 2VCCA 4EIVA 3JS3A 5C7HA 3GH5A 3AIQA 4QSFA 3VIHA 3DHUA 3QOKA 4QAWA 3P7YA 1TKKA 4LGXA 2Z1WA 6PTDA 3TC7A 4YS1A 1TMLA 3V5OA 1KM5A 3DDMA 1N82A 3B8UA 2J47A 3LSBA 1I60A 4HZMA 1TPDA 4GUIA 2E3ZA 1O66A 3NIYA 4O1DA 3W7CA 4GO9A 5GNXA 1F4AA 2YR1A 3BC9A 3ZVHB 4QE4A 3NWRA 1G4SA 1WNOA 4S3KA 4AX6A 2ZTJA 1TYGA 2FYMA 4Y2WA 1QMLA 4QCFA 2ZICA 4ORMA 3EXTA 4X2RA 1AD4A 2VURA 2GGIA 4Y9AA 2HK0A 2OG9A 4O10A 4HNOA 3OOQA 3EOSA 3HTWA 4RW3A 2OR2A 3XIMA 1ECQA 1OFDA 2X0YA 3ZR4A 2YFNA 3E0VA 4UTTA 4C1KA 1QCWA 4X0VA 4PH6A 3DHPA 3W02A 3AIWA 5LXEA 2NQZA 3H2OA 2TSYA 3H7RA 4KWUA 4HJFA 3W25A 4FHAA 3FEQA 4E5TA 3WZ0E 3WIJA 5AYXA 4IMCA 4LFYA 1BWKA 3WQ6A 3SURA 4MMWA 1JNEA 3HN3A 1KTBA 2D20A 4NILA 1HZYA 3QFEA 3MUXA 5HJYA 5IXEA 1ELSA 4B92A 1Q66A 1MRAA 4XD3A 3A5VA 4KEMA 3GXNA 2XH0A 1R3SA 2VZTA 5A6BD 2XFWA 3DU0A 1ZB5A 3R7MA 3S83A 2QDHA 4WOQA 1UQYA 3T09A 2GDQA 1J9YA 3H70A 3ITTA 4S2BA 1JD7A 5EMMA 3W1RA 3CXOA 3MI2A 4MLRA 5HMDA 3TC3A 2PSNA 1RAKA 4YHEA 1KGWA 3REQB 2OQLA 2WO5A 3OLIA 2WYSA 2QCHA 4AZCB 1GJWA 5U7SA 1GWJA 2CKRA 3FXGA 3SCSA 1AW1A 4PTDA 4EACA 1K7XA 2BGQA 4QJ3B 3RU8X 4HA3A 2PDHA 3R0UA 1MO0A 2DJLA 5A2BA 1Y5WA 3DH7A 3M7SA 3GR8A 1YDOA 1NF7A 1XS2A 1KCZA 4XZHA 2ZUNA 3FIGA 4PMZA 1LL7A 6REQA 4KFNA 1EC9A 2VM8A 4Q8QA 1HKMA 1DJWA 4OGZA 3OQ8A 4DYEA 4UTWA 3JUGA 3GIQA 4WRHA 4N02A 3WENA 2CBUA 3PZTA 4EWJA 2ZZ6A 1UR8A 3GM8A 3IJ6A 2G95A 1DE6A 4JTSA 2VD8A 2VKZG 3RK8A 4QSHA 1GYNA 3CB3A 1TCMA 2PE4A 2PLMA 3LRMA 1Q65A 3L0KA 4UNLA 4GQQA 3M5XA 2VWTA 3IPWA 2RAGA 3L12A 4W8AA 5DBUA 4I9AA 4L4PA 3VINA 3I10A 1ZJBA 4E8DA 3W7LA 3N4EA 4FNPA 1J4EA 4XO6A 1SQ7A 1I0BA 2CYGA 1UWSA 1KQYA 5CZKA 2CBIA 1M04A 1N8IA 1EOKA 4GYKA 3W7KA 1OGGA 4XBKA 4DZ5A 1WBHA 2PAJA 2PTZA 3T44A 2OO6A 2VDHA 4LEQA 1E6SM 4H6EA 3IUHA 5IOBA 4MWAE 2E1DA 3PFMA 1ZTVA 3AXIA 3AMLA 4UC5A 1P5BA 1JYNA 1MNZA 1NFBA 5REQA 1JRBA 3GVWA 3S5SA 2Y70A 1RA0A 1CB7B 1JF6A 5I3KA 2PP3A 2HPMA 5CAKA 2D2HA 3B0VC 3OA5A 2ZFAA 3APTA 3N17A 1OF6A 2WNQA 5I09A 1UD2A 5M3WA 4PB4A 2TYSA 4GNJA 1GOIA 3GU2A 5HAOA 