2WWDA

3d-structure of the modular autolysin lytc from streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
432
structure length
432
Chain Sequence
NAAAYWDGDYYVKDDGSKAQSEWIFDNYYKAWFYINSDGRYSQNEWHGNYYLKSGGYMAQNEWIYDSNYKSWFYLKSDGAYAHQEWQLIGNKWYYFKKWGYMAKSQWQGSYFLNGQGAMIQNEWLYDPAYSAYFYLKSDGTYANQEWQKVGGKWYYFKKWGYMARNEWQGNYYLTGSGAMATDEVIMDGARYIFAASGELKEKKDLNVGWVHRDGKRYFFNNREEQVGTEHAKKIIDISEHNGRINDWKKVIDENEVDGVIVRLGYSGKEDKELAHNIKELNRLGIPYGVYLYTYAENETDAENDAKQTIELIKKYNMNLSYPIYYDVENWEYVNKSKRAPSDTDTWVKIINKYMDTMKQAGYQNVYVYSYRSLLQTRLKHPDILKHVNWVAAYTNALEWENPYYSGEKGWQYTSSEYMKGIQGRVDVSVWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 1,4-BETA-N-ACETYLMURAMIDASE
publication title Insights Into Pneumococcal Fratricide from the Crystal Structures of the Modular Killing Factor Lytc.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 121
structure length 432
sequence length 432
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
A PF01473 CW_binding_1 Putative cell wall binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wwdA02
2ZUSA 1LL4A 1SFSA 4U5IA 4N0RA 1FP8A 1J0IA 4XZWA 3WFLA 1W2VA 2WWDA 1GOWA 4MADA 1LG1A 2YL6A 4WKAA 4LGXA 1CGUA 2Y8VA 1Q4NX 3K8MA 4AZGA 1ESWA 5FD0A 1FOBA 2WSPA 1OWQA 2XIBA 3UR8A 4ZE4A 4XV0A 1ODUA 5HXMA 2BY0A 1GW1A 2OWXA 4ATWA 1I1WA 5I77A 2CBIA 3NSNA 2CNCA 3RJYA 3AMKA 1G1YA 4J3XA 2WC3A 4J3TA 5LA0A 2QHAA 3PZ9A 1S46A 2X1IA 5A6JA 1XD1A 1H2JA 2WMHA 3WH5A 4D1JA 4TTGA 3ARTA 1W1TA 3HMCA 4HZ8A 3RO8A 1UD4A 2GUYA 2WZIA 1VEMA 3BAYA 3RM4A 2WHJA 1XC6A 3N11A 1AQ0A 4WLCA 3MO4A 3FHAA 2DSVA 1VFFA 2YBUA 2BVTA 1B3VA 4PMZA 5C71A 1C91A 3RCNA 3GBDA 3CMGA 2OSYA 2IXUA 4DM1A 2FHFA 2J75A 1P6WA 1GCYA 1FH7A 3WL0A 1TUXA 3L2LA 3VGEA 1K9EA 5DEZA 3DYOA 1MWOA 3VD9A 1GQKA 4RE3A 4LYRA 5GNXA 5IXEA 2WVSA 4JFSA 1UKPA 2J62A 1WB0A 5A6BD 4P8XA 3UG5A 1WDSA 1TG7A 1CXFA 1CBGA 3NUKA 4CKQA 1KWGA 2O9RA 3WNKA 3U7VA 1UR4A 1HKMA 1DWJM 1E0XA 1V3MA 3VNZA 1C8QA 4FLQA 1UYQA 2J77A 3WQWA 4AZ7A 3ZOAA 3AIQA 4LX4A 2WPGA 1KB3A 2V5CA 1UWRA 1QI2A 2G3IA 3APGA 3VD3A 1HJVA 2ZIDA 5BROA 3CO4A 2WAGA 2QLYA 2D3LA 2C8NA 2CYGA 2CITA 3GNOA 3WNLA 2DIJA 3OB8A 4Y7EA 4L4PA 2WANA 5GNZA 4UQ9A 3BAKA 1O6IA 2XYLA 3WEZA 2DQXA 1DWFM 2RGMA 1JFHA 1W9UA 1HL8A 4PMYA 1CXKA 4D71A 2BHZA 1CLXA 2VUYA 1JNDA 1J18A 1B3YA 1BG9A 3ALGA 4FF5A 3SURA 2WKLA 5FKYA 4EANA 3ZQ9A 3LPFA 1UZ4A 4HZ6A 2G41A 4AD2A 1GONA 3ARSA 2VZUA 4R5EA 2YLAA 2QMKA 1MQPA 3SCQA 3UETA 1KXHA 1XGZA 4JFVA 1PX3A 2CHNA 2EBNA 5A6SA 2W62A 5AYBA 3M7SA 4JKMA 2YKKA 2E0PA 3CH9A 1WDQA 2AOSA 4H04A 5A6BA 2UY4A 2ZXQA 2GDVA 3VIOA 2VX4A 1KQYA 3W26A 1VEPA 5A69A 3W6LA 2JEPA 2WVVA 1W1YA 1US2A 1XHGA 2YA0A 3KZSA 3GYCA 4IISA 1PIGA 3VM7A 2D24A 1BSIA 1OIFA 3OGVA 1BAGA 1UD3A 2O92A 3MMDA 4HA1A 3CZGA 3ZT7A 3M6DA 1JGIA 1ISWA 4M81A 4YHGA 2PBGA 3A6OA 4CN1A 3N9KA 2BVYA 2JIEA 2J4GA 3OG2A 1SYTA 3D3AA 5M3WA 1QPKA 1CYGA 1JYVA 4BF7A 3ARYA 4DWSB 1M03A 5EMYA 3POCA 1CPUA 2WHMA 3EYPA 3QGVA 2VJXA 3O2LA 2V3GA 3RIKA 3TTSA 5HBFA 1LF1A 1EHNA 5A2AA 2JEQA 5I78A 5EB8A 5IFPA 2QPUA 4Z2JA 3AS1A 3T0DA 4DWSC 1VJZA 2FH6A 4ML4A 3A3HA 2GJXA 1WZMA 5A8PA 5BXSA 3GNRA 3VDHA 4WIWA 2QMJA 4CCCA 2VCCA 1NARA 1NWUA 4JKKA 3WMBA 4MB1A 1CZ1A 2XVNA 1VRXA 1UKSA 1UUQA 4JCMA 2JALA 1DWHM 3EDFA 4H8UA 4DWSD 2D20A 1E4MM 1E6NA 1RH9A 1C8XA 1JD9A 3VDBA 4C7FA 3A4WA 1HT6A 2O9OA 2J25A 4D6FA 5CGMA 2X09A 4JAWA 4W86A 4IUGA 2DSWA 3VMNA 1HP5A 1G0CA 3AYSA 4HZ7A 2ZXBA 1Q6EA 1RPKA 4HMDA 2BS9A 1H4PA 4FLRA 1W1VA 1EDTA 2J8FA 5JBDA 2WMKA 3GXIA 5BXPA 1U33A 2BHYA 2VL4A 4W8LA 3VIKA 2VOTA 3CHDA 1XH2A 4WF7A 2ZUNA 3QOMA 3VM5A 3W25A 1D7FA 1V0KA 1IT0A 2WKGA 2VMFA 1E4NA 3QHMA 2WHKA 4MNJA 2WLZA 3WD1A 5A6LA 3D5HA 1UH3A 1UKQA 2WZEA 1H1NA 3RJXA 1EO5A 1H41A 1WDPA 5JIWA 5A6AA 4TVCA 1OGGA 2CKSA 3EMZA 1NWTA 5BYWA 1E4LA 3AMCA 4W7UA 1XH0A 2OLHA 4ZEPA 1GOMA 1UR2A 1KXVA 4CD8A 3MSGA 2ZUUA 3OLIA 1W1PA 1PX8A 1J0YA 2CHOA 2Y4SA 1CGWA 2J74A 4A3YA 3MUAA 3SUVA 1CXHA 3W4RA 4QAWA 4Z2KA 2J7EA 1LL6A 2BFGA 3CUIA 1OGBA 3DC0A 1DHKA 4DWSA 1CGYA 4HOXA 3VPLA 5FL0A 1JZ2A 4LXFA 7TAAA 1R8LA 3AJ7A 2W67A 1VBUA 3W6MA 4A4AA 2CKRA 2VZSA 2WMIA 1K9FA 4NI3A 2X0HA 1G9HA 5IDIA 1GJWA 1BTCA 3VGGA 5EFDA 4F9JA 1LG2A 3KWXA 4H7VA 3TP4A 4URIA 1GHSA 3GBEA 1ZJAA 1VJSA 1E6XM 1B30A 1TA3B 2F61A 4JL2A 3WUBA 4AZ6A 3N18A 1EO7A 3EDJA 4X0VA 1XCWA 2BY1A 4E8CA 2J47A 3W37A 2V3EA 2ZXAA 2WVTA 1EXPA 1KR0A 3GXDA 4HA4A 4PYSA 3CZEA 4UR9A 3A47A 3AIVA 1JDAA 3AISA 3BAWA 4QCFA 1G01A 2CCRA 2V5DA 2VI0A 3UG4A 2VCBA 4KWUA 1DWGM 2WW5A 1W3LA 3IJ8A 3U7BA 1UA3A 4EAMA 5CPSA 5ABEA 3T0AA 1J0JA 1K9DA 4J3WA 1OGSA 3CBWA 1ODZA 1GPFA 1E9LA 3GZAA 2AAAA 6CGTA 5E9AA 4LYPA 1PEZA 2BY3A 3W29A 4KMQA 4TXEA 3WQ8A 3BAIA 1KWKA 3WF3A 1MYRA 4RL3A 4P8UA 4U3CA 4GI8A 2C0HA 2VCAA 4XB3A 2WHLA 1PBGA 5FCZA 2A3BA 1H49A 1KBKA 1QBBA 3BCDA 4K68A 4Z2HA 3CHEA 1QHPA 1SMDA 4AEFA 1GQIA 2ZOXA 2XWDA 4IPLA 3FN9A 3BAJA 4PCTA 4IPNB 3FAXA 4UQEA 3G6LA 3ZMRA 2FH8A 1WPCA 5C70A 2GJRA 2WVUA 5D9NA 5ABFA 1PIFA 1V0MA 3MMWA 1E3XA 1VF8A 4W88A 3W82A 1J0HA 3MSDA 4F79A 1D3CA 4TVUA 1FHLA 3AHTA 2WMGA 3WDHA 1W91A 3BSGA 1WDRA 3SCRA 1JAEA 1W9VA 3UR7A 5I24A 3WFZA 1JG9A 4X0NA 2XUCA 2Y24A 2GDUA 4PMXA 1E3ZA 4B15A 1NP0A 3AIEA 1WE5A 1VENA 2EPNA 1EDGA 1Q6GA 