2WWDA

3d-structure of the modular autolysin lytc from streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
432
structure length
432
Chain Sequence
NAAAYWDGDYYVKDDGSKAQSEWIFDNYYKAWFYINSDGRYSQNEWHGNYYLKSGGYMAQNEWIYDSNYKSWFYLKSDGAYAHQEWQLIGNKWYYFKKWGYMAKSQWQGSYFLNGQGAMIQNEWLYDPAYSAYFYLKSDGTYANQEWQKVGGKWYYFKKWGYMARNEWQGNYYLTGSGAMATDEVIMDGARYIFAASGELKEKKDLNVGWVHRDGKRYFFNNREEQVGTEHAKKIIDISEHNGRINDWKKVIDENEVDGVIVRLGYSGKEDKELAHNIKELNRLGIPYGVYLYTYAENETDAENDAKQTIELIKKYNMNLSYPIYYDVENWEYVNKSKRAPSDTDTWVKIINKYMDTMKQAGYQNVYVYSYRSLLQTRLKHPDILKHVNWVAAYTNALEWENPYYSGEKGWQYTSSEYMKGIQGRVDVSVWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights Into Pneumococcal Fratricide from the Crystal Structures of the Modular Killing Factor Lytc.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords 1,4-BETA-N-ACETYLMURAMIDASE
total genus 121
structure length 432
sequence length 432
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
A PF01473 CW_binding_1 Putative cell wall binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wwdA02
1CXEA 4FLOA 4RE4A 3NSNA 2JEPA 1KXVA 1PJ9A 4CN4A 2ZX9A 2EQDA 4AIEA 2RGMA 3WH7A 3CUJA 1AMYA 4X0NA 2TAAA 3RM4A 3W25A 2VURA 5D8ZA 4BZYA 4MAVA 1TMQA 2DIEA 4HTYA 4PMNA 5D9OA 1E43A 1HN1A 3QGVA 3VM5A 1ZBWA 1EQCA 4WIWA 5ABEA 2ZUSA 2PWFA 3ZR5A 4ACYA 2WHMA 4D6IA 3PTMA 1FP9A 4PMVA 2J47A 4NRSA 5HNNA 3T0BA 3GDBA 1R7AA 2DIJA 4EANA 3O6AA 1UKSA 2NSXA 1GHRA 4CKQA 3VDCA 1W3JA 1V02E 1JI1A 1G94A 1KXHA 3QHMA 3TTYA 4WK9A 4GIAA 2DT2A 4XZWA 3FW6A 3VD3A 4QCEA 1UR8A 3MUY1 1QI5A 2YA2A 1UKPA 1VFMA 1JI2A 2JIWA 1XV8A 2F8QA 3EDEA 1DWIM 3RJYA 3VIJA 2V3EA 2GVYA 3VPLA 3AXIA 5HXMA 3WF4A 4TUFA 4M1RA 4CU7A 1E4MM 2DT0A 3NJ3A 1TVPA 4H8HA 3T09A 1NP0A 2YBTA 1B3WA 3AROA 4PUEA 3UG3A 2CXGA 1SYTA 1XH0A 2W61A 2PC8A 1G9HA 4Z2GA 3BAKA 2VZSA 4B9ZA 2VCAA 1B3ZA 1HKKA 4QLKA 4OUEA 4PMOA 4AZ5A 4QLJA 1KGWA 1AQ0A 1GPFA 1H41A 2BFGA 3ZIZA 1CWYA 3VD9A 1JZ3A 1QOXA 4JFSA 4UFJA 2PWDA 3WNNA 2JALA 5CZKA 1D2KA 2G3JA 2UY3A 2VZVA 4MAZA 3UR7A 3CUIA 1EIBA 2WMIB 3MO4A 3VKKA 1HKJA 3GM8A 1GUVA 2E8YA 2XGIA 1BSIA 4AZ6A 4BQ4A 5A8OA 2Y2WA 3BCFA 2J78A 5IFTA 1V3HA 1JL8A 3T2PA 3L4VA 1KR1A 1MVYA 9CGTA 3SCUA 1BHGA 1L8NA 4QFUA 4BF7A 1J11A 1GOKA 1WAWA 3L4XA 1H0IA 1UD5A 1KXTA 2WAGA 2XTKA 1OD0A 2VI0A 2V3DA 1WNOA 5HBFA 2CCRA 3K46A 2A3CA 1QBAA 1ODUA 1UKTA 2YL8A 4ZXOA 3W6LA 5JUVA 2YL9A 3MV01 3WELA 3N12A 4W84A 2V38A 1JZ2A 4XX6A 1B3VA 3N11A 2QHAA 5CG0A 1CGYA 4YN5A 4Z2HA 2ZXDA 1QI2A 1RD6A 1CLVA 1LG1A 3L2MA 4P7OA 4GQRA 4OBRA 4OIFA 3BAXA 4F9JA 4AD1A 3G6MA 1FFRA 2D22A 4WKFA 4HA1A 1JAEA 3W28A 3BH4A 3VDAA 2XM1A 3HMCA 1CECA 3RIKA 4WKAA 5HDRA 2CBUA 5DT7A 1GOOA 5A2AA 2WMGA 4MNLA 1XSKA 2WLYA 2ZX6A 3AMCA 5IDIA 3QOMA 3ARYA 4QP0A 3PZ9A 1D3CA 3L4WA 3ARUA 4HZ8A 1XGZA 3S6TA 4W8LA 1OBAA 1TR1A 1JYXA 3SCPA 5FKYA 2GDVA 4OZOA 1JDCA 3RDKA 1JAKA 2WC4A 3WN6A 3RO8A 3S2CA 8A3HA 5BXRA 1IT0A 2G3MA 2BHYA 5A8NA 3GXIA 1MW1A 5M3WA 1H09A 3CMGA 3VGBA 6TAAA 3VMNA 3AS2A 5I5RA 3EMZA 1J01A 2OSXA 1QNPA 5A8PA 4CD6A 2GUYA 3W82A 2BY2A 1XCWA 2WYSA 3F5KA 5DF0A 4DUXA 1XYZA 1HF6A 1RH9A 4HA3A 1KBBA 3ARQA 1QW8A 3WDJA 1GW1A 5IFPA 1CGWA 3GBEA 3WQVA 3T0AA 4PCSA 3WH8A 2DH3A 1W2VA 4PTXA 3AQUA 1TZ7A 5ECUA 1G1YA 3WMCA 2Y8VA 4JFUA 5EFDA 2HISA 3WIJA 3LPGA 4JKKA 1K6AA 3K8KA 3DHPA 1E6RA 1HJXA 4TVDA 2CEQA 3ZM8A 2EPLX 1W9BM 3AS0A 1OT2A 2X0HA 1HIZA 1UH4A 3VMPA 3SCRA 3ARSA 5HPOA 2OSYA 4AZ7A 4FLSA 2D20A 2Q8XA 1CXHA 3PZGA 4WF7A 1B2YA 1KQYA 1ISZA 3QR3A 1UD6A 1ESWA 1UWRA 3W53A 1Y7VA 1H3GA 2WZEA 2XSAA 3W37A 5BWFA 3KZSA 2XVLA 1UWQA 3WF1A 4D6HA 2UY4A 1X1NA 1MFUA 2UY2A 4MTVA 4P8WA 4P7RA 2A3AA 2IXVA 2UWFA 1LJYA 4BS0A 5HOSA 3VIMA 4LGXA 3CZEA 3ZQ9A 5BXTA 2XJ7A 4H04A 4J3WA 2J8FA 1E5NA 1GOQA 4HZ6A 1FH7A 1W1PA 2GJXB 3LMYA 2WK2A 4FMVA 4JIEA 2BNJA 3RM8A 3TTSA 4W7WA 5C8BB 2VUYA 4J3UA 4ZENA 1C90A 2WMIA 1M04A 4XV0A 2Y8KA 4U3CA 3PZTA 5BRPA 4UZUA 4B15A 2IUZA 4JCLA 2D1ZA 3WNOA 3LPOA 4AY1A 1K9EA 4KGJA 4AZCB 1OCQA 1QNRA 1UWIA 1RP8A 5A3HA 2G8ZA 2C8NA 1EDGA 1KFWA 3WEMA 3AHVA 1VEMA 2BXZA 3WQWA 3VX0A 2OYMA 5CSYA 2CIPA 3PZNA 3CTTA 1E56A 1OINA 1WCGA 4M56A 5GQBA 3D3AA 3UEQA 4A4AA 1EHAA 1V02A 4HMCA 4QLLA 1B0IA 4UZSA 3WF3A 2FHCA 4LYPA 3PZIA 5A6MA 5BYWA 1NWTA 2GFTA 3UCQA 2GSJA 5E9AA 3A4AA 5CPQA 5C70A 3WSUA 1JZ8A 2J4GA 2VRKA 1KWKA 2AAAA 1J10A 4D1JA 1L0PA 3ZR6A 1W2PA 2IXUA 4U3AA 3IANA 1NP2A 2WPGA 1JYNA 1E1EA 3AS3A 1LL6A 2YDRA 1K9DA 1V3MA 4GINA 4MB1A 3OZPA 3VIGA 4RE3A 4Z2LA 2D3NA 2VZOA 3W27A 3VIOA 2JF7A 3ZJ6A 4PCTA 3B9EA 1ZBKA 1ZU8A 2A3BA 4JKLA 2W91A 4GPNA 2ZE0A 3WNMA 2VRQA 2V3FA 4UQDA 2J8GA 3ARWA 1S46A 3GZAA 4U31A 2BY0A 4GZIA 2FH8A 2DPEA 2YJQA 3SCSA 1IZKA 4CU6A 1LWHA 1V0NA 2RGLA 1SR0A 2YOCA 4TVUA 4H41A 4XB3A 4KRUA 2W92A 4CN1A 3W4RA 1R87A 4AZIA 3WD0A 1J0KA 2QV4A 5A8QA 3SCNA 1C7SA 3ARPA 1V3KA 2ZXQA 4UOQA 3ZJ8A 2VNCA 5A2CA 2E3ZA 2X0YA 2CKRA 2E8ZA 3WD1A 3VGDA 1QI3A 1TUXA 3MV11 3T2OA 2FHFA 3CZGA 4PBGA 1BYBA 2J7EA 3PBGA 2ZUTA 3NIYA 3WUGA 1EXPA 1C8QA 4IPLA 3ALGA 1V6YA 1E4NA 5D4YA 2CHNA 1BG4A 3N15A 5I2UA 1MW2A 1ZS2A 1VIWA 4JL1A 3NSXA 3HJEA 3K4DA 4DWSC 1CBGA 2FH6A 2XFFA 1KGUA 2J7GA 4H7VA 2J62A 2OWCA 4CUCA 1DWFM 5BCAA 4PMZA 3UR8A 2VMFA 1E4IA 4HU8A 2X09A 1U30A 1ISWA 1UD4A 1UD8A 