3W00A

Crystal structure of pcrb complexed with g1p and fspp from bacillus subtilis subap. subtilis str. 168
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
226
structure length
226
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
total genus 76
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3w00A00
3VKAA 3W01A 3W02A 3VKBA 4NAFB 3VKDA 3VZYA 4MM1A 3VZZA 2F6UA 3VKCA 2F6XA 3VZXA 4JEJA 1VIZA 4NAEB 3VK5A 3W00A 4NAFA 4NAEA
chains in the Genus database with same CATH superfamily
1DE6A 1W3JA 4XIAA 3P2VA 3VDCA 5FJUA 3NVTA 4JR5A 3P8JA 3VOCA 2VX7A 1HKKA 3HBLA 3E3HA 5GJPA 1J4EA 4HMCA 3ABOA 3CJPA 2FZNA 2NQ5A 3RITA 4A3HA 4I5RA 4PMYA 2GDVA 4CVWA 4QJ4B 1KBJA 1CNVA 2XPKA 4E2VA 3N29A 1KFJA 1KLZA 2QMKA 4Y2WA 4LX4A 3P80A 1H7RA 4XX6A 2BXVA 4G56A 1U1JA 4KEMA 4DZIA 2W67A 2O9PA 4IFOA 2QJMA 3OP2A 3GWQA 1QMLA 5HDRA 3KCLA 3H2EA 5I3JA 3QYQA 1E3XA 2EAWA 3QFEA 5DBUA 1EQPA 1AVAA 2YIHA 4ADSA 4YN5A 3W37A 1CYGA 4GD0A 3NPVA 4AEOA 4S3JA 4HPJA 2W92A 2PGEA 4IQJA 1FBAA 2W61A 4GCXA 5LHFA 2WC3A 4JTGA 1PX8A 2XGZA 1UQZA 3WLIA 4AWEA 2BNJA 4JCMA 4IFKB 5CGTA 1JEZA 4U31A 3JS3A 2RH9A 3E0WA 4BWLA 2H8XA 1JCXA 1ZAJA 5K4ZA 1Y5XA 1RQBA 3ZZ1A 3OGVA 4QXIA 4IMAA 5DF0A 2VURA 2F38A 1SO6A 1YNQA 2GZXA 1TQXA 3JVAA 4Q8WA 4O0ZA 1VBUA 2AKZA 3ORWA 4ZQNA 3N25A 5CJMA 4PH6A 1EBHA 2XINA 1EGZA 3NQBA 1EWDA 2WWCA 3NJ3A 4N6FA 2VUNA 1OINA 3UXIA 5A8PA 3MJMA 4AEFA 1VCGA 1J5SA 5HNRA 3UD6A 2NT0A 3MUY1 4Y7EA 3B8SA 4QG9A 3W7QA 4MUZA 3MUZ1 1W5QA 4KPLA 4MKVA 2ZRZA 4P7RA 4XUGA 5MF5A 1WBHA 1M6JA 4DXVA 1XCFA 2Z6JA 3VK5A 5DT5A 3NCOA 3VD9A 1NF7A 2KAUC 1MFVA 4XSLA 2W5FA 4CU8A 5H8PA 3TSMA 1XPYA 1GQIA 3L23A 3IJ8A 4F0MA 2NSXA 2OYLA 3SN4A 4IOTA 4FNTA 1ICPA 1SVDA 3FNDA 1CGTA 1TPWA 1GJWA 3GBDA 3DIPA 1VYPX 4ACZA 1VLWA 5F2LA 1JFXA 5GQBA 4X9YA 1SFTA 4JYFA 1CTNA 2HBVA 1NJJA 3T2QA 1XLAA 1ZQ5A 3D3FA 1RK6A 1XFBA 1LOSA 3CUZA 4LRTA 5REQA 5G2WA 3BAKA 4MJ4A 1W8SA 5BRPA 1SW7A 4YCPA 1DJGA 4NILA 1L8PA 2Y89A 3DU0A 1KO0A 3N13A 3PC0A 3H4WA 4WUIA 1Q6CA 4C6FA 1JDDA 1X1NA 2R9RA 3VZXA 3VNMA 1UIPA 4UB9A 3VD4A 1THFD 1G5AA 1UWSA 4FF5A 4AX6A 5FF7A 3GYEA 4HNVA 4NNCA 2OVLA 2REQA 2AKMA 1J6OA 1O12A 1Z8AA 3UU0A 1CENA 1Y0EA 1IXQA 1XICA 5FAJA 4F2BA 3LB0A 1FX6A 1GVSA 3NZQA 1TV2A 1ZPTA 2VT0A 3TYCA 1TV7A 2E28A 4HCHA 2ZYFA 3RX2A 3W23A 2PRMA 5D8ZA 2VDGA 5M17A 2OWXA 1SUXA 2GGJA 3T42A 4LBUA 4IUOA 1TV3A 4AX7A 4IHCA 2VEPA 4JIPA 3VE7A 2TYSA 1GKQA 2GDUA 2W4XA 1TJ2A 1CIUA 3R4IA 3O6DA 3EA3A 4ERIA 1TQJA 4JQ1A 4IF2A 3ZJ8A 1EGMA 4V1XA 3TE9A 5A6TC 2ZA3A 3ZSSA 1ESWA 3IJ9A 4JHOA 4NXSA 4AWSA 1NIUA 1VHCA 4FALA 1Q6QA 4H8NA 3C2OA 5BWAA 1V08A 2E6DA 2R24A 4GZEA 3MKKA 1UWIA 2Z28A 1X6LA 4ICCX 4FSAA 5I79A 5TIMA 4CCDA 3CYVA 4M5PA 5DMMA 4YTTA 3WUGA 7ODCA 4JS3A 4J3TA 5LNWA 3U2CA 2R1KA 4IZGA 3STFA 1EIXA 1ZS2A 3FA4A 3SADA 4JFSA 3CK5A 5HMFA 1D3CA 3R6IA 2X2GA 3W2MA 2RFGA 5A69A 3AO0A 2DEPA 1PL9A 2P1FA 4MNKA 3PWIA 2FVLA 2VR2A 1AODA 4ENLA 1FXPA 3ZM8A 4IGMA 4N7QA 1HL8A 5JVLA 4EXBA 5CC6A 3PR2A 3TLQA 4OUIA 3A21A 4P5UA 2ZZ5A 4CVUA 1CCWB 1U30A 1P0KA 3BAJA 3TTQA 2QCHA 4V2XA 3W74A 2ZUWA 3K4DA 4AZ5A 3O6YX 4RDYA 3U5UA 3AXHA 1R0MA 3TWBA 2A3LA 1PIFA 2G4JA 3VAVA 1H3GA 3CM4A 2O4QA 1OYBA 1R30A 3LHVA 1J12A 4GY7A 1HIZA 5HJXA 4BY3A 5EMYA 5C2CA 1R3SA 3P84A 3OIXA 3MVIA 2C19A 4UTTC 1OF6A 2ISFA 2RDXA 2DGAA 3W84A 2QS8A 3QC3A 3KBMA 4R3UA 1OX4A 4GQQA 2VR4A 1V8EA 4H1ZA 4P8WA 1W31A 4GBUA 4Z2HA 1KR1A 3AIQA 3AS3A 5RUBA 3UNTA 3MI3A 3WO8A 3R25A 4UZSA 1POJA 4L56A 2CZDA 3QZAA 3H2FA 1U22A 1JAEA 2JE8A 4JFUA 1E43A 3MMWA 5FSDC 3IS4A 3OEXA 1CGXA 1OF8A 5EKYA 2QUNA 1EGVA 4PUJA 2Y5SA 3B8UA 2A3HA 3WUEA 1PWMA 3A23A 1MVYA 3H7UA 4DF1A 5HWJA 2P0OA 4HNLA 5EMUA 2YOCA 2PDMA 4LQ1A 4O12A 1GEHA 4HCDA 5HR6A 3BOXA 3CL8A 2J7HA 4RKAA 4A8LA 4E38A 5B7YA 1F4AA 3P67A 3OGSA 2Y24A 5EY5A 5HWNA 3W01A 1QPOA 4OE7A 1YYAA 5D02A 3VO0A 1HN1A 4S1FA 3IIVA 4IQDA 1PX3A 1QWGA 1PPIA 4TIMA 1LWIA 4BHYA 3EGJA 4MLJA 1VJIA 1GCYA 3FVDA 1KGXA 3WUBA 1JQXA 1KWKA 4C6OA 3S3GA 3VNJA 3W7DA 1UD8A 1ICSA 4UQCA 3IJ6A 5DXYA 4KFOA 1ME8A 4Z0JA 5BNKA 1G94A 1TWSA 3BANA 4Q3MA 4MMWA 3DZ1A 4CUCA 3CQ0A 3EX4A 4W5UA 1H7PA 4DBDA 2A6LA 4AVFA 1G4TA 2FHFA 4OOZA 1XL9A 2H90A 4QP0A 3GG8A 3PFMA 1GOQA 4LAOA 5C7VA 1VFHA 3DENA 3LTYA 3BOLA 1PKNA 4HZMA 4H6RA 1BG9A 1Q2SA 1WUFA 1AQMA 2JGQA 1XYAA 3CV2A 3TQPA 4DLFA 5I7GA 1E0UA 3PZOA 1W3IA 2CU0A 1GONA 2RDTA 2W9MA 5CZTA 1FWSA 3BGGA 1T7LA 3PZUA 3E1F1 3VDHA 4BF9A 3OZYA 3OLGA 4BF5A 5E09A 1H5YA 3AIRA 4UMBA 1UA3A 3UR7A 1S3HA 3P81A 3WL0A 3CUFA 2WXDM 2NWSA 2OO6A 4OGZA 1PE1A 4RNJA 1ENUA 3GVRA 1MXDA 3FYOA 3K8KA 2DORA 3B0YA 1AQFA 3K8LA 3OA3A 1QTWA 3USBA 1FWNA 1TKKA 3C61A 1TMLA 4QAWA 4M82A 4O17A 3WUFA 3BL3A 4IPNB 1AMKA 1M03A 3BGJA 2NLYA 3TK7A 4A3RA 1FWCC 3G3MA 4PUDA 4JTQA 2DP3A 2WHMA 3BGAA 3CTTA 4HTYA 3HGJA 4PTXA 1FWHC 5A6MA 3AIBA 4Q7IA 1FH8A 3ITXA 4TTUA 3SQSA 3WNNA 2JF6A 1RBOB 4NJIA 1GOOA 3I6EA 3FFSA 1D3GA 1W17A 1R2TA 3T6CA 3ZJ7A 3OBKA 3NL6A 4M80A 1XUUA 4C6EA 1QK2A 1E0WA 4FXSA 4Q33A 4LV9A 1CXHA 1OFDA 3A4AA 2XFFA 1DTNA 1GHRA 2EKGA 2VD8A 4L4OA 4UQDA 4IP5A 2ZE0A 1H2JA 2QDGA 3QY7A 3W6LA 3KP1A 1UZ1A 4H6QA 2IKJA 3LXCA 4O14A 3WLOA 