2WWDA

3d-structure of the modular autolysin lytc from streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
432
structure length
432
Chain Sequence
NAAAYWDGDYYVKDDGSKAQSEWIFDNYYKAWFYINSDGRYSQNEWHGNYYLKSGGYMAQNEWIYDSNYKSWFYLKSDGAYAHQEWQLIGNKWYYFKKWGYMAKSQWQGSYFLNGQGAMIQNEWLYDPAYSAYFYLKSDGTYANQEWQKVGGKWYYFKKWGYMARNEWQGNYYLTGSGAMATDEVIMDGARYIFAASGELKEKKDLNVGWVHRDGKRYFFNNREEQVGTEHAKKIIDISEHNGRINDWKKVIDENEVDGVIVRLGYSGKEDKELAHNIKELNRLGIPYGVYLYTYAENETDAENDAKQTIELIKKYNMNLSYPIYYDVENWEYVNKSKRAPSDTDTWVKIINKYMDTMKQAGYQNVYVYSYRSLLQTRLKHPDILKHVNWVAAYTNALEWENPYYSGEKGWQYTSSEYMKGIQGRVDVSVWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights Into Pneumococcal Fratricide from the Crystal Structures of the Modular Killing Factor Lytc.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords 1,4-BETA-N-ACETYLMURAMIDASE
total genus 121
structure length 432
sequence length 432
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
A PF01473 CW_binding_1 Putative cell wall binding repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2wwdA02
1LL6A 2BHZA 4GZIA 3EYPA 2AOSA 4MJ2A 4FLOA 4UR9A 4AMCA 2G3MA 4W5UA 2EPKX 1W3HA 3WN6A 2ZXDA 2CYGA 1ISXA 5M5DA 1HL9A 3WNPA 3SCVA 3W24A 3W6MA 1WPCA 2CXGA 2EQDA 4P8UA 4PMRA 3RJXA 4DWSA 1UWRA 1HJSA 2UWFA 5D9NA 2VNCA 3THDA 5A8NA 5A2CA 2YBUA 1X1NA 4HOWA 4LYRA 3ZR6A 1BAGA 5ECUA 3ZT5A 1E5JA 2WMFA 3VVGA 2WCAA 1KQZA 3WBAA 5D8ZA 2DT0A 3UR7A 2JEQA 1NM9A 4UFHA 3AZRA 4DWSC 3WH8A 1TFVA 4AZCA 2DH3A 2OWCA 3T2QA 5I23A 1BYDA 4YPJA 5ABFA 3OBAA 3SUTA 3T2OA 2D20A 4TVDA 1LG2A 3OZOA 2CHNA 2BNJA 1ZL1A 2C7FA 1W1PA 3L4UA 4ZE5A 1S46A 1QW9A 3M46A 3WENA 4U31A 2WVVA 3ARSA 3WH7A 3WUGA 1FH9A 3M07A 1U2YA 3VINA 1K9FA 2DT2A 1UD5A 1C7TA 2XUCA 3T0BA 4DUXA 1VEOA 1JAEA 1XH0A 3W0KA 1DP0A 5A6BD 3AMGA 4HTYA 4OZOA 2VT0A 3EMZA 1C7SA 1V3MA 3QOKA 3PZVA 4PMZA 1BG4A 4E8DA 3BMVA 1ESWA 3VMNA 5BRQA 5BXTA 3CH9A 4B9YA 3T2PA 5A6KA 4PMNA 1E4NA 1WZKA 5I5RA 3QOMA 3CO4A 5ABEA 5DO8A 3EDEA 2DPEA 3AICA 2E8ZA 1ISVA 4PMYA 4W7WA 5F7UA 3W38A 1JXJA 5I0DA 4V2XA 1E9LA 4PYSA 4AD5A 3VOCA 1TR1A 3EDJA 4PMQA 5E6ZA 3VGBA 3CUHA 4QCFA 1ECEA 3WH6A 2J7FA 3FHAA 1UA7A 2YDRA 3OZPA 3SCOA 3DHPA 1TVNA 4XZWA 3PTKA 3MS8A 4HA3A 1FOBA 1UKOA 1US2A 2PB1A 2BY3A 1FP9A 3IAPA 1E6RA 2ZX8A 3GBDA 4EE9A 1V6XA 1W3LA 1KXTA 3OLGA 1QI4A 1TUXA 1OT2A 1KR1A 2AAAA 5GQBA 1LQ0A 5CPTA 3U57A 4UOJA 2ZX9A 1X6LA 1DWHM 5DEZA 3ZR5A 1BGAA 4WIWA 3DYPA 1VF8A 2WMGA 1Z32X 2WNWA 3K4AA 2ZXQA 4P7LA 1BF2A 1UD2A 4HU8A 5D4YA 2EEXA 4WK9A 1RH9A 1BYAA 4GQRA 3AHVA 5D9MA 3RILA 3VTRA 1E4IA 3BAIA 2D2OA 2A3HA 2IXUA 1UQYA 5KZ6A 1MQPA 4DWSB 4AD0A 3MMDA 2VZUA 1E4MM 2WZIA 4M82A 5FL0A 3WBEA 1J0JA 4DUWA 3WF0A 5LA2A 1UG6A 4AW7A 2UY2A 1GNXA 3AROA 3VM5A 3BSHA 1HT6A 1IZJA 1Y7VA 3QHOA 1H5VA 5GPRA 6TAAA 4FMVA 5A8MA 4KRTA 2YKKA 4TX6A 5ABFB 4AZHA 2MANA 3W6LA 4GXPA 2A3CA 3QHNA 3ARVA 4OOZA 2JF7A 1GHRA 1B1YA 1P6WA 1OBAA 1WAWA 3N15A 5E9AA 4JFTA 3VMOA 1F4AA 4UQBA 1WO2A 1WZAA 4AZGA 2ESCA 5E0CA 1MFUA 4UCFA 1H2JA 4DUVA 2EPNA 3VGGA 2ZIDA 1PX3A 2RGMA 2WZEA 2J78A 2OYLA 3TA9A 3SCUA 2Y24A 4AD4A 1MVYA 2CESA 1VFUA 9CGTA 1E6NA 2DIJA 3MSGA 1E71M 1XCXA 5LA0A 3GBEA 1KXHA 3ZT7A 1I1WA 4BQ5A 1E1EA 1SFSA 2YLLA 1E73M 4CGTA 3VIMA 1MQQA 4PMDA 1Q6EA 5M17A 3WQVA 1HX0A 3FHQA 4PN2A 3CMJA 4U2YA 1QVBA 3IANA 1KR0A 3AIEA 4AISA 5AC4A 3I3EA 4D6CA 1IV8A 2ZICA 3CTTA 4D1JA 2VO5A 4D71A 3N13A 3B9EA 3VUPA 3L4VA 1E55A 4W8LA 1EHAA 1GW1A 4PEEA 1JF6A 1E1FA 2WCGA 2JE8A 1B3VA 2FDMA 4KMQA 3SCPA 2W67A 3WQ6A 4E4PA 1FHLA 2WBGA 2NSXA 1V6UA 3ARPA 3G6LA 4W7VA 3KE0A 3WMCA 1Q6GA 4AIOA 4MTVA 4D6IA 4J3TA 1OGGA 3VIJA 4MADA 4EAMA 4OOUA 5I2UA 4GIAA 1LLOA 3DYMA 1AQ0A 3MMUA 4JKLA 1JYWA 4V28A 3KEHA 2X0YA 2VX7A 1NOFA 2V5CA 2E3ZA 3W25A 2VUYA 2VZOA 2JEPA 4MNMA 1CXKA 3WDRA 2FH8A 1EDTA 1VFMA 2V3DA 3I3BA 1JYVA 3A4AA 3NJ3A 4U33A 1QI3A 2JIWA 3LMYA 5ABGA 1JD9A 1FHDA 1PBGA 3K8MA 3WMBA 1UR4A 1E6ZA 3VKKA 2D0GA 5JBDA 1HJWA 4GZJA 2PI6A 1XH1A 1C8XA 3A6OA 4EKJA 2YJQA 3L2LA 2OSWA 2PWHA 2CHOA 4N0RA 1B3WA 3KL0A 1GVYA 3E1F1 1B30A 1GOIA 4IUGA 1E0WA 3WUFA 3SCRA 3UEQA 4A3YA 3BAWA 4UFLA 2BXZA 2VRJA 2WWCA 4ACYA 2XHYA 1HVQA 4UQEA 3F5LA 4PTXA 5M3WA 1G01A 1UWIA 2CNCA 1CIUA 1JYXA 3MUY1 3ARZA 4BZYA 2J7HA 1FFRA 4H8HA 3EDFA 1JL8A 1CGWA 1CPUA 4UZUA 4J3SA 4NZCA 1WDPA 2QPUA 4AEFA 4AZIA 1E3ZA 3MSDA 1V6YA 2WM0A 4UFIA 3D3AA 2A3BA 4TTGA 5EFFA 4QDMA 5I24A 4UQDA 2CKSA 1UH4A 3WEZA 2XIIA 2BS9A 1QPKA 3T08A 1RP8A 2ZUUA 5A8PA 1Q6DA 2PWGA 1PIGA 4B15A 1B0IA 1NH6A 3ZO9A 4U3AA 1HNYA 2WC7A 4JKKA 1TA3A 2WLZA 3WNMA 3OLEA 1I75A 4MJ4A 4F9JA 3VX1A 4ACZB 5A2BA 1C3FA 3AIWA 3CZEA 4UOZA 3W81A 4CVUA 1J11A 3BAJA 3RDKA 1CXIA 2ZUWA 4D6GA 1HL8A 4C7DA 2WHLA 2PC8A 4JFWA 3TONA 1KGUA 4M29A 1W3KA 1GQIA 2XPKA 3SEPA 4WLCA 5D9OA 3B9DA 2DT3A 3F5JA 4D6JA 3AIQA 7TAAA 4D6HA 1EQCA 1EH9A 2DIEA 2HVMA 1CXEA 2BFGA 3NCOA 3QGVA 3VIIA 2VCCA 4CU8A 3PZMA 1GOWA 2PWFA 2VZVA 4X0NA 4CU7A 4GI8A 1JG9A 1GQKA 1EDQA 4HA4A 1A3HA 4GINA 1NWUA 3POCA 3AMDA 4JCMA 1HIZA 3J7HA 1E40A 1M01A 1BVNP 3U5UA 2Y4SA 4N42A 3VMPA 4JCLA 3W29A 3PHAA 1OGBA 2VL4A 1CGYA 4MB3A 3AFBA 2OSYA 3SCWA 4GQQA 4PCTA 2JALA 1UWSA 1HXJA 4QCEA 2G3NA 2CBVA 1BYCA 1IZKA 1B3ZA 3A4WA 1UKQA 4V27A 3NSXA 3IAQA 3AYRA 7A3HA 