3W00A

Crystal structure of pcrb complexed with g1p and fspp from bacillus subtilis subap. subtilis str. 168
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
226
structure length
226
Chain Sequence
MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Heptaprenylglyceryl phosphate synthase
publication title Insights into TIM-barrel prenyl transferase mechanisms: crystal structures of PcrB from Bacillus subtilis and Staphylococcus aureus
pubmed doi rcsb
source organism Bacillus subtilis
total genus 76
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.n9: Heptaprenylglyceryl phosphate synthase.
pdb deposition date 2012-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01884 PcrB PcrB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.390 Alpha Beta Alpha-Beta Barrel TIM Barrel FMN-linked oxidoreductases 3w00A00
4MM1A 2F6UA 4NAFA 3VKBA 4NAFB 4NAEA 1VIZA 4NAEB 3VK5A 3W01A 3VZYA 2F6XA 3VKCA 3W00A 3VKAA 3VZXA 3VZZA 3W02A 3VKDA 4JEJA
chains in the Genus database with same CATH superfamily
2HXUA 1JXJA 2F6UA 2XH2A 1EKOA 1TTJA 4JIIX 2WNQA 1E70M 3O16A 2PC4A 4PUUA 3FCPA 3CO8A 2AKZA 1Q6DA 2PWFA 1E3ZA 3W01A 3RU8X 2E1DA 3B0VC 2DEPA 3EWCA 4H3DA 4IGNA 3OYZA 3W1RA 4QSFA 2H8ZA 3EX6A 4G56A 3QQ0A 5ECUA 2KAUC 1KV8A 3MSDA 1JNEA 1UQZA 3LERA 3RIKA 4BCEA 1YMYA 2GOKA 2JIEA 1UD2A 1MQPA 4ZO6A 2BOGX 1V4YA 4AD2A 1SW0A 1GCYA 2ZA1A 1XHGA 5HNRA 3ZWTA 3T6CA 4WSJA 4DJDC 4JX6A 2PZ0A 4JTFA 3M1ZA 4DLFA 1IT7A 2RDUA 3SAZA 2PGWA 1M3UA 2EAWA 3R8GA 1NEYA 4RZ4A 4WJ8A 3QXBA 1KBKA 3TJXA 2BFGA 1HJXA 1U30A 3ITTA 3WH7A 2W67A 5EL1A 4CD7A 2BY0A 4Y90A 2F2KA 2GQ3A 2OKTA 3EDKA 1ZBVA 4JTJA 1QXLA 2DIKA 3G1FA 3WD1A 4ERIA 2HBXA 4O54A 1XG4A 1TUXA 3VNDA 3NXFA 3UZJA 3AI0A 1LCOA 5CZKA 2XJ7A 4BY3A 1HVXA 1IZJA 1ELSA 5CC7A 1J5TA 3F4WA 1TJRA 1TRDA 1R2RA 1PV8A 3ES7A 4O50A 4MNLA 4RLIA 4QLLA 1EJTC 4XSMA 1MFVA 3W2MA 3OVQA 2ZUVA 4DO5A 3SRDA 4RE3A 1GOMA 1L6WA 2ALRA 3E6EA 4HA0A 4EXAA 1CZ1A 1X8CA 2MANA 1E1EA 1OFBA 3L4TA 4S1FA 4Z08A 3S5NA 2Y1HA 4M6QA 1HW6A 3QN3A 4OVXA 3SO7A 2BODX 2B7PA 2DT0A 4LSBA 3NIYA 1NOUA 4NY2A 3CAKA 4JDBA 4W88A 1KR1A 2VM8A 2E0PA 1W5QA 1A5CA 4GC3A 1O1HA 4HU0A 1LLOA 3IAQA 3MW7A 4GGHA 4F0RA 2BY3A 1RCOB 1F61A 3ANYA 5DT7A 4IGHA 3TONA 1MVYA 2PDJA 4HHLA 2XM2A 3W7MA 1BWLA 3OVGA 1CXLA 2WWCA 3HF3A 3H2CA 4GIYA 4IIGA 4WJEA 3B97A 5BMXA 1RP8A 3MP5A 4R7WA 3F4DA 3QPZA 4X2PA 2WLZA 3WO8A 3BANA 3WQDA 2H3BA 1QCWA 4WX2A 1XPGA 2XFWA 2WC3A 2PGRA 3DXIA 3LRLA 3P2VA 3ANVA 2QHAA 1ZZMA 4X9YA 3WLLA 4AC1X 1HL8A 4IUGA 1KFCA 4F0HA 2VHLA 2DVUA 1FWFC 4JY9A 5E1QA 3P62A 3GKAA 3QKZA 5XIAA 4XTDA 1QPQA 4XK2A 3FK4A 4FPSA 4DJFD 4DWDA 2IMRA 1OFEA 1GEHA 3CAWA 1I75A 3O1NA 1V6XA 5LIXX 1FXQA 2GJPA 4YIWA 5H2ZA 1XIFA 2Y2WA 3M5YA 1U1JA 2FPYA 3NQ2A 5MF5A 1R3RA 5BNKA 1WX0A 2CLLA 1I45A 4PGLA 1EEXA 1W9PA 2XH0A 5LXEA 4QNEA 2YW4A 3CH9A 4IWWA 5IBXC 1E56A 3THUA 3CWHA 2X30A 3AWNA 2P8CA 3LGEA 3KVMA 3GBEA 1B9BA 2A7PA 2XFRA 3WH9A 4CD6A 4XBKA 1F2JA 2W27A 4Z42C 1HVQA 3BC9A 3PF3A 3LPGA 4I6KA 1LQ2A 3CYVA 4NRRA 3O8AA 1CXIA 3VK5A 1XCFA 2J62A 3VZYA 5DQPA 3KFTA 4DWSB 1CGVA 5GJPA 1KRAC 3PC0A 1W3JA 3CS2A 1ZCCA 3GYCA 4PYSA 3U7BA 4E6MA 1QW8A 1YDVA 3GR8A 2XSBA 2VZOA 1YBQA 1EP3A 3COTA 1LYXA 3WLTA 2F38A 4UTMA 2YB1A 4XVEA 2Y8KA 3S42A 3T2OA 1GK8A 3GNOA 4GUFA 3IVUA 4BWLA 1IEQA 1AQFA 2E5CA 4NJJA 3T09A 4CKQA 5AC6A 3CXOA 4H83A 1OD0A 1Y7VA 6TIMA 2ONEA 4MUZA 2VOTA 2WZIA 3OVRA 4NX0A 1CECA 3V75A 4UR7A 2TYSA 3HMCA 5JBDA 3DG7A 2X05A 1GPFA 1OFRA 4WIWA 4N0RA 2W9MA 3GWQA 4DN1A 4B92A 3BJSA 3UU0A 3VKDA 4O17A 4KWWA 1KBJA 3PWIA 4Q6XA 2DJLA 5PTDA 3P82A 3UWWA 2OVLA 1EJXC 4C6IA 4TX8A 3CUZA 3CASA 3O07A 1X6LA 3STEA 5F4SA 5I23A 3ZVIA 5E09A 3VDBA 2BZNA 4RR4A 3FNDA 1PDZA 4YYCA 4HJFA 1QHOA 3GHUA 4TVDA 1G6CA 2UY4A 3BQ6A 1TMQA 3W1PA 2AL1A 1XBYA 3BJFA 3C52A 3EKZA 3D46A 1JXKA 1J0IA 4HVXA 1UWRA 3LSCA 3JVAA 2CHOA 4Q7IA 5KTLA 3U2EA 4P5UA 3EMQA 4RE0A 3ZM8A 4DUOA 1PKMA 3BGAA 6XIAA 2V2DA 1N55A 4RKAA 4YJ5A 3WNPA 4ZTYA 3BMWA 4GIRA 1G4SA 1S3HA 3WJYA 2BTMA 2XFFA 4JTTA 1NOFA 2XISA 1OBAA 4N42A 1QT1A 1UKQA 3KL3A 1J6PA 4HP5A 3J7HA 4XAZA 3ZVHA 2VFGA 4L6HA 1FWDC 1POJA 2HNHA 3HQ1A 3BTNA 4GE8A 3FDKA 4NIRA 3QLLA 4GFSA 2ZUMA 1OIFA 1BXNA 4RPPA 1H61A 4Q6JA 3F4CA 1GQIA 4M82A 4DQWA 3IARA 5FEWA 5D4YA 5I3KA 2H8XA 3QM3A 4DLMA 5KZ6A 4BQ5A 2IS7A 1XIDA 3VCNA 2A3CA 1CI1A 4C60A 3BXWA 4K1WA 5EU9A 3JU2A 2R1PA 2GVEA 4PH6A 4HT3A 2Q02A 5FKYA 2D73A 1EO7A 3NSNA 1TA3A 4HZ7A 5DT5A 4J3SA 4JFVA 4E8CA 4FALA 2Y24A 4Y9MA 1NARA 1BGAA 3BAKA 3UJEA 4IPNB 4W8BA 4JTUA 2ZTKA 3BLKA 3FJ4A 2P3ZA 5XINA 1PTGA 3GE7A 5M1TA 3GS6A 4FIRA 1YX1A 4RDVA 6ALDA 1QPOA 1SSDA 4UCGA 1AD4A 1Q45A 2PTXA 3VGEA 3TQVA 1CDGA 3M0KA 3PANA 1BPLB 1I6NA 5FCZA 4XZBA 2DW6A 5F4WA 3VUPA 4H19A 4DO4A 2PBOA 3WJZA 3DC0A 3PZMA 5M5DA 1GVRA 2VYOA 3TYDA 2G3JA 3O6CA 3CHEA 3G22A 1UP0A 2JE8A 3QV7A 4UTWC 4O28A 1VCFA 3RGTA 1AJ2A 3NURA 3W81A 1XRVA 4FX7A 1L2UA 2ZICA 3A4JA 3CO4A 3GXFA 3T0TA 3CK5A 4ORIA 3NVTA 3OIHA 4RNIA 4CVUA 1ZL1A 4DPPA 5M3WA 2OEMA 3KS5A 1RK5A 4MIMA 2PDIA 1EBHA 2JKEA 5EMMA 5K3VA 4CEXC 4JEJA 1JCLA 2D69A 4FNTA 1LQ0A 3L4XA 1GHRA 1J18A 3MUIA 4K68A 2BHZA 1BXCA 3S0CA 3KL0A 3QPEA 1VEMA 2HE5A 4S3AA 