3PF3A 5A6BA 3MI6A 1QRQA 4CEUC 1VB9A 1EJSC 3PAOA 1AUSL 3GDMA 1JDCA 2BXYA 4ILSA 1BWVA 5ABTA 4IGNA 3A4XA 1NOFA 5IOBA 1R38A 2Y8KA 4FI4A 3PPFA 2XM1A 6REQB 2X7WA 3U6WA 1WZLA 2D22A 1MZHA 2OZ0A 4S38A 1XLKA 3STEA 1P48A 4A2RA 4LV4A 1HKIA 3T7VA 1GVYA 3GLCA 1VGAA 5ABHA 2XH0A 3PZMA 3VZYA 3E6EA 3ARYA 1WAUA 2ODOA 5CH9A 4BR1A 1RPXA 2WKJA 3PJTA 1MO0A 2G4FA 2RUSA 1OM0A 4WDUA 4JD4A 1RPKA 3PG8A 5GJNA 1D3HA 2F6XA 2W6RA 2PB1A 4TVDA 4YIWA 3MV11 4QITA 1V03A 4O16A 4I7UA 4WVXA 3NPUA 3ZVHB 4IIHA 3W1XA 2NLIA 1IT8A 1MEWA 2DQWA 4I5UA 3GM8A 4K3ZA 4RV3A 2PDIA 4GGHA 2CZEA 1Z7AA 4QQ3A 3W1UA 3EKGA 3MTWA 1EDGA 1EYEA 1WKDA 1X6UA 4L64A 4M29A 4O53A 1W5MA 1ZP4A 2QCGA 3CZJA 1UZDA 2BGQA 3DXIA 1ZRQA 2J7FA 2PUZA 2OWWA 3U5YA 3SCWA 4GQRA 4XV0A 4S3DA 3RU6A 1C7SA 3TAOA 5MHBA 2V38A 4YU1A 1TTQA 4MJMA 2BGNE 3WD4A 3PNZA 4C7DA 4CKQA 4U3CA 1JYNA 3MHGA 5FJRA 3FLUA 2V5CA 1V6VA 5C9WA 3A9BA 4P8XA 1O6IA 1EF2A 2WVTA 3FN9A 4LOCA 3P74A 2PURA 3PBUA 1RJPA 4FXJA 5A6SA 5AHFA 5MKGB 2VRKA 1YNPA 3PFRA 3B8DA 4I9TA 1K03A 2DVXA 2O56A 2VX6A 1CEOA 1H1ZA 1ZLPA 4PMOA 6REQA 5IRPA 3T08A 1OGBA 4LY4A 4PMNA 3ZYZA 3LXAA 3MP3A 3DX5A 3VMNA 5E5CA 4QIUA 2XWEA 1RSCA 3NQ7A 2D0GA 2FHBA 2R82A 2VI0A 1DJYA 4LUTB 4UMAA 5KSWA 1B4EA 1N7KA 1LG2A 2GGGA 3PUDA 4AY7A 4O1BA 5A8MA 2J4GA 2YLLA 4NAFA 4PCNA 1AMYA 3UWEA 4TVUA 2I14A 2A7RA 3EB2A 2A85A 3UR5A 1ONRA 4WX2A 3P7YA 3KOYA 4XK2A 3CLMA 4ZQPA 4LH8A 3MMTA 3KOXA 2J9ZA 4NL1A 4C6BA 2IPJA 4EE9A 1EBGA 3KHDA 3Q45A 4GGBA 3WD3A 1XYZA 1K02A 4O19A 3AMGA 3MV01 2PMQA 4ZOEA 3NFUA 5A8GA 1E6SM 3T9PA 3HJZA 4Q8OA 4DPPA 1YDVA 1W2PA 1HJWA 3LZ5A 5EA9A 4TX9A 3E0VA 2CLPA 1IZJA 4NAEB 4CD8A 5F2GA 3EOEA 1DXIA 3HA1A 1W56A 3F5JA 1N8WA 1HL2A 2OEKA 1LRNA 5LNRA 2YBVA 3AIWA 5C9UA 3PZTA 1EIBA 1XQKA 3MQTA 4OQVA 2PZ0A 5BOFA 3EZ4A 3QQWA 3GNNA 1M68A 3KHJA 2D3LA 1N8IA 1XUZA 5FEWA 2BVTA 1MI3A 1C7TA 3TWAA 1CGUA 1UC4A 3QZEA 5KINA 4HU3A 3R10A 3MO7A 2QXWA 1JCJA 1KM2A 1LDCA 2ATSA 3PZIA 3BLDA 2J78A 5G2IA 1JL8A 2XSAA 5F4SA 3SUTA 3ISIX 3PM6A 5DT7A 1EJVC 4JDYA 1WDDA 3RMJA 3L5LA 1XIBA 3EWUA 3M41A 1QCWA 2FB2A 1NWTA 1FWWA 2A4AA 2A79A 1W91A 4PEKA 1QO5A 1KGWA 4WZHA 2J74A 3SGGA 3QYSA 1W1YA 3SN0A 4X2PA 1PTAA 1MUWA 3WQPA 3J7HA 1OFQA 1BYCA 1EOKA 5HJYA 3QBUA 3BLPX 3GVWA 1DPMA 2F9RA 3NDZA 2XFRA 5C55A 2TSYA 3QJAA 3ABXA 4I9MA 4PA8A 2QCNA 3R2GA 5CSRA 1MSSA 2ZC8A 1W9UA 3SCVA 1WXJA 1FDYA 4NZ4A 1AJZA 2YL5A 1TIMA 1MMFA 1ONEA 1B3WA 4RE0A 3PBWA 2E6FA 2NXIA 2I16A 4IXXA 2QZRA 2WANA 2OLAA 3KX6A 3TC6A 2AAAA 4A35A 2C15A 3G6LA 3P0WA 4MPKA 1EOMA 1RY0A 4O1EA 1KFCA 3ABSA 3UNDA 4L9YA 3SB0A 3MDUA 5I07A 1NARA 4AWTA 4JIQA 5EPDA 2V0TA 1YEYA 1BYBA 4WXYA 3PSVA 5I3IA 2EO7A 4L1XA 3UR2A 5DBTA 1B9BA 3HPAA 3NUKA 3WJZA 2CCRA 2FPTA 6ENLA 2IPFA 4PYSA 1EP1A 3KVKA 3GHSA 4NJHA 4F9DA 1SFSA 3NEVA 4WIWA 3H2AA 3Q4DA 4M24A 5LIXX 4HHHA 4L4PA 3W7LA 1XH0A 4LFYA 3FXGA 4B2DD 4YTRA 4Z1BA 4QGCA 2V3GA 2Y61A 1XGZA 3LHTA 4YXGA 2VNCA 4YVXA 1YNYA 2JFEX 1QPNA 3QGVA 3WDQA 1QFEA 5ECVA 1CPUA 1KFWA 2CLKA 4ZE5A 1WV2A 4KEVA 1E70M 6XIMA 1OGSA 1W3NA 4S2CA 4QCFA 3FHQA 3IIOA 2QDHA 1H51A 2Y63A 1GQJA 4DX3A 3UJRA 2WNWA 2CHOA 1JRCA 1NFPA 3DC0A 2WVUA 4NAEA 2ACSA 4HCLA 4GZIA 4JFVA 1IHIA 1WX0A 1E5NA 3LG3A 1O60A 2Q3OA 1RCXB 2QIIA 3BVJA 4NU7A 1PYFA 5AN7A 1KC7A 3BCFA 2IPWA 1PDYA 3KRBA 1KXHA 2I56A 2IKHA 3ABRA 4PMXA 3LCWA 1UC5A 3QY6A 3AXIA 2X41A 3PTMA 3CZKA 5DRIA 3W9ZA 3W6MA 3EWCA 1K8YA 1BHGA 1FDZA 4WLCA 2VEGA 3CZGA 1GW9A 3QV6A 4ACZB 1C93A 5JBEA 1QOQA 1F61A 3NQ8A 1OGGA 2CC0A 4JCLA 1VRDA 1FTXA 1RCOB 4ZBCA 2WC4A 5F1UA 4Q8UA 1QO2A 2W0UA 1N2VA 5BOEA 1Q5MA 1MNZA 3AMCA 1E4IA 3FEMA 4OJYA 1ZJAA 4O0QA 3W2JA 4HZ6A 1WAWA 3RK8A 3WFZA 2EG8A 3SIZA 4FNQA 3I4KA 2C16A 3RR1A 5XIMA 4YTUA 5IFPA 2YDSA 1LLWA 1OD0A 4LYRA 4PRRA 3VOFA 5CAHA 1POKA 1GGOA 3DFTA 1JUEA 4UTUA 4NJGA 4NT0A 4PMUA 3N14A 3UWZA 5EBAA 1US0A 2UY3A 5J04A 3CIWA 1ELSA 2G95A 3CL6A 4DO6A 2VGIA 2DZBA 2A6NA 1WZAA 3SAZA 1CI1A 1S2UA 1HG3A 3A6OA 1BPLB 1F3WA 2H6RA 2GYIA 4O4VA 2O9TA 1KV5A 3W7RA 2VKZG 1XLLA 4AH7A 1PZ3A 5CBIA 4JHMA 5BWFA 2BODX 2ZRVA 1GPFA 1YE6A 3DG6A 5DEZA 4C6JA 2PODA 3UP8A 1OCBA 4W4QA 2B7NA 4B92A 2G50A 3VOIA 2Y7FA 5G1MA 4I6VA 2BLEA 3BW3A 1UCWA 1KTBA 1RA0A 1MW3A 4W5ZA 3DFQA 1K9DA 2J27A 4LXFA 3CEPA 3W2UA 1DIKA 4L4LA 2A0NA 4RK8A 4HU8A 2ONEA 1KXVA 2XGBA 2A5HA 1KBIA 3G77A 2YYUA 4FS9A 4FB7A 1E71M 2VZVA 4K1WA 2UBPC 1UKSA 2QCEA 3HQPA 4IQLA 1UQYA 1HQTA 4YVPA 1V0KA 3T07A 4GC3A 4WEVX 2C0HA 1KBLA 2A3CA 2DUZA 3OVQA 3UZXA 2CEQA 1X7FA 1BLIA 1ISWA 3AZTA 1ZNNA 2WQPA 3W2NA 5BRBA 1RXOB 4H7CA 1CECA 4NVTA 2NVAA 2OLHA 1ZY9A 1XDJA 2VOMA 4B90A 4N9EA 1FUYA 2J75A 2VC9A 3W53A 3S1VA 1RVGA 2GGHA 5TNVA 4GUIA 3VKBA 4O13A 3L21A 2DIKA 4MTVA 3Q67A 2DZUA 1E6ZA 4IM4A 3OPSA 1PYMA 4W86A 1FKWA 1KWGA 4PMQA 4MF4A 5A2BA 1BVWA 3TH6A 2GUBA 1GWJA 1TPEA 4MY9A 1NWUA 3O15A 3DG3A 3VIKA 3SI9A 3UA3A 2X40A 1W3TA 2BTMA 3T1GA 1F76A 5G1TA 4PCPA 5F2MA 1NP2A 3KWXA 2OEMA 1DIEA 3T8QA 2PTYA 3GDTA 2E1WA 2Z7GA 2G37A 1KM5A 2DPEA 2JEPA 3WMLA 4URIA 3I3DA 4EX4A 1YBQB 3N4EA 3VNIA 1YTKA 3KM8A 1KM4A 5DXXA 1VC4A 2I5GA 4GACA 2BP1A 1M3UA 1VJSA 4WOQA 3NR0A 4GI9A 2HS6A 5D03A 4HHPA 4UXDA 4WKHA 1OCJA 4X0VA 