1CGUA 3GXFA 3ALFA 1FFQA 3ZM8A 4JFSA 4LX4A 4Z2LA 3S2CA 3EMQA 3KL3A 1WZLA 1JXKA 3VGFA 1K9DA 1JZ5A 5BROA 4PMXA 4PUEA 5BYWA 2VQTA 2NT1A 5EBAA 3RCNA 1GCYA 2YDSA 4P7RA 1CGTA 4Q22A 1MW2A 3WNNA 2ZWYA 4OIFA 5CXPA 5JIWA 1HP4A 1I1XA 1C8YA 4IM4A 3FAWA 1WDQA 1D2KA 4OKDA 1BSIA 3WF3A 3VIFA 4S3KA 1HP5A 3ALGA 3B8SA 1B2YA 1BPLB 1R8LA 2O9PA 2FHFA 2CITA 1MW3A 2J7CA 2XVGA 5HOSA 3A3HA 2CBIA 4PBGA 5IFTA 3UR8A 3W26A 4CD6A 2Y2WA 2NW0A 3NDZA 7CGTA 1VFOA 1XSJA 2UY5A 2W5FA 2YL6A 5CQ1A 3GDBA 2CEQA 2PBGA 5AC5A 1GOOA 1ODZA 2ZUSA 4W8BA 4NRRA 2GJXB 3DC0A 4CD8A 2WZHA 3AMKA 5JIPA 2QF8A 4F66A 3GH5A 4E8CA 1VRXA 3RMEA 3MUZ1 4X9YA 1E0XA 1D7FA 4QLJA 1R85A 1EQPA 3VIKA 4K68A 1UH2A 3VD5A 3WQ4A 2XJ7A 3N04A 1W9DM 1BGGA 2DH2A 4A4AA 1MQRA 3ZQ9A 3HU7A 4P8VA 2E9BA 5HDRA 4WSKA 1TCMA 1V3IA 3ZJ8A 3PTQA 1V0KA 3GYCA 1QI0A 2V3EA 1E72M 2W92A 1CXLA 3WEOA 4W87A 5KEZA 3ARTA 1BG9A 4PRWA 2E0PA 2QMJA 2YIHA 1UD6A 1PAMA 4DWSD 5GNXA 1OD0A 3LPFA 4TUFA 1E0VA 5I77A 1BFNA 1R86A 4M1RA 1KCKA 1W1YA 5A6LA 4PUDA 3RO8A 1V0NA 1GOKA 2TAAA 1UH3A 4U2ZA 4AD2A 4GPNA 3K1DA 3IJ9A 2ZE0A 1FA2A 1MXDA 1OIMA 2DSZA 2GJRA 3OGRA 1SR0A 1JZ2A 4HMDA 2WC4A 4Z2GA 4UFJA 2FHBA 4AYSA 3WKZA 1HJUA 4R5EA 3UERA 3WNKA 1E6QM 4DM2A 1W1TA 2YA2A 4C7FA 5E09A 1PZ2A 3OGVA 2NT0A 4MNKA 2J47A 3WH5A 2WAGA 1UR0A 1V3LA 2CPUA 2F2HA 2J62A 1ZJBA 2ZX6A 1E5NA 1V3KA 2GDVA 2OWXA 4X0VA 2X2YA 4HP5A 4ZENA 1M53A 3HN3A 4ZE4A 4IPNB 2UY4A 4F8XA 3ZSSA 2DSWA 4PTMA 1J0ZA 1AMYA 2XFYA 4HA1A 1EHNA 4TTUA 4D6DA 1GJWA 1BLIA 2IUZA 3SCTA 4AD1A 3VIGA 3ZJ7A 4JL1A 4LYPA 4FLSA 4AZCB 3PTMA 3L4WA 1UKPA 3A4XA 4AZ7A 1GJUA 3K46A 4AZ5A 4AEEA 1M04A 3MV11 1JDCA 3PZUA 3WQWA 1JYNA 1KGXA 2XVNA 3OG2A 3W37A 2WVVB 4J28A 1GORA 1OSEA 1FH8A 4QP0A 2CBUA 5E6YA 5BRPA 2ZX7A 2J4GA 2W61A 3WNLA 2VR4A 3PZQA 3GNRA 1E43A 2YL9A 4BCEA 4FF5A 1NP0A 3WDIA 1ZU8A 1MFVA 4KH2A 1DWJM 3AHYA 3CHDA 4ATDA 1GOQA 2Y5EA 4AZ6A 4UQAA 3VNZA 4CU6A 1ZB5A 4OBRA 4XB3A 1CECA 1UWTA 4H7VA 2J7DA 3SUVA 2BY0A 1KFWA 5FOOA 3NSMA 2XFRA 1KWGA 4PTVA 1HVXA 1CTNA 1GQJA 3FY1A 5LYRA 4GO8A 1LWJA 3GH4A 1W9UA 4B3KA 1EA9C 1MW1A 2WHMA 4J7RA 3K4DA 2GVYA 1Q4NX 3AXHA 1CDGA 4H04A 3BMWA 4CD4A 1OGSA 1TE1A 3GNPA 3RM8A 1HKJA 4LGXA 2D22A 4BQ4A 4WKHA 2DEPA 3UG5A 1AQHA 2V3FA 3CZLA 3AHZA 4CKQA 1SYTA 3LPOA 3BXWA 1Q6FA 3BCFA 2VURA 2WKLA 2ZUTA 4D6FA 2EBNA 2D0FA 4W5ZA 3LPGA 5AYIA 1OCQA 2VZSA 1XH2A 3ZSTA 5C71A 1DEDA 4JIEA 2YBTA 2WMIA 4PSPA 4TVCA 4E2OA 1KWKA 1NOWA 1XC6A 2GDUA 3AYSA 1JAKA 2CERA 1XYFA 4NSBA 3T0AA 1L0PA 2C0HA 2WMHA 4XX6A 3N12A 5M03A 3WQ5A 4HOZA 4WF7A 3WFLA 3PN8A 5BXPA 1JNEA 3K8LA 3OIHA 2G3JA 3GXIA 1KBKA 1GUVA 1H09A 3F4VA 1EXPA 1K6AA 4HMEA 3CUFA 1H49A 1W9BM 3WF2A 2Z1KA 3VD4A 4OUEA 2B31A 4PSRA 4PMVA 4QLLA 1MW0A 3N9KA 3VGHA 4ATLA 2UY3A 3RPMA 4HZ7A 5HPOA 2XGBA 3RJYA 3WD1A 2XSBA 1V6VA 3QHMA 4AWEA 1PIFA 4MAZA 2VX6A 5A6AA 2YOCA 5I3DA 1HF6A 4AY1A 1WZMA 1H1NA 3POHA 4DM1A 5HXMA 1KQYA 2PWDA 4M80A 4HMCA 1E56A 1R7OA 2D3LA 2WCSA 2F61A 4W84A 1EO5A 3AS3A 4RE4A 1MYRA 3D5HA 2RGLA 4UTFA 1RP9A 3AZSA 4FLRA 4W7UA 1GOMA 1SMAA 3WD2A 3ZJ6A 1OINA 1EOKA 2W91A 3AISA 3RM4A 1O7AA 3WD3A 5CJ5A 2Q8XA 5JBEA 1DHKA 3WDJA 2FHCA 4UQCA 2W4XA 2WBKA 2DGAA 1ODUA 1V0LA 3OA5A 1UZ4A 4AXNA 1E4LA 3BGAA 1ISYA 1QI2A 2GK1B 3MV01 3AZTA 3FW6A 2X05A 1H3GA 3VPLA 1JZ7A 4M8UA 1KB3A 3MU7A 1X6NA 1QBAA 4JHOA 3BLPX 1NQ6A 4KWUA 2VRKA 3VDAA 1V3HA 1OM0A 4J3WA 1HJVA 4HOXA 4CCEA 1H41A 3CZKA 2J7BA 1US3A 1G0CA 3WD0A 3W53A 5I79A 2Z1SA 3U7VA 5DFAA 4W93A 1L8NA 4AC1X 3UESA 1C90A 4PTWA 3SURA 5A2AA 2ZXAA 5IFPA 5IDIA 2W62A 3THCA 4BQ3A 2JFEX 2VRQA 3VU2A 3AI0A 3VD7A 2YL8A 3U7BA 4QLKA 4P7OA 1HKMA 2WKGA 4F9DA 3NYDA 3PZNA 3VGEA 4ZEPA 3T09A 5ABHA 1W9VA 5BCAA 1UYQA 1QOXA 3WIJA 2X09A 3UG3A 4GO9A 3BAKA 2A3EA 4UOQA 2WVTA 1NWRA 1PX8A 2J77A 3IJ7A 4MB4A 4YN5A 2ZUMA 1E6SM 2J25A 3K8KA 1NP2A 4MNJA 3CLWA 1U33A 4CVWA 1MXGA 1TG7A 3FXYA 2VOTA 2EPOA 2ZUVA 4J3UA 1J0KA 2ZWZA 2ZOXA 4U3CA 4KGJA 3KZSA 1B31A 2D24A 4J27A 1V3JA 2Y8VA 2V5DA 4ZXOA 3SIMA 4D72A 1OD8A 2O9RA 3W4RA 3ZOAA 2G41A 3AQUA 4ACZA 4P7QA 3LPPA 3VM7A 1H4PA 2YA1A 2D3NA 2OYKA 3CHFA 1CGVA 2XSAA 2XWEA 4PCSA 5BWFA 1J12A 2DSUA 4HZ6A 1DWIM 1JZ3A 3AXXA 5A1AA 1UQZA 2J74A 1PZ3A 3AMLA 2VX5A 2OSXA 5CPQA 4B9ZA 2VTFA 2CETA 3VD9A 2WPGA 4FLQA 8A3HA 3ARYA 3VILA 4UZSA 1J0HA 4RL3A 5I78A 4TXEA 4EANA 2PF0A 2AMGA 1JFHA 2QPSA 2XFFA 4HPHA 4LPCA 3WSUA 3BC9A 5AYBA 3ZT6A 1VBUA 3EDKA 1XYZA 1W9XA 2WXDM 3L4TA 4LYQA 2VZTA 1FP8A 3W82A 2ZXBA 3CGTA 2WVUA 2O92A 1GQLA 1J18A 3ZMRA 1XSIA 1W9PA 3ARXA 1RD6A 1TMQA 1ITCA 2BHUA 3BAYA 2PWEA 3II1A 4OJYA 5A8OA 1TVPA 2CBJA 4H41A 3VDBA 1B90A 3BSGA 1NWSA 1QNOA 3QR3A 2G4FA 1CLVA 1UR9A 1W1VA 1XCWA 4BF7A 4MAVA 3M7SA 1KXQA 1GONA 1J0YA 4PMUA 4UFMA 3GNOA 1WE5A 1E15A 3CIVA 3SUUA 1KXVA 2E9LA 1VFFA 3NDYA 1EIBA 1EO7A 4P8WA 1CWYA 1UD3A 3MO4A 1OB0A 1WCGA 3AMCA 1UWQA 5FCZA 4AIEA 1W3JA 3KWXA 1UD8A 2XVPA 3AIBA 5CG0A 3ZJKA 2J7GA 3O6AA 3VD3A 2BY2A 2BY1A 3TTSA 2D23A 1MWOA 2XG9A 3GH7A 5EMYA 3EMCA 1H11A 1M03A 4CCCA 4PMOA 2WHJA 4JHZA 4EK7A 5CLTA 5A6MA 3CBWA 3I3DA 1YQ2A 2QLYA 4JFUA 3TTQA 4URIA 2WANA 1C92A 1HKIA 2BVYA 5EFDA 4HPGA 4D1IA 4GZEA 4MDOA 2E40A 1EGZA 2BV9A 2G8ZA 2WLYA 1V6WA 3B9AA 4M56A 3VIOA 2BHYA 3PZOA 1R87A 3TOPA 4D6EA 3WFZA 3FNDA 3MUIA 3N1AA 3AXIA 5FIPA 2WB5A 