4PMYA 3CHFA 4CD8A 3AHTA 2G41A 1H11A 1E6QM 5I3DA 4GI9A 1UH2A 3FAWA 4A3YA 5CGTA 5A6SA 4UNIA 4BA0A 1UWTA 4W93A 4TVCA 5FD0A 4Y7EA 4P8XA 4V27A 3BC9A 1GORA 4M81A 3BAJA 1UYQA 1JZ5A 1WB0A 3WDPP 4HZ7A 4AZBA 3SCVA 5HPCA 3CUFA 1XRVA 4N42A 2WVVA 3JUGA 3VNYA 1V0LA 4HOWA 2WZHA 1W3HA 3WBAA 1VFUA 4B16A 2XM2A 3ECQA 3ZMRA 2ZX7A 1JF6A 1W1TA 3POCA 4IUGA 2BVTA 3ARXA 7A3HA 4LQ1A 1DP0A 1KQZA 3CHDA 5A6AA 1BYCA 3WEZA 3WMSA 1V6WA 4TXEA 1HVXA 4XZBA 3BXWA 4M29A 4NRRA 1W9UA 3ZT6A 5CLWA 5EFFA 3KL3A 1XSJA 3VGGA 3VNZA 2NT1A 1WDPA 1GQKA 2VX4A 5CXPA 3KE0A 2VVSA 5FIPA 1FFQA 2AOSA 4UOZA 4W5ZA 1CZ1A 1JZ7A 1GOWA 3DC0A 3MUZ1 3UETA 4MADA 4P7NA 4U2YA 2WVUA 1TFVA 3AZSA 3CMJA 3VTRA 3K1DA 1PBGA 4KH2A 1UA3A 2YKKA 4WSKA 4PUDA 3PZVA 2JFEX 2WVVB 4OKDA 2VX6A 1W9DM 3L2LA 4CCCA 3GXMA 2VRJA 1W1VA 2VQUA 2WC7A 4UFMA 4QDMA 4PMDA 1V08A 2D0GA 4CCEA 5A1AA 4P7QA 1E0VA 1CYGA 4LX4A 3N9KA 1HT6A 1PZ2A 1XCXA 5A6BA 3K8LA 3IJ8A 4Z2IA 4P7LA 2OYLA 3VD4A 2XIIA 2O9RA 4R5EA 1XYFA 1K9TA 2PBGA 3BSGA 2G3IA 5A95A 4KGLA 1EA9C 1CPUA 4U5IA 3ZT7A 3MMUA 2XPKA 1UKQA 3AHYA 1US2A 2ZXAA 1KWGA 1HNYA 1JIBA 1ECEA 4KMQA 1GJWA 5TD4A 3WMBA 4GO9A 2D0HA 2W4XA 1ISVA 3U7BA 3GNPA 3ZSTA 1HJQA 3CO4A 5I23A 1F4HA 1UR0A 3VVGA 1G0CA 1FH9A 2D23A 1NWSA 3J7HA 2QPSA 1E72M 3K4AA 2Y24A 4AZGA 2CBIA 3N17A 3AHZA 1NWRA 1E40A 1O6IA 1EOMA 1MQQA 1JD7A 3GH5A 4TX8A 1H5VA 2XSBA 1WZKA 3WBEA 1UQZA 1MWOA 3HN3A 4AD0A 3N13A 4GI6A 2EPKX 3CIVA 4TOQA 1YHTA 4E4PA 1QHOA 1UHVA 2YA0A 1LQ0A 4J7RA 2WWCA 2BXYA 3PZUA 4IPNB 4DUVA 1A47A 3A47A 4L4PA 1G5AA 4TTUA 4XUYA 5BROA 2ZIDA 1JD9A 1W9VA 3TA9A 4A3HA 4ZE4A 1NH6A 1M53A 2WVTA 1M7XA 3PTKA 5LA1A 1HJWA 5A6JA 3O9NA 3OG2A 1HL9A 3I3DA 3BLKA 3NDZA 2D24A 3VDBA 2E9LA 1BG9A 2ZXBA 4P8UA 1UKOA 3CZ8A 3AHXA 3VINA 3OGVA 4F8XA 2BS9A 1X6NA 3OLIA 2JF6A 3VGFA 4D6EA 2Y4SA 4AZHA 3TONA 2GK1A 1KBKA 2BHUA 4BQ3A 3WF2A 3GNRA 1B90A 3CLWA 2WANA 3ZSSA 4W5UA 4HMEA 4PSRA 2C0HA 4M8UA 4D6FA 1B3XA 2X2YA 2HVMA 1PX4A 4PSPA 1E4LA 4PMUA 3WH6A 4EK7A 2XVKA 1MQRA 1CXIA 4CCDA 5LYRA 3L4UA 2GDUA 2E40A 3G6LA 4W85A 2XHYA 3ARTA 1JG9A 5KZ6A 5FOOA 2OLHA 3APGA 2WBKA 2EEXA 3VIPA 4F79A 3FN9A 3TTQA 2J79A 3AZTA 4AD2A 4UTFA 4MNKA 1ISXA 2W62A 1GOMA 1R85A 2PF0A 3VIIA 4DM1A 5M17A 5DFAA 1AQMA 3CPUA 2F2HA 3OGRA 5A69A 1WDRA 1UQYA 2EO7A 5I79A 1MYRA 3BAWA 6A3HA 3SEPA 4CU8A 1JFXA 5EB8A 3L4TA 1J0IA 4MNJA 1GQLA 2GJRA 2YBUA 1JYVA 2QMKA 2D0FA 1BLIA 4MPKA 3MUIA 3MS8A 1CENA 4PMRA 1NM9A 1GONA 2PWGA 1V3IA 2YDSA 1H0GA 4NI3A 2JEQA 2WNWA 1DTUA 5CSUA 4JZ5A 2BY1A 3CUHA 4Z2KA 2DH2A 4BQ5A 4W88A 2ESCA 3RILA 2XFRA 2UY5A 1HP4A 3PZQA 1U2YA 3U7VA 5LA2A 2EBNA 3THDA 5CGMA 1NOFA 1Q4NX 1K9FA 2EPOA 3FNDA 5A2BA 1CTNA 2W5FA 3IAPA 1MW0A 1E9LA 1EQPA 1GJUA 1D7FA 2XUCA 1WP6A 4UFHA 3ZO9A 3A6OA 2XIBA 1E3XA 2OWXA 3OBAA 1V6XA 3BSHA 3VX1A 4JL2A 1EOKA 1WDQA 4DUWA 3CHEA 4MB3A 4F66A 2PBOA 2J7BA 3UESA 3M7SA 1VEOA 4W8BA 4HOXA 4PN2A 4E8CA 4KWUA 1WDSA 2J7CA 3QHNA 1EO5A 1W3LA 1XH2A 4D6CA 3VMOA 1VAHA 4AD4A 3CZKA 3AMDA 1H49A 3WD2A 1GVIA 1JZ6A 4EAMA 1HX0A 1QVBA 3WDQA 2VX7A 1A3HA 3B9AA 3WDRA 3AXHA 1E71M 3LPFA 3CZJA 2VL4A 4D71A 2G4FA 5ABHA 4X9YA 4U5KA 4UQAA 1VENA 1QI0A 4CVWA 1C8YA 4C7FA 3POHA 3O2LA 5JBDA 1R8LA 1I1XA 1UD3A 4W87A 1E5JA 3WENA 2YLLA 3N1AA 4Q7NA 1BTCA 3AJ7A 2WMJA 4CN6A 3AICA 1WZLA 1PX3A 3M6DA 1OIMA 4PRWA 3VIKA 5M03A 3M46A 4NF7A 1NOUA 1OGGA 4UFIA 2E0PA 3ARVA 3AIRA 3MMDA 1YQ2A 4MDOA 4BQ2A 2WKGA 1N82A 1HXJA 1Q6GA 1I1WA 3VD5A 1CGVA 3GH4A 4CD7A 5E70A 1HKMA 5E0FA 3L4YA 4UFLA 2EPNA 3RMEA 1OWQA 3SUVA 5E6YA 4GZEA 3ARRA 3FAXA 1Q6EA 5F7UA 1VJSA 4AW7A 1CXKA 2EXOA 4W86A 1JFHA 5BXPA 3WD3A 2VX5A 1SMDA 1BF2A 1TG7A 3OGSA 1C92A 4H8VA 4V28A 2OYKA 2FHBA 3F5JA 1KGXA 4FK9A 2WMHA 4DM2A 5A6BD 6CGTA 1JXJA 4B9YA 1HJVA 4QCFA 5EBAA 3FXYA 2CKSA 1FH8A 4ACZB 2XWDA 1PEZA 1E70M 1GCYA 5JBEA 1IV8A 1PIGA 1W91A 1OT1A 1ZJBA 3SUUA 2VZTA 3SCQA 1W1YA 5I24A 1E6SM 2VCCA 1IZJA 1JF5A 3EMCA 4WJXA 1CIUA 3ZJKA 1E0XA 2YIHA 2VOTA 4EKJA 1XH1A 5D9PA 4E2OA 1OGBA 3II1A 4GI8A 3T0DA 1PPIA 5I0DA 2YDQA 4H8UA 2CERA 1NWUA 1UZ1A 2GK1B 4AYSA 4B3LA 3CBWA 1XD0A 2DSKA 3GTNA 2CYGA 2VR4A 5CLTA 2OSWA 1JDAA 5IHSA 2ZICA 3AIQA 2PWEA 1NQ6A 2ZUWA 3BLPX 1OB0A 1EDTA 4PMXA 3VOCA 4J3VA 5DO8A 2BVYA 4WLCA 1NOWA 4OJYA 2FDMA 2WZIA 5CPSA 4PTWA 3BCDA 3VIFA 2BY3A 5IXEA 2NW0A 5EMYA 1M01A 1BVNP 3ZJ7A 3MKKA 1XHGA 3L4ZA 1MQPA 1NARA 1JNEA 3AZRA 1BAGA 1MXDA 1FHDA 1OM0A 2DT3A 3MMWA 2B31A 1US3A 2PWHA 5IHRA 4AMCA 1ZB5A 3ALFA 5KEZA 1QNOA 4BCEA 3AIUA 2DDXA 4GO8A 4FF5A 4ML4A 4K68A 3NCOA 1LG2A 3NSMA 1HJSA 2Z1SA 1J0YA 3WQ5A 2Y5EA 3TTOA 1VJZA 1KB3A 3AMGA 1KXQA 1I75A 4R27A 4DWSB 4AZCA 3F4VA 2PB1A 4U2ZA 5FL1A 4WKHA 1E6PA 2ZWZA 2VO5A 1G01A 1LWJA 3EYPA 1J12A 2QF8A 1BPLB 1UD2A 3WUEA 1WZMA 3HU7A 3SUSA 3EDDA 5JIWA 3DYOA 4KRTA 3GBDA 4JFWA 4ATWA 3F5LA 4DWSD 3THCA 1SFSA 3K8MA 2D2OA 2XWEA 5A94A 4LYRA 5A8MA 5CJ5A 5ABFA 4C7GA 2DSZA 1V3LA 1CNVA 2OWWA 4YPJA 1UWUA 4JAWA 4UR9A 1CXFA 3OZOA 4MJ4A 2YL5A 5GNZA 3AIVA 2Z1KA 4HU0A 4GKLA 3DHUA 2WHLA 3T08A 4JFVA 2WM0A 2FGLA 4DWSA 1V6UA 1Q6DA 1V0KA 1V6VA 3OLEA 5A6KA 1TVNA 3WY1A 2O9TA 4ZXLA 1UWSA 1BGAA 3RPMA 3MU7A 1MXGA 3W38A 1FOBA 3RM9A 2VVNA 4AC1X 1QI4A 2GJPA 2WKLA 4JCMA 1VFOA 3SIMA 3M07A 4V2XA 1UR1A 4ZFMA 1C3FA 3AOFA 3A3HA 3VGHA 1QNSA 3WH9A 4UCFA 