3C0JA 1KW1A 2Y8UA 4O57A 3M6DA 2WMHA 3U3HA 1QW8A 2FFIA 3LLDA 3B03A 3EOLA 2XIQA 4IT1A 3VCNA 1YTDA 1EDTA 3WX7A 3SECA 2ZXAA 1TZZA 5HNNA 4C6MA 4PMRA 1H4PA 4UQ9A 4HNNA 4IMFA 5FESA 3L2LA 1TPH1 4XZ9A 2ZBTA 3A3WA 4IL2A 2QCLA 3I7RA 5IHRA 3L66A 1FWBC 3GH5A 3B0XA 5DX7A 3W0KA 3GU2A 3BPWA 4PSPA 3NZ1A 4DJFA 3W2LA 2VVSA 2HMCA 4YYCA 1TO3A 5FJOA 3U2ZA 1CXIA 4RZ5A 4ZFMA 1Y5WA 4KWSA 3KAOA 1VP5A 4ROQA 3SSZA 2NXHA 1TCMA 2YA2A 1I0DA 2YB4A 4MVAA 2Y85A 1JNDA 2XVGA 1BD0A 2VDIA 3T4WA 1A0CA 2CHNA 4HBKA 3QLDA 2C1IA 2J9XA 3QMRA 1CLXA 4E2DA 3DFNA 2Z0IA 1OC6A 6TAAA 1QNVA 5F2IA 4ZENA 1A4MA 3TW6A 1AJ2A 2DQXA 1BF2A 3CUIA 1PKMA 4L65A 2WKLA 3GB6A 3H7RA 5E0KA 1ALDA 4BZYA 1US2A 3CMFA 1V02E 3C4UA 4Z2GA 1RAKA 1UD4A 4F2TA 3LXBA 3G24A 2WBKA 3GDBA 3BE7A 5FF0A 4US6A 3VMPA 2QULA 3RX4A 4A8RA 1NVMA 2DW6A 1PB0A 1U33A 2Y5JA 2Z1WA 4YLWA 5CC5A 2NV9A 3W7HA 1ISYA 2V30A 1E1CB 4Q6JA 4D1IA 1K6WA 2YKKA 1ITQA 4WR3A 2ZC1A 1QWKA 3BUVA 3H22A 2ADAA 3MVTA 3PAJA 2C14A 2X0SA 2WNNA 1LL4A 1MQPA 4E5TA 2Z2UA 3TYBA 1Q6FA 4K1GA 4WSHA 4H2CA 1X97A 2O4MA 4I7VA 2BBFA 4M3PA 1K6AA 2AQVA 1AG1O 1VBRA 4UTTA 3TW9A 3OB8A 1EC8A 4UBPC 3CQIA 1UKPA 5CKSA 4DPQA 4MG4A 4AG0A 3IK4A 2UY2A 1C9DA 5FEPA 3L4UA 3AMDA 1MWOA 2Q6ZA 1UOZA 3IGXA 3OYZA 1ZSXA 4AD5A 4MJ2A 2CWNA 3F4VA 1JDFA 4X2RA 3TTYA 3S0CA 3W1TA 1YDYA 2V2CA 3HZ3A 1G1YA 3OJGA 1DORA 4C6PA 3E96A 2ZXDA 3TIMA 5AECA 4PRTA 9XIAA 2E5CA 1C3FA 3MKVA 3RPMA 1XSIA 3ARVA 3M0HA 1K8XA 1YIXA 4J3UA 1AH3A 3RN6A 3VINA 2OKTA 2PGWA 2YGYA 2AAMA 2XIOA 1XH2A 3R13A 1GKRA 2MANA 4J40A 3IJ7A 2VEIA 2DSKA 7PTDA 5A6JA 4C5ZA 2ZZ6A 1G4EA 5BU9A 2P0IA 2OGJA 3R7MA 1JQVA 4AUBA 3GD6A 2VEKA 4KCUA 1R3YA 4LB4A 3T0BA 1A5MC 3O07A 2WJDA 5EB8A 2NQ9A 4MPQA 4GHRA 3GTHA 1KD0A 5HJLA 3IWPA 3WJSA 3LPFA 3SUVA 2DZTA 4FNRA 2P5NA 4TQTA 3WLPA 1ITCA 3Q58A 3LPGA 4KCWA 3NQVA 1H11A 4HNOA 4HA3A 3UG5A 3GX9A 1W32A 2ZTKA 3B4UA 1M04A 4ACYA 4UR8A 4R85A 1UPPA 3G1DA 3GK0A 5BYWA 1MEHA 5CLWA 3W1PA 4E8DA 2CKSA 2IPGA 1C9WA 5EMJA 3W81A 3UERA 2DZWA 3FVMA 2ZUMA 3RPDA 2OEJA 2ZX8A 1TTPA 1DQWA 3AMKA 3C86A 1KBBA 4RZBA 1E4NA 3G1HA 3PVFA 4MFEA 1PDZA 4LNCA 1XH1A 4U2ZA 1JCNA 3SFWA 2QAFA 4MWAA 3W7CA 4LCRA 5FL1A 3VA8A 5CSYA 1HVXA 4B5NA 3FS2A 4ALDA 3EWBX 4PFMA 2ISVA 4CQCA 2ZX5A 1TWDA 1QI0A 4UUIA 4AHPA 3M5ZA 1VRXA 5BROA 3PZQA 3HPXA 4ZB2A 3T0TA 4H8UA 2PU0A 4E2OA 4XZHA 4TX8A 3CV7A 3NXFA 3WMCA 3WJWA 1OC7A 1VENA 2C8NA 1W0MA 1P6BA 4UWMA 1VQTA 3L67A 3CIVA 2PLKA 1QI3A 2C1GA 1NEYA 2INEA 4ERGA 3WY1A 1Q4WA 3GVGA 3STGA 3DOPA 4XWUA 3B40A 1R7OA 4JN8A 4JIRA 5DN1A 5LNUA 1JZ4A 3THUA 5DY3A 2Y0FA 5REQB 4P7OA 1E1FA 1YRRA 3G0UA 4JTCA 3LX9A 2PGRA 2WQDA 1YDNA 4GK8A 3E0IA 1GORA 4V27A 1SJCA 1MYRA 3QF0A 3R11A 4BQ4A 1UWAA 1J01A 4RXFA 4IJRA 1YDOA 3SDOA 4J2PA 5JU6A 1HF6A 1L6WA 1DHKA 1KCZA 5CG0A 2DZAA 1V3HA 4AYGA 4DAFA 3V7PA 5FL0A 1GOMA 5FF3A 5L9FA 4ML4A 4EPEC 3UCQA 2FTPA 3W7OA 3HQNA 3W7NA 5A2CA 3A22A 1AA1B 1KM0A 1YE4A 3GHRA 4ECLA 3G18A 4Z17A 1ZU8A 2NQHA 1QAPA 1QI2A 1X6NA 2WSKA 1ZAHA 2E8ZA 1TVNA 1EC9A 2CBIA 2R6OA 3C6CA 1J10A 1C29A 2Z2AA 3WF4A 3TYZA 1TV4A 1FFQA 3QXBA 1B0IA 3SCNA 1BKHA 4YS1A 3MKCA 1P1MA 2YYTA 3TFCA 4D2JA 1BYAA 4LVBA 1UUOA 4JY9A 1PIIA 4W85A 3S2JA 4LUIA 2OX1A 1ICQA 2PS2A 4ML9A 1W9XA 2OELA 4ONVA 4XB3A 5DMYA 4C6DA 1OX5A 2Y6ZA 3DAQA 4GJIA 3VMOA 1G6CA 2VQUA 4HB7A 1WA3A 1UZHA 5T8GA 3UXLA 4FP1A 3VNKA 1PVNA 1Q63A 4HJWA 2UWFA 5CC3A 1QNPA 3SRFA 3I7QA 3TQVA 1J18A 1J0KA 3M0KA 2DV0A 3GKFA 1K7XA 3GIYA 3CH9A 1RP8A 3EX3A 4XAGA 3V5FA 5BZAA 1JNEA 3ABQA 2NXGA 1Z9AA 1K9FA 2YL9A 3KL3A 4WDTA 4JEQA 1UUMA 4OTKA 2ISDA 1TA3B 4RNFA 3IIPA 3SCQA 1HP4A 3S5ZA 3CHVA 4QR6A 2FHCA 1UWUA 4IGSA 2YXGA 4LU0A 3W82A 2CLEA 3GYCA 3V0UA 4XD6A 4W89A 3EWYA 4IIEA 4AD1A 4O54A 4KEUA 1TG7A 3AHZA 1JJKA 3B9OA 1EPXA 3LHZA 2CLMA 1LJYA 2DY3A 1H5VA 2ICSA 3RM4A 1QPKA 2PGFA 4CCCA 1UMYA 1HTIA 5CG7A 3OZPA 1ECQA 3BQ6A 3LENA 3VGEA 3ZJ6A 1UD3A 1UR1A 4DBSA 4DJDA 1XLEA 4LC8A 5GJMA 3EAUA 3NDOA 3P14A 3A3HA 2X1UA 2JBMA 1OD8A 4R5EA 5EFDA 5AC7A 2NWRA 4LVDA 1TMHA 1QJWA 3T55A 4HYRA 4N9DA 4HOZA 2YLAA 1JF5A 4NKCA 1H0GA 2XIJA 1XYBA 3H24A 4F4RA 2PLCA 1BVZA 3EPOA 2CXGA 3N3TA 2PD5A 1JRBA 2VC7A 3EEGA 1T41A 3RM8A 2PDCA 1NH6A 5CZJA 4LWWA 2XWDA 1WB0A 1R8LA 2V9DA 2NX1A 1NDVA 2DU2A 1V3KA 4L7ZA 3CWOX 3RU8X 3PG9A 1Q4NX 3BH4A 3M44A 1FY6A 3P5ZA 4UTFA 2QF7A 4I7WA 1I6NA 1ODUA 1TVLA 1N82A 4KBXA 1B1YA 5C7HA 3UJEA 4QS5A 2OT0A 3WFLA 4HA1A 3CHDA 4MDOA 3EWDA 4Q8TA 1O68A 3H12A 4EANA 1PTDA 3RIKA 1FHDA 1F8IA 3F4NA 3WJYA 2PEVA 3N3MA 3CTLA 3JZEA 4PUMA 4J2MA 5LA0A 3HGSA 4OV4A 3BOFA 3RCNA 1VEOA 1UKOA 3FCPA 3UA4A 4C60A 1KCLA 1Z41A 2CLIA 3TTSA 4Z42C 3PULA 4AAJA 2XZ7A 4MKNA 3T78A 1JZ5A 1T5AA 1OCQA 6XIAA 3WEZA 8RUCA 3NL2A 3CPRA 3NVDA 3PZVA 5C6MA 3PHAA 4UR7A 1W3LA 4AZGA 2VZSA 2CBVA 2OQYA 2WC7A 1E56A 2X1RA 5DCDA 5SWUA 5HAOA 5DANA 3CT7A 3ZT7A 3RO8A 4NP7A 1N55A 1MW1A 1YW1A 1IWBA 3SCRA 1MUMA 3VKAA 4AD2A 4GVFA 3GW0A 1SZFA 2B7OA 5HXMA 4TMBA 4XZWA 1EYWA 3S5YA 4IWWA 4EAMA 3DBNA 3BAXA 2IS7A 1BRLA 3GQYA 3QV8A 1H09A 3PUOA 4HIBA 1NAL1 3T2PA 4ZGYA 4QDWA 3M0LA 3L0KA 3G8RA 2J8TA 3WLJA 3LGDA 4IPIA 4LGXA 2PE4A 4L6HA 3N11A 2IXUA 3OVPA 1W3KA 1Z69A 4P7LA 2Y2WA 