5LYRA 3WEMA 2CBUA 4B16A 1NP2A 1UH2A 2YL5A 2J7DA 4UFMA 3U5YA 1TA3A 1QI4A 1WCGA 3GDBA 3AIUA 1XSIA 2VT0A 4CGTA 3EBVA 3DYMA 4D6EA 1R7AA 1PAMA 1M53A 1BHGA 1K6AA 1BGGA 1IZKA 2PWDA 3B9EA 4F8XA 1UWTA 1C90A 1EQCA 5A6MA 2VNCA 1OCQA 3AQUA 3F4VA 4D1IA 2J7CA 4PMUA 4GZEA 2YOCA 1Z32X 2D1ZA 2BY2A 2UWFA 1VFMA 4PMVA 1UR9A 2WVVB 3L2MA 3TTOA 1JF6A 2DEPA 2YIHA 1H09A 3BC9A 1CXIA 4OZOA 1GHRA 4NRRA 4HOWA 3VU2A 2JE8A 1EIBA 2PWEA 3SUSA 3OA5A 2WLYA 1C93A 2J79A 5A8OA 3DHUA 1QNQA 3VMPA 4PMDA 1EDQA 3SCTA 4OKDA 3GH7A 1OM0A 1CGVA 2DH3A 5GQBA 2TAAA 1TR1A 3OGRA 2W91A 4CD7A 3AMDA 2Y2WA 2E9MA 4W5UA 3I3EA 1JD7A 5I0DA 4WKHA 4AZ5A 4U3AA 1R86A 7CGTA 3B9DA 1E43A 3L4XA 4AZCA 5I23A 3K8LA 1E0WA 1US3A 4XUYA 3AOFA 3PTQA 1H0IA 3EMCA 3E1F1 4AZBA 4JHZA 2FGZA 3WEOA 2XHYA 2XG9A 3WMSA 3FHQA 1QNOA 1RP8A 4HMCA 1ZS2A 4ATDA 3UEQA 3U57A 1IZJA 3UESA 3GH5A 2W61A 4MNLA 3L4VA 4HU0A 1BF2A 3AZRA 2WCGA 1BQCA 2BVDA 2Z1SA 4M24A 4BA0A 2ZX5A 2GJXB 2WCSA 1MW1A 1C92A 3W27A 3WDIA 1V3HA 1CDGA 4ZENA 1OD8A 1ZU8A 4PMOA 4ZFMA 5M5DA 1KCLA 1VB9A 2CBVA 2E8YA 1R87A 1UHVA 1H3GA 1E5NA 4AD4A 5DO8A 1EGZA 4AD0A 3M07A 2VR5A 1UD8A 4NSBA 5E6ZA 3KL3A 2QPSA 1E1FA 4R27A 1B90A 4S3JA 4JZ5A 3JUGA 4D6GA 4CU6A 1GZJA 4QP0A 3VX0A 4BQ2A 3ZJ7A 3WL1A 5I5RA 3T0BA 3WF1A 5D9PA 4PMRA 3ARZA 1UD2A 4PTMA 3AHZA 1BG4A 1B3ZA 4JFWA 2CXGA 1FA2A 2J8GA 4J3UA 4MAZA 3VKKA 1RP9A 1CNVA 3NJ3A 8CGTA 2ZX8A 1BVNP 2VVSA 5BXTA 3TTYA 4QLKA 3BLKA 2NT0A 3RM9A 4ZXOA 1VFOA 3J7HA 3VIIA 1MXGA 4D6IA 5AY7A 4AIUA 2YDRA 4LQ1A 1KXQA 3WF4A 1HIZA 5FIPA 3OZOA 5IHSA 1FFRA 1J0KA 1UG6A 2GSJA 2G3NA 4TTUA 1I1XA 3O6AA 3U5UA 1J11A 4W5ZA 1L0PA 2DT1A 3K8KA 1LLOA 1UD5A 3T2PA 3VD4A 1LJYA 4HU8A 1J0ZA 1ISZA 4DUWA 3L4WA 3PZGA 3CZJA 1C8YA 1G5AA 2XGIA 1UWUA 1JL8A 1JXKA 4ACZA 1SMAA 3ARVA 1DEDA 2VRKA 1V6VA 1CTNA 3DYPA 4EKJA 2WMIB 3IK2A 2PB1A 4J7RA 3CUHA 4MNMA 3QHNA 1PJ9A 3TA9A 1RD6A 1ECEA 1QI5A 1GVIA 4PSRA 1B3WA 1ISVA 3A4XA 3B8SA 5I3DA 2CPUA 3ECQA 4E2OA 2CBJA 2D0GA 4PTVA 1JAKA 4WJXA 3VIMA 1ZJBA 1JZ6A 3VIPA 3VO0A 3ZJ8A 1BFNA 4AWEA 3WIJA 4UZSA 5E6YA 5DF0A 3FAWA 3W81A 2FHCA 1HNYA 2IXVA 4HPGA 1DWAM 1OSEA 4KH2A 4H2CA 1B2YA 2BNJA 1OINA 4AD5A 1MXDA 3PHAA 1BYBA 3CUFA 4W89A 3RMEA 2WC4A 1WZKA 1E6ZA 1GNXA 4AIOA 8A3HA 4D72A 4HTYA 4AYSA 3CTTA 2D0FA 2X05A 2C7FA 4E4PA 1UOKA 3AHYA 5TD4A 4GI9A 3K1DA 4MAVA 3L4YA 1ISXA 4P7RA 3ZO9A 2AMGA 2Q8XA 1V6XA 2J7GA 1MW3A 3SCNA 4W84A 3QHOA 2CEQA 3WD2A 3FNDA 4MB5A 3ALFA 1JYNA 2CERA 4U31A 3SCVA 1DWIM 1ZL1A 2ZUMA 3AYRA 1JI1A 3MMUA 2DT0A 1CECA 4C7DA 2VRJA 3ARXA 1UWIA 2GFTA 3AXXA 5C8BB 2Y5EA 4H41A 2WC7A 3VUPA 1GVYA 3F5JA 2YA2A 1PPIA 5A1AA 1JZ5A 2X8RA 2W4XA 5FL1A 2XVPA 5A95A 2WNWA 1VEOA 1E6QM 1E70M 1V02A 5A3HA 4MPKA 2PWGA 4ZE5A 1W9XA 4M29A 3SCOA 2WYSA 3PBGA 3AMGA 3NYDA 1MQRA 5ABFB 3LPPA 2D2OA 3BAXA 1H0GA 4HMEA 1HP4A 2JF7A 1AVAA 1E6SM 4A3HA 1WO2A 5JUVA 3SCWA 1E56A 2GVYA 4HA3A 4QLLA 1C7TA 4YN5A 2ZUTA 4U2YA 2JIWA 3ARRA 4B9ZA 3IJ7A 2E9BA 3BMWA 1XSJA 5HNNA 2G3JA 3PTKA 3W53A 3MS8A 4OOUA 5GPRA 2VO5A 1E1EA 1BYAA 3WN6A 2VZVA 3RILA 5D9OA 2XFFA 1XSKA 1XRVA 1E4IA 4ATLA 2ZWYA 4CU8A 4OBSA 3PZQA 3NCOA 3G6MA 4PCSA 1ZBWA 2WBKA 3QOKA 2V38A 1HJQA 4GINA 3UERA 3CUGA 2OSWA 5ECUA 1WKYA 4Z2LA 5D9MA 1GUVA 1W3KA 1ZB5A 1A3HA 1AMYA 4AEEA 3AS2A 1QVBA 3WUGA 2YDQA 1YQ2A 1V3IA 3ARPA 1LWJA 1V6UA 4P8VA 4UOJA 1HN1A 5AC4A 5M03A 2IUZA 3RM8A 3TOPA 1TVPA 4TVDA 1V6YA 3L4ZA 3ARUA 4HP5A 3BXWA 1NWRA 4JFTA 4HPHA 1QW9A 5CZKA 3SEPA 2EEXA 4CVWA 1V3LA 3SCPA 1H5VA 2D22A 4AZIA 5CLWA 3VIHA 4JL1A 3T08A 5KZ6A 2E4TA 1EOMA 4IM4A 2CESA 1Q6FA 5E09A 5ABGA 3CUJA 1W2PA 1HVXA 1V0NA 3L4TA 3ARQA 4D6DA 5E0CA 3AXIA 2OYLA 3WUEA 2B31A 3AIBA 3K4DA 3VNYA 3VILA 2XSAA 4J27A 3VGFA 1V08A 3I3DA 4W8AA 3OZPA 3ZM8A 1HJUA 2GK1B 2VQTA 1W9PA 1D2KA 3N15A 1UQYA 1EA9C 3WELA 6A3HA 4AZCB 4AZHA 2DT2A 5DT5A 4CN6A 2XVLA 3EDEA 4GZIA 3PZTA 2VZTA 5AYIA 3GM8A 1BPLB 3WQ4A 4P7QA 1W3JA 2OYKA 1C3FA 1ITXA 2OYMA 3UG3A 4D6JA 3EMQA 3VIGA 3IANA 4BQ5A 1E5JA 5ABHA 3WMCA 1GOQA 3PZUA 4GO8A 4KRTA 1NQ6A 4AMCA 4U2ZA 2VTFA 4BCEA 4QLJA 2UY5A 1DP0A 4BZYA 2W92A 1W9DM 3IJ9A 3VVGA 1QHOA 5E70A 2YBTA 3THCA 1KBBA 1UZ1A 4GO9A 3WDJA 4OUEA 4OOZA 1JYWA 3DECA 5CGTA 1XH1A 1XYFA 4UZUA 2DPEA 1ITCA 4ACYA 1OB0A 1E72M 3AHVA 1NOWA 5I79A 3WBAA 2F8QA 1TCMA 4RE4A 2E3ZA 4DM2A 4CD4A 4XZBA 1GQJA 1UR1A 2O9TA 1EHAA 1VBRA 3NDYA 1E6RA 2XIIA 5JBFA 4GQRA 1KGXA 1YHTA 1NOUA 3VDCA 1B1YA 4M56A 1Q6CA 1EQPA 1UD6A 1WP6A 3F5LA 4GPNA 4Z2IA 4AD3A 4MJ2A 2J78A 2QV4A 1HL9A 3K46A 2ESCA 3MUZ1 3SIMA 1KGUA 1OBAA 1TVNA 4V2XA 4TOQA 4E8DA 2WB5A 2D3NA 4P7OA 3LMYA 2QF8A 3SCSA 1M01A 1CGXA 4DUXA 1QNSA 2ZICA 1NM9A 2JFEX 3NSMA 4MJ4A 2EPOA 4P7NA 1V6WA 1WAWA 4J3SA 1KFWA 1JYXA 4UQBA 3CZKA 1E71M 1V03A 4W7WA 4GQQA 4CCDA 3VD5A 5DMYA 5A94A 3WUFA 5HPOA 1BGAA 1CEOA 2GJPA 3PZMA 4FK9A 3BCFA 2O9PA 5D8WA 1EOKA 1IV8A 4UTFA 2GK1A 4UCFA 1X6LA 4W93A 1OIMA 2Z1KA 1E15A 4TX6A 5M17A 2WSKA 1LWHA 3VINA 4AISA 3BMVA 4UFLA 2BHUA 3LPOA 5CXPA 1V3KA 1V0LA 2CIPA 3CLWA 3PZIA 2DT3A 1QBAA 1UR8A 2J7FA 4H8VA 1N82A 1F4HA 1Y7VA 4ACZB 1MW2A 2XTKA 4PBGA 3PZOA 4CU7A 4OJYA 1M04A 4LYQA 3W28A 1CIUA 4PSPA 3CPUA 5KEZA 1A47A 1CENA 5CSYA 1B9ZA 3OLDA 4MDPA 1BYCA 4H8HA 3WKZA 2VURA 5A2CA 5EBAA 3CZ8A 3BGAA 3CMJA 1B0IA 2G3MA 5HPCA 4EK7A 1OD0A 4NZCA 