3W00A

Crystal structure of pcrb complexed with g1p and fspp from bacillus subtilis subap. subtilis str. 168
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
226
structure length
226
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 76
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3w00A00
4NAFB 2F6XA 3VKBA 4NAEA 3VKAA 1VIZA 3VZXA 3VKCA 4NAEB 3W00A 4NAFA 3VZYA 3VK5A 2F6UA 3VKDA 3VZZA 3W01A 3W02A 4MM1A 4JEJA
chains in the Genus database with same CATH superfamily
2WBKA 5HA7A 5AFDA 3NPUA 1A5MC 3R11A 1EJSC 2CZFA 3QFEA 5CBJA 1KXVA 2EPOA 3P0WA 3O15A 1GPWA 1JZ2A 5I0DA 5C7HA 1JPDX 5GJPA 2WOQA 2PGEA 3CWOX 1W1VA 3SSZA 2AGKA 2PS2A 3QR1A 1FWBC 2BDQA 3BAYA 4MNKA 2Y8UA 1X8FA 2X05A 3SCSA 1A3HA 1U1UA 3T0TA 1NQKA 2GVLA 5KZDA 2BG5A 3IS4A 4S3CA 3RU8X 2Y6ZA 2QCCA 1S5TA 3OTRA 2G3MA 1TPC1 1G94A 3SM0A 3VMPA 1IXQA 1YTDA 1YEYA 3B3DA 3D5HA 4UFLA 2Q71A 1BRLA 2QUVA 3FVDA 2CBIA 3SB0A 3U57A 2OEKA 4NRRA 5U4NA 4GXWA 4NX0A 1LBFA 5A8QA 3VD9A 1K7XA 5T8GA 5FJTA 3GK0A 5DCDA 5AYXA 1TTIA 1J79A 5HBFA 1WO2A 1TPWA 5I3KA 2JKAA 4GNJA 3PWIA 3LSBA 1XRFA 1HZYA 1PZ3A 2H3BA 4O1DA 4AD3A 4ZOAA 3FFSA 1DE6A 3GR4A 1EXPA 2FVMA 2WJEA 2HNHA 1VP5A 4C6KA 2V3EA 3KTSA 3RX4A 1EA0A 2J24A 3M0HA 3BO9A 1ONXA 2F6KA 1R3YA 1V08A 5BYWA 2PGWA 4HNTA 3AZRA 2GGEA 5D2YA 4RNJA 3IVSA 1IEVA 3SEPA 1REQB 3PBVA 1HJWA 1ZHAA 2JGQA 4TUFA 3D3AA 3H8AA 2OVLA 5A6LA 4HPXA 3LBCA 3QVQA 3D6NA 2DPEA 1W5MA 3IVTA 3SJNA 3VU2A 5D2TA 2X41A 2Z1WA 3MUAA 1H7XA 2X0YA 3TAOA 3TR2A 2VEKA 4W88A 4C65A 2NWSA 3CMGA 1DWGM 2HS8A 2B7NA 5K4ZA 3UXKA 2E5DA 2E28A 3NL3A 1C8VA 4ZQCA 3GU2A 2B81A 2WMFA 3CIWA 3U0HA 4HHMA 2QCFA 2BOFX 3OZYA 2VEMA 4FPSA 3TX9A 1OYAA 1J10A 2Y0FA 4H7VA 1EP3A 3ERPA 5LHEA 4KFOA 3W27A 5H8PA 2D20A 3KVJA 3RLUA 4HSOA 5A94A 2CU0A 4C1NA 1CPUA 1MNSA 4OBSA 1F74A 3GQYA 4XX6A 1ONWA 4NJGA 2WANA 3SY1A 1F3WA 2DH2A 1B5TA 3RRAA 1E1EA 1ECQA 3L2MA 1H51A 3LU2A 4YN5A 3QPEA 1GUVA 1GVRA 3KBWA 3DIPA 5C6MA 3C5QA 3PPFA 1P0NA 2YLAA 3O1NA 3PBMA 3VKBA 4HB7A 1RCXB 1PWLA 5M17A 1TA3B 1WCGA 1BAGA 4F0MA 1CDGA 1DHPA 3VGFA 3QZEA 2GLKA 2OEMA 3P84A 4FLOA 4AZIA 3GH7A 1TUXA 2VC7A 2VFHA 2FGLA 3BLIA 4LAKA 1EH9A 3B8TA 4Q4QA 1E0TA 1F9CA 1T96A 3IARA 3CZKA 5I6SA 3DECA 3MYPA 2V5KA 1QJWA 2OCZA 1BPLB 1T6MA 3NPVA 4A29A 3NUKA 4MJ2A 4QJ3B 3VX0A 1JGMA 1P6CA 1QNPA 2QF7A 2BWGA 4UR9A 1ZP3A 1KXQA 3UR8A 3U7VA 4NNBA 2QPUA 4DYEA 2XVNA 1JDFA 4LAMA 1QW8A 2YOCA 4RZ5A 1F5ZA 1I60A 3FA4A 3QC3A 2PWFA 1BQGA 2GJXB 3DXIA 4S38A 5FSEC 3PJTA 1XDMA 5BMXA 1IT8A 3CZEA 3N13A 5TF0A 4OV4A 4DBSA 3DC0A 3HB9A 5EKYA 3WYZA 4UOQA 3AXXA 3T55A 1UKPA 3TXVA 1FFRA 1AG1O 4GHRA 3ZVIA 1XLEA 4GXPA 1ZUAX 1E55A 3ABSA 4XSMA 1Q65A 2BXVA 2Z2BA 4MADA 1JDEA 1V3JA 4FI4A 1M6JA 1SR0A 1EZ2A 2ZRWA 1LLOA 4IICA 3T2QA 2IKIA 1PX4A 4FXJA 3AICA 1L6FA 3SJ3A 3OBAA 5B7ZA 4NYUA 2VZUA 1PAMA 3PM6A 2WKGA 3WNLA 3KLKA 1QO2A 4WY0F 2P0IA 3PFMA 3P5ZA 4Y7EA 2R14A 4JTUA 3TLLA 3O06A 3LK6A 2WHJA 3BLKA 2Q3RA 1GOQA 4V15A 3W01A 3TSBA 3U3HA 2ISWA 4PEEA 2YBTA 3HBLA 1DIOA 4PA8A 2W91A 1MFUA 4RK8A 5FF7A 3TTEA 4LTSA 2NQ5A 1UH3A 2LLEA 1K4HA 3TYAA 4L64A 1LL4A 3GXNA 2D0HA 1F3EA 4Q3MA 3EX4A 2NXHA 3TJIA 1A47A 2Z1KA 3NIYA 3C2FA 2RFGA 2I9UA 4XK2A 2JBMA 5A2CA 4YL2A 4QLKA 3GTFA 1KCZA 1FBAA 1RJRA 1QNOA 2BODX 4MPKA 4G1NA 2AL2A 2JIWA 3M5VA 1B3ZA 3HQNA 1L6YA 3HJZA 1SO4A 3CO8A 3BLEA 2WHLA 1DPMA 5I3GA 3GDMA 4PH6A 4LBUA 4YHGA 1XIHA 5A3HA 3W1LA 3V1HA 3F7JA 1G4PA 1YKWA 2CZEA 4CLMA 2PUZA 2NV9A 4D6IA 2FPTA 2WNWA 3NYDA 3PFRA 4KESA 1IIGA 2FLIA 2XDFA 1F3TA 2WHMA 4FSAA 1H0IA 3CYVA 2ZZ7A 4UQBA 3VGGA 1VCFA 5IM51 4AMCA 4JKLA 4NXKA 3QJAA 1DWAM 1N82A 4PEKA 1CB7B 3T81A 3CB8A 3N3TA 5DXYA 3JU2A 2A0NA 3BAKA 4PMDA 1G4TA 1KKRA 3STFA 2GJRA 1NP2A 1TR1A 1MDLA 4MB4A 4PR4A 4IIDA 1LLZA 1XCXA 4FS9A 4O17A 2EO7A 3NDYA 2V9DA 4L4LA 3EAUA 5E9AA 2NX1A 3NSMA 1EOMA 1WBHA 3ALGA 4XZLX 1GQJA 2CITA 3R5EA 3STGA 2C1IA 3G1SA 4K1WA 4XBJA 1XISA 2ASHA 2UWFA 2TSYA 4A8RA 2ZX9A 1B31A 5FL0A 3MP5A 4GYJA 1VFMA 1ME7A 1E5JA 4GACA 3NM1A 5FSDC 3TN6A 1TIMA 1TTPA 1ITCA 1DIDA 1JDDA 5AYYA 4EKJA 5JBEA 4QDWA 1QI3A 3DN5A 1DE5A 3MANA 5HPOA 4JNMA 2PLKA 2J6XA 2ISVA 1DJXA 4GZ7A 5FOOA 1S2VA 2J7HA 2ZX7A 3AMGA 2PBGA 3W84A 3VDHA 3N2OA 1JEZA 4JNYA 1V6UA 1TJ2A 4ENLA 5FESA 3E5PA 1VBGA 2I7GA 1U1HA 3WZ0E 1GOKA 3CM4A 4ZQRA 1MI3A 4DO4A 4XWUA 3BTNA 1R86A 2Z4GA 3VABA 4GG9A 1EC9A 3VDCA 5LIUX 5EMKA 2BVYA 1ONRA 2CBJA 3FJLA 3I68A 1E3XA 1LJYA 1R3RA 4MVAA 4MJZA 4R34A 1V3KA 2C0AA 4REQA 2XGBA 4D1JA 2FYMA 1SM9A 5AHEA 1QPKA 3W2LA 1GVSA 3RMJA 2DH3A 3RITA 4A21A 2REQA 3QYSA 3UYIA 1F6YA 3E2QA 3ZJ8A 4JIEA 3CQIA 2XGZA 1RXOB 4C5ZA 2EHHA 4O50A 4QBXA 4GOAA 4F2UA 1WZAA 1CT5A 1JGIA 3OIXA 4JIHA 2XFRA 1WDPA 3HIJA 5AKQA 1PZ0A 4IIFA 2HSAA 1YIXA 1H1NA 1UWQA 1Q4WA 1Q45A 1IGSA 3HPAA 4GUHA 3UP8A 4KWSA 4Z1YA 3LXAA 5E0FA 1KFCA 3UCCA 4AU0A 2PF8A 2WBGA 3ES8A 4ZZ9A 2ACQA 2TODA 3PZVA 3CZ8A 3E1F1 2UZ9A 3WLLA 3LS9A 4M1BA 1QO5A 3FLUA 2I5QA 1TE1A 3LV6A 3GTNA 4JHOA 2PFHA 2G4FA 1MZRA 4DWSB 4W9TA 1O12A 2GYIA 4IXHA 3UZZA 5M3WA 4W5ZA 3M0LA 1WAUA 2P3ZA 3ZLGA 4MZ8A 4XIAA 2E0PA 5CZTA 3ENLA 4MOZA 4BFAA 2C91A 2WSYA 4OVXA 4BJHA 3BK0A 3NQMA 3H55A 