3WL1A 4GQQA 3CGTA 1WPCA 1QHPA 4GZJA 1TCMA 2E9BA 1Z32X 1VF8A 3NDYA 3SUTA 1BQCA 1PX8A 3WEOA 3WNLA 4YHEA 1C8XA 1GHSA 1OD8A 3WQ8A 2YLAA 4HMDA 1JDDA 3CH9A 1E55A 1LF1A 3PTQA 4MB5A 2WCGA 5I77A 4HP5A 5D9NA 2W67A 4PEEA 1H4PA 4AEFA 1B31A 3WF0A 2J7DA 1WZAA 2D3LA 2FGZA 1OGSA 2X05A 3VO0A 3EBVA 3FY1A 2WHJA 3AFBA 2ZUUA 4MB4A 3VM7A 3AIWA 4C7DA 3W24A 1BVZA 3OLDA 1OSEA 2DSVA 4AWEA 2VTFA 3ZOAA 1VB9A 3W6MA 3PZOA 2ZUVA 2ZX5A 1VEPA 2ZUNA 1CGXA 2CETA 1ISYA 4AXNA 2WW5A 3SCTA 3MSDA 3GXDA 3RJXA 1E0WA 2ZX8A 3SURA 2EPMX 2WXDM 3W0KA 4ATDA 2BV9A 5GNXA 3I3EA 3VUPA 1ITCA 4MDPA 3I3BA 4MJ2A 4U33A 4NZCA 2J74A 1WE5A 1ODZA 3OB8A 2CNCA 2O9PA 3BMVA 3BAYA 4AIUA 5I6SA 1JXKA 1QNQA 2WCSA 2VC9A 3TP4A 3LPPA 3PZMA 4RL3A 1W9PA 2WBGA 1H2JA 2A3EA 4JHZA 2WB5A 3W26A 1EHNA 4ATLA 1C91A 3A4XA 5E09A 3W81A 3IJ9A 4P8VA 4AD5A 3IK2A 3PHAA 4CD5A 4Q22A 2WMKA 4J3XA 3MANA 2CITA 4CD4A 4AISA 2BHZA 1UR2A 4NSBA 1PAMA 1UG6A 1VFFA 1J18A 2WC3A 2PI6A 2XFYA 3WDIA 2JIEA 1QW9A 4UOJA 3AIEA 3CUGA 4OBSA 1DHKA 3MUAA 1VRXA 2ZWYA 3WD4A 1BGGA 5BXSA 3VD7A 2XG9A 1CGTA 1RPKA 5AYIA 2VCBA 4MNMA 1CGUA 1EO7A 4PTVA 2XVGA 3MSGA 1LL4A 4D72A 3VGEA 1PIFA 4W89A 4EE9A 4HPHA 2W63A 5AC5A 1E6ZA 1UUQA 1JZ4A 3B8SA 2WVSA 1OIFA 1JNDA 1ITXA 2XGBA 1U33A 1QBBA 2X1IA 2DSUA 3ARZA 4D1IA 5LA0A 3WUBA 5GNYA 5A6LA 4J3SA 4FLQA 3KEHA 5FL0A 5ABGA 1VBUA 3EMQA 4IM4A 3BMWA 4JKMA 3U5YA 2J7HA 4AD3A 3AYRA 4S3KA 1C93A 4TTGA 5CQ1A 1BFNA 1O7AA 2EJ1A 3T2QA 4M82A 1CXLA 1QHZA 4RE2A 4E8DA 2DT1A 3NUKA 1M03A 1P6WA 4HA4A 4CGTA 1GQIA 1WKYA 2A3HA 2C7FA 4WSJA 2ZUMA 4HPGA 7TAAA 1HP5A 2WLZA 5DT5A 1DWHM 1B9ZA 2DQXA 1DEDA 1B30A 1XSIA 3DYMA 5E0CA 3EDJA 2WWDA 5D8WA 3B9DA 1HL8A 1ZBVA 5ABFB 1MFVA 3WH5A 4HOZA 3A4WA 2VQTA 2XVPA 1V03A 2E9MA 5D9MA 3AS1A 4X0VA 4W7UA 1TE1A 2V5DA 2QPUA 3DYPA 5FCZA 2VJXA 4D6DA 3SCWA 1FHLA 4ZEPA 4AIOA 1TA3B 4LPCA 4UQBA 4YHGA 1BYDA 4UQEA 1R86A 1GNXA 3SUWA 1E6XM 1ZL1A 1CEOA 2QLYA 1W9XA 1F4AA 3OLGA 4OOZA 4F9DA 5AYBA 3VIHA 3QHOA 1JYWA 4S3JA 5DEZA 5JBFA 3KWXA 3WNPA 1LL7A 3GH7A 4JHOA 3KL0A 1UR9A 2J77A 2WCAA 1DWJM 1EDQA 4J28A 1E15A 3TOPA 4TX6A 4H2CA 3VDHA 3GYCA 1Q6FA 3AMKA 1CDGA 3GXFA 3N18A 1DWAM 2W66A 2WSPA 3EDFA 3OA5A 4PTMA 1J9YA 4PMQA 1GZJA 4PYSA 3PN8A 2ZOXA 1J0HA 2BVDA 2CPUA 2MANA 5CPTA 1PZ3A 3N04A 2QMJA 1UA7A 3AIBA 1E1FA 3CHCA 5BRQA 1J0JA 1HJUA 2WMFA 1W32A 3WQ6A 3VU2A 3IAQA 1GQJA 2V5CA 1UZ4A 4LYQA 1DWGM 5E6ZA 3WFLA 3IJ7A 4UFKA 1J0ZA 4FLRA 2YL6A 2CESA 3AISA 4GXPA 5GPRA 3AMLA 5DMYA 3GNOA 1BYAA 8CGTA 2AMGA 1ZJAA 4ACZA 1UOKA 2DSWA 1XD1A 5AC4A 5AY7A 2YA1A 1WO2A 2F61A 4QAWA 4Z2JA 3ZT5A 4L4OA 4UQ9A 1AVAA 3FHAA 4CVUA 1GVYA 4AEEA 2WHKA 3AYSA 1MW3A 4IISA 4D6GA 1R7OA 1HVQA 1RP9A 3OIHA 1TA3A 1AQHA 2DEPA 3FHQA 4JFTA 1E6NA 3WDHA 3CZLA 1CLXA 3WKZA 4W7VA 1VBRA 3BAIA 3U5UA 5M5DA 1ZBCA 3QOKA 2VR5A 3U57A 3UG4A 4OOUA 1EH9A 1XC6A 1GOIA 4N0RA 4ZE5A 3WNKA 2J25A 4J27A 2VZUA 4W8AA 2O9OA 3DECA 4LXFA 1EGZA 4B3KA 5JIPA 4URIA 2J7FA 3VILA 3WL0A 1FA2A 1JGIA 3AI0A 1H1NA 3UG5A 2DGAA 1SMAA 3EDKA 2V3GA 7CGTA 2XVNA 5I78A 3SCOA 3E1F1 1KR0A 3WQ4A 1B1YA 1LLOA 1Q6CA 1UH3A 1C7TA 2XYLA 3D5HA 4J3TA 2E4TA 2CHOA 2G3NA 3BGAA 4UQCA 4M80A 1B3YA 2GJXA 4M24A 1E3ZA 2J75A 1V0MA 5C71A 2JE8A 2NT0A 3KL5A 1KCLA 2WSKA 3W29A 1E73M 2CBJA 1KCKA 2VT0A 1FP8A 1X6LA 1HKIA 1V3JA 3RCNA 3WUFA 3WFZA 1W3KA 3UERA 3AXXA 1QPKA 1UR4A 2CBVA 4D6JA 2O92A 3NYDA 2X8RA
chains in the Genus database with same CATH superfamily
3SZ8A 3VOJA 4MWAA 5LIUX 4H9YA 3NSNA 4GJIA 1KXVA 1PJ9A 3M43A 1O1HA 2ZX9A 1KFBA 3WK3A 3CUJA 3VC6A 3GUWA 2P1FA 3MCOA 4FOUA 4LEQA 3W1UA 2J24A 4FIRA 5D8ZA 2ZRZA 3UWVA 1IYXA 4HTYA 1UC4A 1N8IA 4O52A 1FWIC 3VM5A 4AWTA 5G1YA 1VRDA 2WHMA 5IBXC 3EKGA 3PTMA 4C6KA 1KCXA 3SQLA 3FS2A 4RDWA 3W74A 3O6AA 1W3JA 1KXHA 3NQCA 2DT2A 3FW6A 5CKSA 2WSQA 4PCNA 3CC1A 2JIWA 3UJFA 3K2GA 3VIJA 3IGHX 2QR6A 2BBFA 2B7NA 3VPLA 4UTIA 4EPEC 3AXIA 2A7RA 4M1RA 5L9FA 3W2NA 3NJ3A 1TVPA 4H8HA 4QE5A 2QEZA 1NP0A 1EC7A 5DCEA 1V7AA 3AROA 3QH2A 3KBMA 3UG3A 2CXGA 3LNMA 2ZZ5A 1G9HA 3E2SA 1KRMA 3AC0A 2BG5A 3MB9A 2VCAA 3IK4A 4F2BA 1Q2SA 3VI2A 1AQ0A 3TMQA 2DIKA 1JULA 4JFSA 3WNNA 1Q45A 4IL2A 4QROA 1F3WA 3UZJA 2CC0A 2I7GA 5AYYA 2P76A 1FWTA 3UR7A 5BMXA 3CUIA 2P88A 2XH7A 3EEZA 5I07A 1K8YA 5J5DA 2QAFA 2WMIB 2XH2A 3HPSA 2YR1A 5K7JA 3NFUA 3WQDA 2ZRWA 4E5TA 1V3HA 3T2PA 1BHGA 4KCVA 3N34A 4H9UA 3PBWA 3RXZA 3ABOA 2VEIA 1GOKA 3UZYA 1C9DA 5G2HA 4Q6JA 5DANA 4JIIX 1UD5A 1T96A 1KXTA 3PNUA 5J8LA 4UMBA 1JEZA 4AVNA 5HBFA 1MUCA 1G4PA 3E38A 4TV6A 3K46A 3ABRA 3IGSA 2YL8A 4ZXOA 3LD5A 3TV8A 3W6LA 2BODX 2YL9A 3KS6A 2V38A 3INPA 3PG9A 5DRIA 1CGYA 1YXCA 2GL5A 2ALDA 2ZXDA 1RD6A 3H12A 3VXGA 3PBUA 4OBRA 3KVJA 1VLWA 3S8HA 5XIAA 1UJPA 1FFRA 4XZIA 2ZFAA 2QAPA 3W28A 3BH4A 2Y7EA 4WKAA 5HDRA 2C79A 5DT7A 2WMGA 3AWNA 3S0CA 3A13A 3FGCA 3BQ5A 4QP0A 1NDVA 1E9YB 1D3CA 2BTMA 4GUGA 3ARUA 5BRBA 1XGZA 1KC7A 3FX4A 4W8LA 1OBAA 3SCPA 1SFTA 2WC4A 2Z27A 4GYKA 4XZMX 1HTIA 5C7VA 5A8NA 3GXIA 3CMGA 5CPNA 2FVMA 3KZPA 6TAAA 3VMNA 5I5RA 3EMZA 1J01A 4AX6A 4QSFA 3RR1A 1UW9A 1D8WA 1W54A 4CD6A 1I60A 1DPMA 3PUEA 1LORA 5F2LA 1KA9F 3W7HA 4LALA 1GK8A 2WYSA 5AYZA 1RH9A 1GQNA 1SQ7A 2R1PA 3ISIX 4AHQA 3ARQA 1QW8A 3WDJA 1GW1A 1H63A 4UTTA 3I7SA 2PCQA 4HZMA 1R3SA 2O56A 3IV8A 4OV9A 3MJYA 4KW2A 5PTDA 