3PTMA 4QFUA 3CHCA 2W5FA 3WDPP 4CUCA 2JF6A 4MDOA 2W66A 2NT1A 4PTWA 1U30A 3AS3A 4LPCA 1HKIA 2EXOA 2RGLA 3IAPA 2OSXA 4CVUA 3W0KA 1R85A 4M82A 1QNPA 2PBOA 3ARWA 1JZ8A 1UWQA 3S2CA 2XJ7A 1B31A 1PZ3A 4GI6A 1TE1A 4UFIA 2UY3A 1GOOA 1TZ7A 3OLEA 2EJ1A 3ZJ6A 1AQMA 1K9TA 2VX6A 4Z2GA 3OIHA 5CG0A 1KGWA 3I3BA 3II1A 1JDCA 4Q7NA 2VRQA 3ZT5A 2DSZA 5BCAA 3OGSA 3BH4A 9CGTA 3O9NA 2YJQA 1O7AA 2BXYA 2FDMA 4JFUA 4FLSA 4QDMA 2W63A 5LA1A 2DDXA 4GKLA 2A3HA 2J7HA 3AS0A 2E9LA 3SUTA 1BVZA 1DTUA 1WZLA 4P8WA 2J7BA 4PMQA 1LL7A 1CXEA 2WMFA 4AY1A 3AZSA 1V02E 1XD0A 3TTQA 4XX6A 2XVGA 1L8NA 1U2YA 3ZT6A 2XFYA 3WD4A 4UOQA 1J10A 4WKFA 3KE0A 1PX4A 4W8BA 2D0HA 3SUUA 2WCAA 3AZTA 4AW7A 2ZUVA 1FH8A 3PN8A 3WDRA 5BXRA 1JDDA 2V3FA 3VTRA 3A4AA 4PTXA 4PN2A 1NWSA 4OBRA 2NW0A 1GJUA 4JKLA 5EFFA 4D6HA 2WM0A 5CQ1A 1UQZA 1V3JA 3CHFA 4UFJA 3PZNA 4W7VA 1CXLA 1CWYA 5CJ5A 3GTNA 1UA7A 5HDRA 3LPGA 1HJWA 2A3AA 3CGTA 3GNPA 2ZUWA 4P7LA 2Y8KA 1GOKA 2XM2A 3WNMA 1HKKA 2X0YA 1B3XA 4PMNA 3MUIA 2WXDM 3FXYA 3WF2A 1G94A 2YL8A 3WH7A 4YPJA 5IHRA 1UWSA 3BSHA 2X2YA 7A3HA 4WSJA 1ZBVA 1WNOA 3VGHA 3VDAA 3HJEA 2HISA 1W9BM 4MNKA 3CIVA 4TUFA 1MFUA 3GH4A 5LA2A 1E0VA 2PF0A 4KGLA 4HOZA 1CGTA 4MTVA 2PWHA 4GZJA 1KR1A 4UFKA 1MFVA 1NH6A 3IAQA 4NF7A 3ZSSA 3AHXA 2XSBA 5E0FA 5GNYA 3T2OA 4N42A 4AXNA 1E55A 5BRPA 2XFRA 2YLLA 4B3LA 1Q6DA 1KCKA 2EPLX 3T09A 2PC8A 2F2HA 4FLOA 2G4FA 2VC9A 2CETA 3F5KA 3MKKA 5CPQA 5JBEA 1I75A 1GORA 1JNEA 1SR0A 2E40A 1QHZA 1E73M 1C7SA 1JXJA 1BLIA 2E8ZA 2FHBA 3OBAA 3VX1A 5F7UA 1JFXA 3VIFA 3B9AA 3GXFA 1LQ0A 3VIJA 4WK9A 3MV11 3MV01 1E6PA 1XYZA 2XWEA 4V27A 1UR0A 1MVYA 4Q22A 2ZX7A 4B3KA 1JZ7A 3WNPA 1ZBCA 3WD3A 3N1AA 3UCQA 1X1NA 3VD7A 2DH2A 1NOFA 3N13A 1JIBA 1TFVA 2UY2A 3RDKA 4DUVA 1KQZA 1QI0A 3POHA 5I2UA 2VZOA 1HJSA 5JIPA 2V3DA 1CLVA 1GQLA 2HVMA 5BRQA 3NDZA 1J01A 3TONA 3S6TA 5CLTA 2XGBA 3WQ6A 4U5KA 1VAHA 3THDA 2ZE0A 2OWCA 4OIFA 2D23A 2VQUA 3BLPX 1JZ4A 1XV8A 4UNIA 3AROA 3M46A 1ISYA 3WBEA 3WENA 1J12A 3WF0A 1QI3A 2DGAA 2EO7A 3FY1A 3ZR6A 5CSUA 3NIYA 4D6CA 5D8ZA 4B9YA 2DSUA 4W85A 1M7XA 2VVNA 2FGLA 2VX5A 2PWFA 4CCEA 1R7OA 1GOIA 3L4UA 2ZX9A 5A8QA 1PZ2A 4NRSA 1XCXA 5BWFA 4GXPA 3ZIZA 3MANA 1QOXA 4CN4A 4PRWA 4U33A 1UKOA 1HXJA 1JZ3A 3NSXA 3KEHA 1FFQA 3W38A 1E40A 2WWCA 3MUY1 2OWWA 2XVKA 4KRUA 3W24A 4CD5A 1H11A 4AD1A 4QCEA 1BYDA 3WNOA 4MB3A 2BXZA 3AI0A 3WH8A 1OT1A 3N04A 2YL9A 3CZLA 2WMJA 4JIEA 3N12A 3ZR5A 4J28A 4YHEA 1VIWA 4BS0A 1F4AA 3WNNA 4S3KA 4CD6A 1VFUA 1QW8A 1MQQA 1ZBKA 4M80A 2EPKX 3HU7A 1W3HA 1HX0A 1WZAA 3ZSTA 4L4OA 1FP9A 2YA1A 3WY1A 1X6NA 3MU7A 4F66A 4EE9A 4JHOA 3T2QA 1J9YA 3EDDA 3OLGA 4PUEA 3KL5A 3AMLA 5D4YA 4AC1X 2A3CA 3HN3A 4C7GA 2ZWZA 3WD0A 3AIWA 5A8NA 5I6SA 3FW6A 5DFAA 5DT7A 2VX7A 2YDSA 5HOSA 4PUDA 2XM1A 2XPKA 1KXTA 2NSXA 2G8ZA 3VGBA 5A6KA 2MANA 3VOCA 2DSKA 2WBGA 3WH9A 2ZXDA 1AQHA 5IFTA 3PZVA 1QNRA 3AICA 1HVQA 4UQAA 4V28A 2EQDA 1W32A 2DIEA 3DHPA 4PEEA 4UQCA 4TX8A 1FH9A 3AFBA 4UQDA 3N17A 1OT2A 1HF6A 4UOZA 4M1RA 1MW0A 3ZJKA 4AIEA 4X9YA 3K4AA 3EDKA 3SCUA 4GIAA 4J3VA 3WSUA 3WQ5A 2BV9A 5A8MA 3WH6A 1UH4A 1HKJA 4FMVA 4MB4A 4JCLA 2PI6A 5A2BA 5AC5A 1HJXA 1EH9A 2ZX6A 4F9DA 1JI2A 5FOOA 5CPTA 2A3EA 4BQ4A 6TAAA 3KL0A 4M8UA 4RE2A 3AIRA 3VMOA 3WQVA 1FHDA 3SUWA 1TMQA 2EPMX 3AXHA 4KGJA 3GXMA 2WK2A 3QR3A 4W87A 2VR4A 3VGDA 2WZHA 4UFHA 4WSKA 1JF5A 4BQ3A 3WDQA 3RPMA 4ZXLA 1UKTA
chains in the Genus database with same CATH superfamily
1EC9A 2XZ9A 1LL4A 3A4JA 1PVNA 2YPIA 4U5IA 4N0RA 4KPLA 1W2VA 3S1UA 2WWDA 1WKDA 2XIOA 4MADA 2HDJA 1CGUA 3MWCA 1UMLA 2F6UA 4HN4A 5FD0A 2WSPA 1OWQA 1GVSA 1T96A 4ZE4A 1RJPA 3K2GA 3MP4A 1ODUA 5HXMA 2BTMA 3BJSA 3GWQA 1GW1A 3P0XA 5I3GA 2CBIA 2CNCA 1ZZMA 2V30A 4AAJA 1W5MA 2YCLB 2OO6A 4S3GA 1LP6A 2WMHA 3W7RA 3WH5A 4O12A 3LBCA 4D1JA 3HMCA 1UD4A 3WJYA 2WZIA 5CZSA 3CEUA 4N9CA 2Z1BA 1XIBA 1XLEA 6ALDA 1LT7A 3UA4A 3BAYA 3IWPA 3O7UA 3INPA 3N11A 1A5LC 4AEOA 2FZ8A 3F4CA 1ZENA 4BI7A 3UR5A 3LK6A 1C91A 1GG0A 2BB0A 3CMGA 2OSYA 3R79A 5AHFA 4NILA 4DM1A 2Y7EA 2J75A 1P6WA 1GCYA 3WL0A 3P74A 1HL2A 1ONWA 3VGEA 1K9EA 1N55A 5DEZA 2Z28A 3OHIA 1TRDA 2Z29A 3FOKA 3QJAA 5IXEA 5AFDA 1JVNA 2HMCA 5EL1A 1QO5A 1OK4A 3MO7A 1AQFA 4X61A 5TIMA 3LY0A 2O9RA 1L2UA 2WJEA 1C8QA 3TN6A 4GUHA 3EXTA 1I6NA 3UXLA 1XPYA 1VJIA 4F0RA 1L6SA 3WQEA 2PPGA 3RPTA 3BW4A 4WY0A 5T8GA 3UZ5A 4K8GA 3GNOA 3OB8A 5LZLA 1D8CA 3LTPA 4N4QA 3TYEA 3BAKA 4BHYA 2XYLA 3LCLA 1DJYA 1TWIA 2DQXA 1NVMA 1W9UA 4CQ9A 1QPNA 1HL8A 3CO8A 4X2RA 3O0FA 2P3ZA 2VUYA 1XIEA 4IIEA 5FEZA 4R9OA 5K9CA 1ICQA 2NXIA 1UZ4A 4AD2A 3RX4A 1GONA 5SWUA 2YBVA 2PDJA 1WQ5A 3GE7A 3W74A 1TX2A 1KXHA 4JFVA 5CSSA 2PZNA 3R12A 2A2IA 2D2HA 5A6SA 3ZLGA 4PUNA 1YTEA 4XIMA 4XAGA 1KRBC 2DZUA 1XG4A 1WDQA 3RFAA 4WDUA 1W31A 1EJWC 1PTAA 2KX9A 2E6FA 2VX4A 3NGJA 1KQYA 4FNQA 2OXNA 3N4AA 3THAA 4HU3A 1W1YA 2W3ZA 3UWWA 5G1MA 5C9UA 5CKSA 3KZSA 3MHGA 4FP1A 1PIGA 4UMBA 2D24A 1XLCA 2ZZ5A 1UD3A 3ZT7A 3CZGA 1JGIA 1BF6A 4KT2A 1EKOA 3MMTA 2J4GA 5DELA 4GH1A 3OZYA 4LCQA 3ABQA 4R88A 1ITQA 1LRQA 4BF7A 1V8EA 4DWSB 5EMYA 3POCA 1PS9A 3QGVA 3SRKA 3BICA 1OX4B 1LF1A 3TC6A 5A2AA 3IRSA 5IFPA 3CWNA 3L67A 3AS1A 3SGZA 1ZGDA 4DWSC 1MDRA 3M0JA 3QF0A 3AWOA 3A3HA 3IUHA 5BXSA 3W2KA 1OFEA 3M9YA 1G4SA 1P0KA 2V5JA 4A29A 1Q7ZA 3BLLA 6REQA 