1DXIA 2WQPA 3ICJA 3H4XA 1AJ2A 1OQFA 3L9CA 1WKYA 3CT7A 3TWBA 4GCXA 1TV3A 4GI9A 2VVSA 2W9MA 1NFBA 3W1PA 1JPIA 1M9HA 4ACZB 2WW5A 3B0PA 1XYMA 4HZ6A 3CV1A 3W7JA 3GAKA 4NASA 3L23A 4HOWA 1PX3A 1UHVA 2ZZ4A 3KCOA 4QX4A 3OQ8A 3QFWA 3G3MA 3S1XA 2DV0A 3ZT7A 4GY1A 4GGHA 5K4XA 3VOCA 4IQJA 3W88A 4OT7A 1W3NA 3BANA 5G1YA 1CCWB 3B06A 5ABTA 1GOXA 3CZGA 3ITLA 4M3PA 3MW7A 4AEFA 2OT0A 2WSQA 2FHFA 4LQ1A 3WNMA 4HPJA 4AZCB 2XISA 1ZPTA 2FZDA 5FJOA 2CKRA 2G37A 5D2WA 2V2HA 2CCRA 4GQQA 1HTIA 1VZWA 2XN0A 4E0CA 5SWUA 4V1YA 4DO7A 5DRIA 1UA3A 5HR6A 1D7KA 5FL1A 4Z17A 4JIIX 2PRLA 1DBTA 4WY0B 1WX0A 3W7GA 3ARXA 3HMJG 1HKKA 1DL3A 3SI9A 3EB4A 2ACUA 1E4NA 2R8WA 3DFTA 4W4QA 3C8NA 3P60A 2GUUA 2NW0A 2P53A 1O4UA 3TAKA 2RKXA 2NLIA 3TYZA 4PCFA 1HFBA 3GNOA 1TPB1 3HQOA 1P43A 1J96A 1WBJA 3N25A 1I45A 3LB0A 2E6AA 4NAEB 1MZHA 4MKVA 5F2MA 4URIA 3MVIA 3I3DA 3GXFA 5F4SA 1HJVA 3M0JA 4DBUA 1DJZA 2CZVA 5REQB 4WDWA 1ZBWA 3EKGA 3UEQA 1XBZA 1FCUA 1B9ZA 3LENA 5I02A 1VD6A 2QJHA 3AIEA 2WMKA 3TMLA 5AHNA 1ZCOA 1Z89A 1EF3A 4LRSA 1OFAA 3A24A 4HCHA 4DN1A 5E5CA 4GE8A 3ITYA 2JEPA 3CLMA 1WDQA 3G8RA 1YE6A 3IRSA 4XQ6A 3WK3A 4QG8A 1A5AA 2WC3A 1DHKA 4HNUA 1YDYA 2I1OA 3IV8A 2VEPA 5LZLA 5I3IA 1K8CA 2C8NA 3AXKA 2V5BA 1UCWA 2A3HA 3MSGA 4WOZA 1VEPA 3V5CA 1N55A 3BJSA 3W7LA 2DZWA 3A5VA 4I8DA 3THQA 1XX1A 4X3ZA 2XIQA 3QSRA 4FA3A 2CBVA 1MNZA 3HTWA 4GYKA 1A3XA 1IEIA 3MMWA 3BDKA 4PN2A 3S9YA 4PUKA 4HYVA 3F2CA 1CLKA 4X0VA 1EPXA 4OBRA 5MKGB 2PAJA 3O6AA 2O4QA 4X2RA 3ARWA 3AYSA 3REQB 1HKMA 2D24A 3LLDA 3VA8A 1A5KC 2DVTA 4O1AA 3UYCA 1TPDA 1EUAA 1L6WA 4N6FA 5K9CA 3PWGA 3DKJA 1FDZA 2QGHA 3ATYA 1S39A 4I5RA 3N34A 1Z6KA 4GZIA 2OT1A 2GPTA 1R9YA 4ORIA 2J8GA 1RPXA 1BHGA 3GNXA 3UVAA 3ITVA 3KHJA 2ZFAA 3AYVA 2GVEA 4ZSUA 1Q2RA 1XIJA 4MWAB 4QQ3A 4RE2A 1GYLA 2FHBA 2Y2WA 2A3AA 2A3EA 4TO8A 1MQQA 3WF0A 4JTTA 1EC7A 1K3UA 2Z1BA 3E9AA 2YCJA 3IVUA 3IIOA 4EXBA 2FTWA 1PX8A 3PTDA 3UG8A 4H9YA 4NJKA 3GC2A 2QCLA 4MY1A 4U28A 5BXRA 4I9TA 4HA3A 4IJRA 1UBSA 3I7SA 1S2AA 4NNCA 4IX0A 1P5BA 1RVGA 4Q4RA 3B8SA 3TQVA 1SPQA 3S5SA 3VKDA 1VBRA 5DBUA 3KW3A 3NZRA 3VAVA 4DWSA 3MKKA 1VGAA 3PPHA 1QBAA 2XH2A 4EPDC 1KR0A 2BNJA 3QY8A 2CWXA 2W67A 3VIJA 5CGMA 5IBXC 3K4WA 1B4KA 3MO4A 1TELA 3S2MA 1G67A 3VNMA 3ZO9A 1MUCA 2EJAA 1TWIA 4Y8FA 3I3BA 1JCTA 3ZR5A 1C90A 5HNRA 1XYFA 2WNNA 3H53A 2VELA 4PMYA 2JF6A 1QBBA 3TSDA 4E2OA 1C29A 4P7RA 4K3ZA 5A2AA 4IFKA 1UWUA 1UR4A 2DP3A 2Y70A 2BHZA 4AWEA 4UUIA 3BAWA 1WZLA 3GVRA 4JTLA 3FEMA 4HU4A 3WLMA 3W83A 1CNVA 3SRHA 4DPQA 4KWWA 4LEFA 1LT7A 1I0DA 2ZX5A 4Q8VA 2B7OA 1KR1A 2P1FA 3BQ6A 3QY6A 3WDHA 3OA5A 1OZMA 2RJGA 2HEJA 3PVFA 5ECVA 2VOTA 3WELA 4LWWA 4AZCA 3Q37A 3SUWA 3F5JA 3R8RA 2B7QA 5E93A 5A8NA 1HJUA 1QATA 3KS6A 4K39A 4I9MA 2ZYFA 4MB5A 1SZFA 4HSHA 1UJQA 5AOUA 1J0IA 2H3DA 3GSMA 1NWSA 3L4UA 1GGOA 2EPKX 3UPWA 4KFNA 1AFSA 5AN7A 5FI8A 2IXUA 3RLGA 4KIRA 1EGVA 4L4OA 1R3SA 1ZJHA 3IPWA 3TCSA 1FFQA 2PRMA 1TVNA 3I10A 1EOKA 3K8MA 1BLIA 3CL6A 4OBTA 3DHDA 2WQDA 2Z26A 3MSYA 2A3LA 2KZHA 2ZRYA 3FJNA 2VYOA 1LL6A 1Q6QA 1GNXA 1NU5A 3VINA 1H7RA 1PHWA 1GEHA 1UMLA 5CSSA 1Q6LA 2PD9A 3H7VA 4YU1A 4B2DA 3B0UX 1LWIA 3DGRA 3BLPX 1DP0A 3OHMB 4GQ0A 4UB9A 3S2CA 4ROPA 1EDTA 4ES4A 5REQA 3S6TA 3ABRA 3L65A 3T0AA 2Z25A 2OSXA 5D05A 4YIWA 2VKZG 1W31A 5CG0A 2QCGA 3E12A 4UZSA 4UTTA 3TTYA 2HBXA 2Q8XA 1PTAA 3MUXA 3IAQA 1G5AA 3O2LA 3XISA 4U33A 4B4FA 3VOFA 3U5YA 5EL1A 4HTYA 4KRUA 1S3HA 3K5XA 2TAAA 5HNNA 3PAOA 2J7BA 4ZL1A 3TSMA 3D46A 5FEWA 5DBTA 1T99A 1JFHA 4UCGA 3B0YA 1LRQA 1ZAJA 2IQDA 4JDBA 1BTMA 5HUPA 3EEGA 3F2BA 4IIEA 2WNQA 2ZKMX 2WZMA 2XH4A 2DUZA 1TWSA 3WQWA 1JI1A 3FDKA 3HG4A 4DYJA 1Y5XA 2OU4A 1W9UA 4IISA 4NG3A 3ZS4A 3W2MA 3GVVA 2ZUUA 5E6ZA 3R7MA 4GKTA 4L1WA 1BVNP 3R94A 1FHVA 3A22A 5G4EA 1ME8A 1U5VA 3W76A 1J93A 3QXBA 1FWHC 1S5NA 5MKGA 1SFSA 2INEA 3EPNA 4XV0A 3SUTA 4MFEA 2E4TA 1K77A 5DRCA 4NAFB 4TX9A 1FQ0A 4XKYA 2ANUA 4US6A 5HPCA 2C19A 2V5JA 3WQFA 1JCMP 3PNZA 3IUIA 4HNLA 2CLOA 3QKEA 2G4JA 2DZBA 4LPCA 1OCJA 1HGWA 1RK5A 1EYWA 2VDIA 3ID7A 4GRSA 2NV2A 1ZJAA 3BSMA 1E6ZA 4K8HA 3UW6A 3RXZA 3W9ZA 3C0LA 1XLMA 4IM4A 4P8XA 1Q66A 3F5LA 1L2UA 1JL8A 3K8LA 2HBVA 4C6IA 3WJXA 4HSNA 3NQBA 4ICMA 3B04A 4MZ1A 1X1ZA 1PIIA 2ATSA 2J7FA 2W3ZA 2TRSA 3CPGA 1E3ZA 3P67A 3ZFHA 2Y7DA 1XFBA 4G6CA 1V0KA 3ZYZA 1SSGA 4PSRA 1HGYA 3S4TA 1ZBVA 3IRDA 3WF4A 3TQKA 5AVNA 2CXEA 3IJDA 2XWDA 3W2JA 4ADTA 1I1WA 3I6TA 5K2ZA 4XTIA 3FHQA 5HJYA 1O94A 3FEQA 2OWWA 3CAWA 4PYSA 4L9YA 4S3BA 3KVLA 4UTKA 1KM1A 2VJXA 3QW3A 4FLSA 4XUYA 1FH9A 1AUSL 3U6WA 4EWJA 1J5SA 1B30A 5DX7A 4RE3A 3CGTA 4UTJA 3KL5A 4QNEA 1VYRA 3M5XA 2HROA 4HCLA 3CEPA 1GW9A 3TU9A 4JQ4A 4IQLA 1I2NA 2QUUA 2FZMA 4N02A 3HU7A 4ICNA 1VFHA 3CMJA 4YNGA 5D9PA 2EAWA 2WM0A 1VR6A 2CLPA 3B8UA 1TPH1 3RYSA 4Q22A 3EXSA 1OFBA 3W71A 1OX4A 2F61A 4H6QA 4UQ9A 1OWQA 1TPEA 1OEPA 2ATMA 4NI8A 4RZBA 4D8AA 3BOFA 1CECA 3POHA 2PDNA 1EEPA 3GRIA 1EQPA 1W9PA 3PPGA 2CPUA 3R0DA 3PAJA 4EE9A 3NPXA 1NFPA 4FOKA 3TJ4A 1YXDA 4KW2A 1GKRA 1KV8A 1YXYA 2NT1A 5F7UA 1GJWA 1O5XA 7ODCA 7REQA 1RQEA 3WQVA 4MNLA 1X6UA 2PDMA 2PZNA 1OF8A 1W2VA 5BMWA 1KW1A 3GE7A 4TOQA 4P2VA 4G7FA 5CJMA 8A3HA 3TCEA 