2WWDA

3d-structure of the modular autolysin lytc from streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
432
structure length
432
Chain Sequence
NAAAYWDGDYYVKDDGSKAQSEWIFDNYYKAWFYINSDGRYSQNEWHGNYYLKSGGYMAQNEWIYDSNYKSWFYLKSDGAYAHQEWQLIGNKWYYFKKWGYMAKSQWQGSYFLNGQGAMIQNEWLYDPAYSAYFYLKSDGTYANQEWQKVGGKWYYFKKWGYMARNEWQGNYYLTGSGAMATDEVIMDGARYIFAASGELKEKKDLNVGWVHRDGKRYFFNNREEQVGTEHAKKIIDISEHNGRINDWKKVIDENEVDGVIVRLGYSGKEDKELAHNIKELNRLGIPYGVYLYTYAENETDAENDAKQTIELIKKYNMNLSYPIYYDVENWEYVNKSKRAPSDTDTWVKIINKYMDTMKQAGYQNVYVYSYRSLLQTRLKHPDILKHVNWVAAYTNALEWENPYYSGEKGWQYTSSEYMKGIQGRVDVSVWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 1,4-BETA-N-ACETYLMURAMIDASE
publication title Insights Into Pneumococcal Fratricide from the Crystal Structures of the Modular Killing Factor Lytc.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 121
structure length 432
sequence length 432
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
A PF01473 CW_binding_1 Putative cell wall binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wwdA02
5D9PA 1TUXA 4RE3A 3WD2A 1C92A 1E6RA 2W62A 2VX6A 3WNOA 4QP0A 2O9TA 4UCFA 4M80A 5CPQA 1W9XA 1EGZA 2VZTA 2EPOA 1CXLA 4JHOA 3IANA 1E3XA 1AQHA 3K1DA 2E8ZA 1UWUA 1HP4A 1KXTA 4LYPA 1EHNA 1JF6A 1LJYA 1UWQA 4HA3A 1GOOA 3N9KA 1CXKA 4S3KA 4D1JA 2VO5A 5CJ5A 1OB0A 3JUGA 1H41A 3MMDA 2W91A 3BH4A 3ARPA 1I75A 4WIWA 3MV01 1WCGA 1WKYA 4PRWA 1TR1A 4B9YA 2CIPA 3LMYA 2DPEA 2XG9A 1H0IA 3N1AA 4U3CA 1QHOA 4PSPA 3UCQA 5HOSA 4JL2A 4OKDA 1JXKA 4H41A 4AD1A 3PHAA 1OD0A 2ZUTA 1ISXA 1CXFA 3ARYA 3AMLA 1GQLA 1UD3A 3AISA 1UWTA 3T2QA 4HZ7A 3VX0A 5C8BB 2PWGA 5A6AA 5HXMA 4FLRA 3WUEA 3KL3A 4F9JA 4ATWA 1FHLA 2J79A 3CIVA 4WSKA 3II1A 2VR5A 3L2MA 4LYQA 3BGAA 1H4PA 2VX4A 3WDQA 3OLDA 4YPJA 4DM1A 5FOOA 4U2ZA 2XWEA 5JIWA 2CBJA 3HU7A 1CDGA 3MANA 3AMGA 2WCAA 2CESA 1CNVA 4AD5A 3GNOA 5AYIA 1EQPA 1BG9A 4H2CA 4KH2A 3T08A 2D20A 2VOTA 1VEOA 2Z1KA 1E1FA 3DYPA 4HZ6A 3QHOA 5A94A 1XCWA 2G3MA 2CERA 5KZ6A 3BAXA 1AQ0A 3VMOA 1G5AA 2J25A 1JGIA 1RPKA 4AY1A 4BA0A 1HN1A 3UG3A 2D3LA 3B9AA 5I5RA 1FOBA 3WKZA 3MU7A 2EBNA 3ARQA 1KQYA 3WQ6A 3K4AA 2WSKA 1H2JA 1W2VA 2VUYA 5D8ZA 2CCRA 2VR4A 2GFTA 1OD8A 3MUAA 4U2YA 2W66A 4PMYA 2V3GA 4ATLA 1NWSA 4CD8A 2WSPA 4AD3A 1MWOA 1LL6A 3W0KA 4J3WA 3U57A 3ARWA 1VFMA 5I2UA 3CHCA 3FW6A 1ISYA 1WPCA 3L4YA 3IJ7A 3OGRA 2J7GA 3W4RA 5E6ZA 4B9ZA 1TZ7A 1HJUA 4AISA 4KGLA 1R7AA 1CIUA 3WF3A 3D5HA 5CLWA 5GQBA 2MANA 3M7SA 5A8NA 1EOMA 2OSXA 2J7DA 1MW2A 1MQQA 1GJUA 1CLVA 1E73M 2IXUA 1EQCA 1CTNA 2WPGA 2NT0A 2BHYA 2AMGA 1E6PA 4OOUA 3T0AA 3VO0A 4HMEA 3ARXA 5A2CA 3AIWA 1M7XA 1E72M 3K8LA 2WHLA 5IHRA 5A6BA 2FGLA 2DH3A 4EK7A 4TVUA 3WFZA 4W84A 1E4MM 1CECA 3WF4A 2EPNA 3UERA 3VGEA 3HN3A 5CG0A 1CBGA 3KZSA 1B1YA 2CPUA 3K4DA 4JFTA 4TVCA 3WBAA 2XIIA 1A47A 3CBWA 1Q6FA 3O2LA 5DO8A 3TA9A 1IZKA 3VMNA 2V5CA 3BSGA 3UEQA 1UA3A 1UWRA 3RJYA 2OSWA 2ZUMA 2CYGA 1WZMA 1HJXA 4GI9A 2VI0A 1ITCA 1QBBA 3EMQA 3T0DA 2JFEX 1WZKA 1VB9A 5I79A 3FAXA 1XSKA 3M6DA 4D72A 2XM1A 3EDJA 3WFLA 2CEQA 5CLTA 1UG6A 2YIHA 1HJWA 3VM5A 1E4LA 3J7HA 4PTVA 4UFJA 3VDAA 1W1VA 3WQVA 1J0KA 4J27A 1M01A 3RM9A 1K9FA 3PZIA 2D0FA 2Y8KA 1EHAA 2YDRA 4MB1A 2D0HA 1C93A 2C7FA 1P6WA 4PYSA 4OIFA 4UQ9A 3WD0A 4YHEA 1JYNA 3OGSA 4Z2IA 4H8VA 2XYLA 4PMDA 4W8AA 3WQ5A 4MNKA 2Z1SA 1BF2A 3GZAA 4CN4A 3WELA 5F7UA 1ODZA 4PMRA 3CUIA 1JZ8A 1OIMA 3ZT5A 4CD6A 1V3HA 1LLOA 3BC9A 3WH7A 2HISA 4E8CA 1BTCA 3M46A 3RMEA 4XB3A 4AIEA 2E4TA 1QNPA 1OINA 1PIFA 1R86A 2CNCA 1GPFA 4ZEPA 2E0PA 1B3YA 4GZEA 5FCZA 3AHXA 2RGLA 1B2YA 1PAMA 2OWXA 1GCYA 2VTFA 4D6HA 1H09A 4AMCA 2XVNA 3WEOA 1OCQA 4AXNA 1E4NA 3VD3A 4B15A 5I6SA 5M5DA 4OZOA 4AZCB 2WMHA 3L4UA 3SCVA 2WMIA 1XYFA 4TUFA 5D9OA 4B3KA 1DWJM 4Q7NA 3T09A 4Y7EA 4H7VA 5I3DA 4J3VA 5A95A 4OUEA 2VRJA 3BXWA 1C8YA 1WDPA 1W3LA 5DT5A 5E0CA 3EDFA 3VUPA 1Q6CA 3VGHA 1SFSA 1Q6EA 4KRUA 3BMWA 3VX1A 4AWEA 4LXFA 2W4XA 3OG2A 3BLKA 4P7NA 2XFRA 4W7WA 1JZ3A 1TMQA 1UD8A 3RJXA 4W88A 2XVKA 4GINA 1J0YA 2J8FA 1BYCA 3VU2A 1N82A 3AMDA 3RCNA 3FNDA 4JFVA 3B9DA 3TOPA 1DWGM 4A3HA 4BQ2A 1UUQA 2CXGA 3L4XA 2V3EA 4JFWA 2XGBA 1ITXA 2WVVA 3WDRA 2WBGA 3SEPA 5TD4A 1E6SM 3AIVA 1JYXA 3ZM8A 2WHJA 1DTUA 4F66A 1JZ7A 2PWEA 4XZWA 4TTGA 2GJXA 4Z2LA 4PMNA 1UOKA 3CZLA 4AZ7A 1OGGA 3VGFA 1UR9A 5FL0A 1BFNA 1O6IA 2EJ1A 1SMAA 3O9NA 1SYTA 4V2XA 4AD0A 3ARRA 1HVQA 3AXXA 2EPLX 2PC8A 2WMJA 1B90A 3S6TA 3CTTA 3VIGA 3B9EA 4EAMA 1FP8A 5E9AA 1LL4A 1JI2A 3WBEA 4TTUA 1H11A 4MB4A 4D6CA 2J7BA 2ZUUA 4EE9A 1EDGA 2CITA 3IJ9A 1UD6A 4WSJA 1XRVA 1HXJA 1UR8A 1K9TA 4D6IA 2WBKA 1QHPA 2XUCA 2FHCA 1OT2A 2WANA 2JIWA 1MQPA 2PI6A 1H3GA 1CGYA 3VM7A 1EIBA 1QVBA 3NDZA 4E2OA 1V02A 2YDQA 3EDEA 3WF2A 2ZOXA 1UR2A 9CGTA 3VGDA 3RPMA 1PZ2A 1Q6GA 1E70M 2J8GA 4FMVA 4HPGA 3VDCA 2QV4A 4X0VA 2EPKX 4J7RA 1TVNA 4HU0A 2GSJA 3QGVA 1FFQA 4UZSA 2WWCA 1W9VA 4HPHA 3MMWA 1QI5A 5ABGA 1YHTA 4AZ5A 2RGMA 4AZHA 2WVUA 1HJVA 1J01A 1B3WA 4TXEA 3U5UA 3ZSTA 3OLIA 3VIJA 1V02E 4JKKA 4UQEA 1W9DM 1EXPA 4JCMA 4IPNB 1NP0A 1J0JA 1OBAA 1TCMA 2BXYA 3ZJ6A 2ZE0A 2UY3A 2BY0A 3SURA 1JL8A 5IHSA 4JZ5A 1MVYA 1DWHM 4UQCA 4D6EA 2A3CA 3W27A 3SCRA 4DUVA 1R8LA 3SUWA 1ZBWA 3W38A 3CZJA 2WNWA 4DUXA 4J3SA 2J7EA 3AHVA 2YKKA 3AMCA 