3PZOA 1PEZA 5A8PA 1VYPX 3LUTA 4AH7A 4WY0F 2ZRVA 2NXIA 3N2CA 3PFRA 2EPMX 4AZGA 3NQGA 1K1DA 4Q3MA 3NA8A 4NX5A 1QOQA 1LT7A 2NUWA 3OP2A 4BZYA 4GJJA 2RJHA 1H7OA 1TREA 4RK8A 3SRHA 1XSJA 3VNZA 2JFEX 1GG1A 4KETA 1GQJA 3PPHA 1RBLA 3TW7A 4WXZA 4E8GA 2EKGA 5JH1A 4ADTA 4GX8A 4M7TA 4UTKA 3M41A 4C1LA 4FXFA 7REQA 5C2XA 2WMKA 3CT2A 1OYBA 2FTYA 2RDXA 2DY3A 1G67A 1P5BA 1I1XA 5C5YA 3UD6A 2OGJA 4AMAA 2WJZA 2ZX7A 1SW3A 3KX6A 4UR9A 4J2MA 1ZBWA 3QPYA 1K4HA 3NL3A 3T05A 4GBDA 4H8HA 1LORA 1Q2SA 4JTCA 3I7RA 3ZJ6A 1PYFA 2UV8G 4PUNA 3JZEA 1MW1A 3I6EA 4DJDD 4V1XA 2QAPA 5FSEC 1BF6A 3VIPA 4O53A 3KM8A 2Y8VA 4LCSA 2QCDA 1TKKA 1W5OA 4YTTA 1F3WA 4HK6A 1BQGA 4A2SA 1KM0A 1EL3A 3VGGA 1TWZA 3MP4A 4MZ1A 3VDHA 3SIZA 1YDYA 3VNMA 3EA3A 4IFKB 4WOZA 3MC5A 4YWSA 3SB0A 2Y88A 3W28A 1IXPA 4PODA 4ZFCA 1RR2A 4NUWA 1Y8BA 1TO3A 4Q4PA 1WYIA 2FTWA 4WVXA 1IIGA 1UKSA 3VKAA 1JCTA 3S8HA 2DT2A 5B7ZA 2CESA 1WDWA 4FLQA 3NL5A 2P8BA 5D32A 1A47A 3K4WA 4D6FA 1U22A 1FH8A 4CNPA 3LNMA 4PUEA 2OU4A 5K9DA 1JFHA 4WSHA 1K9FA 3UESA 2H6RA 3TX9A 4XWUA 3KBJA 3T8LA 2FHBA 3MMTA 1E9ZB 1WCGA 1XLGA 4H8VA 4JKMA 1LDCA 3KOYA 3N4EA 4P2VA 2VEKA 1OYAA 2DSKA 3WQ4A 4NXKA 3L2LA 1CIUA 1EJ7L 3M46A 1DJNA 2GK1A 4MWAE 4HMDA 5AYIA 4EVZA 4GUGA 4X9SA 4TTUA 4PR4A 3MCMA 4HPGA 4IPPA 3N3MA 5EPDA 5B7YA 4AF0B 2P76A 2R1NA 5DXYA 1XUZA 5CPQA 3S2MA 1QRQA 4OE7A 1FHVA 2PSNA 3DFHA 2V3DA 3KBVA 2EG7A 4LWWA 3H26A 5D2YA 2VR4A 3BW2A 4PSPA 1O6IA 1H49A 1Q6LA 2ODOA 3G3MA 4XZWA 1K3UA 1FP9A 3APTA 1UH3A 3EWXA 1NFBA 4JTLA 2OSWA 3WQVA 4MZYA 1JDDA 1GJPA 3RPMA 2XIBA 1M7OA 1W3HA 1KRCC 3W1XA 5HULA 2GQAA 4GVFA 2AMXA 3RRXA 3B0XA 4G7FA 3QTGA 1B3YA 3W6MA 4PUKA 2JQXA 4JTAA 5F2IA 3PP7A 4QBXA 3WG6A 3VFLA 4L6OA 1FDYA 1JAKA 4JOMA 2FB3A 1RCXB 4NQ1A 5MHBA 1LLZA 1TWDA 2WMIB 4GY7A 5DLCA 4PTNA 4A22A 4K3ZA 3B06A 4JQ4A 5HK4A 1ZSXA 2XM1A 4A4AA 3E0FA 1LRQA 5FEPA 1QATA 1CXFA 3N12A 1S46A 1QAPA 1TPUA 1VD6A 2G95A 3L2IA 4P8UA 4ZQRA 3RXZA 4REQB 3JRKA 3AWOA 2Z1BA 2WVSA 2FDSA 4BEQA 4IIEA 4MADA 4LF1A 3WFAA 3PTKA 5GPRA 4A8LA 1GHSA 2OTDA 3E0VA 1TZ7A 2PURA 4BJHA 1Z9AA 1KFEA 3TC3A 3B9OA 3E9AA 4PULA 2GWGA 4US5A 2DDXA 1UKPA 2W66A 3THAA 4NP7A 5AFDA 1JJKA 1EGMA 3VIIA 4GMEA 2DH3A 1FFRA 3OJGA 4M56A 2FZDA 1CNVA 4ZE4A 4O1EA 2CPUA 4XQ6A 3TNOA 1XRSA 2J7CA 3P0WA 3QC3A 4E2DA 1LG1A 3P8IA 3TN4A 2XVLA 4DVOA 3UXLA 1EA0A 3YPIA 1RD5A 3DFYA 1TCDA 3MUCA 3ALGA 1R2TA 4ML9A 5F2GA 1I4NA 4DF1A 3ME3A 5IXEA 3TZNA 4NZFA 1M9HA 2PC8A 2I5QA 3CQKA 3URNA 1KFWA 5CBJA 3SN4A 3LCWA 1QPKA 2B7QA 2FGBA 3VDAA 3VE7A 2EKCA 1A0EA 2J6XA 3ICJA 4L9YA 5CJ5A 1LWHA 4R7OA 1S5MA 3FFSA 2X1SA 1JPIA 3ATZA 3QH2A 2YFNA 4PB3A 3QZAA 4DO6A 3R8RA 1VPQA 1PTAA 4JNMA 3ZLHA 1FCQA 1FCUA 1WA3A 2GGGA 4D72A 1UJPA 4BS0A 3ITCA 2CWXA 1RBOB 2PLJA 3ARUA 3L4VA 4HSNA 3G1RA 3HGOA 1OCNA 4AVOA 3SADA 2Y63A 4IL0A 2PUZA 4QE1A 2GDVA 3B8IA 2NQZA 4U5KA 1Q65A 5FF0A 3TAKA 1V6WA 4ZFMA 4B91A 2YCJA 1NTHA 2IKJA 3I65A 1L6SA 1NWUA 3GW0A 4OFCA 2OMAA 2V5LA 3EOEA 1Q7QA 3IJ6A 2PWUA 1VLIA 4WY0A 4YLWA 2CLIA 1VC4A 3CQJA 4RJEA 4Y2WA 3MJYA 4MPKA 1Z48A 3W86A 4HPJA 3QYQA 1THFD 2OXNA 1VBRA 4OTKA 2Z27A 3VIMA 2QGHA 3WQWA 4EWJA 5HQLA 5J8LA 3O05A 4FSAA 5HNUA 1T5AA 5G2IA 4NYYA 2J78A 2R1MA 2YCLB 2YCEA 4MAVA 3W7HA 3CMFA 4XZIA 3INPA 2I1OA 3HQPA 3GFZA 3ITLA 3H6OA 1ISVA 2VR5A 2FQIA 3JR2A 3QTPA 4F2UA 1C90A 5I3GA 3HG4A 1RQBA 4ONVA 4JTEA 1JNDA 4RNJA 3ARPA 1E0WA 4GCAA 1MSSA 2GZXA 1TJ2A 4A6GA 3DX5A 1UKOA 1RK6A 4LVBA 3LBOA 4KRTA 2GSHA 2WOQA 1W32A 4C5ZA 3RMEA 1TZ9A 4DJEC 3IUIA 4D8LA 1TVLA 1CXHA 3WBWA 2E25A 3QV9A 4LYQA 5EGRA 1M6JA 3HPSA 2FZ9A 2ZYFA 5BW6A 3DUGA 4AQLA 2FGZA 3NEVA 2BY2A 5E70A 1UWAA 3W1LA 4JQ2A 3IGHX 1SYTA 1J0KA 2AAAA 1B57A 1AQ0A 5DMLA 4B3ZA 4P8XA 2A7NA 1W5MA 3PJXA 4Y6GA 2MUCA 5EMUA 2PDKA 3VNIA 2CLFA 3VVGA 2I7GA 4GK8A 3CV1A 3SFKA 4HIBA 1CCWB 3N25A 1J8VA 3TAOA 1W3LA 1US3A 3AYSA 3WDIA 1OK6A 4LUIA 3RLUA 3M0HA 1OWQA 3PAOA 4KH2A 2PBGA 3WBEA 1SFJA 5C71A 4ZO9A 4FLRA 1WPCA 1GYMA 3RN6A 1DYSA 3AXHA 2VO5A 3OLEA 4I8DA 3TFCA 4HA4A 1E6QM 2VNCA 1QNPA 1W3TA 1XQLA 3GDKA 2QUNA 3PHAA 3V5CA 4CU7A 3URAA 4GXMA 1L8NA 1UROA 4LAMA 4AYGA 4DWSC 2O56A 1P4CA 2V63A 3HQNA 4O1FA 1IE7C 1JZ5A 3W25A 3CV7A 3HPXA 1FWWA 4GI8A 4LB3A 4IQDA 2HK1A 4JYFA 4L4LA 4XZ9A 1W8SA 5H8PA 2PLCA 1KC7A 4ZOEA 1NDVA 5HNTA 3TCEA 5T26A 2OX1A 1H62A 1XLEA 2V38A 1WZLA 4UC5A 1EH9A 2BHYA 2EO7A 4EKJA 2F6XA 3OU8A 5G4HC 1KTCA 1V5XA 9CGTA 3NFUA 2O9RA 3KRZA 4P7NA 4PMNA 2HE8A 4ZO7A 1HKVA 2WO5A 1IT0A 1C8VA 4DI8A 3S9YA 3DG3A 3DENA 4IMDA 1FWSA 4FEZA 3STPA 3UG3A 5A6JA 4UQEA 1BSLA 2NQ9A 1VKFA 2DSUA 4CNSA 2C91A 4IFOA 1KXTA 2NQ5A 2VVNA 2PRLA 2H9AB 1R87A 3MMUA 3EPNA 4LAOA 4FX6M 4J7RA 5LIUX 2CKRA 2VL4A 2ISWA 1IV8A 5L9FA 4AAJA 2EPNA 2WW5A 4AHOA 5AHEA 1BYAA 4UTHA 3T0AA 3G2GA 4AC7C 4GJIA 4O11A 5LNRA 2V9DA 2A21A 1F6YA 1VBJA 1EC7A 2Z26A 5FI8A 4E0CA 5EYWA 5HJLA 4AY7A 1D3HA 3UCDA 3VOCA 5H8UA 4W9TA 1IEVA 4Z2HA 3CIVA 3GDRA 3WLMA 4C6BA 4PUWA 1OIMA 4AX6A 3FXYA 3A4XA 4M5PA 2GJRA 3N2BA 4JEQA 3SGUA 3VNKA 2X1TA 3BWWA 3QC0A 2YLLA 4GYFA 4U31A 1BFNA 3L65A 3KUMA 4F66A 4PSRA 4QM1A 1I2PA 4ICNA 4C6OA 4BF9A 2BGNE 2CBVA 5I3IA 1P0EA 3AISA 3UPBA 4IJRA 5I02A 5CBBA 4LAUA 5CC5A 3BV4A 2Q71A 4GQBA 1GORA 3E96A 1C7SA 2DW7A 1K70A 4H00A 4PMUA 