2AL2B 1G67A 1ADOA 1NWUA 4JKKA 4WJ8A 3WMBA 2GGHA 4MB1A 4CQCA 1HTIA 2XINA 2XVNA 5DY2A 4PMJA 3PB2A 4WQ6A 1BEUA 3UZXA 2D20A 1E4MM 3L9CA 1E6NA 1JD9A 4GLEA 3VDBA 2J25A 3PUDA 3I6RA 2CXEA 4B5SA 1HP5A 2A7PA 1VHNA 1XX1A 1H4PA 4FLRA 3QKEA 3ZWTA 2Z2UA 1HZYA 5JBDA 4EPDC 3W6YA 2CWNA 2NQLA 1OADA 1DYSA 2JGYA 3CHDA 3MCOA 1LCOA 2QR6A 2Y62A 1A4LA 4PR4A 1AA1B 3W25A 4JNZA 2WJDA 1AL7A 2WKGA 2VMFA 4DBDA 3QHMA 3EOUA 6TIMA 4CNUA 3QXBA 1ICSA 3D5HA 4LB3A 1H41A 4NVTA 1UOZA 2J66A 1XBZA 2CKSA 3EMZA 3ENLA 3AXMA 1NQKA 5AKQA 1DVJA 1NY1A 6XIMA 3GVGA 1GPWA 1MUMA 1UR2A 1PX8A 1RV8A 2Y4SA 1CGWA 4MJZA 4I5RA 1O5RA 3MUAA 3SUVA 5FJUA 5KMYA 3BTNA 2VD8A 4KFNA 3QM3A 4QAWA 1ZALA 1LL6A 1R47A 4KEZA 3CUIA 5LIWX 2QCDA 1I4NA 2FJUB 3IUDA 3GNXA 4C6BA 4YVPA 1YMYA 3SZ8A 1K7XA 1R8LA 3AJ7A 1VBUA 1R3WA 2VZSA 2HRWA 1G9HA 3W2NA 1EJXC 3LUTA 2BWGA 3VGGA 5CGQA 1LG2A 1TZ9A 3TFCA 4H7VA 3GU2A 4F2TA 3GBEA 1XDLA 1PUDA 3L7RA 1LWIA 3HQOA 3AUJA 4JL2A 1JULA 3OW1A 5DCDA 4UWMA 5BW6A 4E8CA 5HWNA 1V4YA 2G4JA 4A2RA 2WVTA 3JW7A 3DGRA 3GW0A 4UTMA 3DG3A 1JDAA 4LS1A 4OQVA 1G01A 2VCBA 1KFKA 1WXJA 3LX9A 1UA3A 1RLDA 4C6IA 4BKNA 3KRUA 4PB4A 3T0AA 1J0JA 2D69A 3A24A 2W6RA 1ODZA 4GGBA 3PBVA 2G3FA 4GXWA 1KC7A 4M51A 4Q7IA 1MYRA 3APYA 1NSJA 3O05A 3B9NA 4XB3A 4DXKA 4HB7A 2A3BA 1H49A 1KBKA 1QBBA 1QHPA 1SMDA 4AEFA 1GQIA 1YPXA 1I8JA 3EOSA 3KS6A 3MKVA 1SSGA 2CZVA 3FAXA 4H9UA 4UQEA 3G6LA 4US5D 3M5YA 4HZMA 4HJWA 2E77A 5ABFA 1PIFA 1V0MA 1E3XA 5HJLA 4W88A 4YTUA 3W82A 3XISA 3MSDA 4TVUA 1MI3A 3VNKA 4D2JA 1I2NA 3MBFA 1I2RA 4GJ1A 1DJHA 1LQ2A 1LZOA 4O11A 3PAOA 4YS1A 4TO8A 4K36A 3KVJA 3VI2A 5F4SA 1VBJA 5H8MA 3WFZA 4HYRA 3ORWA 4DJDD 2V5KA 4C6QA 3WLLA 3AIEA 2OQYA 2TSYA 1EDGA 3W73A 5LNSA 3UVAA 1VCVA 1VP5A 2Z1XA 1A0CA 3W1XA 1TA3A 4Q4RA 1S5MA 3B0VC 3B8IA 1FRBA 1WCGA 4GYFA 3AIUA 3SFKA 4MKVA 2I57A 3GG1A 3W1LA 2ZZ2A 1A49A 1VCFA 1Q85A 2E6AA 1WXYA 5EGRA 2FVKA 6ENLA 4NZ5A 1EQCA 1OCQA 3AQUA 4D1IA 2OOFA 1AODA 3VA8A 4GZEA 1F3EA 2B0MA 2BY2A 4US5A 3CUXA 3AC0A 5ECVA 5B7YA 3PS7A 2WVVB 3L2MA 1X97A 4TQTA 3VU2A 3XIMA 3S1WA 2VWSA 2PWEA 1XRSA 1X1OA 5HA7A 3VMPA 3DHDA 2PE4A 2OX1A 1F07A 1OEPA 3TSDA 5GQBA 2TAAA 3NO5A 3OGRA 2W91A 1JDEA 1RA0A 4CD7A 2IPJA 4JTUA 3CV1A 2E9MA 3HQPA 3I3EA 1DL3A 1JD7A 3N9RA 4RW5A 4DJDA 4OT7A 4H6EA 1RCQA 3HM7A 3RR4A 3K8LA 2QULA 4Q6XA 3EPMA 4XUYA 5HWJA 4E6MA 4JGDA 2FGZA 3WEOA 5LXXA 2JK2A 3FHQA 1RP8A 4DBUA 1VQTA 1ZS2A 2F6KA 1IZJA 4MNLA 5CJMA 3WQGA 5TQLA 3B8DA 1QWGA 2W0UA 3AZRA 4I3GA 2WCGA 1BQCA 4GH3A 4M24A 2ZX5A 2GJXB 1ME8A 1NDVA 4DAIA 3W7EA 2EPHA 3ISIX 3MBDA 3OVQA 1CDGA 4Z1CA 1FQ0A 4Q4KA 4LSBA 1OD8A 4PMOA 2ZQ0A 1KCLA 2CBVA 2ABAA 1S5WA 2ZVRA 1F5ZA 4AD4A 3PBMA 1EGZA 4AD0A 2UBPC 1K8CA 2VR5A 3R0KA 4NSBA 3NPUA 3R6IA 4D6GA 1I2OA 4QP0A 3CC1A 3KLKA 3WL1A 5I5RA 3T0BA 1UD2A 3GZ3A 1SU5A 3APTA 3ERPA 2F6XA 3PPFA 1BG4A 4JFWA 3AYVA 3NZPA 2ZBTA 1RP9A 1CNVA 4L6OA 2ZX8A 1BVNP 5F2MA 2VVSA 4QLKA 4IQLA 4Q6JA 2P5NA 3MUCA 1OF6A 2J24A 3H4XA 3LCGA 4RE0A 1MMFA 2Q8ZA 3RUBL 4B5NA 1EA0A 2C91A 1XYMA 5FIPA 3LXAA 5IHSA 4CQ8A 2D73A 1J0KA 3W1RA 2G3NA 2R82A 4GFIA 4CNSA 4QDPA 2QCNA 2DT1A 4FX8A 1KNWA 2Y88A 3DENA 4AU0A 1UD5A 3VD4A 3DKLA 5KETA 1RBLA 4ONVA 3NTYA 4HU8A 1GT8A 1F6PA 1ISZA 3L4WA 4UCGA 2C18A 4DEFA 3W22A 1DKWA 1C8YA 3UNDA 1VFTA 2Y61A 1U5HA 1JCLA 4ACZA 2B7OA 1PDZA 1ADSA 1V6VA 4FNTA 1UPPA 4W4QA 2R1NA 4EKJA 2ZZ4A 3IK2A 2PB1A 2P3EA 2PU1A 5H8PA 1XL9A 1A5KC 4MNMA 4I5UA 1UW9A 1PJ9A 5LKYA 4QNEA 4PSRA 4HPXA 1QK0A 4RPQA 4HNTA 3NPXA 2CPUA 2QUVA 4E2OA 2CBJA 2D0GA 1P0DA 1GKQA 1BFNA 2EGZA 4UMAA 1IEXA 3CIWA 3G77A 4JN6A 4H2HA 3W81A 4LS2A 3Q45A 4LEQA 1C9WA 3PSWA 3DERA 1OSEA 3GD6A 2BNJA 4AD5A 1TUFA 1MXDA 4HK7A 3PHAA 1SFJA 3BL3A 4UTKA 2YB1A 3W2UA 1H61A 2QDGA 1O1HA 2DVXA 3VYLA 3S9IA 1GNXA 4S39A 5FAJA 4AYSA 2X05A 2WNZA 3H54A 3MHUA 1OG6A 1XF0A 1F6KA 2WJFA 4GI9A 1PB0A 3K1DA 1TV8A 4GC3A 2AMGA 1JRCA 1V6XA 1MUWA 3QHOA 3HTWA 4OV4A 2PDPA 2OELA 2Z00A 3PAJA 4GJIA 1Q66A 1A5CA 3SCVA 2C13A 4CQBA 4EP8C 3MMUA 1OF8A 1F8MA 4HHLA 3ARXA 1UWIA 4J2MA 4GVGA 3AXXA 5C8BB 4O8AA 1GVYA 1R3VA 4UUIA 2W4XA 2WNWA 1VEOA 3WO8A 1K03A 3U4AA 2HBXA 2DQWA 3P3BA 5LGXA 2WYSA 3NYDA 5AOUA 4EXQA 3LPPA 4HSHA 2D2OA 4JXCA 3H8AA 3SRFA 3C2OA 1H7RA 1E6SM 1WO2A 5JUVA 4XZNX 2GJNA 4PUKA 5HR7A 2GVYA 4PL1A 3H7UA 4G1KA 2HS8A 5BMWA 3NZGA 1KM1A 2C3ZA 1OABA 1EJTC 3MS8A 5GPRA 3QW4B 3DI1A 2VO5A 4S3AA 4P2VA 3FIGA 1NF7A 3UYIA 3F2CA 4ATLA 2WSYA 4DX3A 2ALDA 4DYEA 4PCSA 1ZBWA 1YDNA 5HNTA 1KD0A 4GINA 3URQA 3CUGA 4CNNA 5DXXA 1W3KA 3WK3A 3V1PA 1A3HA 1Q5MA 1DJZA 2VXNA 1ADDA 4HCHA 3H12A 3S3GA 6PTDA 2P50A 1HQTA 2FTYA 1V3IA 2X40A 4B90A 3VOGA 1POKA 3GTFA 3DH7A 1TIMA 3TOPA 1TVPA 3REQA 2XN0A 4TVDA 1V6YA 4HP5A 3S83A 3N2MA 1QW9A 4ZB2A 3SEPA 4A8RA 4LH8A 4AZIA 4V33A 3LCFA 3T08A 1EOMA 2CESA 1OFPA 4QX4A 4NKCA 1JUEA 3UXAA 3ZWSA 1A5SA 3UJFA 3CUJA 1W2PA 1FCVA 3L4TA 2PLCA 3VNYA 5KINA 4XTIA 1RA5A 1V08A 1MEIA 3ZM8A 1HGWA 3T40A 2GK1B 1OYAA 1W9PA 2NUXA 4G7EA 5EMLA 3N15A 4M0XA 1Y5VA 5AHNA 2JGQA 6A3HA 1ZFJA 4AZHA 1EBHA 5H6HA 1MZRA 4OVXA 3EDEA 3QGKC 2Z0IA 5AYIA 4J4KA 3GM8A 3TAOA 4S3DA 3WQ4A 4ADSA 4P7QA 1W3JA 1XS2A 4AHPA 4JTHA 1W54A 2OYMA 3UG3A 1F3XA 2OKTA 3P80A 2E6DA 3CEPA 3IANA 1E5JA 4B5UA 2YYTA 3G0UA 4C6LA 4FX6M 5ABHA 3JS3A 4MYXA 1I9CB 