3VIOA 3G6LA 3OLGA 2QMJA 1MW0A 2ZX5A 3DHPA 3DYOA 3MSGA 5EFDA 3CMGA 3WNMA 1GW1A 3K46A 5JBEA 2PWHA 5D9NA 4KMQA 1LF1A 3CUHA 1QW8A 4MJ4A 1ZBCA 3K8MA 2PWFA 3GM8A 1V0KA 1V0LA 2VJXA 1JZ5A 1NWUA 3RDKA 4W8LA 3SUVA 2DIJA 1QW9A 3PZGA 1VFUA 2V5DA 2BVYA 4W8BA 2NT1A 5EMYA 4CGTA 3A6OA 2VVSA 4FLQA 2UY2A 4M29A 1ISWA 1RH9A 4LYRA 3QR3A 4E4PA 2G3NA 2VURA 3ARUA 5BWFA 3WNLA 1JAKA 4CU6A 4HMDA 3VIPA 1V3MA 3AYRA 4X9YA 2VL4A 3BSHA 2WVSA 3N13A 3OLEA 3PBGA 1XCXA 3GBDA 4M81A 5CZKA 3U7VA 3WDIA 2BY1A 2XFYA 1WZLA 2XIBA 4FLOA 1RD6A 1UYQA 5FKYA 1AMYA 1V0MA 3PZUA 2VQUA 4NSBA 3A47A 2WMFA 4MNJA 3VOCA 3ZIZA 2XSBA 1Y7VA 3POCA 3CZEA 2F2HA 2JIEA 5CPSA 2CHOA 1KXQA 3MMUA 4ZE4A 2PF0A 5E70A 7TAAA 1JNDA 1JDDA 4PTWA 4JKLA 2DSZA 3IK2A 4MAZA 2E9LA 2DGAA 2UWFA 1XHGA 1KWGA 1J0ZA 4P7RA 1JZ2A 4AIOA 4AIUA 3GXMA 2Y2WA 2FH6A 1J18A 3CPUA 1JD9A 2BHZA 1Z32X 1E4IA 4UQDA 1GQJA 1E0VA 2X8RA 2J4GA 2OWWA 2X0YA 4UQAA 3WSUA 4EANA 2OYMA 1KCKA 4MDPA 1OSEA 4H04A 4E8DA 1CGVA 5ABEA 2C8NA 3CGTA 2EEXA 3OGVA 4N0RA 1UH3A 4P8XA 3T0BA 1NOFA 1BAGA 2OLHA 1DP0A 5DEZA 5AY7A 4D6DA 1XD1A 4HP5A 3VGBA 3THCA 2EXOA 6CGTA 2JALA 2V38A 1U2YA 2WVTA 3OZOA 4FF5A 1VAHA 5ABFA 4CVWA 1IZJA 4MDOA 2QHAA 3CH9A 1UD4A 1KXVA 3NSMA 4GQQA 4ZXOA 4GO8A 1CEOA 1GOKA 2G3IA 1RP9A 6TAAA 3AXIA 1C8XA 1QI3A 1Q6DA 2ZWZA 3EYPA 4ML4A 2YA1A 4PEEA 2VZUA 3SCPA 2E3ZA 1E6XM 1VENA 1ZL1A 4HA1A 2EQDA 3WH6A 4A4AA 4JIEA 3AICA 2ZX7A 5ECUA 2J47A 5I23A 4QLKA 2WK2A 1X1NA 3AJ7A 1NOWA 1UH4A 4ATDA 3L4ZA 2BXZA 4MJ2A 3L4TA 5ABHA 4LX4A 3W6LA 2X1IA 5LA2A 4CCDA 1ISVA 2J7HA 4DM2A 4UR9A 2IXVA 5E09A 3AS0A 3W81A 3W53A 2V3DA 1W3HA 3CHFA 2VRKA 3TTOA 3ZO9A 4PMXA 3L4VA 2CBIA 1Q4NX 4S3JA 4CUCA 1DWIM 1HIZA 3GBEA 4F79A 4KWUA 3ZJ8A 1PIGA 3SCOA 3BMVA 2BS9A 2UY5A 2WCGA 3CZGA 2BFGA 3GH5A 4OBRA 2FHBA 5GNZA 3LPFA 3TTYA 4HOXA 1EO7A 1BVNP 1UKTA 2YLAA 1XSJA 3QOMA 3VPLA 3MO4A 4HTYA 1UZ4A 4QFUA 4B16A 1GVYA 1NH6A 2DQXA 5D9MA 1I1XA 4P7OA 5EFFA 2BY3A 1UKQA 2DH2A 1CGUA 1UD2A 5A6MA 2WMKA 4NRSA 4WKFA 3TONA 4JAWA 1FH9A 4IM4A 4U5IA 1GZJA 1WDQA 3K8KA 1QPKA 1J12A 3IAQA 2J7FA 4ZENA 4D71A 2O9PA 1E3ZA 4C7DA 3AIBA 3A4XA 1VEMA 4JFSA 1GHRA 4XV0A 1G9HA 1O7AA 1ISZA 3GNRA 1UA7A 2YA2A 1MW3A 5A6JA 1RP8A 2TAAA 1LG1A 4CN6A 1VBRA 4W7VA 2QMKA 1XYZA 5KEZA 4M8UA 5FL1A 4UFKA 4QLJA 3D3AA 4HZ8A 1GUVA 2GK1B 4PBGA 5DT7A 3BAYA 1GOWA 3AZTA 4XX6A 2DT2A 2E9MA 1X6NA 4LQ1A 1EDTA 2VCBA 1UR0A 4AZCA 5A6LA 3DC0A 4CD4A 1CYGA 1E5NA 4MNMA 4K68A 1UR4A 2XSAA 3VD4A 1GORA 1JZ6A 2YL8A 1XC6A 3VNZA 3AXHA 4DUWA 2DDXA 2XM2A 3GXDA 3E1F1 2X0HA 3DECA 2YL9A 1ZBVA 2ZICA 3CUJA 2YBTA 3FXYA 5A2BA 2YL5A 3WD3A 3TP4A 4PCSA 1HKMA 4J3UA 5BXTA 1BYDA 1DEDA 5BYWA 5IXEA 4ZFMA 1ZS2A 5BXSA 1E6QM 2CBVA 4UFMA 2YOCA 1CGWA 3HMCA 4NRRA 2BY2A 4BQ4A 5AYBA 4MTVA 4TVDA 1C7TA 1KR1A 3G6MA 1TA3B 3EBVA 2OWCA 2ZUSA 4UQBA 2XHYA 2W5FA 1VBUA 3WDJA 2G3JA 3ZQ9A 1EH9A 3WD1A 3KEHA 1UQYA 5C71A 2GDUA 2WC3A 3ZMRA 1XD0A 4IUGA 4QCFA 4IISA 2G4FA 3HJEA 3AYSA 1BLIA 2WCSA 2ESCA 4BZYA 4UOQA 2XWDA 1VFOA 3W26A 1KBBA 2D3NA 1US3A 1EOKA 2J62A 4WLCA 4W7UA 2D0GA 2PWDA 5HBFA 2BV9A 2E40A 2J74A 2WC4A 1H5VA 1V3JA 1JDAA 4WF7A 1HJQA 1NWTA 4QCEA 2YJQA 1BQCA 1E15A 3KL0A 3VDBA 3MUIA 1QI0A 1C90A 5A2AA 2VZSA 1CGXA 1CXIA 4WK9A 4HA4A 1G94A 1B9ZA 1L8NA 1CLXA 3AS1A 3LPOA 5M03A 2O92A 1D2KA 3AI0A 2A3AA 5BROA 1QNSA 1ODUA 3WMBA 4U5KA 1V6YA 2VX5A 4IPLA 1W1YA 2ZUWA 4QLLA 1DHKA 1G0CA 2XVPA 1C91A 2WKLA 1OWQA 1OT1A 1JDCA 3WDHA 5GNXA 1LWHA 2NSXA 4TOQA 4U31A 1BVZA 3KWXA 3SCUA 3WY1A 1NQ6A 1WZAA 1EDQA 1XGZA 1J0HA 4BQ5A 2J77A 1VJSA 1XH2A 1W2PA 3MUY1 1KGWA 1NWRA 3WEMA 3SUTA 3ZOAA 2WLYA 1UD5A 2FHFA 1HKKA 2W61A 1QHZA 3GDBA 4RL3A 3UESA 4GQRA 4MB3A 3A4AA 3U7BA 1JXJA 3VMPA 3VIFA 2WZEA 4P8VA 2VZVA 2WW5A 3VIHA 1QNRA 1HVXA 4P8WA 1UWIA 3ARTA 3B8SA 1BGAA 2Y8VA 3CUFA 3VD7A 2QPUA 4LPCA 4JFUA 2YBUA 4HOWA 4M82A 1VIWA 3N15A 3N18A 4Z2KA 3O6AA 5BRPA 1HJSA 3PN8A 4RE2A 5FD0A 3AFBA 5D4YA 1VRXA 1B3XA 1VF8A 3CMJA 4GXPA 1WAWA 2VC9A 4BCEA 2QF8A 1W3JA 3ZT6A 4D1IA 1VEPA 1GVIA 4CD5A 2QLYA 3OZPA 2WYSA 3NJ3A 5LA0A 2XGIA 3F5JA 1U33A 3ECQA 5M3WA 3AIQA 3AS2A 1UKSA 5I77A 2EO7A 5CPTA 1V6UA 4CCEA 1JYVA 1HT6A 5AC5A 4AD2A 3U5YA 1ECEA 1JIBA 1W91A 1NARA 3VGGA 1PEZA 2YL6A 3AQUA 4CN1A 4J3XA 2FGZA 1A3HA 4AD4A 4UTFA 5E6YA 3W37A 2BHUA 3WUBA 1E40A 4PTXA 4ACZB 1B0IA 4GZJA 4U3AA 1AVAA 3KL5A 4H8HA 3WMCA 2J78A 4PMZA 1CPUA 4XUYA 1MYRA 3AS3A 1BSIA 2OSYA 4W86A 1ZJBA 8A3HA 1JG9A 3ARVA 3NCOA 1US2A 2BVTA 6A3HA 3BLPX 1D3CA 1CGTA 4W5UA 3S2CA 1UQZA 3MKKA 5FIPA 1KB3A 3MSDA 5I0DA 4Z2JA 3WEZA 2O9RA 1FA2A 2ZXBA 3ZSSA 4PTMA 2QPSA 5LA1A 4DWSB 2VCAA 3PZTA 3WUFA 2DSKA 4M56A 2DT3A 2PBOA 4C7FA 3WMSA 3VDHA 2CHNA 2DSUA 2XJ7A 3VINA 4UFLA 3VD9A 1PPIA 4AC1X 3LPPA 1BGGA 2IUZA 5CGMA 1QOXA 4R27A 3F5LA 1M53A 3F4VA 5AC4A 1GNXA 1KCLA 1XH1A 3TTSA 2D1ZA 1UR1A 2NW0A 1LWJA 4C7GA 1UKOA 3AIRA 4TX8A 2W92A 3WQWA 4B3LA 5A6SA 1MFVA 3AHZA 3VIMA 3GTNA 5GNYA 3WF1A 4XZBA 1PX4A 1VFFA 4NZCA 3BCDA 1L0PA 4OJYA 1KQZA 3W29A 4OOZA 3N11A 3NUKA 1PZ3A 1ESWA 4BF7A 2XTKA 4U33A 2WM0A 3OIHA 1JYWA 3LPGA 4MNLA 4HU8A 1ZJAA 2WB5A 1YQ2A 4PCTA 5GPRA 3CHEA 2ZX9A 3AZSA 4JHZA 2VZOA 2Y5EA 4V28A 3F5KA 3I3DA 3UG5A 1C8QA 5JUVA 1B3VA 2DSWA 2E8YA 2CBUA 3SUSA 5DF0A 1QI4A 4QAWA 4UOZA 1LQ0A 1M03A 3CO4A 4ZE5A 1FFRA 