1F6PA 4Q4OA 3H2NA 1ZRQA 3K30A 1V51A 4A8NA 3OG3A 3MBFA 5IM51 1OC6A 1V3JA 1OF8A 4JQAA 3L21A 1ADSA 2O9OA 3O2LA 4EPBC 4JCLA 1JG9A 2NT0A 1DXFA 1KQZA 5EFDA 2E9MA 1KGWA 3VKJA 5AYZA 1LL7A 2Z00A 3SQMA 4HTYA 2O4QA 2TSYA 3AALA 3LMYA 4Z2LA 1OCQA 3M7WA 3E2RA 2Z0IA 3AS1A 4IQJA 3LLXA 4S3BA 4QFUA 1JL8A 4YN5A 2E9LA 3ES8A 3W9ZA 4O52A 4ZVJA 2QMJA 1C9WA 1J0HA 4R27A 2GYIA 4XKMA 1UR0A 4QJ5B 1Z7AA 4JXCA 2CW6A 4F0KA 4P61A 2B4GA 5HJYA 2JALA 4L9ZA 3HGJA 4KW2A 1V8EA 2X0SA 2W3ZA 2WVUA 5ABTA 3PBYA 1XWYA 5FACA 4Z1AA 1H60A 1M65A 3NCOA 4FR1A 4IH3A 3HGSA 4WSKA 3GHTA 6REQB 4JY8A 1LRTA 2NSOA 4OU1A 3ZXWA 1QHZA 4EPDC 2YBTA 4NAEB 1RLDA 4LUSA 3EPMA 4IX0A 4A2RA 2DZBA 2C71A 2Y7DA 4GC4A 3TH6A 3GNPA 1HIZA 3R58A 3S6DA 3QOMA 3NYDA 4JGDA 4S2BA 4XZMX 4MKSA 1W54A 4AW7A 3ZT7A 2BX7A 4QG8A 4G2DA 6A3HA 4O0ZA 5H6HA 1UD8A 3W7OA 4X61A 4YNGA 3BG5A 5EY5A 3H53A 3UNDA 3UZWA 2NQLA 2D2JA 1QDSA 2VCCA 2FDMA 5ABFB 4UTLA 3N34A 2AQOA 3S1WA 4GYKA 3QY6A 6PTDA 4LX4A 2WNZA 1OC5A 1UIPA 1RA0A 1V02E 4FNRA 3DECA 2BVTA 2V2CA 4JTQA 4FNQA 3ZSSA 3TTSA 3MV11 3WF2A 5RUBA 3C6CA 5A6BA 3GNRA 1GT8A 2D24A 5FEZA 1LUCB 1NVMA 3HPZA 1W1B1 4KQNA 2AL2A 1ICSA 2VC7A 4MWAA 3BOLA 4H8UA 1S2CA 4QDPA 4CCEA 4M24A 1LZOA 2VDIA 5ECVA 1UP2A 1H09A 4OBTA 3DAQA 1CPUA 2WC4A 3C2YA 4W86A 4KKXA 4ECLA 2QYGA 3NO3A 2GQ9A 2E6YA 3N18A 1KKRA 2WK2A 4DEFA 5FJOA 2UBPC 1ISXA 5DCDA 4EANA 3PPFA 2FPVA 3HPAA 1GOKA 4FOUA 1HFBA 2X1UA 3APGA 4HYRA 5K2ZA 3MTWA 4C7GA 3BAXA 3GX9A 4JTIA 1XLDA 3WNKA 2Z1WA 3OBEA 3RX4A 4XKYB 5EMKA 4C90A 2NW0A 3WDJA 2RGLA 2FKPA 5LNSA 2GDQA 1E71M 2X1IA 3CL7A 3WK2A 2F61A 3W1QA 4IMGA 1MXSA 1KCKA 2G8ZA 5CGTA 5D2VA 4HNNA 2RFGA 1HJVA 4UQBA 1E6NA 5CC3A 1JUBA 5FL1A 3W1NA 1EIXA 2KZHA 4FOJA 3O6DA 1WZKA 4ES4A 1CEOA 3WNMA 3WL0A 1WP6A 5CCZA 1ESWA 3W74A 2V67A 3LB0A 4IXHA 1Q3NA 3WEZA 4J28A 4DZ5A 2INFA 1KB3A 1DIEA 3S6TA 4ZENA 3ZJ7A 4QEEA 1PWLA 1T0OA 4RW3A 1DJYA 1DJWA 5HANA 3IIZA 4C6LA 3SUTA 3RLVA 4Q7NA 1VGAA 4H9TA 4F2TA 2ON3A 1F4HA 3PZQA 4S39A 4H9MA 3C2VA 4J3UA 4AFYA 1AJZA 9XIMA 2CHNA 5D37A 1SSGA 1W2VA 2WVTA 1F73A 1BSIA 3LI0A 4HCHA 3DOPA 2BLEA 1OB0A 2VWTA 3WK0A 4DBWA 4CU6A 1VFSA 1YXYA 3MUZ1 4XZLX 1YE4A 3CHDA 4UOJA 3VOJA 2YL8A 4UFLA 1JZ7A 3C0QA 1QNOA 1T96A 5EB8A 4WJXA 4N4QA 4O18A 2B0MA 2OOFA 1S3TC 1H63A 4BEUA 2ZUNA 4GI4A 2YOCA 2VX5A 1K8CA 4KWUA 3W07A 4BQ3A 3PJTA 1JYNA 3EOUA 2FJUB 1LJYA 1T40A 4J2PA 1U1HA 3S1XA 4JTRA 1DE6A 1Y5VA 4AY1A 3T0BA 4Y8EA 3O9NA 1QO2A 3S2JA 4DAFA 1YPXA 1LTDA 3QMRA 5CC6A 3AS0A 3DH7A 4B16A 3MUAA 5T91A 4L61A 4B5TA 1KBIA 1ODZA 1XLMA 4AZ6A 4KEVA 2Z7KA 4N9CA 1B0IA 3SUSA 3N3TA 5LGXA 1EIBA 3SN0A 2GJXB 1V03A 4DJED 5CZTA 4ZQMA 3GLCA 4I5RA 1P6CA 3RCMA 1SO3A 3WK1A 3UXKA 1I2NA 2WVVA 2VVSA 4JKLA 4P7RA 1TR9A 3O15A 3TTQA 4AZ7A 3AICA 4ATWA 1B9ZA 4B2DD 2WSRA 2ZRXA 3PG9A 1HJQA 3O3RA 4MFEA 1MNSA 4GXPA 1TVPA 3C8NA 3M64A 3WEOA 4W89A 1K6AA 3H24A 4WKFA 2XG9A 4L6DA 1UWQA 2Y5SA 2PE4A 4GUIA 3UR7A 5D9OA 4Y9OA 2QUVA 4US6A 4UTFA 3S5ZA 1TZZA 1QWGA 1TV5A 2CLEA 3UZ5A 1C91A 1KV5A 2J7FA 4DUVA 3W7QA 3KAOA 2E67A 3R25A 4D6JA 2ABBA 3WD0A 2YDRA 1IXNA 5JBFA 3BAYA 3ZZ1A 3KBSA 3L67A 2C15A 5GJNA 4WQ6A 3U7VA 2QPXA 5CJNA 4RZ6A 3VNJA 3NDYA 1ITQA 1SJCA 1R5YA 2J24A 2VR2A 3OODA 3NR0A 3A22A 3DERA 2XDFA 3I3DA 3GC4A 1BLIA 3SCPA 3VZZA 4DWSD 1I2RA 4MLJA 4FI4A 2PDCA 1G01A 1IXQA 1G0CA 2WHMA 3NSXA 4IM4A 5ABGA 4GINA 3ONCA 5FSDC 3L5LA 2PGEA 2VFHA 3GXTA 1GVQA 3HFYA 4WK9A 2EGZA 3GIPA 4Z17A 2PTYA 2X16A 1QBAA 1U5JA 4YVPA 1JVNA 1ZU8A 2YCKX 4J3XA 1MW2A 3W4RA 2UZ9A 4FF5A 2A3EA 4JFTA 1WDSA 4L1WA 3FV9A 1XH1A 4KCVA 3DHFA 3REQA 3U0HA 3N2OA 3UG8A 4F79A 2VI0A 2Z6JA 3MKKA 4HOWA 3TJ4A 1E6RA 3CJPA 2XVKA 1B3WA 1FDJA 3NGFA 2ZZ3A 3QSTA 3WQFA 3LPFA 3GTNA 4UMCA 1PTDA 4C6NA 3G1VA 2HEJA 3E74A 3WZ0E 2XPKA 1JCMP 3PUDA 3FY1A 2OWWA 5DMYA 3V5OA 4TVCA 3LHUA 2P53A 4CQCA 3BURA 3UXIA 3RFAA 5D38A 4E3TA 1C8XA 4WUIA 1V7AA 1IXOA 2PDWA 3K1DA 3SZ8A 1J0ZA 4AXKA 1S2VA 1TPVA 3WUBA 4I9AA 1A5OC 4GZJA 1F76A 5LYRA 4DB7A 4UOQA 2DH2A 2QCCA 3C0JA 3K4AA 1RALA 4YCPA 3NSMA 2ESCA 5C8BB 4LV9A 2W4XA 3B0YA 1GWJA 4D6CA 2YB4A 2POTA 3VDGA 2EF9A 3H4GA 4K39A 2WNNA 3AAMA 1FWIC 1ZAHA 3PBUA 2J74A 2IPJA 4RV3A 3CC1A 1J12A 3SUUA 1FP8A 3ZSTA 1MDLA 4JS3A 5KMYA 1FH9A 1E9IA 4EXQA 1R3TA 3AU6A 1O94A 5A6MA 3WD3A 4B15A 5AC5A 1DIKA 4W7VA 2R82A 4HA1A 1Q7MA 2J7BA 3HBLA 1OT2A 5G4EA 4KBXA 2OEKA 4CCDA 1LL4A 1ZP3A 2WB5A 4G6CA 1S2WA 4XIAA 5T9BG 4HSOA 1UR3M 4PC8A 4D1JA 3QZ6A 4O14A 3BICA 4H04A 5BXPA 2ZBTA 2PP1A 1VPYA 4TX9A 3HURA 3ZMRA 3H22A 3OZPA 1TSIA 4PCSA 4HD5A 1WAWA 4Q4RA 2GGEA 3Q2DA 2ZE3A 2X2YA 5DN1A 2QUTA 1WDRA 1FWGC 1K77A 3OZYA 3OA3A 5F4XA 1QR7A 3VNYA 3DYMA 1FFQA 3AHVA 1SJBA 4E5TA 3M47A 2XGBA 5F7UA 4I8YA 8A3HA 3LPPA 1KWGA 4UZUA 3K8KA 3SY8A 2Z1KA 1L0PA 3JS3A 1T8XA 1YBQB 1O4UA 2V6AA 5A2CA 1Q85A 4F40A 3E1F1 1I2OA 2X41A 1ECEA 5AYYA 3VPLA 3SCNA 4IXXA 2P88A 1UMYA 4XX6A 1SM9A 1MXGA 5BOFA 4UMBA 4UB9A 4UFKA 3GNNA 5DBTA 3WQ5A 3T44A 1GUVA 3LHVA 1TVNA 3A13A 1E72M 1KBBA 5BU6A 3PSWA 4NILA 3LHYA 3KTSA 1IIHA 3FKRA 4KEZA 4OUIA 2GGIA 3V0SA 3UGVA 1K9DA 3L2MA 3OQEA 1A5LC 2X0HA 1U83A 5LIYX 1XYLA 2RHGA 4UR8A 1CLKA 1XSKA 1UR9A 3ZJ8A 2HQAA 4Z1DA 4QDWA 2HWGA 3VGBA 1S5WA 5KZDA 4HJWA 1RUSA 2O9TA 3TXVA 4F3HA 2HRWA 