4MZYA 4H6EA 2W66A 4YPJA 2ACSA 3TJLA 4JEJA 4EWND 4F9JA 1UG6A 1UC4A 3S9IA 3SY5A 3NOYA 5KZMA 1Q6EA 1H1ZA 5LA1A 3O0KA 3GXTA 3MKCA 3D0CA 3QHNA 2QJNA 2HE8A 3NZGA 1KC7A 1WP6A 2XVGA 3MMUA 2EG7A 1W37A 4P8WA 2Q01A 1FDYA 3L0KA 2DZVA 4V2XA 4KRZA 5BXPA 2JKPA 3NG3A 2CLHA 2IKGA 4BI7A 4ZB5A 2CLFA 1X39A 4G1KA 2DU2A 2OTDA 3LPGA 1A4LA 4UFJA 3KL0A 5A5WA 5FEXA 4GQGA 3G2GA 1JPHA 1LF1A 4ZGYA 1DJWA 2VUNA 4JTKA 2G8ZA 4LW7A 4IMDA 4MJMA 5LNRA 3LRLA 1ECEA 5A95A 2Q8ZA 6REQA 3PUGA 1PTGA 4O19A 3S42A 4O28A 4CEXC 4DLMA 3BLFA 2DZPA 1G4SA 4WKAA 4WJXA 3GBEA 3WX7A 2FKPA 3E96A 5DO8A 4M56A 4O54A 1FP9A 4EPEC 3EOLA 2ZC8A 3ZT5A 3GFYA 2X09A 1W1IE 3UBPC 4KPLA 1OG6A 2Z1XA 3SUUA 3SZ8A 3F03K 2J66A 1O66A 4JTFA 4HN8A 4R53A 1JCJA 3MB9A 5HUOA 3GG0A 2WO5A 3P5YA 3WY1A 1HIZA 4DJDA 1SW3A 3PZGA 4AY7A 3MUZ1 4B5XA 1UWSA 4IGHA 4MNJA 5HMSA 1DQUA 5M5DA 1HUVA 1VBJA 3MCOA 2I17A 2CLIA 4YTSA 3UCDA 3IIXA 1JXKA 2RDXA 1QDSA 2X16A 2J62A 4CQ8A 2EKGA 3T2OA 3OLDA 1JCXA 1ZJIA 5FF3A 4Y90A 3WLHA 1PUDA 3BGJA 4F0KA 2YXOA 5I23A 1NDVA 1PBGA 4PUEA 4HA0A 2WMJA 4IX2A 4RXGA 4LUSB 3H22A 2BHYA 4Z0JA 4KEZA 4MAVA 1R9ZA 4NZJA 2CESA 3T0BA 3WLSA 3HV8A 5D2XA 3WBEA 3A4WA 5DXXA 3SSJA 4AXNA 2ZUTA 3RM8A 1J0HA 4D1IA 4KCTA 3N9RA 1UIPA 1W1ZA 4GY0A 3USBA 3MYOA 1RZMA 2CZDA 4FLQA 4Z2JA 3KBMA 4PBGA 4AF0A 3VCNA 4GBDA 3B97A 4JTAA 4CD7A 2OJPA 2V81A 1JYNA 2VGFA 5AC8A 3SW6A 4UTWC 1YE4A 1GW1A 4A3YA 4FALA 3DFPA 3W23A 2AQVA 4PE8A 4KETA 3DYPA 1GQNA 4MY8A 1A0DA 2OKOA 1WDRA 4OV9A 5KMYA 3HGRA 1DXFA 1J4EA 2QCDA 5JMUA 3S1GA 2A6LA 4ZMGA 1H63A 4WHBA 3GNRA 5C5YA 4GI6A 3FJ6A 3UNDA 4JPGA 2Z24A 3PUDA 2JALA 4BHYA 2C13A 1P48A 3W1QA 2CW6A 1FXPA 3WD1A 3OLIA 4LNYA 3MT1A 1VYSX 2G3JA 1X97A 3W53A 1K7FA 4O1CA 3E0LA 3RLHA 5KITA 1VC4A 4DM2A 2BLEA 3LBOA 3L4VA 3THCA 4K38A 3GR8A 2VT0A 4GKLA 3PJUA 1V6YA 2ALDA 3JVAA 1XLDA 3GC4A 3DC8A 2VEFA 5KEZA 3K30A 1FWDC 1MEWA 3F1QA 2ZDSA 1DVJA 3GC5A 3BG9A 3B03A 3VCRA 4F9DA 4IT1A 3RPDA 1WKFA 2H8ZA 1C8YA 1GQIA 1T40A 1KCLA 3EDDA 3ES7A 4ORMA 4JBRA 3CXOA 2BXYA 3KXQA 1JJKA 4IJBA 3KZSA 5HAOA 2A3BA 1N2VA 1EIXA 5EMUA 4LAOA 3EWZA 3B0VC 3IGHX 4LYQA 4C1KA 1HP4A 5A69A 2PDCA 2XZ7A 4IIGA 4RR4A 2EF9A 4ZENA 4DB7A 4U3CA 1R2SA 3BICA 4NKCA 4L6DA 4S3EA 2DZTA 4FB7A 2RH9A 4PMXA 4P8UA 5CSUA 3SAZA 3SO7A 2QJGA 1TJPA 3UWZA 2E6DA 1V0NA 3AMLA 3FYOA 3GFXA 3OZMA 2F2HA 4GJIA 3N4EA 3UERA 4DBWA 3SECA 3VIMA 1OB0A 3HPZA 3CUZA 4YYCA 4B5UA 2CEQA 2WK2A 2ZWYA 4FLRA 3FAWA 1JCNA 3AISA 1C9WA 1KLZA 1RY8A 1DWJM 3GHTA 4U5IA 1Q6FA 3AUOA 3DFQA 1K8XA 4DWSC 3AU2A 1VHNA 2DJXA 1YBQB 1KM5A 2C1GA 3QSTA 1I0BA 2QW5A 1KBIA 4R27A 3WLIA 1XDJA 5J8LA 3WQPA 2W6RA 1ZCCA 2NSOA 2YA2A 4C6DA 3OG2A 1JAEA 4LS1A 2WZTA 2G50A 4KH2A 1ITQA 4O15A 2QPSA 4P7OA 4NUWA 1XUZA 2WV8A 3W7RA 1NWUA 4FP1A 1J0JA 2DIKA 3LQLA 3UY7A 3DFOA 4WDTA 1CI1A 3CHEA 4QISA 1F3XA 1OCNA 4G8TA 4ZVJA 2PP0A 4F79A 1EJWC 3LI1A 4AZ7A 2DFAA 3QYQA 1LL7A 2XM1A 3NQAA 2RAGA 2D3NA 2OO6A 1R3WA 1XGDA 3B8VA 1OC5A 2IPWA 2R24A 3BV4A 1E1CA 4BF5A 1GT8A 4HK5A 1UD2A 3VYLA 4RX0A 4DWSD 7ENLA 5F2GA 2E9BA 3SCUA 3WBWA 3SIZA 1HL9A 1QAPA 4Z1CA 2PODA 1JF5A 3NQFA 3QTPA 3KWSA 1LRNA 3LHVA 3BCJA 3C6CA 3ZR4A 3G8EA 4WVXA 9XIAA 3MUIA 3W70A 1H62A 1UD5A 3N2CA 2O0TA 4IMCA 5EBUA 3MUCA 1KNWA 3VX1A 4DUOA 2OZTA 1JD7A 3QF0A 5FJJA 1RQBA 4XVDA 2Y7FA 4C5YA 2QQ6A 1B3WA 2PEVA 1IZCA 3F4CA 3MMTA 5EA9A 1XL9A 3K1DA 4HTBA 4MLRA 1F8MA 4CCDA 4P8VA 2NZLA 5E09A 4RDWA 3WDRA 4CN1A 4C91A 1FWCC 3V75A 4O11A 1HXJA 3ZR6A 5DMYA 3SCNA 2A85A 2EPLX 1QCWA 4O52A 4GK8A 4K7VA 1KKOA 3MY9A 1UQYA 3CT2A 4NZ3A 4ZA0A 1XHGA 3CB3A 3HPXA 3U9IA 2YYTA 2RDWA 3KRSA 3G1HA 1A4MA 3M7WA 2OSWA 3A3HA 3SFKA 4HBKA 1F73A 5EMYA 4LNCA 4LUTA 2C1HA 1W17A 3CQJA 4L7ZA 1SGJA 1A0EA 1BWKA 2HWGA 4RZ4A 1LG2A 2HMCA 3O05A 4KWOA 3CPUA 1QPOA 2XIMA 3V36A 4L9XA 3B05A 3HURA 3B4YA 4TV5A 1LUCA 2UY3A 2J78A 4XZMX 2XPKA 3II1A 1KBBA 3EKZA 5JIWA 5A6BA 1LDCA 1X98A 3R4IA 1HF6A 2P76A 3L66A 4QJ1A 1KRAC 1RBLA 4TVUA 3WG6A 2VR5A 4R9OA 1ZENA 2YB4A 3BLDA 3LDVA 2OX4A 1EL3A 1TREA 2P10A 4NF7A 1RP9A 1QPRA 1GOOA 1QK0A 3KRBA 3VDBA 3OZPA 4LV9A 3STCA 1M68A 1UW9A 4UFKA 1UD3A 2VRJA 3FX4A 2X42A 5I3HA 4DIAA 1X8CA 2ZVRA 2DSVA 3WD4A 1XR2A 1HJXA 1I2OA 2R1PA 4N9EA 1Y5WA 2J9ZA 1UZ1A 4PULA 2Z2UA 4PCNA 4Y9AA 2CNCA 5I5RA 4O4VA 4BEUA 2OFJA 3MBDA 4IIBA 1N8IA 4XZIA 1OCBA 3WMBA 1ZTVA 3W7EA 1G69A 3MO7A 3UZYA 3MCMA 2DZUA 1QU4A 3S1WA 3FXGA 1B4EA 4QE5A 2G97A 2ZVIA 2P5NA 3LTPA 3AS3A 3WBYA 3P6LA 3VD3A 4DJFC 2VC5A 2J79A 4XD4A 4RNIA 3EA2A 1E15A 3IV3A 1KM2A 3QLLA 2QLYA 3DH7A 1XLHA 1XFCA 4MWAC 4TTGA 1I1XA 1W54A 4AW7A 5G1TA 3ARPA 4KT2A 1XC6A 4GVHA 3BL3A 1GKPA 2Z7GA 5EU9A 4D6JA 1XLBA 4LY4A 4H4IA 4RE0A 4RE4A 4AAJA 4W93A 3L4YA 4FXSA 3LRKA 1QNVA 3I4KA 3BCDA 4PBEA 2PCEA 5DMLA 1VFLA 1ZBKA 3TTSA 3TMQA 3QGVA 1A50A 5CJNA 3S5OA 3PK7A 1B3VA 3S9ZA 4TU1A 2HXUA 2OO0A 4DJFD 3P8IA 4V28A 4V1XA 5HNUA 1Q7ZA 3NO5A 4H3DA 1UYQA 2ALRA 3SRFA 2YBVA 1HJQA 1S2TA 4GIEA 4J2MA 3VIFA 1CXIA 1NOWA 2WSRA 4MWAD 2D73A 2V30A 4GIYA 4YTUA 4WD0A 2PDBA 3V5FA 4KBXA 1X38A 2OXNA 5A6MA 3C2YA 2O9OA 1CGUA 5C9ZA 3FJ4A 4S2CA 2W63A 3N73A 5CAKA 3KM8A 3LSCA 5EPDA 1JPKA 4POCA 4B5VA 1FKWA 2DZAA 3KCLA 3T42A 2WC4A 