2QQ6A 3QC3A 3C4UA 3C0QA 2NX1A 3L66A 4C5YA 1R3VA 1ME7A 3TQVA 3SBFA 1HKWA 4JTTA 4HNUA 3H2NA 3GDTA 4DWDA 2FJUB 1TJ0A 1V4YA 4QG9A 3P93A 1XQLA 1M7OA 4U28A 3NQGA 2FMNA 3K8KA 3W7GA 1VC4A 1E6RA 3L23A 1YXDA 3G1RA 1W9BM 1HIZA 2NLIA 3NQVA 4DAFA 4PFMA 4MMWA 2D20A 4MPQA 5HJYA 4A2RA 1ZHAA 3SO7A 4JTDA 3RX2A 4AAJA 3LQGA 1ISZA 3QR3A 1UD6A 1UMLA 2QDDA 3GDMA 4AB4A 2WZEA 1Y5VA 4RW3A 3DFQA 4GX9A 5BWFA 3WF1A 2UY4A 5K9DA 5FEXA 4OQVA 2UY2A 4P8WA 1JQVA 5FJOA 5HOSA 5LNRA 3VIMA 4LGXA 3GG0A 3CZEA 1UBPC 2BGNE 2TRSA 3BSMA 2AQWA 4H04A 3Q37A 1QWGA 3TCEA 3GHUA 3SJ3A 3O15A 3AJXA 1GOQA 3CHVA 3BJSA 2YXXA 4JIEA 2XN0A 4C6IA 3IIOA 4MWAC 4NAFA 3JZEA 3B0PA 4J3UA 3F2CA 2WMIA 1TPFA 2Y8KA 3R58A 1BWKA 2ISFA 3KLKA 5EMJA 4AY1A 3L2IA 1VHNA 4IFKA 1UWIA 2Z00A 4JTRA 2G8ZA 1EDGA 4LCQA 1VEMA 2OYMA 4TMCA 6ALDA 1E56A 1OINA 1X7FA 4HMCA 3G1HA 2J27A 3LEPA 3PZIA 5BYWA 3HV9A 1KFKA 5CPQA 3UPBA 2YXGA 2J4GA 2ZYFA 3U2EA 4D1JA 3WYZA 2IXUA 1ADDA 3CL7A 3TSMA 1GKQA 3PB2A 1NP2A 2WPGA 1P48A 3RYSA 1LL6A 2YDRA 2WJEA 5CC6A 2QPXA 1K9DA 3UQNA 3N6JA 4WDXA 2PUZA 4GUIA 3GHSA 2X7VA 1PE1A 1VCGA 3TN4A 4JKLA 1K02A 4GPNA 2VRQA 4I9JA 1THFD 3QEZA 2ZA3A 4WOZA 2Q02A 3GD6A 4DBDA 1TQXA 2QUMA 4MVAA 3UVAA 1PHWA 1RCQA 4J4KA 4LJ3A 4ZSUA 1IZKA 3V16A 4TVUA 4AYGA 4XVDA 1SZRA 4BJHA 2RDXA 3W4RA 5KITA 2YYUA 5D03A 1C7SA 1V3KA 4KPLA 3LTYA 4OE7A 2HPMA 1YPIA 1YX1A 1EXBA 3G3DA 4YTQA 2CKRA 4JGDA 1VZWA 3WD1A 3MV11 4XAYA 3T2OA 2FHFA 4IPPA 4DBSA 3CZGA 2HZGA 1Z9AA 3WUGA 3LCGA 1EXPA 1C8QA 1T99A 4C6NA 5I2UA 3I7QA 2DUXA 3K4DA 3PNZA 2RJHA 2FH6A 3H4WA 4CUCA 4OWGA 4IXHA 3U2OA 1R9ZA 3HM7A 2QJJA 2VMFA 1BXBA 1EGMA 4ICMA 4IOTA 2A1YA 4CD8A 4DQWA 3AHTA 1S39A 3C61A 2ABAA 4WR3A 1BTMA 4C6OA 4A3YA 1Z89A 2D2JA 4UNIA 5I3JA 4BA0A 4TVCA 1ONRA 5FD0A 3M5ZA 1BRLB 5B7ZA 4JTLA 2C18A 4Z1DA 3WDPP 1JZ5A 2WQDA 2JBMA 4LNYA 3CUFA 4DYJA 5I06A 2QW5A 2XIMA 3WQFA 3H21A 5HMFA 1W3HA 3WBAA 4LUIA 1VFUA 3TK7A 1K7FA 3B8UA 1UP0A 1MNSA 1DP0A 2H3BA 5A6AA 2OZ3A 4FNSA 1HVXA 4XZBA 3BXWA 2OEMA 1EL3A 3VGGA 2NT1A 3QSTA 3SQSA 4IJRA 4GFSA 4KFNA 1AA1B 3LHYA 3KE0A 5FIPA 3RITA 2PTWA 4W5ZA 1CZ1A 2Q71A 3DC0A 5HNRA 4C1LA 4U2YA 2WVUA 3LG3A 1TFVA 3CMJA 4HCLA 3K1DA 4KH2A 1HGYA 1UA3A 4AHPA 2YKKA 3NO3A 5LSMA 4Z08A 3O05A 2GSHA 3ZVIA 2PDWA 4UFMA 1TUFA 3PBYA 1IT8A 4P7QA 1E0VA 2W9MA 3GDRA 1MUMA 1PCKA 1PZ2A 3TX9A 3IJ8A 3KXQA 3Q67A 3QV7A 5U7SA 4LT9A 1TZZA 3N29A 4DJED 2FYMA 4KWOA 2HVOA 2WPBA 2PDBA 2O9RA 1VGAA 1RD5A 3MI6A 5A95A 1A53A 3KFTA 3ITTA 3ZT7A 2Y1HA 1KWGA 3UZ5A 1DJXA 2WOQA 4GO9A 2W4XA 3GNPA 4RZ6A 3VVGA 1QTWA 2D23A 3DIPA 4L7ZA 4RJEA 1NWSA 3W83A 3L0KA 2QPSA 3UWZA 3SIZA 3K4AA 1UIOA 1KFJA 4AZGA 4NAEB 4H3DA 3U4FA 1EOMA 4Q4SA 1MQQA 1JD7A 3EWCA 4TX8A 2XU2A 4QNWA 4JTSA 3CEUA 3HV8A 1UQZA 1ZZMA 1MNZA 2JK2A 1U1UA 4AD0A 3W73A 1FQ0A 3TYUA 1UHVA 2CU0A 4J7RA 3PZUA 3KCOA 2G95A 4XD5A 1DTNA 1W9VA 4KETA 3PTKA 1M7XA 4MWAE 5A6JA 4JTHA 3LBOA 3BLKA 1ZGDA 3NDZA 2D24A 5EMLA 1VBJA 4WCJA 1R38A 3VINA 3OGVA 4F8XA 2BS9A 3OLIA 3KOFA 1QPOA 1A5OC 4D6EA 1B4EA 2Y4SA 4LS1A 4AZHA 3QZEA 1RR2A 2GK1A 3V7PA 1KBKA 3RX4A 3CLWA 3B8WA 2A5HA 3C3UA 1DJZA 2PRLA 4HMEA 1DIOA 4I8DA 4PSRA 3RCYA 4D6FA 1S5TA 2DFAA 2I14A 2HVMA 3M5VA 4A6GA 2PDHA 2XZ7A 1VHCA 4MUPA 1S1RA 1X39A 4PMUA 2XVKA 1XG4A 4CCDA 4IQDA 4JTIA 1M7PA 3CYJA 2HS8A 3EWYA 2E40A 3G6LA 4W85A 3W02A 2BOFX 1D7KA 3G1VA 4GCXA 2OVLA 3APGA 1T0OA 2I5IA 5HNTA 3CAWA 4LUTA 4N9CA 1Y5WA 4A3QA 2EG6A 2Z0IA 1AQMA 5D33A 3G1AA 3CPUA 1C8VA 1I4NA 3OGRA 5C2XA 5A69A 2YZ5A 1UQYA 1F61A 3UP8A 3W2MA 4DO7A 1J2WA 3ABSA 3AWOA 4M6QA 5EB8A 4PUWA 2CLOA 1GQLA 5LKYA 4OUIA 4Q6XA 2QMKA 1CX9A 2RJGA 3KVLA 1AL8A 3MS8A 1CENA 1A4LA 1GONA 2JEQA 1XGDA 1KM3A 2X2GA 1IXOA 4S2CA 1LT8A 1TCDA 4GXMA 1DTUA 3EPNA 3OZYA 2V63A 2BY1A 2DZTA 1YMYA 4UMCA 3RILA 1IHIA 5HWJA 1K3UA 4ZO7A 5LA2A 2CLMA 2EBNA 3W7KA 2NUYA 4YL2A 3R1ZA 4TR9A 3FNDA 3UT0A 1ZFJA 3TLLA 1GVFA 1W0MA 3E0WA 3BG3A 3A6OA 3ENLA 3THUA 4CLMA 2OWXA 1V6XA 1TTPA 2A6NA 1FHUA 5FSDC 1FKWA 4DUWA 3UGRA 4F66A 2J7BA 4O12A 3S5ZA 3M7SA 2X30A 5AC8A 2Z28A 4UNLA 2GJNA 1O68A 4AQLA 3VMOA 1VAHA 4AD4A 2OG9A 1IEWA 4FOJA 5BU6A 4UIOA 1P0NA 4EAMA 3QPYA 4PCFA 1QPQA 2C1HA 3WDQA 3G1FA 2F7FA 1QDSA 4YXGA 2UV8G 3L65A 4NASA 2G4FA 4U5KA 1KM0A 1RBLA 3IEBA 1QI0A 1H61A 1DQXA 4C7FA 5D09A 5JBDA 1UD3A 4GOAA 3WENA 1J5TA 5DRCA 4ZOAA 2ACRA 5BW6A 1BTCA 3L5LA 1QK0A 5T91A 1P43A 3U4AA 3PB0A 2OGJA 1PX3A 1EJ7L 4K8HA 4HNOA 1TV7A 1DJYA 4GABA 3NR0A 4UFIA 3CB3A 3CIXA 4ONVA 4HD5A 1DXIA 1YQ2A 2Y89A 3WJWA 4MDOA 3SADA 4JD4A 5CAKA 4N9EA 3C2OA 3VD5A 1CGVA 1J93A 4M7SA 5E0FA 3T40A 2EPNA 1OWQA 3FA4A 1RQEA 5E6YA 4EWJA 3ARRA 1TO3A 4G1NA 1WAUA 4PBEA 2WQPA 5GJPA 4K6AA 4W86A 1UUOA 1W5QA 2CLIA 2GGEA 1BF2A 1TG7A 3W7OA 1C92A 3C8NA 4H8VA 4WDWA 3EOSA 4FK9A 2WMHA 3WLSA 2DZXA 2FFIA 3P60A 2MUCA 1HJVA 4JOMA 3B03A 1V8EA 4C6PA 1GCYA 3A9IA 1W5PA 4JNMA 4ERAA 1Q3NA 5CZ0A 5AHEA 2VCCA 4B90A 3EMCA 3ES8A 1CIUA 4JY9A 1Q5MA 2OZ0A 1XDMA 2VOTA 2C16A 5LZLA 3GC2A 3TC7A 2PTXA 3BGJA 1TVLA 2GVEA 1PPIA 4QE1A 2CERA 7REQA 4JS3A 2GK1B 4H6RA 1VH7A 3F1QA 4AYSA 3BV4A 4ERIA 1OFAA 3RRAA 3DERA 1XD0A 1QW7A 2CYGA 4DRSA 3B0XA 4AMAA 3B8DA 2L5HA 4YIWA 2OSWA 1JDAA 2ZICA 2NXGA 4GBUA 1FY6A 2ZUWA 3BLPX 5CSRA 1CT5A 4FXSA 4E3TA 1A5MC 1QOQA 3ITCA 5DO8A 1NOWA 4OJYA 