3VCRA 3KW3A 1B54A 1XX1A 3O0KA 4PCFA 1W1A1 4MJ2A 2WLYA 3KOXA 2B81A 2DPEA 2XU2A 4GISA 3ZLFA 3NL6A 1DWIM 1N2VA 3UWUA 2PF8A 1PKYA 1HP4A 1GOWA 4I9JA 2ZOXA 1D7FA 3A64A 3VA8A 3TN6A 3GHRA 3IV8A 1VB9A 2W0UA 3L5MA 4LGXA 4MJZA 3MCOA 4TUFA 5C9RA 4GNVA 1RP9A 5AHLA 1BG9A 2WQPA 2FZ8A 3AHXA 4R88A 2PWVA 3OGVA 3DHDA 3N1AA 3WY1A 2GVGA 4WLCA 2X7VA 3GXNA 5HOSA 2AOSA 3LN3A 1P48A 1W8GA 3DU0A 4J9JA 4N9EA 4RW5A 3LOTA 3WQGA 3ZVHB 3ARZA 1LL6A 1UB3A 4TTGA 2VFEA 3IJDA 3BW3A 4O1DA 1YKWA 4AISA 3R0UA 3RJXA 3CYJA 1W17A 3NQ6A 3BOXA 3MZ2A 2NWRA 3BPWA 1P7TA 2BG5A 3KCOA 3GFYA 1UPMB 2VURA 3TJIA 4GH3A 4PMVA 1EQPA 2HVNA 4FF7A 2VZTA 4MDOA 3F5KA 3BW4A 1A3XA 3P67A 3FHAA 1RJQA 2G96A 3WKZA 1VFTA 4LY4A 2IKHA 2VC9A 1C92A 4TXEA 1TA3B 4DM2A 4E8DA 4U2YA 3MJMA 1AMYA 2J75A 2WHKA 3ARXA 4Q22A 4HQVA 5FAGA 3WFZA 4KIEA 3KP1A 5I07A 1UOKA 3F1QA 5C54A 2FHCA 4AIBA 7CGTA 4K37A 1B90A 2C14A 1O95A 5IHSA 2J25A 4UXDA 2PU0A 3WF0A 3NQMA 2V5JA 2HS8A 4Q4MA 1IQ8A 2GGHA 4F0MA 1OFPA 4O1AA 3N29A 4LC8A 3BZGA 1BXBA 4PTWA 4MKNA 5F2LA 4HNCA 2G97A 1XLAA 3LCFA 1FDZA 3WH8A 2XZ7A 1N7KA 1V02A 2QUUA 2E8YA 1K8XA 3PAJA 1OX4A 5D9PA 3SN1A 2R24A 4KERA 2PD5A 3GR4A 1S38A 2ZADA 3LXBA 4O1CA 1P0DA 2V81A 2QCMA 3G6LA 1W1VA 2JIWA 1WOAA 1T8QA 3UWEA 2C1IA 1A0CA 2J79A 1DWFM 2GOUA 4XBJA 2FIQA 3CPUA 4Q4QA 1DV7A 5HWNA 2INZA 4Z1YA 3S9IA 2V69A 4HK7A 3WMCA 1JGIA 2PU1A 1ZBKA 2VCAA 2QIIA 5E0FA 1IR1A 4KPLA 1VF8A 2FMOA 1HJSA 1OABA 1XM3A 2D3LA 1OGSA 2GUUA 4KESA 1J96A 3KBWA 2C13A 4B5UA 1MI3A 2BV9A 1XYFA 2GJNA 3AHYA 2Y7EA 1ZENA 2OG9A 3S1UA 1K6WA 2ZXDA 3O7UA 1F4AA 3W7JA 4LV4A 3GHSA 4OGZA 3KDNA 3QRHA 1RVKA 3DHPA 2D22A 3R2GA 3WLPA 1FVPA 2ZKMX 4TQTA 1E0VA 4UFJA 4ZB0A 1SZGA 1WKEA 4PMRA 3AYTA 3QR1A 4KEMA 4G8TA 3IRSA 3TTOA 3EA2A 3QHOA 3E02A 3O0FA 5CJMA 4RZBA 4LPCA 2PA6A 7REQB 3CPRA 3CIXA 5HMEA 3VD5A 1JF5A 3SQSA 1WUEA 3AMDA 1GOXA 3PNUA 3PZGA 3WLJA 4MUPA 4H7VA 3A9IA 3FHQA 3AXMA 4YMZA 4MYAA 3ZJKA 2CZFA 3AC0A 1C93A 1U33A 1OSEA 4ZO8A 1ISYA 4H2HA 1O5RA 3FVDA 4M6UA 1W9VA 3GY1A 2CZDA 4NASA 4DYJA 5H8MA 4CD5A 1QFEA 2DIJA 4X2RA 3NPWA 1JCNA 2I17A 2ISVA 1GQLA 3PSVA 6TAAA 4AWTA 3D0CA 4YU1A 5FF7A 2NV9A 3EOSA 3BMXA 1HGWA 2FH6A 1SO4A 3HPFA 4ZMGA 2CC0A 4NNBA 5KINA 4S2CA 1MW3A 2QCDB 3LLFA 1PIIA 5TAOA 5LXXA 5AHMA 3CUGA 1FWCC 2CLOA 1B3VA 1JZ2A 4Z2GA 3A9BA 3MUXA 1UR4A 4LNYA 4JHMA 2EG8A 1BD0A 3RHGA 2ATSA 2NSXA 4JPGA 2YZ5A 1OYCA 4C6KA 3VYLA 4A3QA 2FB2A 2UY2A 4WHBA 1EPVA 3P61A 5E0CA 1TRIA 4V33A 5HATA 4D1IA 4HK5A 4ZSTA 3RK8A 2NLIA 1PX3A 3T40A 4D6GA 2BHUA 2VGIA 4ZL1A 1A5BA 4LAZA 2DZSA 4NNCA 4GNJA 3S2LA 1SFTA 4DF2A 2W63A 4K8GA 2C8NA 3VD9A 2VWSA 1YW1A 3ARTA 5JBEA 1TJ1A 1KTNA 1QK0A 2YBVA 4XV0A 3CNYA 2GVLA 2D20A 2GK1B 4FLOA 3GNDA 1Q8AA 3P14A 4AY8A 2F2HA 5CSUA 1WKFA 3H23A 4YS1A 4RE2A 3NQCA 3C5QA 1ZNNA 2Z4GA 4PMDA 2OQHA 2ZXQA 3OVPA 2NVDA 5EBAA 3KHDA 2F6KA 3E12A 3HTWA 2FZBA 1XC6A 1CW2A 1N8IA 3R6IA 1EGVA 2YX0A 5LHFA 2QMKA 3LV5A 3MV01 2D2HA 4LJ3A 1UOZA 2JF7A 1XPYA 4G1KA 4LS0A 4F9JA 3MPGA 3AIEA 4V28A 3C2EA 1XDJA 3MS8A 3NO5A 4IGSA 1H1NA 1WUFA 3GU2A 2H3DA 1R8LA 2NVCA 4CLMA 2P3EA 1WNOA 3BGJA 4IUOA 1E55A 1E4LA 3DG6A 2J47A 2QPSA 6XIMA 5L6UA 3F03K 2CXGA 5AB3A 2G3FA 4C6CA 5BWFA 1XBVA 1NDZA 1B5TA 2VC6A 1UR1A 1FCBA 1E5JA 3I6RA 3QQWA 1TUFA 1NP2A 4GKLA 1OFOA 3BLOA 4HSHA 2NX9A 3QOKA 2P50A 1QW7A 7A3HA 2DFAA 2EJAA 4ROQA 4MGGA 2YYTA 2ISFA 3C0SA 2J8TA 1Q4WA 3UJFA 5LNWA 3CTTA 4HU8A 3ARVA 8RUCA 4N6FA 2BBFA 2CNCA 4KWOA 4H6EA 3N6JA 4JTDA 3GVVA 5D2TA 3M0ZA 1GJWA 2J8FA 1H1ZA 3QFEA 5CPMA 5AY7A 1AW5A 3OO2A 2C16A 3PUOA 5G2WA 3A3WA 2P10A 3GG8A 1K4GA 4AEFA 5FF4A 5HMFA 4QITA 5AC7A 2RUSA 4K38A 4Q8QA 1FH7A 1BVNP 3LHTA 3FJLA 4JFUA 2P1FA 1EQCA 3KOFA 4O19A 1O60A 3BZJA 3AMKA 4YHGA 3W6LA 4BFAA 3H12A 2BP1A 1JRBA 5K9XA 1G94A 4GYPC 4AWUA 2QGYA 1W37A 2Z6IA 4ZCWA 4Q8OA 5TF0A 4CN6A 2OZ3A 1BF2A 2Y7FA 3CZKA 3FA4A 3DFQA 5AHNA 2NXHA 4QG9A 1J01A 3N6HA 1XYBA 4QP0A 2ZWZA 4IJCA 1TJPA 3V5FA 2QXWA 1KNWA 2OYMA 3SEPA 4IG2A 2BDQA 3BSHA 2KX9A 2V8ZA 1S1RA 1WKYA 4AIOA 1VR6A 4MB4A 5BCAA 2Y8UA 4YTSA 4M51A 1GW1A 2HNEA 5I77A 4HHPA 1R7AA 2WHJA 4HMCA 4AZBA 1X7IA 2QCHA 2TAAA 3B9NA 3VOFA 2DV0A 1WE5A 1PZ3A 2PDNA 1DOSA 3VIFA 1NH6A 4NZ3A 4Q8UA 4ICCX 4JIRA 4QQ3A 3RX3A 1NP0A 2E9BA 1AK5A 3VM5A 2WM1A 2HCVA 1JYVA 1OD8A 2P0OA 1Q6GA 4J4KA 3BLDA 1AD1A 3DBPA 2J9ZA 3M7SA 3U2OA 2R91A 4OECA 2GPTA 3PBMA 4L1XA 3BGGA 4H9VA 4MMWA 2GUYA 3W7LA 1S39A 2Q8ZA 2TPSA 1LG2A 1YDOA 3HJZA 4K6AA 1EC8A 2J88A 3QFWA 2A6NA 4C6FA 3AO0A 3WF1A 3HU7A 2A7RA 4H6KA 1ONXA 3NM3A 3SFWA 2ZUSA 5HQEA 2YA2A 2CCRA 3PNZA 1JI2A 4JDYA 1IEXA 3UWYA 4HZ6A 1XRTA 4ZA0A 4HB7A 3TROA 4POCA 4P8VA 3OHMB 4KIRA 2FVMA 1XYZA 3AMCA 3CUIA 1YTKA 3GM8A 3T55A 4BF5A 2E77A 5FJRA 4LT9A 3WQOA 3TYEA 1QU4A 3DYOA 3UY7A 4JCMA 4M3PA 3TLQA 3L4YA 2WMIA 1TWWA 3M0YA 2FZMA 1RPXA 4ZBCA 1OT1A 1XYMA 5K9CA 1VH7A 1UH4A 4XUYA 4Z0JA 4DELA 2QCNA 3BCDA 5CSSA 2XSXA 1JPDX 4FR6A 3V18A 1HF6A 3V3WA 4HBKA 2D0FA 4REQA 3CAVA 5BXSA 4CN1A 1PPIA 1QI5A 1B4KA 1IYXA 3GVGA 1FWAC 3IUHA 1SZRA 2PF0A 2A0NA 2WCSA 1UC5A 2ZTJA 3WNLA 4A3RA 4CU8A 4FK9A 1Q6CA 1FX6A 4EAMA 4HOZA 1T6MA 3O06A 1VENA 3BE7A 4A3YA 1OK4A 3IJQA 4XD6A 1E6PA 5D9MA 4H6QA 1KFJA 2CBJA 3OZOA 3SCQA 4PMJA 4WDWA 3UJSA 4M8UA 3FIGA 1R3QA 