1VAHA 4W85A 3AHTA 5A95A 4W8AA 2J75A 1CZ1A 2E4TA 2E9MA 3FAXA 3SCSA 2DSKA 3DHUA 4LQ1A 1G9HA 1DWGM 3OLIA 1WB0A 1V02A 1HJXA 5HBFA 1CNVA 3VO0A 3PBGA 4P7NA 2GSJA 1JDAA 2QV4A 3N11A 1ZBWA 3CPUA 2DQXA 4XV0A 3WEMA 3ECQA 4Z2JA 3L4YA 3AOFA 1B9ZA 1H0GA 1PEZA 3AS0A 1C93A 2VJXA 2JIEA 3IJ8A 3MUAA 4GI9A 1V02E 3BAXA 3GM8A 2XM1A 2XGIA 2EO7A 1ISWA 1V08A 1UWUA 4W86A 3CZJA 1HJQA 1HKKA 1ZBVA 3AHXA 2QHAA 4P8XA 2O9TA 5A6JA 3VIPA 3WD4A 1DWAM 1Q6CA 4S3JA 2VI0A 4WJXA 5JUVA 3WF4A 1UR2A 2XYLA 4OBSA 5CZKA 2O9OA 1KBBA 3NIYA 5BXRA 3UG4A 3UETA 1EOMA 1WKYA 4B3LA 2WSKA 4IPLA 2J8GA 5FKYA 1UR8A 3RIKA 3O2LA 4BS0A 1JZ6A 1VEPA 4FK9A 1JI1A 1ITXA 4CD7A 1BHGA 1XV8A 3OLDA 1DTUA 4KRUA 3BLKA 1VBRA 2DT1A 1LG1A 5DT5A 1B3XA 1ISZA 2OLHA 3S6TA 2BVDA 4YHEA 5TD4A 3L4XA 3N18A 2VQUA 4J3XA 5A6SA 5BXSA 1EDGA 4MB1A 4U5IA 3CHEA 2GUYA 4C7GA 3WUBA 1BVZA 1UKTA 1KGWA 2ZX5A 3SCQA 1J9YA 2YLAA 1D3CA 1A47A 4KGLA 4R27A 1O6IA 5E70A 1CEOA 1QI5A 1DWFM 2WSPA 1SMDA 4WKAA 2IXVA 4ZXLA 2CIPA 1W32A 5JBFA 1WDRA 4M81A 1CXHA 1R7AA 3G6MA 2WMKA 1C91A 2D1ZA 4AZBA 1JI2A 1QBBA 4XZBA 4Y7EA 1UR1A 1LF1A 1G1YA 1N82A 2EJ1A 5A94A 2XVLA 4U5KA 4QAWA 1UHVA 3CZ8A 4H8UA 3TTOA 3GZAA 2J79A 4NF7A 4Z2KA 3AS2A 4Z2IA 4XUYA 5A3HA 1G94A 1UOKA 3W28A 2BXYA 1JDDA 2E8YA 2EPLX 1XD1A 3MANA 4W89A 5FL1A 1QHZA 3VX0A 1W2VA 1KCLA 2XTKA 3JUGA 4Q7NA 1CENA 5CGMA 3CUGA 4IISA 1JZ8A 1OIFA 1VJZA 3AIRA 5CLWA 1GZJA 3PZTA 1XSKA 3GTNA 1E70M 3PZGA 1M7XA 3NSNA 1VENA 2J7EA 1QHPA 2WMIB 2Y8KA 1IT0A 1H0IA 1WDSA 1QNRA 3ZIZA 3SUSA 1J01A 1UZ1A 1K9TA 1ZBCA 2VMFA 5GNYA 2VVNA 3FN9A 1E6XM 1LJYA 2EXOA 1W2PA 1XD0A 3DECA 4WSJA 3AS1A 3CHCA 1LL4A 1XHGA 3SUWA 3ARWA 3EBVA 5LA1A 4JKMA 2A3AA 2PBOA 4B16A 3AIUA 4MNLA 5D9PA 2X8RA 2F8QA 1VEMA 1NOUA 3BH4A 3WL0A 1QNSA 5GNZA 4ML4A 2WVSA 4M24A 4RE2A 1PJ9A 1B3YA 2XIBA 1CXFA 4J3VA 1C8QA 2DSVA 5HPCA 1WP6A 3IK2A 5A69A 2FGLA 3ARQA 1JFXA 1UA3A 2QMKA 1K9EA 2V3GA 3TTYA 4ZFMA 4AD3A 3L4ZA 2WHKA 3EDDA 3ARUA 3N17A 3F5KA 5A8QA 1ZJAA 4WKFA 2D0HA 3GXDA 3M6DA 1NARA 1GHSA 3W27A 5DMYA 1UKSA 5D8WA 2CCRA 2V38A 2X1IA 3WDHA 3ARRA 2GFTA 4HU0A 3VDHA 4CN4A 1JZ4A 4JAWA 2VC9A 1OT1A 1JD7A 1OWQA 8CGTA 3PZ9A 5HNNA 4NRSA 1G5AA 5AY7A 3OB8A 4MB5A 4TOQA 5E0FA 4QFUA 4UQ9A 1GVIA 3VNYA 2FGZA 4L4OA 4H8VA 2X0HA 5EB8A 1ZS2A 4CN6A 5IXEA 4JL2A 2VR5A 1CGXA 2YL5A 4CN1A 4CCDA 5DF0A 3HJEA 3WQ8A 2GK1A 1E3XA 4W88A 3WDQA 2XM2A 1JGIA 4NI3A 4CUCA 2XVKA 4MPKA 1QHOA 3WNOA 3WL1A 4TVUA 4CD5A 2CKRA 5DT7A 1V03A 1J10A 5CSYA 1TA3B 2ZUNA 1HN1A 4RE3A 1QNQA 3VIHA 5CSUA 3UCQA 1LWHA 1RPKA 4JFVA 2HISA 4AIUA 1UUQA 1BTCA 4BQ2A 3WMSA 1GPFA 3CZGA 2J8FA 2OYMA 5IHSA 4MDPA 4GKLA 4A3HA 3APGA 4LXFA 1CYGA 2GJXA 3OGSA 2YA0A 4L4PA 2OWWA 3WH9A 5A6BA 4TX8A 2W63A 3VGDA 2FH6A 3L2MA 5IHRA 6CGTA 3CUJA 3WDPP 4F79A 1UD4A 2WK2A 2XWDA 3WF1A 2W66A 1JF5A 1XRVA 1E6PA 1JNDA 3PZIA 3T0DA 2GJPA 1J0IA 3MMWA 2EPMX 1VB9A 1TZ7A 1CLXA 1VIWA 5CGTA 2VCAA 1VJSA 1WNOA 3HMCA 1AVAA 1PPIA 2VX4A 3DYOA 3WY1A 2WMJA 4GI6A 1NWTA 1ZBKA 3MKKA 4Z2HA 3AIVA 3O9NA 5I6SA 4JZ5A 1V0MA 3BCDA 1BYBA 4HZ8A 4UFKA 3TP4A 3VDCA 2C8NA 4ATWA 1LL7A 1U30A 2VVSA 3SCNA 3AJ7A 1QW8A 1W91A 5C8BB 1CBGA 4H2CA 5CPSA 1FH7A 3NUKA 3WELA 3WUEA 3GXMA 3RM9A 2WYSA 1YHTA 1XGZA 2G3IA 1F4HA 1BQCA 3A47A 3CMGA 2YDQA 5FD0A 2VCBA 6A3HA 2DDXA 2BVTA 1JIBA 5C70A 2WC3A 1PX4A 3KL5A 4YHGA 4BA0A 2WWDA 2WW5A 3CUIA 4UNIA 2JF6A 3U5YA 1QNPA 1AQMA
chains in the Genus database with same CATH superfamily
4XTDA 2BHZA 4GZIA 2V30A 2R8WA 4H00A 1GGOA 4O4VA 4FLOA 4ZO8A 4UR9A 2OZTA 1FCBA 2XN2A 3ISIX 2G3MA 4W5UA 2YDAA 4Z08A 2DZPA 4S3EA 4KWOA 2H90A 5EMUA 1WPCA 4P8UA 5C9XA 3W7RA 3GDKA 2V5JA 4EXAA 3R0UA 3C8FA 1L8PA 2VNCA 3KZPA 5A8NA 2I9EA 3EKLA 3F2BA 4ZZ9A 1BAGA 3LRLA 2WMFA 4JN7A 1M7PA 5D8ZA 3BSMA 2OLSA 1NM9A 2G97A 4UFHA 3DFSA 3WH8A 4I90A 1IEIA 4CQCA 3E3HA 3R8RA 3SUTA 2D20A 1YYAA 2BNJA 3VAVA 1ZL1A 4KKXA 1S46A 1LQAA 3M46A 3WENA 2P3ZA 2WVVA 5I00A 3WH7A 3R13A 4F4RA 3GXTA 1XDJA 3M07A 4QGCA 1K9FA 4OGZA 2D69A 2WJDA 1VEOA 1DBTA 4PL1A 4IJCA 5GJMA 1K4GA 1HGWA 3S0CA 1PYMA 4GX8A 2VT0A 5DMMA 3M0JA 3H70A 3QOKA 4XKYB 5BXTA 3URNA 2CLKA 2NWSA 3GY1A 3CO4A 1YBQB 5DO8A 1JDFA 5LHFA 3M64A 2HCVA 1EA0A 1ONWA 1YPFA 4LSBA 5XIMA 1JXJA 4M1BA 4QBXA 3MHGA 2REQB 4QAIA 3VOCA 5KZDA 1TR1A 2C16A 2XZ7A 3B9NA 1NDWA 4LRTA 2Z29A 3NXLA 2F84A 3R79A 1DXFA 1FX6A 1UA7A 4HD5A 2QF7A 2PTWA 3AJXA 1TVNA 2H8XA 4QITA 4S1FA 4E4FA 3VFLA 3B0UX 4LV9A 4YTTA 1UKOA 2UBPC 1US2A 1R3TA 2PB1A 1V6TA 1FP9A 1X96A 2J66A 4EE9A 1V6XA 2C15A 1KXTA 3HO8A 3OLGA 1OT2A 1KR1A 1M9HA 3NPWA 3UG8A 4M0XA 1W17A 3PFRA 3ZR5A 5DEZA 4C6KA 3PWGA 1KW1A 2AKMA 2WNWA 1JR1A 3QY8A 3CNYA 1WKFA 1ZSXA 1W6TA 4HU8A 3ABQA 3E2SA 4ILSA 2DV0A 1BYAA 4V1YA 2NSOA 2R1NA 3FEQA 1HUVA 2PCQA 4MM1A 1TZ9A 2RUSA 1PB0A 2D2OA 3EWXA 4QEEA 1MQPA 4XAYA 4AD0A 3UPWA 4RPQA 4M82A 4O28A 1J0JA 3FGCA 4A21A 2HEJA 5LA2A 4I5RA 3USBA 2P0OA 4O54A 3W1QA 4C1NA 5CEWA 3R12A 1NFBA 3KAOA 2FYMA 1W5OA 3BSHA 3MI6A 3TMLA 1Y7VA 5GPRA 3AU6A 2OX1A 3W6LA 3MCNA 2FFCA 2A3CA 2DZBA 2JF7A 3VMOA 4JFTA 4YXGA 2BWGA 1WZAA 4ICCX 4AZGA 4C6CA 4XZ9A 1MFUA 1H2JA 1JQVA 3KCLA 3TA6A 3WLIA 3CIWA 4ZL1A 2RGMA 2J78A 3PPCA 3GC4A 1H7RA 3PSVA 1ALDA 3MSGA 3MP4A 4XKYA 3UJEA 8TIMA 2ZZ6A 4NAEA 1E73M 4GJJA 1RLCL 1MQQA 1KFEA 5IDZA 2EG8A 1HO4A 4FOKA 