3DG6A 1VAHA 1NDYA 3BSHA 4DBDA 3WDQA 1R5YA 2DZXA 3KDOA 2WKJA 4OUEA 7A3HA 3OO2A 5JBDA 2DJLA 3MP4A 4LX4A 3HJEA 2NUXA 3IGSA 2BSLA 4GZEA 4QG6A 4RW5A 5DCBA 3DZ1A 1K9FA 3H7RA 3CIXA 3CH9A 1GCYA 3K1GA 2AOSA 3STEA 2Q3OA 4J3XA 3RG6A 1UR8A 3WQ5A 1P0KA 3WIJA 4UBPC 1TV8A 3R1ZA 3VIPA 2A1YA 3AUJA 3G3DA 2E25A 2VGIA 4IP4A 3GHUA 2FGZA 4MB1A 2SFPA 1X7FA 2POTA 8CGTA 3SURA 3BW2A 1DIEA 1T5AA 4XAGA 2QV4A 2ZXDA 4JFVA 2NVDA 4XD3A 4OU1A 2V0TA 3LYEA 2NLYA 4EPKA 3CUGA 1US2A 2VD9A 3L2IA 1XLCA 3M7SA 3CHDA 3W3OA 3VGDA 3LHZA 2XN1A 3RRXA 2IUZA 3HZ3A 4M0XA 1FKXA 1MW1A 2JQXA 2NX9A 5HWJA 1KFBA 4C7DA 4CVUA 1XIBA 2XH0A 1XIMA 1AH0A 2GL5A 1K8ZA 3M6DA 4UTFA 1XLFA 5FD0A 4L6HA 3IEBA 4LY8A 4QR6A 3VIOA 4M80A 3TDFA 3L5LA 3L21A 3NPWA 1GVFA 4JFTA 3TC3A 2Z27A 2GSHA 2VTFA 3G1RA 4JNZA 1PYFA 4W8AA 2QEZA 1KFJA 1MVYA 3WSUA 7PTDA 4HD5A 3FNDA 2YCIX 4J40A 3W1TA 3WNKA 3GFZA 4M1RA 4D6EA 3I65A 3NWRA 4B4HA 4CQBA 3BMXA 2PI6A 1Z32X 4KWVA 3T44A 2DSZA 4G7EA 3WH6A 4AD4A 1U1JA 3TA6A 4DJDC 1MW0A 3QV8A 1V02E 4JTEA 3W24A 3K4AA 4GZJA 5BROA 1BGGA 4OJYA 4QSHA 4DF1A 1PVNA 1VHCA 1XBXA 3SQMA 3EMCA 2ZC1A 4J3VA 4S2BA 3ITCA 3L4WA 2PP3A 5DEZA 4Z2HA 2V67A 2ZA3A 1PJ9A 3HG2A 3VIHA 1JI2A 2X7WA 4PB5A 3WQ6A 9XIMA 2GGJA 1IWBA 1JRCA 4YCPA 2OGJA 1ITXA 1ZQ5A 1BRLB 3M9YA 1DTNA 1UWTA 3PHAA 4PUDA 3VD5A 1HO4A 1H41A 3G5EA 3M46A 3KL3A 4HGXA 4IMEA 1ISXA 4CGTA 2VUYA 4DJDD 3CL7A 3W7IA 3V5OA 4QSFA 4CVWA 4FHAA 5IFTA 5C9WA 2FPYA 4Q4OA 3LEPA 2VQUA 3PZMA 4AD1A 2PDXA 2BVTA 4A35A 5IXEA 1GQLA 4C6EA 3UETA 1XWYA 3M41A 2RUSA 1IHIA 4Z0SA 3GS6A 3QV6A 4JR5A 3WDJA 3VIGA 1NAL1 3W07A 4NRSA 1UH2A 2PLCA 2IPJA 4JFUA 1TZ7A 4Y8EA 4ZFMA 2Z29A 3SCQA 2VCCA 1AL7A 3DKLA 5DFAA 2OR2A 3F5KA 4HOXA 2YX0A 2WWCA 4DUXA 4S3DA 3MTWA 3P3BA 3W72A 2FDMA 3TFCA 4GJ1A 4U4MA 2X30A 2WYSA 5ENLA 3VNDA 1XRSA 2BB0A 3FY1A 1KBJA 4OWGA 2FTYA 4QS5A 4ADSA 2NQJA 5FJIA 4JTGA 4HVXA 2EPMX 3FK4A 4H9UA 3E5BA 1PTDA 2EXOA 2C3ZA 1FY6A 3ZJKA 2PGRA 2A4AA 5AC7A 4U10A 5EMLA 1FCBA 3O07A 4JEQA 2J27A 2WJDA 4BZYA 3AHYA 4M81A 1JZ3A 1WB0A 3UCQA 1EXBA 1OT1A 1OIFA 3V18A 1KQZA 3KBVA 3ONCA 4JGDA 1KQYA 3QQ1A 1TTJA 5FIPA 3T7VA 3CH0A 4RW3A 4QCEA 4OQVA 4WKFA 4CNNA 2QKFA 4EIVA 1H0GA 4ZXOA 4HMNA 5F2LA 1OY0A 4Q7NA 4C6JA 5I3JA 3ZJ6A 1V02A 2V5LA 4LYKA 4MIMA 4NHVA 3EX3A 3AO0A 2ZXAA 2TPSA 2VCBA 4A3QA 1EC8A 5FJPA 1OYBA 1XH0A 3AYTA 3EX6A 1AW5A 3E02A 1I8JA 3GIYA 1E9IA 2YXXA 3AAMA 5DLCA 2A79A 4QEEA 4NQ1A 3OVGA 4PSPA 4B16A 3VDGA 5CXPA 1D8WA 1PS9A 2NUYA 3WUEA 2C6QA 2GVJA 2NQHA 1QW9A 3IIVA 5CBIA 2VFIA 4JFSA 4XBSA 3SN4A 3UWQA 5IDZA 3SFWA 4Q4MA 3TJXA 5G5IA 4NZ1A 3BW3A 2G0WA 4NY2A 2BMBA 2R91A 1SZEA 5JQ9A 1UPMB 1E6XM 4NYYA 1UP0A 4F0HA 4IMAA 4BK9A 1O60A 1EB3A 1OZQA 2EG6A 3LCGA 3LPOA 2WC7A 5FJRA 5D30A 4UWMA 1ISWA 2OKTA 4XO6A 3LCXA 2I14A 3MI2A 4WRHA 3W1RA 3IGXA 3S0CA 1FWRA 5HMDA 2QXWA 3WQ8A 4GJJA 3SCWA 4EP8C 1Q2SA 3ABQA 3A6OA 3WK2A 3ARQA 3Q65A 2QUMA 3JRKA 3VE7A 4A22A 3AHXA 4UZUA 2Y4SA 2XFYA 4JOMA 1JIBA 4RXFA 2J7CA 3GD6A 3UWUA 3VCCA 3URQA 4JTQA 2YIHA 4FNPA 3D3FA 1F7BA 4JL2A 3MWCA 3GIPA 1M41A 1AW2A 1Q6GA 3S8HA 1NOUA 3M0XA 3W26A 5I07A 5G2HA 8XIMA 4YS1A 3G0UA 5A8MA 3UGRA 3HM7A 1LQ2A 2CLEA 1UQZA 4JYFA 4ERGA 4MKNA 4PMVA 3FAXA 3G1DA 4B5SA 1QI2A 1HP5A 4EXQA 2D2JA 1H4PA 4CD4A 3AZSA 4Z2GA 5HR7A 3SCRA 4O4WA 3MS8A 3R43A 1DWFM 4ZXLA 1T8QA 4UTLA 4Q7IA 4LVGA 3DFSA 1VPXA 1UR9A 4X22A 1XIFA 5B7YA 3AJ7A 4ROQA 1B2YA 1V3HA 5CBBA 4NZCA 5CSYA 1IZKA 1V3LA 5PTDA 4BWLA 1SZGA 3DFHA 3NQ7A 3MBFA 2O55A 2WSPA 1XYCA 1J6PA 1GZ1A 4GI8A 4F4RA 4ZQOA 3WF2A 2ZUWA 1GVEA 3CC1A 4A2RA 4HHHA 2AKZA 4N9BA 5EMJA 2P3EA 4DZ5A 4H41A 1JG9A 1IWPA 4L1GA 4JN8A 3W86A 4PRWA 3E0IA 2PDPA 2IXVA 3T40A 3O3RA 4MNMA 3SY8A 3MC5A 3OYZA 4N0RA 4F40A 1FHDA 1Q8JA 1IEWA 5HATA 1XKYA 1JQXA 2HPIA 2BY1A 1WUFA 3GDTA 1XYZA 1LG1A 3LPFA 1OG0A 3ABXA 5FF2A 1UUQA 1XQLA 1SFTA 5MHBA 3NOEA 4UCFA 1P1MA 4KF1A 1V6WA 3EOUA 2VXNA 4Y9NA 1R2RA 3QW4B 2WCAA 3IWPA 2PDWA 1XYAA 2PDJA 4YCOA 1EFZA 2AL2B 2ZOXA 1GG0A 3VC6A 5CC6A 3KZPA 2FZ9A 1WDDA 1S2UA 2YA1A 3PZUA 3ZLHA 1QMLA 3RO8A 2PWEA 1OFEA 3RPTA 2R9RA 4GFSA 5LXXA 3I7RA 3TV8A 1BYBA 2F6UA 1MDRA 3W02A 3UZ5A 1OFOA 2E67A 1TO3A 2PDGA 2AGTA 2C79A 3BV7A 1R3VA 3T08A 1RLDA 1W91A 4I7WA 1OF6A 1YDVA 4AVNA 3LRMA 3GXIA 3JUGA 1KFWA 3RR4A 2OYLA 3NQ2A 4I90A 1ZL1A 1V03A 1GVYA 4C6MA 4Q4KA 1XH1A 1MYRA 4ZBCA 4O0ZA 4AD2A 3HG5A 2ZX8A 3S3GA 4H19A 1TX0A 4RNFA 1VEOA 1DOSA 4JY9A 1FWSA 3OG3A 1AQHA 1SMAA 4PUUA 4DZHA 2QCNA 3M0KA 4IZGA 3ISIX 4HIBA 3VKJA 2PZ0A 5ABFA 3M0IA 4Z1DA 4ERAA 1B9BA 2XINA 3FXYA 2PURA 1A5LC 2WWDA 4DPPA 2QDGA 4GC4A 3EZ4A 4H7ZA 1OCQA 4IL0A 3M07A 4AX6A 2YDAA 4HHPA 1Y8BA 4DXKA 2NSXA 1UZDA 3PULA 4LC6A 1OX6A 1VENA 1TR9A 3RILA 3IIZA 3N11A 1UWAA 4O8AA 5T91A 4KEUA 4M6PA 4N42A 1TE6A 3M43A 3VI2A 1P7TA 1TKKA 1DJQA 1NQ6A 3BH4A 2INZA 4Z1BA 2PF0A 1UKSA 4AWUA 3MZ2A 3L2LA 3HMCA 5A2BA 3M44A 2CHRA 3GG1A 4QP0A 1UWIA 1LBMA 2JE8A 2J8TA 3RPMA 2J75A 1WE5A 4JTHA 4GC3A 4AQLA 2YZ5A 4H6RA 3RF9A 1TQJA 4DEFA 3TFXA 4J3ZA 2WB5A 3G1XA 3WENA 4EVZA 1ZALA 4AIUA 5CPOA 5HK4A 3Q67A 4C6BA 1O6IA 4B90A 4H04A 4W8BA 4ZTXA 2W61A 2NX3A 4REQB 3ZZ1A 1T0OA 4GYPC 3WD3A 1GOIA 1JUEA 1WAWA 1RJPA 2RHGA 