1OM0A

Crystal structure of xylanase inhibitor protein (xip-i) from wheat
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
274
structure length
274
Chain Sequence
AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase Inhibitor Protein I
publication title Structural analysis of xylanase inhibitor protein I (XIP-I), a proteinaceous xylanase inhibitor from wheat (Triticum aestivum, var. Soisson).
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 98
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1om0A00
3VIHA 3GBDA 3WD4A 1F4HA 1V0LA 4RL3A 1FP8A 2JE8A 3WEZA 1MQQA 4HU8A 2PF0A 5BCAA 2NSXA 1FH8A 5KEZA 3NUKA 1PEZA 3QHNA 4IISA 1XCXA 4UZSA 3CGTA 2OYLA 1HVQA 3ARYA 1CGVA 3EDKA 1CZ1A 3WF4A 6A3HA 4UFKA 1CGXA 4XUYA 3L4WA 1QHPA 4FLRA 1VEMA 1PBGA 2Z1SA 3WEOA 3PZUA 1PIGA 1DWFM 1JDCA 2NT1A 4TXEA 3NSMA 2ZUSA 2WSKA 2V3GA 4JCLA 4U3AA 1GHRA 1V3MA 4PMXA 3CPUA 7TAAA 2VCAA 3GTNA 2WAGA 1JAKA 1QI5A 2CCRA 2WLZA 1WZAA 4LPCA 5FD0A 2PB1A 1UR4A 1E0XA 2GK1B 2WHMA 1M53A 4PUDA 3LPGA 1KQZA 1V6XA 2BS9A 2GJXB 5GNYA 1CBGA 1GPFA 1OD8A 3EMCA 1HL9A 1J0YA 1W3LA 3DHUA 2W63A 5I78A 5JBFA 4H8UA 2F2HA 4WJXA 1BSIA 1ZU8A 5HDRA 3SUSA 1QNQA 3B9DA 3MSDA 1AVAA 4P8UA 3WF1A 3PZIA 2UY3A 3MKKA 4WKAA 2WKGA 4JFUA 4QDMA 4W5ZA 2XIBA 1ZJBA 4IM4A 1UZ1A 3B9AA 2FH6A 1HJVA 3DYMA 2YL5A 2WHKA 3BC9A 3SCTA 3DECA 1DTUA 4ZE4A 3EYPA 4GIAA 4GI9A 1BYDA 4DWSC 3VKKA 1GONA 2BFGA 4W5UA 1BYBA 2DDXA 5AYIA 3QHOA 1CGUA 4D1JA 1BG4A 1R86A 3OGSA 2GUYA 5E0CA 4UQCA 2EQDA 2ZXAA 5IFPA 1W2PA 5I77A 4MJ4A 1UKSA 1UWIA 3N13A 2DSUA 1GOIA 1BGAA 2ZUUA 2JEQA 4ACYA 1WE5A 3SUUA 3VD7A 3VO0A 1LL7A 2WZHA 1XSKA 3ARTA 2WWCA 2OSYA 2XVKA 2X8RA 2CITA 5A6LA 3S2CA 1CXEA 4QLJA 2OYMA 2WVTA 4P8WA 1JF5A 4AZ6A 4EK7A 3CBWA 2DH3A 2A3EA 2YOCA 1NQ6A 5DFAA 4J3WA 5BXPA 5DMYA 4GXPA 3WD0A 2CNCA 3AMCA 3MUZ1 3K8MA 1SR0A 3AHVA 3NIYA 5FL1A 1WPCA 3KZSA 4JKLA 1B90A 1UA3A 1GNXA 1E1EA 5FCZA 1BLIA 4D6GA 4AY1A 2G3MA 3O9NA 5M17A 1V6VA 4MDOA 2XFRA 3U7BA 1DWJM 