5M17A 3WQVA 4B90A 2A6NA 2BOGX 4I7WA 3CMJA 4AF0A 1QVBA 3IANA 1L6SA 3WG6A 3EA1A 3VE9A 1XKYA 2V0TA 4D71A 1SJCA 3VUPA 3L4VA 1E55A 4W8LA 1EHAA 1G7VA 4PEEA 3SW6A 1JF6A 4Y8FA 4YTSA 1B3VA 2FDMA 4NT0A 4KMQA 2VELA 4AUBA 1FHLA 2WBGA 3S6DA 2NSXA 2A4AA 1W5QA 3ARPA 1AG1O 4W7VA 3WMCA 3Q94A 1Q6GA 3LYEA 3E0IA 1TV5A 2E1DA 3V75A 4LU0A 2POZA 1EP1A 3KDNA 3PULA 1BF6A 3DFQA 1RD5A 4IIFA 4UCGA 4V28A 1E1CA 2QIWA 3KEHA 2X0YA 2VX7A 1NOFA 5HAOA 4O0KA 1VYPX 1B3OA 1EL3A 3MDWA 4MKVA 1FWAC 2WJEA 1LBMA 1TV4A 1T7LA 3WDRA 1EDTA 3I3BA 2PDLA 3A4AA 1QOQA 2Y5SA 4U33A 1QI3A 5ABGA 1JD9A 1FHDA 1K02A 2P3EA 4FXRA 2PE4A 1PBGA 3C2RA 1V7AA 3RN6A 1MI3A 3DOPA 5E1QA 3DFNA 5ENLA 4G56A 4GZJA 5C6MA 2HSAA 3UQNA 1V4YA 3L2LA 4BEUA 3DFTA 4N0RA 4PTDA 2I17A 3VKBA 3KL0A 1B30A 1GOIA 3GSMA 4B2DA 3SCRA 3UEQA 3VK5A 4UFLA 3SRDA 3O1NA 2WWCA 4XVDA 4PTXA 2QUMA 3BDKA 1JYXA 3W1TA 3MUY1 3CL6A 4BHYA 1ONXA 3SJNA 1JL8A 1NFGA 2QUVA 3LTYA 4RNFA 4UIOA 4NZCA 1WDPA 1UP3A 2QPUA 5HNTA 4DXVA 1VFHA 4AZIA 1RA5A 3LN3A 2E5BA 2WM0A 3TW9A 4G7EA 4TTGA 2QS8A 5I24A 1UH4A 7XIMA 3A23A 3MI2A 3MJYA 1LYXA 3T08A 3CQIA 2EGZA 2OO0A 5A8PA 1Q6DA 3NL5A 3N6HA 1B0IA 1TQJA 3FVMA 3LEPA 2QKFA 4KWWA 3ZLFA 3BGGA 1TELA 2CXEA 4LUJA 3LENA 4CQ9A 2V2DA 1A53A 1KM2A 1ZRQA 4HNNA 4CVUA 1J11A 2Z00A 4HJWA 3TSDA 1H51A 2IPJA 2Z2AA 4JFWA 4NJJA 3KVLA 1SZNA 3I10A 2XN0A 3HQOA 2XPKA 4EACA 1LQ2A 5D9OA 3NL3A 1WDWA 3WLLA 7TAAA 5I09A 2Z7KA 4XSLA 3PBMA 4WDUA 3DH7A 3G18A 2VCCA 2HK0A 3TAOA 3PZMA 4RXFA 4UTTC 3K4WA 4DNMA 2CLPA 4HJFA 1EDQA 2FKPA 1M1BA 1ZPTA 1L2QA 1O68A 1A3HA 4GINA 1NWUA 5B7YA 3AMDA 3I65A 4PGLA 3J7HA 5BU6A 3UZYA 2VWSA 3QBUA 1F73A 4DJEA 3ICJA 1OG6A 4XQ6A 1W56A 5D2VA 4IG2B 2XINA 4Q32A 4PFMA 3W2KA 3AFBA 4XAZA 3SBFA 2WSRA 2JALA 1LRNA 1UWSA 4NXSA 2WKJA 4QCEA 5I3JA 2G3NA 1IZKA 1B3ZA 1H7PA 2WM1A 4V27A 4GJIA 3IAQA 4LJ3A 3L9CA 5H91A 1XUZA 4Z2LA 1IWPA 1OF8A 3KL3A 1FUYA 1JXKA 1TB3A 3VGFA 4PMXA 3EX4A 1FY6A 5EBAA 1X1ZA 3FDKA 4ZO6A 1SZRA 4P7RA 3VE7A 1CGTA 4Q22A 3WNNA 5D05A 5JIWA 4FX6M 3PANA 3NQDA 1D2KA 1RY0A 1BKSA 1VHNA 1LBFA 1GKQA 3N6QA 4EF9A 3M0HA 4S3KA 3KOYA 2O9PA 4CNPA 2FHFA 1S5TA 1Z7AA 3S2JA 1MW3A 4QRNA 2X1RA 3VOJA 5L9FA 4O0ZA 5IOBA 4FEZA 5IFTA 3UR8A 3W26A 5D30A 4H9YA 2NW0A 4JY9A 2W5FA 3GO2A 3GS6A 5E93A 5HJLA 3DC0A 1Z6KA 4AY7A 1P43A 1V5XA 4ZOBA 3NM3A 3UW6A 5C7VA 1Z3NA 1VRXA 4TIMA 2OT1A 5CC3A 1D7FA 2VFEA 3SY1A 4US5D 1UH2A 2XJ7A 3H2FA 3MO7A 1KD0A 1XIMA 1TTIA 1IQ8A 5G4HC 3USZA 1YMYA 3RG6A 3CUZA 2Z27A 2PURA 3ZJ8A 3P93A 1V0KA 4PA8A 5MKGB 3GYCA 4XBSA 3C61A 2Z0IA 1XIIA 4W87A 3ARTA 4PRWA 4WR3A 2YIHA 2H3BA 1I6NA 4DWSD 1NQKA 5EMJA 2C71A 2Y7DA 4GPNA 1XBVA 1MDLA 3OGRA 1OIMA 3IJ9A 2GJRA 4HMDA 7ODCA 2WC4A 4UFJA 5AYYA 2VEFA 2VHLA 4MFEA 4LC8A 3UERA 3WNKA 4NG3A 4HCLA 5E09A 1UASA 3E0WA 3U0HA 1UR0A 5HJYA 3DG6A 1R47A 3C3NA 1E5NA 5DY2A 1TMHA 5H8UA 2X2YA 2HS6A 2VEGA 3QSTA 4ZENA 3NOYA 4IMEA 3EB3A 1CI1A 1O95A 3HG4A 1K8ZA 3RPDA 4MMWA 3NNTA 4S3DA 3ZSSA 1AMYA 4C6JA 3PPFA 1EHNA 1RAKA 3MCOA 4D9PA 1GVRA 3I4KA 4JL1A 4LYPA 4AZCB 3L4WA 3UWZA 1CX9A 3MPGA 2KX9A 1UKPA 4AZ7A 3K46A 4AEEA 5JH2A 1M04A 1XKJA 1P7TB 4YTQA 3M41A 2GOKA 1N8FA 3REQA 2XVNA 2GWGA 3DERA 1FH8A 3SADA 2CBUA 5BRPA 2GYIA 2J4GA 3WNLA 2VR4A 1E43A 2YL9A 3H54A 4UTIA 1NP0A 3WDIA 1ZU8A 3W7GA 3M44A 4NJIA 3CWHA 3LBMA 1XLGA 1W31A 3UVIA 2W6RA 1DTNA 4HSOA 2I56A 4RW5A 4DIAA 2J7DA 4AWUA 1LT7A 5FOOA 3UD6A 3CV1A 1DVJA 1FCVA 2PDCA 3LLFA 1GQJA 1QW7A 1MEWA 3SM0A 3NDOA 3WBXA 4CNOA 4CNTA 2INFA 3GH4A 3CS2A 4O17A 9XIAA 1EA9C 3G1VA 1XRTA 4ZA0A 3G1AA 4A8RA 3VNKA 4JTSA 4HA0A 3THAA 3IWPA 4H04A 3PWAA 3UGVA 1XYAA 3F7JA 5PTDA 5HATA 1EBGA 3RM8A 3HFTA 2CLOA 4LGXA 4QE1A 4LEFA 2D22A 5MKGA 4XD5A 3UG5A 3RU8X 3CZLA 4GY7A 2E6YA 4CKQA 3NO5A 3V0TA 1KBIA 3BXWA 3LX9A 3EWZA 3LGEA 2FZNA 4X2PA 1U1HA 2AAMA 1YLVA 3BW2A 2DVTA 1F61A 2EBNA 3LPGA 4N9DA 3RYSA 1OCQA 1UROA 1TJRA 3VCNA 2QV5A 5C71A 1TV2A 1DEDA 2ZVIA 4JIEA 3OIXA 2V2CA 1G4TA 4PSPA 1A0EA 1KFBA 1JAKA 3T0AA 3W1UA 2HPIA 5REQB 5C55A 3B8DA 5M03A 3WQ5A 1EJXC 4HOZA 5CPMA 2G3JA 3GXIA 4INFA 2QULA 1Q2RA 1ZALA 1EXPA 4KFPA 1K6AA 3ES7A 3F4VA 3TAKA 3FK4A 4AF0B 1H49A 3EX2A 4ZO7A 2Z1KA 2IS7A 4OUEA 2B31A 4OV4A 4LBSA 3W2NA 4ROPA 1MW0A 3N9KA 3W73A 2UY3A 3YPIA 4GCAA 2HXTA 3WD1A 4H6RA 1PIFA 2VX6A 2YOCA 5I3DA 1WZMA 4PCFA 5HXMA 3W1NA 2PWDA 4HMCA 4M80A 5CCZA 4LCQA 4JTLA 4W9TA 2WCSA 2D3LA 1E9IA 1G6CA 4W84A 2NZLA 4I6VA 3GTHA 4RZ5A 3AS3A 3MZ2A 1PDZA 1PZ0A 3L0NA 2OEJA 3EA3A 4XK2A 1RP9A 1Z89A 3BARA 3ZJ6A 2EKGA 4JHMA 4XIMA 3AISA 2TRSA 1O7AA 5ABTA 3IV3A 4PZVA 4Z1DA 4LY4A 3CQKA 1MMFA 2FHCA 1JPKA 1WA3A 3E12A 2W4XA 4DRSA 3S2NA 1PE1A 3OODA 3BVJA 1SJAA 1TUFA 3L68A 1VLWA 3KVKA 4HNCA 1H3GA 1X6UA 1XCFA 4X9SA 5FF0A 3QSRA 1NDYA 3EB2A 4OV9A 1K8XA 3VDAA 4AWTA 3LNPA 1OM0A 1HJVA 1LROA 5F4SA 1US3A 5LHEA 2RDWA 3IGUA 4ENLA 1Q5MA 3U7VA 1L8NA 1AW2A 4AC1X 1C90A 5FJTA 3BLIA 4YU1A 2ZXAA 1GG0A 2OXNA 3KXQA 1MSSA 2JFEX 3VU2A 2QJHA 1CCWB 4QLKA 4P7OA 5EMKA 3NYDA 3VGEA 3T09A 1QOXA 3QGAC 2QJMA 2I5GA 4GO9A 4UOQA 1NWRA 1PX8A 2J77A 4YN5A 2PLCA 1XISA 3THQA 4MNJA 4O1FA 3UU0A 1TG7A 3FXYA 2ZUVA 1J0KA 3QR1A 2ZOXA 3QZEA 1B31A 1TWWA 1MDRA 8XIMA 1V3JA 2A1YA 2Y8VA 4ZXOA 3MC5A 1OD8A 1J6PA 4R7JA 1DQXA 3ZOAA 1BVWA 2CZ5A 2EAWA 4HN8A 4HHMA 3TYBA 1A5KC 1NF7A 1YEYA 