2GQ9A 2REQB 3RM9A 1H60A 4WEVX 3EX2A 2YCLB 3W7DA 2D23A 5FJUA 3PBWA 3QC0A 2HE5A 5BOOA 3BAIA 5CPQA 2X40A 3QHOA 4YTRA 2J6VA 3OPSA 4GFIA 4ZOCA 2W79A 1EUNA 4AYSA 2ZQ0A 3GKFA 3UU0A 4ACYA 1UUOA 3VXGA 2OOGA 1PB0A 1FWIC 4JX4A 4EX4A 5HQMA 3M0ZA 4NJHA 4O14A 1F61A 2Y5SA 2Y7GA 1E56A 5G4WA 3CWNA 3BZJA 3PBYA 2XSBA 5BU9A 4O1FA 1AH3A 4J3TA 2VCAA 3WUGA 4GA8A 3UVIA 5D33A 3W1UA 3W74A 3LX9A 4E8CA 1SZNA 4UTHA 2NVAA 2P50A 3W7NA 1GONA 4E5TA 5C55A 3NL5A 4BR1A 3M16A 3NXLA 4H6KA 4S3KA 3ZJ7A 1J12A 5CZ0A 3UXIA 3L0GA 4BF7A 4YMZA 1GHRA 4LSBA 4DAFA 1FUYA 1XRVA 3W1MA 3WJZA 4JKKA 4JY8A 1OFRA 4LV4A 3DDMA 3FYPA 3U4AA 2FQIA 3G1YA 2XM2A 1BEUA 2Q09A 3S2JA 1PZ2A 3A12A 2V69A 4PTNA 5AY7A 2D0GA 1R3QA 4O0QA 5C2GA 4FAMA 3GB6A 1A5BA 3CV7A 3M0VA 2C15A 3V16A 3QH2A 3LCLA 2VL4A 1J5TA 4S3GA 3KWXA 4H8VA 1FHUA 1K70A 1PKLA 1V6VA 3W25A 2VX6A 4GISA 4B91A 4G2DA 5C54A 4H9VA 4AHQA 1YADA 5ABHA 3H4WA 3DG7A 4A8IA 2O7SA 2DT1A 2XZ9A 4W7WA 5C9RA 4XIMA 1QR7A 1W9DM 3ELFA 1UROA 3GX9A 1TIWA 1TYGA 3TN3A 2PBOA 2J88A 1D3CA 3MHFA 4G9PA 2PCQA 4W85A 8TIMA 4FF5A 1EWDA 3UF9A 3EB2A 1D9EA 2PWDA 3RFAA 4QE4A 2D2GA 1W5QA 1SO6A 4AVFA 3N29A 4X9SA 1R7AA 5E70A 3MVTA 2YR1A 3TH6A 1SFLA 1HT6A 3LTSA 3T6CA 1AQFA 3IAPA 3URAA 1LP6A 3ARVA 1JNEA 2X1UA 3ZVHA 1S2CA 2TMDA 1O1HA 5F1VA 3MQTA 1ZBCA 3NYZA 1LQ0A 5BU6A 3CUXA 3G24A 3E2VA 1LYXA 3A5FA 3IJLA 3IUHA 1A3WA 1H1YA 1R85A 3WDIA 1G6CA 4L4PA 1V79A 4AB4A 2FZ8A 3AXIA 3IANA 2YB1A 3NR0A 3AIVA 3LXBA 1NP0A 4OZOA 3AIWA 4EK7A 2O9RA 1RH9A 4XD6A 3UESA 4HQVA 3QGKC 4N9CA 3VOGA 3C3NA 4PTXA 3B9OA 3UQNA 4JTDA 2X2YA 4PMQA 1TZZA 3DHFA 2F8QA 3MUY1 4US5D 2PSNA 3TQPA 3NO3A 4UFHA 1QI0A 3GU9A 1MEIA 4QAIA 3TTQA 2X1RA 3NQ6A 3LPPA 5HINA 5E0KA 1W32A 3PNUA 3SGZA 1XV8A 3LXCA 4IMGA 3MHUA 1GWJA 3PC0A 2ZZ6A 3V35A 5DY3A 1MO0A 4R88A 1FWFC 2UBPC 5AC5A 4JQ1A 3P7YA 3EKLA 3B9AA 2OODA 3WJYA 3E2SA 3BPWA 4WGXA 3RAOA 3P61A 2UY4A 1JRBA 3BZGA 3NXFA 1PIFA 4LUJA 1QWKA 3FHAA 4Y9OA 5A8OA 3W37A 5LIXX 4CNSA 2HZGA 2YGYA 4JX5A 4INFA 3UR7A 2D1ZA 1VPYA 3ZXWA 1KM0A 2PWGA 3KP0A 1JYXA 1BTCA 3M1ZA 3SUVA 4I7UA 4H8UA 3PANA 3VOJA 1PIGA 1K7EA 4UMCA 2GK1A 2RGLA 1U22A 4RV3A 1JQVA 1QASA 1E0VA 2PU0A 3TYDA 4N6EA 2GUYA 3CK5A 4RLIA 3GLCA 4HNOA 4EAYA 4EOUA 5I2UA 2ZXQA 2VFGA 3KLLA 3VMNA 2D22A 3NFUA 4Z2LA 2ZUVA 1LTDA 2HVMA 1OK4A 1M3UA 3TZNA 1KLYA 2PTZA 4ERIA 1V6TA 1TUFA 1H7WA 3VK5A 4NP7A 1VH7A 2VX7A 2YCLA 2WVVA 1LORA 1EO7A 1LOSA 2E6YA 3R8GA 4DJEC 5M1TA 2FIQA 3WD0A 1TWZA 2ZE0A 2ZBTA 3S1UA 1FWJC 3VMOA 2RDTA 4PMJA 4IF2A 1C9DA 2A21A 2JEQA 3EGJA 2YBUA 2HJPA 5E1QA 3NDZA 4TVCA 1CBGA 4MY9A 4CUCA 3OGVA 3MHGA 2GUBA 1UC5A 1OFDA 1XYLA 3KAOA 1XLJA 1LOLA 1MFVA 2P8BA 4J9JA 1E71M 1M01A 3W7MA 5I3FA 1CXEA 3TW7A 4N4PA 1TRIA 4S39A 4CNOA 1MUWA 2VFEA 4B5WA 4ZOBA 3DAQA 4Y9PA 1HKJA 1K1DA 4DJED 3MV01 3RDKA 1NJJA 1ESWA 3NURA 4M19A 1CYGA 1FTXA 3VFCA 3T8LA 2HTMA 3H21A 3T78A 4CD5A 1SR9A 4DWDA 3A4JA 3ZLFA 3KHDA 4NXSA 1MRAA 4PTMA 1GORA 2QIIA 4GINA 1POKA 4K2SA 1O5KA 2FMOA 1IYXA 1H5YA 4N4QA 2IKHA 3O8AA 2VZTA 2XVKA 4K6AA 4IUGA 2QIWA 5D38A 5EY5A 5JBFA 1UR1A 1NM9A 4H83A 2YLLA 4DVOA 3EB3A 2HV5A 2GDVA 4AD5A 2J7EA 1PE1A 3M6YA 1J2BA 3FGCA 4IFKB 3CAQA 1ZFJA 1HVQA 3DERA 4GBUA 4AVOA 1I4NA 2AQOA 1N8FA 3V1PA 4GCAA 3K4DA 1PCWA 3QY7A 4F8XA 4HZMA 3DYOA 4XZNX 1E72M 1XLAA 5L6UA 1ZSXA 3PZQA 1ZJBA 2QS8A 1JYWA 2Y63A 3I3EA 5MF5A 1GTHA 4UMBA 3TYCA 3WNPA 2GJPA 2ZZ1A 2PC8A 3H2MA 4V33A 3PZOA 9RUBA 4D8LA 3UFYA 4CCCA 1SYTA 5BCAA 2VFFA 4LVFA 4LJ3A 1M53A 4KS0A 1EP2A 2WLZA 1POJA 1DQXA 3FV9A 4C6NA 5EYWA 5CQ1A 4WSKA 1XSKA 4N2YA 1AD4A 2XVLA 4A6GA 3R25A 5B80A 5C2XA 2HK1A 2E7FA 1AQ0A 3VOHA 1T7LA 1WDSA 3GTIA 4KEMA 5I79A 3FSUA 1H50A 1QOXA 3URBA 2H8XA 4TX6A 3TLQA 2XVPA 1Q63A 3P80A 2O92A 5D9NA 4L61A 3WEZA 2I57A 4FZIA 4Q4PA 2VEGA 3WLNA 4QRNA 3QV9A 3POCA 2WNZA 5I09A 3DBPA 3AS1A 2R82A 3DESA 2XG9A 4PTVA 1W1B1 1I6NA 3QQWA 4M51A 1OADA 1ZLPA 4DBEA 2FHCA 3EA1A 3U8GA 5EGRA 4Z2IA 1YNYA 4O18A 4D6GA 3EWDA 2W0UA 3VZZA 3SQSA 5A8PA 3KTXA 7XIMA 4PUWA 1KTCA 3QOMA 3TNBA 4P7NA 5K7JA 3T2PA 2BOGX 1VF8A 2BGSA 1NDZA 4A4AA 1OJXA 3WMCA 1ISZA 1GJUA 2FVLA 2VURA 4MMWA 5EB8A 3T8QA 1GTEA 1KM3A 1TTQA 2F38A 1ISVA 3FW6A 1NEYA 2BY0A 4FXRA 4HT3A 1KB3A 4DF0A 4GMEA 1A0CA 4XAYA 2PDIA 2BY3A 4IG2B 4LCQA 4LCSA 3OB8A 2E9MA 1XW8A 4Z42C 4QXIA 2HISA 3NZPA 1SU5A 3S5YA 3RK8A 1TPVA 1KTBA 1VBUA 2NQLA 2PGFA 3WD2A 2Z6JA 3EPOA 3LGEA 4L80A 3Q4DA 2VGBA 1FWTA 4EAMA 1ZS2A 1XH2A 2PDQA 3RU6A 1IQ8A 1HW6A 4NILA 2VR4A 2Z7KA 3AHTA 3BLLA 3N9KA 4DM1A 1YW1A 4L1XA 1P0BA 1QHOA 4PBFA 3GHSA 2H9AA 4NT0A 2XN2A 3OVPA 4XKYB 4HYWA 3QOKA 4MFDA 2MUCA 3VILA 1DV7A 4UQDA 4DI9A 3NVDA 1WYIA 7TAAA 3BC9A 3RX3A 1M7OA 3HPFA 3LHWA 4HNNA 2HK0A 2EJ1A 1FH7A 2V5DA 3W85A 4ML9A 2YFOA 3SUSA 4I6VA 2OQLA 1AQMA 1ICPA 3PG9A 1QNQA 4JZ5A 1QI5A 3OYXA 1RALA 1W8SA 2BOEX 1XSIA 5DMMA 3O63A 2Y8KA 4YWIA 3WNOA 4UFMA 5CG7A 2QMJA 1EP1A 4N9DA 2YSWA 5CJ5A 2ZUNA 2XWEA 1XIGA 1V0LA 1U2YA 1D7FA 4KCUA 3FOKA 1ZAHA 3OA3A 3L5MA 1FVPA 3M5YA 2VC9A 5AC4A 3O7UA 1HL8A 3NZQA 3VZXA 4FX8A 2O9TA 3OIHA 2XIIA 3G0SA 4NL1A 4OOUA 2WSKA 3WDPP 2I9EA 4Z2KA 4LGXA 3GY1A 1B57A 2IQ0A 1J2WA 4OTKA 4M6QA 1Q3NA 2R1LA 5C0QA 