1NQ6A 2NVDA 4AMCA 4G9PA 2VTFA 4BCEA 2FFIA 4XKYA 1TV5A 4BZYA 4H19A 4FA3A 1B9BA 1SO6A 3VVGA 4RJEA 1QPQA 2ZCGA 4DBSA 2NZLA 4ZBCA 3R8HA 1AD4A 3FSTA 3WDJA 4ZFCA 2OKOA 4WUIA 2CLIA 4QG6A 4XIAA 1XYFA 3LU2A 2DPEA 1ZPTA 3WG6A 4Q4MA 3RF9A 4FXRA 5G4WA 4LBSA 2VWTA 1O94A 2FMOA 3IVSA 2Z6IA 1C8VA 4GZ7A 4DM2A 4CD4A 4MY1A 4XZBA 3B0PA 1EHAA 5F4WA 1E6RA 2XIIA 3IJLA 2AQWA 4DLFA 2FTPA 5DANA 1Q6CA 3TW6A 1XIMA 3S1GA 5CCZA 3UWVA 2QV4A 4MZ1A 2BDQA 3EB4A 3W3OA 3K46A 5MF5A 4C6JA 1R3QA 4I9JA 2ESCA 3FEMA 4M6PA 2D3NA 4BF5A 4C90A 2ZZ3A 4CEXC 5FEPA 2QJJA 3SCSA 4BFAA 1M01A 1CGXA 5XIMA 3V5CA 1IE7C 1NM9A 4PH6A 1PWLA 1WAWA 2H3DA 3FJ4A 4J3SA 3QEZA 3CZKA 1E71M 4NZ1A 5MKGB 4FS9A 4CCDA 3CL7A 1PTDA 1T7LA 5DMYA 2PDWA 3ITCA 5CEWA 2QT3A 2GJPA 5KZEA 2O9PA 1EOKA 4C6EA 2PURA 2E5DA 3QFEA 1QW7A 2WSKA 3IPWA 1AZ2A 4HNNA 5CXPA 1V0LA 2DT3A 4LY8A 3N6JA 1B54A 1Q13A 1F4HA 1Y7VA 3CPRA 3DBPA 3PZOA 3Q94A 1H5YA 4CU7A 4IGHA 2V0TA 5REQA 1M04A 5LHEA 1JRBA 3OYZA 2FQIA 1CIUA 4PSPA 3L12A 5KEZA 1A47A 3DG6A 1NDZA 1BYCA 3NQCA 4LYKA 1JPKA 5D03A 1A0DA 5FI8A 1KTCA 4AX7A 4HPNA 1JQVA 3MI6A 3S5SA 4IMAA 3RNDA 4FAMA 3PFRA 2C0AA 2F84A 4NZCA 1KKRA 1B3OA 3EPOA 2FYMA 2NV1A 1LLZA 1R3SA 2W66A 2NT1A 1LDCA 3CK5A 3WLOA 3T8QA 3O6YX 1TE6A 3URNA 3SFWA 2GGIA 4JY9A 2OSXA 3NQEA 4CVUA 2IQ0A 3U2OA 1W0MA 4YWSA 2GOUA 2PBOA 3OHMB 1T0OA 5BMXA 3N6HA 3S2CA 2PMQA 4KW2A 5FA5A 3OQEA 4OECA 1P7TA 3RAOA 5TNVA 3IEBA 1CW2A 3IIVA 4G8TA 3NPWA 4Z2GA 1OVDA 1UPMB 4GYPC 2DY3A 3BARA 4EWND 3EWCA 1KGWA 1PSCA 3I3BA 3VKCA 3EWYA 1KO0A 5C7VA 2RH9A 3QRHA 5BCAA 1H1ZA 3EKGA 1O7AA 2FDMA 4QDMA 5LA1A 2OMAA 1XINA 3UF9A 1UIOA 2E9LA 1Z69A 3EWBX 4PMQA 3W02A 1CXEA 2O7SA 1DQWA 3TTEA 3PPCA 4S3BA 4PEKA 2XVGA 1J10A 4L56A 3BGJA 3KE0A 3RRAA 1UUOA 1PX4A 4BF9A 2P76A 3DFYA 4XD3A 3NQDA 3GAKA 4AW7A 4K39A 5I3KA 3FA5A 3PN8A 3VTRA 1ZUAX 4DO6A 1GJUA 5EFFA 4JY8A 5DRIA 1UQZA 5G1TA 4KQNA 3C3UA 5DCBA 2PTWA 3W00A 3PZNA 4W7VA 2OGJA 2V5BA 1XKJA 1UA7A 5HDRA 3A12A 5C2GA 4MPQA 3FKRA 1PKNA 3R5EA 4JTSA 1PZ0A 4IMDA 4PMNA 3R13A 2YL8A 4HCLA 4YPJA 1UWSA 3WLIA 3BSHA 4CNOA 3HIJA 3L0KA 1WNOA 2Z26A 3EXSA 2HISA 1PV8A 1W9BM 3VNDA 4TUFA 4WDWA 2PF0A 2NQ9A 4KF1A 1ZAIA 2AKZA 4MTVA 5LNWA 3O1NA 1NH6A 4RNHA 2G95A 3AHXA 2XSBA 4POCA 4DI9A 3LV5A 5E93A 3T2OA 1E55A 1JR1A 2V67A 1RQEA 2V81A 3RLUA 1X96A 4HJFA 4I7UA 1KFEA 1KCKA 2RFGA 3P14A 4FLOA 2VC9A 2CETA 3F5KA 4YXGA 3QMTA 5LIYX 1JNEA 3W07A 2OTDA 1E73M 3GXPA 2WPBA 2PDQA 3U48A 2CLHA 1JXJA 1BLIA 2FHBA 2QCGA 1EJ7L 1FWRA 5F4XA 3Q58A 3KCJA 3MV01 2QGHA 2XWEA 1UR0A 1MVYA 1R6WA 2CZFA 4Q22A 4GCAA 3LHWA 3WNPA 4YTSA 1ZBCA 2HE8A 2W79A 3VD7A 3N13A 1TFVA 4LUSA 5I2UA 3WK0A 3R89A 2RDXA 1HJSA 5JIPA 2V3DA 2NUYA 1CLVA 1GQLA 2HVMA 4IWWA 5FSEC 1KBJA 4QG8A 3TONA 3S6TA 1VBHA 2GQ8A 4YJ5A 3NEVA 3ANVA 2HVNA 2Z1WA 1VKFA 4QIUA 4F2UA 2OWCA 3BLPX 4LNCA 1WKEA 1JZ4A 1FY6A 3U0HA 3C2YA 1ISYA 2ZA3A 3WF0A 1QI3A 2CZ5A 4LBUA 3FY1A 3ZR6A 5C9WA 2VFFA 4LY4A 1RBOB 2DSUA 4W85A 1XYAA 3L4UA 4XAYA 4C1NB 4H7ZA 3NQ2A 3P82A 1PZ2A 1VPYA 4JTJA 1XCXA 4ALDA 1VYRA 4L7ZA 2EJAA 4UB9A 5IOBA 3SQSA 4U33A 4U28A 5LIKX 2OEMA 3NSXA 4QSHA 2P88A 4XVDA 1O5XA 2WWCA 3MUY1 1GKRA 2JBMA 2XVKA 2QCMA 1ZHAA 2ZDRA 4FB7A 4MB3A 2QUNA 4EPKA 1X7IA 2PDUA 3ZS4A 3L21A 1OT1A 4LUIA 3WH8A 1KTNA 1FWTA 2QCCA 2H9AA 4QQ3A 4W9TA 3N12A 1F6YA 4X63A 3SN0A 1JPDX 1RCXB 1VIWA 4BS0A 1F4AA 4CD6A 3S6DA 1HW6A 1VFUA 4XK2A 4Y6GA 3ZSTA 4L4OA 2YA1A 1TV4A 3DCPA 4ERAA 4GY7A 4JHOA 4LUJA 3EDDA 5D4YA 4AC1X 1J2WA 3D6NA 4C6DA 4XAZA 3HN3A 2VGBA 1V79A 1F05A 1W17A 3G1XA 4GX9A 5GJMA 3WJWA 3UFYA 2YCJA 1SO3A 2R6OA 1H7OA 1KXTA 2CLOA 1SPQA 3NQ7A 2DSKA 2YYUA 5IFTA 4YTQA 1QNRA 1W32A 2QNEA 4AIBA 5IRPA 1TB3A 3UWUA 3AALA 4DPPA 3PUGA 4PRRA 2ZA2A 3C86A 3SR7A 2QS8A 4M1RA 1MW0A 3ZJKA 3N2BA 3P0WA 4AIEA 4O13A 4X9YA 4B92A 1GGOA 5CSRA 3EDKA 4J3VA 3N9SA 3UZZA 3N25A 5A8MA 3G1FA 4IIDA 4Q8PA 1TJ2A 1RJQA 4I9MA 5AC5A 1EH9A 3BLDA 3FA4A 1J2BA 4RE2A 4MY9A 4FR1A 5JU6A 1OX6A 1TMQA 4KGJA 3GXMA 3M1ZA 2WK2A 3VGDA 3WLMA 2WZHA 2HCVA 4WSKA 1NU5A 1TV2A 3RPMA 2Q3RA 3W7MA 4ZXLA 1UKTA 1YADA 5BNKA 2WSRA 4O1AA 1SFSA 3KCOA 4KRZA 1XBVA 1IEWA 1RD5A 3W84A 4XZWA 1OYBA 2GSEA 3H22A 1GWJA 2HTMA 4LAUA 3IJIA 1LG1A 4WKAA 3WLHA 1ESWA 1QR7A 4IJCA 1TWZA 2D2JA 1FOBA 3MI3A 1ZQ5A 2B4GA 1PZ1A 5EMKA 2CZDA 4LNYA 1I1WA 5FJIA 3RJYA 5FESA 2GQ9A 5CPMA 3AMKA 4IIFA 4J3XA 2CWXA 4J3TA 5LA0A 2QHAA 1S46A 4UTHA 3RLGA 3L0GA 4TTGA 4HZ8A 3RO8A 2IPFA 2EG7A 2R1PA 1UIPA 2BGNE 3W7DA 4UTIA 3MP3A 4WLCA 3K4WA 3MO4A 2ZDSA 4RZ4A 1FUYA 4K3ZA 2BVTA 1B3VA 4PMZA 5BOFA 5K9DA 3S9YA 2IXUA 3PK7A 3MCNA 3QMSA 1FH7A 3L2LA 2PGRA 5C5YA 4UNLA 3VD9A 1GQKA 2TMDA 4RE3A 3MI2A 2BASA 5GNXA 1UKPA 1WDSA 1PKYA 1GYLA 4IMFA 3DESA 1TG7A 3A3XA 3U7VA 1DWJM 1E0XA 3W87A 3VNZA 1ML1A 3IRDA 3LA4A 4UTTC 1UZDA 2V82A 1UYQA 2J77A 4XKMA 4AZ7A 1X6UA 2PP3A 4HPJA 4QNWA 4HYWA 3LSBA 3ZOAA 1P48A 1ZY9A 1R2RA 1XIIA 3UZYA 1WX0A 3W7JA 1KB3A 2MNRA 2V5CA 4KFPA 1OCJA 1QI2A 1HJVA 2ZIDA 3BWWA 1UC4A 3N2CA 2C8NA 5LIUX 2OEKA 3KCLA 4XO7A 3WNLA 3UPWA 3NQFA 3IGSA 4L4PA 5D04C 5GNZA 5BU9A 1Q6RA 3WEZA 4RK8A 5HQEA 1JFHA 4XBJA 3NFUA 3VK5A 3JU2A 4PMYA 4D71A 5DLCA 1CLXA 2GLKA 3HO8A 3P5ZA 3SO7A 4LVDA 1J18A 1BG9A 1FCBA 1UP2A 3ALGA 4FF5A 3SURA 2WKLA 2DZVA 4EANA 3LPFA 4QGCA 3BOFA 2QDDA 3ARSA 