2OYKA 4OT7A 3CHFA 1CGVA 1Z41A 2XSAA 4PCSA 1ZGDA 3VC6A 5BWFA 4XZMX 4HZ6A 1DWIM 3SZ8A 2OMAA 3W87A 2J74A 1ECQA 4H7CA 2ONEA 2F2KA 1QPQA 4B9ZA 3VD9A 1PSCA 4O0QA 3I7SA 2Z1WA 3QW3A 1S2UA 4UZSA 1J0HA 4RL3A 3ID7A 4TXEA 3TZNA 3TROA 2I5QA 2PF0A 2QPSA 2XFFA 3BOLA 3BC9A 1UPMB 3PB2A 3EDKA 2AL2A 3L4TA 4LYQA 4AQLA 1FP8A 5C9RA 3W82A 4H6KA 1MXSA 3TWAA 1XSIA 3IUIA 4KF1A 1TMQA 1SJBA 3BAYA 2PWEA 4HHPA 2O0TA 2HXUA 4M5PA 3CASA 1KTBA 3TOYA 3MY9A 2EPHA 2NLYA 4H41A 1NWSA 3QR3A 2G4FA 1CLVA 5SWUA 2Y63A 2PGWA 5KITA 4IMGA 4UFMA 1IT7A 4YTUA 2WQPA 1BTMA 3CIVA 1KXVA 3LLXA 3TCEA 4DF1A 4PODA 1CWYA 1KNWA 3GU9A 4X3ZA 3MO4A 1XR2A 4KIRA 2CWNA 5FCZA 1FWCC 1EFZA 4GE8A 2XVPA 3AIBA 5CG0A 1WOBA 2PAJA 4QQUA 4A35A 2BY1A 1FWRA 5AYZA 3P60A 5HJXA 3GH7A 3EMCA 1PZ1A 1H11A 1M03A 1XIHA 3W2UA 3GVGA 4IL0A 4RW3A 2DW7A 3CBWA 1JPIA 3EWBX 3MYPA 4JFUA 3TTQA 1C92A 2BVYA 1XIJA 4F2BA 5K7JA 3EWYA 1CW2A 2WLYA 1L6WA 3PZOA 3E49A 4QJ1A 2XSXA 3MUIA 2WB5A 3C2FA 4JX6A 5A95A 4Y96A 1U1JA 3VXGA 5TF0A 5DANA 2IKHA 4R9XA 5EPDA 4KEUA 1G9HA 1GYMA 4F0KA 1A5SA 4HPNA 5HBFA 4MIMA 1TWSA 4HPJA 1UP2A 1SFLA 3TC7A 3CPUA 5HQMA 3S2LA 1GW9A 3ECQA 1UJPA 1ZJIA 1B9ZA 1RLDA 3BG5A 1F8IA 3IJ8A 3MUAA 4GI9A 4IJBA 1V02E 4KERA 3GM8A 2IPFA 2EO7A 3GX9A 1V08A 3CZJA 2ZADA 3MVTA 2QHAA 1S2WA 2O9TA 2CHRA 3WD4A 1KFCA 4L80A 4WY0F 2VI0A 3OZMA 1KKOA 3WF4A 2XYLA 3S2MA 2O9OA 4GACA 1KLZA 3UG4A 4LBUA 4NNCA 2F7FA 3IJQA 1C9DA 2C1HA 4GI4A 4FK9A 4CEXC 2F6UA 4JTUA 2H3DA 3IVSA 1K03A 2F9RA 2GGJA 2BMBA 3BCJA 4KRUA 2OQLA 1R5YA 2PC4A 1B3XA 5CC6A 2VWTA 2R82A 3WCZA 3HM7A 2B7PA 2QVHA 1N55A 3QJAA 4KCTA 4RXGA 2PDGA 4J3XA 1E0TA 1IWBA 1UOZA 2VFFA 1EWEA 3S9YA 2GUYA 4L4LA 1NEYA 4JYEA 2UV8G 3FCPA 1IWAA 1H63A 2YLAA 1A47A 4NZ4A 3AC0A 3KRZA 5BU9A 1CEOA 1QI5A 3REQB 5G2IA 3WLMA 4TMCA 3BJTA 4O12A 4ZXLA 4ZMGA 5CBBA 4KEMA 1W32A 5JBFA 3T55A 4PB4A 1R7AA 3M16A 1X7FA 3M0LA 1VR6A 2WMKA 3ABXA 4AZBA 4XZBA 4Y7EA 1UR1A 1LF1A 3UZXA 3MT1A 1RCQA 1K7XA 3C5QA 3CEPA 3TN6A 5F2MA 4ML9A 1Y8BA 4M3PA 4NF7A 4Z2KA 4Z2IA 1WUFA 5A3HA 1G94A 3W7EA 1OFQA 3N2BA 1J2BA 3O07A 2BXYA 2OOGA 3AYTA 2EPLX 2A7PA 4CCZA 3MANA 3U8GA 3V0SA 1TPB1 2Q6ZA 3KX6A 1OFDA 2IKIA 3U2CA 3VX0A 1W2VA 4EXBA 1NAL1 2XTKA 1NELA 3JUGA 3SECA 1T8XA 3QF0A 3W7HA 3CUGA 3S9ZA 3HPFA 3UJFA 2J13A 5J8LA 1OIFA 2G50A 1SVDA 3F4NA 1E1CB 3PZGA 2YYTA 3BZGA 4HGXA 4N9BA 4N2YA 2QCNA 3T8LA 4YCPA 1UZ1A 5GNYA 4BWLA 4RV8A 4AEOA 1TV8A 1LJYA 1XLJA 4N02A 4EPDC 4L5ZA 1GOXA 3DECA 4MZYA 3AS1A 4Q7BA 1VPYA 2ICSA 1SSDA 3SUWA 3EBVA 4ZO9A 5JXQA 3AALA 2YZ5A 1VGAA 5D9PA 3HIJA 4DO7A 4ML4A 2WVSA 4M24A 4MY9A 3W75A 4RUBA 5KMYA 4LAOA 2J27A 2H9AB 2YFNA 1SO6A 3PJTA 5IRPA 1I4NA 1K9EA 4GQBA 3TTYA 4F0HA 2NV1A 2WHKA 4NVTA 5FESA 3EDDA 1XYCA 5I03A 4UTHA 3NPVA 1AL7A 3SJ3A 2TODA 4BFAA 5A8QA 2D0HA 1VBJA 5D8WA 2CCRA 3WDHA 2PUZA 5AYXA 3WLPA 1M3UA 2VC9A 1OWQA 4NZFA 3PZ9A 4C6QA 1EJTC 4DQWA 5HNNA 4NRSA 4NX5A 1W1B1 2Y88A 1XPGA 4HMNA 4HB7A 1U1UA 1KM4A 3UYIA 4H2HA 1N2VA 2ATSA 1GVIA 2GPTA 3NQ2A 1Z69A 1N7KA 1AZ1A 1BQGA 1ZS2A 4JL2A 4IIHA 4R3UA 3OVRA 4CCDA 5DF0A 1QMLA 4AHQA 3WQ8A 2PODA 1M6JA 4ZOAA 1NIUA 5C2GA 3VNJA 4JEJA 2ASHA 1JGIA 4NI3A 2YW4A 3GNXA 6ALDA 1DJNA 4QE5A 3UR2A 3M0XA 5AHNA 1QHOA 3WNOA 1C8VA 4YMZA 2I57A 4TVUA 1FDYA 5DT7A 1J10A 4E38A 5K3VA 3CTLA 1T96A 1TA3B 1XX1A 5EYWA 2DUZA 1HN1A 5FA5A 4RE3A 1XGDA 2ZZ3A 3GTXA 5CSUA 3KRSA 1R0MA 2PP1A 3WK1A 4JFVA 2QXWA 5AN7A 1YRRA 4I3GA 4M51A 4MDPA 4GKLA 3MHUA 4A3HA 1AD4A 3N9SA 2O7SA 4LXFA 3IIVA 3CL8A 3GYEA 4K3ZA 2OWWA 1PTAA 2FH6A 3L2MA 7REQB 4GH1A 6CGTA 4JQAA 4AVOA 2ISWA 3KCJA 3R11A 1UD4A 3WF1A 1D9EA 1XRVA 2XIMA 3CXOA 3KBSA 3RX4A 4UTUA 2NWRA 3RR4A 5K2ZA 2PDIA 2VCAA 1OFBA 1WNOA 4NIRA 3S3GA 4YS1A 3E38A 2VX4A 2HE5A 3EA2A 3NQFA 3HOJA 5CAKA 5I6SA 1V0MA 4GOAA 4US5A 1HO1A 4ZQOA 3TP4A 3MQTA 2C8NA 4OECA 4XBJA 3ATZA 1U30A 1EJSC 1SZFA 3UXKA 4DI8A 4H2CA 5CPSA 5EKYA 3WELA 3WUEA 3GXMA 1K70A 1VLIA 4RDWA 2WYSA 5RUBA 2TYSA 1FDZA 3HPSA 2WJFA 5D2XA 3A47A 3GFYA 3PUOA 4QR6A 2WNNA 1NF0A 2BVTA 3KVJA 3KL5A 2ZRUA 4YHGA 2WWDA 3IUHA 4PMJA 1P0KA 1LL6A 3EYPA 4NZJA 3O7UA 4Q8VA 1XI3A 2QAFA 1S2VA 2I14A 2ABAA 3WN6A 5M5DA 3SCVA 4KIEA 3W6MA 2CXGA 1WKEA 3RJXA 1TPDA 1ZCCA 4DWSA 3LCHA 2UWFA 3THDA 3AXMA 4HOWA 2NQ9A 2YPIA 2AL2B 3ZT5A 1E5JA 1YXYA 2WCAA 1KQZA 2DT0A 2PP3A 2JEQA 2Q09A 1XF0A 4CNSA 3LCIA 1ME9A 4FX7A 1EKOA 4AZCA 1XW8A 3T2QA 5I23A 2VR2A 1AL8A 3IVUA 2QCHA 2PDJA 1VFSA 5KTLA 3UPBA 3RCMA 4PRTA 4UXDA 2CHNA 3H4XA 1XICA 4ONVA 4ZE5A 9XIMA 4JTDA 4IQEA 3WUGA 1U2YA 4HNTA 3LI1A 3L7RA 1B54A 3DI0A 1C7TA 5A6TC 3JZEA 4H4IA 4UBPC 1QCWA 1XXXA 4DUXA 3URBA 1JAEA 1XH0A 4UB9A 1R2RA 2BODX 4HTYA 4OZOA 3CAQA 1OFRA 2DZWA 1C7SA 3PZVA 1BG4A 3BMVA 2X42A 3I7RA 1NY1A 5BRQA 4EWND 3H55A 1OK4A 3L67A 3T81A 2ZA3A 3T2PA 3V0UA 4PMNA 1E4NA 1WZKA 4A05A 1T6MA 5ABEA 3WJWA 2DPEA 4IIBA 3AICA 2E8ZA 3GQYA 1OC7A 3B8TA 3RU6A 4CQAA 3DUGA 4V2XA 4XBKA 4PYSA 1A49A 4H9VA 1BWKA 3IGSA 1KBLA 3RF9A 5E6ZA 5LKYA 2OEMA 4S3FA 3WH6A 4JICA 4JOMA 3B3DA 2UZ9A 2V6AA 3S4TA 7PTDA 2WOQA 2BY3A 3S9IA 3L5AA 3PFMA 3IAPA 3SSJA 4Q8QA 1QI4A 4DXXA 1TUXA 2AAAA 5GQBA 3FX4A 5K4ZA 1O5QA 2JKEA 2ZX9A 3GIPA 1X6LA 4WDWA 1IXQA 1DWHM 2GVEA 2X41A 2NV2A 2WMGA 4EX4A 1Z32X 5HUPA 2ZXQA 2CZEA 3G8RA 5CSSA 3G2GA 1BF2A 1RHCA 3OZYA 3MP5A 