3WMLA 3E38A 2J7EA 4QNWA 1EP2A 4DNHA 3WQPA 2JEQA 5AZ0A 3TYZA 2ZA2A 3FKKA 3C2OA 3SSZA 5D8ZA 1AODA 4L80A 4ENLA 3LZ5A 4DXVA 4MFDA 4PTXA 1L2QA 3W70A 4PB5A 2PB1A 3MCNA 2JK2A 4ATLA 2QJMA 3PY2A 2J7DA 4J5NA 1TV4A 3GH7A 3W0KA 1E0XA 1FWJC 1JGMA 1OHLA 3G0SA 4CCCA 2Z1XA 3ABZA 3KE0A 4JIQA 4MB5A 1RBAA 4GG9A 4IIDA 1X97A 2E5BA 3T0DA 5HMDA 1M03A 4GOAA 1PWMA 1IWPA 2XGZA 4OIFA 1EZ2A 3CGTA 4V1YA 3TJLA 1S2TA 1G69A 1X8FA 3CM4A 3VUSA 5C55A 4JL1A 1GW9A 3D5HA 1X96A 1XIGA 2YFOA 5CEWA 3WH6A 1KRBC 5KEZA 3WUEA 4YCOA 5ABHA 1OGBA 3T4WA 3WLIA 3WQEA 3OG2A 3B8VA 3LGGA 1XFCA 2WQDA 4PRWA 2GDUA 4I5XA 1PX4A 4BWLC 2PDXA 5BOEA 1C9DA 3ATYA 3OGRA 3AS3A 3S5SA 2SFPA 2FYMA 5EFFA 1KW1A 3NZQA 3H7VA 2CZVA 3CUHA 4E38A 3DGBA 3F4VA 4NZCA 2OR2A 4LQ1A 1W91A 1WBJA 2EXOA 1ZY9A 4Q7BA 3MI2A 3IRDA 5DELA 4IHCA 3KVKA 4H7CA 2FLIA 5A8NA 1DE5A 2QJJA 4JFSA 1XC4A 1FKXA 5I3HA 4PCNA 4PTDA 3OGSA 2BGSA 1YE6A 1CWYA 1AG1O 2O55A 5I0DA 2GLKA 1UKTA 3U4FA 4I7WA 3VMNA 3E3HA 1V6VA 3KP0A 3LCXA 1NAL1 1PUDA 1BWVA 3SCOA 2XIOA 4B3KA 2W61A 3VX0A 2B7NA 1UZHA 3IGSA 4JNZA 4A8RA 3SDOA 1ZP4A 3BK0A 1F05A 2JGYA 4GGBA 3CH0A 3T78A 4DHGA 2R1KA 3NZPA 4LY8A 4AZIA 3P84A 3OLGA 5T8GA 3MSRA 4GD0A 3NO1A 4K7VA 1Z3NA 1LP6A 5H91A 2WSKA 3M43A 1AL7A 1W1TA 3EEZA 1PXGA 3TV8A 1BHGA 3TLLA 3GRIA 5CQ1A 3OYXA 5DY3A 3EB2A 4MJ4A 4QHRA 2F7FA 2PDUA 1Q6FA 2HK0A 2YDSA 5FJIA 1PZ0A 5HDRA 1XKJA 4KCUA 3VX1A 1E73M 1KFLA 4RL3A 1UG6A 4FB7A 5CXPA 5AN7A 4R9XA 5DBUA 5FL0A 1DTUA 4C65A 5A8GA 3RNDA 3A5FA 3UWVA 4ERGA 1OM0A 1BGGA 1TX2A 3NQEA 1BKHA 1WKDA 2QZRA 1CXKA 1IHIA 2V3GA 4JHOA 2YYUA 5MKGA 3AZRA 4LXFA 1OG0A 2JF6A 2Z7GA 4LNCA 2HVOA 2QJGA 4DBDA 1A50A 3BDKA 4PMOA 4L65A 1G4EA 2PWEA 1FBAA 2OELA 1GZ1A 2HISA 4JIPA 2BSLA 4H9ZA 1HT6A 4AU0A 2YCIX 4UFHA 2QR6A 5G1MA 4GBUA 3EWWA 1HZYA 3P0XA 3WELA 2DZPA 1XLKA 2PCEA 4GACA 3MANA 1XSIA 3BAWA 2YPIA 1D2KA 2WPGA 2XFYA 3UPWA 3ZT5A 1J6OA 3P5YA 3B8UA 4H9YA 2ACUA 3H4WA 5D30A 4AXNA 3G1SA 1WAUA 1MNZA 1R2SA 3L0GA 3TW6A 4XO6A 1QPRA 4JYDA 1V93A 3MWCA 1GJUA 3VM7A 3B4UA 1Q5MA 1S5VA 3PS7A 1F3EA 1JPHA 4GI9A 3LYEA 1EJWC 2A85A 5A6TC 4MF4A 3P80A 3BLIA 4HOXA 4B5VA 1A49A 3S1VA 2AGTA 4RNFA 1ZJAA 1NM9A 2E6FA 4ZE5A 3CZGA 1KM3A 1MQRA 4M19A 4GKTA 1XISA 3VINA 1E1CA 4LUSB 1NF0A 3VD4A 1LLWA 3POCA 2W5FA 1YXDA 5FF2A 2E1WA 1XIHA 1MQQA 3R4IA 4AD5A 4AUBA 2FVLA 4AX7A 2A4AA 3OBAA 4D9PA 4L64A 1Q6EA 6CGTA 2HZGA 1R9YA 4OV4A 4W5ZA 3C8FA 1ONWA 1TELA 5DCBA 2EPHA 3SCSA 3OLDA 2ACQA 1ZJBA 2VT0A 1WDQA 4AD3A 3UEQA 2OCZA 3UZXA 2HSAA 4N6EA 1WXJA 3TQKA 2OLAA 1SVDA 4CNOA 2Q6ZA 3D47A 1KCZA 1FHLA 1SO5A 1BQCA 1HN1A 1TE1A 4B3LA 1Z69A 2OWCA 2GSEA 2H9AA 2QAFA 1HKIA 1TWSA 2QF8A 4N4PA 3EWDA 4S3FA 1D8WA 1XW8A 4A29A 3WNNA 1ZLPA 3FEQA 3WIJA 1R47A 1CX9A 3G1YA 4S3DA 3ZO9A 5CSRA 1TMHA 1K8ZA 3PB2A 3V1PA 4PMYA 2E68A 7PTDA 2C19A 1QNQA 2AL2B 4CGTA 4MWAB 2HV5A 3FAWA 1OC7A 3WSUA 1Q4NX 2YA1A 3CUXA 4RE4A 3BV7A 2GJLA 1UHVA 4LCRA 3URBA 3AS2A 1MYRA 5ENLA 4DJFA 3I4EA 4GVHA 2NX3A 3FLUA 1FTXA 1ZPTA 3WLNA 3TYCA 3FA5A 1SJAA 1YIXA 4GZ7A 4LUJA 5EMLA 1VFFA 4HPHA 1W1ZA 1FCVA 4PL1A 1O5XA 3TFXA 3O6YX 1P1XA 4LS1A 4Z1CA 5A5WA 3LQGA 1FKWA 5A8QA 1TV7A 3BLPX 4O57A 3W7EA 4C7FA 7TIMA 3QGKC 1GONA 4UTTA 3KOZA 1JIBA 4E2BA 4ATDA 1O12A 1Z6KA 2O4MA 3HO8A 1E43A 1XG3A 4YPJA 3UGRA 1TPDA 1EJSC 3EXRA 1RJRA 4LW7A 4QQUA 4AB4A 3SW6A 3QBUA 4R9OA 2POZA 3NQ7A 1EBGA 1FHUA 3B8DA 4OKDA 2BVDA 3KOWA 2Y4SA 3R11A 4MY8A 4NAFB 3ITGA 3AXKA 3GVQA 1VYSX 1VPXA 1MDRA 4E2OA 2QF7A 3EA1A 2DJXA 1LWJA 2CLHA 3OLIA 1Q2RA 4HN4A 3W75A 1IGWA 3N11A 1TQJA 3NG3A 3VD3A 1I8JA 1SMAA 4W4QA 2V0TA 1TV8A 4Y96A 4FXSA 1G4PA 4R3UA 4B5NA 3FYYA 1J0YA 3ARQA 3QJAA 2ZIDA 5TIMA 2GVJA 1HL2A 5J5DA 2WHLA 2E4TA 1ALDA 4KMQA 4QCEA 2VZVA 2OJPA 2WZTA 4LUTA 4HNUA 2OX4A 1VBGA 2I9UA 2BOEX 3N9KA 1P6WA 1DXIA 3L0NA 4PEKA 3E2QA 4GO8A 3TYAA 1JZ3A 3EX4A 4B5XA 3TDFA 4C91A 3THQA 4TU1A 4S3CA 5D02A 1UPPA 4WRHA 1TV3A 3IGUA 5BRBA 3A47A 4C1NA 4FP1A 1CTNA 2GVYA 1ZUAX 4F4RA 3LRMA 1O7AA 1FXPA 3PK7A 5HA7A 2J13A 2DUZA 2YXGA 4QE5A 5FJJA 1XLCA 4FIQA 3WBXA 4MZ8A 2I14A 1GVYA 1QWKA 4RCXA 4FS9A 1PSCA 3GDBA 3LTSA 4R33A 1R86A 3PG8A 1TMLA 3I6TA 3OQ8A 1G5AA 4PTMA 1MO0A 1OY0A 3H55A 4KCTA 5CZJA 1SJDA 3H21A 4D6EA 1KFKA 3IIVA 4GZIA 1R9ZA 3APYA 5LHEA 1K7FA 2YXXA 2FHFA 5TNVA 4A05A 1TPH1 4GY1A 4YVVA 2WVVB 4UQCA 4O0QA 3VIHA 4DM1A 3RO8A 3W82A 1QTWA 3MI3A 4QIUA 1ZQ5A 4GABA 3GDMA 3WDQA 5DMNA 2C7FA 5JIPA 3LV6A 3AHTA 4E3VA 4WF7A 3RM4A 2OGYA 2BVYA 4FXJA 3K13A 4K8EA 3SUWA 2OQLA 3M9YA 1KM5A 3GDLA 4WKAA 1PE1A 1UIOA 1NQ6A 3HGRA 7ENLA 3R10A 2PWGA 4JL2A 2VGBA 1DWGM 4XB3A 2TRSA 4J3ZA 1P0KA 3HOJA 3M0JA 3W2UA 4S3JA 4RDYA 2NV1A 1W5NA 3IACA 4C6JA 3IEBA 3KXQA 3L4ZA 3SCVA 4ZODA 3W38A 3KRBA 3WJXA 1B2YA 1HP5A 4UOZA 5I6SA 3TMLA 2B7OA 3G1DA 4NNAA 2IKGA 2PI6A 3LG3A 2YL6A 1DJGA 3GSMA 1J5SA 2Z2BA 3PZVA 4C6PA 2C79A 3POHA 1S5TA 3TVAA 3PPGA 4J40A 3M0LA 1H7XA 2W62A 4HCDA 3LI1A 3V16A 2BXYA 1HG3A 4RX0A 4GIEA 4XZHA 2BOFX 4X63A 4O10A 5HBFA 5EKYA 4JR5A 3WMSA 4BA0A 3CUJA 2D0GA 3ZFHA 4BR1A 4EE9A 3PJUA 1REQA 4L9XA 3WMBA 4OQVA 3TA9A 4FAMA 4QJ3B 3N2TA 3WLRA 3REQB 2CLMA 2OKOA 5GNXA 3CAQA 2A79A 1KLZA 2Q8XA 3K2GA 4OZOA 2V5BA 4BI5A 4XAFA 4W87A 2CIPA 4R7JA 3L5AA 1LF1A 3A23A 1TG7A 3V35A 1R3SA 3NZRA 