4H2HA 1PBGA 3E5PA 4GRSA 2P76A 1XDMA 4D8LA 3SSJA 1OEPA 2YZRA 1XRVA 3WH6A 4GVHA 4HZ8A 1LUCA 4KRTA 1CDGA 2VGBA 3S1XA 4PFHA 3VM5A 1IEXA 3VGDA 2BGSA 1S1RA 4EXAA 3THCA 2J47A 1EC7A 3LA4A 2QDEA 3G2GA 3CQKA 3IRSA 5HQMA 1M9HA 2J7BA 1FXQA 1G7VA 4HU0A 2XG9A 3CIXA 1VFTA 1NF0A 1W1IE 1T8XA 1EQCA 2QJJA 1VF8A 4IP7A 1IXOA 4QJ5B 2JIEA 3ZMRA 3N15A 1WCGA 2G3JA 2BY3A 2Z1SA 3LU2A 3V5CA 2VEFA 3FDKA 2W66A 4JTIA 3EXTA 1S39A 3ITCA 3GG0A 3ATYA 1FKXA 1PEZA 4IJBA 2NUWA 2YSWA 1V5XA 5KTLA 5A95A 2ZX9A 1KM6A 3NZRA 2WMJA 3QV7A 2AMXA 1Z89A 1TWIA 2VGGA 2D24A 3WLQA 3RM9A 3QKEA 4LYKA 1WKYA 5XIAA 1G4SA 2W27A 4PB5A 4ZXOA 4EF9A 2DT0A 4GYKA 3UCCA 1WOBA 2WCAA 3AALA 3BSGA 4GXMA 1RLDA 1OIMA 3QR0A 2OYMA 3GR8A 5HPCA 5IM51 3P6LA 3CBWA 2X16A 3FGCB 3Q37A 3SUSA 2HEJA 2VENA 4JN6A 4UZUA 1EA0A 2OJPA 4PL1A 2J77A 3HURA 1L2UA 3WLLA 2DUAA 3Q2DA 2WCSA 2HVMA 4W88A 4DBEA 2PWUA 4BEQA 1TV5A 4Q4MA 1XBZA 2WLYA 3LHWA 3LK6A 4HKPA 2V2HA 1W9VA 1BYDA 3UZWA 1JXKA 2BVYA 3POHA 4IMEA 4QEEA 4JXCA 1BTCA 3DUGA 4DAIA 4NHVA 4UTLA 1A0DA 5C5YA 1VHNA 1PWLA 2Z1KA 4NZJA 1A80A 2ZUTA 3BG9A 1MEIA 1BXNA 4AZCB 3T0AA 4RNIA 1KM3A 2PRHA 1R9YA 1XQLA 3CLWA 3S6OA 3GTXA 2E8YA 3OG2A 1IIGA 1A5LC 4LYPA 4FOUA 3R12A 3NA8A 4G1NA 4WKAA 3T44A 3THDA 3TR2A 4GNVA 3QFWA 2OSYA 4DIAA 3UY8A 3TSDA 2INFA 3CZEA 2XSBA 2VGFA 2PWFA 3DYOA 3ZR6A 1KR0A 3W00A 4HSOA 4GCAA 4DJDC 2FZBA 1PAMA 1TZ9A 1WQ5A 1O5QA 4PR4A 2OSXA 3I10A 5KEZA 2D1ZA 1Q7QA 3VOJA 1F05A 4HMEA 3H7VA 1QATA 1DQUA 4KW2A 1E9IA 4S3GA 5K9DA 4CU7A 1SJAA 4MHBA 3EX1A 4JIIX 4MSSA 4LB3A 3Q94A 3ICJA 3N2XA 3URQA 4F0LA 2HVNA 4XTIA 1XBVA 4X61A 1XRSA 1GJPA 3PS7A 3HPSA 3TA9A 3C8FA 4ZQMA 2DIJA 1NFGA 3KBNA 4J3VA 1K4GA 1KM1A 4I90A 3EDFA 3TU9A 4U5KA 2XH2A 3F03K 2ALRA 2R1LA 3F4CA 1OFPA 4GINA 2XYLA 2PDQA 3R89A 4C65A 3LERA 3FKRA 3RYSA 1MQRA 4H9MA 1PCWA 3M43A 3TROA 1QK0A 1XCXA 4K2SA 4HK6A 4KIEA 1M7OA 1Z3NA 3UXAA 1UIOA 4PN2A 2G5WA 3TVAA 4F3HA 4LCQA 1OFRA 4QJ3B 1P0NA 3MWAA 4M6UA 1JZ6A 4H6EA 1PTGA 5AVNA 1VPXA 2PTZA 2PDKA 4ZL1A 1Z44A 1NWSA 4A29A 2P8BA 3GC2A 1FWEC 4HP5A 1D9EA 2HS8A 3DFOA 4EOUA 3KL0A 3EB3A 5J8LA 4WGHA 4POCA 3OLEA 1E9YB 4GIRA 4FHAA 2XN0A 5I3FA 2DT2A 5AYIA 3P93A 3G1VA 2F7FA 3A3XA 4E8CA 2P10A 4P8VA 1QHZA 2HQAA 1G9HA 5FA5A 3KTCA 4P7NA 4A4AA 3QC0A 4PMJA 3NQCA 4CNUA 1SW3A 3NYDA 4ZR8A 4KWOA 4IJCA 3MO4A 1P0EA 1XLHA 2V5LA 1MRQA 5AZ1A 4IL0A 1XRTA 3UZZA 4RDZA 3S2MA 3AROA 4BFAA 3S9YA 3VGGA 3DHFA 4LY8A 1SU5A 1XHGA 4Z1AA 1H7NA 4US5A 4LSBA 3LCIA 4P61A 1AW2A 3WNOA 1N8FA 1W2VA 3N2MA 3DFSA 3OODA 5LIWX 4E3VA 1UBSA 1RY8A 2VCAA 3F2BA 1ISXA 3MZ2A 1E6NA 2ZOXA 1JUKA 5BU6A 1E72M 1GKPA 4AQLA 4DNMA 3GIPA 3M47A 3VPLA 4R9XA 1S2VA 5CSUA 5AY7A 3B9NA 2HISA 3HGRA 5DCEA 2D20A 3EMQA 4IIBA 4CD6A 3G5EA 1X96A 2DJXA 2WJEA 1VBGA 2G3IA 3N4FA 2HV5A 5C70A 1F8MA 4Z2KA 1JVNA 2ZKMX 1BEUA 3CAKA 3W1LA 4S3AA 5F4XA 1CLVA 3BSHA 4A6GA 2P3EA 5DMNA 4AZBA 3N6HA 3T05A 1G67A 3VNLA 4I6KA 1NSJA 3I6RA 2B81A 2QJGA 2FLIA 3UEQA 2IQTA 4C7GA 1E6QM 3LLFA 4NAFB 3QQ1A 4GYPC 4JX4A 4NY2A 1SR0A 2PDWA 3VTRA 2PDXA 1XLMA 2CXEA 2VO5A 3GVQA 1OYCA 2C6QA 4XUYA 3I68A 4DN1A 1CXKA 1SJBA 2WZTA 4DEFA 5IFTA 1YTEA 3LCLA 5DELA 3K46A 5KZ6A 3WQDA 3L4ZA 4X60A 4D6IA 4LBRA 3A47A 1M7PA 3MUXA 5FJIA 4UQAA 2XTKA 1V0MA 5AYZA 7REQA 2C71A 4D6JA 5IBXC 2X30A 3KL5A 2C18A 3R43A 1KKRA 1W54A 1GZ1A 3S2CA 7TIMA 1E51A 4GX8A 3KEHA 4ZOCA 1LBFA 4XVDA 4I9AA 3OOQA 2OXNA 3L9CA 2GFTA 1MFUA 2OT1A 1DJXA 2QPXA 4N4QA 4DM1A 2GQ3A 4IMDA 3ZOAA 4A22A 3LHUA 4LVGA 5T9BG 5FI8A 2HCVA 4UTJA 4A8IA 2VTFA 4O8RA 3QGKC 3BG5A 4CN4A 3V1PA 4Q4OA 2DJLA 4JNMA 4QLKA 3N4AA 1DEDA 4Q4SA 2PDBA 5D8WA 3MMUA 1WXYA 1XFCA 1XSKA 2XGIA 3MHFA 3ALFA 3IIZA 5A6AA 2ZIDA 3E5BA 1KNWA 2OWCA 3TXVA 4D8AA 3N1AA 5LHEA 1TJ1A 3LV5A 3TZNA 1GYLA 1YXYA 2YCJA 3C2FA 4IISA 1GVFA 3LCXA 2VQTA 3KLLA 1RJQA 4QE1A 5AHMA 2FKPA 3ANYA 4KCVA 3S6DA 4PGLA 4PMDA 2GQ9A 2ZA2A 2IXVA 2D3NA 4JQ2A 3DESA 2BY1A 1UWRA 4C1NB 2YBTA 1B3XA 2Z1VA 2HE8A 3B05A 1I9CB 1CB2A 1LLOA 3LUTA 1T96A 4IUGA 2OQHA 4IG2B 1MXGA 3P0XA 2RGMA 3S8HA 1C8YA 1I2QA 1DJZA 4ZB5A 4R88A 4FX6M 2VVNA 3AXKA 3GZAA 1HO1A 5HBFA 3E2VA 3ZLHA 4AVNA 2GJPA 2G3NA 3MT1A 2G3MA 1IWAA 4E3TA 1ZP3A 3AXXA 2CLLA 4LW7A 4CLMA 3NURA 3PTDA 1GOXA 1HGWA 3O8AA 4EAYA 1J0ZA 3M0JA 1YX1A 1F4HA 3R58A 2E77A 1XV8A 3BLKA 1F73A 3HPZA 4WY0B 3PTKA 5I03A 1DQXA 1BQGA 3COTA 1NOUA 1GVRA 3R79A 5EBUA 1LQAA 2E09A 5I78A 2G41A 4RPQA 5HATA 3GNDA 2GJNA 4CD5A 3VUSA 4QDMA 3MSDA 5ECUA 1J0YA 4AZIA 4JICA 1B4KA 1OX4B 3WCZA 4AEEA 1OBAA 5GNYA 5LKYA 3N12A 3SQLA 4TV5A 2FB3A 2NZLA 3LY0A 1UROA 2BX7A 3NQEA 3TX9A 3TA6A 2IKIA 4NZFA 3W75A 1R85A 4AF0A 3LI0A 4JFTA 5D2XA 1SGJA 2V8ZA 2JALA 2X2YA 3CT2A 3DEQA 5DQPA 2BY0A 3F1QA 3WQ6A 3KOWA 1L6FA 1W8GA 4FIQA 4REQB 3ZQ9A 1ZJHA 2O0TA 3R0UA 4Y6GA 1JPDX 2BMBA 2EPKX 3OHIA 2QAPA 3ID7A 4GY0A 4DXKA 1XF0A 2F2KA 1BTMA 4YHEA 1UR8A 1IF2A 2CFFA 4WY0F 3NQ2A 2DT3A 2FFCA 3CYJA 5GNXA 1DXFA 4MY8A 5CBBA 2KZHA 4B5VA 4DHGA 5MKGA 3BK0A 5EMMA 2ZQ0A 5I24A 2OYKA 4HZ7A 2YL8A 1GHSA 3FHAA 2Q01A 1H60A 3MCMA 4HOXA 2SFPA 4GQBA 4KEZA 2VD9A 1OG0A 4FLRA 1ZJBA 2FJUB 2E3ZA 1DWAM 3MDWA 1I75A 1MZRA 1TWZA 3C0SA 4XAYA 3V16A 3O06A 3H4GA 1S1PA 2E6AA 