4Q4OA 3W7DA 5H1WA 5D4YA 1MZHA 3UWQA 4WK9A 3W1MA 3TXZA 4GQRA 4XUGA 1YPXA 5D9MA 2HVNA 3AAMA 4PH6A 1E4IA 3BAIA 1P0DA 2R1PA 1UQYA 5KZ6A 3GC2A 1ZP4A 1WOAA 2VZUA 3DEQA 3BOXA 2WZIA 4KS0A 5FL0A 1GTEA 3D0CA 3DI1A 3HQPA 3V1PA 2NLIA 5AHMA 1P48A 4L9XA 4MYAA 1RCXB 2YX0A 4FMVA 4KRTA 2OQYA 5C0QA 2ZRWA 3O06A 3NQAA 3TE9A 3ITGA 5LIXX 4DAFA 4OOZA 1SQ7A 1GHRA 1B1YA 1WAWA 3N15A 3N3TA 1O4UA 4FI4A 1WO2A 3KTXA 3QN3A 4UCFA 1EP2A 3MBFA 4DUVA 2ZIDA 1PX3A 2Y5JA 5F4WA 2ZZ5A 4RKAA 3ATYA 3SCUA 3TA9A 3MB9A 4AD4A 1MVYA 1R3QA 9CGTA 3N2TA 2FB3A 1JPHA 5LA0A 1C9WA 1XCXA 3H4GA 3GBEA 5HMSA 3HGOA 2H6RA 5REQA 3TIMA 1E1EA 1SFSA 4MJZA 4CGTA 1M65A 1VD6A 1P1MA 3GUWA 1Q6EA 3UY8A 3FHQA 5FEPA 4U2YA 3CEUA 3AIEA 4IWWA 5I07A 4JQ2A 3MYOA 3NURA 3CTTA 4C1KA 4M7SA 2VO5A 1EP3A 3PG8A 4Q8NA 3N13A 4L7ZA 4O18A 3S1GA 2WCGA 3CAWA 4HVXA 3SCPA 1FWTA 4LUYA 1XLEA 1I9CB 2TSYA 3G6LA 1W3NA 1OYBA 4MTVA 4B5VA 1R3YA 3M9YA 4BWLC 3T8QA 4EAMA 5I2UA 2ISDA 1QNVA 1AQ0A 3MMUA 1JYWA 3TZFA 3LQGA 5AZ0A 4JX5A 1XFCA 1TTJA 2I7GA 3W25A 2HK1A 2VGIA 2VZOA 5CGQA 3OG3A 4LW7A 4MNMA 2J88A 3STEA 1IHIA 1RVGA 2YCEA 1JYVA 2FFIA 3OVPA 2Y0FA 5BMXA 2AMXA 2JIWA 1W0MA 2PD5A 4JTTA 1UR4A 4ROQA 3LU2A 3VKKA 2HZGA 1W5NA 1HJWA 4IOTA 3GR8A 2IPGA 1W3TA 2QJGA 4XO7A 2YJQA 2GLKA 4XG1A 3WJXA 2DZUA 2BGNE 4XTIA 2V81A 2X40A 3EOLA 2BXZA 3CHVA 4ACYA 4TU1A 3APYA 1G4EA 3TH6A 4KWSA 2IMRA 4FXSA 5C9WA 3W1PA 1PCWA 4N4QA 1DIOA 1Q4WA 3A64A 4DY1A 4QG9A 3LV5A 1BWLA 4PUKA 3EAUA 4Y2WA 3TMQA 1CGWA 3FJNA 4CLMA 1R38A 1LBLA 4UZUA 4B5UA 1XLFA 4KETA 4NX0A 4HU4A 3W7NA 2EHHA 3MDUA 1VIZA 3MSDA 1V6YA 3IV8A 3QPYA 3D3AA 4UQDA 3UNDA 2XIIA 1JJKA 1QPKA 1QO2A 2ZUUA 3IIZA 1PIGA 3TYZA 4B15A 3LTPA 5C2XA 1UIPA 3ZO9A 1MEIA 4L6DA 1HNYA 2WC7A 4GBUA 2F38A 2WLZA 3OLEA 3LHUA 4IMAA 1BXBA 1I75A 2NXHA 3PWIA 3GZ3A 3INPA 4LB4A 4Q6JA 3QGKC 1B4EA 1C3FA 1HKWA 1QWGA 3W81A 2A85A 5EMMA 1RALA 1LCOA 3BAJA 4D6GA 4C7DA 2FPTA 4MHBA 4XZIA 2FTWA 2PC8A 3KRUA 2DUXA 2X1TA 1NTHA 4ZGYA 4AFYA 2O55A 2PMQA 3PNUA 3O05A 1NVMA 3GFZA 5HMDA 1XJBA 2PLKA 3AIQA 5J5DA 4PBFA 4BF9A 4GVFA 1AH3A 3OHMB 4JTGA 1P0NA 2HVMA 5FACA 5G5IA 1R3SA 2QCEA 2DY3A 1DE5A 1GOWA 3L23A 3U4AA 4GI8A 1KFJA 1JG9A 4JNZA 5LNWA 4HA4A 1A80A 5U7SA 2Q8LA 3ITCA 3CIXA 4B4HA 3VKDA 4BR1A 4JCMA 5AC6A 4WGXA 1E40A 1M01A 1YXDA 1R2SA 2YXXA 3I68A 2Y4SA 4FZIA 3VMPA 3Q37A 4JCLA 3W29A 2TPSA 2QGHA 1OGBA 2VL4A 4MB3A 5CPNA 4S38A 3Q58A 2X7WA 2OSYA 4FALA 4GQQA 4FNUA 4YVPA 3CC1A 8XIAA 1YTEA 1YXCA 3TYUA 2CBVA 1BYCA 2PTDA 3G1RA 1UKQA 3NSXA 3WLKX 1OX5A 2Q01A 2PDHA 3GXFA 1FFQA 1DPMA 4LX4A 4E2VA 3PP7A 1DJGA 3W01A 4PUEA 3VOFA 2VQTA 5BRBA 2XIOA 3RCNA 4R53A 4OIFA 4LAZA 2Z2UA 3FAWA 2EJAA 1A5CA 1U22A 1HW6A 2WNQA 5M2FX 3MW7A 4OKDA 3UJ2A 1BSIA 4IIGA 3KTSA 1BPLB 1ZFJA 2Z24A 3TX9A 4JIIX 3LS9A 3A3HA 2FMNA 3ZLGA 4A2RA 2FZBA 3NDZA 4J3ZA 7CGTA 3P2VA 4LANA 1XP3A 2CEQA 4QNEA 5AC5A 1GOOA 2C14A 4P61A 2ZUSA 4W8BA 4NRRA 4CD8A 3AMKA 5JIPA 1CB7B 4FF7A 3GH5A 3EOOA 3RLVA 3SY5A 2XH7A 4QLJA 2HBXA 4RPPA 2R1MA 3VIKA 4TR9A 3VD5A 3WQ4A 2EG6A 4ORIA 1W9DM 1BGGA 6PTDA 3UWEA 2G3FA 3ZQ9A 2ZA1A 3HU7A 4B2DD 3W2JA 3M0KA 4ZB0A 5BOEA 2V3EA 2W92A 3WEOA 1RSCA 3KS6A 3TTEA 2E0PA 1TPC1 4AWSA 1UD6A 1DJIA 4PRRA 1OD0A 3LPFA 4TUFA 4RLIA 4LB3A 4ZB2A 3W02A 3GVQA 4M1RA 4D8LA 3LHWA 3UWVA 3H12A 3RO8A 4JQ4A 3K1DA 5DX7A 4S3AA 1FA2A 2DSZA 3DENA 4LAMA 4LAUA 3WLRA 4Z2GA 1W1TA 3SRHA 3OGVA 3N4AA 2VM8A 5T9CE 2CPUA 2F2HA 4DJFA 1V3KA 4X0VA 5K9CA 1RBLA 1M53A 4CQ8A 2X0SA 3HN3A 1SW3A 1LRTA 2E6FA 4E0CA 4UTLA 2JKPA 4IPNB 2PF8A 2OO6A 1SR9A 2PS2A 2X1UA 2VFGA 2ZZ1A 3VZYA 1J0ZA 4I8YA 2P76A 1R6WA 3SCTA 4A3QA 4AD1A 1GQNA 2A79A 4IIDA 3RLUA 4YNGA 5FEXA 1YDOA 2JK2A 3M4HA 4K38A 1KGXA 4TX9A 1ADSA 1YKWA 1YDYA 2X1SA 1GORA 2E25A 4RZBA 4DELA 5E6YA 4FNPA 5FI8A 2W61A 3KLKA 4MWAE 4N6FA 4DVOA 4O1EA 2DZAA 1CB2A 4BCEA 2EKCA 3LZ5A 4FF5A 2VGGA 3M5YA 1MFVA 1DWJM 2GGIA 3SFWA 3V5FA 1ZB5A 1MUCA 2WQDA 2XZ9A 1CECA 1EJVC 3VKJA 4DF0A 4H7VA 4WRHA 2BY0A 2PDKA 3LLDA 5KZMA 2XFRA 4PTVA 1HVXA 3HMJG 4GUFA 4QHRA 1LWJA 4NUWA 1XLMA 2ALRA 4B3KA 4C5ZA 2FJUB 4F0LA 3V4BA 5HMEA 4UWMA 1WDDA 3LZ3A 2GVYA 4J7RA 3AXHA 1JCLA 1TE1A 3GNPA 3Q4DA 2GGGA 4M19A 4ZB5A 2DEPA 1AQHA 2V3FA 2BDQA 3AXKA 4NAEB 4O8RA 5EL1A 1Q6FA 1OF6A 1Q7QA 4NNBA 5D04C 1FWEC 2ZUTA 4YCOA 5T91A 3M6YA 4W5ZA 3QZAA 3GVRA 3FJLA 3C0JA 1T40A 3VYLA 1XH2A 4FPSA 3ZSTA 2CZDA 2WMIA 2P88A 1Q6QA 4E2OA 4HNVA 1DXEA 2H9AA 2GDUA 3AYSA 1SW7A 3KUMA 1PTDA 1LRQA 3NGJA 3L21A 1QK2A 2Q3RA 3HGSA 3OVQA 3UJRA 4MKNA 3S1VA 3LG3A 3K8LA 2WNZA 3FKKA 4KPLA 4UC5A 3CMFA 4KW2A 2BB0A 3H2MA 1FCUA 2CW6A 3G5EA 3LCLA 4NJKA 4PSRA 3VGHA 1OX4A 2GDQA 3W70A 2XH2A 4V15A 2XSBA 2E6AA 1V6VA 3E5BA 1H7NA 5D02A 2FTPA 3GW0A 1FHVA 4AWEA 4C65A 4K8EA 3NM1A 1LUCB 1HF6A 3PVFA 4H9XA 4F0MA 1I0BA 4JGDA 1W1IE 5DBUA 5I7GA 2YB1A 3TU9A 2OQHA 2ZKMX 2F61A 4XD3A 1X38A 1XIDA 1EO5A 3W7CA 4EPBC 3C0QA 3H2CA 3HBLA 1KKRA 3D5HA 4JDBA 5AB3A 3IVTA 4JTIA 1CLKA 3AZSA 4FLRA 4NNAA 5CAHA 3NG3A 3WD2A 2E1WA 1OINA 4UMCA 4DPQA 1EOKA 3KWSA 3S5ZA 1QFEA 2DFAA 5CJ5A 1Q6RA 5JBEA 3WDJA 3CB8A 1EIXA 1OK6A 3V3WA 4ICNA 2WBKA 4DB7A 3PPHA 1LOLA 1MNSA 2QPXA 1UZ4A 3NZGA 3EWUA 3GLCA 1TTPA 3FJ6A 4D2JA 2X05A 2Y85A 4M8UA 2VENA 2V63A 3NZQA 3OQ8A 4H9UA 1WXJA 2PDWA 2O56A 3ABZA 1X39A 1W1A1 3BLPX 3GUGA 