1CNVA 4U5KA 4WSJA 5HNNA 5IFTA 3MMDA 4AW7A 2VURA 2D20A 3SCUA 1UYQA 1HP5A 3N12A 2DPEA 4YHGA 5CSYA 3TP4A 4Z2IA 3DYOA 2V38A 3GXMA 3CHEA 2Z1KA 4RE4A 3W6LA 1IZJA 4K68A 3SCWA 4W8LA 4HZ8A 1EOMA 4AXNA 2V3DA 4WKFA 1NWRA 4PSRA 3W24A 2CBJA 4A3HA 1XHGA 2E8ZA 2CHOA 3VIJA 2EXOA 3WD3A 1PZ2A 3WDQA 3WUGA 1GOKA 1E4NA 3MV01 1DWAM 1WZMA 3TTYA 4ML4A 1G0CA 3CZGA 1PX3A 1AQMA 1MFUA 2V3EA 3FHAA 1KGWA 3PTKA 3PTQA 1D2KA 4PTVA 4AD2A 3OG2A 2FHCA 1NWUA 2EPLX 2X09A 3RMEA 3AS0A 3PZ9A 3WNPA 4LX4A 3FXYA 5D4YA 3SCNA 3EDDA 4AWEA 1P6WA 3RM8A 2VC9A 1J01A 1JI2A 3AMDA 2DT2A 4CN4A 3CUJA 2NW0A 1SMAA 3WL0A 2E9MA 3AJ7A 1XD0A 4FF5A 1E3XA 4MJ2A 2V5CA 1DWHM 1LF1A 1KR1A 1US3A 3DYPA 5I5RA 2VMFA 3AOFA 1CDGA 4C7GA 1F4AA 1OB0A 3RPMA 5JUVA 3GM8A 1MWOA 2BY1A 1GJUA 4AD3A 3FN9A 3ECQA 1C3FA 4CVWA 3VMNA 3WDRA 2WVVA 2PC8A 3I3DA 1UD3A 4M24A 1H3GA 5BYWA 4CD4A 1CECA 1OINA 1E3ZA 1MQRA 3WFLA 2G41A 3VPLA 3ALFA 5LYRA 2ZUTA 3SEPA 4AD0A 1HVXA 1QI4A 1A47A 1B1YA 1BPLB 2VRQA 4YHEA 2VCBA 3VDAA 2J7DA 4HMCA 1I1WA 4ATLA 3MSGA 1BGGA 3OZPA 1PX8A 1QHOA 2WSPA 4CN1A 2YL8A 3NDYA 4U31A 3WKZA 2DIEA 3RCNA 2DH2A 4J27A 3T0BA 2EPKX 5CJ5A 2XJ7A 4F8XA 3E1F1 1VRXA 3SURA 2WMIB 4JCMA 3RM4A 1EO5A 5HOSA 2WKLA 2EPNA 5DF0A 2QV4A 1G9HA 2WCSA 1E0VA 5IDIA 3ARVA 4L4PA 1GHSA 2G3JA 2C7FA 1EHNA 3EMQA 1JGIA 2X0YA 5A8NA 1M04A 3GNRA 3LPOA 2XVPA 2VX5A 3TTQA 2GDUA 3TONA 4WK9A 5EFFA 5CLTA 2GVYA 3T0AA 1MXDA 5I0DA 2VZSA 1LJYA 4PMQA 3VX0A 2V3FA 4PMRA 1M03A 4DUWA 1ZBKA 1JG9A 2W5FA 3WD1A 2ZUMA 3U57A 2FDMA 4N42A 3T09A 2YJQA 5GQBA 2WB5A 1EA9C 4D6EA 2E8YA 4NF7A 4PBGA 3FHQA 4OBRA 1OCQA 3N17A 3BMWA 4D6HA 3AI0A 3LPFA 4WIWA 3GZAA 3K4AA 3N9KA 3VUPA 1RH9A 1JFHA 2XM1A 3VM5A 2WHJA 1YQ2A 1QNSA 4C7FA 2X2YA 4BQ3A 1TCMA 3ZR6A 4JIEA 2O9PA 1H2JA 4BQ5A 2Y8VA 3AIWA 3ZR5A 2VJXA 4KGJA 1C91A 4UTFA 1J18A 2F61A 4C7DA 2EPMX 2E0PA 4W7UA 4H41A 1QBBA 1C8XA 1I1XA 4ATDA 2BHUA 1HL8A 3N04A 1J0KA 3A4WA 2AOSA 1E72M 2YBUA 5JIPA 2VRJA 2AMGA 1JXKA 2J74A 2YDSA 1MW0A 4MADA 1VFMA 4CVUA 3UERA 