1YE6A 2VXNA 3E2VA 4ERGA 4JTUA 5DMLA 3VIFA 4BR1A 2NW0A 4XTDA 3N3TA 3ZJ7A 4NT0A 1LDCA 3TJXA 3DFYA 4D9PA 3DFTA 2B31A 3M0LA 1AZ2A 1DIDA 1YTEA 4AMCA 3ALFA 1DXFA 3IJ6A 3DAQA 4NI8A 3AIUA 2PDLA 3NPXA 4RDZA 4ML4A 1XGEA 3NSMA 1JCYA 4GVHA 5EL1A 1J0YA 3WBYA 2Y5EA 3NZPA 3AMGA 1KXQA 3LNPA 3DFHA 1I75A 4DWSB 5M1TA 3NQAA 4CCZA 3AU6A 3KCJA 5J04A 1E6PA 1F74A 4IMFA 1WOAA 1FBAA 2ZWZA 3V1PA 3V0UA 1KW1A 3NQMA 2WO5A 5I02A 1BPLB 3MHFA 1UD2A 3HU7A 3GKAA 4QM1A 1U22A 3GBDA 3THCA 3DENA 4J9JA 2PDXA 5A94A 2V2DA 4LYRA 3S2NA 1ZP4A 5EPDA 2DSZA 4UTHA 1UPMB 1W5MA 2OWWA 4YPJA 4JAWA 1PYMA 3QW3A 4UR9A 5C9UA 2V30A 4PUNA 5D04C 3DHUA 2X1TA 3UZWA 4P61A 3UJEA 5XINA 4DWSA 1VIZA 1V6VA 3WY1A 4Y8FA 3FK4A 4LAKA 4GNKB 3RPMA 3MU7A 3B0VC 2QCNA 2H6RA 2WM1A 3VNDA 3W38A 1QI4A 1FWGC 4R9OA 2WKLA 3I6TA 4ZFMA 5HAOA 3A3HA 4E0CA 3KP0A 4NIRA 3C5QA 5TQLA 3AU2A 1Z42A 1XUZA 4UNKA 2DZAA 1TCMA 2E9BA 3QV6A 1HO1A 1ICQA 1ICPA 3KOXA 1VKFA 3HIJA 3RPTA 2OB3A 1DXEA 2Y70A 4HNLA 3LMZA 1PVNA 4A3RA 3JS3A 2QCFA 1Z69A 4ZB0A 3GXNA 1M6JA 3AO0A 5FEWA 4DLMA 5I77A 4HP5A 1H4PA 4AEFA 3W1XA 4HA0A 3LN3A 1WZAA 3RK8A 2D3LA 5DXYA 2X05A 1EC9A 2INFA 1NIUA 4KKXA 4MB4A 3VM7A 1BVZA 3LK6A 3ZOAA 3LSBA 1Q66A 4GY0A 1LRNA 3NQBA 2XFWA 2YB4A 3TJLA 3LYEA 3TTEA 3MSDA 3GXDA 4E4FA 3LI0A 2ZX8A 1ZAIA 1YXYA 3T81A 2C1GA 3GU9A 4E8GA 3TEVA 2WXDM 3LRKA 3I3EA 3VUPA 1ITCA 3F7JA 3B9OA 5E1QA 4MJ2A 1IWBA 3ZS4A 1VJIA 1Q6LA 4NZCA 2YCLB 4G5DA 3DCPA 2H8ZA 5RUBA 2CNCA 3QBUA 1IXNA 3PF3A 4QDPA 4KCWA 1Q8JA 4I9MA 4AIUA 3LCLA 1XRTA 1YTDA 2WCSA 2CZ5A 2O7SA 4FOKA 1G6CA 1I2NA 3W1QA 2DJLA 3DU0A 2ZC1A 2A3EA 3S47A 2WB5A 3XISA 1S2TA 1Y65A 5F1VA 4O0ZA 4C5ZA 1C91A 3W81A 1I2QA 2QV5A 4AD5A 1WOBA 3SECA 3TQ0A 2WMKA 3N4EA 1P1XA 3RRXA 2WNZA 4CD4A 4Q8VA 2QUNA 2BHZA 4FEZA 5I3GA 1NEYA 2PGRA 3GZ3A 4IT1A 3WDIA 2V5BA 1A0DA 3IIPA 4AX7A 1WKDA 3CUGA 3U3HA 2NXHA 3H7RA 4FX6M 5FAJA 1A50A 3VD7A 2I9EA 2XG9A 4ZSTA 5AYIA 4AVFA 3HTWA 1CGUA 1XIDA 2XVGA 4LVGA 4LRSA 1S2CA 5DXXA 3VE7A 4RPPA 2DP3A 2TPSA 1UUQA 4LWWA 5JU6A 4NJKA 1SFJA 1KLZA 4XO6A 5LGXA 3W70A 2GQAA 3F4WA 2XGBA 1QBBA 2YW3A 1LQ2A 3ARZA 2E6YA 1F5ZA 1BWVA 3HQPA 4J3SA 3QR0A 3KX6A 3FJ4A 3A22A 1FCBA 1VBUA 1V5XA 4IM4A 3U5YA 4JKMA 1PV8A 4F0KA 1LUCA 1RZMA 4REQA 4S3KA 1BSLA 3IARA 3WLMA 3DFSA 5CQ1A 3CASA 1BFNA 1O7AA 5KZDA 4M82A 3LHVA 3IVSA 2FTYA 4I5XA 3NUKA 1M03A 3H4GA 4CGTA 2HS6A 1WKYA 2A3HA 2V2CA 5DCBA 1OFOA 2QZRA 1PKLA 4RZ4A 1SSDA 3G77A 4KFOA 1R3QA 2OOGA 2WWDA 3W7LA 4QJ3B 1HL8A 3HJZA 3MBDA 1MFVA 3QR1A 3EWWA 1RA5A 2I5GA 2P0IA 3AS1A 4L56A 4EXBA 3M0YA 1SW3A 2TODA 4D6DA 2FTPA 4AIOA 1TA3B 4LPCA 4R88A 1LT7A 2OCZA 1XLJA 5I3FA 5EBUA 3C2RA 1F8IA 1UIPA 5DLCA 3HOJA 1W9XA 4XBKA 3N2XA 2BVWA 3OLGA 4GVGA 5AYBA 3DEQA 3S46A 4MY8A 4YMZA 5JBFA 4JNZA 3PJWA 2GSEA 1LL7A 3GH7A 4JHOA 4DF0A 4JEQA 2WCAA 1DWJM 1EDQA 4RW5A 4J28A 1E15A 1YDOA 3KBWA 1Q6FA 3RFAA 4E6MA 3AMKA 3GXFA 3N18A 4H7ZA 3UWEA 3EDFA 3MQTA 5HK4A 4PMQA 4PYSA 4MIMA 1YDVA 2CPUA 5LHEA 1SJDA 3T44A 1F8MA 1FCVA 2QMJA 3GTFA 1UA7A 3LRMA 5BRQA 1J0JA 1W32A 3WQ6A 5EMUA 5I03A 3VU2A 2DZPA 3IAQA 1UZ4A 3AAMA 4RNFA 2DY3A 4B2DD 1KO0A 3R0UA 2B4GA 3IJ7A 1QO2A 3LXAA 4UFKA 5MHBA 3AISA 4GXPA 1HZYA 4DI9A 1DJHA 3IPWA 4PUMA 5DMYA 4IMAA 8CGTA 3T8LA 1UOKA 5AC4A 5K3VA 1WO2A 4QAWA 3ZT5A 1PZ0A 5GJNA 4UQ9A 5F2GA 3FHAA 1OCBA 4CVUA 1GVYA 4NKCA 1MW3A 4DJDC 1W8GA 1AQHA 1TPDA 3FHQA 4JFTA 4I8YA 3WKZA 2PP3A 2ZRYA 5HJXA 1VBRA 2HK1A 3W2UA 4GWEA 1ZBCA 3QOKA 3RNDA 3U57A 3GTIA 1XINA 3W2JA 2PS2A 8TIMA 4WGHA 2FPTA 2J25A 1XIBA 2VZUA 4J27A 2O9OA 3H26A 4M6UA 3DECA 4B3KA 3CT2A 2VFEA 4URIA 3VILA 3MP4A 1JGIA 2GPTA 3EDKA 3FYYA 3TN6A 1FWFC 4W9TA 5I78A 3RN6A 4Z1CA 1SU5A 4KCUA 1KR0A 1B1YA 1Q6CA 1XF0A 2BGSA 1FHVA 2XYLA 4HSOA 4C91A 3MSRA 1NJJA 2E4TA 3MZNA 5LGZA 1B3YA 4RCXA 2V2HA 4LTSA 3BW4A 4MOZA 2C91A 3W7DA 3H22A 2QKFA 3LSCA 5D38A 2ZDSA 3AXXA 1XP3A 3PUGA 2HJPA 5HMSA 4GD0A 2CBVA 1QWKA 3KRSA 4MWAD 2O92A 3O7UA 1L6FA 3SN1A 1Q2RA 3OVRA 1SO3A 1X96A 1CXEA 4G7EA 1YBQB 3H2FA 1F07A 3U2ZA 1A80A 2ZQ0A 4NY2A 3WH7A 5H8MA 2FKPA 2P10A 4QS5A 2CHRA 3QQ1A 1G67A 5HA7A 1NQKA 2Z2UA 4BZYA 3DN5A 2QDHA 4MAVA 2YCIX 3G0UA 2Y6ZA 4PMNA 4J3ZA 2EKGA 1HN1A 3QGVA 5ABEA 4WIWA 2ZUSA 4NX5A 4PEKA 4ZCWA 3SRFA 4Q4QA 1PCWA 3WMLA 1FP9A 3GK0A 5LNVA 4PMVA 2J47A 3DG3A 4RNIA 3T0BA 4O13A 3IGXA 3GDBA 4EANA 1QJWA 2ISDA 1UKSA 1TREA 3AUJA 1GHRA 4GA8A 3QHMA 4GIAA 4XZWA 3HFTA 1UR8A 3E5PA 3LS9A 1YE4A 3R89A 1XV8A 3B06A 2G3FA 3QQ0A 1FXPA 3QGAC 2V3EA 1RK6A 1XKJA 3T78A 2A7PA 3PANA 4UC5A 5MKGB 1P0BA 1TPEA 5HXMA 2GZXA 4KEMA 5G1MA 3LUTA 1VQTA 1SYTA 5KTLA 5K9XA 4Z2GA 4GBDA 3BAKA 3ORWA 2VZSA 3CV7A 1XIMA 1VD6A 4QLKA 4OUEA 4PMOA 2Z7KA 1AW1A 1B3OA 3WJZA 3VD9A 4DBWA 1OFEA 3RCMA 2OTDA 3W7NA 2UY3A 2VZVA 1HFBA 3O0FA 1E9IA 2Q8ZA 1EIBA 3MO4A 3GM8A 3MC5A 1TV3A 3BCFA 3BLLA 2VGIA 5IFTA 3RR4A 4JXCA 4M3PA 1E9ZB 2I9UA 1PKYA 3KBVA 5DN1A 1OHLA 4RDVA 3ITLA 4GYFA 3G8EA 4LC6A 3M0MA 1WAWA 4LVBA 2XTKA 1OD0A 1YNPA 4IP5A 5CBIA 2V3DA 1WNOA 2VUNA 4OV4A 3T4CA 1JZ2A 2QHAA 3TNBA 4Z2HA 2PP0A 1LG1A 4P7OA 4R34A 4HU3A 4F9JA 3M47A 4O17A 4E2DA 3G6MA 2D22A 4JTJA 1JAEA 2HNHA 3TXZA 1M9HA 3USBA 3VDAA 4CNSA 3TMLA 1CECA 2CBUA 2TMDA 4MNLA 1XSKA 4MYAA 2ZA1A 2ZX6A 5DBTA 4S3EA 1DJIA 5D05A 3S2LA 3S6TA 2QGYA 1JYXA 2GDVA 5C9RA 1JDCA 