3W37A 4GQGA 3EDFA 3MHGA 1E0UA 4PUMA 1US0A 1K03A 3OOQA 2OZ0A 3VD7A 4LF2A 3O63A 3TN3A 3IIOA 1RJPA 3GXDA 3TTYA 3U8GA 4XIMA 4M29A 4AEEA 3ARYA 1NOWA 3VIJA 3GVRA 2PP3A 3GKFA 4MTVA 3LBCA 4JTHA 1H7PA 5JXQA 4AMCA 2C1HA 3GDTA 1R0MA 5LA0A 2ZA3A 2X1RA 4ZXOA 3MVTA 1KQYA 2I5IA 3PR2A 4EPEC 1XYCA 3UZYA 3DGRA 2R1LA 3P5ZA 2DGAA 3K46A 2HPIA 2GJXA 2Z1SA 3G6MA 4IQEA 1R30A 3GW3A 1J11A 5I00A 4UNLA 3KDOA 2RAGA 4JFWA 1LOLA 1W9DM 4TIMA 2VCBA 1E6SM 1FWTA 1HUVA 1EJRC 4JN6A 4LYPA 3EOOA 4IISA 2BWGA 3GXPA 2CYGA 3ZR6A 5C9WA 1CB7B 3PWGA 1BYDA 1Q6QA 4Q4SA 3RITA 4TR9A 2HDJA 1LROA 2CBIA 3AIVA 2CU0A 4JTGA 3GAKA 1CGTA 5FAJA 2VGGA 3B40A 3VFCA 1EC9A 2O7SA 3T2QA 1KCLA 1GYNA 1DWJM 1JPMA 1VQTA 3EMZA 4HTBA 4EOUA 1GZJA 1AUSL 5J04A 2E3ZA 2ZDSA 1Y65A 3XIMA 1XBXA 1DIOA 2DZWA 3IUDA 4LRSA 1EXPA 1GYLA 4XAGA 4AIEA 4AD0A 5HR6A 4DJDA 4BQ2A 2QIWA 4JX5A 3RJYA 4EX4A 3VC6A 2CZ5A 3IJLA 1E4NA 3P3BA 3UZZA 5E93A 1E5NA 1H7WA 2Q09A 4ZOBA 2XGIA 4TO8A 4ZSUA 4F8XA 3K4DA 3IV3A 3LA4A 2DU2A 2OODA 1M7XA 2QULA 3AIQA 3LZ3A 3ITYA 1YNPA 4OOUA 4M80A 2E6DA 1ZFJA 3LCGA 3BLLA 4ZOAA 4CNUA 5C7HA 4J3WA 4JIHA 1AZ2A 3QVQA 1I60A 1BYCA 4IICA 3NOEA 3B3DA 4HPXA 1W1PA 1Q6OA 3GNXA 5LSMA 1DIDA 1AA1B 1YPIA 5LNUA 2EHHA 3H2EA 4PFMA 1I0DA 1QNRA 1QUMA 2CLKA 4KFNA 2GL5A 2HPMA 1XLJA 1VP5A 4HZ8A 4ZQCA 1XH0A 3URQA 1WDDA 2ZCGA 3QGAC 3M6DA 4O15A 3T1GA 3QY7A 3M16A 3DCPA 1NJJA 3KRUA 3W88A 1SZFA 2ZXBA 3H2AA 1UWTA 1XICA 4DZAA 5JVLA 3E49A 2AAMA 3R13A 3RYSA 4AD4A 3TTEA 2WCAA 3NL2A 2WPBA 5FJUA 1ONRA 1J93A 5BWAA 3GXIA 3ABOA 1E15A 2A3HA 3NTYA 2OZTA 3NPUA 1VBHA 3PTDA 3S9ZA 3KZPA 1GGOA 4O8RA 4W8AA 3TE9A 1VS1A 1PAMA 4KWVA 3RUBL 2VRKA 4JHZA 3TU9A 3R7MA 1AH3A 4Q8WA 1X38A 3SY1A 3M4HA 3BAIA 4C1KA 3A21A 1DVJA 4HNOA 4NKCA 3E0IA 2PTWA 2QDGA 1XKYA 1TQXA 4AHQA 2PDBA 3IJ9A 1AZ1A 4S3KA 1YDNA 5JU6A 4WGHA 4DO7A 1AW2A 4BF7A 1ICPA 5DMMA 1D8CA 1UZ4A 4EXBA 3AIBA 1NIUA 1KXVA 1V3KA 3ID7A 3RR1A 1ISZA 1P7TB 4U28A 2YLAA 7TAAA 4JYEA 2CWNA 3W72A 4H4IA 3FXGA 1A5NC 1I0BA 3T42A 1NFGA 5IBXA 5F1UA 2Y0FA 3VKKA 3NZGA 4WXYA 3T81A 4JNYA 1HJUA 4L4MA 1XLBA 3FN9A 4W7WA 1RZMA 2QV5A 8CGTA 4ADSA 2V82A 3CHVA 4KFPA 4Q8VA 4ML4A 1GG0A 2OO6A 4L7ZA 3W7KA 3ABXA 1LQAA 5CSYA 4TV6A 3V4BA 2ZZ6A 1K7EA 1W6TA 4XG1A 3KWSA 2PWDA 1GEQA 1ZALA 5DCEA 4ACYA 5I3JA 3EDJA 4QJ4B 2C0HA 5HR7A 2BNJA 3IPWA 5A95A 2V5DA 1RH9A 4RDWA 1EPXA 4M1RA 1G4TA 1HXJA 3TC6A 1XFBA 3LEPA 1QHPA 2VXNA 3G5EA 4FNSA 1IT8A 3FOKA 2QS8A 3G0XA 3S3GA 3HG5A 3SJ3A 3N15A 1ENUA 1A5AA 3NOYA 5B80A 3JUGA 5KETA 1DXEA 5I3FA 3KLKA 3S46A 4IIFA 3WK3A 3ZT6A 5GJMA 1F07A 1R85A 4XAYA 3WLOA 1M68A 1LBFA 3A4WA 1OX4B 2GFTA 3GIYA 3W29A 5E9XA 1ZAIA 4GVIA 4IMFA 2ACRA 2YBUA 4DZIA 1QMLA 3P74A 3QLDA 1L6GA 3BUVA 1YXCA 3RAOA 4QJ1A 4W93A 1GZGA 1DPMA 2WMFA 3VTRA 2C6QA 2DSZA 4BI7A 2C3ZA 3LXAA 3CB3A 2QCEA 3TYUA 3R0DA 3NNTA 4Z0SA 2IPWA 4OBRA 5G4WA 3SRFA 5D2XA 3VU2A 4GQQA 2WJFA 1GTHA 4S38A 2PDGA 3EWZA 4ERAA 1H41A 2DZVA 3NJ3A 5HXMA 3R94A 8XIAA 3NUKA 4WD0A 4GO9A 1UW9A 2WSYA 2GSJA 3CQ0A 3Q58A 1Q6RA 3U2ZA 1GKRA 3CU2A 3QV6A 2OSYA 3D6NA 2G37A 3WH5A 1LRNA 2O7QA 1WB0A 4A8IA 1KKOA 2WWDA 1L8PA 4F9DA 3A3HA 1UBPC 3VDCA 1J9YA 3A5VA 1PKLA 1X39A 1VJZA 1XIMA 2Y6ZA 1IWBA 2ZRZA 3VIKA 1JD9A 3KL5A 2YL5A 2WNWA 1DWAM 3LSBA 3QHMA 1AMKA 3SM0A 5DO8A 5IDZA 3R1ZA 3EXSA 1H0GA 1J4EA 7ODCA 1J79A 4TX6A 4BHYA 2OPJA 3CLWA 3H2FA 4ZZ9A 2PEVA 3UPMA 4F48A 1M41A 3VABA 1ME8A 2D0HA 2REQA 1U5HA 1DJHA 3L66A 2H90A 1T41A 3B8SA 3OEXA 4GFIA 3GO2A 4JX4A 1D3GA 4CUCA 3UNTA 3C2RA 3RDKA 1BVZA 3E2SA 3RLGA 2CKSA 2X0YA 3QY8A 4UQDA 3MO4A 5CZSA 1Q63A 1R7OA 3SI9A 1H2JA 2JEPA 4AG0A 1OG6A 2MNRA 4P7LA 1EEPA 3FAXA 3ZOAA 3L23A 1OFQA 2W6RA 3S5YA 1BVWA 3V0TA 4J3VA 3ZYZA 1CLXA 3THCA 2VRJA 1OCJA 3W7DA 3UVAA 1JUEA 3W71A 3TNBA 2ATMA 2VMFA 1TTQA 1R3VA 3VOGA 3RPTA 1RY0A 3DKLA 1IEIA 4LEQA 4XTIA 3A12A 1W1IE 4US5D 3H2OA 1JDEA 3DFPA 1ZJHA 4MWAC 4H6RA 2QCGA 3LCLA 3EWUA 4UTWA 4IPJA 3RU6A 4DBEA 3S83A 3UR5A 1A3WA 3B9DA 3WLSA 3W76A 3W2JA 3T07A 5TBOA 1ZAJA 3UXAA 2PFHA 3L68A 4RXFA 4RUBA 4PCTA 4NI3A 3MSYA 3AZSA 4G5DA 2DSVA 2CEQA 2XIQA 5JQ9A 2WBKA 8TIMA 4YTUA 5E5CA 1OJXA 1Q13A 3WL1A 1XP3A 4W84A 3KVJA 3WF4A 3UWQA 4C7DA 1NELA 4MNJA 2VGFA 2PDPA 2HTMA 2OZ8A 4IPLA 2Y5JA 1V3IA 5HWJA 2R9RA 4R34A 1IGSA 3U3HA 3DDMA 5C2GA 4BKNA 5I06A 3IK2A 4MLRA 2OB3A 9RUBA 4ILSA 3QW3A 3HV9A 2IPGA 3MP3A 1QO5A 5AC4A 4O4WA 3PPCA 2Z2UA 1JQVA 5HMSA 2VZSA 3W2NA 2J6VA 4HHMA 1G7VA 3E5PA 3WX7A 4LYRA 3RF9A 2WC7A 1GOOA 1XIJA 1XLIA 3OTRA 2WAGA 2PDFA 3CEPA 2HJPA 3K8MA 2DUXA 3LY0A 4AZCA 3T7VA 4R5EA 1YEYA 2NXGA 3KTXA 4PBGA 4O12A 2BXVA 3R8HA 5I78A 3USZA 2FPTA 3VIOA 1OX6A 2J4GA 5G1YA 1YNYA 1V0LA 1UUOA 4YWIA 1Q7ZA 4R85A 1QNSA 1PZ2A 3IANA 4L4OA 2VUNA 4JZ5A 1HL9A 2J7HA 3WF3A 5HUPA 4DX3A 2QV4A 1JFXA 1V6YA 3ENLA 1BTCA 2D2OA 4Y8FA 3TKFA 1F3TA 3N9RA 4M81A 4AD1A 1FUYA 1HQTA 3GU1A 4LVGA 3WD2A 2P5NA 1X6NA 3WENA 2BMBA 2EJ1A 1M1BA 4B90A 3HA1A 2EEXA 3W1TA 4UQ9A 1AH0A 3HM7A 4PL2A 4IMEA 1QW9A 3RRAA 3GFXA 5U4NA 3UXDA 3SECA 4CD4A 1XR2A 2F9RA 1Y5XA 3V7PA 2Y70A 1HKJA 1PCKA 4MG4A 1KM4A 3HG3A 1AQHA 2VTFA 3NWRA 4F0SA 1UWSA 4N2YA 2Y62A 4HU3A 3LXCA 4GQ0A 4TMBA 3B8TA 3W23A 3TOYA 2Z1VA 3CBWA 1VEPA 6ENLA 3A3XA 3STFA 1NFPA 3C2FA 4ACZA 1WO2A 3WQ6A 