5LNVA 2VZUA 3AAMA 3MYOA 1ECQA 5DBTA 4GCXA 1XGZA 4NNAA 4A8NA 1PX3A 1I0DA 5JVLA 3NQ8A 4IMGA 1RY8A 4DYJA 3M7SA 4JKMA 2E0PA 4NU7A 5J5DA 4FNRA 2B7PA 4DRSA 1DV7A 3VIOA 4IQJA 3E12A 1GEQA 3W6LA 4YTTA 4NJKA 3R8GA 3URBA 1AZ1A 2OQHA 5AHMA 3DGBA 4LAZA 3DG7A 4RXFA 2ODOA 4JTLA 1R46A 3H7VA 4NNCA 1VRDA 1ISWA 4M81A 4YHGA 4CN1A 3MUXA 2DZBA 2H8ZA 3A9IA 3QQ1A 2HBVA 3R11A 3STFA 1JYVA 2D2GA 4QAIA 4HT3A 3MWAA 1CPUA 2DW6A 3I6TA 4OU1A 2V3GA 3WJSA 1R9ZA 1POJA 5HBFA 1EHNA 3W7GA 2VEKA 2JEQA 1BTMA 5I78A 3F4DA 4Z2JA 3T0DA 3ZLFA 4WSHA 3GTIA 2FH6A 4AMAA 4JTIA 4CQAA 2Q01A 1E1CB 2GPTA 2A0NA 1XICA 1W1B1 4KKXA 3VDHA 1A3WA 1EJUC 4MLJA 2QF7A 2AMXA 4NX0A 2I7GA 4JBRA 3M5VA 1LUCB 3WQPA 4MJMA 1F73A 4YCPA 4H8UA 4DWSD 3TWBA 3G0SA 2WQDA 3Q65A 4AY8A 4YNGA 3UJ2A 1C8XA 3A4WA 3TW7A 1R30A 4RNFA 5CGMA 3G1SA 3V16A 3QVQA 2DSWA 3VMNA 1G0CA 3RX3A 2ZXBA 5FAGA 3E02A 3EA2A 1EDTA 2J8FA 3L23A 3GXIA 2QCEA 2BHYA 3PY2A 3VIKA 2VOTA 4RXGA 2TPSA 3VOFA 3RU6A 3QOMA 3W83A 1V0KA 4JIRA 3LBOA 5CG7A 2WHKA 4MNJA 2VGGA 3WD1A 4K2SA 3S5OA 2HPMA 1H1NA 4E3VA 5JIWA 3UNTA 4TVCA 5BYWA 3AMCA 5DXYA 2OLHA 5EYWA 1TJ0A 4DWDA 3OLIA 2YR1A 1O60A 2CHOA 2J74A 1TV7A 4A3YA 4RNIA 3HGSA 1CXHA 3S46A 2V2CA 3OOQA 2J7EA 3BPWA 2VM8A 1SZRA 1ME7A 1OGBA 4NHVA 1Q8AA 3RO6A 4DWSA 4E5TA 2BOGX 4XG1A 1CGYA 4HOXA 2PTZA 3MZ2A 4EAYA 5FL0A 5CBJA 2HK1A 1Q6LA 5EA9A 4E4UA 3H2MA 2W67A 3QZ6A 4A4AA 3HGJA 1A5OC 3NQMA 1F76A 1FWFC 3QR0A 4NI3A 4GBDA 2X0HA 5D38A 1NFBA 3LRLA 1BTCA 2PDIA 3UZWA 3HG4A 3ES8A 1ZJAA 2PP0A 2Z1VA 1E6XM 4IFOA 1LLWA 3AYTA 3G5EA 1EP3A 3UPMA 4AZ6A 3QSRA 1R3TA 3N18A 2XH4A 4O0QA 1XUUA 2PDYA 2BY1A 4RV8A 3FDKA 3RPDA 4C5YA 3T42A 2V3EA 1ZP4A 1EXPA 3DAQA 1H63A 1CB7B 4FI4A 4OBTA 2OVLA 3U2EA 7PTDA 2E1WA 3RR1A 4RLIA 2V5DA 5HR6A 4R7JA 3QZAA 3UG4A 2QJMA 1DWGM 4Q4PA 5HWMA 3IJ8A 1OFRA 4LAKA 3VNLA 1S2VA 5ABEA 5F1VA 4ZSTA 2P8CA 4J3WA 3CBWA 3DEQA 1GPFA 4HHMA 1E9LA 3GZAA 4PTNA 3QV7A 4GGHA 1EX5A 4DJFC 3AXKA 3KTXA 3SY1A 4KMQA 1IEVA 1XCFA 3WF3A 4U3CA 4GI8A 4B3ZA 2VCAA 2HWGA 4S3FA 1PBGA 3LSCA 3OVPA 1O66A 1IGSA 3BCDA 4XZLX 1GJPA 3VKBA 2FZNA 3M0HA 3ANUA 3N19B 4Q4QA 3TJXA 4K7YA 3DFQA 2QAPA 4IPLA 3FN9A 3CQ0A 4IPNB 3E9AA 3PG8A 3ZMRA 2VEIA 1WPCA 2WVUA 1WUEA 4EVZA 4E0CA 4C5ZA 1GG1A 1J0HA 4F79A 1AUSL 3I7QA 4WY0B 5I02A 5L6UA 2E09A 1P43A 4CLMA 1NAL1 3BSGA 3UWEA 2H90A 2YCKX 4Y9PA 4C6NA 1CB2A 1WDRA 1RQBA 3UR7A 4RDZA 3LCWA 2XUCA 2Y24A 1J6OA 2AKMA 3BQ5A 1NP0A 3RGTA 3WLRA 1XLBA 2EPNA 1EUAA 1S2WA 4L6DA 3GFXA 5LYRA 3N4EA 3WJZA 5C54A 3U5YA 3IVUA 3VE9A 1XSIA 3R58A 4B2DD 4YYFA 5CZ0A 3DYMA 1R7AA 1PAMA 1M53A 4GA8A 1YXYA 3B9EA 2PWDA 2PTDA 1DBTA 2JKAA 3LTYA 2IS7A 3F4VA 2J7CA 1EGMA 1W1ZA 3UXIA 1EXBA 2CFFA 4ML9A 1JF6A 2DEPA 2BSLA 1TWDA 1RY0A 3KHDA 1EFZA 1EIBA 3QZEA 2A7RA 4I9AA 3SCTA 4R34A 1CGVA 1CT5A 4WGHA 3M0VA 4O1CA 4W5UA 2VKZG 4MKSA 5I0DA 3S1XA 2VFHA 4WKHA 2OEJA 4U3AA 7CGTA 4AZCA 3TZFA 3H2CA 1H0IA 3G1VA 3A13A 3T6CA 4WDXA 4E2BA 3KP0A 4JHZA 4JIHA 3KP1A 4B2DA 1XXXA 4ATDA 2C79A 3GXNA 2BX7A 3W1PA 2F7FA 2W61A 4JQ2A 4PFMA 2HXUA 3GKAA 2GZXA 2QEZA 3I4EA 4LANA 1FHVA 2NQHA 1K02A 2GUUA 4R85A 2VEPA 3TYBA 2Z1SA 3RLVA 3MJYA 2HJPA 1JCXA 2KAUC 2QJHA 3TSMA 1C92A 3WDIA 4Q8VA 1QDSA 3UD6A 4LUYA 2FKPA 4ZENA 2Y0FA 1R87A 1H3GA 1KW1A 5DO8A 2C1IA 1WKFA 1OX5A 3M07A 5EMMA 1UD8A 5E6ZA 5AC8A 4QDWA 2QPSA 4R27A 5LIXX 5DBUA 1K8YA 3QPYA 1A4MA 4CU6A 3NQAA 2PDHA 3VOHA 1GZJA 1NFPA 1U1UA 1JEZA 4PTMA 4OFCA 1TPH1 3AHZA 1L2QA 1JCTA 3BG9A 2CXGA 2J8GA 4MAZA 3B3DA 2FGBA 1DJGA 3SSZA 1AW2A 3TYCA 4O18A 4ZB5A 3EX2A 2BOFX 3IJQA 1MXGA 3C0SA 2PF8A 1M7OA 3F03K 4D6IA 5AY7A 2YDRA 4LQ1A 3BJFA 1XYBA 2FZMA 1KXQA 3P62A 3E0IA 4H6QA 1EZ2A 3GAYA 1S2CA 2PRLA 1FFRA 3DU0A 4P5UA 5CPOA 2GSJA 4TTUA 1X39A 1I1XA 1UASA 2R24A 3U5UA 3C0QA 5K9XA 4MM1A 5B7ZA 1SR9A 3V3WA 4W5ZA 4E3TA 1LLOA 3S9ZA 3WLSA 4DUWA 3PZGA 3CZJA 2QCDB 3PJTA 3SJ3A 1GVQA 1JL8A 1JXKA 1QOQA 4X60A 1XYCA 3R0DA 3OBKA 3ARVA 2VRKA 1CTNA 1H50A 1BWLA 3TZNA 3GIPA 3TA9A 1ECEA 1QI5A 1TPFA 7ODCA 4KWSA 3CQKA 5I3DA 2XN2A 2J13A 1RHCA 4PTVA 1JAKA 5D2TA 2PLMA 3TJ4A 4WJXA 3VIMA 3TYAA 4NZ3A 4M5PA 2JKPA 3BLIA 3VIPA 4AWEA 4WXYA 2E67A 1YYAA 2ZKMX 4MG4A 4HNVA 5F2IA 5CBBA 3UJEA 1XLDA 1F3TA 1F7BA 3WQOA 4KH2A 2X16A 5AN7A 5FJTA 1SZEA 1FWEC 1OINA 2BBFA 1H7WA 1SSDA 3GUWA 3GB6A 3PBWA 2WC4A 1F61A 1WZKA 3L5AA 4H00A 4HTYA 2C7FA 2X1RA 1ISXA 1MW3A 2TYSA 4LVGA 1ZCCA 3FNDA 3WD2A 1JYNA 4DIAA 2CERA 4IL2A 4NJGA 4UBPC 3V7PA 1XLFA 3GYEA 4MZ8A 1XLJA 2DT0A 1CECA 3O63A 5I09A 3ZZ1A 2VRJA 5EU9A 2QV5A 3RU8X 1U1HA 2ALRA 3G1HA 2CHRA 1PPIA 1JZ5A 2X8RA 2XVPA 5A95A 2L5HA 3DHFA 1FKWA 1XRFA 2OLSA 1R0MA 2DW7A 4QE5A 5A3HA 4MPKA 2PWGA 4ZE5A 7TIMA 3PBGA 1RBAA 3AMGA 2GGGA 4MSSA 1MQRA 5ABFB 1D8WA 1T6MA 3U6WA 1IXPA 4Z1YA 3LI0A 3HF3A 1HP4A 4IICA 1AVAA 5T91A 1KM0A 2V68A 1QO2A 1C7TA 3SAZA 3VC5A 1Z44A 3HPFA 1FCQA 3QQWA 4U2YA 3R7MA 4GRSA 4B9ZA 3IJ7A 3BMWA 2GGJA 4PRTA 1XSJA 1J93A 5KZDA 1HUVA 4N6FA 1BYAA 3WN6A 3C4UA 3R25A 1YDOA 3TQKA 3GQYA 3PBUA 2PDKA 1E4IA 4DAFA 4OBSA 3PZQA 3MW7A 3G6MA 1JGMA 5LNRA 2V38A 3KOFA 4GG9A 1NTHA 2HE5A 2OSWA 1NDWA 4FEZA 3LLXA 5D9MA 2X41A 1GUVA 3LGDA 4ASTA 4Q8WA 1F3WA 4UTWA 1AMYA 2F9RA 2Z24A 4AEEA 1FWIC 1QVBA 1TPDA 2YDQA 1V6UA 4UOJA 3SDOA 4H6RA 3W7NA 1PTGA 4HNOA 2IUZA 4WDTA 4YMZA 3RM8A 2Q8LA 