4C1NA 5AHFA 4J2PA 1JAKA 4BWLC 1XPGA 4QG6A 5E0KA 2D2GA 5BXRA 1IT0A 1BKHA 2BHYA 4OVXA 4XZLX 1MW1A 4TMBA 1AJ0A 4BEUA 1DE5A 3HB9A 2Y88A 2RDWA 2YXOA 3W82A 4B2DA 1WDDA 4H4IA 3SY1A 2HCVA 3F5KA 1XYZA 6REQA 3EXTA 1IT7A 2PODA 1KBBA 5HUOA 3BZGA 3MP5A 4ZTYA 2CLLA 3GBEA 3S1XA 3UA4A 2WZTA 3WQEA 1OX6A 5C2GA 4AF0A 2NWSA 4ICCX 2NQHA 2DH3A 4PTXA 3PBVA 5T26A 2HWGA 2VFIA 2VKZG 3WBWA 4ADSA 1G1YA 5I3IA 4EPBC 1US0A 1U83A 1ALDA 4JFUA 5EFDA 3WIJA 1VYRA 4G6CA 3MMTA 4JKKA 1QAPA 4YVPA 4Q4RA 3DHPA 4G7EB 4TVDA 1XYBA 2ZA2A 1D9EA 3AS0A 3QJAA 4FS9A 3UYCA 2X0HA 4Q7IA 3ZR4A 1UH4A 3VMPA 3SCRA 3ARSA 5HPOA 3PJTA 4AZ7A 2HBXA 4QQUA 1H60A 3SDOA 3I7RA 1XLHA 4XKYA 3PZGA 2ISVA 2VEFA 1KQYA 1W5NA 4ICNA 3FKKA 1ONEA 3RLHA 5H1WA 1I0BA 5LHFA 4DJEC 3W37A 3KZSA 3MSYA 2E28A 2QJMA 3PFMA 1U5VA 1MFUA 4MTVA 4P7RA 2PZ0A 2A3AA 2E25A 3FJNA 4AEOA 3HZ3A 4AY8A 3LHUA 3NO1A 4C6CA 5BXTA 2XJ7A 2J8FA 2C6QA 5TAOA 3SY8A 4Y9NA 2W3ZA 1W1PA 4D8LA 2AAMA 3WLTA 3Q4DA 1ENUA 4FMVA 2A79A 2PWUA 3EXRA 4AUBA 4GG9A 4W7WA 4R7OA 2VUYA 4D2JA 4XV0A 4EX4A 3QPEA 1LBMA 1H7XA 3GYEA 4UZUA 2IUZA 3LX9A 4JCLA 1VFHA 2D1ZA 1QT1A 4KGJA 2C8NA 5BMWA 6TIMA 1KFWA 2HE5A 3WEMA 1XRSA 3PP7A 3WQWA 4RXFA 1I2RA 3PZNA 3CTTA 1J8VA 3IUHA 5MF5A 3UEQA 4QNEA 1FWEC 4Q4PA 1V02A 4UZSA 3TFCA 4IMCA 2I56A 3QQWA 3LCHA 3TJ4A 1N7KA 2GFTA 3UCQA 3TAKA 4ENLA 3USZA 1XFBA 3RX3A 3MZ2A 4MUZA 1ADOA 1OFRA 4O1BA 4FNQA 3V3WA 3BARA 2VRKA 4QJ1A 2I57A 1OYAA 2EAWA 3BUVA 3IANA 3M0HA 3VNMA 4LC8A 4O28A 1DE6A 1NY1A 2V69A 3AS3A 3LRLA 3STFA 1W17A 4C6QA 2R94A 4GINA 3Q65A 5DQPA 5EGRA 2GQ8A 3VIGA 5D32A 4GZ7A 1MRAA 2D3NA 2VZOA 2JF7A 4K36A 2C3ZA 5LIWX 4QEEA 4XG1A 2E5CA 2J8GA 4NXSA 3GZAA 3W85A 3WO8A 3FDGA 5AHLA 1L2QA 2BY0A 2Z6IA 1XLCA 3B8TA 4GC3A 1DQUA 2DPEA 2YJQA 4CU6A 1LWHA 3VZXA 1SR0A 2YOCA 3E96A 3RLGA 2EG8A 4KRUA 3V5FA 3EXSA 3JVAA 1R87A 2R8WA 3N4FA 1GWJA 4V33A 1J6OA 3ARPA 3LCXA 4UTWC 5AFDA 4WY0B 3BOXA 3S2JA 1LBLA 3ZJ8A 3MO7A 3MWCA 3TIMA 2VNCA 4UTJA 1H51A 1TR9A 4LV9A 1QI3A 1QR7A 4PBGA 4LS2A 3B0UX 3GFYA 3PBGA 3NIYA 4B5UA 4IPLA 4MF4A 4ZQPA 3ALGA 1V6YA 4XZNX 5EYWA 1O5XA 2CHNA 2NV9A 3JW7A 3PR2A 1BG4A 3N15A 3CV2A 4QE4A 4DWSC 3UR5A 4AC7C 1XR2A 2J7GA 1IR2A 4JTEA 3NM3A 4PZVA 1AH0A 3VNKA 3UR8A 5LNUA 3C8FA 1E4IA 4G56A 1OX4B 1U30A 1ISWA 2DW7A 1UD8A 2PGEA 1T8QA 3CHFA 1JCXA 5LXEA 3CQIA 5I3DA 2VGFA 3IRDA 4GI9A 4ILSA 4CQDA 1MEHA 4W93A 4BI6A 4Y7EA 4BI5A 3BC9A 1GORA 2VFFA 3MCNA 3BAJA 1TTJA 5HANA 3SFWA 1AH4A 4ROQA 4DO6A 5AC7A 4I9AA 3PAOA 4CNNA 3P2VA 1XRVA 5KSWA 2PTZA 3JUGA 3GAYA 3EX4A 4I5RA 3DOPA 2ZX7A 1ICSA 1EP3A 2C0AA 1JPIA 4LEFA 3POCA 3GIYA 1P7TB 7A3HA 4LQ1A 1SR9A 1BYCA 3WMSA 4Z1AA 3M6YA 4NRRA 4FAMA 4JX6A 1MRQA 3W1LA 5EFFA 3KL3A 1XSJA 5CAHA 1GQKA 1R46A 1YADA 2FMOA 3ITVA 1PYFA 2R24A 1O5QA 2VEMA 4DNMA 2WJDA 1FFQA 2AOSA 1TELA 1JZ7A 3S1GA 3UETA 4YTSA 3C0JA 3GAKA 2RAGA 2ABBA 1PBGA 3UXAA 3P61A 3G22A 4QGCA 4X2PA 3FEMA 2V68A 3L2LA 5I3KA 4A8LA 3VNJA 1SO4A 3KDOA 4IPJA 4PMDA 3E2QA 2D0GA 1P6BA 1CYGA 5K4ZA 3B0YA 1SUXA 5A6BA 4HJWA 3LHZA 4H9TA 5F2IA 4F48A 3VD4A 2XIIA 3TR9A 4R5EA 4HN8A 2Q3OA 1EA9C 2QIWA 3AHYA 3O16A 1JIBA 5TD4A 3WMBA 1TJPA 3CQHA 2D0HA 4IX0A 3ZSTA 1YPFA 1F4HA 4XD6A 3OBKA 1FH9A 1V6TA 1QCWA 2BX7A 3J7HA 2QF7A 4GGHA 1UJQA 3RPDA 3H53A 3L12A 3N17A 1NWRA 4CQ9A 1O6IA 4L6HA 1H5VA 2Z2BA 2XSBA 2CW6A 1MWOA 1GJPA 3PJUA 3HN3A 4XISA 4KIRA 3PPHA 3WLKX 4E4PA 3IVTA 1QHOA 2B7OA 2P0OA 2WWCA 3BLDA 4IPNB 4XUYA 1EC8A 4L4PA 1G5AA 3TH6A 4A3HA 1PTGA 2AGTA 3A3WA 1NFGA 4GACA 3BWWA 3M5YA 1HJWA 3O9NA 3FKRA 1FWBC 3I3DA 2ACUA 4ZQRA 4NUWA 2FPYA 3NGFA 1BVWA 1IEIA 1KM1A 4P8UA 2E9LA 1BG9A 2ZXBA 3BK0A 4NZ4A 4XIAA 2DJXA 1YTKA 4NJGA 1X6NA 1TWZA 2JF6A 3NL6A 5GVJA 4L9ZA 2YZRA 3WF2A 1B90A 3TNOA 1XIJA 4W5UA 1W37A 3OO2A 3NPUA 3DKLA 1EA0A 1V77A 1PX4A 3ITGA 4YNGA 1E4LA 2ISSA 4O0QA 2IQTA 1MQRA 1FVPA 1H1YA 1L8PA 1P1MA 1VR6A 3ARTA 5KZ6A 5AHIA 2OLHA 3W3OA 4F79A 2J79A 3A64A 4UTFA 2Z29A 1ISXA 2OEJA 2W62A 1XIGA 4LY4A 3VIIA 1LUCB 2AL2B 3E49A 1XLKA 3Q58A 5G2IA 3FOKA 5FEPA 1NF0A 1ONXA 4KEVA 5T9BG 1TV5A 3R8HA 5E9XA 5I79A 1TV2A 3BAWA 6A3HA 1JFXA 3L4TA 4MNJA 2YBUA 3N2MA 1JCJA 1BLIA 1GVQA 3MUCA 4US5D 1NM9A 5C9ZA 2YDSA 2WNWA 3PTDA 4ZVJA 5CSUA 3O07A 2E6FA 3QLLA 4N9BA 1XG3A 4PRRA 2WNNA 1HW6A 3P80A 1O5KA 4WVXA 2X41A 4DZAA 1Q13A 2XFRA 2AKZA 1HP4A 1U2YA 3TYZA 3KCLA 4NZ1A 1FXQA 3THDA 2DZWA 4O4WA 1NOFA 1K9FA 2EPOA 1O12A 5A2BA 4HN4A 3IAPA 1FDJA 2KAUC 1GJUA 5FJRA 1S3HA 3ZLGA 2XIBA 2QUTA 2QUUA 3BL3A 2P3ZA 3VX1A 4JL2A 4FNRA 1EOKA 3MYPA 2PZNA 1MUWA 3NL3A 4PN2A 4E8CA 4O19A 4RUBA 3N6HA 1WDSA 1DJQA 1Z48A 2ICSA 2J7CA 3QHNA 1EO5A 4JPGA 4FPSA 4D6CA 2GWGA 3WD2A 4RNHA 1VPQA 2OXNA 1JZ6A 1HX0A 1A3HA 1PWMA 4K8GA 3LPFA 1L9WA 4IP4A 4O1DA 3G1YA 1PSCA 1VENA 3NZGA 3C2YA 4ZZ9A 4CVWA 1KKOA 3BLOA 3GSMA 3POHA 1R8LA 1I1XA 4W87A 3HG4A 1V93A 3S6OA 2YLLA 4LRTA 4Q4OA 3TXVA 2NV2A 4JQ1A 3C0LA 4H01A 4N2YA 4XUGA 5A8GA 1RCOB 5D2TA 3UPWA 1WZLA 3CPGA 3S4TA 4B91A 1OIMA 3M46A 4NF7A 3FVMA 4HHMA 3QZ6A 3ARVA 4O8RA 3M44A 3ONCA 4R85A 3UU0A 3K4WA 2OX4A 3ME3A 1L2UA 4AY7A 3UZXA 2WKGA 3C2EA 1XLLA 3GH4A 4UFLA 3SUVA 4ORIA 4GK8A 1XFCA 5F7UA 4O0KA 3E0IA 4Y9PA 4A8NA 2EXOA 1JFHA 3FFSA 4BF5A 2ZTKA 2E67A 3QKEA 3T0TA 2VX5A 4F3HA 1REQA 1RVGA 3OGSA 3UWWA 3JRKA 4KQNA 4V28A 1XISA 4GVIA 