3WUBA 1Q6DA 1NF7A 1KRCC 1ADDA 2ON3A 4HKPA 4PCTA 1TV7A 3FN9A 3QPYA 2Y7EA 3NQ8A 4M29A 4ZE5A 3WQGA 3L4ZA 3UWEA 4WJ8A 2E6FA 5IHSA 1IIHA 2VENA 3C4UA 1HX0A 3VKKA 4B9YA 3ZMRA 4FX6M 1NWRA 2VX4A 3AI0A 3B9DA 4UMAA 1VCGA 1Q6OA 3AALA 1FRBA 1R2TA 4E4PA 4ZO9A 3VUPA 4RNHA 1F4AA 1OX4B 4XTDA 4KRTA 4O0KA 4GO9A 3GUGA 4GVGA 3CASA 4PMRA 2E1WA 4V27A 4E8DA 2IS7A 1E5NA 5EFFA 2I5IA 3ABZA 1LT8A 5LGZA 5T26A 4R7JA 5BRPA 1RP8A 3AWNA 2XSXA 4JIRA 2UV8G 3HN3A 3DX5A 1S5MA 4LUYA 1VJIA 3PUEA 5T9CE 7REQB 5BXTA 3M0YA 5AECA 2DIJA 2HS6A 4Q8NA 3TYEA 1RHCA 3PPCA 4JAWA 3CL8A 3N18A 4YHEA 1XD1A 2OLHA 2NQZA 4PCSA 2ZZ3A 4A2SA 2WVTA 3PZ9A 3CTLA 1HKWA 3N6JA 1YLVA 2BVDA 4E3TA 1SZRA 1IXNA 3P93A 3MSRA 1BYDA 3KCJA 3RCYA 1KWKA 1GQKA 3MU7A 4J3UA 4DQWA 3SQLA 5HDRA 3KBJA 1BKSA 4MTVA 4ONVA 3FYYA 1KGUA 3R13A 3FKRA 1NTHA 3RNDA 4C7GA 1RBAA 4LVDA 3QLDA 1C3FA 1NH6A 7CGTA 4IP7A 2E5CA 5I06A 1E6NA 4GPNA 2QJMA 5CGTA 2I16A 3W1AA 2BTMA 4C60A 1I2PA 1Q7QA 3LZ3A 3ABOA 1VCVA 1CXHA 2JF7A 2V3GA 1MSSA 3NSXA 1EJRC 3R79A 2WHKA 5KSWA 4GGBA 1O95A 1W0MA 4UIOA 2X2GA 1EHNA 3RR1A 5G1MA 6REQB 3ITOA 4F0RA 4LB4A 1QOPA 3T4CA 2FDSA 1WOAA 1E0WA 4ZTYA 3TOYA 1KM4A 1M5WA 2HDJA 3NNTA 3NJ3A 1EA9C 1JDAA 1MXDA 1EGZA 4XVEA 3UG5A 1Z42A 3ARRA 3WEOA 1JR1A 3APYA 3KOFA 3UJRA 4W87A 4I7VA 4G56A 1QHZA 1NVMA 5D04C 5HNTA 2PD5A 3KS5A 4UR7A 1IZJA 3AXMA 3NEHA 2AL1A 3L4TA 4QFUA 4IP5A 5BZAA 2GSJA 3AMCA 4JCLA 3FVMA 1A49A 1JD9A 4J3SA 1H49A 1KFEA 4IMFA 4KCVA 4C6CA 3CU2A 4HMEA 3C2VA 3A23A 1OT2A 4OGZA 5AYBA 2Y5JA 4L4MA 4LB3A 5AYIA 3NDOA 1LM1A 4IG2A 4UQEA 5JU6A 2HNEA 4Q8WA 1JUKA 4HP5A 3G6MA 2GFTA 2Q8LA 3W4RA 5LNSA 2PE4A 4FNRA 2VFDA 3GHRA 4P7LA 3VZYA 4RZ6A 2QR6A 3RJXA 2YCEA 1CXKA 3ITXA 4I5XA 4ML4A 4M5PA 1H3GA 1B0IA 3PP7A 3O9NA 2BY2A 4J3WA 4D6HA 3OEXA 4LH8A 1JZ6A 5JIPA 3CJPA 1W3LA 4DI8A 3BGAA 3IK4A 3M5ZA 3BGGA 1I2QA 4LAZA 3TOPA 1MXGA 4AMAA 2FGBA 4QROA 1WOBA 4K1GA 1DKWA 3VM5A 3NL6A 4H8HA 4PL1A 1W3IA 3TNOA 1UZHA 3BQ5A 5FF4A 1MW2A 2CXGA 4LRTA 1Z41A 3QEZA 4D6FA 4X61A 4AF0B 5FAGA 3W1NA 2BV9A 1HKIA 4Q8QA 1WXZA 3LG3A 4CQAA 3PWAA 2DEPA 4LBRA 2NXIA 3A47A 3GUWA 1EDQA 5IBXA 3WLQA 1XS2A 1E9ZB 3RJYA 2F7FA 2NT0A 1R38A 4JYDA 3MDUA 3H54A 4O8RA 4A8LA 4J35A 4H9MA 1ZNNA 4B15A 1SW0A 5T9BG 1U30A 3IJ6A 4IJCA 4OOZA 2WJFA 3LM3A 2ZCGA 3QZ6A 2QCDB 5D03A 2EG8A 4NZ5A 1LRTA 2WMIA 3TTOA 4JICA 2OMAA 3GW3A 5AZ0A 1TPFA 2ZRUA 2JKEA 3N2XA 3NGJA 3WJWA 5JVLA 2INFA 1T41A 2WM1A 4B3KA 3F4DA 1A53A 4KWUA 1EJ7L 5M2FX 3SN1A 1UR0A 2B7PA 3LHYA 3THDA 3VNYA 1PYMA 2GQ8A 1QVBA 3B4UA 3E74A 3WEMA 4WXYA 4K7YA 3AJXA 2FH8A 2VR2A 1XXXA 2Z2AA 4FNQA 3BWWA 1UOKA 1J0YA 2GJNA 3ARYA 3VTRA 2D2OA 4LT9A 3CQKA 4PFMA 4QLJA 3CUJA 3JZEA 4DAIA 1KXHA 4O53A 2VNCA 3A3XA 4E6MA 3ANUA 4W7VA 3APGA 4ZE4A 5LA0A 1SSDA 4ZO8A 3LCHA 1FCVA 1AJZA 2DDXA 4ALDA 4FIRA 5XINA 1SQ7A 2Y5EA 3VGHA 1R30A 4DX3A 2J8FA 1EDGA 1OD8A 4UOJA 1UP3A 2VX5A 4MPQA 5LIYX 2D2HA 2GVYA 4DHGA 1NF0A 4NZ4A 3VKCA 3UXLA 3TIMA 1V6XA 3R0KA 1D3HA 1XUUA 5E0CA 1IEQA 4N7QA 5KZ6A 3AIRA 1CLXA 1JULA 1UOZA 3HOJA 3CS2A 4UQCA 4QJ5B 4UTMA 1W5OA 2QDEA 3S6OA 5I03A 1QUMA 3H2CA 4XUGA 5A8GA 5M03A 4AYGA 1S3TC 3ONBA 4HU8A 1E4LA 1R46A 3CIVA 4AZ5A 2VQTA 3GWQA 4GUJA 2X0HA 3WO8A 4S3AA 1V4YA 2OYMA 5BWFA 3TA9A 4LC8A 2ISDA 1THFD 1ALDA 1F6PA 2GOKA 1KRBC 5CPMA 4QE1A 3C3UA 4PMNA 4PMOA 5XIMA 2GVGA 1TQXA 3R2GA 1BWLA 3RLVA 1KD0A 1VFSA 1WKDA 4BCEA 2Q6ZA 5HWNA 2VWSA 4BKNA 1E0UA 3LNMA 4TX8A 3GU1A 4IPNB 1E1CB 1IE7C 1P0EA 2CKSA 3JZUA 2BP1A 2V5CA 3DI1A 5DT7A 1E6RA 2EPHA 4HPHA 1AMKA 3SADA 1WXJA 3IACA 3M4HA 3MDWA 1REQA 4C7FA 4E4UA 3U48A 3UR2A 1OGSA 4UQAA 4WF7A 3U2EA 3UR5A 3MWAA 2ABBA 4AZHA 1CEOA 4IHCA 1ZB5A 4CQCA 5I7GA 1CXLA 4DXXA 3H2FA 4GABA 4XBKA 3J7HA 3W2NA 4YWSA 1DJNA 1BVZA 2HVNA 3DGBA 3TXZA 4R85A 1FX6A 3W82A 4BQ4A 3NL2A 4CNUA 5GNXA 3TN4A 2GDUA 3GNNA 5CCZA 1JZ7A 5A6JA 1ITUA 3SCTA 1EQCA 2A7PA 3YPIA 3S6DA 5K9DA 6PTDA 1W3KA 4UTIA 2X1TA 5JXQA 2BS9A 2J47A 4YYFA 3LM7A 4H7CA 2DT2A 3WK1A 3GAYA 4LOCA 3N9SA 4JS3A 3VIKA 1EKOA 1AW1A 4F2BA 4WDUA 3W1XA 1NOFA 3WQOA 1C91A 3H7UA 3NQEA 4PZVA 4QQUA 1XYBA 4UTUA 4WSHA 3EDFA 3THUA 3PJWA 3EXRA 1BQCA 4Q7BA 4XKMA 4AXKA 4F3HA 3GO2A 2ONEA 2J13A 2BASA 3ARZA 1MXSA 1F05A 2YL6A 1W5PA 1W9BM 1XBYA 2WMHA 1Y0EA 3GNDA 1X96A 5DF0A 6ALDA 2GGHA 3CHCA 5GJNA 2POZA 4LUTB 2OLAA 2AKMA 2YW4A 3PZNA 2V68A 4CCEA 3OGRA 2BXZA 1HL2A 2R1MA 4J1OA 3WFZA 1TA3A 2CIPA 3H4GA 1VQTA 3OVRA 3RUBL 1E40A 1DQWA 2GGIA 3W7HA 3TUUA 1LUCB 4M6UA 1XRTA 4QIUA 5TQLA 4HCDA 4PTDA 3BLOA 4GO8A 4RKAA 2CHNA 2WPGA 3FKKA 3WK0A 3HGSA 1W3TA 1TSIA 2Q02A 1QFEA 5FACA 1V3MA 5D9OA 4AIOA 4GXMA 3BJTA 2VZSA 1VEMA 1XD0A 4EF9A 1QPQA 2O9PA 5BNKA 5A6TC 1H5VA 3BURA 4KIEA 5BOFA 2GJXA 3ARTA 5CC3A 4UR8A 4U2ZA 2QGYA 1NY1A 2Z1VA 4WX2A 2C16A 5CEWA 3ZWTA 2OELA 1H7OA 5G2IA 1BF6A 3SCVA 2XH7A 2ZA1A 3HF3A 5EBAA 4QCFA 1MRQA 4KKXA 2ODOA 5LYRA 5AZ1A 1K6AA 3ATZA 4WSJA 3ZIZA 1YTEA 5CGQA 1QHPA 5CPTA 4ZOEA 3WNNA 3IK2A 1XI3A 4PB3A 4AY1A 2L5HA 3UA3A 2E3ZA 1FHLA 1UJPA 3TZFA 4AEEA 2O4MA 3P14A 1UPPA 3WN6A 4MUZA 3R89A 1A5NC 2ABAA 1W1YA 2GOUA 1H7NA 3DHPA 5KTLA 1S1RA 1J6OA 1FCQA 4JTJA 5C9XA 1OVDA 3VC5A 2GZXA 3R10A 3CMFA 1UUMA 1E51A 4ICCX 