3BOXA 3KOZA 3W1UA 3L4ZA 1GQNA 3BXWA 2E68A 3PUEA 1FDJA 5FJPA 1H5VA 2VDHA 5CLWA 3DDMA 4IM4A 1AH4A 3G1YA 1X1ZA 2KZHA 5ABGA 5CAHA 5HMSA 4D6DA 5E0CA 2OYLA 1TMLA 3K4DA 4BR1A 3VILA 2INEA 2HEJA 1EC8A 4Y9MA 4A8LA 1O95A 1P0EA 3C2EA 4H9TA 1EA9C 1J5SA 2HVOA 1UB3A 2QKFA 3B05A 3E3HA 3LS9A 5FF2A 5D2WA 3NPVA 3PUOA 3VNJA 3PZTA 4PFHA 3VOJA 1PE1A 1IHIA 3S2LA 1SO5A 1S2TA 4KETA 1JCJA 2ZZ7A 4D6JA 4BQ5A 4DJDC 1PO9A 3S2NA 4GO8A 2BOEX 4H83A 4PC8A 3GIQA 4MLRA 1OC6A 4IGMA 3TIMA 1XUZA 2UY5A 1XIDA 3BVJA 4XD6A 3TNOA 2OFJA 2QIWA 1TSIA 5F1UA 4PCFA 3E2QA 2YFNA 1YNPA 4KIRA 1KFBA 5CGTA 1ITCA 4MFDA 1E72M 3AHVA 4J1OA 1AMKA 1EP2A 1XJBA 1NOWA 5I79A 5HMDA 1TCMA 3GHTA 2DVUA 3NDYA 4GQRA 3W1TA 4GQGA 1KGXA 1NOUA 1S39A 1WP6A 3F5LA 4K8HA 4K6AA 5C0QA 1HL9A 3W7HA 1VYPX 5CPNA 3UWQA 3TLQA 1FWCC 1OBAA 1TVNA 4E8DA 4M6VA 4P7OA 3QQ0A 3SQLA 3CH0A 1I0BA 4L1XA 1QNSA 2ZICA 3KBWA 4Q4OA 2JFEX 3NSMA 4P7NA 3VNMA 1V6WA 3GSMA 3VXGA 1LOSA 1KFWA 4V1YA 2JQXA 3ABSA 4UQBA 3F1QA 4GQQA 1DPMA 3UCDA 2VENA 5HPOA 1BGAA 3LERA 1CEOA 3BCFA 1UBPC 1PCWA 5D8WA 2YB4A 2GK1A 2P53A 2ZZ6A 1VD6A 3AWNA 2PWVA 2XU2A 2IKGA 4AHOA 4IIBA 4AWTA 5M17A 3TN4A 1KRCC 2INZA 4XBKA 1F8IA 3VINA 4UFLA 2BHUA 1FXPA 3FLUA 2CIPA 3PZIA 1RSCA 3LXCA 4FIQA 4A35A 4ACZB 2ATSA 5BOEA 4XSMA 2XTKA 4RW3A 4M7SA 4LYQA 1S5VA 3BOLA 1W1IE 5CSYA 4GYKA 2VFIA 4MDPA 4H8HA 1TTJA 2VURA 2J9YA 1VFSA 5A2CA 3CZ8A 3KHJA 2NUWA 4IQEA 1B0IA 5HPCA 4Q8OA 4EK7A 4QFUA 4F2BA 4GHRA 3KVMA 3W72A 1K8XA 3WQCA 2E7FA 4LPCA 1KV5A 4MIMA 4M82A 1TYGA 1LRTA 4CCZA 3W9ZA 3CB3A 4JTFA 3PPGA 3LXBA 4DZAA 4GI6A 1BRLA 1A50A 1TZ7A 2EJ1A 2Q71A 4JX6A 9RUBA 3ZJ6A 3BK0A 3FJLA 3QH2A 4MUPA 1DIEA 4JTDA 3TQ0A 3LRMA 4Y96A 4O52A 4ERIA 4RZBA 3OIHA 1QJWA 1WBHA 2XZ7A 4JNYA 3KBNA 1O4UA 3II1A 4ORIA 2V8ZA 3ZT5A 2DSZA 4NX5A 3TXVA 2V9DA 9CGTA 3O9NA 2YJQA 2C16A 4UTUA 3MYPA 2DDXA 3BW3A 1BXNA 2A3HA 1E0UA 4N2YA 3SUTA 1DTUA 1WZLA 4P8WA 2QJGA 1LL7A 2A7NA 3TWAA 4AY1A 3AZSA 4NYYA 1WA3A 4M6UA 5MKGA 3GLCA 3C52A 1SZGA 1L8NA 4I6KA 2CLFA 4FIRA 3WD4A 4RDWA 2OT0A 5BOOA 3KBVA 2I5GA 3FVMA 3ITOA 4W8BA 3SUUA 4XAFA 3LGEA 4GUFA 4ECLA 1R9XA 1JDDA 4PN2A 5D32A 1N2VA 2C19A 2WM0A 5CQ1A 4O28A 3B8VA 3AUOA 3FCPA 4DO5A 1Q4WA 2QJIA 5CJ5A 2PSNA 2CLPA 2O56A 1HJWA 4S38A 2EHHA 2VELA 3TQPA 1K8ZA 2ZUWA 4P7LA 5CC5A 4HSOA 2XM2A 4DLMA 3LCXA 1B3XA 4IQDA 3N6QA 3NGFA 4MGGA 3WH7A 2X2YA 4S23A 7A3HA 4WSJA 3VGHA 2BGQA 3G3MA 3TN5A 5A8GA 4RDVA 3CIVA 4ZTYA 3PF3A 4DY1A 1MFUA 3USZA 1E0VA 4IG2A 4KGLA 1CGTA 2J6VA 3LDVA 1G4EA 2PWHA 1KR1A 5T9BG 4D8ZA 5E9XA 1IGWA 5E0FA 3EX6A 1RPXA 5BRPA 2XFRA 2YLLA 5C2XA 3C5QA 3T44A 1KFCA 4TU1A 3PWGA 2PC8A 2F2HA 1I60A 2ZRZA 3TOYA 3M5ZA 3FGCB 4C6FA 3W7PA 3TU9A 2INFA 5JH2A 3FYOA 1C7SA 4JTRA 4B91A 3VX1A 5F7UA 1JFXA 4GIRA 3UXKA 1AW5A 1DIKA 1ELSA 3NURA 4G7EB 3VIJA 4WK9A 3ATYA 2I16A 4TMCA 3G18A 1XYZA 1BWVA 3BMXA 1K3UA 4B3KA 5C7HA 3S4TA 1JZ7A 1XDJA 3WD3A 1VHCA 3N1AA 3H2OA 3EX1A 1X1NA 1MSSA 3W7LA 2DH2A 3QR1A 1NOFA 2NXHA 1JIBA 3KWSA 1DTNA 1JPMA 4Y9OA 2I9EA 3V18A 3HZ3A 4K1WA 4PUUA 1J01A 3C0LA 3OZMA 4FOJA 4Z08A 1OYCA 5CLTA 2XGBA 1VAHA 4XKYB 3BZJA 4OIFA 2VQUA 3E2RA 4CNPA 3M46A 1OY0A 1IR2A 3WBEA 1J12A 2YCIX 2V63A 2EO7A 1N8FA 3HPSA 3NIYA 1JUBA 4L64A 2HPIA 1M7XA 2VVNA 1CI1A 3DFNA 4K37A 4CCEA 1RALA 1R7OA 1GOIA 1U5JA 1VBGA 3GVWA 3NQ6A 5DMMA 4NRSA 1IWPA 4O1DA 3MANA 3MDUA 5AYYA 4PRWA 1W37A 3QC0A 1UKOA 4LJ3A 1HXJA 4TIMA 2RDTA 3SGUA 2OG9A 1FFQA 5F2GA 4KRUA 3W24A 4CD5A 4D8AA 2DFAA 4QCEA 1QT1A 3WNOA 4HD5A 2PD9A 4U4MA 2BXZA 3TCSA 3W2JA 2YL9A 3G8EA 4CNTA 4JIEA 1G69A 3ZR5A 2HQAA 2ZYFA 4S3KA 1H1YA 1MQQA 1ZBKA 5CH9A 5FEXA 4I7VA 4IGNA 5HNUA 3HU7A 1W3HA 3LBMA 2TRSA 3V0TA 1KFLA 1S2AA 1TTPA 3BV7A 3WY1A 3MU7A 2NWRA 5HANA 3OLGA 4PUEA 3OYXA 3VOIA 2A3CA 2BODX 1RQHA 3WMLA 2ZWZA 3WD0A 5A8NA 3FW6A 3S47A 1JCMP 3PFMA 4YVVA 2VX7A 4LUTA 2YDSA 5HOSA 2H8XA 2PD5A 1PHWA 3BLEA 3UGVA 2CLEA 2GGEA 3WBYA 3VGBA 1PKMA 3UG8A 5C6MA 2MANA 4B5VA 4QE1A 2OO0A 3WH9A 2HK0A 1V5XA 3PZVA 2HS6A 4V28A 1THFD 3SQMA 3DHPA 4IT1A 4N4PA 9XIMA 2VD9A 1FH9A 4QITA 2ONEA 4XISA 5DX7A 4O15A 1ALDA 1V7AA 3BE7A 1Y0EA 1SFLA 4UR8A 3K4AA 1SJAA 3WSUA 3U2ZA 3BJTA 4IP7A 2PAJA 4JCLA 2PI6A 5A2BA 3C2FA 1OC7A 2ZX6A 1JI2A 2Y8UA 1YIXA 3CXOA 3ITTA 2A3EA 3VDGA 3QV9A 6TAAA 4UIOA 2X30A 4GK8A 4DO4A 1XIFA 3VMOA 2PDCA 1NIUA 3B8TA 3EWUA 1P7TB 1UC5A 2J88A 3PULA 1Y5WA 4W87A 1A53A 4BQ3A 3WDQA 4H7CA 4I6VA 3GRIA 3BLFA 2Z6JA 3WFLA 1GOWA 3NQVA 2YL6A 4FXJA 4LGXA 2NV9A 2Y8VA 2XGZA 2GQ3A 1Q4NX 3K8MA 3S42A 3GO2A 3BCJA 4J3ZA 3UR8A 5D2VA 3DBNA 3OVGA 5GVJA 4XV0A 5LNUA 2BY0A 4O4VA 2OWXA 3H55A 1G1YA 2PS2A 3EEZA 2XH7A 3PZ9A 4GBUA 4L61A 1U1JA 2ON3A 5A6JA 1XD1A 1H2JA 3P6LA 3ARTA 3P7YA 3STGA 1VEMA 4I8DA 3STPA 3ITYA 2I5QA 1WOAA 3KUMA 3RM4A 2VUNA 2WHJA 2EKCA 5G4HC 1J79A 4G5DA 4Q8TA 4H9VA 3FHAA 4J5NA 2DSVA 4NJJA 4JTGA 2E28A 4ZB0A 3GBDA 3CT7A 1GVFA 3N2XA 2FHFA 4MKNA 5GJPA 1TUXA 3NDOA 3EB2A 3O6DA 3NZRA 4EF9A 4ICMA 4MWAB 4JX4A 4LYRA 5AZ0A 1UMYA 2WVSA 1WB0A 5A6BD 1CXFA 1CBGA 3NUKA 4CKQA 1KWGA 1V3MA 1RAKA 2DZSA 2ZA1A 1A5MC 4FLQA 3WQWA 3UJSA 3EAUA 1FWDC 3AIQA 1FWNA 4C91A 1UWRA 4MWAC 1SJBA 1DJWA 2NLYA 2G3IA 4RNJA 1U5VA 3VD3A 5BROA 2WAGA 3IGUA 2QIIA 2D3LA 2CITA 4QS5A 4NAFA 2ZE3A 4Y7EA 2HROA 1PKLA 1O6IA 3FEQA 1FCUA 2NLIA 4PGLA 