6CGTA 4H19A 1JXJA 3GC4A 4DAIA 3FXYA 2CKSA 2E1DA 1FH8A 1PEZA 1NDYA 1UCWA 1PIGA 1RK5A 3W7JA 1MZRA 4FO4A 1ZJBA 4GIYA 1RBAA 2VZTA 4AVOA 5I24A 1E6SM 1JF5A 4YCOA 4WJXA 4ZODA 3PWIA 2XH0A 2YIHA 1X7IA 4DYEA 4HYRA 1D8CA 3VCCA 3CV6A 1XH1A 2A2IA 4E2OA 5IRPA 1OGBA 3W87A 4H8UA 4KESA 2MNRA 4B3LA 1XICA 5HQEA 4HK5A 1XIIA 5ECVA 4X61A 5CLTA 4M5PA 1RV8A 3GU1A 1TV8A 2HXTA 2NQ5A 3S2MA 3TYCA 3VOCA 3KBSA 4L80A 4PFHA 2GVLA 3I65A 3O6YX 4GQGA 2WZIA 4PTWA 3BCDA 3QF0A 1LOQA 5IXEA 5GJMA 1M01A 2PLCA 4IIBA 3MKKA 3L4ZA 1RSCA 2OMAA 3LTSA 3GNXA 4L61A 1FHDA 1OM0A 2DT3A 2FZMA 5IOBA 1TJ1A 2J9YA 3M5XA 2HRWA 4LAZA 3E3HA 2I17A 1QNOA 4BCEA 7ENLA 4UMAA 4NILA 1XQKA 5JXQA 3NCOA 2I5QA 1VP5A 1HJSA 2DQWA 2Z1SA 3WQ5A 3TTOA 1XBXA 1VJZA 1EYWA 1KB3A 4K3ZA 5H2ZA 1AUSL 4AZCA 3F4VA 4C6DA 2PB1A 4U2ZA 5FL1A 2E5BA 2V5KA 3PS7A 4WKHA 3UG8A 1R3YA 2QF8A 3HA1A 1UASA 3EX3A 3WUEA 3EDDA 1I0DA 5JIWA 4JFWA 1NVMA 1OX4A 3F5LA 3CM4A 3NO5A 1A49A 2D2OA 2DVUA 3VKDA 5A8MA 5CJ5A 4O1EA 3H8AA 1JPKA 4MY9A 4C7GA 2ZCGA 4BKNA 1CNVA 4XZHA 1CXFA 5CZJA 4MJ4A 2YL5A 5GNZA 1QU4A 2BZNA 2OELA 4GKLA 1IEXA 2QGHA 1YLVA 4AFYA 2O4QA 4HMNA 3BG5A 1V0KA 1WA3A 1FKXA 2IPWA 3TUUA 3W72A 1T8XA 4JHMA 3RM9A 2VVNA 4DPPA 3CUXA 2OQHA 3H24A 3C86A 4PULA 1SGJA 3FIGA 3SIMA 3CL8A 1ME9A 2J88A 4V2XA 1F76A 2Z26A 1F3XA 1R5YA 2Y8UA 3M9YA 3WL1A 3CGTA 2OFJA 5C0QA 1QHPA 4IQLA 1VF8A 3NDYA 1BQCA 3WEOA 3GTXA 1PL9A 3WNLA 3NTYA 3IWPA 3NPWA 4PL2A 2IKJA 2WSYA 3K30A 4ASTA 3LB0A 3CH9A 3BE7A 4DJDD 3PTQA 4POCA 4RLIA 1PKMA 2ZZ2A 5BOEA 3W01A 2VP8A 1Q6OA 2HEJA 1B31A 2GUBA 3WF0A 4IIDA 2FGZA 3VO0A 4UCGA 1PWLA 3H7UA 1B9BA 4C7DA 4XKYB 3W24A 2QUVA 3P0WA 2DSVA 2DVTA 4LOCA 3W6MA 4I3GA 4FXJA 3LGDA 4O15A 2V82A 5G1TA 1JCLA 4XSMA 3ID7A 3L21A 2CETA 3S9ZA 3ANUA 3MDUA 3SCTA 1XLBA 5FF4A 3RJXA 3G5EA 2RDUA 2JKAA 5DMMA 3W0KA 3EPOA 4ATDA 2JGYA 1WUEA 2Q01A 5GNXA 5JH1A 1I8JA 1NF7A 4MDPA 4IICA 4U33A 1H7NA 3FLUA 1ODZA 3SAZA 3A9BA 4PR4A 5BNKA 3DHFA 3EX2A 1NU5A 3BAYA 3DUGA 3PSVA 5FAGA 1JXKA 4L4MA 2VFDA 3ANVA 4MSSA 1QNQA 2VC9A 4ZB5A 3TP4A 5FJUA 4RL3A 3VCRA 1H2JA 3G1XA 3STGA 3N2OA 2FDSA 2V5JA 2ZZ1A 4UR8A 3QYSA 2PCEA 3B8VA 3FCPA 5CCZA 3IK2A 2J8TA 4J3XA 2VENA 2CITA 3CT7A 3TLQA 1PAMA 1UG6A 3CL6A 2CLPA 1VFFA 1J18A 4HQVA 2XFYA 1FX6A 3GFZA 1QW9A 4DEFA 1IF2A 1T41A 1Q6QA 4OBSA 4JTFA 1DHKA 2ZWYA 1RJPA 2YCLA 3BZJA 3A5FA 5HINA 3STEA 3P81A 3MKVA 1RPKA 1N2VA 2VCBA 2YSWA 2A7NA 2VWSA 4ALDA 4QSHA 4X9SA 1LL4A 4D72A 2V8ZA 1X6UA 4HPHA 5BU9A 1SW0A 4ZL1A 3B8SA 2WVSA 3GTHA 3UXLA 2NZLA 2TSYA 2X1IA 2DSUA 4FNPA 1I9CB 3TZNA 2FZ8A 4D1IA 1NSJA 4C6BA 3P6LA 4B5XA 2FZNA 4LB4A 3EMQA 3BMWA 4G2DA 4Z42C 4FXFA 4UWMA 1DOSA 4HPXA 4HK6A 4TTGA 3CXOA 1GTEA 2EJ1A 3HG3A 1XLMA 1LP6A 4E8DA 4IZGA 2Q6ZA 3KRUA 1P6WA 3QTGA 2YGYA 1GQIA 2BB0A 1LOLA 3BLEA 1ZRQA 6XIMA 2VDHA 2ZUMA 5CEWA 2HTMA 3PPCA 3C0SA 4L9YA 3E0VA 2WLZA 5DT5A 2OZTA 2INEA 4WZHA 1XSIA 4IIGA 5D8WA 3P5ZA 4FXRA 1G7VA 5ABFB 2HDJA 1VBHA 3MJMA 3SGUA 3GQYA 4XBJA 1EZWA 2VQTA 3S6DA 3TOYA 2JGQA 4X22A 3OOQA 4X0VA 4LVFA 4W7UA 3KTSA 3DYPA 3R94A 3W84A 2VJXA 3IJQA 4C6FA 4AWSA 5G5IA 3I6RA 4DY1A 2Y63A 1FHLA 1TPWA 4UQBA 1ML1A 1BYDA 4L6OA 3R8GA 4WGXA 4XD4A 1F4AA 4OOZA 3ZZ1A 1BRLA 1PTDA 1KRAC 4D8AA 3R13A 4HGXA 3QHOA 3UWUA 3GVRA 5DEZA 1Q7MA 3EWDA 7REQB 3KL0A 1UR9A 1IIHA 1TSIA 3VDHA 3QW4B 2IKIA 1CDGA 3WLRA 3LOTA 3V4BA 3OA5A 2PDFA 1GZJA 4IGSA 3PN8A 2CWNA 1F6PA 1FRBA 3SM0A 1J0HA 5H6HA 1BQGA 1QOPA 5CPTA 1TPUA 1FCUA 1RY0A 2DZUA 3ZLHA 3AIBA 3W75A 4A35A 4O1FA 1XYCA 5CBBA 4C65A 1GQJA 1XKYA 3O3RA 4JIRA 3I4KA 1TX2A 3VZYA 5FSEC 4LYQA 3WFLA 4FLRA 3W7IA 4DO4A 3OYXA 5D2VA 3M0XA 4Q8NA 3WJYA 1YDYA 3GNOA 5CPOA 4N02A 5EU9A 2AMGA 4MZ8A 3FEQA 4NXKA 4GYPA 2NX9A 1UZDA 2PE4A 1UWAA 1IZCA 3VNLA 2PDCA 4B5WA 2JKPA 4J35A 4Z2JA 1AVAA 1YDNA 5AKQA 2CXEA 1TPVA 4D6GA 1HVQA 1RP9A 1EJVC 3URAA 1E6NA 3WDHA 2OKOA 1FDZA 3TDFA 4UTKA 3U5UA 5M5DA 3M0IA 3MBFA 5E5CA 4OOUA 2HV5A 1XC6A 1DJGA 4N0RA 2B7PA 4RE0A 4W8AA 3OPSA 3S5SA 4LXFA 3VOGA 1EGZA 1XI3A 3LCWA 3FA5A 2J7FA 5LXXA 1H1NA 2DGAA 6PTDA 2V3GA 1ME8A 1TIWA 3TQKA 2R82A 2Q8LA 2Q3RA 5TIMA 1XYMA 3WQ4A 1YIXA 1RHCA 2XN2A 3IUDA 1FWWA 3P74A 1UH3A 5DMNA 1UR3M 3K13A 4J3TA 4UQCA 4IPIA 3OG3A 4M24A 5A5WA 2J75A 3S5NA 4FA3A 2JE8A 2NT0A 3KL5A 1KCLA 3HPZA 5D2WA 1XW8A 3CU2A 5JMUA 1P4CA 1KCKA 1FP8A 1HKIA 1V3JA 1XDLA 2A21A 4G8TA 3P8IA 2RH9A 4MYXA 2HSAA 4IF2A 3IJLA 1K4GA 2HBVA 4S3AA 1JVNA 1W8SA 2XIQA 2V0TA 4CQBA 2YCKX 3UY8A 4EPKA 4ZMGA 4JIQA 2X8RA 2J13A 1T7LA 3LDVA 4C6MA 4DJFD 3XINA 4WOQA 1NAL1 1K7XA 2JEPA 2ONEA 4CN4A 3WLHA 1XLEA 4M51A 3UCCA 3U48A 2EQDA 3BPWA 3WJXA 1AMYA 2TAAA 3RM4A 3W25A 4JIPA 3KRBA 4ZTXA 2YCJA 4TX9A 2DIEA 1MO0A 5D9OA 1ZBWA 2QXWA 4EVZA 4IMDA 3ZR5A 3PVFA 3P8JA 4D6IA 1YW1A 4WXZA 5CJMA 4NRSA 1W6TA 3AYVA 4Y90A 4RR4A 5HNNA 1EJTC 1XIFA 3PUDA 4GNJA 5HMDA 3VKBA 1R7AA 1H5YA 3WCZA 1NFBA 4HIBA 3L5MA 2NSXA 1V02E 4QJ5B 1EPXA 4DYKA 5CPLA 1HO4A 3MUY1 2Z7GA 4GMEA 3UR2A 4NJIA 2FLIA 4KIEA 1P0DA 2QVNA 3W7MA 3EDEA 3RJYA 1X98A 1RQHA 1W1B1 2YCEA 4MJZA 4A8IA 3QGKC 4C6EA 4CEXC 3WF4A 2D73A 2DT0A 1XYAA 5FF3A 3SFKA 4F0MA 3MI3A 2YBTA 1KCZA 3EKLA 3S9IA 2W61A 4GH1A 2WKJA 5KINA 4WHBA 4YTUA 1B3ZA 3E02A 1ADSA 5C9WA 4BWLA 4PUKA 4QLJA 1UP2A 1H41A 3LBMA 1I45A 1CWYA 1JZ3A 1QOXA 4UFJA 4WY0F 