4P8UA 5A6KA 2WMGA 4UFIA 1BYBA 1J10A 4Q22A 1R7OA 3VNYA 1UHVA 1XV8A 3TTQA 4CD7A 4PUDA 1JI1A 4L4OA 1LL7A 5EB8A 2ZXQA 3VTRA 3VKKA 4CU8A 1DWFM 2ZX8A 2OYKA 1WB0A 5A69A 5JIPA 1J0IA 4L4PA 3VIKA 3NSXA 3CLWA 1C3FA 2W67A 2D22A 3ZT7A 1W1TA 4GI8A 1E0WA 1V3LA 4A3YA 3N12A 1VJZA 4AZ6A 1DWAM 1M04A 3WF0A 3POHA 3N17A 4YN5A 2DIEA 2GJPA 2V3FA 4UFHA 3AROA 2ZWYA 4AEFA 2O9OA 3ALFA 1HP5A 3T2OA 4BQ3A 2Q8XA 2VNCA 3VVGA 4ZXLA 5A6BD 1OGBA 2EPMX 5D8WA 3UETA 3WNPA 1MXDA 4W93A 3ARSA 1E9LA 2GVYA 1V3IA 2WHMA 3W25A 2X2YA 5ABFB 1JAEA 1JNEA 3W82A 4CCCA 3PZOA 2ZUNA 2XFFA 2D24A 4P7QA 3ARZA 3NDYA 4M24A 1TE1A 4JCLA 4D6GA 3PTKA 1HKIA 3A3HA 2UY4A 3MS8A 1BHGA 1GJWA 5DMYA 2F8QA 2JF7A 2B31A 1FHDA 4HMCA 5HPOA 3ZJKA 2WKGA 2JEPA 4PN2A 1QNQA 4KRTA 3L2LA 3W24A 4BS0A 5CGTA 2ZXAA 5EBAA 1C7SA 3KE0A 3WNKA 4JKMA 1NOUA 1KWKA 3SCSA 3UR8A 1NM9A 4FLSA 4HOZA 4WKHA 4Z2HA 2AAAA 3AIUA 4MADA 3WL1A 3IJ8A 2GK1A 2G41A 3GYCA 1W3KA 3QHMA 1MQRA 3RM4A 2W63A 3PZQA 1OIFA 5JBFA 3APGA 2YA0A 4LGXA 1V6XA 3N04A 2WWDA 4W87A 4N42A 4AZIA 5JBDA 4AW7A 2XVLA 3AIEA 3AHTA 2BNJA 3GNPA 1I1WA 3UR7A 3WD4A 1KXHA 4GIAA 5HDRA 4J28A 2BVDA 3PZ9A 1QBAA 2WLZA 3SCTA 5BXRA 4Z2GA 2WHKA 4F8XA 1F4HA 4URIA 2CKSA 1EO5A 3ALGA 1LG2A 3NYDA 1BYAA 2FH8A 4JL1A 3EMZA 4W5ZA 2XPKA 5CQ1A 2PB1A 2ZX6A 4YHGA 3WDPP 3WNNA 4MPKA 4R5EA 3BCFA 1H1NA 1QNOA 4PMOA 2VVNA 1WDRA 2ZXDA 3GH4A 3THDA 3WIJA 5E0FA 1XSIA 1TA3A 2F61A 1F4AA 3MV11 1OGSA 3WL0A 1CENA 5IDIA 1WO2A 3BAJA 3OBAA 4GPNA 1UKPA 1FH8A 3SIMA 3SUUA 2WAGA 3OA5A 1E56A 1HL8A 4GO9A 4DWSC 3BAIA 2GDVA 1V6VA 1W9BM 5A8PA 5BXPA 3RILA 2XVGA 5I24A 4CU7A 3AZRA 5CSUA 2HVMA 3ZR6A 3ZR5A 2A3EA 1V6WA 5DFAA 2CKRA 1HNYA 1H0GA 4X0NA 4EKJA 3AMKA 1GONA 3DYMA 2WMIB 2GJRA 4W89A 1E6NA 2ZIDA 3WN6A 3W28A 4ACYA 1G01A 7CGTA 1WDSA 1PX8A 1HX0A 2JF6A 2WC7A 2OYLA 4GI6A 4V27A 2DT1A 3VIIA 1PJ9A 1ZU8A 4D6JA 1H49A 4J3TA 5A3HA 3BAWA 5A8OA 2WXDM 4AZBA 1UZ1A 1GHSA 1E71M 3AOFA 2VRQA 1GQIA 3L4WA 1G1YA 5BRQA 1WNOA 5HPCA 1SMDA 1PBGA 4NF7A 4KGJA 1CWYA 2YDSA 1U30A 8CGTA 4WKAA 3WQ8A 4MAVA 2Y4SA 1E6ZA 1X6LA 1CZ1A 5C70A 1QI2A 4PMQA 5I78A 2D2OA 1D7FA 1W1PA 1E5JA 3EMCA 2DSVA 2WVVB 3VD5A 3NIYA 3I3EA 1BG4A 2D23A 3ZJ7A 2Y24A 4OBSA 1V3KA 4CKQA 4RE4A 3CZ8A 4M1RA 1AQMA 1GQKA 1W9PA 2J75A 4AYSA 3SCQA 5BCAA 2A3BA 3AHYA 5CSYA 2GJXB 1NP2A 1MXGA 1JD7A 2CETA 4PMVA 1V0NA 5A1AA 4FK9A 1JFHA 1E1EA 2E9BA 3QHNA 1W32A 5CXPA 1ZBKA 4NI3A 3WH5A 2J7CA 2VCCA 3CUGA 2A3HA 4TX6A 4D6FA 3FHAA 1BPLB 5IFTA 3EDKA 2G8ZA 5IFPA 4PUEA 3CHDA 3VILA 3NSNA 3PTQA 1GOIA 3WUGA 2DT0A 2GUYA 1J11A 3FY1A 2YLLA 1B30A 1EA9C 4WJXA 3WENA 3FN9A 1HKJA 2JE8A 1E55A 1ZB5A 3W6MA 1FH7A 1JF5A 3IAPA 3I3BA 5A8MA 1GOQA 3WQ4A 4AZGA 3A4WA 1K9EA 1W9UA 3GXFA 1KR0A 3GH7A 1E43A 1K9DA 3FHQA 2X09A 4QDMA 4P7LA 4UOJA 5LYRA 4PMUA 1R87A 1OM0A 1WE5A 1KFWA 1B3ZA 2AOSA 1JZ4A 1CXEA 1PX3A 1XH0A 1IT0A 4MB5A 4W85A 1E0XA 4CVUA 1JFXA 1TFVA 2DEPA 3DHUA 1J9YA 1MFUA 1UWSA 3OB8A 2VX7A 3PZMA 4ACZA 1R85A 2PBGA 4GKLA 1K6AA 3CZKA 3WH9A 4AEEA 1HL9A 2WZIA 1WP6A 3T2PA 2VQTA 2ZUVA 4UNIA 4F9DA 2VT0A 3PTMA 2FDMA 1FP9A 3UG4A 4DWSD 1KGXA 2C0HA 3BAKA 1CXHA 3SCNA 1SR0A 3GXIA 2WZHA 1TG7A 5M17A 1HF6A 4PSRA 1KBKA 1MW1A 3PZNA 3MUZ1 5A8QA 1V08A 1B31A 3RM8A 1TVPA 4UZUA 2X05A 2JEQA 5HNNA 7A3HA 4DWSA 1V03A 2VMFA 3EDDA 3SCWA 4GZIA 3M07A 1GOMA 3RO8A 3PZVA 3QOKA 4H8UA 1KGUA 1UH2A 3RIKA 3WH8A 1IV8A 1S46A 3FAWA
chains in the Genus database with same CATH superfamily
3T8QA 2W62A 3MT1A 2D69A 4QP0A 1L6FA 5CC6A 5CPQA 1TWSA 4JHOA 4D9PA 3VKDA 6TIMA 1E3XA 2ZFAA 1AQHA 3K1DA 2E8ZA 4Q4RA 1HP4A 2OT0A 4HA3A 3N9KA 3L5MA 1UUOA 2VO5A 2PP3A 3MMDA 4MFEA 3GTHA 3W7PA 3RPTA 5DQPA 4PRWA 4K8GA 5G1TA 3N9SA 1QHOA 2WO5A 4PSPA 6XIMA 3LDVA 1UP3A 3FJ6A 4C1NA 3WK2A 4DNHA 1U5HA 3P5YA 2E5BA 4JL2A 4OKDA 1U83A 4AD1A 2ZUTA 3B0YA 1UWTA 3SRFA 5A6AA 5HXMA 5F1UA 3KL3A 3O05A 5REQA 4C1LA 2G5WA 3RR1A 4A35A 3W2NA 2BXVA 2V0TA 4QQUA 3A64A 2CLEA 2J79A 3CIVA 4WSKA 3UWUA 1H4PA 4YPJA 4DM1A 3QW3A 2OELA 4ZOBA 5LHEA 5JIWA 3ABZA 5AVNA 3AMGA 5C9RA 4NL1A 3ANYA 4RR4A 1CNVA 4AD5A 1ZAIA 4H2CA 3T08A 3O07A 1TX0A 3SR7A 3DYPA 3WK3A 5CC5A 5A94A 2OKTA 2G3MA 3BJTA 4AF0A 1JGIA 3PB2A 4NAFB 4NY2A 4AY1A 3H23A 3UG3A 2QCNA 2F7FA 1FOBA 1VJIA 4AG0A 2GGJA 4FNRA 1W2VA 2Z29A 1VCVA 2CCRA 4MY1A 1A5NC 1OD8A 4FXJA 3W7HA 3K5XA 2W66A 4GYJA 5D05A 2V3GA 4DZ5A 4ATLA 1DJHA 1NWSA 4CD8A 2WSPA 4AD3A 1LL6A 4L5ZA 5JU6A 3ARWA 2PMQA 3CHCA 1ISYA 3CWHA 1PDZA 3Q37A 1P5BA 3GTFA 4N9BA 3W4RA 1XLHA 1FRBA 1CIUA 4HSHA 4MM1A 3SBFA 3SI9A 3D5HA 4I3GA 5DMMA 5A8NA 2BP1A 3W7DA 4ZQCA 1M68A 1ML1A 1MQQA 3BARA 3HMJG 1E73M 3B8DA 3DCPA 4REQA 2Z25A 3O6CA 3T0AA 4HMEA 1LUCB 2XH2A 1QAPA 1E72M 3K8LA 1S2UA 1DVJA 3K4WA 5DRIA 3CL8A 2DH3A 1RLCL 6REQA 4N9EA 3CV6A 3MP4A 3MVTA 2X1SA 3UERA 3VGEA 3HN3A 3Q4DA 4XAPA 1CBGA 3KZSA 2WJFA 4TVCA 2GWNA 3P84A 2XIIA 4TO8A 3TA9A 4Q4SA 1I2RA 3BSGA 1UWRA 2VFHA 1WZMA 2C1IA 1P7TA 4LV9A 2OZTA 1QBBA 1RHCA 3DZ1A 1KFLA 1K8YA 4M6VA 3VZYA 2PLKA 1VFSA 1XSKA 4D72A 3BSMA 2XM1A 1IQ8A 2YX0A 1UG6A 1HJWA 2VC7A 5C54A 4N9CA 1KM0A 3K2GA 1W1VA 4RV8A 4O1AA 3MO7A 1DOSA 1WDDA 4UTTC 4YTSA 4QEHA 1C93A 1P6WA 4PYSA 1JYNA 3FXGA 3IIXA 2XYLA 4PMDA 1FWDC 3OPSA 3CUXA 2H3DA 4WOZA 2ZKMX 2J13A 1OFQA 3ZT5A 3QTGA 3EWXA 8XIMA 3O0FA 3O0KA 4S23A 3WH7A 4WSHA 