3GTHA 1SUXA 5GNYA 3R12A 1PPIA 3EMQA 4O16A 5HANA 5TD4A 1A5SA 4IIHA 3CWHA 2X1IA 2PDLA 4LU0A 2G3FA 1GVIA 4UC5A 4AFYA 2JGYA 1Z8AA 3QTGA 4HPNA 2Z28A 2R94A 1R47A 1XP3A 3Q2DA 2J74A 3MCNA 1UKOA 4GH1A 4JXCA 2QCEA 2VD8A 3H2OA 3WLOA 4J5NA 2G96A 4NNAA 3VD4A 4AD0A 2DW7A 2ZZ5A 3UJ2A 2E9LA 4G5DA 5HWMA 2PMQA 3UG4A 5JUVA 1K9DA 4WOQA 3T0CA 2DORA 2ADAA 2G3NA 3RHGA 3G18A 3EPMA 1DORA 1BYAA 1C8XA 1X1NA 1WA3A 2XFFA 3G77A 4KEVA 4YVXA 3BMWA 3ITTA 4PUMA 1A80A 2O7QA 1WZMA 3GXPA 4CNTA 4MKSA 1VBHA 3RMEA 3HQPA 3VNIA 3V0TA 4HK6A 3C8FA 4E2DA 2UY2A 5HMEA 4ZFCA 1NFGA 2QPXA 4ILSA 4F0LA 4DELA 1QI4A 5ABGA 1OC7A 4WIWA 2EKCA 1Q7MA 4R9XA 1TRDA 2F6XA 3UXAA 1KM6A 3LGDA 1JZ8A 5DN1A 4DUWA 4F0SA 1F2JA 4TIMA 1EHAA 5HQEA 4E38A 1LCOA 5DANA 4CQ9A 2ZRVA 1CGVA 1ICQA 1BVWA 1TG7A 4AG0A 2QAFA 3UZJA 3LMYA 4ZO7A 1H7PA 1OC6A 5CH9A 1GOWA 4JHMA 1DTUA 1Q6CA 3VO0A 8RUCA 5FF0A 3BUVA 2CFFA 5AHFA 3K2GA 4YVPA 1PZ1A 2AAAA 4YXGA 3WMSA 3UJEA 3EWYA 3BE7A 4PMZA 4BI5A 4F2TA 2Z0IA 6XIMA 4EF8A 2V3DA 1L2QA 1ZY9A 1IEXA 1VLIA 4UTWA 4HN4A 2EQDA 4DZAA 2HVOA 1O7AA 3EWWA 1K9TA 2VOMA 4PGLA 5HJLA 1Q85A 2W62A 4LF1A 4HOZA 5LHFA 2HRWA 5IDIA 2P0OA 1RCQA 3EEZA 1SFJA 1YDOA 3AOFA 4EANA 1RD6A 3E2RA 2X1SA 1FDJA 3BOLA 2EBNA 2BVWA 3N19B 3NA8A 5E6YA 3S2NA 3KVMA 4L56A 2XIJA 1CGYA 5AB3A 4Q8UA 1LBLA 4UTTC 1SJCA 4OFCA 2FFIA 1J0KA 1JF6A 1PHQA 1E6QM 4GYFA 3B8IA 4AZBA 3EDJA 4GLEA 1J8VA 4HZ7A 5DT5A 3RX2A 3S46A 2PDUA 9CGTA 4C90A 1UH4A 3UPMA 4G7EB 3WLKX 3QBUA 3TQ0A 3KP1A 1W6TA 4BS0A 4GX9A 5FAJA 4B2DD 1PCKA 1SO3A 2QJIA 4E8GA 5D9MA 4IL2A 2CETA 2AQWA 4OKDA 2H6RA 1SW7A 4X9YA 1P4CA 2YYUA 2PLMA 3NZ1A 4XISA 5C2CA 4JTIA 4R33A 2VHLA 1GYMA 2WZHA 3QQ0A 4GIRA 4AUBA 5TBOA 4CKQA 1YNPA 3MKVA 1V77A 1BXCA 4MYXA 4DLFA 4IUOA 5CZSA 1PKMA 3ZOAA 1VS1A 4AWSA 1IXPA 1SMDA 2YDSA 1UBPC 3AC0A 4DRSA 3GDKA 4A05A 1CTNA 1DEDA 3R6IA 3R0UA 4MYAA 3LN3A 4LXFA 5LXEA 3LERA 4QAWA 4QHRA 4S3JA 5LNUA 4Q32A 2RDUA 2VGGA 4A3UA 3QM3A 4GD0A 4PRTA 3VM7A 5HJXA 2Y62A 2X7VA 3EWXA 1BSLA 4QEHA 2VC6A 4GI4A 4RDVA 3F2DA 3A9BA 2D0FA 1OX5A 4U3AA 2CZ5A 1OINA 2PPGA 3UG3A 4O10A 3HFTA 4W5UA 1LQAA 4W86A 4XAFA 1S38A 1Z44A 3G0XA 1B3XA 5D02A 3NQDA 2CC0A 3WFAA 3BMVA 2UY5A 4ACZA 2F2KA 1EZWA 3EOEA 3F4NA 3N6QA 3TONA 1B3YA 3CAKA 1PKNA 1YPXA 2PP1A 1ELSA 1V93A 2ICSA 1Y5VA 2QV5A 1UZ4A 1SJAA 2FFCA 1N8WA 4WJEA 1YPFA 2PRHA 2ZA2A 1RD5A 3P74A 1BG4A 1E1FA 4HU3A 1IGWA 2PTYA 3AZTA 4I9AA 1OGGA 3NSNA 4IGMA 1WQ5A 1ZRQA 3PF3A 5EFDA 2Y61A 3QMTA 2BX7A 2CHOA 1XJBA 4DNHA 3KOZA 3AHZA 1AZ1A 1YRRA 3M64A 1QTWA 2X0SA 1XIDA 2DSKA 3TC7A 3QMSA 4KFPA 4CU6A 1E70M 2FJUB 2KAUC 2W27A 4FIQA 5DMNA 1L0PA 3PY2A 3C2OA 2I5GA 1XBVA 3PB0A 3U7BA 3GVWA 3UXDA 5J5RA 5H8UA 1CWYA 2QMKA 1M1BA 1FWGC 4I5UA 3KUMA 2YA0A 3TC6A 3QKZA 4HJWA 3WLRA 4IFRA 1TVPA 4MWAE 5K3VA 3W7PA 4WCJA 1R6WA 5DCEA 6ENLA 4WY0A 2R1NA 3U2ZA 1SJDA 3L12A 1YXCA 1KGWA 4QITA 1PKYA 3ZM8A 4K68A 1RLCL 2BGNE 4JDYA 1XGEA 3B8DA 2NUWA 4XZBA 1EX1A 4HMDA 4QS6A 1TJ1A 3LOTA 4CCZA 3NCOA 4CEUC 1E6SM 3PSVA 3AU6A 1KV5A 3DCPA 4PL2A 3O6YX 2IPGA 4WLCA 1RK6A 3EDKA 2D3LA 1CX9A 3UGVA 2A7NA 1AJ0A 4M24A 3WH8A 3IJ9A 3BOXA 3UY8A 1W9XA 3FDGA 1AMYA 3W7QA 4NAEA 1HO1A 2WCGA 2PWUA 1EF2A 3ECQA 4LFYA 2R6OA 1TWWA 1YMYA 3T07A 4FOJA 1RUSA 3UD6A 1YHTA 4H1ZA 4O1BA 4P5UA 2X8RA 5BRQA 4MSSA 3NO1A 4C1LA 4TXEA 1JCYA 4P61A 2Y85A 5FEPA 4ATDA 4D2JA 3PTQA 1GVQA 3RCNA 1MWOA 3H2NA 2JFEX 2G41A 3U4FA 3G6LA 4CD6A 2E1DA 3C52A 3PJXA 2CLLA 1P6WA 1CGWA 1W8GA 2J7DA 2PWHA 2E77A 4IPJA 4DYKA 5AC6A 1TJ0A 4Y6GA 3CUIA 5GPRA 2ZIDA 1G9HA 3L4XA 4I9JA 2QDDA 2QUTA 2XU2A 1RJQA 2YCKX 1WUEA 2YW3A 3QGAC 1XLLA 3XINA 1TCMA 1IR1A 1I9CB 1XM3A 4OE7A 1JUBA 3G1AA 1UP2A 4NSBA 2ZE3A 4UNLA 2ZICA 4JQ3A 4MB3A 1M7JA 3QV7A 2QF8A 4B9ZA 2ESCA 4HU0A 5ECUA 5H91A 3CEUA 3MI6A 3FSTA 3OGSA 3VPLA 2E68A 3LHTA 3ARSA 1NWTA 5AHIA 1TV2A 1VFUA 5D32A 3GH5A 1QPNA 1TVLA 2A7RA 3REQA 4ZCWA 1VKFA 1MUMA 5I78A 3WH5A 4FNSA 1UR3M 1HG3A 1U5HA 4MG4A 1OABA 2OWXA 3V4BA 1KTNA 2IW0A 3SCPA 4ZR8A 3WF3A 4PTWA 2H90A 3APTA 4DJFA 2E5BA 1I2RA 3H12A 2YFNA 5DELA 1UASA 3CPRA 1C7SA 4Q4SA 4TQTA 5DY2A 3EXTA 4QM1A 3K8KA 1XIIA 3PS7A 4MWAA 4YTQA 1P0DA 1BKHA 3W6LA 3PG8A 2PDYA 3CV2A 3MI3A 4M7TA 5CPNA 4CQDA 4X0NA 2OLSA 1X6NA 5CKSA 4PUNA 1XG4A 3KBNA 4LVBA 4TMBA 4I3GA 2YXGA 5IOBA 2ZX6A 4LANA 4ZODA 1OFQA 1IXOA 1PSCA 4JTRA 1Y7VA 4H01A 3A9IA 5CZKA 1EJTC 1A5OC 5F4WA 3F4VA 1IV8A 5KINA 2FJKA 2OX1A 4PMUA 1RAKA 3DYMA 2V2CA 2NXGA 3B8WA 4XB3A 3ZT6A 6TIMA 1U5JA 4R7WA 1N7KA 1XG3A 2VVNA 4IH3A 2V3FA 3DFNA 1BD0A 4WK9A 3PR2A 3UZWA 4ZO6A 1AODA 1KBKA 4RUBA 4JCMA 4D71A 5CSRA 5D8ZA 3KX6A 2XYLA 4D72A 1PEZA 5LNVA 1V5XA 2WZIA 3DOPA 3GBDA 4TV6A 1ISYA 3A21A 4S3FA 4AIEA 3AMKA 2Y8VA 4CN4A 1RV8A 2ZXBA 1JZ5A 3LLFA 1GJPA 4Q6XA 3IGUA 3OLGA 3MA8A 1JXJA 3KE0A 3TEVA 1GHSA 4ATLA 1PWMA 4JFWA 3NQCA 3E6EA 1QNRA 3H70A 3PBGA 3TVAA 2ZDRA 1C8QA 5IFPA 2PDKA 4UXDA 3DFYA 2MANA 4JTSA 4PRRA 3UWYA 1RY0A 3L67A 4A8NA 2OZ3A 3PTMA 1B90A 3GG7A 1AH4A 2QCMA 2DSUA 3CQHA 3ZSTA 4AHPA 1Z3NA 3MJMA 4Y96A 5ABFB 3LY0A 3CQ0A 1M7PA 3EWBX 1AD1A 4HZ8A 3IJ8A 4GIAA 1OYCA 4KGLA 4P7QA 3UA4A 4HA4A 4LAUA 4AISA 2BHUA 1VIWA 2YPIA 3GXDA 2WAGA 5IRPA 2YL9A 1X6LA 