1RQHA 3SCOA 4H41A 4BF7A 3GNOA 5TD4A 2BY2A 1XD0A 3WLHA 3IEBA 1GYNA 3GXTA 2LLEA 1G4PA 4JX5A 3U57A 1CT5A 1ADOA 3U7BA 4H7ZA 3HPFA 4S39A 2V6AA 4GWEA 2DZXA 4IG2A 5AHIA 4KT2A 1IV8A 3UPBA 1IZKA 4PRWA 4RZ6A 3DGRA 1E0TA 3C2RA 1R2SA 5AKQA 4XKYA 1WDPA 1ZBCA 2V68A 2VFFA 2Z7KA 2ASHA 1PHWA 1YXCA 3WN6A 3ARUA 2J66A 2PFHA 2D69A 1FWTA 1HL9A 4FIRA 4ZSUA 4UOQA 4NX5A 1ZBVA 5FEZA 1T0OA 3N18A 3BMWA 2FZ9A 5JUVA 2J25A 4LALA 1H0IA 4PEEA 1ZFJA 2J7EA 2VFIA 1XLGA 1AQHA 4H9VA 2E9LA 3KS5A 4TOQA 1KQZA 3HOJA 3K1GA 2FZMA 4PUNA 2RDWA 2JEQA 3W86A 4LTSA 1R3QA 3WH9A 1XS2A 2FMNA 3UVIA 2ZRUA 1EJWC 5HR7A 2GVEA 2EKCA 1EF3A 4B15A 3SM0A 1JPKA 3C0QA 1I1WA 3FAWA 1P4CA 3FYPA 2WMIA 3RILA 3T4CA 1WYIA 3JU2A 1OWQA 4B5TA 2IQ0A 1PUDA 1MW2A 3S4TA 1BWKA 2EPMX 4OT7A 1HKVA 3PBGA 3AWOA 4YHGA 4C6CA 1W9PA 2HK0A 3O05A 4S3BA 3L5MA 4DJEA 1TSIA 2YCEA 3QHNA 1OZQA 2NSOA 3WSUA 1X8FA 3WF0A 4NASA 4DYEA 7REQB 4MNMA 4CQDA 1HJSA 3VYLA 2UV8G 5PTDA 2H9AA 3TMQA 2PC8A 3PJUA 3U4AA 5G2HA 1TZ7A 3NGJA 3E0LA 4JTDA 4AD3A 1MDRA 4BA0A 1M41A 4XBKA 5I77A 2NX3A 4G9PA 1YMYA 1GEQA 4XAZA 1I8JA 4DBWA 1XSJA 3NM3A 4ZOBA 2NVCA 2ACRA 4J28A 3EKZA 4E2BA 1RUSA 3RR4A 5I2UA 3WZ0E 5BMWA 1BVNP 2IUZA 3RDKA 2CETA 5BXRA 1LBMA 3HB9A 1M7XA 4FX7A 5BRQA 3GU1A 1HP5A 1NM9A 1Q66A 4P7QA 3ARZA 2P88A 1VFOA 3ERPA 1ITXA 2BVWA 3IVSA 4JQ4A 2ACUA 2R1PA 1WOAA 3C52A 1R5YA 4Y96A 3S1WA 4WJ8A 3N9KA 2AOSA 5AC6A 2Z29A 3DKLA 2GSHA 2OB3A 1LG1A 2V81A 2W63A 3VU2A 1RV8A 2QUVA 4K38A 3NO5A 3BWWA 2WYSA 1F3TA 2CLFA 5CEWA 1ECEA 5M3WA 2BDQA 1XIGA 3ABZA 5A5WA 3RO6A 2WNQA 2HNEA 2EPNA 3RAOA 1KRMA 1XIIA 2GL5A 3G22A 3MCNA 2VFDA 4W7UA 3GTNA 4WGXA 3WLSA 1E6PA 2J7CA 3RGTA 4PTVA 4HTBA 3EA1A 5KETA 2ZVIA 2XJ7A 2E7FA 2CIPA 5AVHA 2GJRA 2W62A 5K3VA 1SZGA 4I8DA 1HW6A 1KFBA 5D2YA 3WELA 2VP8A 4LVAA 3B04A 3SRDA 3BJTA 3C5QA 2WWDA 5TAOA 1DJQA 2HNHA 4G1KA 2PWGA 1VYSX 1Q3NA 5D2VA 5C9XA 1GK8A 3GZ3A 1Z48A 3FJLA 4A8NA 1KRAC 2CHRA 5LXXA 3VIMA 1FWGC 1GG1A 1ADSA 4R53A 3KBJA 5FIPA 4YWSA 1PZ1A 3M5XA 1SPQA 4FOKA 4B3ZA 1DIOA 4A05A 4GUFA 4UNKA 3RUBL 3W7EA 3U2EA 4XO6A 1BSIA 2J7GA 4E4UA 2JGYA 4NJKA 4FX8A 2A21A 3KDNA 2J7DA 4M7SA 1OHLA 3IJDA 1YQ2A 3AU6A 1EL3A 1LTDA 4YYFA 1ZCCA 2ZRWA 4MWAE 1Z42A 1S5TA 4ZO7A 3GDKA 4OOUA 4UOZA 3BMVA 2VCCA 2WMFA 3WEMA 3VKKA 4NJJA 3FGCA 2B0MA 4ZZ9A 3UWWA 1NY1A 4HHMA 1XBYA 5CZKA 1TA3A 4CNNA 2C79A 4ZQRA 1UKQA 3BO9A 3OW1A 3L4XA 1LLZA 2H3BA 4EPBC 5CZSA 2G8ZA 4KH2A 1W5NA 4RE3A 3GC5A 1XCWA 3DHDA 2R1NA 4Q8MA 3CQHA 3KVJA 2Z1XA 2FPVA 4NRSA 4DF0A 4UIOA 1FVPA 2DSWA 4NYUA 4DJED 1J0IA 1I60A 5AHEA 1YBQA 5XINA 2E4TA 4A3QA 3GAYA 3O6CA 4MNJA 1IEQA 4OBRA 4FO4A 5KITA 1UW9A 1ZL1A 1JCYA 1CW2A 4JTHA 3WH5A 1XINA 5D33A 4O4WA 4MJZA 4IPJA 3W73A 4WSKA 4NF7A 3TJ4A 2P53A 1FCQA 2QHAA 2WVVA 1IQ8A 2E40A 4JKMA 3TNBA 4LUTA 2ZCGA 1X98A 2I9EA 3T40A 5G1YA 1DBTA 2VWSA 4L9ZA 3HQOA 2O9RA 1L6GA 5K2ZA 3SJ3A 4MIMA 3PZ9A 3KBWA 4J27A 4ZTXA 2PP3A 1BG4A 4NIRA 1R9XA 3ITOA 1KBKA 5JQ9A 4AF0B 1NP0A 3AYSA 3N2BA 2PC4A 3WBAA 2ZUSA 1D8CA 3PP7A 1FWAC 3TZFA 4HYVA 1AW1A 2JK2A 3LLXA 5AFDA 4KCTA 1OABA 3AS0A 4JQAA 1C91A 4DYKA 2DW7A 4EPKA 2XH7A 1JPIA 4L6OA 3UWVA 2QMJA 3BV4A 1J79A 2ABAA 2BZNA 3FX4A 5I3KA 1DHPA 4OIFA 3UFYA 4Q8VA 3AYRA 1J0JA 5E70A 1UZ4A 4MZYA 1TR9A 1FHLA 4J4KA 2X0YA 3KVLA 5AC4A 1IR1A 3CZ8A 3BZGA 3IGHX 1CZ1A 1EJUC 1A3WA 2V82A 2GVJA 2X7VA 5CPNA 2Y8VA 3BLOA 4NNBA 4A3YA 1K9EA 1GVQA 5ABGA 1B5TA 2Q8ZA 4CCZA 2I5QA 3AHVA 5FCZA 5CJNA 3W70A 2VELA 2DVUA 2OPJA 5I06A 4F8XA 4J3ZA 4GI6A 1JR1A 3PB0A 5ABEA 2WPBA 1RP9A 4DNHA 1PKYA 4HA4A 4XVEA 1FWRA 4AYSA 3K1DA 1P1XA 5LNVA 2WK2A 3GAKA 1XIFA 4EPDC 4IFKA 3LN3A 1XJBA 4ZE4A 3M1ZA 5T91A 3HG5A 1VFUA 1W37A 1X1OA 3OBAA 2L5HA 3POCA 4KRZA 3IUDA 1OG6A 2BHYA 4BS0A 2PDPA 3GH4A 5GPRA 4HYWA 3FY1A 1W1PA 4W87A 3GE7A 3HG3A 1UYQA 4KFPA 3FYYA 4MUPA 4DYJA 4BI6A 4Y9MA 3PK7A 1VIWA 1JF6A 2QGYA 4I3GA 3NO3A 2YA1A 1M53A 5HOSA 1PHQA 4RPPA 4L80A 4LAMA 3M64A 3UVAA 1PZ2A 4O0KA 4ATLA 4CEXC 1DWFM 3N9SA 2QIWA 3GXPA 1JIBA 1I4NA 2V5KA 3SCPA 5FJPA 2JIWA 5JH2A 3NNTA 1FWDC 3ITLA 3LI1A 4XD5A 2V3FA 2TODA 1D8WA 3R94A 4F40A 1CX9A 3SCSA 1RQEA 3FA5A 4QBXA 4DLMA 2EHHA 4EP8C 1H49A 2HE5A 4D6FA 3R8RA 3CUGA 2J13A 4H4IA 3QQ0A 3CHFA 1SJDA 1XIJA 3LSCA 3GW3A 3TFXA 4CQBA 5FSEC 5HWMA 3W28A 1D7FA 2WM0A 1TELA 3S5SA 3CMJA 4NG3A 3QM3A 4WOZA 1KRBC 1XG3A 1FWFC 2XH4A 2PDNA 2PP0A 2OOFA 1NQ6A 4IQEA 3RF9A 3M4HA 4Q22A 4HVXA 4MYXA 3AJ7A 4R33A 1AFSA 1H41A 4W8AA 4L61A 3L5AA 1OIFA 4MWAD 1QHOA 2ZZ1A 5A6LA 3QTPA 4ROPA 4WDWA 1S2AA 1B2YA 2DDXA 2CBUA 3UJFA 3GU9A 3T81A 1P6WA 1XDLA 3G1SA 2FVKA 1M65A 4AD4A 1TMQA 2WSYA 3G1YA 3W7MA 2GOUA 5M5DA 3SY1A 4Y90A 4GG9A 1E9LA 1ZBWA 3M5VA 2W79A 5H8UA 2Y62A 3A12A 4KMQA 2F6UA 3FKKA 4DRSA 3BW2A 5ABFA 1QT1A 4WJXA 2Q8XA 2QLYA 3B8VA 2GQAA 4HA0A 5CPQA 3N2CA 5C9RA 5IBXA 2WNZA 3CXOA 2XN2A 4XBSA 3AWNA 3I3BA 1B30A 4IICA 3C0LA 1QW7A 4IPPA 4Q6XA 2EQDA 2VDHA 3REQA 3LMYA 5TF0A 1B9ZA 4ES4A 4EWND 1A5OC 3W22A 2PDJA 3NG3A 4MZ8A 2X0HA 5CC7A 4C90A 3W72A 5LIUX 1EWEA 3EDKA 4CNOA 3U7VA 3R5EA 4LT9A 2MNRA 5E1QA 1DJWA 4ZOAA 3A5FA 3DYPA 3ZSTA 1TIWA 2D2JA 5D9PA 4F0SA 3L0NA 3N9RA 3EWWA 1GZGA 4M7TA 3IVTA 3ARSA 2HDJA 4L9XA 2C13A 