1P0BA 1RUSA 2AL1A 4FXFA 1R5YA 4E8CA 4CNTA 3PPFA 2YDAA 2CNCA 1YDVA 4IQEA 1B3YA 3AHXA 3L23A 2RGLA 1B2YA 1PS9A 4BEQA 1MRQA 1S5NA 4YTRA 2XVNA 1HO1A 1ZZMA 4LYKA 3VD3A 5I6SA 2WMHA 3P82A 2WMIA 2R1KA 4K6AA 3W1MA 3I6EA 4HN8A 3GUGA 5M1TA 2QV5A 2DZUA 3T09A 3KRUA 3WFAA 2NWSA 3H53A 4LAKA 4J3VA 3IUDA 3OYXA 3EB3A 5D02A 1WDPA 1A49A 3H12A 4KRUA 3BMWA 3VX1A 2A0NA 3PWGA 4WQ6A 1LOLA 4AWEA 1RJRA 3HV9A 2CHRA 1JZ3A 3RJXA 4W88A 4PULA 1VCGA 1N82A 3AMDA 5GJMA 2G0WA 3TOPA 3VK5A 4H9UA 3HO8A 3GHRA 4GCXA 1ITXA 3GFZA 4UC5A 3LCLA 3TN3A 4DI9A 3LBOA 3UFYA 3WDRA 2WBGA 5C0QA 1FWCC 5TD4A 1EZWA 3AIVA 1FWHC 2DZTA 1YKWA 2PWEA 4WEVX 4TTGA 2GGEA 2QEZA 3V18A 4Z2LA 4NKCA 1UOKA 1UR9A 2BZNA 4WDWA 2ISSA 3O9NA 3NNTA 3ARRA 3PANA 2VM8A 2DW6A 2DZWA 2WMJA 2CLPA 4W4QA 3K1GA 3S6TA 1AZ1A 3DI0A 4Q32A 3SGUA 1IGSA 1JI2A 1UB3A 2PRLA 2X0SA 2ZUUA 2CITA 3IJ9A 4WSJA 2WM1A 4D6IA 2NXGA 3GC2A 3NQBA 2YYUA 3T1GA 2XUCA 1MRAA 4XD5A 2E5DA 4CLMA 2WANA 3DN5A 1AQFA 2PI6A 2VEIA 3VM7A 3QZAA 4Q8QA 3RX3A 1ZJIA 1V02A 3WF2A 3EDEA 2XFWA 2ZOXA 2RDXA 3KRBA 3FA4A 3LCFA 4O28A 1PZ2A 1E70M 2J8GA 4HPGA 3EWYA 2QV4A 3DESA 2GOKA 4XQ6A 4UTTA 2OTDA 1AD1A 3SQSA 4UZSA 4B5WA 3N19B 3MMWA 4GVGA 4GYKA 5FA5A 3G8EA 2PAJA 5ABGA 1JUBA 3GVGA 2J27A 3VNJA 2WVUA 1HJVA 1J01A 3H54A 3ZSTA 1K4HA 1N7KA 3QSTA 1LT7A 1FXQA 1AMKA 3GW3A 3FV9A 3ZJ6A 1TTPA 5DRCA 2UY3A 3SURA 1JL8A 5IHSA 4JZ5A 2QDHA 1YPIA 4JBRA 1PHWA 4UQCA 4D6EA 2A3CA 3W27A 1R8LA 1YRRA 4G2DA 1PCKA 3B8UA 1ZBWA 2EPHA 3W38A 3AYTA 3E0VA 3PPGA 2WNWA 4DUXA 2J7EA 5TQLA 3AHVA 1FTXA 3AMCA 3LHTA 3VIOA 3G6LA 3OLGA 3A22A 1MW0A 1G4SA 2ZX5A 3DYOA 3WNMA 3ITGA 1X96A 3MUXA 2WNZA 5K4ZA 1S5TA 5D9NA 3C0JA 1LF1A 3CUHA 3GW0A 4M1BA 3R8RA 3K8MA 1XIHA 3U0HA 3QEZA 3BL3A 1YNYA 3GIYA 3GWQA 3W73A 1JZ5A 3NQMA 1NWUA 2B7OA 4C60A 4PR4A 3WZ0E 4W8BA 2BOGX 1CLKA 1U5VA 4LCQA 3A6OA 2UY2A 4M29A 1ISWA 1KM6A 1RH9A 3ABOA 1GTEA 4LV4A 3WNLA 1Q6OA 4CU6A 3IUIA 4MHBA 4X9YA 2VL4A 2QJHA 4JN6A 1XLFA 5AVHA 4NQ1A 3PBGA 4MKNA 1XCXA 5FEZA 2BY1A 2EKGA 2XIBA 4IQJA 1RD6A 4Q8OA 3MA8A 4Q8PA 2RDUA 4OU1A 3TC6A 1R3WA 3KS5A 1XRTA 3ONCA 4IWWA 3WLKX 4QXIA 5CPSA 2CHOA 3MMUA 4ZOCA 2QCDA 4JTDA 1JNDA 1QO5A 4JKLA 2DSZA 2C91A 4NVTA 2E9LA 1XHGA 3U2OA 1KWGA 4Q4KA 5H1WA 2VWTA 5FF4A 2Y2WA 1AW2A 1J18A 1SUXA 1Z32X 3U4AA 1GQJA 3WG6A 3LHWA 2HMCA 1S1PA 1C29A 3I65A 4AWSA 3QYQA 4GH3A 4EANA 2R6OA 4XO6A 4E5TA 3STEA 3R6IA 3TUUA 4HNCA 4IP5A 1LWIA 3VI2A 3E5BA 1OC6A 3RCYA 2ZYFA 1F73A 3H22A 5BMWA 1MI3A 2OLAA 4RDZA 3B3DA 1KM5A 5M2FX 4P8XA 4KWWA 3LTPA 2DJLA 3TN6A 4HP5A 4L80A 1POKA 1N8IA 6CGTA 4RZ5A 4IUOA 2CLLA 3OZOA 5ABFA 1O60A 2E1WA 1IZJA 4NZJA 3CH9A 3M4HA 4N9DA 5CH9A 1CEOA 3CTLA 2JGYA 3M0YA 1Q6DA 2ZCGA 2ZWZA 4PEEA 2TYSA 1VENA 4NUWA 4HA1A 2EG8A 5H6HA 3TH6A 4GH1A 2ZX7A 1R9ZA 5ECUA 1UP2A 5I23A 1QO2A 1O5XA 1XLAA 4Q3MA 1TRIA 3WQCA 4DAFA 2PZ0A 2Q01A 4L64A 6ENLA 2F2KA 2P53A 3LA4A 3E0WA 4IMEA 3F2CA 4LX4A 4XK2A 2X1IA 5LA2A 4DJDD 1ME9A 4CCDA 1ISVA 2J7HA 3HPXA 3IIZA 1LCOA 4WXZA 3AS0A 1W3HA 4R88A 3V3WA 2QUMA 3IVSA 4MY9A 1W5NA 4XVDA 2BLEA 4AMAA 4X63A 3PPHA 1PIGA 3IIPA 2UY5A 1T0OA 3VKJA 3LPFA 4H9ZA 3HPAA 4HOXA 3NPWA 4M0XA 1UKTA 3EPNA 3LZ3A 1QTWA 1RV8A 5IOBA 3LQLA 3QOMA 3VPLA 1UZ4A 1TWZA 2C3ZA 3FJLA 1X7FA 4BKNA 1I1XA 2BY3A 4RPPA 3S9ZA 2DH2A 2REQB 1XJBA 5A6MA 2RUSA 4WKFA 2Q6ZA 1FH9A 3LGEA 3W6YA 2OX1A 1QPKA 3IAQA 4D71A 5D04C 1E3ZA 4PE8A 3BICA 2NZLA 4C7DA 3N6JA 4NHVA 1ISZA 3GNRA 4MFDA 2TAAA 1RSCA 5HJYA 3AUOA 5KEZA 4A3UA 2EG6A 4FX8A 1RJQA 3D3AA 4HZMA 1NDWA 5DT7A 1GOWA 3OJGA 3UZWA 1DIEA 4JTEA 2DT2A 4GBUA 5CG7A 2E9MA 1PYMA 2VCBA 1UR0A 3LNMA 5DMLA 5A6LA 3ZLGA 4LB3A 2OJPA 1CYGA 4K68A 1L2QA 4ZA0A 3WLPA 3LOTA 4E2DA 1KRAC 5D2WA 5A2BA 2YL5A 2BWGA 4NAEB 2ATSA 1MEWA 1HKMA 3Q67A 4GKTA 5BXTA 1J2WA 1WV2A 1BYDA 1DEDA 3CQ0A 1ZS2A 3PG8A 1UMYA 4FPSA 1E6QM 2CBVA 4UFMA 1QK2A 1CGWA 2INZA 2BY2A 4FIQA 2DORA 4MTVA 2BGSA 4TVDA 1ELSA 1C7TA 1FWBC 4Y90A 4IIEA 3EOEA 3FYOA 1TA3B 4O0QA 1XBYA 2OWCA 4WY0F 2W5FA 1XBVA 1S5VA 2G3JA 5FJPA 4YYFA 3CJPA 2C18A 1O5RA 4A8IA 9XIMA 4QCFA 1OQFA 2ESCA 4BZYA 5CPMA 2XWDA 4HK6A 1YTKA 2X16A 1Z9AA 3N25A 1S2CA 4WLCA 4PEKA 4W7UA 1R3VA 2J74A 2WC4A 2NVAA 3W74A 4RW3A 1BQCA 1QI0A 1C90A 1SPQA 2E6FA 4BI5A 3CS2A 5A2AA 1XLKA 3N6QA 1CGXA 1XI3A 3R13A 4WK9A 4HA4A 3TYAA 1B9ZA 3CQHA 1CLXA 1R0MA 4KRZA 2O56A 3MBDA 3I7SA 3VNIA 2I9EA 1AW5A 1QNSA 2GJNA 4U5KA 2HZGA 2CXEA 4IPLA 1ZHAA 3KM8A 1I4NA 2ZUWA 1DQUA 1G0CA 3ITTA 4O12A 1C91A 1OWQA 2IPGA 4U31A 1W1B1 3SCUA 3CT7A 1TX2A 4XO7A 4KEVA 1FCUA 3G22A 3KVJA 3SUTA 3P81A 1EJTC 1U1UA 2Y5SA 2Y88A 2FHFA 1SJAA 2YW3A 4K7YA 4HNTA 3S2MA 2CLFA 3MB9A 3A4JA 4JTIA 2WW5A 1XWYA 3VIHA 3CHVA 3IGHX 3EX1A 3L5AA 1R3TA 3O8AA 3B8SA 3OHMB 3CUFA 1XL9A 4LPCA 5AHEA 3LN3A 1F3WA 3E02A 3KDNA 3N73A 3UJEA 1VIWA 3IEBA 3QFWA 4QDWA 1FWWA 1HJSA 4RE2A 3FYYA 2HROA 4US5A 1VRXA 1VF8A 3CMJA 3M0IA 4QX4A 4GXPA 2VC9A 4JIRA 4BCEA 4J40A 4L61A 1KTBA 3UQNA 4CD5A 2P8BA 4YNGA 1EJ7L 3P62A 3HIJA 3NJ3A 1GGOA 2XGIA 2ZQ0A 1U33A 3ECQA 3E12A 2QVHA 3AIQA 3W7KA 5M3WA 2Y63A 1UKSA 1V77A 1NFGA 2EO7A 1YADA 1ME7A 2E7FA 1VHNA 2VEMA 1HT6A 5AC5A 4AD2A 1W91A 1NARA 4CQBA 1I6NA 3TIMA 2CWNA 3TCSA 4DBEA 4LBRA 4DBUA 5CCZA 2ATMA 4AD4A 2QCLA 4UTFA 1EJRC 3W37A 2BHUA 5BW6A 3F4CA 1X8FA 1F7BA 5BMXA 4ECLA 