1OF6A 1KO0A 3FGCA 2X09A 4A21A 1PVNA 4E4UA 5CKSA 3DESA 1JZ6A 1F74A 3BLEA 3GK0A 3EDDA 3MKCA 2Z2AA 3SCRA 4LVFA 1M04A 1OFAA 3DFSA 5CPOA 1G7UA 5A6KA 4MDPA 1E3XA 2IQDA 3WDRA 1PB0A 3NPVA 1A5UA 3UA3A 1W3IA 1F5ZA 3USBA 4Y9PA 3EB4A 4Q33A 1ZJIA 3FX4A 4GIAA 3IVTA 3C4UA 3UY8A 5CPTA 3W7CA 4XBSA 3VMPA 4IG2B 2XVGA 4GHRA 4N9BA 5F1VA 3GG7A 3MYPA 4M0XA 3UJ2A 4GJ1A 4CVWA 4DXXA 1QASA 3G24A 4UTIA 1M5WA 5LZLA 1B4EA 4Q8TA 1CENA 2EPKX 1FHDA 3QF0A 2VDGA 1MXDA 3KS6A 1BRLA 5TD4A 1MRAA 2I57A 2FZNA 4Z2KA 1CYGA 2DZXA 2AMGA 3QMSA 1XL9A 2ISSA 4XUGA 3PZUA 2OYKA 1N82A 4NVTA 1HGYA 4IIBA 1ITXA 3MI6A 4UCFA 3LTYA 3LM7A 3S2CA 1E51A 3PM6A 4PE8A 1XDMA 1U5VA 4I9MA 1JRCA 3UJRA 3DZ1A 1DQWA 3CQHA 4Q32A 3VGFA 1VHCA 3ITVA 3CZLA 4QE4A 4P7OA 4B5WA 4QISA 3I7SA 1P43A 1RQEA 3GUWA 1OFDA 3TC7A 1UJQA 5REQA 3AJXA 4QEHA 3N73A 4EF8A 4CNTA 2X40A 2INEA 3LM3A 2QT3A 4EIVA 2VFFA 1ICQA 4PA8A 1HX0A 2PDLA 1MFUA 2PRHA 4GY0A 2PODA 3G77A 3QR0A 2AGKA 3W7IA 2E5DA 4G7EA 4B4HA 4MM1A 4IOTA 1PZ1A 3IJIA 1YPFA 1BWKA 3BG3A 3LMZA 3PBGA 1RCQA 5CBIA 1WZMA 1F6KA 3KBNA 5DRIA 3UF9A 3MDWA 3MMDA 1ZGDA 4Q8NA 5E0KA 4D6IA 4EP8C 2PDHA 3OPSA 2WMGA 4HNTA 3TR9A 1RSCA 1I2QA 4I9TA 4UBPC 1J2BA 1MUWA 1EB3A 2VQUA 3A6OA 1H50A 2B31A 2YR1A 3GR7A 1AW1A 3MY9A 1PX8A 3BL3A 4H9XA 1QI2A 2O9PA 5CAHA 4DUXA 1B3XA 2GUBA 1EO5A 4X60A 1YNQA 2XWEA 1XCXA 4IGMA 4IX2A 5HAOA 4NZ4A 4C6EA 2DVXA 1T7LA 1VJSA 2NX1A 1CXEA 4DYEA 2HBVA 3PZTA 2ISDA 1EUAA 2RDWA 2XN0A 4PUDA 1XD0A 4F2BA 9XIAA 3EWBX 4CQBA 3Q4DA 2WYSA 4UMAA 5E9AA 3SR7A 1O68A 3SQLA 4TVUA 1W3KA 2QDDA 5K7JA 2CITA 1NQKA 1L6FA 3KCJA 2NVAA 1KD0A 2V3EA 1M7PA 1KGXA 4K7YA 3OIXA 2AQVA 2VDHA 4BQ4A 1BTMA 4FO4A 1PYMA 3TSDA 4EWND 3C61A 4QROA 2GGJA 3ZIZA 5CZ0A 5BU9A 3OA5A 2Y61A 3R89A 2Q3OA 2FVKA 3NZ1A 4G9PA 1MZRA 4LRTA 3BQ5A 3PTMA 5FF3A 2V5KA 3PWAA 4MNKA 5IDIA 3GYEA 4M6VA 3QKEA 4DAIA 4AWSA 4U4MA 4OJYA 1LBLA 2BGQA 3LU2A 1A80A 4J35A 4B5SA 3EMCA 2G50A 3TSMA 5AHFA 2AKMA 2WMHA 2IQ0A 3RMJA 1JCYA 2TMDA 1EOMA 3GB6A 1TE6A 1FWRA 4XD3A 1VYRA 1FY6A 2VX4A 1FRBA 4QX4A 3M5XA 3LHWA 1YRRA 5AOUA 5C9ZA 2X2GA 1KR0A 4DF0A 5A69A 1MMFA 4KRUA 1KM6A 1NDYA 2PLKA 3MQTA 1PHWA 4TV5A 4IL2A 4LVDA 3M44A 3BO9A 3T4CA 1O5KA 3W73A 1TTPA 4P8WA 3UBPC 2ZVRA 3GTIA 4NZ1A 2EPOA 4FX8A 3UERA 4PCPA 4H1ZA 1WXYA 2OSXA 4DPQA 3PVFA 3S5OA 1KTBA 3VI2A 3W7RA 4MPQA 4X0NA 3TQPA 3ABQA 4KCWA 3RPDA 3GTFA 3C56A 4KGLA 3ZLGA 3H54A 3TK7A 3NPXA 2FFIA 3DFTA 1JDFA 2ZC8A 2XN1A 4GZEA 2V2HA 5DXXA 3F4NA 1ZTVA 2ZRUA 4DJEA 1XCWA 2PDYA 1OINA 3STCA 2FFCA 4LANA 1AJ0A 5BYWA 4Y9AA 3RILA 5A6BD 4HN8A 1OZMA 4FA3A 1IWAA 1YTEA 1ZCOA 3P7YA 2XUCA 3MSGA 4BI6A 2PS2A 4B2DA 4NG3A 1OADA 1K9TA 3TW9A 4MWAD 2XVNA 3QHNA 2ZC1A 2VKZG 4O0KA 4B4FA 1GVEA 3F2DA 4UFIA 2G4FA 4KT2A 1RD6A 1A3HA 3WQ8A 1Q8JA 1DEDA 1DJXA 1GTEA 1EDTA 3MKVA 4IQLA 3FJNA 1EHAA 3S2NA 1B1YA 4Q4KA 5KSWA 3BSGA 1FOBA 3ZQ9A 3TOPA 3HFTA 5MKGB 2Q3RA 4LYKA 3SSJA 2IKIA 4MAZA 1NDWA 5D03A 4CD8A 5TQLA 2VC5A 3NQVA 3UW6A 1XGEA 3T2PA 3IJ7A 1QBBA 4O4VA 4RZ5A 3LDVA 4JQ3A 3MVIA 1ME9A 3EB3A 1TCMA 4HU4A 3CQIA 1TB3A 3E5BA 3PBWA 3W22A 5LIWX 1EX1A 3B0UX 1XGZA 4CN4A 2XIJA 3U5YA 3WCZA 2DSWA 2YL9A 2JGQA 4KWSA 5D33A 1KXQA 2A1YA 3DYPA 1KLYA 4GCXA 2A3AA 4QAIA 4OT7A 4DWSA 1LM1A 5KITA 1N8FA 1AFSA 5C9XA 1EJUC 1IEWA 2CETA 4Z2JA 3F5JA 1PJ9A 3G1AA 1QOXA 3KWXA 1W0MA 5M2FX 3FYOA 1CGUA 3ELFA 2OFJA 2OLHA 2XN2A 5LGZA 1US2A 1PIFA 4LUYA 4QAWA 5G2HA 1QOPA 1LOQA 3DBNA 3II1A 1X7FA 2XIIA 4M6PA 2OT0A 2PDMA 1FWEC 5CGQA 4WDXA 4NU7A 5EMJA 4L56A 5I79A 7XIMA 3UA4A 3B05A 3CMGA 3WBAA 3NYZA 2ZZ5A 4ZEPA 2Z24A 1GKPA 4NZJA 1K9EA 3GTHA 2VZUA 4LTSA 3QW4B 3OZMA 4MVAA 1E1CB 2ZX6A 4NJKA 2VEIA 2ZZ4A 2C18A 3FJ6A 4IT1A 4GPNA 1PCWA 1TJ0A 1A5SA 4HCLA 5CH9A 4ZGYA 1H5YA 4CNNA 4MOZA 1R3YA 1VFUA 4NYUA 4Q8MA 3C86A 2DT3A 4N7QA 2OQYA 2ACSA 5C70A 1UQYA 3EBVA 5HJXA 1FWBC 4QSHA 3K8LA 3BCJA 3P8JA 3I4KA 3E0LA 1EDGA 5G1TA 1BKSA 3S4TA 4JD4A 1GPWA 2RJGA 4LOCA 1ADDA 3I7QA 1A53A 3FA3A 1OVDA 4Y9NA 4XVDA 3BLFA 3W02A 3B4YA 2RH9A 3FS2A 1R46A 3B9EA 3D3FA 1RA5A 5BOOA 3UR2A 2XH7A 4LBUA 4PMQA 3BMVA 4QRNA 5I7GA 1SU5A 1GQNA 4HYWA 2ZX9A 5IFPA 3VGDA 4GUJA 2Q01A 3VAVA 1UD3A 3WJWA 1IZCA 2A6LA 2QW5A 4U2ZA 1EDQA 1TV2A 3L12A 1UD5A 4C6QA 2ZQ0A 4OWGA 2OWXA 4MKVA 4OHQA 3UR8A 1DORA 3NM1A 3LENA 1G9HA 2YIHA 3TR2A 2VX7A 2AQWA 3R79A 3WN6A 1PKNA 3AYRA 5I03A 4U10A 1W5PA 3CB8A 3M0XA 2WBGA 3G0UA 3W87A 1F3XA 4KGJA 3KZSA 2IXUA 4D6HA 2LLEA 4AZ5A 1MWOA 2NQHA 1XYAA 2QCFA 1VFMA 4PMZA 4FOKA 4H2CA 1VRXA 2ZFAA 1ISWA 4W5UA 4AEOA 3GU9A 4AWEA 2W79A 3ORWA 1BG4A 3PN8A 4KS0A 1MUCA 3IIPA 3RR4A 5JUVA 1QI0A 1VCGA 5CG7A 1ZHAA 4S3GA 3DEQA 3E0WA 5A8OA 3JZUA 4S23A 1KBLA 2HS6A 4O16A 1KRMA 3V1HA 5A2AA 4DYKA 5E6YA 3IAPA 1M53A 1MW0A 1X1OA 4UTUA 1UBSA 2R6OA 1KM2A 4Y7EA 1UUQA 1SZNA 1Z89A 2VX6A 2GQ8A 4WZHA 5SWUA 1IZKA 2BASA 5D8WA 3LNPA 1UYQA 3KRSA 5EBUA 1XV8A 2R94A 3MUY1 1SFLA 1GOIA 1JUKA 3CHFA 4A35A 3VO0A 2DIEA 1D7KA 4JICA 3WJSA 2J9XA 3SGGA 2PTDA 1P1MA 3SCTA 5BXRA 5F2MA 3F2BA 1CT5A 4AZHA 3CV2A 4LUTB 1V79A 5JH2A 1EFZA 4HPNA 3K5XA 1WZAA 3W3OA 3MO7A 1RQHA 5FA5A 1C8YA 4CQ8A 2X7WA 1VCVA 2HXTA 4JTKA 1HKKA 4U5IA 2WKGA 3QEZA 3S47A 3HG2A 4C6DA 2IQTA 3W00A 2A5HA 4C1NB 2HMCA 1NU5A 4HHHA 3T8QA 1O5QA 3PJWA 4Z2IA 3Q45A 