1V3HA 4Y90A 1H41A 3W7MA 2J7BA 3WD0A 3MSYA 5FF7A 1R3RA 2Z1SA 4W93A 4PTWA 3U4FA 3NPXA 3SURA 5A2AA 4BQ3A 3P8IA 4PUNA 4QDPA 1A5BA 2PA6A 3QM3A 3T40A 2YL8A 3SO7A 4HZMA 1HKMA 2WKGA 3RCYA 3PZNA 4G8TA 3EEZA 3K30A 3ITYA 3WIJA 1DQWA 1S2CA 2GJLA 3BAKA 2A3EA 3OO2A 4EF8A 2WVTA 4MB4A 4UTKA 1EXBA 1T5AA 5JH1A 2J25A 3K8KA 4HK5A 3CLWA 5T8GA 3G0XA 4GX9A 1MXGA 2VOTA 1KRMA 3BUVA 3GRIA 4N9CA 4J3UA 2ZWZA 5I06A 4U3CA 3EWCA 1HFBA 2FZ8A 1D3HA 4NASA 4PBEA 3W4RA 1XBXA 3AQUA 4F2UA 5FSDC 4ACZA 4P7QA 4JTQA 3KP0A 3VM7A 1H4PA 2V5KA 3F1QA 1Z48A 3W7IA 1J12A 3P62A 1JZ3A 4ZR8A 1IE7C 4X60A 3UZJA 4RNHA 2VTFA 1KM1A 3W84A 3MKCA 5AVNA 2GQAA 1OEPA 4JXCA 2DZTA 5I78A 1K8CA 3JVAA 2AMGA 3MVIA 4QE4A 3LM3A 4LS1A 3FYYA 2C13A 2FTYA 1AUSL 1W9XA 3MHFA 2WXDM 4EXQA 4M6UA 2O92A 2DVUA 1J18A 1KTCA 3QKZA 1VPQA 3ARXA 1RD6A 5E9XA 3II1A 1VCVA 4C6EA 1SGJA 1J5TA 1TVPA 2CBJA 2OTDA 3ITOA 3VDBA 1B90A 1QNOA 5CJNA 1TPEA 3LBOA 2R14A 4BF7A 1KXQA 4I8DA 3WQOA 5DN1A 3DFYA 2PPGA 4I9TA 3GNOA 3PTDA 3JW7A 1WE5A 3SUUA 1VFFA 1AJ0A 1EIBA 2Y1HA 1EO7A 4P8WA 4KESA 3DIPA 1H7WA 1OB0A 1UWQA 3A3WA 3DHFA 4PULA 3LRMA 1XDMA 3PS7A 1UD8A 1F9CA 4NYYA 3XINA 5DXYA 3O6AA 2I16A 2BY2A 2IW0A 4D8AA 2D23A 5CH9A 2HPMA 1JCXA 3H22A 1YNPA 4EK7A 5K9DA 2PTYA 4MY8A 5A6MA 4DJFD 3I3DA 4S2CA 1Q3NA 1YDNA 3RLHA 2FB2A 4O8AA 3E6EA 2WANA 3FEMA 4HPGA 4GZEA 4GIRA 3A22A 4MWAC 2BV9A 3G0SA 1V6WA 3B9AA 2INZA 4M56A 3TJIA 2CLHA 2ZRYA 4NZ5A 4YWIA 2BHYA 1XIFA 1R87A 4GD0A 3FNDA 3N1AA 3AXIA 4DI9A 2V5LA 3NAVA 1OC5A 4W8AA 4NAFB 5CPLA 1CZ1A 1I2NA 2E4TA 2E9MA 4S3CA 1F6YA 3FAXA 3SCSA 2DSKA 1WB0A 1SW0A 1POJA 4POCA 3FA5A 1CNVA 2G0WA 2GSJA 4MWAA 5DQPA 3RRXA 1REQB 1DIDA 5J04A 1Y0EA 4XV0A 3L4YA 1V7YA 3AOFA 4MLJA 2B7QA 3N3MA 4K37A 4TV5A 4MZ8A 1H0GA 4ICMA 4ASTA 3AS0A 4WQ6A 1BXCA 1FWWA 4AMAA 2NX1A 3GU2A 3R43A 2XM1A 1VS1A 3QRHA 2XGIA 4UTWA 1KV8A 3UNTA 1ISWA 1ZNNA 4FHAA 1UWUA 3JR2A 3W72A 1D3GA 4FOUA 1EEPA 3AHXA 4IXHA 3N4EA 3PAOA 3TKFA 4Y8EA 3GAKA 4WJXA 5JUVA 3B4YA 1TE6A 4IX0A 1TJPA 3G1SA 2PDUA 3NIYA 1BWVA 3DG7A 4H1ZA 3A12A 4WX2A 1GTHA 4UR7A 4ZTXA 1XC4A 4IPLA 2J8GA 5FKYA 3QTPA 3RIKA 4QJ5B 4JS3A 3QFWA 4MY1A 3R2GA 5C9ZA 1GYLA 3T07A 1GVOA 4YYCA 3BLKA 1S1PA 1VBRA 2QCGA 2DT1A 2BG5A 3NA8A 1ISZA 2OLHA 3S6TA 1H5YA 2BVDA 1Q2SA 3L4XA 3N18A 4O53A 4P5UA 5A6SA 2HNHA 1UP0A 4MB1A 4C1NB 3CHEA 5FF3A 2GL5A 1L6FA 4C7GA 3WUBA 1BVZA 1KGWA 3SCQA 2D2HA 1D3CA 2VEPA 4TQTA 1LOSA 3GB6A 4HHHA 4C6NA 4IF2A 1SMDA 2ISSA 1QT1A 2QGYA 3WFAA 3EOEA 2CIPA 4NQ1A 4XIAA 3B04A 4QIUA 3QV7A 4LS0A 3ZR4A 3EWWA 1J6OA 1C91A 4HHLA 1QBBA 4AB4A 1B57A 2IPWA 1G1YA 1SZGA 2EJ1A 5HUOA 1DJXA 1OZQA 3K5XA 3IIPA 5H8MA 1UHVA 3TTOA 3GZAA 2XDFA 4AX7A 1FTXA 3EPNA 3F4CA 1TJ2A 3QY7A 1RXOB 3W28A 1XD1A 3TR2A 3RK8A 2NV9A 2PZNA 1QHZA 3W2LA 3GHRA 1CENA 4GA8A 1DJYA 4IISA 1JZ8A 1F6PA 1VJZA 1HKVA 1IGSA 3TWBA 4GXMA 1E70M 1V93A 1M7XA 3NSNA 1QHPA 3ANYA 4O1AA 4MLRA 4QS5A 1QNRA 4JY8A 3ZIZA 1K9TA 2RH9A 3FN9A 4DBEA 1HGYA 1AODA 2EXOA 5MF5A 3CK5A 1BSLA 2X2GA 4Y9NA 2QZRA 5I3HA 2ACRA 5LA1A 1EBHA 4JKMA 4KCUA 4B16A 1YE4A 1VZWA 2F8QA 1NOUA 2C19A 4O15A 3WL0A 1CXFA 4J3VA 3H7VA 3EWDA 4UTMA 4XZLX 1WP6A 4MGGA 1SZEA 3HG2A 4JTRA 3TJXA 1R3WA 3QPEA 4N6EA 1UA3A 4GABA 2V3GA 2PP0A 3L4ZA 3ARUA 1BEUA 5LSMA 2A3LA 2E6DA 5IBXC 4JIPA 3P0XA 3GXDA 3C4UA 3M6DA 3UXIA 1NARA 1GHSA 4RDZA 1UKSA 4PUUA 1JPDX 2KZHA 3VKCA 2GFTA 1LP6A 1V51A 3O6YX 1EF2A 4CEUC 3TLQA 2CZFA 1U5JA 3LCGA 1Y5VA 1G5AA 3OB8A 1AFSA 1ADDA 2HTMA 4IGHA 3ZYZA 4B3ZA 3M7WA 2FGZA 3CUXA 4I7VA 2V67A 4RZ6A 2DVXA 3E74A 3N2XA 4L6OA 1ZY9A 3NQ7A 1P6CA 4O13A 4H6QA 1E3XA 5C9UA 1BKHA 4S23A 2B4GA 1ENUA 1F3XA 2NQ5A 5HWNA 4ADSA 3HF3A 3EX3A 4LYKA 1L2UA 4UMBA 3QEZA 1RPXA 1EGMA 2FZ9A 4I9AA 1YE6A 4GQGA 2WPBA 1R30A 2CKRA 4HT3A 3TQKA 3LXCA 5CSYA 2ZUNA 3TXVA 3BG3A 3VIHA 2Q02A 1UUQA 3WMSA 1QWKA 4G9PA 3CZGA 1NJJA 3MWAA 5LIUX 3O3RA 3APGA 2A21A 3L0KA 2YA0A 4G2DA 4O57A 2WZTA 3BICA 1AD1A 5D38A 2D2JA 1JNDA 2OLAA 3MSRA 4F2TA 1ME7A 3G77A 3CPGA 4K8HA 2EF9A 5LIYX 1CLXA 1VJSA 5I3IA 3HMCA 3O63A 3GK0A 1LM1A 3DYOA 3EKZA 2WMJA 4GI6A 2AL1A 1NWTA 1KCXA 1ZBKA 2VD9A 3AIVA 3C3UA 1BYBA 4GKTA 4IH3A 2FVMA 3VDCA 1LL7A 3AJ7A 3SGGA 4Q33A 2BOEX 4PUJA 3UP8A 3O6CA 1FH7A 3NUKA 3OJGA 4AHOA 3GKFA 4JNMA 1XGZA 3TNBA 1F4HA 1BQCA 4LUIA 2V68A 3CMGA 2YDQA 5FD0A 2VCBA 2DDXA 1QATA 1PX4A 2R24A 1GT8A 2WW5A 3D47A 3UFYA 5T9BG 2JF6A 3EPMA 1XGEA 3F2CA 2AOSA 1PVNA 3BG9A 2OG9A 3GTIA 1VKFA 4AMCA 2EPKX 1DJHA 4PFHA 3ZZ1A 2CYGA 1ISXA 1HL9A 3G1XA 3W24A 4GC3A 1UUMA 3QMTA 4LY8A 3GNNA 4KRZA 4BKNA 2VD8A 3RX3A 1HJSA 1WXYA 3PJWA 2JBMA 5A2CA 2YBUA 1X1NA 4LYRA 3ZR6A 3GHSA 2YSWA 4E8GA 3WX7A 3MUXA 1K4HA 4KT2A 3TQVA 2PWUA 4DWSC 3SB0A 5B7ZA 5JQ9A 1H60A 3EOSA 2DH3A 2OWCA 3H21A 5DCDA 2W79A 4A3RA 4K1GA 4DN1A 5ABFA 3OBAA 4ZSTA 1P7TA 4TVDA 1LG2A 3OZOA 3S1WA 1IXNA 1YTDA 3LBCA 2E67A 1W1PA 3L4UA 4AAJA 1IXOA 1QW9A 4U31A 3NOEA 1FH9A 1S3TC 1JVNA 1QOPA 5AKQA 3VINA 3WLTA 4LF2A 3W71A 1GJPA 3UZWA 4JN8A 1ZCOA 3W0KA 1TPUA 3BWWA 2DZVA 2QCDA 3EMZA 4BEQA 1V3MA 1ESWA 3VMNA 3CH9A 3WLJA 4B5WA 4MVAA 4MPQA 5A6KA 4YWSA 2DIKA 5I5RA 2VOMA 4MOZA 3NQEA 3NQ8A 3RRAA 3W38A 3TYEA 1KA9F 1E9LA 3JU2A 4AD5A 3L2IA 1JDEA 1KO0A 3C8NA 3MKVA 5AFDA 2ZA2A 4Q7IA 3T78A 3VGBA 3QH2A 1QTWA 3CUHA 4DXKA 1GEHA 4QCFA 3FHAA 4C1LA 