4QR6A 1KBIA 1KTBA 3A5FA 1M3UA 3LLDA 1TV3A 3GFZA 1W8GA 3TSBA 2WZMA 4LFYA 4MVAA 3ZQ9A 3PVFA 3FA3A 2G41A 2PP1A 4QTGA 4R5EA 2YLAA 2QMKA 3SCQA 3UETA 3KOWA 1M1BA 3SJNA 1EC7A 4QRNA 2V2HA 2CHNA 2EBNA 3O8AA 1WAUA 2W62A 4O1FA 2SFPA 3RLHA 3KDNA 2YKKA 2AOSA 5A6BA 3NM3A 3AU6A 2GL5A 2ZXQA 2OZ8A 4JDYA 1ZLPA 4JIIX 4C1KA 1RR2A 1S3HA 1Z7AA 3HGOA 1FWHC 3W26A 4IOTA 4LUSB 5XIAA 2ISSA 2RJGA 5LGZA 1E9ZB 4KWWA 3LD5A 3MT1A 2A85A 2Z2BA 4IISA 3NYZA 2J9XA 3VM7A 1AG1O 1TJPA 1OIFA 1ZSXA 3OGVA 1BAGA 1EPVA 3MB9A 3MMDA 4HA1A 4REQA 2PBGA 3A6OA 4E4FA 3W7CA 5AC6A 2BVYA 4IXHA 3PNUA 3OG2A 4IIHA 4AB4A 3W2MA 2XIJA 4BJHA 2Y70A 1XWYA 5M3WA 1QPKA 1DIOA 3NQGA 2QCHA 3ARYA 1M03A 5U7SA 4PCNA 4ZCWA 4B4FA 1QRQA 2C15A 4IFKA 4ZR8A 2OR2A 1FWAC 3O2LA 4F0KA 1YDVA 3RIKA 3TTSA 3FVDA 1PYMA 1X98A 3LM3A 4J2PA 2NSOA 1VCGA 4QE4A 2HXTA 3UXDA 5EB8A 1AJ2A 1SQ7A 4IP4A 2QPUA 3CT2A 2QUTA 2GWGA 1VJZA 2IMRA 3ICJA 1OFBA 1PYFA 2FZ9A 3MTWA 4ML4A 1WZMA 4LAOA 1HG3A 4PB5A 4CCCA 4JTCA 2H9AB 3RRXA 4AVNA 1NARA 2DVTA 4KCUA 5D33A 1CZ1A 4WHBA 1R2SA 2G37A 2IW0A 1VRXA 4TR9A 4IZGA 4G6CA 1UUQA 4IMCA 3LQGA 4JCMA 2JALA 1DWHM 2NQ5A 4X22A 1RLCL 5B80A 3RYSA 4NYUA 3C56A 3VABA 5HMEA 4W86A 4IUGA 1EL3A 1B57A 1R5YA 3RK8A 4XZHA 4QISA 1W1VA 4A6GA 4S3EA 4NJIA 3E0WA 2P1FA 1U33A 2UV8G 4Y8EA 4W8LA 3GHSA 2C71A 4WF7A 3G1RA 1YBQA 1D7FA 1Q7MA 1GZ1A 3JZUA 1IT0A 2BMBA 2WLZA 1EP1A 8RUCA 1UH3A 1MRAA 1GK8A 3VC6A 4HK6A 2UZ9A 2WZEA 4Q8MA 1WV2A 3RJXA 1EO5A 4KS0A 1OGGA 2Y7DA 3S5YA 3M0YA 4M3PA 1OCNA 3W1QA 4W7UA 1RZMA 1XH0A 4ZEPA 2PUZA 1GOMA 3P60A 5HUPA 1KXVA 3E96A 4CD8A 3MSGA 1XQLA 1W1PA 1J0YA 2WKJA 1IT7A 1PDYA 4V15A 4IXXA 3TLLA 3B97A 3WFAA 3B8WA 3S0CA 5I06A 4GXMA 5G2HA 3QN3A 4Z2KA 2P10A 3GG8A 3DC0A 1REQA 4L1GA 2ZC8A 1VH7A 3VPLA 1IWBA 4Z0JA 1IT8A 3HOJA 1XYLA 3BV4A 4LXFA 1R2TA 3W6MA 1JJKA 2CKRA 1D3HA 5ABTA 2WMIA 1K9FA 2OU4A 2VDGA 2DUAA 3SECA 5IDIA 5I3JA 1YPFA 5CZJA 3TP4A 4ZL1A 1GHSA 1VJSA 2YFOA 4Q33A 1B30A 2Q6ZA 3HFYA 3FV9A 4UTLA 2QDEA 4C6MA 3G3DA 3WUBA 1SGJA 3TVAA 4X0VA 1XCWA 3VFCA 1ZTVA 4ZTXA 2J47A 4QEHA 1B4EA 2ZXAA 3I7RA 3T4WA 4NZJA 3GXDA 4HA4A 3G22A 4PYSA 3CZEA 2XH0A 4PULA 4Z42C 1T8QA 3CS2A 1P0NA 3AISA 1W3IA 3WQDA 3BAWA 4QCFA 2XH2A 4XD4A 5AHEA 4KWUA 1ME9A 3B9OA 3UJRA 4EAMA 3ZR4A 4R33A 3EEGA 4DN1A 2PLKA 1K9DA 1OGSA 3M0ZA 5DRCA 4J35A 3OJGA 4AF0A 2FPVA 6CGTA 4L6HA 5E9AA 1PEZA 3CL6A 3W29A 3ABXA 4TXEA 1FHUA 3BAIA 3E2VA 3MKCA 1OHLA 4RL3A 4LVFA 2C0HA 2AAMA 3RN6A 4JTTA 2P8BA 2WHLA 5FCZA 4K68A 3CHEA 3ZVHA 1A3XA 3NZQA 1EZWA 5LSMA 2I1OA 2REQA 4O10A 3K30A 1Q6OA 2ZOXA 1UP0A 2V2DA 5AECA 4AWUA 1ONEA 2XWDA 3DFTA 3I4KA 4CQDA 2P0IA 2BZNA 4AH7A 4PCTA 2AGTA 2EG6A 4DJFD 7ENLA 3EA1A 2FH8A 2DZPA 2GJRA 5D9NA 1AD1A 1TMHA 3MMWA 3ITXA 4O57A 3SBFA 3IGHX 4JR5A 3STEA 4LAMA 2PZ0A 1FHLA 3AHTA 4N02A 4F3HA 3WK2A 1F9CA 2WMGA 3WDHA 3FJNA 1T8XA 3TYDA 5CZTA 1UJPA 1TPEA 2ACSA 3PJXA 3MSRA 1JAEA 4FOKA 3TYUA 1W9VA 5I24A 5HQMA 3E74A 1JG9A 4X0NA 4L4LA 4PMXA 1E3ZA 4IPJA 4JYEA 4NJHA 3RHGA 2Y5JA 3WEMA 1L6GA 1V77A 2CBUA 1EWEA 3LHZA 1NP2A 4EWJA 2YL5A 2J7DA 5IDZA 1QI4A 1ENUA 4LC6A 3LI1A 1EWDA 3EBVA 3CLMA 1BHGA 1K6AA 1BGGA 1M9HA 4F8XA 3C61A 3LZ5A 3OP2A 4LEFA 1C90A 3DUGA 4WCJA 5A6MA 2VNCA 1Z6KA 3TX9A 2FTWA 4DJFA 4NZ4A 3P67A 2D1ZA 1AH3A 2UWFA 5LHFA 1P5BA 1BKHA 3HV9A 3WYZA 3TTOA 3CPGA 3EB3A 2YIHA 3BC9A 3FJ6A 4MY8A 1TPUA 4OZOA 3LTSA 2I56A 3SUSA 3B03A 3NO3A 1C93A 2WO5A 3NOEA 3DHUA 1QNQA 4O1EA 3GC5A 3TW9A 3CHVA 4GISA 1OM0A 3HJZA 3VKDA 4Q8UA 2DH3A 3NL3A 3EX3A 3FXGA 1Z9AA 4MWAE 2VEFA 4GKTA 3HFTA 4HNCA 3H2NA 3B9DA 3NAVA 5CC3A 5I23A 1E0WA 1US3A 1A5NC 3N3TA 3OIXA 2PC4A 2XHYA 4N9BA 4M19A 3WMSA 4IIGA 1XRTA 4P61A 3U57A 3QBUA 3GH5A 2PTXA 3L4VA 3GG0A 1BF2A 5PTDA 1V51A 4ZODA 4BA0A 4JEJA 4S2CA 4LV4A 2DJXA 3E0VA 1MW1A 3QV6A 1MNSA 2V6AA 3H26A 5E0KA 4R53A 3DXIA 3THUA 3O16A 1QK2A 2E8YA 3SY5A 1UHVA 1QMLA 4LT9A 5JMUA 1IR1A 3B4YA 2PCQA 1RK5A 4MUZA 5A5WA 1P0BA 3EX4A 1KM4A 4BI6A 3KL3A 4EOUA 2Z4GA 1E1FA 4JS3A 2QUMA 4KEVA 4ZO7A 3OO2A 3GU1A 3SI9A 4BQ2A 3ZJ7A 4BWLC 4XD5A 3WF1A 5D9PA 4PMRA 3ARZA 3IUIA 4GY0A 4S3CA 1FA2A 4O4WA 3NJ3A 8CGTA 2O4QA 3QMRA 3TTYA 2ANUA 3BLKA 1J4EA 2QVHA 3O06A 2PRMA 4LU0A 3TKFA 3RM9A 3UA3A 4DVOA 4RCXA 3VIIA 3J7HA 3DFOA 1YKWA 1I2QA 4QG9A 1O5KA 3L5MA 2DUZA 2OPJA 4RR4A 4C65A 2Q09A 3VFLA 3OZOA 3BURA 4ZQNA 2QAFA 5K7JA 2E25A 3GW3A 3TC3A 4LCRA 1J11A 3EZ4A 4XQ6A 3T2PA 1W6TA 2NXGA 1XLIA 4NAEB 1ZJIA 1G5AA 4A3QA 1UWUA 5H91A 4WRHA 2CW6A 4M6QA 1DEDA 4F0HA 3DYPA 4B5WA 1KRMA 1Y65A 1T5AA 4GVIA 3UT0A 2RDUA 2OJPA 3BG3A 3MCMA 4DZHA 3QHNA 1GVIA 1B3WA 2PWUA 3P61A 5D09A 4PODA 1LQAA 4NXSA 5LXEA 1WXZA 4NY2A 5D30A 3W7IA 2WJZA 4CEUC 3COTA 1JZ6A 3VO0A 2QW5A 3D3FA 5DF0A 4Q4SA 2A4AA 1HNYA 2FHCA 2IXVA 1DWAM 4O17A 2ISVA 1W3TA 3NG3A 2TODA 3NA8A 3NR0A 1KM2A 1W1A1 3H24A 3WLJA 2VC7A 1ZAHA 3CUFA 2DV0A 3W23A 2GUBA 8A3HA 4N7QA 4D72A 4XZ9A 2D0FA 4E4PA 1UOKA 5AYZA 4P7RA 2FVMA 1TQXA 3SCNA 5EMJA 2C1HA 1Y8BA 4NXKA 4U31A 1DWIM 1VGAA 2ZVIA 1JQXA 3HURA 3R0UA 4C7DA 4UXDA 2GFTA 4DF1A 3NXFA 4XTDA 4GUIA 2WC7A 4LALA 3VUPA 1WUFA 4HU4A 2MUCA 5A1AA 5FL1A 1LT8A 3HG3A 1E6QM 1EJVC 4HBKA 3T4CA 3WZ0E 3NL6A 3SCOA 3GXTA 2OLAA 2XSXA 1M5WA 4E2DA 3KW3A 1VLIA 1H0GA 4HMEA 2JF7A 4XZMX 4A3HA 1N8IA 5HULA 3SCWA 3LB0A 1E56A 4FX7A 4QLLA