4GA8A 4LAKA 1W9BM 3VOHA 4CEUC 4OV9A 5IHRA 5HPCA 1E9YB 3B9AA 3RM9A 1PL9A 2V5CA 8XIMA 1E0TA 4PMXA 3VKCA 4E2VA 2C0AA 3QR3A 3FEMA 2NUYA 4O13A 4HYVA 2FMNA 3MWAA 1BAGA 1P6BA 1JYWA 3MA8A 1K7XA 1JAEA 1TR1A 4DRSA 1XS2A 1PO9A 1SMDA 4DBUA 4XD5A 3PBVA 3W85A 2VEPA 2ZVIA 2ABAA 1VAHA 3UYCA 3DC8A 1L6YA 4NHVA 2WJDA 3L0KA 5LNVA 4R53A 4GLEA 3GTXA 3LPOA 2ALDA 4JBRA 1KCXA 3TZFA 1DJIA 3G1XA 2VEGA 2W92A 4MJMA 3RCNA 4A3UA 5IFTA 1POKA 2A3BA 1EJVC 2DQWA 4JKKA 1X6UA 2F84A 2QJNA 4MHBA 4IP4A 2BXZA 1S1PA 3AZTA 3C3NA 3SCUA 3IGXA 3PFMA 2QVHA 4WR3A 1S5NA 2ZDRA 1ITUA 1DJQA 4QR6A 4LH8A 4XD4A 4QGCA 3QZEA 3FSUA 3IIXA 4NRSA 2QQ6A 5A8MA 1F8MA 3GC5A 3IWPA 2PMQA 2VELA 3GD6A 3SIMA 4EK7A 3UG4A 4D6DA 3WD4A 2PCQA 3A4AA 4IJBA 2EPLX 1XDLA 1JDCA 3PB0A 1B3ZA 2DZAA 3WLKX 2RKXA 2NLYA 2TODA 4IF2A 1JZ4A 4QLJA 5GVJA 1XJBA 3E2VA 1R9XA 1W3NA 1E40A 4EACA 2WZEA 4MYXA 4YL2A 4D71A 3EAUA 2PP0A 1UD4A 3R0KA 4JAWA 3DN5A 4UFMA 1MRQA 1ONEA 4D8AA 4G1NA 2O92A 4JN7A 5AHIA 4GI6A 3CPGA 2C1GA 1EA9C 4IFKA 3FDGA 4N02A 2CZEA 3MT1A 2PAJA 4NAFA 5C9UA 4HA3A 1XH2A 3NDZA 1OCBA 1W31A 4L1GA 3EPOA 3IK4A 2Z28A 1REQB 2IUZA 5CPLA 2YDQA 1TTIA 4WEVX 2DZUA 1PS9A 2NUXA 5FEXA 4E4FA 3TA6A 4DI9A 5D9NA 1F8IA 5A1AA 3W83A 3BAJA 2G4JA 2NQJA 1VLWA 1OX5A 4CCZA 1JCJA 4L5ZA 3U57A 2QKFA 1VIZA 2V3FA 2E6AA 1EYEA 1A4LA 1N8WA 3G8EA 3DFOA 2ADAA 3N04A 3VXGA 2X42A 2D2GA 5EMYA 4AIUA 1QJWA 4DXKA 5CLTA 4AHPA 2UY3A 1I9CB 1W1YA 1E1FA 1JYXA 4O1BA 1CGWA 2QLYA 3BCFA 2ZX8A 2QNEA 1GVFA 1UMLA 3B8WA 3FSTA 2A3LA 4IZGA 1JCXA 2EBNA 1P0NA 1MUMA 1YLVA 4QTGA 3OW1A 1Z44A 5U7SA 1UC4A 2WANA 5HQMA 4UNKA 1UP3A 1F9CA 4AF0A 2DZTA 1XINA 2E7FA 3R43A 3GZ3A 1TPEA 1H11A 1H4PA 1H1YA 1AQMA 1NF7A 3I68A 2DUAA 3THDA 2DQXA 5XIMA 3TMQA 4XAPA 5FOOA 4K36A 1XBZA 3BG9A 2OYLA 2PRMA 3ANUA 4WGXA 5BXTA 4UTJA 3WDHA 2D3NA 2OT1A 2WSPA 3KBMA 4WY0B 3N14A 3LQLA 2RDTA 3IJ8A 4S3EA 5DEZA 1KFBA 5AYXA 3ARWA 2ICSA 4XZNX 5T9CE 3SRKA 1NY1A 3EGJA 2NT1A 3HIJA 3IS4A 3FYPA 4RPQA 4AVNA 3UG5A 4IP7A 1SZEA 2O0TA 5I2UA 3B03A 3FVMA 4D2JA 3C0LA 4PBEA 4YHEA 3STGA 3W2LA 2VUYA 3KHJA 1UCWA 1XRFA 3O6AA 4TMCA 4NI8A 4X22A 1JDAA 3W7NA 4PB4A 3CWOX 3ARSA 3GVWA 3T08A 3SUVA 1QVBA 5GNZA 1HKMA 1VBUA 3H7RA 3EZ4A 1D3CA 2J66A 3H4XA 1J10A 1J0JA 1DL3A 3WNOA 2V68A 4PUJA 5A3HA 2OO0A 1I1WA 4NSBA 2YZRA 5FESA 1F7BA 3K1GA 3GAYA 2VQTA 1CGXA 1TX0A 1UA7A 2CXEA 3EEGA 5H1WA 3CZEA 4LEFA 2QJHA 3BARA 3ZR5A 4YYFA 3Q67A 3DIPA 1EHNA 1QI4A 4TOQA 3V0UA 1C7TA 4GXWA 1LBMA 4KEUA 5AYBA 1WOBA 5GNYA 3EX3A 1TIWA 1E4IA 3FW6A 5I5RA 1E6XM 1OGGA 3DHUA 4JQ1A 3CV6A 2PD9A 4WKHA 1DTNA 2NV2A 4WOQA 1UWIA 1GOQA 4GVGA 3AROA 1ME7A 2GWNA 3W24A 5LKYA 3TXZA 3C3UA 4JIEA 3UQNA 4LU0A 4QS6A 4U3CA 2HVMA 2RGMA 3TSBA 3OB8A 4GX9A 3AUOA 1YQ2A 2ZUUA 4DNMA 2E28A 2WJEA 3PUEA 3W1MA 4V15A 1RPKA 3A24A 4QS5A 5IRPA 1V3LA 3BVJA 4FZIA 3U48A 2DT1A 2WKLA 3ISIX 2EG6A 3XINA 1UWUA 4PEEA 4FNUA 4UIOA 1DP0A 1E9LA 4NZ5A 3WDPP 2QVNA 1QNVA 3AHZA 1Z41A 3N2XA 3CT7A 1DQUA 1RVGA 1Y0EA 2Y89A 3WBYA 3AJ7A 1C3FA 4H7ZA 1GQKA 4FXRA 1H0IA 5ABEA 3M6YA 1UUMA 1NWRA 4NJHA 3WQCA 1OQFA 3BOFA 2Y7GA 5FIPA 3H70A 4XO7A 4OOZA 3MMWA 3WLHA 4LB4A 4FHAA 5FD0A 3SBFA 3PZ9A 1KWKA 3MHUA 1NWTA 1PBGA 2BB0A 2IW0A 1J2WA 1ITCA 1QPNA 4V27A 4KFOA 5FJTA 5A6LA 2CHRA 1FA2A 4ZXLA 1K02A 4INFA 1DJZA 4ORMA 3CWNA 4IMCA 1R38A 5CG0A 5LIKX 2CFFA 3TCSA 1VFOA 5DX7A 5KZEA 1KXHA 3W26A 1EWDA 5AECA 3WUFA 1D9EA 4K2SA 3LGDA 1XIBA 3CZ8A 2XVPA 3B0PA 4QXIA 1RY8A 4QCFA 1SPQA 2YCLA 4E4PA 3RLHA 3UT0A 5BRQA 3MB9A 3GQYA 4LC6A 4U3AA 4X0VA 3LX9A 5BROA 1LWIA 3U5UA 4C6MA 4GWEA 2XHYA 3CL6A 2I56A 4GH1A 3GZAA 1B31A 2Y85A 2WZHA 1GVIA 2WZMA 1JEZA 3SCWA 2VENA 2QJIA 4FMVA 3GH5A 1ADOA 5G5IA 2QDHA 1HO4A 2G41A 1R3WA 1BEUA 2ZWYA 4EAYA 3LHZA 2XTKA 3W7GA 4QG6A 3QMTA 2G3MA 4PN2A 3P93A 1UH2A 3DI0A 1E4MM 3PULA 3RCYA 1UR8A 1NWSA 2FTPA 4UWMA 1TFVA 2OEJA 3W7PA 4F0LA 2VP8A 4LFYA 5DRCA 3NQBA 3R5EA 3M0IA 3CUFA 2QDEA 3QGVA 4IPIA 4EF9A 1XD1A 5HINA 3Q65A 3AIRA 2WV8A 1V3HA 3EYPA 5CPSA 5HPOA 1WBHA 2E40A 4C5YA 2YSWA 3WLQA 3CTLA 1G1YA 4GYJA 3EX2A 1UZDA 5JMUA 4MB1A 5A94A 1W9UA 3VILA 2JKAA 1A0DA 2D1ZA 5I24A 3LS9A 5LA1A 4YTRA 1H7RA 2IPFA 1OEPA 3KVLA 3AYVA 3AQUA 1EF3A 1H51A 3HJEA 2WMJA 4B9YA 4LVAA 3HMJG 3NEHA 4JN8A 2P0IA 4LCQA 1SGJA 4LS2A 1JF6A 3GC2A 3TUUA 2ZX5A 3UWZA 3W27A 3EWYA 3LK6A 1X1ZA 1AL8A 5HUOA 3TQ0A 1Z42A 3MZNA 3AOFA 4MB3A 3U2CA 3L4WA 3ERPA 1DBTA 2NWSA 3MBDA 3MU7A 1TPFA 1X98A 2E8ZA 1SR0A 2ZXAA 4J3TA 3M0VA 1SR9A 2QUMA 5DANA 5GQBA 2Q8LA 3W53A 3GG0A 4K8HA 1EXBA 2PTZA 2YKKA 4DIAA 1RAKA 3WUGA 5FJPA 4H01A 1GNXA 3Q94A 4H9UA 1E6ZA 2I9EA 3VIGA 3ARRA 1V0KA 2PZNA 1XI3A 2J27A 4YXGA 2VJXA 1ECQA 3S6OA 3CMJA 2F8QA 1M7JA 3NQAA 3VC5A 3PZNA 2CERA 3EOLA 5KZMA 1TPC1 2VFIA 1JPKA 1V0MA 4HMNA 1LOSA 3VGHA 3P6LA 3NQ8A 1TWIA 1XLFA 3KLLA 5HNNA 2ZE0A 3DKJA 2BS9A 1CB2A 1VFLA 2W91A 4IMAA 2REQB 3XISA 4EPKA 4KRZA 2ZZ7A 4RXGA 3ECQA 5CPNA 1C29A 1TPWA 1Y5WA 3WYZA 1GVSA 3ZS4A 5M03A 2YA0A 2WXDM 3W84A 4HKPA 4PBFA 2V30A 3N4AA 3AU2A 1L9WA 2VEFA 4NL1A 3LRKA 1XLLA 1KGUA 3SJNA 2VD9A 1VHNA 3CIWA 1SW7A 4CQAA 3VOIA 3OBKA 1UA3A 1ZB5A 3NDOA 5C2CA 5AKQA 3QYSA 2Z29A 2DVTA 1XQKA 1MZHA 3LCIA 3WEMA 4PFHA 3H2MA 4NXSA 2VOMA 3ABSA 3G18A 3V36A 1S2UA 3AIUA 1XGDA 1HJWA 3I3EA