1D2KA 1TWSA 1TTQA 3YPIA 1G69A 1VYSX 4PB5A 2EHHA 3B3DA 4ZO9A 2G0WA 3UYIA 2A85A 2PDMA 2VFGA 1GUVA 3F03K 2E8YA 1N8FA 1SFLA 3M0ZA 1IGWA 3PULA 4BQ4A 4ECLA 5DELA 3A4JA 1JCMP 3NZ1A 4YLWA 3WX7A 1JL8A 3L4VA 1KR1A 1MVYA 2X1RA 2X40A 9CGTA 3SCUA 2YFNA 3VFCA 1X38A 3I6EA 4BF7A 3HGOA 4S3GA 1J11A 2E77A 3UNDA 4CEUC 4FP1A 3L4XA 1PXGA 1H0IA 5CC7A 2WAGA 2V81A 3EX6A 3SRDA 2PRHA 2VI0A 3URNA 1JPMA 3LCFA 3NEHA 1UUMA 2A3CA 1QBAA 1FWRA 1UKTA 3BQ6A 3GIPA 3V0TA 2G37A 4HK7A 3N9RA 2XIOA 2PDUA 3QZAA 4W84A 4OT7A 4XX6A 1B3VA 3N11A 1A3WA 4YN5A 2YYTA 4NJHA 1QI2A 3LZ3A 4K1GA 4GQRA 4OIFA 3BAXA 4ZOBA 4HTBA 3HG2A 3M0KA 4HA1A 4E3VA 3MVIA 4QX4A 3TWAA 1GOOA 4XAFA 5A2AA 4DPQA 2WLYA 3T05A 3PZ9A 1AQFA 3G8RA 1QUMA 3H6OA 3KBNA 4HZ8A 4B92A 4O18A 1HKVA 1TR1A 1YKWA 3D47A 5FKYA 4L6DA 4OZOA 3RDKA 2PDJA 3EOLA 2QYGA 3RO8A 8A3HA 1IQ8A 1G4TA 3GY1A 1UB3A 2R1NA 1SSGA 3CH0A 1H09A 2ISWA 3AS2A 3BJTA 4NYUA 2P8BA 4PRTA 5KZEA 1QNPA 1H1ZA 3L5AA 4XAGA 4DUOA 5HR6A 1YNQA 2VYOA 5JH2A 1JDFA 1XCWA 1A5AA 1Y5XA 4MKSA 4DUXA 2O4MA 3KVMA 3G24A 4C6JA 1ZCCA 4L1XA 4YVXA 2BXVA 5IFPA 3GRIA 4Z1YA 1CGWA 3WQVA 3NNTA 4GY7A 4PCSA 3UPMA 3QFWA 4F0RA 1LWIA 4ZA0A 1OZQA 3Q94A 1TZ7A 5HATA 5ECUA 3I68A 4Z17A 1XWYA 4H9XA 2HISA 3HQOA 2ASHA 5C7HA 3F2BA 2IMRA 4DIAA 2QCCA 1XM3A 3H2CA 2CEQA 3ZM8A 7XIMA 2EPLX 4OBTA 1QFEA 5EMKA 4Q8MA 2PDPA 2QCLA 1OT2A 8XIMA 3LV5A 3H54A 1GW9A 2OSYA 3A23A 1B4KA 1M5WA 2ZRUA 4FLSA 5AC6A 2Q8XA 3NVDA 4WF7A 3KVKA 1RJQA 3W53A 3CEPA 1R47A 2ZE3A 3GVGA 4IMGA 3W00A 3FDKA 4D6HA 1DIKA 1NTHA 3KTCA 4I7UA 3GE7A 2E09A 1W56A 2UWFA 4GYJA 4BS0A 3PSWA 2WSRA 3ZQ9A 1IE7C 4J3WA 3W23A 4DO5A 1E5NA 1FH7A 3LMYA 3WLNA 3TZFA 1EEXA 3WLIA 4MLRA 5D2XA 4QXIA 3B05A 5C8BB 1W5OA 4WJ8A 4ZENA 1C90A 1M04A 3PZTA 5BRPA 4BEQA 4DN1A 4B15A 1W3IA 3W7QA 2FFCA 5A3HA 1RP8A 1DJWA 3OYZA 4HHPA 5I09A 2SFPA 2WZMA 3AHVA 3WLOA 1QATA 2BXZA 1KM6A 4GYPC 3VX0A 5CSYA 5DY3A 2D2HA 4M56A 5GQBA 5HJLA 3D3AA 4A4AA 1AFSA 1PIIA 1B0IA 4FSAA 2UBPC 1K77A 3T4WA 1V7YA 1VCVA 1TQJA 4NX0A 3S1VA 2NQZA 1NWTA 2CZVA 3PM6A 2H9AA 2GSJA 4L1GA 4Y8EA 3A4AA 4GHRA 3WSUA 1JZ8A 1J10A 4I7WA 3ZR6A 1J4EA 1W2PA 4L9XA 3CLMA 1REQB 4GCAA 1JYNA 1E1EA 1GVEA 1MEIA 1FWSA 4MB1A 3OZPA 1R9XA 2NUWA 3FXGA 4H8NA 4RE3A 3SW6A 3LM3A 4A8RA 3CWNA 4AG0A 1FUYA 1Y0EA 4PCTA 4MZYA 1ZU8A 3SSJA 2W91A 2FIQA 4UQDA 4IIHA 1S46A 1EIXA 4U31A 1PUDA 1OFPA 2Y5JA 3C6CA 4IMEA 4GZIA 3TC3A 5AVHA 3TVAA 1OX5A 3QVQA 4JQ3A 2FH8A 4RX0A 4PMJA 1J96A 3SCSA 2HK0A 1KV8A 2NSOA 2RGLA 4H41A 4XB3A 4CN1A 1D3HA 4UUIA 2BWGA 2ZKMX 4O8AA 4LCRA 5D02A 1J0KA 3SCNA 3R43A 4M19A 2ZXQA 3RLUA 3UWQA 4AIBA 4LUSA 3GB6A 3KW3A 5A2CA 2HXUA 2X0YA 1R2SA 3WQPA 3GR7A 4JQAA 1Q8AA 9XIMA 2ZUTA 1E51A 3PK7A 4ZQMA 5D4YA 3SN0A 1MW2A 3B4YA 1VIWA 3NSXA 3HJEA 1KFEA 3L68A 4GJ1A 3PFRA 3BV7A 4KWSA 4H7VA 2J62A 2OWCA 2R1MA 1DWFM 5BCAA 1RQBA 3APYA 5K2ZA 2GOUA 4KBXA 2P8CA 3TWBA 1DVJA 1N8WA 1E6QM 4QDWA 2VC6A 2PTDA 5BOFA 3S5YA 3LLDA 5REQA 4O11A 3LBCA 1UWTA 1J6PA 2AL2A 4LY8A 1X97A 1UYQA 4HZ7A 4AZBA 3SCVA 3RHGA 1XCFA 2G5WA 4N42A 2PGWA 2WVVA 4IQJA 3OJGA 4UTLA 4GIRA 4B16A 3ZMRA 5F4XA 4N4QA 1W1TA 4MLJA 4LUTB 4MWAB 1WYIA 3CHDA 4N6EA 3WEZA 1V6WA 4TXEA 3AUOA 4M29A 3ZT6A 2V9DA 2QNEA 3GKFA 3VNZA 1WDPA 3CIWA 4ZQCA 1H7WA 1OYCA 2ACSA 1ZUAX 3SGZA 4HNCA 2VVSA 3KOWA 4UOZA 3U0HA 3E12A 4O4VA 4MADA 4P7NA 3F2DA 3KAOA 3VTRA 4WSKA 3M41A 1FWJC 3MWAA 2JFEX 3AYTA 4NYYA 5EA9A 2VX6A 4EIVA 1TYGA 3LLFA 4FZIA 4CCCA 3R2GA 3LGGA 4QDMA 1P7TA 2ZTJA 1ZCOA 4LX4A 1SO5A 1T40A 1M3UA 1XCXA 1JCNA 3NOEA 5CG7A 2H90A 4Z2IA 4P7LA 1VPYA 4GQBA 3U8GA 1M1BA 2CWXA 1Z8AA 3MUXA 4KGLA 2C13A 1PKNA 1CPUA 4MHBA 4U5IA 2OR2A 4K7VA 1SZNA 2PDYA 2ZXAA 1HNYA 3NQ6A 4KEZA 4KMQA 1GJWA 4S39A 1M65A 4Z0SA 4GRSA 1ISVA 1HJQA 3CO4A 1G0CA 4DJEA 1J2BA 3DFPA 1E72M 1CI1A 3D46A 2Y24A 1YYAA 2CBIA 1N55A 3H4XA 3IUIA 3Q2DA 1E40A 4DNHA 1S2WA 3GH5A 1WZKA 3WBEA 3XIMA 2POZA 2C1IA 4LBSA 2QJNA 1OY0A 4GI6A 3CIVA 4TOQA 1YHTA 1XIHA 3CV1A 5D2YA 1LQ0A 1OFQA 2BXYA 3RMJA 4TTUA 4R7JA 2G50A 4JR5A 3IV3A 3HGJA 3TA9A 2OO0A 2WVTA 5LA1A 4JQ2A 3MYOA 4DBUA 3RUBL 3OG2A 2OT1A 1HL9A 3PC0A 1AL7A 3KLLA 1DKWA 4JQ4A 1UKOA 3CZ8A 1DYSA 3KWSA 2X42A 3B9NA 4O50A 3VGFA 1JPDX 2BDQA 3GVVA 3TONA 2DUZA 3P82A 4HNNA 4XAPA 2Z25A 3KS5A 5SWUA 3CJPA 2WANA 6ENLA 4UTMA 2C0HA 3R6IA 2GYIA 1MSSA 1K4HA 3BANA 1E1CA 4RKAA 1EKOA 4IFOA 3CS2A 3WH6A 3V5OA 4CQCA 1CXIA 1OF8A 2H3DA 2GDUA 2BASA 3HMJG 3N14A 3GU2A 2G4JA 2RUSA 4QITA 2XIJA 3TKFA 1LLWA 1JG9A 2HROA 2WBKA 3W1MA 3VIPA 3FN9A 4JYDA 3GG8A 1G7UA 3AZTA 4N4PA 1RA0A 4AD2A 3D6NA 4Y9MA 2G96A 4NZFA 3FJ6A 2PF0A 4NU7A 3SSZA 4DM1A 4G7FA 2IW0A 4NHVA 5DFAA 3P7YA 4PCPA 4FX8A 2A6LA 1WDRA 4NL1A 4I9TA 1EJSC 1OVDA 2EO7A 4NZ3A 4UTUA 4CU8A 2GJRA 1XLAA 1PS9A 2D0FA 3O06A 1AZ1A 3MUIA 4PMRA 3LXCA 4JICA 1V3IA 4NI3A 1H0GA 3V1HA 1QXLA 3UNTA 4JZ5A 4K8EA 2G97A 1LTDA 2B81A 1A5KC 3CUHA 4Z2KA 4CNOA 4W88A 2ESCA 2Y62A 3U7VA 4Q33A 1SJAA 3W7PA 4ZB2A 1Q85A 2AMXA 1SO6A 3PAJA 2YBVA 2W5FA 1JUBA 1E9LA 1EQPA 3NL5A 3EWZA 4Q8TA 4UFHA 2TYSA 1OC6A 4ROPA 1EJWC 3OBAA 3KOZA 2CZEA 2C71A 5LNWA 5I3HA 2DZBA 1PO9A 3NQ8A 1ONWA 1HUVA 1SZGA 3CHEA 3KP1A 4MB3A 2PBOA 4HB7A 5U4NA 3VC5A 4HOXA 1GVOA 1ZSXA 3VOIA 1W3LA 1XH2A 4NVTA 3MHUA 2E1WA 4WJEA 5HULA 3ES7A 1GVIA 4H83A 3TAOA 1QVBA 2NV1A 3LZ5A