4NY2A 1GVYA 5A8NA 3S4TA 3FY1A 3NZQA 4IOTA 3PUOA 2BB0A 2I9EA 1OGBA 1FWHC 1HL2A 1XBZA 3LPFA 3GNNA 5EBAA 4W8LA 3GE7A 1NAL1 2GOUA 4AX7A 3WELA 1VJSA 3ARRA 2QMKA 3LHZA 2QJIA 3BAKA 1XWYA 1DWAM 2Z1XA 4CQ8A 3SRFA 3K30A 2VFFA 3GBDA 3A4AA 3ARQA 4GOAA 3WNMA 3CV7A 3GZAA 3CIVA 1IR2A 2O9OA 2EPLX 2GYIA 5ABFB 2ODOA 2FJKA 3RYSA 3S1XA 3MJMA 2OQHA 4AZBA 5I3IA 5PTDA 2XIIA 3LYEA 3WCZA 4HIBA 3CT2A 3S9ZA 1OWQA 3WBAA 4JTHA 1G69A 2EEXA 3BAXA 2V82A 4Q8VA 4DAFA 1K8XA 3GYEA 1SYTA 2VZSA 3SAZA 1Q4WA 1GW1A 2D2OA 3KBVA 4DUWA 1L2UA 2OZTA 1TQJA 1VENA 1LOLA 1IXOA 2HTMA 2RDTA 3BG5A 3GIPA 4D2JA 3L21A 4UMCA 2WCSA 4DWSB 4RE2A 1V3JA 2GSHA 3CM4A 4BWLC 4HNVA 4A35A 1EQCA 3HM7A 1XLDA 2BY1A 2YDSA 4XD6A 3RJXA 3XINA 1KLYA 5HBFA 2WNWA 1WKDA 4WJEA 4ICNA 1WZKA 1W56A 2QCDA 3NTYA 3CV6A 3NQBA 4CQ9A 1Q6RA 2C0AA 3GW0A 1V5XA 3OYXA 4RLIA 3FJ4A 1C91A 4QCEA 1PCWA 3IV3A 1CECA 3LCFA 1SO4A 3UA4A 1LQAA 4QS5A 4C6LA 3C5QA 1ODZA 4HU3A 1XFCA 3ARSA 3U2OA 2GVLA 3NVDA 5FI8A 5BRBA 5A1AA 1OF8A 2TMDA 3MZNA 4NXKA 3UZYA 1QW8A 4GGHA 4O52A 5DLCA 8A3HA 3LU2A 3BAJA 1I2PA 1E4MM 4IIDA 1HO4A 1CDGA 1JAKA 3RO6A 1K3UA 2XN1A 3EWZA 5BMWA 5A6MA 5F4XA 3NZPA 5C55A 2D3NA 4HYVA 2OEJA 1U30A 1OIMA 2C14A 3G1DA 1BTCA 2HBVA 1WQ5A 3IJ9A 1KB3A 3WQOA 2DT1A 4KPLA 1NQ6A 3UCDA 3DAQA 5HPCA 4KEZA 1XPGA 2WJZA 1ITQA 3LN3A 3PZNA 2IMRA 2I7GA 3W2JA 4O53A 2E40A 3ES7A 1UJQA 3VOJA 3ZFHA 1JR1A 3R0DA 3DGBA 4HPGA 1CXHA 3GLCA 1R85A 1OG0A 3EWDA 3WLNA 4F66A 3RMJA 3SO7A 2DUXA 4PL1A 1E1EA 1VJIA 4DWSD 1Z42A 3SCOA 2Z28A 1MUCA 4KEUA 1PZ0A 3PF3A 1UWRA 1JZ2A 3RR1A 2XTKA 1F05A 4E2OA 1FHDA 2VX4A 4MLJA 4PTWA 3KOZA 3MP5A 3PTMA 3ES8A 1WP6A 2PWGA 4UQDA 4DNHA 3KVLA 1DJZA 2CBVA 4CD4A 4GZ7A 2EG6A 1EX1A 4E3VA 1UMYA 3WQVA 1FRBA 2NT1A 5M2FX 3NFUA 4NAFB 4XIAA 3T81A 3UJFA 4PSRA 2GQAA 4XAYA 1SJDA 3BAYA 5CH9A 3OA3A 2V69A 5DX7A 2O92A 1UP0A 4UTLA 3H24A 2PA6A 3CJPA 1XLBA 1W5PA 3LPGA 5I79A 3I7RA 4M6QA 4IFRA 1WAWA 1MFVA 4CN6A 1RCXB 4UWMA 3LGEA 2DVUA 2J62A 2XH7A 2AQOA 1Q7MA 1VEOA 5CZTA 1QXLA 1KCXA 1YTKA 2YDRA