2PDHA 4GWEA 2V63A 4H00A 3EA3A 2QNEA 1YYAA 1H09A 3GH4A 3WH9A 1K6WA 4WXZA 3HGOA 1XKJA 1E4IA 1GYNA 4C6FA 2DIEA 4DO6A 1P7TB 5F2IA 3INPA 2PWVA 1VJZA 4GUIA 1CGTA 1WV2A 4GX8A 2FB2A 2DVXA 2PDFA 2RGMA 3OBEA 1WNOA 2V82A 3Q94A 5GQBA 5D8WA 3UWVA 4LYRA 4AH7A 1MMFA 3QN3A 4HK7A 1J9YA 1D8CA 1DJGA 1ODUA 2XFWA 4Z1AA 4Y9MA 5C70A 3BG5A 3OJGA 3ZSSA 1CZ1A 2HQAA 1E9YB 4UFIA 2PLJA 4CN6A 4FR1A 1NELA 1F76A 4XZWA 3H26A 3W75A 4WUIA 1LWHA 3TROA 2F9RA 1LWJA 2E40A 2OGYA 4E2BA 2GGGA 1IF2A 4FXFA 5C9UA 3EMZA 3AS0A 1RPKA 2J7GA 2WJZA 3R8HA 3PZTA 8XIAA 3N2TA 3PB2A 3WH7A 4KMQA 1GOMA 1Q5MA 3TYUA 2BGQA 1IT0A 1LZOA 5HXMA 3QR0A 1OSEA 1WDWA 2NV1A 4YLWA 3OU8A 4E4FA 4KGJA 3N6HA 1DIKA 3H2AA 2V8ZA 3UJFA 3NAVA 1OM0A 3I6RA 1VRDA 1YQ2A 5XIAA 2WKLA 3NVTA 4MDOA 1MQRA 1LROA 2PU1A 2FZBA 2B4GA 4D9PA 4LS0A 3LI0A 5CPSA 5L9FA 3SN0A 4AZGA 2IMRA 2G5WA 1GPFA 4GQRA 2OPJA 4EXAA 1JZ4A 4OECA 4M6VA 1BXBA 3NEVA 1T8XA 3TN5A 3BAXA 1VYPX 2EGZA 4FEZA 3A13A 3EX1A 3DEQA 4TTUA 3CHFA 4NAFA 3C0QA 4E3VA 1XPGA 5BWAA 1W1A1 5AHLA 3HQ1A 2VEIA 4B5TA 2HCVA 3C2RA 1Z48A 1S46A 3K13A 4MM1A 1E9LA 3P82A 4FNUA 2ACRA 3VKAA 1K03A 5GVJA 1L8NA 4S23A 5A6AA 3RIKA 1XQKA 3I4EA 2KX9A 1RR2A 5A6SA 1W1TA 1IT7A 3DBNA 4XO7A 2OWCA 1G4EA 4J28A 4IXXA 3UNTA 1FP8A 3NTYA 4ZB0A 1NIUA 1DWIM 1DYSA 2E09A 4QDPA 1MQPA 3VD7A 2DQWA 2OZ0A 4JYEA 4L5ZA 3L68A 3KOWA 3MV11 1J01A 1HVXA 4H8NA 4WDXA 3VNJA 3E3HA 3L0NA 3DENA 2XIBA 1BXNA 3EBVA 3KOXA 4A3RA 2C14A 4GUGA 1UD4A 1Q4NX 3PTKA 2YZRA 3G22A 3PN8A 1GZJA 3GG8A 3W6YA 2R1KA 1TJRA 4AC7C 4O13A 3EOOA 1VIZA 1AK5A 4JIPA 2CLMA 4F48A 5KETA 2YDRA 3STPA 3T05A 4LCRA 1R7OA 2ZRZA 1F6KA 1S5WA 1V7AA 3KRZA 2GJLA 2Y88A 1OBAA 4W8LA 2CLKA 1KGXA 2BBFA 1TMQA 3GNPA 4X2PA 3GZ3A 1PDYA 4KQNA 1L6SA 3S5ZA 3ZVHB 1XLGA 4L65A 2A6NA 4FR6A 1EBHA 4LEQA 3A3WA 3AXHA 3TKFA 2OEJA 5HQLA 1C7TA 2FZNA 4D6CA 3V0SA 3LTYA 5FKYA 1FWEC 2XGIA 3S1VA 4L9ZA 2PTDA 2VI0A 3LHUA 3CUHA 4Q8PA 3KRUA 2PTXA 4HA1A 3EOSA 1XINA 1W3JA 1Q8AA 1CENA 4FNTA 2QHAA 2A3CA 4LUIA 4R7OA 3S47A 2E8ZA 3LCFA 4JHZA 3GVQA 1ZAIA 5J04A 2XUCA 4HYRA 4NI3A 1TFVA 1Y65A 5A6BD 4JL1A 3PZIA 4L6OA 2QCHA 4JQ2A 5A1AA 2QJJA 1QWGA 4PC8A 3U2OA 3SCOA 4GH3A 3A4XA 1OHLA 4Z08A 3W81A 3WF1A 2V6AA 3TR9A 3BARA 4S1FA 4XZ9A 5D37A 2DVUA 3B9EA 4K8EA 4CU8A 2YKKA 1WXYA 4C6QA 3ARUA 5AYZA 4GNVA 2XSAA 1XLIA 1ZU8A 1ONEA 3W2KA 4GVFA 2VZVA 4OIFA 1Q6RA 3BVJA 1W3HA 1W2PA 4I8YA 1S5VA 3HV9A 3BSGA 3WCZA 5HMFA 4NZFA 1TB3A 1H11A 2AMXA 4XAZA 1WKEA 4LALA 2CERA 4XZHA 2W92A 2HXTA 5CZJA 2A2IA 5FA5A 2GK1B 4MUPA 3C0SA 3CV6A 3VNZA 3MMDA 3T9PA 3I7QA 1KFLA 3W00A 3IUDA 1P1XA 4RL3A 5KZEA 2BFGA 4IQDA 4IPIA 2G3IA 3N12A 5G4HC 3BCFA 4HMCA 3EYPA 4NX5A 2YL5A 3VNLA 1UMYA 3S2LA 1Z9AA 3SRKA 3AS2A 3HA1A 5ABEA 2GQ3A 4ECLA 1KBLA 2YDQA 2I56A 1CXFA 3WQDA 1HJSA 3WLTA 1OIMA 2WMGA 2DT3A 1ADSA 1O1ZA 3W2UA 5IHRA 1E4MM 3VGBA 4H9TA 3IJQA 2WVVB 5J5DA 1Z69A 1AVAA 3U5UA 3N4FA 3W0KA 4XAPA 2VDHA 3P0XA 2DT0A 3LCIA 3M0MA 4DZIA 3C61A 3SIMA 3M47A 4A3HA 2ZTJA 2QAPA 1G0CA 2XJ7A 4XD5A 1C93A 1KFKA 1QT1A 1RA5A 4QG9A 3KFTA 3CUFA 4RDZA 4LUSA 4XSLA 4IGNA 3V0UA 1CB2A 5CPLA 4DF2A 5G2WA 2IPFA 1B1YA 2C7FA 4HJFA 1VJSA 3LV5A 3HG3A 2ZWZA 1GK8A 3NQGA 5BW6A 4K8GA 1QW7A 4O57A 4HHLA 1EIBA 4AEOA 3ZQ9A 5I24A 3N2MA 1UWRA 3N1AA 3LD5A 2FPVA 3K46A 1G7UA 3N17A 4IWWA 4FF7A 4YJ5A 4J27A 5E9XA 1KO0A 5TAOA 3NQVA 3HO8A 3B40A 2V38A 1DXEA 2ZRXA 2P88A 1QNSA 3SRDA 4X63A 5U7SA 2CBUA 4H9XA 2OYKA 1VFOA 5D2VA 1YNQA 2B0MA 1VFFA 5JH2A 4MLJA 1SJBA 4GVIA 3FGCB 4NJIA 3VDAA 1QRQA 3G1FA 3R58A 4U2YA 4ZEPA 1SVDA 4NIRA 2PA6A 2O56A 3AROA 4ZQPA 3SR7A 4J4KA 3QZAA 1R3TA 3H23A 1OK6A 3LA4A 1W56A 3DU0A 4BY3A 4JKMA 5TNVA 4CD8A 3VGEA 4EPBC 1K02A 4QTGA 4D6DA 3UJSA 1XC4A 4NU7A 2QULA 1IR2A 4HNCA 1G7VA 2VWTA 3OVQA 4Q6JA 5CLTA 5C7VA 1FA2A 1Z7AA 2RJHA 3WBXA 3AQUA 2YJQA 4WGHA 4Q8TA 2ZUMA 4RPQA 3OQEA 3LLXA 5GNZA 2ZZ2A 3GDLA 3N2BA 1XCFA 4QGCA 1XPYA 4MHBA 3CHVA 4OHQA 5D09A 1BYCA 3TW6A 3OZOA 4KCWA 2Y24A 1AZ2A 3E0FA 2C71A 2NQ9A 6XIAA 4DO5A 4LBSA 1JNDA 4FMVA 3T0DA 2YL8A 4FK9A 4B92A 1JAKA 1VPQA 2WVUA 1XIEA 4QJ4B 2DUAA 5TIMA 1GG1A 3O6DA 4UOZA 2VDGA 5LA2A 4B3LA 3THAA 3CZJA 1OGBA 1WPCA 2WCSA 1BFNA 3IJ7A 2FB3A 4MAZA 4ZB2A 1LLWA 4AIBA 1S2WA 3GVGA 1DWHM 1TMHA 5BRBA 5FCZA 3WQ4A 1W9VA 3D47A 3W73A 3LBMA 1JYVA 4ADUA 1JVNA 3AFBA 1O68A 1L8PA 3S5NA 2VP8A 1QK2A 1R8LA 5LIKX 4EACA 5F4XA 4RPPA 2GDQA 2WZEA 1IWAA 1DJHA 2QVHA 3NM3A 2JIEA 3JR2A 3EWCA 3N14A 1NARA 2AAMA 3GM8A 4DNMA 3FCPA 1W1PA 1KCXA 4LS2A 1XGZA 1R9XA 1UA7A 1VFTA 4IGSA 1BSIA 5H2ZA 1PDZA 3W38A 3TP4A 1YBQA 1WZKA 2XHYA 1GEQA 3WMLA 3VIIA 3GW0A 6CGTA 1RBOB 2E8YA 4U31A 4I6KA 5C71A 1CW2A 1J0ZA 1XSJA 4J7RA 3P81A 4FOUA 3ANYA 1V0MA 4ZSTA 1PL9A 3AWOA 3DI0A 1KWGA 2Z1SA 2XTKA 4E2VA 2FVKA 1ODZA 3ME3A 2WXDM 4GYPA 4QNWA 3W87A 4KERA 5AVHA 3ZWSA 2QVNA 4X60A 4OUIA 2QYGA 4C6LA 3MP3A 5AHMA 1PV8A 3CAVA 4PUJA 1FWWA 3IJIA 1XLKA 3RO6A 3GTXA 4TMCA 3ORWA 4GNKB 2VZOA 2JK2A 4K37A 4MJ4A 2VO5A 1GKQA 3AIQA 1ZGDA 1KA9F 4C6OA 3EDEA 3H24A 4RDYA 4YTTA 2FH6A 3UT0A 1HQTA 1HKVA 1YX1A 4FO4A 1I75A 1B3OA 4H2CA 4U5KA 1L9WA 3VUSA 4HPGA 1K8YA 1TX2A 5H6HA 3LMZA 1CLVA 2H9AB 3E0VA 1F07A 5CLWA 3N4AA 1M03A 3AIB