1AVAA 1W5OA 1AH4A 1TTJA 2J78A 4PMZA 4XUYA 4HT3A 3AS3A 4W86A 1EIXA 5I3IA 1GJPA 2NQZA 3ARVA 1O1ZA 1K8CA 1KBIA 3JS3A 3QGKC 1OF8A 1Z69A 4BEUA 3PUGA 3GNXA 5CPOA 5FIPA 3MSDA 4Z2JA 1TWDA 3THUA 2GVEA 3IV8A 1A80A 3LRLA 3TYUA 4QNWA 1S3HA 2QPSA 5T91A 2IPFA 3LXBA 1T99A 4DWSB 2VCAA 3LS9A 3PZTA 3NPVA 5AKQA 4C7FA 3UF9A 1QCWA 3U2ZA 4UFLA 4AC1X 2ZRVA 2IUZA 4R27A 3F4VA 4S3EA 2J6VA 1IHIA 3W7RA 4JYFA 4K1WA 1XLGA 5GVJA 3BLEA 3AIRA 2WSQA 4DXVA 3EOUA 3D6NA 1LBMA 1XINA 4OJYA 3W29A 4U10A 3N11A 1Q5MA 5HMSA 4HHHA 4YYCA 2ZDSA 2ZRZA 4IMCA 4BF7A 3WLRA 3OIHA 3WJZA 4WOQA 3MJYA 2QGYA 4HU8A 2WB5A 3UXIA 3W7EA 4C1NB 4JHZA 2VZOA 3PY2A 5D37A 5GJNA 3DDMA 4MVAA 5JUVA 5EPDA 2DSWA 3IJDA 5DF0A 4UOZA 1LQ0A 3CO4A 1A3WA 5A6KA 3PBYA 5LIWX 1R3SA 4Q22A 4IL0A 5EBUA 3H21A 1UHVA 3TTQA 1POJA 4DAIA 1V4YA 4L4OA 2YBVA 1Q6LA 4H1ZA 3VTRA 4JTKA 5EL1A 3OU8A 3VKKA 3JVAA 4C1KA 2ZX8A 1WB0A 3CLWA 3S1XA 1C3FA 1B54A 4XBJA 1W1TA 4J5NA 3HG4A 4FO4A 3W2JA 3LCIA 3KOYA 1NELA 3N12A 5DANA 4AF0B 4Z42C 4YN5A 5DELA 4P2VA 4A8NA 2J9YA 3VKCA 1S5MA 4NZ4A 4BQ3A 2Q8XA 5DXXA 5HMFA 3QKEA 4EIVA 2RDWA 3UVIA 3UETA 4E3VA 5DY3A 3WNPA 1W1ZA 1HKVA 1EPXA 1SW0A 4LVGA 2P76A 1JAEA 2ZUNA 4FSAA 1GVEA 4L9YA 2VGIA 1HQTA 5XIMA 5CJMA 4GY1A 1LROA 2QCEA 3TXZA 2EG7A 1FVPA 3S1GA 2F8QA 2JF7A 2OOFA 2NX1A 4KEZA 4QJ3B 1EJUC 1QNQA 2GUUA 3L2LA 4BS0A 1GOXA 2ZXAA 1C7SA 1NDZA 1NOUA 3LCWA 4R3UA 1A5SA 2H6RA 5CJNA 4QRNA 3H55A 4Z2HA 2AAAA 4JX4A 4MADA 3UZXA 3DAQA 4AC7C 2D73A 3RXZA 2W63A 2L5HA 3STFA 5AFDA 4DUOA 3PZQA 1OIFA 3Q94A 1JRCA 3ABRA 4LGXA 1V6XA 4US6A 3N04A 4RNIA 4O54A 4W87A 1KV8A 3KBSA 5JBDA 4AW7A 3AIEA 1ICPA 1SM9A 3TMLA 1IEQA 3THAA 4J28A 1P7TB 1XYBA 3PZ9A 2Z1XA 2WLZA 1IXPA 4NU7A 2F38A 4Z2GA 1JDEA 3LTSA 4HBKA 1FWGC 3PS7A 1F4HA 3RF9A 4UTHA 1QW7A 3NYDA 3JRKA 1TWWA 3EMZA 2XPKA 3KLLA 3G18A 3QV8A 2QPXA 1YNPA 2OGYA 4E4FA 2EF9A 4EAYA 3GSMA 1BQGA 2IQDA 4O0KA 4DELA 1FKXA 1WDRA 3WIJA 1B5TA 1FWNA 1LQ2A 3GIPA 2VD8A 1BXBA 1EGVA 4RV3A 2GUBA 2Z7GA 5E0KA 3LERA 5AYYA 2VELA 3Q45A 2X30A 4GPNA 3W87A 4ADTA 4S38A 1UKPA 4XSMA 1PZ0A 2GZXA 3M0KA 3NOEA 1FH8A 3SUUA 2WAGA 3N4FA 4JQ3A 1HL8A 3BLOA 4RZBA 1XFCA 2X1RA 3LHYA 4IMFA 5A8PA 4CU7A 4FNPA 3CC1A 1HNYA 1H0GA 2Q8ZA 1KKOA 4YLWA 5MF5A 2QW5A 4NJHA 2WMIB 4W9TA 4DX3A 4J4KA 4W89A 1R9XA 3VNDA 3PULA 2FB2A 2RFGA 3BLFA 1WDSA 1HX0A 1JPHA 4QAIA 4V27A 1SVDA 1FCVA 5LNRA 3IWPA 3BAWA 4PCFA 5J5DA 3LI1A 3HG5A 5A8OA 2WXDM 3GG7A 4IX2A 2VRQA 4GUHA 1WNOA 4L1WA 2YR1A 3KUMA 4NF7A 1L2UA 2PDJA 4KGJA 1CWYA 3OZMA 5K9XA 2R1NA 3HM7A 1CB2A 2Y4SA 1RR2A 1X6LA 5BOFA 1XUZA 2ALRA 3NQAA 3H7RA 1W1PA 4JQ1A 3EMCA 1TKKA 3T9PA 5F2GA 1K6WA 3NIYA 1VS1A 2GVJA 4OQVA 1DJYA 3WQGA 1BD0A 4OBSA 4F0HA 3QQWA 4CKQA 4RE4A 1EYEA 3FSTA 3EOSA 3P0WA 4MSSA 4UMCA 5K3VA 1H1ZA 5DMNA 4JTUA 3SCQA 2O4QA 1A5BA 3DH7A 1MXGA 1X97A 3O06A 5HATA 1ZFJA 2E9BA 3QHNA 2QQ6A 3R11A 2ZZ3A 1AODA 3E2QA 3FHAA 5CBBA 1BPLB 4ZOEA 3MZNA 5IFPA 3WUGA 3QJAA 1J11A 5I3KA 4RK8A 2ZZ6A 1A0CA 3GUWA 2JE8A 4H6RA 1E55A 3W6MA 4QEEA 1FH7A 5A8MA 3U6WA 1R2RA 3B9OA 4AZGA 1K9EA 1W9UA 4YWIA 4KCUA 4J2PA 4JOMA 4A6GA 3G0XA 1I45A 1K03A 2ZA3A 4PMUA 1R87A 3LQGA 2GLKA 1CXEA 1PX3A 1XH0A 4W85A 3DHUA 2DEPA 1J9YA 2QJGA 3OB8A 2ZVRA 3TLQA 1LRQA 3WJYA 3PZMA 3RAOA 3RU6A 4O18A 3WH9A 3UY7A 5F2LA 1TMLA 3UYCA 4GQ0A 4AEEA 1OEPA 1QOPA 1WP6A 4HNOA 3BVJA 2ZUVA 3W7NA 1A0EA 3URBA 3TXVA 2Y85A 2FDMA 2XSXA 5AOUA 4DWSD 3BAKA 3MHFA 1SR0A 3B04A 3GXIA 2GWGA 5AZ1A 5M17A 1G4EA 2GVLA 2ISWA 1XCFA 4G1KA 1Q65A 4GLEA 5CAHA 4I5RA 1B31A 3RM8A 4I7UA 1TVPA 2X05A 5I02A 3D0CA 4IGMA 4DF2A 4A29A 1MZHA 3M07A 1GOMA 4H8UA 3T7VA 1IV8A 3FAWA 5D9PA 1C92A 1E6RA 1NAL1 3WNOA 3NFUA 3E2SA 4UIOA 2O9TA 4LWWA 4M80A 1W9XA 2VZTA 1CCWB 3A12A 5HWNA 3EGJA 1KA9F 1UWUA 1J6PA 1KXTA 4LYPA 1LJYA 1GOOA 4S3KA 4EPEC 2QCHA 5F2IA 2RJGA 2NQJA 3JUGA 2PURA 1IEXA 3N2OA 1V93A 3ARPA 1I75A 3MV01 1WCGA 4A22A 1TR1A 2CIPA 1OFOA 1H0IA 2XG9A 1YPXA 4IP7A 3CAWA 4FI4A 4H8NA 2Q3RA 2EGZA 4O8AA 1AA1B 1C8VA 3GVRA 4MF4A 3EWZA 1Z7AA 1OD0A 1ISXA 1J5SA 1SZNA 1H63A 3ARYA 4GHRA 2PWGA 1V8EA 3WUEA 1F61A 4MUPA 5CKSA 4LW7A 4IT1A 3KTSA 2Z1BA 3QPZA 3M16A 4GUGA 2FTYA 1ZRQA 3II1A 2YB4A 3MZ2A 2VX4A 5FJTA 3OLDA 3Q58A 5FOOA 2FZ8A 2XWEA 1JVNA 2VXNA 2I14A 2BVWA 1TPEA 3LBCA 4WDUA 1BWVA 4I6VA 4HNLA 3BV7A 3A9IA 1SZFA 1UJPA 5K9DA 3SFKA 1K3UA 2CERA 2PDFA 3GXTA 3RMJA 3EOOA 3F2DA 1G5AA 1RPKA 1HN1A 4IMDA 3B9AA 1OHLA 1GK8A 4JGDA 3DI1A 2ISVA 5HR7A 4QNEA 2E09A 2EBNA 1KQYA 3WQ6A 3K4AA 4FEZA 3HPFA 1Z6KA 3EKGA 5I00A 1YBQA 4GJIA 4MOZA 2NLIA 4NXKA 5BU6A 4PMYA 1J79A 4JNZA 4QG9A 3W0KA 4J3WA 1BWLA 4UTIA 2OEJA 2HXUA 3FW6A 5H8UA 3L4YA 2TPSA 2OO6A 3KRZA 3ME3A 3W1XA 3ES7A 4Q4PA 4AISA 2IQTA 3HGRA 3PK7A 2MANA 4N2YA 3STPA 1TB3A 2G97A 1T5AA 1MW2A 1GJUA 2NXIA 3QSRA 1KRBC 2ICSA 1K70A 1EQCA 5LZLA 1CTNA 4LUYA 2NT0A 2BHYA 9RUBA 2WZMA 5A2CA 1ITUA 3M43A 2FQIA 2Z1VA 5CZSA 1RCXB 2EJAA 5C2GA 4B2DA 5H8PA 3QR1A 1GTHA 5KITA 2Z24A 4G8TA 3VOIA 1DIDA 2WNQA 2Z7KA 5T9BG 3K4DA 4JFTA 5GJPA 3WBAA 3CBWA 1Q6FA 5DO8A 3OP2A 1W6TA 1EL3A 2V5CA 1UA3A 4M3PA 3DX5A 3XIMA 3C0SA 2OSWA 4GI9A 2GVGA 3GAKA 2YB1A 2PD5A 1WZKA 3IIVA 1JEZA 3FAXA 2PUZA 4NX0A 3WFLA 4DLFA 4JYDA 3IJ6A 1UZHA 3KXQA 1E4LA 1OVDA 4PTVA 3V1PA 1EKOA 4KEUA 1EUNA 3HFYA 1K9FA 2PA6A 4MB1A 1EHAA 2OPJA 