3KDOA 4IPPA 3BL3A 3SCOA 2WO5A 4DBWA 1MNZA 2J8TA 3DHPA 3LA4A 6REQB 3WQPA 4XZWA 2YYUA 5LGZA 1FOBA 2OU4A 5CZSA 4BI6A 3S83A 3HQ1A 4HYVA 1NFPA 4GZ7A 1I60A 4JIHA 1E6RA 3LCFA 3GBDA 2HROA 1W3LA 3LTSA 3QC3A 2C6QA 1FQ0A 1AW5A 5CPTA 3TC6A 3KCOA 4UOJA 3I7QA 4FIQA 3DYPA 4MWAB 1VF8A 5JU6A 3K13A 2ZDSA 3DESA 3BW3A 3BPWA 1UD2A 4DPPA 4GY1A 2HJPA 1GVEA 4TV6A 4K6AA 1RH9A 3S5YA 2HS8A 3AHVA 2CLLA 5K4XA 3RILA 2I5IA 3VTRA 1AK5A 4A2SA 1QPOA 4B5NA 4DWSB 3MMDA 3ENLA 2CU0A 3R7MA 3QQWA 3S8HA 4IX2A 1TJ0A 5CSRA 3SN1A 3WBEA 4DUWA 3NO1A 4ZBCA 1UG6A 4AW7A 4F3HA 3ME3A 2R1LA 1TVLA 1XQKA 1M7OA 1TTQA 3AROA 4QDWA 3VM5A 3W7OA 3QHOA 2PLMA 3QLLA 4Y6GA 4GK8A 2YKKA 3R5EA 2V82A 4JX4A 4AZHA 2MANA 5DXXA 5E9AA 1OBAA 4MWAD 4X61A 4UQBA 2ESCA 1XYBA 4ZFCA 3DG3A 3D6NA 1TJ1A 1TPFA 4NYUA 2PGEA 3XISA 2EPNA 4B5SA 2E5CA 3OYXA 1T41A 3SN0A 1W5PA 1NDVA 2WZEA 3N9RA 2V8ZA 2C1IA 2CESA 1VFUA 3P61A 1FHUA 1E6NA 2QCDB 3N73A 4WGHA 4WXZA 3PSWA 1KXHA 4BQ5A 1I1WA 4LTSA 1HG3A 4GNKB 2YLLA 4MF4A 3VIMA 3B8IA 1E9YB 4PMDA 2PFHA 2V5BA 3OTRA 1HX0A 2P8BA 1FDJA 6ENLA 1O94A 3IACA 4D6CA 1J5SA 2ZICA 4Y9OA 5JMUA 3B97A 3QW4B 4L1GA 5KSWA 2ZVRA 4EPEC 2J9ZA 1LT8A 3MBDA 3VNLA 5J5RA 2QYGA 5D33A 2OODA 3GD6A 4YVVA 5FJRA 4E4PA 4BI7A 6REQA 4XAFA 5LNSA 2ZCGA 4Q3MA 1A0DA 2ZZ7A 4WXYA 4D6IA 5LZLA 1N8IA 3PAJA 3ABSA 5G1YA 5D37A 5F2LA 2YR1A 4OOUA 3QY6A 2VFIA 1W3IA 3R6IA 1LLOA 4AVFA 3BOFA 1LWIA 1RQHA 1K77A 3LNMA 5EBUA 3W00A 4LUSB 1ZAIA 4NZ3A 3N6JA 3H8AA 2QUTA 1KBJA 2JEPA 4GQ0A 3MWCA 3TN4A 1R9ZA 1VFMA 2V2HA 2V3DA 4E2BA 4ERIA 3NJ3A 4HSNA 4BY3A 1F7BA 3LDVA 3LMYA 4LNCA 4WCJA 3T44A 4QX4A 3WMBA 1PHQA 1E6ZA 3FVDA 4FO4A 3M0MA 4OUIA 1FVPA 2J6VA 1MUWA 4IFKB 2PI6A 4NU7A 1XH1A 3A6OA 3FJ4A 1Z42A 1LOQA 3ABOA 2PWHA 1AQFA 1V79A 1B3WA 4K7VA 5I3KA 3E1F1 4G6CA 4IUGA 1AJ2A 2OVLA 1Y5WA 4NJHA 2XHYA 1HVQA 1EX5A 5M3WA 3P84A 4IXXA 1DYSA 2VC5A 4BZYA 1MRAA 3EDFA 4OHQA 4OTKA 1JRBA 1S5NA 3V16A 1CPUA 1F76A 2QNEA 3PJXA 4J3SA 3L66A 4GISA 3I6TA 4OBTA 3E5PA 3PUGA 2BTMA 3F03K 4YL2A 3STPA 1EC8A 3N2CA 1WX0A 3VI2A 5HWJA 1DOSA 1RP8A 1KM0A 2YW3A 4G1NA 2GGEA 4E2DA 1OFPA 1TPWA 1XLKA 2PWGA 5HQLA 4G5DA 1TQXA 3MJMA 2G4JA 1Q63A 3TJLA 2C3ZA 3CV2A 1TA3A 3WNMA 1W1ZA 3AUJA 4GH3A 1VYSX 4MJ4A 4PUMA 3MA8A 2J6XA 5HWMA 3G1FA 3I6EA 4F9JA 3VX1A 3C2OA 4ACZB 3H2OA 3AIWA 2ACUA 4WEVX 3W1AA 3CZEA 3RDKA 2ZUWA 2FZMA 2XH4A 2Y70A 2WHLA 1R46A 1UW9A 3TONA 4Q8TA 2C0AA 4M29A 4L9YA 1W3KA 4AXKA 4B5TA 2X16A 4WLCA 3M43A 5F2GA 5AHFA 4D6JA 3M0VA 4UTWC 2DORA 4D6HA 3ITVA 3PG9A 1EQCA 5CJMA 1EH9A 2J9XA 1TZZA 1CXEA 3NCOA 1TWDA 3QGVA 3VIIA 4EOUA 3G24A 1O5KA 4M6VA 2PWFA 2VZVA 1MUMA 5U4NA 3BLEA 3A5FA 1GVQA 2ATMA 3POCA 4WZHA 8RUCA 3GR4A 4H3DA 1HIZA 2C79A 5GJNA 5T26A 3TN3A 1GVSA 4N42A 3B03A 3Q65A 1DV7A 3LRKA 3CYJA 3HG5A 5FJUA 3W83A 2PGRA 2XISA 1HXJA 1FWFC 4IL2A 4LRSA 4E3VA 3A4WA 1RZMA 3NEVA 7A3HA 3ALFA 3ERPA 3S2CA 4IPIA 1ITUA 5BMWA 1WZLA 1GYNA 5D09A 3A9IA 1M5WA 1JZ5A 3RPTA 1XLIA 5BROA 1UB3A 2NT1A 3PJUA 1X1OA 1W8GA 1GCYA 2YDSA 4Q4KA 4HQVA 2ZWYA 5TNVA 3L5LA 5D03A 1I1XA 4HIBA 4IM4A 2PD9A 3BZJA 1A5LC 3SFKA 2CLMA 3STCA 5AHLA 3FYPA 2H8ZA 3R94A 3WF3A 3VIFA 1KRAC 1YX1A 1HP5A 3ALGA 1B2YA 4QROA 2HQAA 2CITA 5HOSA 1OFAA 2JGYA 2RDTA 4PBGA 1GKPA 3CPRA 2RFGA 4CD6A 1VFOA 1XSJA 2UY5A 5CQ1A 2PBGA 3E02A 3B8VA 1ODZA 3LHTA 5EU9A 4KQNA 3SR7A 4C6MA 2GJXB 3R1ZA 4HK6A 3WK2A 3TSMA 1TCDA 4EAYA 4A29A 2ZBTA 3RMEA 3R8GA 3GDRA 4X9YA 2QCMA 4F0RA 4C6FA 4UTTA 3TEVA 4GGHA 1R85A 2OR2A 4K68A 4JTAA 1EZ2A 3NVTA 2VFHA 5FAGA 3Q45A 2DH2A 1DORA 1MQRA 4H8NA 3HFYA 3BLOA 3NWRA 3OA3A 3A4JA 4P8VA 4XKMA 5HDRA 1H61A 3H6OA 4W4QA 4V33A 3PNZA 3GG8A 2QCCA 4ZSUA 3CT7A 1Q6LA 1CXLA 3HB9A 2CWXA 1JQXA 5KEZA 1YBQA 2NVCA 1FWSA 3FDGA 3NXFA 4AY8A 2RKXA 1A50A 1AH0A 1PAMA 2YFOA 1KCZA 2O4MA 1GWJA 1E0VA 4AH7A 5I77A 3IEBA 4A8NA 1R86A 1KCKA 1W1YA 5A6LA 1F74A 4PUDA 3IUDA 1GOKA 2TAAA 3BANA 4U2ZA 1X97A 3CM4A 2ZE0A 1MXDA 2QJJA 3S5SA 1SR0A 1O1ZA 4AYSA 1I2PA 1HJUA 1JRCA 4DM2A 4C7FA 1PZ2A 2NT0A 2WAGA 3LUTA 4YVXA 3O6DA 2ZX6A 3I4EA 1KRBC 2OWXA 2DJXA 3UWWA 4HP5A 2R94A 4ZE4A 4LCSA 4WD0A 5CG7A 3M5VA 4C6OA 3ZS4A 3WQGA 4F8XA 1H1YA 2NXGA 1SO3A 3RO6A 4PTMA 3SN4A 4HA1A 4TTUA 1GJWA 1UC5A 4JIRA 3SY8A 3VIGA 3W1XA 4R85A 4A8LA 4O10A 4E3TA 1GJUA 3W85A 4AZ5A 4DLMA 3MV11 3PZUA 5AC7A 1JYNA 3OG2A 4I5XA 3SQSA 2WVVB 2CLEA 1OSEA 3R0KA 1QUMA 7TIMA 4QP0A 4J9JA 4L65A 3CO8A 3LM7A 5DRCA 3NYZA 1I2OA 2P8CA 3PZQA 3TYDA 3GNRA 2EG7A 4ZVJA 3CAVA 5EMLA 3W7JA 3H4WA 4KH2A 2BXVA 4ATDA 4DJDA 1XG4A 4HYRA 4IGNA 4OBRA 3SUVA 4JEQA 1KFWA 2A7RA 4JTJA 1CTNA 3S1UA 3FY1A 4FXJA 5AZ1A 1RJRA 1UMYA 5CC5A 3NZ1A 3QKEA 3P5ZA 5EY5A 4FIRA 5LIKX 2OGYA 1MW1A 3KBWA 4DJDC 3L5MA 3IPWA 3E0FA 5HNRA 4CD4A 4BJHA 5TQLA 4Z1YA 1OQFA 3P8JA 2Z6IA 4WKHA 3LB0A 1F2JA 2E5DA 3M0IA 1YIXA 1SYTA 3QV6A 3LPOA 3QMSA 5HANA 3R89A 3B40A 2YZRA 1GG1A 3BCFA 2ZDRA 4D6FA 3UY7A 2B0MA 2VZSA 4NHVA 3PBWA 2C18A 4PEKA 1EWDA 1YDVA 4PE8A 4TVCA 3V5OA 2XU2A 4IQDA 2CERA 4ECLA 1PYFA 4XZHA 1K3UA 4XX6A 3DZ1A 5C5YA 4F40A 3VFCA 4NILA 1JNEA 3OIHA 3IJDA 1KBKA 3GNDA 4GIEA 1GUVA 1H09A 4DBSA 3LOTA 4HMEA 3BQ6A 3CUFA 1W9BM 3WF2A 2A2IA 2Z6JA 2E68A 2ZZ4A 4PMVA 4QLLA 3P74A 1PKMA 3RPMA 2GVGA 2XGBA 3RJYA 5I02A 3G8EA 1A4LA 4Z1CA 3QHMA 3P81A 1JCYA 4AY1A 1U5VA 5H6HA 4J5NA 1H1NA