1VYRA 3BXWA 3FDGA 4U3AA 1ME9A 3CO4A 3NO1A 3M7SA 5HQLA 1S2TA 3WK2A 1AJ0A 1GT8A 1TPC1 3HFTA 2XVLA 5AHNA 2VL4A 4O52A 4Z2JA 2HWGA 3W7IA 1EKOA 1HFBA 2O7SA 4O28A 1K7EA 3H53A 3FA3A 5H6HA 2JKEA 2WB5A 3CAQA 3N2OA 3BJFA 3H2NA 2JKPA 1OCNA 3NOYA 1SO5A 4KIRA 2DH2A 3L4WA 2OOGA 4FNSA 4XD4A 1EX5A 1CLKA 4MZ1A 5CCZA 4TTGA 3CH0A 3QMSA 3CL7A 5DRCA 4MB5A 3PBVA 3NTYA 4H3DA 3DKJA 1UB3A 2DZSA 4PTWA 3GC4A 4WCJA 2BSLA 1WP6A 3WKZA 4AW7A 3BICA 3AIEA 1WXZA 1TTJA 3QTGA 1O66A 4UCGA 5DCBA 3WL1A 2GOKA 4Y8FA 3LZ3A 3VM7A 1VFMA 4MWAB 1C92A 2QKFA 2HPIA 3RLGA 3K4WA 4BQ5A 3SFKA 2FIQA 4YPJA 2ZDSA 4D9PA 1L0PA 4YCOA 2J79A 2TRSA 1EJXC 3W1MA 4Z08A 4GC4A 3EMCA 4EWJA 3S83A 1S5VA 4RZ4A 3QSRA 1V77A 1KTCA 3OTRA 4FA3A 1GQNA 1AK5A 1E40A 4GXWA 3NZPA 1C90A 2HBXA 2YW3A 4MNLA 1WO2A 5TQLA 3GFYA 3U2OA 5HANA 3R0DA 5KZDA 5CPOA 3IUHA 4JNYA 1WNOA 3WD0A 2W3ZA 2Y88A 3TMLA 4G5DA 2OFJA 3LM3A 1QPRA 1SMAA 3I65A 2PDHA 1TFVA 1Q8AA 3GXNA 3CU2A 4C6NA 3ZVIA 1ZGDA 1EEPA 1ITUA 4W8LA 2W91A 4IIDA 3EB4A 4QFUA 3VIOA 3UQNA 1JUBA 1Q7ZA 3KRSA 4QQUA 1ZJIA 4U5IA 4J1OA 1LRTA 3TCSA 4REQA 3MJYA 4PBEA 5CLTA 2Z27A 1JYVA 1V93A 1TB3A 2V3EA 3UWYA 1IR2A 4B5UA 1ADDA 2ZFAA 4U28A 4XBJA 2DSZA 3W85A 4PBGA 1EHNA 3B8IA 1FP9A 4BWLC 4JOMA 4B16A 3NEHA 4HMDA 1Q6OA 1TX0A 1M5WA 3M0IA 3S2NA 1FQ0A 2WV8A 3PWAA 4A21A 1NTHA 2XZ9A 3IAPA 3SBFA 4GNKB 1VBHA 1BGAA 4RX0A 4KETA 4QSFA 6PTDA 2HROA 3UYIA 1D7KA 4LS1A 1HJXA 1PKLA 4AWUA 2HPMA 1G7UA 2AMGA 3TSBA 2B4GA 2ZXBA 3CEUA 2E0PA 2O55A 4GBDA 2EXOA 3T8LA 4AZCA 4LF2A 1O5RA 3L4YA 3D6NA 3PPGA 4ZVJA 1VEMA 2GSEA 2YL6A 1K4HA 3AI0A 3MHUA 5FJTA 4X9SA 2HJPA 1K8CA 4Q32A 1I2OA 2GK1A 7TAAA 5D04C 5J5RA 1AD1A 2B7QA 4I9JA 4F0HA 3A64A 1P0DA 3RLVA 4MOZA 5FKYA 1X39A 3KZSA 1QDSA 4XZBA 1ISVA 4M1RA 1S5WA 2QVNA 1OT1A 5H91A 3HIJA 4MKSA 1OK6A 3LCHA 4JTRA 1J6PA 1W1ZA 5IDIA 3WQ8A 3SR7A 3W7PA 3LQGA 2Y1HA 4JEJA 3L7RA 3BLFA 3S9ZA 4MB3A 4UTKA 1YPXA 3KW3A 2WAGA 2NQLA 3OA5A 3TR9A 3UYCA 2YCLB 3GVVA 4S3CA 1RJRA 5E93A 3H6OA 1SSDA 4LVFA 2I1OA 3F5LA 2WLZA 3LRKA 3UT0A 2OG9A 1KB3A 3M6YA 3W83A 2E68A 4XG1A 2HK1A 1LWJA 4B3KA 3B8TA 3QGAC 1L6YA 4I8YA 1VS1A 3TJIA 3VOGA 3N2TA 4B5XA 3MU7A 1HZYA 7CGTA 3ARRA 5HULA 4LEFA 4N9BA 1WDRA 4PULA 2YCLA 4WDXA 4FZIA 4XKMA 2FGBA 1WDWA 3G3DA 4UTIA 3W29A 2OX4A 5FF4A 1OK4A 5U7SA 4D71A 1GZJA 3EWXA 4YJ5A 2YFNA 2DUXA 2XVKA 4Y9NA 2O9OA 1F3EA 4WK9A 4KWUA 2CESA 1ISZA 4ATWA 1E0XA 3EOUA 3M0MA 3L68A 2YXXA 5EGRA 4RW3A 5LYRA 2OU4A 1GNXA 1OJXA 3NDYA 3VIJA 3SUUA 4L1GA 4S3KA 5U4NA 2PD9A 4XZNX 1AL8A 1G0CA 3O1NA 3UPWA 3K2GA 3OQ8A 1U5JA 3DH7A 4UFJA 3IK2A 1BRLB 3IANA 2PZNA 3DGBA 3T09A 1GTHA 3MC5A 3URBA 1V3IA 2PTDA 1WUEA 4RJEA 1ODZA 3PSWA 1UH3A 4GX9A 3C8NA 3E2RA 3UCDA 1GOWA 2GJLA 2BXZA 5EFFA 4H8HA 3BLEA 4K7YA 2P50A 4X0NA 2IW0A 3UG3A 4GY1A 4NUWA 4FEZA 4V33A 3AICA 3WF2A 3KRUA 4LUSA 1IXPA 5HUPA 3MBDA 2QJIA 2F6KA 3LRMA 1JZ8A 4HT3A 1TE1A 3YPIA 4C6IA 3RCYA 1A50A 4BI7A 3ARXA 5F7UA 2PDYA 3W7KA 2XM2A 2WBGA 3AIUA 4AHOA 5HNUA 2VC5A 3IJIA 3SZ8A 4ZO8A 3TEVA 3F2CA 4LUSB 4O1FA 3M07A 2NV2A 3E0FA 2BHUA 1DE5A 3G1AA 3NQFA 4EVZA 2X05A 4JTAA 3EDJA 4OVXA 3CWHA 3PPHA 3GDLA 3M9YA 3S47A 1P7TA 3APGA 4GA8A 3AJXA 5HNTA 3W1QA 5BXPA 2P3ZA 1J5TA 4JIEA 2YW4A 2EJ1A 4QG6A 3VFCA 4UCFA 3VC6A 2HRWA 5A3HA 1RD5A 2JQXA 4G6CA 3OHMB 3MPGA 3TYAA 4XZLX 1RVKA 4MYAA 2WZHA 3QW3A 3WH7A 4C6QA 3O9NA 1FCVA 4NZ1A 3TOYA 1UP0A 4LF1A 1DJIA 2YDRA 3V1HA 4GE8A 1EP3A 1G69A 4XQ6A 1YHTA 3OIHA 4RR4A 3D46A 4HHLA 1VFLA 1XLDA 3TYDA 2Y7EA 1WDSA 5I6SA 1V6XA 4P8UA 5K4XA 1TE6A 3H54A 1BQCA 4LPCA 2OMAA 4AMCA 4UFKA 3LV6A 2A1YA 1QW9A 3IV3A 4PODA 1JCLA 2VHLA 3STPA 3MMDA 2BWGA 3WLTA 5D05A 3U8GA 4Z1DA 1BGGA 4HK5A 3VNDA 3EDEA 1Z32X 1MDLA 2PF0A 2PDUA 4DUVA 4Q7BA 4WRHA 3HG4A 3NSNA 1XGDA 2ZWYA 3IGSA 4JKLA 4DO7A 1RALA 1RH9A 4DJEC 3EDDA 4RXGA 3JRKA 3GG7A 1OC5A 2PTWA 3IV8A 3I6TA 3ONBA 2UZ9A 1C8VA 1X8CA 4EACA 4MLRA 4EK7A 1HJUA 1Y5VA 3MYOA 2FZ8A 1NDWA 5LXEA 2EPHA 2PWDA 1LOQA 1R3TA 2TAAA 4JKKA 3WDRA 1TCDA 3LBOA 4CN6A 3QPZA 1TV8A 4D6EA 4JN7A 3ZXWA 4FMVA 2OSWA 3BLIA 3UXDA 1YADA 3KUMA 4M6PA 3QH2A 2Y7GA 2ESCA 3VDBA 3SIMA 4FAMA 4KRUA 3AAMA 4QEHA 1A5KC 3F2DA 4PCFA 2BB0A 5EU9A 1TPFA 3WNLA 4UMCA 1QU4A 1SZRA 1R47A 1E55A 1LROA 4UQBA 5H8MA 1TJPA 1EHAA 2XVNA 4PL2A 2J6VA 3EX6A 5I3DA 5FF2A 3FW6A 3KCJA 2PCEA 2QJHA 2Y70A 2QVHA 4AMAA 1K3UA 9RUBA 3VIGA 1U5VA 5CGMA 1T8QA 4DM2A 5FACA 4CCEA 2GJXB 2POZA 3V0TA 2YBUA 4IIGA 4PCSA 6CGTA 4S3FA 1XXXA 3PJXA 2XIMA 2AL2A 4OU1A 1FH9A 3CWNA 3T0CA 2CWXA 4FOJA 1Q13A 3KOZA 4GLEA 2ZZ7A 3CB8A 2HTMA 3EKLA 3P8IA 3ZJKA 3QR3A 4K39A 1XYCA 1U2YA 3V18A 5M2FX 4TV6A 1KTNA 2Z24A 3O0FA 3R8GA 4E0CA 5BW6A 4AHQA 3TCEA 2YCKX 4DJFD 1BFNA 4RV8A 4GKTA 2OTDA 2PWVA 4F66A 3VILA 1VAHA 2BOGX 3E49A 4U4MA 1O4UA 2PPGA 2WCGA 4MM1A 4O1AA 1OSEA 1IWPA 4D8ZA 1J8VA 3TNOA 4GQ0A 2DZVA 4AXKA 4GIAA 1OFBA 2V3DA 4K8EA 5K9XA 5H1WA 1I2RA 2QYGA 4DO4A 1VZWA 1JZ3A 1X1ZA 2ZZ2A 3HM7A 3HO8A 3T2OA 1LCOA 1W1VA 5G4WA 1P5BA 1TREA 4AC1X 4JTUA 3D5HA 2G97A 2GJXA 1SQ7A 1F6PA 4IXHA 1P0BA 4M6QA 3BCDA 4ICMA 3LTPA 2AGTA 4GZJA 1SSGA 1KFLA 4LANA 3ONCA 4OZOA 2E5DA 4J9JA 4ZXLA 4IPLA 3TDFA 2FDMA 3GFZA 2OQLA 2DFAA 2D0HA 4CD4A 3QLLA 