1E9IA 4GC3A 4C5ZA 4DEFA 3L0KA 4GYPC 2IKJA 4OIFA 2C1HA 3OGSA 2INFA 3GYEA 3R94A 4W8AA 3UT0A 3UU0A 1NVMA 2Z1SA 3GZAA 3WELA 5F7UA 3W71A 5XIAA 3EB2A 3S0CA 1XLEA 3CUIA 2Z6IA 4CD6A 1OFBA 5D09A 3LMZA 3W01A 1BF6A 2HISA 3LG3A 3GY1A 1BTCA 1BXCA 3V5FA 3RMEA 4XB3A 2E4TA 3CMFA 2E0PA 2OU4A 3QQ1A 4RZ6A 3TE9A 2OWXA 1GCYA 4JQ4A 4KKXA 4D6HA 4AMCA 1RD5A 1R3QA 4EXAA 1I9CB 2Z1WA 2WQDA 1VYSX 2O7QA 1ITQA 2O4MA 5M5DA 2VOMA 1SSGA 3SCVA 1WXYA 4TUFA 1VLWA 5D9OA 2IW0A 1DWJM 1F74A 3OVRA 4Y7EA 4AU0A 1RCOB 1EWEA 1V7YA 5EMLA 4EACA 3WK1A 3RU8X 3EB4A 1LLZA 5A95A 1VH7A 3BXWA 1C9DA 4XIMA 5IBXC 1AUSL 2OGJA 3C3UA 3LM3A 3NVDA 1XIMA 3E6EA 3BLKA 3R25A 2XFRA 5F4WA 1UD8A 3IIOA 1J0YA 3NL3A 5HK4A 2J8FA 1UIOA 3G77A 1BYCA 5L6UA 3RCNA 3UWZA 3AUJA 1D9EA 4FNTA 2DJXA 4GXWA 4MY8A 1DWGM 4BQ2A 1UUQA 3CV1A 3L4XA 2V3EA 4FOUA 2V68A 4G1NA 4HCLA 5CZ0A 1JYXA 2OZ0A 3S6DA 3ZM8A 3BJFA 1Q2RA 3A24A 4DWDA 1OG6A 4F66A 1JZ7A 4HGXA 3BPWA 4QR6A 4H7CA 4KESA 2V5BA 1P0EA 3W86A 2HV5A 3R43A 4PMNA 4Y9AA 4AZ7A 4GVIA 4Q4OA 4H4IA 4KIRA 1RQHA 1KTCA 1R6WA 4V2XA 3SADA 4CQCA 3AXXA 2OMAA 3COTA 2PC8A 5E9XA 1SW3A 3B9NA 4P61A 4DYEA 2AL2A 1VRDA 3L0GA 3CTTA 3B9EA 7ENLA 4EAMA 5AHIA 1FP8A 3EX3A 3ITLA 4LUTA 1H11A 4MB4A 4D6CA 2J7BA 4I8YA 4EE9A 4ICCX 4LUSB 3SY8A 2F6UA 4ZL1A 1QATA 2WBKA 2FHCA 1W5MA 1XM3A 3NOYA 4GVFA 2XH4A 5CEWA 3UWQA 1S2AA 1SQ7A 2CLIA 1H3GA 4EX4A 4DJEC 5LNWA 1EIBA 1PHQA 2ADAA 2OODA 3NDZA 4F40A 4FA3A 5TAOA 2YDQA 1OYCA 4FOKA 4IIBA 3VGDA 4KWOA 3RPMA 3KCJA 1Q6GA 4FMVA 5HWJA 1TVNA 4HU0A 4XD6A 3NZQA 4HHMA 1DYSA 1GYMA 2WWCA 1W31A 4GYPA 2X1UA 4HPHA 3BMXA 4C91A 4IH3A 2GQ8A 3F2BA 1YHTA 4NNCA 4WY0A 3MWAA 3KVKA 1WBJA 4TXEA 3U5UA 4NT0A 4F2BA 3W75A 1W9DM 1EXPA 4JCMA 4Y9OA 3RFAA 1NP0A 1OBAA 3TYZA 4RJEA 1DWHM 3ITVA 4RPQA 3NL6A 3UXLA 3OEXA 2ZZ4A 3DFHA 3LCXA 3WLNA 2Y89A 3MW7A 3VYLA 2QMJA 3DHPA 1Z8AA 5EFDA 1IT8A 1P43A 4JNYA 1YE4A 3K46A 3NO1A 3M0LA 2PWHA 4AAJA 1QW8A 4MJ4A 4Q6JA 1TPUA 3ITYA 3MKCA 2QDGA 4L4MA 3W2LA 3BK0A 4I5XA 5E5CA 4YIWA 3RDKA 3LZ5A 3SUVA 3LY0A 5IBXA 2BVYA 3BLLA 4LBUA 3H4GA 3AJXA 1XIEA 4ZZ9A 5EMYA 4CGTA 2XISA 3KOFA 4L9XA 1QNVA 4FLQA 4HSOA 4QROA 2JBMA 4RNFA 1H7NA 2NLYA 1A5OC 4MZ1A 3HOJA 1VFHA 2G3NA 3CU2A 4YTUA 5BWFA 1B9BA 2XH0A 4HMDA 4GIRA 1V3MA 1S1RA 3AYRA 3KOZA 3OLEA 4L9ZA 4M81A 3U7VA 4FLOA 2XFYA 1WZLA 3U4FA 4LCRA 2V9DA 1AMYA 3PZUA 3C61A 4NSBA 1Z89A 2WMFA 1TPWA 2ZC8A 4OGZA 1Y7VA 3CZEA 1ZTVA 4F0LA 3ZYZA 3L0NA 3OYZA 1KCXA 2PF0A 2PODA 5E70A 1QFEA 4PTWA 3QN3A 1LBFA 3NYZA 4MAZA 4CCZA 4EOUA 1UC4A 2DV0A 1AG1O 4GYFA 3RN6A 2QCCA 4HB7A 4ZVJA 4AIUA 2HE8A 3EPOA 4FNUA 1CX9A 2VEGA 4LVDA 3SAZA 2OWWA 3PAOA 5T9CE 3MVIA 3G1XA 2NUYA 4MDPA 1ZP4A 4MKSA 5LSMA 4E8DA 3M6YA 1H7XA 4KPLA 2C8NA 1JPDX 4ZB2A 2EEXA 1PWLA 5DCEA 3GVWA 3GK0A 4DJEA 1UH3A 1B4KA 3T0BA 3S1WA 3R10A 4K7VA 4ICMA 3TAOA 5DEZA 3L9CA 3P7YA 2E1DA 4IICA 2WVTA 1JCTA 4HMNA 4UMAA 2QHAA 3T0CA 3M0ZA 4O10A 4LS1A 3CPGA 4GQQA 4ZXOA 1BEUA 3W1QA 2PCQA 1GOKA 1RP9A 7REQA 6TAAA 3CK5A 1C8XA 1QI3A 3PAJA 3UPMA 2YA1A 3BJSA 2VZUA 3PC0A 4GJJA 1REQA 4HK5A 2E3ZA 2EQDA 4JIEA 4C6CA 3AICA 3DOPA 4QLKA 2WK2A 4FP1A 1ZSXA 3AJ7A 4ATDA 2BXZA 3RK8A 3L4TA 1PYFA 2QDEA 4DRSA 3SN0A 3HJZA 1AK5A 2IXVA 5LIYX 4H00A 3T4WA 3CHFA 3TTOA 1SFLA 4PMXA 2CBIA 1Q4NX 4S3JA 3OW1A 4LVBA 1HIZA 3GBEA 4F79A 5G4HC 1FHUA 4DF1A 3BMVA 1VPXA 4XKYA 3CZGA 3GH5A 1ZJHA 3IPWA 4IZGA 3TTYA 2P8CA 4L6HA 2E5CA 1VHCA 2GSHA 3D3FA 2YLAA 5KZMA 1XSJA 3MO4A 2MUCA 4HTYA 5G1MA 2BMBA 1NH6A 4JIPA 2ZBTA 3HFTA 5EFFA 2PGFA 2WNNA 1OG0A 2ZA2A 3LV5A 1TJ1A 1UD2A 2A79A 3TONA 2PRHA 1ZAHA 1WDQA 1J12A 4ZENA 2O9PA 3CWOX 2QR6A 3F4NA 3A4XA 1O5KA 1G9HA 1Y0EA 1RP8A 1TJRA 3OO2A 1VBRA 4N4PA 4W7VA 5EMUA 1XYZA 3CPRA 3VKAA 4RUBA 1ZUAX 4GISA 5MKGA 1TV2A 3CIXA 2BOEX 4RLIA 3DG3A 1F05A 2NVCA 1Q8AA 2QUNA 4AZCA 3DC0A 3IVUA 1I2OA 4MNMA 1TJ2A 2AMXA 2XSAA 4Z0SA 1XC6A 4L56A 3NQVA 1IZCA 5HR6A 3PFMA 3AXHA 3W23A 3MBFA 3OHIA 3W72A 3MUCA 4KERA 1HFBA 2YL9A 1ZBVA 1PB0A 3FXYA 1OY0A 3VUSA 3NXLA 4J1OA 4TMCA 2VD9A 4PCSA 5FF2A 1VFLA 1JUKA 4J3UA 3NO5A 2P1FA 4QJ5B 8XIAA 5IXEA 1SSDA 4ERIA 3H2AA 1RBAA 5BXSA 2HK0A 4ZODA 2QZRA 3PFRA 4AIBA 5HQLA 1KR1A 3R4IA 3EBVA 4AVOA 2ZUSA 1C9WA 3QW4B 5C55A 1VBUA 4IP4A 1EH9A 3WD1A 3KEHA 2GDUA 3ZMRA 3TVAA 1XD0A 1F6YA 3HPSA 3VXGA 3CQJA 4IISA 4HU3A 2G4FA 3W7JA 3MI2A 3HJEA 3W07A 2WJZA 4FOJA 4H7ZA 1M7PA 3W26A 2D3NA 2HBXA 1I2PA 4RW5A 1EOKA 1LYXA 3GTIA 2GJLA 1W3NA 5JVLA 1QASA 1WX0A 4Q6XA 2E40A 5FSDC 1H5VA 3TSMA 1DE5A 5HA7A 1JDAA 2YPIA 1XLJA 3KCOA 2NX3A 1E15A 3KL0A 5HQMA 3VDBA 2V81A 4X3ZA 1KC7A 2A6NA 1XXXA 2VZSA 3GZ3A 1CXIA 1VZWA 3ATYA 1L8NA 1VFTA 3LPOA 1LZOA 5M03A 3JR2A 1D2KA 3AI0A 3W2UA 5I3GA 1M65A 1Y5XA 3GHSA 1VYPX 1V6YA 5LGZA 4AHPA 2XVPA 2WKLA 1OT1A 3K13A 3NDOA 1KLYA 4HN4A 1JJKA 1BVZA 3L66A 3KWXA 3N4EA 1BRLA 3KHDA 1WZAA 3T40A 2VDHA 4BQ5A 2DZVA 2J77A 1XDLA 1W2PA 1KGWA 2QGHA 5TIMA 4ROQA 4WDTA 5CZTA 3WEMA 3ZOAA 3QTPA 3IUHA 2WLYA 1UD5A 1YMYA 4YL2A 1P48A 4F0MA 4GQRA 3VOHA 1XR2A 3A4AA 3VMPA 2WZEA 4US5D 1X98A 1QNRA 1SZRA 1HVXA 2C6QA 4C65A 2A7PA 2ANUA 3S6OA 3VD7A 1P0DA 4AHOA 2W0UA 4HHPA 4KFPA 4Q8UA 4BFAA 4LEFA 1W56A 4M82A 3N15A 3N18A 4JTLA 5BRPA 3PN8A 3URAA 4MZ8A 3AFBA 1O4UA 3F7JA 4KT2A 1AJ2A 5D4YA 2O7SA 1B3OA 1WAWA 1TIMA 3QLDA 3EWDA 2C13A 2QT3A 2QLYA 2FZ9A 4GX9A 4PUWA 1O66A 3GQYA 4YMZA 3UXKA 1U1HA 3TROA 2WYSA 4X2PA 3F5JA 2YYTA 5HMEA 2XZ7A 4JICA 3AS2A 3QV6A 3MP3A 5CGQA 2PDGA 3BWWA 1W37A 5CPTA 2NUWA 3PTDA 4JX5A 3U5YA 3NQ2A 1JIBA 3TEVA 5LNVA 1I0DA 1PEZA 3ZVHA 4J3XA 1XGEA 2ZTKA 4GZ7A 4HJFA 2CZDA 1E40A 1W8SA 1TSIA 2XH7A 3UD6A 4GQGA 3U8GA 3B0VC 4JDBA 5JMUA 3CWNA 1D8CA 4H8HA 4GA8A 1IE7C 5KMYA 3TN5A 4RDWA 4HIBA 1BSIA 1MSSA 1Q3NA 3OTRA 3ABSA 2ZDRA 3RRAA 1EP2A 1US2A 2BVTA 1A5KC 1BXNA 3DHDA 5F2MA 1D3CA 4NYUA 1UZDA 2OZ8A 3S2CA 5D32A 5B7YA 5C9WA 2ZZ7A 1J8VA 2O9RA 3LCGA 3ZSSA 4PTMA 3HQPA 2ZE3A 4KCVA 3TDFA 1P1XA 2HTMA 1R2SA 3WUFA 2PDIA 4XSLA 3VD9A 3VDHA 3VINA 2XJ7A 3UJFA 4S3DA 2X41A 3V4BA 3W85A 4OTKA 3KX6A 1QOXA 4JIQA 1DPMA 1GNXA 1K8XA 5CPLA 1H50A 4L4LA 3ZS4A 5HUPA 1UKOA 1PKYA 3H2EA 4FF7A 3V75A 3WQWA 4PB5A 4M7TA 5A6SA 1MFVA 5GNYA 4XZBA 1IF2A 3MCOA 1VFFA 1L0PA 5C7HA 1P4CA 5JH1A 2HXTA 1FWIC 5EU9A 1Z3NA 1DORA 1XLDA 2FMNA 1ESWA 1W54A 4EXBA 2XTKA 2WM0A 1DJWA 3LPGA 2BBFA 3A3XA 4MNLA 4U4MA 2BG5A 4PCTA 4XZHA 3CHEA 3EX2A 1YYAA 4V28A 3F5KA 3I3DA 4MWAC 5LIKX 4D8LA 2HCVA 3BV4A 3WQOA 4J9JA 4O50A 2GL5A 3SUSA 1X1ZA 2P10A 1XS2A 1JCNA 5AYXA 1M03A 4ZE5A 2VR2A 3RPDA 5I3HA 3QBUA 4UFIA 2PCEA 4RXGA 4NYYA 3VCRA 4FXSA 2I56A 4GVHA 3NWRA 3VNYA 1MDRA 1XV8A 1LOSA 1JI1A 2P3ZA 2ZXQA 4CU8A 3N34A 1DWFM 4YU1A 3BGJA 2OYKA 4L4PA 3G8RA 4A3RA 3NSXA 1R2TA 1I60A 2D22A 3ZT7A 4GI8A 1E0WA 4JTTA 1VJZA 1R3YA 3HURA 3WLLA 1EA0A 3W00A 1DWAM 1M04A 3HB9A 2PRMA 4S3CA 3ZWTA 1PSCA 3MI3A 3E96A 4DY1A 2DIEA 3AROA 3S2LA 5FAGA 4WR3A 1T41A 2QNEA 4FNSA 3QPEA 1K1DA 4CNOA 2G37A 3B8VA 2VNCA 3C5QA 1YBQB 1MUMA 3T0TA 4ZXLA 4JTJA 1GKRA 3WYZA 5A6BD 4A2SA 5D8WA 3BOLA 4MJZA 1MXDA 3ARSA 3LHVA 1OCJA 2GVYA 4IXXA 5AC7A 1FWJC 4GC4A 5D2YA 1UP0A 2PF8A 1JNEA 1XYAA 5ECVA 2ZZ5A 5FF3A 4A05A 3C8NA 1TE1A 1SR9A 2XN1A 1XISA 2V2CA 4D6GA 1XRFA 1HKIA 3A3HA 2UY4A 4S3GA 5DMYA 3IGUA 3M0XA 3H2NA 2H3BA 3W22A 5HPOA 4PN2A 4LU0A 2G4JA 4KRTA 3E2RA 2R91A 1Q6QA 5EBAA 4TV6A 1P6CA 4QG6A 4JKMA 1K77A 1OK4A 2NV9A 3S5ZA 4QE4A 3UR8A 1NM9A 3L68A 3B03A 1NDYA 3LLFA 2BODX 3OZYA 2FIQA 2GK1A 1WQ5A 2XIMA 4CQ8A 1FQ0A 4AVNA 2I16A 1TPC1 1Q8JA 4B5SA 4B5UA 1XBXA 2GSEA 3VKBA 5JBFA 1BKSA 3APGA 2YA0A 1YTDA 2PS2A 4PRTA 2FVKA 4N42A 3AC0A 1XLLA 1OF6A 1I8JA 2XVLA 1MNZA 2PDUA 1MUWA 3G24A 1F2JA 2DQWA 4YS1A 2O0TA 2HS6A 4YWSA 3KAOA 5CZJA 4ZFCA 3SCTA 3ZWSA 3UCDA 4H9XA 4F8XA 3HQNA 4PMJA 1B57A 2HEJA 3NQ7A 4LS2A 2Y8UA 1YLVA 1SU5A 4JL1A 2BX7A 1J93A 4HSNA 1E1CA 2PB1A 3WNNA 2W27A 4R5EA 3REQB 3U3HA 2CLMA 3FYPA 3MC5A 3ELFA 1F3TA 2ZXDA 1FWTA 5E0FA 3BGGA 4MWAA 2F61A 5T26A 5IDIA 1WO2A 1Q7QA 4AYGA 2R8WA 2VEPA 5G5IA 3STGA 1U5JA 2G95A 3SIMA 3B0XA 4CQ9A 2QJNA 4HTBA 4XZNX 3BAIA 4HHLA 2ZA1A 2GDVA 4ZO8A 3B8WA 2C19A 4R9XA 5BXPA 5I24A 3AZRA 5CSUA 3ZR5A 2W79A 1V6WA 3W7GA 3AMKA 4KFOA 2QUVA 1ZCOA 3NXFA 4Q8NA 4Y6GA 1GKPA 3DGRA 4B3ZA 2ZIDA 3W28A 1G01A 7CGTA 3FVMA 2Z4GA 1Y65A 4C5YA 5G1YA 1GG1A 2DIKA 4V33A 3QY8A 3I6RA 4GI6A 4DYKA 2DT1A 1FWRA 1ZU8A 4D6JA 5A3HA 2R14A 4R34A 3GS6A 1FCQA 1E71M 3AOFA 1GQIA 5BRQA 3LGGA 1SMDA 3GKFA 4FIRA 2YDSA 2H9AA 3O6YX 1U30A 1W1A1 2ZVIA 3WQ8A 4O17A 5EYWA 4MAVA 1CZ1A 3FKRA 4AY8A 1F6PA 1D7FA 3CM4A 1E5JA 2EAWA 3SZ8A 1O94A 3LLXA 1BG4A 4L1GA 5AHFA 2WV8A 1V3KA 3CZ8A 4HYVA 1DHPA 1HGWA 4A2RA 4Z1AA 1M5WA 2A3BA 3AHYA 1TJ0A 3UPBA 4NI8A 1MZRA 1SFJA 3BW4A 3OVPA 4PMVA 1V0NA 4JQ2A 3UCCA 5A1AA 4QITA 1JFHA 2LLEA 2XIQA 1E1EA 3H7UA 1ECQA 4LOCA 1ZBKA 4V15A 4GUIA 4TX6A 4D6FA 2HJPA 4M51A 5IFTA 1G6CA 2HDJA 3P8IA 3MWCA 3PNZA 3CHDA 4PUEA 3VILA 3PTQA 4RZ4A 5TNVA 1SJBA 2YLLA 1EA9C 1WYIA 3WENA 1GYNA 2FVLA 3UWYA 2I17A 1HKJA 2V5JA 3B8TA 4UTMA 4LUTB 3I3BA 1GOQA 1EP1A 1KR0A 2VFIA 1K9DA 2X09A 2QXWA 1M3UA 1OM0A 1AFSA 1B3ZA 2AOSA 1F5ZA 7ODCA 3DENA 4MB5A 3S2NA 1TFVA 2FZDA 4AFYA 1OK6A 1UWSA 2OZ3A 4JTRA 4GGBA 4YXGA 4IG2A 4WUIA 2Z2AA 3G0UA 1A5MC 4GKLA 3DFOA 2HBVA 2OKOA 4N4QA 4JN8A 3W76A 2NQLA 4RKAA 3TMQA 3CAKA 3T6CA 3T2PA 3WJWA 2OX4A 2D2GA 3B0UX 3P14A 3T81A 1EZ2A 3LGDA 2NV2A 1EF3A 1FXPA 4WY0B 5I03A 4ZQMA 3GXPA 2WZHA 1TG7A 4AH7A 2PD9A 3KHJA 3TYEA 1W8GA 4O1EA 3MUZ1 3P74A 3GC4A 3SGGA 2JEQA 3G1HA 5HNNA 7A3HA 2VMFA 1ZNNA 3RO8A 1MEIA 1VKFA 3ERPA 1RQEA 3RIKA 3W7IA 1S46A 4GFSA 2BDQA 4PBFA 1TZZA 2VX6A 4AB4A 2WJDA 1EGZA 3KTCA 3IANA 4ZO9A 1JCMP 1CXKA 2V67A 5CJ5A 1H41A 1DXIA 3GE7A 5I7GA 3EKZA 4HQVA 4WIWA 3R2GA 1WA3A 4B9YA 3CEUA 3QYSA 2DPEA 3FEMA 4IIHA 5FEPA 3HPZA 3G5EA 4Q8WA 2HVOA 4O0ZA 4Y8FA 1PXGA 1JXKA 2E28A 3UWEA 3ITXA 4UR7A 4N6FA 3VC6A 3AMLA 1GQLA 3AISA 1OFPA 3T2QA 1TO3A 5C8BB 5FSEC 3KS6A 4FLRA 1DE6A 1YIXA 4F9JA 3BW2A 3QMSA 4ATWA 3GVVA 3L5LA 3TC7A 1SJCA 2VR5A 4LYQA 3BGAA 5IRPA 3WDQA 2I57A 1DV7A 1KNWA 2CBJA 1WKFA 3HU7A 3QKZA 4DJFC 2DZSA 3FS2A 3GNOA 2FFIA 2CW6A 4KH2A 2D20A 3TFCA 1VEOA 2Z1KA 1E1FA 2X1TA 3S1VA 4QHRA 3KZPA 1W1IE 3BAXA 4I9MA 4BA0A 3ZVIA 2D3LA 4LAZA 4LNYA 1DIKA 3WKZA 5KETA 4Z1DA 3MU7A 4XZMX 1H2JA 3N2BA 4UNKA 1UPPA 2VR4A 2GFTA 2NX9A 3MUAA 3QM3A 2OQLA 3KBVA 1MWOA 1BWKA 3D47A 3HV8A 2PDMA 1WPCA 3IJ7A 1QJWA 3NQGA 5E6ZA 1TZ7A 2DVTA 3RHGA 4KGLA 1R7AA 3WLMA 3QLLA 4H9MA 5CBIA 5GQBA 2NWRA 1EOMA 4I7WA 1UJQA 5AC8A 1AD4A 4B2DD 1E9YB 1TELA 3MYPA 2DW7A 2X42A 3MP5A 3RRXA 1XPYA 4XZLX 1OZQA 1CLVA 4NZ1A 1DBTA 3N2MA 4L1XA 2GQAA 