4M0XA 2Z00A 3HTWA 3MWCA 5E0FA 1V51A 3B9AA 3PUGA 4S3EA 3RXZA 4AY8A 3OZOA 4O50A 3O2LA 1LWHA 4MB1A 4JFWA 3WBXA 1PJ9A 3ZO9A 2FTYA 4NI8A 1MNSA 4GVIA 5DFAA 3SGZA 3B9EA 1SW0A 3LRLA 3W87A 1B3OA 3HF3A 4GUJA 3GH7A 3IUIA 4HOWA 3UGVA 1W6TA 3G1FA 1O1HA 3M5YA 1QR7A 2DVTA 3NWRA 4N4PA 4WD0A 4N02A 3TXZA 2RJHA 5LZLA 1HX0A 2WMIB 1DVJA 4JTLA 4ZTYA 4BI5A 3W3OA 3MUIA 3WQFA 2WKGA 2VZTA 1CGWA 3OQEA 3L2MA 3MANA 4DVOA 1LQ0A 1R6WA 2BVDA 3IJQA 1ZBKA 5AYXA 1M01A 3ALGA 3L4VA 3OBEA 2R1MA 4GIEA 2GSJA 4X22A 4DZHA 4HN4A 1F07A 2GUUA 1MQQA 4X3ZA 1SFLA 1KQYA 1Q6DA 2PBGA 1AZ2A 1E9ZB 3MS8A 1F5ZA 3ITYA 3WQGA 2QGHA 4US5D 1EO7A 3URNA 2F84A 4HMNA 1HNYA 4C6KA 4JTTA 3OVRA 3TTOA 2BOEX 4FR1A 3TW7A 2QCMA 1EJTC 1XIHA 4FK9A 1JZ7A 1EDQA 1HXJA 3SY5A 5BCAA 1IZCA 1J0HA 3H21A 1L8NA 1EX1A 3BZJA 5ABFB 4ZEPA 4Z2LA 3KBVA 1UOKA 5C2GA 4UR9A 3WDJA 2Q8LA 4N2YA 5CAKA 4JNZA 3IGUA 4CQ9A 2PLMA 3FXYA 4TO8A 1ZZMA 1RZMA 3M0XA 4QROA 1PX4A 2ZUUA 4JGDA 5DMLA 5AHLA 4EF8A 4GO8A 3LTSA 3EPMA 3AZSA 4E8GA 1Y8BA 2IQDA 2V67A 1JGIA 3OG3A 3A13A 1A5UA 1XGEA 4Z1YA 1B3YA 5T26A 2AQOA 2A2IA 5IHSA 3IACA 3SEPA 4ZSTA 4LAZA 2H8ZA 4ORIA 3E9AA 3PANA 4U2YA 4M6VA 1X7IA 2VJXA 3HN3A 3D3AA 3VGFA 2XFYA 4LCSA 4BEUA 1UR9A 2Y5EA 3VABA 1V4YA 1FOBA 2QV4A 3V3WA 3KWSA 1H62A 3VIFA 2JKAA 3PWGA 2ISWA 3VIPA 1RLCL 2YX0A 5CPMA 3QW4B 2ZVRA 4L4MA 1WZKA 1WPCA 2EBNA 4P2VA 4YL2A 3LBMA 1QNSA 2QCDA 3WDPP 1FDJA 2Q3RA 2NQZA 1HKWA 4LC6A 1T6MA 4GVGA 2V2DA 1EXBA 3PY2A 5G4EA 4QHRA 3XINA 3UJ2A 3RCMA 3K4AA 4H8VA 5JBFA 3BJSA 3IJLA 3MSGA 1Q85A 3WBYA 3CO8A 1XPGA 1EH9A 4ATDA 1E73M 4Z1CA 4FF7A 1ZAIA 2GGEA 2INZA 1V02A 2D2OA 3CHCA 3ZLGA 3LQLA 3LYEA 4ADUA 3UJSA 3WNKA 2E1DA 1O1ZA 4H04A 1E5JA 5DY2A 2EGZA 4C1LA 3THAA 4OWGA 4Y9AA 3G8EA 5HMEA 1LRQA 1KXQA 4LS0A 4QSHA 5A8OA 1PO9A 3GHTA 3ZIZA 3L65A 3C56A 6ALDA 4FNUA 2J9YA 4PBFA 4QAIA 3IAQA 3H2MA 2ZE3A 1Q6EA 3AISA 3NQGA 2ZXQA 1VKFA 2FPYA 3DCPA 3E74A 4IX0A 1DWIM 5D9OA 4DUXA 4FXRA 4GYJA 1JXJA 1KCXA 3AHXA 3REQB 1EXPA 3AYTA 3B9DA 1TTIA 5E9XA 4IP4A 4PUWA 3O7UA 1XC6A 4F0KA 2CZVA 2VRQA 4CD7A 3VUPA 2PA6A 3NIYA 2QQ6A 3QVQA 2J88A 1XYMA 4O10A 5G4HC 3FEQA 3C2EA 1A5SA 1H63A 2X09A 3DG7A 4DBUA 4R9OA 3CUJA 3DFYA 3BURA 4DUOA 2DSUA 3CPUA 5F4WA 1LT7A 4NX0A 4QE5A 5B7ZA 3TKFA 4GMEA 3IVUA 4K68A 1GJUA 1DKWA 4XO7A 2DT1A 1CGYA 3CGTA 3CMGA 1R87A 3KTSA 3R0KA 1NDZA 5D2WA 1W5PA 4ZB0A 3WFAA 3TYUA 3WQCA 3WNPA 1GQKA 2J8GA 4GQGA 1TPDA 2BFGA 3C2YA 3SUWA 3N19B 3AHYA 5AYYA 4LRSA 1VR6A 1J2WA 2QJNA 2QR6A 5HK4A 1OZMA 3AS2A 1DOSA 1AZ1A 3JW7A 3WG6A 2BHZA 3DFPA 1KA9F 2WO5A 5C54A 5FEXA 3C3NA 2YJQA 1AW5A 3V35A 3TV8A 3ZS4A 4B5WA 3EA2A 1K7FA 1JAKA 5C71A 4WY0A 3P82A 3WYZA 2I7GA 3FAXA 4ZA0A 4LEQA 3L4TA 3LSBA 2VZUA 4PUEA 1VH7A 4UNLA 3WBEA 1JI2A 2J8FA 4QISA 2O7QA 5T9CE 3NXLA 3APYA 1XR2A 4XZIA 1VCVA 2WVSA 1XBXA 3NGFA 4KERA 1VPYA 4LBSA 2E9BA 4NZ5A 1Y65A 4MADA 1AH4A 3LPPA 2OODA 2HSAA 4A2SA 4F79A 4QE4A 3GNPA 3LCGA 3VD7A 4CNPA 3O16A 1V7AA 3M0YA 3GNRA 4XISA 3F4WA 4AZ6A 2GPTA 2D2GA 1HT6A 4YWIA 4CQAA 4PTDA 1ZUAX 3BAWA 1OVDA 8A3HA 4NRRA 1R3WA 3TN4A 1T40A 2G3FA 1IYXA 3W88A 1AQ0A 1TWWA 2PSNA 3GXIA 4K6AA 2PF8A 1JD9A 3APTA 3SY8A 4GJ1A 4GO9A 1W1A1 1JPMA 4GH1A 3ZR4A 3GG1A 1VPQA 1QXLA 1BXCA 3ATZA 1UP3A 2FZDA 3ANVA 4B2DA 3DI1A 1TJRA 1S2WA 3R8HA 1KKOA 2TPSA 3SW6A 3EXSA 1V6TA 2XIBA 1KRCC 3TTEA 1A5AA 1ZB5A 3E12A 2Y7DA 4AY1A 4RDVA 3W1NA 3PN8A 4QM1A 3AC0A 3CC1A 5HQEA 1FA2A 3OVGA 1MUCA 2Z4GA 4CU6A 3I3EA 4KGLA 3G0XA 3GXDA 3AMLA 1J93A 3FOKA 3F5KA 4IFRA 1HJVA 2WJFA 3WLNA 4BQ3A 1QI5A 1EUNA 3S46A 1IGSA 4XZMX 3GS6A 5K7JA 3G0SA 1YPFA 1ZALA 3W1AA 3TYEA 3QR1A 3WQWA 4GKLA 4KWWA 3A4WA 2VRJA 4DUWA 8XIAA 3ARWA 1CXEA 1FCUA 4LUJA 4JHZA 3O3RA 5FAGA 4TMCA 3KLKA 3GUGA 2O92A 4WJEA 3C2VA 3KFTA 4UFLA 3VI2A 3DN5A 4JTJA 2Z25A 4B9YA 1V7YA 4J3SA 2VWTA 3ANUA 2Q02A 4F2UA 1CBGA 3U4FA 4B9ZA 1REQB 2JF7A 3BAIA 5CQ1A 1UPMB 5D38A 1Q2RA 3FK4A 1SZNA 3KVMA 4MB4A 3LNPA 4JY8A 4ORMA 4DQWA 5I3GA 3HJEA 1CXFA 3UZ5A 1FFRA 8TIMA 2CERA 3RRAA 2ZX6A 2E5BA 5HINA 1RA5A 2QCCA 3HV8A 3ZR5A 1HGYA 3GR4A 2WVVB 3U0HA 5A94A 1QNRA 1UJPA 3VD5A 1GOKA 3NQ6A 3VGBA 5KMYA 4DWSC 3H2CA 2OZ8A 3DBPA 3RX3A 3LGGA 1H7WA 1J96A 3G1RA 1EB3A 1V0NA 2C0AA 2NT1A 1V6UA 4PSRA 4MDPA 4GZ7A 4RLIA 1UUQA 1UR3M 2J6XA 4Q8NA 3M7WA 3N04A 1LORA 1GUVA 2NQJA 4D6HA 2VX5A 4HQVA 3K8MA 2WHKA 1Q6GA 3TC7A 3GDRA 1LYXA 1ML1A 2VZOA 2VFHA 1JFHA 4XTDA 1FWJC 4KESA 5LSMA 4ZO9A 2X1IA 4XIMA 3WK3A 3ZWSA 1E0VA 4NI3A 3CUHA 4PUKA 5G5IA 1OYAA 1BXBA 1NU5A 1ZCOA 4G8TA 4INFA 1GVOA 2OLSA 4XD3A 4ZCWA 1OQFA 4YTSA 4DO5A 2Z6IA 4GFSA 5AZ0A 5HUOA 1K77A 3XISA 1TVPA 1E1CA 4HPGA 2BOFX 5CSSA 1U1HA 1CXLA 3SJNA 4Q8QA 3INPA 4AIBA 4XAPA 8XIMA 2YXOA 2C91A 1WDQA 1AD4A 2ZRYA 4JBRA 4GH3A 3W25A 5JH1A 2DH3A 2GVYA 4J5NA 1O5KA 4LUYA 5E0CA 1A49A 1KFKA 4GI4A 1XX1A 3OU8A 2A7PA 1SYTA 3VDGA 3PTQA 5CJ5A 4UTWC 4W84A 1PSCA 9CGTA 4CNSA 1IT0A 4AC7C 3QHMA 5AC5A 4I5XA 5E6ZA 4UTMA 4Q4KA 1HKMA 1EPVA 4GIYA 4AZ7A 3AU2A 1LM1A 1B57A 3VDAA 3AFBA 1NQKA 3M46A 3FJ4A 3M0ZA 3W02A 3KDOA 9XIMA 3RHGA 1L2QA 3IRDA 2GWNA 4M56A 1EJ7L 5I23A 2WHJA 3VGHA 2BASA 2VCBA 3KS6A 4RE4A 3RPTA 4YNGA 1LL6A 1F3XA 1XLFA 2E67A 4LJ3A 4C1NA 1LT8A 