2AMGA 1E6PA 3B8IA 5A8GA 2F84A 4HPXA 3AIWA 1PUDA 1M7XA 4ZB0A 7REQB 4XVEA 1OX5A 1YDYA 1P0KA 1RA0A 3S5OA 2FGLA 4GRSA 4EK7A 4TVUA 3DFNA 3QFEA 4W84A 3TFXA 3RX2A 1GVOA 3HBLA 1JPMA 5CG0A 5DCBA 1Z42A 2G50A 1EJVC 2V82A 3RUBL 5C9ZA 2TRSA 1QT1A 2YFOA 4DYJA 3VMNA 1PIIA 3RJYA 2ZUMA 2CYGA 4AY7A 3G1YA 1S38A 5HAOA 3EMQA 3T0DA 4OHQA 2JFEX 4C90A 3LXCA 1JGMA 5I79A 3M6DA 3EDJA 3I6TA 4CQAA 2CEQA 3LSBA 3UYIA 4XKYB 2QAFA 2YIHA 3UNDA 3J7HA 4C6PA 4UFJA 4GQBA 3VDAA 3WQVA 5FEXA 3H26A 5BRBA 1EX5A 4Q7IA 1KM3A 3RM9A 3PZIA 3TNOA 3M0MA 2C16A 3GC5A 2Y8KA 2D0HA 4LSBA 2MNRA 2WPBA 3DFPA 3PUOA 1QWGA 4UQ9A 3WD0A 1DKWA 4Z2IA 1ZP3A 2J8TA 3WQ5A 1VBHA 4E2BA 1BF2A 1M41A 4CN4A 4LVAA 1ODZA 4FR6A 4PMRA 4JR5A 1JZ8A 2Q71A 3QV7A 1V3HA 1LLOA 2HS8A 1BVWA 4AWTA 3GU9A 3WLSA 4Y9PA 1XW8A 3R8GA 5A6TC 4NZ3A 3IARA 3NZGA 4HK7A 4QSHA 1IWBA 3W70A 4AIEA 3VFCA 1OINA 1R86A 1GPFA 1U22A 3MCNA 2Z27A 5MKGB 4HNUA 1DJXA 4DJFA 1PAMA 1J6OA 4IJCA 1OABA 1G67A 1E4NA 2YCIX 3LU2A 3A23A 2GDQA 4B15A 4OZOA 4AZCB 5BU9A 4HD5A 3V5CA 5J8LA 4IIFA 2PGRA 3GHTA 4G7EA 4QBXA 1RK6A 1N55A 4IFRA 4Q7BA 4Q7NA 2DUAA 5I3DA 4ZCWA 4B90A 4OUEA 2VRJA 3FDKA 3R0KA 4EWJA 3E0IA 5E0CA 3R0UA 3VGHA 1SFSA 1Q6EA 5TF0A 3W7MA 4RX0A 3EOLA 2QUTA 4J3ZA 2HPIA 3CIWA 5MHBA 3GTXA 1QPNA 3S3GA 1J2BA 3WQPA 1TMQA 5D30A 2YSWA 4B4FA 2O55A 3KP0A 3PNUA 1KFEA 4K36A 1U1JA 4JFVA 1IWAA 3GXNA 1T8XA 4S3FA 4A3HA 4CQDA 3C3NA 4X61A 2WVVA 3QF0A 1RZMA 3EXSA 2QDDA 1E6SM 1TV8A 3GR4A 2NV1A 3V5OA 4UMBA 5D2VA 1TMHA 3UXDA 1KBJA 2GJXA 4PFMA 1EJSC 1FDJA 1X6UA 3CZLA 1QXLA 1WDWA 3TC3A 3UPWA 1O6IA 4FHAA 1SYTA 1OYBA 1TPVA 2PDLA 4V1XA 1HVQA 3C2OA 4S3BA 3FK4A 2VFDA 3N3MA 2ISFA 4ZSUA 2WKJA 4OV4A 3UY8A 1B90A 1UCWA 2GGHA 3KFTA 3H2CA 4LY8A 3PJWA 3O63A 3CXOA 3VIGA 2E68A 4FNQA 1TUFA 5E9AA 3SFWA 2NQ9A 5CSSA 2HSAA 1EDGA 1XRVA 3TSBA 1HXJA 3E0FA 4MZYA 1K9TA 2IKHA 1EB3A 4QTGA 2WSRA 3KOXA 1OT2A 3AALA 1LDCA 2JIWA 3KWSA 3PB0A 4BI7A 3NR0A 1CGYA 1QVBA 2DVXA 3GR8A 5D2TA 1BRLB 3LCHA 3ZXWA 3QZ6A 3P5ZA 1UR2A 1TE6A 9CGTA 3JU2A 3VDCA 3KCLA 2EPKX 4J7RA 1YDOA 1FFQA 4Q4MA 3L7RA 3VABA 1YW1A 3TJXA 3TWAA 1EEPA 4AZ5A 2RGMA 4AZHA 4PA8A 4WD0A 3STCA 5CC7A 4O4WA 1JRBA 4XAYA 3VIJA 1V02E 4UQEA 3CUZA 4IXHA 1JCYA 1YX1A 1J0JA 2BXYA 2IKIA 3T8LA 3PWAA 1S2VA 1N2VA 3S2JA 3SCRA 2VEKA 4DUVA 4LNCA 2YXXA 3SUWA 4ENLA 1IEWA 1A53A 3CZJA 2J6XA 4O13A 4J3SA 2YKKA 1RBLA 2A3LA 3CMGA 1GW1A 3TQPA 2VC5A 4GMEA 4O4VA 5JBEA 4C6EA 4KMQA 3KBMA 5KSWA 1ZBCA 4GY0A 4E3TA 4WVXA 3USBA 2XIJA 4LBSA 4O15A 3ZVHB 3WLOA 4K38A 2VJXA 3WLTA 1XDJA 4Z1CA 1QW9A 3PZGA 1VFUA 2V5DA 4H9YA 5I3FA 1KCZA 1TJPA 4DF0A 3VNLA 1VPYA 3SY5A 4JX6A 1R9YA 1K4GA 2VVSA 1RALA 2VFEA 3QR3A 1PTGA 2E6AA 3APYA 3FJ4A 4E4PA 4PUMA 2R9RA 2VURA 4GD0A 1KM1A 3G1FA 1QR7A 1M7JA 1TREA 3GU1A 2FZMA 1UW9A 1F3EA 1G7UA 2QJMA 3BSHA 2WVSA 3N13A 1J4EA 2POZA 3EXTA 4X22A 5CZKA 4DB7A 1UYQA 3GVQA 3BW3A 1V0MA 1VIZA 3NL2A 3A47A 3VOCA 2A1YA 3ZIZA 2XSBA 3POCA 3QVQA 1YXDA 2F2HA 6PTDA 4WRHA 5JXQA 1YDNA 2JIEA 1V5XA 1QDSA 2R94A 3TJ4A 4ZE4A 7TAAA 1FKWA 3IK2A 3QPYA 1J0ZA 4PZVA 5JH2A 3CT2A 1JZ2A 1JCXA 4DVOA 4AIOA 4PC8A 1OFAA 2FH6A 4DJED 4UBPC 1JD9A 2BHZA 4C6OA 1E51A 1E4IA 1E0VA 2ACSA 3SSJA 3FFSA 2OFJA 3EWBX 1DL3A 4QM1A 3L12A 3VCCA 1RBOB 1TYGA 3H4WA 2Y61A 5REQB 1T40A 4H04A 3UWVA 4H3DA 2R82A 3CGTA 2DU2A 2FDSA 3OGVA 2A4AA 4N0RA 4K8EA 2A2IA 4E0CA 3R5EA 3O15A 4WX2A 1K7FA 1NOFA 2OLHA 3WBYA 2PDHA 2ASHA 5AY7A 1XD1A 2Z0IA 3VGBA 3FGCA 2VKZG 2EXOA 3THCA 5D2XA 4E2VA 4NZ5A 1U2YA 4JTFA 3C6CA 1VAHA 4ZO7A 4CVWA 2QCGA 3GG8A 1KXVA 1PVNA 1G69A 4GO8A 4TIMA 3AXIA 4BR1A 2X7VA 4ML4A 3CL7A 3AXMA 1E6XM 3PP7A 5EY5A 2CZFA 4A4AA 3LSCA 5C5YA 3TW7A 2J47A 3W9ZA 3NL5A 4FAMA 2PP1A 1NOWA 3S46A 3L4ZA 4MJ2A 5ABHA 3P0XA 5F4SA 3R1ZA 2Q02A 4DM2A 4UR9A 3O6DA 5HNUA 2C14A 3W81A 1UPMB 2CZEA 3BDKA 2V3DA 2X2GA 2VRKA 4NILA 3ZO9A 3A21A 3LTYA 1LRTA 3L4VA 5IDZA 4CUCA 3FCPA 3KVLA 2RH9A 3ZJ8A 4GABA 2BS9A 4GI4A 5C7VA 2WCGA 4NZFA 1ZLPA 5GNZA 3EWCA 4Q33A 4REQB 3UZZA 1FWFC 2CFFA 3CQKA 5DX7A 3URQA 1BVNP 2FZNA 1WOAA 4K39A 3GIQA 1H7OA 1GVYA 4XZ9A 2DQXA 4TQTA 4ZO6A 4XBKA 1I2QA 2DZPA 6REQB 2PZNA 3NZPA 2HE5A 5TBOA 3FJNA 4GG9A 4NRSA 3KVMA 4ZR8A 1PZ1A 4IM4A 1GZJA 3K8KA 1DTNA 3CV7A 2BB0A 2AKMA 3TCEA 3SN1A 1PO9A 3BG9A 1YXYA 5AHNA 3AIBA 3W1AA 2B0MA 4JFSA 1VEMA 3ZFHA 3NQCA 4XV0A 1PE1A 1O7AA 1OC7A 1UA7A 2YA2A 5A6JA 4CN6A 4POCA 2EKCA 2V5LA 4UFKA 3FKKA 4QLJA 1GVFA 4HZ8A 2GK1B 4KS0A 3BAYA 4XX6A 1X6NA 2QIWA 4LQ1A 2I5GA 1EDTA 1Z41A 1UWAA 1S5WA 2ZC1A 4N02A 1UR4A 3NVTA 1XUUA 3VD4A 3BTNA 1J5TA 1JZ6A 1JDFA 2JKPA 4O52A 2YL8A 3VOFA 1OFEA 4XKMA 5FF0A 1ZQ5A 3KW3A 5F1VA 2XM2A 3DECA 2X0HA 1V79A 5EA9A 1KW1A 3CUJA 2YBTA 4IIGA 1XYMA 2OT1A 3TP4A 1H7PA 4JTCA 1NF0A 1SO5A 3C2FA 4R33A 1E1CB 3TN4A 5BYWA 4B91A 3UA3A 1S3TC 2YOCA 3QC3A 4IFKA 1EPVA 2Z6JA 3ZLHA 4LANA 3G6MA 4MWAB 4UQBA 2RHGA 2XHYA 3TJIA 2D2HA 3PBUA 1AH0A 4KW2A 3HA1A 5SWUA 1JR1A 4IUGA 4JTHA 1FUYA 3R79A 1Q4WA 4EPDC 1R46A 1RVKA 3UG8A 1SO4A 4UOQA 1MEHA 4Z1BA 4KBXA 4S1FA 1VFOA 1TR9A 1KBBA 3SQMA 4ALDA 1US3A 3VAVA 2J62A 4UWMA 3TNBA 2D0GA 2PWDA 3M64A 3B97A 2BV9A 4PCNA 5KZDA 4AEOA 3WMLA 1V3JA 4XBSA 4PFHA 1HJQA 1NWTA 2YJQA 5AZ0A 5HNRA 1SO6A 3MUIA 1EWDA 2VFFA 3E74A 4WXYA 3WJSA 3GNNA 4FX6M 2V63A 1L8PA 2P0IA 1JQVA 1MDLA 2CLKA 1