3H2OA 4JPGA 4RCXA 5F1VA 3M16A 1S3TC 4DWDA 3NM1A 3FSTA 3VC5A 3G1XA 3WMBA 4KGJA 1KCKA 5KZMA 4G7EA 2QCDB 4FNPA 5LIKX 2CPUA 3II1A 1IEWA 3W1RA 2WHLA 2GWGA 4DI8A 3UZYA 1UD6A 4S2BA 2R14A 3DYMA 1HVQA 1WKEA 2FGLA 3WBWA 3FSUA 1RBLA 3WQEA 3H70A 3KXQA 5D30A 3NSMA 5JBDA 3RLHA 2PCQA 1KGUA 1QOXA 4G7FA 4W93A 3ZLFA 5I02A 3VKJA 3BG3A 3F7JA 2QPSA 4JYDA 1UR4A 1DIDA 3S5NA 1CWYA 4GXPA 4DY1A 1G01A 3QOKA 4PMVA 2QUUA 4G2DA 3AUJA 3ZT5A 4PC8A 2WMGA 3PUEA 1UJQA 4AXNA 1V3MA 4FR6A 5C2XA 1FH7A 2GQ8A 1QVBA 1S2CA 4GYFA 3W71A 4NXKA 2GVLA 3P62A 2XHYA 3ELFA 3QPEA 4C7FA 1MXSA 4B5SA 1F6KA 2VMFA 3I7SA 1E6RA 4HNUA 3EWZA 1B3ZA 4JTFA 4BK9A 1JGMA 4QNWA 3MYPA 3GIQA 1F9CA 2HXUA 2V5JA 2Z1BA 2CNCA 1GTEA 1SO3A 3GY1A 2CBJA 1SMDA 3QKZA 5D2TA 1OFAA 4HU4A 1XLBA 1JCTA 2YFOA 5D09A 4PTNA 3BMXA 3EXRA 3M0VA 1XIEA 3W2KA 1U1UA 4HGXA 4UC5A 3LNMA 4V1YA 3TC3A 2RKXA 1MRAA 3LPOA 4WSJA 4UFHA 2X42A 2DZPA 4YVVA 3S2LA 4K7VA 4O8AA 3UGRA 4O11A 3JR2A 2PI6A 3IPWA 2Q71A 1REQA 3D47A 2ABBA 4ASTA 2XU2A 4Q4PA 4PZVA 3UY7A 3RRXA 1QUMA 4CQ8A 3NPXA 3OO2A 2F61A 4C1KA 3QN3A 2EG6A 3LGEA 2H3DA 2EPOA 1NELA 3FJ6A 4HSNA 4UNIA 4B4FA 3LM7A 1U5HA 1EO5A 3N34A 3UWQA 2RAGA 3S9IA 1ZTVA 3F4DA 4ICNA 2AL2B 1UH2A 4QCEA 3Q65A 1ZENA 3ARPA 1VEPA 3W26A 1UG6A 2VUYA 3PZGA 1XP3A 2FTWA 1KXTA 3WMSA 4XKYB 2R94A 3VKCA 3CUXA 3UZJA 5LGZA 3BW4A 4Z2IA 1BF6A 3VOHA 1DWJM 4OHQA 2XISA 4HNTA 3LBCA 2VM8A 3GXMA 1UH4A 3GR7A 1GVIA 1Q6LA 3V5OA 3VE9A 2WPGA 4AIEA 4PTMA 3UBPC 1V3JA 1XG4A 7XIMA 1H1NA 5BMXA 3ES8A 4V28A 2X8RA 4B91A 4GUHA 1Q8JA 3MB9A 1JDEA 4V15A 1SM9A 3GTFA 1LBLA 1P43A 4W7VA 1W9DM 1YLVA 3GXFA 3RNDA 3P5YA 4BQ2A 1I2PA 1F74A 4O18A 3TP4A 3WQVA 2IMRA 3PJWA 4GNJA 3I4EA 3U48A 4PE8A 3RFAA 4GOAA 2D73A 2ZADA 1I0BA 1XD1A 2ZWZA 1AH0A 1US3A 3WENA 1K9TA 1GVEA 4IMGA 5C9ZA 3AQUA 4WHBA 1ONXA 4MY1A 1NWRA 2VR5A 4MWAC 1A53A 2QUTA 2CLOA 2NVDA 5LGXA 5GNZA 1OT2A 1UWTA 3R1ZA 4H9UA 4NNAA 4IIFA 4QTGA 1VFFA 3TN6A 4UTHA 3VIHA 4PCTA 3AIVA 3WDHA 1JPHA 1LOLA 4JIHA 3W07A 2QNEA 1VJZA 2ON3A 4GFIA 1DXEA 4L1WA 1A3XA 4ZQCA 1TPUA 1R2RA 4FLOA 3ZT6A 4D6GA 2ZZ3A 1GOIA 3NZGA 2PDFA 3GUWA 3H4XA 3D0CA 2UY4A 5BXSA 1HJQA 1QASA 2GGIA 5CGQA 2OZTA 2XUCA 3WQ4A 4UTWA 3WDIA 1UA7A 3UPMA 1SZEA 4TXEA 4A3UA 4DELA 4GYPA 1FCBA 5K9CA 4CGTA 3K13A 3HQ1A 4KS0A 5L6UA 1P7TB 2AQWA 3H23A 4HSHA 3B4YA 5IDZA 4ZO6A 3HFYA 2ACQA 3SCUA 3ITGA 4OBTA 4HN8A 1HUVA 3KTXA 5D9NA 2BG5A 1UKTA 1NFBA 1XYFA 2FH6A 2ZTJA 3GTIA 3IARA 4Q4RA 4U10A 1BAGA 1GYMA 2WSPA 1F6YA 4Q8PA 4PMZA 2PLJA 3BDKA 3LS9A 2YZ5A 4TVCA 5JMUA 3N6QA 5AYBA 4UQEA 1DV7A 3DFHA 4RE2A 4M8UA 2PRLA 3KRZA 1EZ2A 3S5OA 3PBYA 4DF2A 4AU0A 3ECQA 8CGTA 4MFDA 1LP6A 3ARTA 4L6DA 1E1EA 2GDQA 2HVOA 4RNHA 1LQ2A 4H19A 3WNMA 5D37A 1FWIC 2OR2A 1OY0A 3ME3A 4H9TA 1O5XA 3DDMA 5EYWA 2WM1A 2QDDA 2QW5A 1I1XA 4ZODA 4BKNA 2FQIA 3ITVA 1TRDA 3SO7A 3V36A 2XIIA 2QPUA 1RHCA 3KE0A 4HNCA 3HMCA 3VZZA 3FIGA 3TAKA 3KP0A 4S23A 1S46A 3TLLA 3MBFA 3H55A 3CHEA 1H7XA 1UD2A 4HPNA 4WF7A 2NUYA 3KOFA 1VBJA 1A5BA 2WSRA 2ALDA 2CKRA 4R27A 5I5RA 3UESA 1XIMA 1E4LA 5C0QA 3E02A 2ZRXA 3AUOA 3AXMA 3DI0A 1O95A 3DERA 1E6XM 1ONWA 3VVGA 1JULA 3W4RA 3XIMA 3CV6A 3MUAA 3SURA 3VIIA 4XSMA 2FH8A 3TJLA 5LIYX 3N73A 1TYGA 3RMEA 5JIPA 3BAYA 4RL3A 1C8QA 1PCKA 5I3HA 4L5ZA 3O6AA 2DIEA 3S6TA 2Z2BA 1I45A 3WK0A 3IIXA 2ZUVA 1RBAA 5AC8A 1W9BM 2BS9A 2QF8A 1PZ0A 1YKWA 1IIHA 1O94A 4KKXA 2FJKA 1JCMP 5M03A 3NQMA 1QI4A 2PDLA 1XLCA 4QDPA 4M51A 2V69A 4RDWA 2Z26A 2ATMA 2I5IA 4TUFA 4IX2A 2P8CA 3JUGA 1UR2A 1VIZA 3CASA 2G96A 1AL7A 4C91A 1LF1A 3HU7A 3PBMA 2XDFA 3W76A 1DTUA 3WEOA 3LHYA 4IH3A 2PBOA 1R3VA 1XISA 3EOOA 4NSBA 2RHGA 3B3DA 4PUUA 3K30A 3VKDA 1IEIA 4R34A 2PWEA 4E4PA 3P3BA 1XRFA 1H7OA 4QS6A 1V6WA 4FLQA 4OUEA 3CAVA 2ANUA 3CZLA 3HGOA 3L12A 1EP2A 2C3ZA 6A3HA 2HXTA 1S5NA 1R86A 4KFNA 4WQ6A 1V3LA 4JL2A 3L0GA 1EA9C 4DWSA 1FP8A 3RLUA 4GI8A 1TRIA 4KWVA 1A0EA 1XW8A 2XFWA 3GO2A 3WF3A 2NX9A 3KCOA 3LEPA 3TN5A 1W1TA 3MY9A 1KFEA 2QT3A 1K70A 2X1TA 4C6LA 4DB7A 1JYWA 1H1YA 2VXNA 4GABA 2VOTA 4R7WA 2R91A 1L9WA 2CZ5A 1DWGM 4KF1A 3PPCA 2V5BA 2CYGA 4RW5A 1LZOA 2ZA1A 1VD6A 5CPTA 3HV9A 4JZ5A 3GRIA 5HMSA 1LUCB 1PXGA 3ES7A 1DJNA 2A3BA 1KLYA 4H83A 4NZ3A 4HK7A 5AOUA 1WBJA 4QLLA 4W7WA 5TBOA 4FLSA 1LL7A 4GUGA 3G6MA 1UR0A 1SO4A 3UXKA 2G0WA 4ZFCA 2PTXA 1UMLA 4HJFA 5A6KA 5LNSA 2OGYA 2WJZA 5FOOA 3LD5A 2WW5A 2NUXA 2YB1A 3WK1A 1F7BA 2D2HA 1UD5A 1XIDA 1P6CA 4R7JA 2H9AB 5CXPA 3GHUA 4O15A 3OYXA 1A5NC 4N9CA 1WZMA 2NW0A 2QEZA 3MW7A 3SGUA 3W6YA 2VFGA 1V0LA 3S1GA 1YPIA 3DHPA 3UG8A 1TUXA 3VXGA 3HG2A 1PV8A 2WZMA 5JXQA 4K37A 1OX6A 2AL1A 2OZ3A 3LOTA 4CNTA 1CB7B 1QNQA 4DJDD 1XWYA 1QOPA 2UY5A 1A47A 1QPQA 1TJ0A 3WJXA 3K5XA 1TUFA 3VD3A 1B3VA 4E4FA 3C3UA 4ADTA 3MA8A 5JIWA 3BV7A 5FD0A 2B7PA 3O63A 3AS1A 2PWHA 3ARQA 1TX2A 5CZ0A 2XSXA 2YR1A 3FV9A 3VNZA 3A9IA 4M81A 5E9AA 4HD5A 3B06A 2EEXA 3EOSA 3MP4A 3WLRA 4D6CA 4M1BA 4IMCA 3PZNA 3UF9A 5LA2A 4AISA 3ZWTA 5BOOA 4DJFC 2YDAA 4DXXA 1X38A 1K1DA 3UWUA 6TIMA 4FXFA 1TR1A 3EX2A 3CB3A 3QZ6A 5CPLA 3TJXA 4CN1A 1DJHA 3NL3A 5I09A 3H8AA 2OKOA 2YPIA 4H7VA 1UHVA 4LAUA 1BKSA 4QG8A 1QHPA 4TR9A 1TPB1 4QJ1A 3S1UA 5DO8A 4N42A 4Q4QA 7A3HA 2XVPA