4JL1A 3VD5A 3UG4A 3JUGA 4M81A 1JNDA 1OT1A 1NOFA 4JFSA 4ZE5A 2BHYA 4MAZA 4PN2A 4KWUA 2QF8A 5DT7A 1H0IA 5A95A 1H5VA 5CQ1A 4KH2A 2W62A 5HPOA 1E56A 2DSWA 3WH7A 3WSUA 1H11A 5CPSA 4XX6A 1EO7A 5FL0A 1CXKA 4P7NA 3WDHA 1WCGA 4P7QA 1NOWA 1J0JA 2OSXA 1KFWA 4UQBA 1E5NA 1QW9A 2W67A 4PMNA 1E9LA 1C90A 3RDKA 2A3HA 4OOUA 1K9TA 4MNJA 2NT0A 4IPLA 2Y24A 3IK2A 2FH8A 3GNOA 5BWFA 3VTRA 5E09A 2IXUA 1LG2A 4Z2JA 1BHGA 1UKOA 1JI1A 1BVNP 5D9OA 1C8YA 1M7XA 2YDRA 2WMFA 5GNZA 2J75A 1V6UA 2X05A 2XVNA 1JYVA 1CENA 1XH2A 4JZ5A 1UD8A 1V0MA 3L2MA 2ZXDA 3F5LA 5LA1A 1KQYA 1O7AA 2XGBA 4TUFA 1GUVA 2VX7A 3BCDA 1QI3A 1J9YA 4CUCA 1HJXA 3VDBA 3BAKA 2GFTA 4F9DA 2X1IA 2CXGA 4JAWA 1E6QM 2CPUA 1ESWA 5FKYA 4J3TA 6CGTA 1CXHA 4EANA 1VFUA 2WC3A 1TG7A 4HZ7A 1E55A 1UR0A 1HKKA 4JHZA 2WZEA 1LQ0A 1V3IA 4M80A 1ZJAA 3RJXA 4UFMA 2JIEA 5A6JA 3VM7A 4DM1A 3WMBA 3GH5A 3WMSA 1U33A 2DT3A 1H49A 2VZOA 2ZIDA 2DQXA 1LWJA 2C8NA 5A8OA 1W9XA 3ZIZA 4CU7A 2DSKA 3PZQA 4W93A 1JAEA 5AC4A 5IHRA 1KWGA 4AD4A 1DWIM 2WHLA 4H8HA 3VMPA 5M3WA 4GZIA 3ZM8A 1BQCA 3PZOA 1HJWA 4WSKA 3RJYA 3W6MA 3T0DA 1FFRA 2ZX6A 4PCSA 1EGZA 2ZX5A 1W3KA 2J8FA 5CPTA 5BROA 3WDPP 3HMCA 1ZBCA 1L8NA 2VZTA 5JBEA 2PI6A 4TX6A 5D9MA 1VF8A 4KRUA 4KGLA 1UWTA 4OKDA 1FA2A 1JNEA 3WBAA 1KR0A 2XFYA 3NJ3A 5CXPA 5IHSA 3KL3A 1WDQA 2PWHA 4P7RA 3PZTA 4D6JA 3OGVA 1ODZA 2JFEX 3SCRA 3UESA 2CIPA 1QW8A 1E70M 3AMLA 4PUEA 3PBGA 4QLLA 4S3JA 3UETA 4UOJA 3W29A 2CHNA 2XSBA 3BH4A 2OYKA 2WMGA 4M8UA 4OJYA 1QNRA 3SIMA 4W84A 1JD7A 3AYRA 1B30A 1KB3A 2HISA 3SCOA 5CLWA 4IPNB 4M56A 1ISYA 3ZJ6A 3WIJA 3W0KA 2DSVA 1KXVA 1X1NA 3MANA 1ITCA 3UR8A 2WCAA 2VZVA 1UR1A 3HU7A 2WBKA 2QHAA 4U33A 3CUFA 2EEXA 2E9BA 3K8LA 5A2AA 4GO9A 4JKKA 3W4RA 5I3DA 3QGVA 2GJPA 1XH0A 1CLVA 4CCDA 2VVNA 2VZUA 2ZXQA 4GKLA 1JZ5A 3KEHA 4FMVA 4TVUA 3EBVA 1CEOA 1BF2A 2AAAA 1WZLA 2BXYA 3OB8A 3AIRA 1ISVA 1XYZA 1VB9A 2DT1A 1J0IA 3MMUA 3CZEA 2Y5EA 3QR3A 1W9VA 4A3YA 4TVCA 3J7HA 1Q6DA 1CWYA 3K46A 1C7SA 1G94A 4CD8A 4X0VA 1ECEA 1UH4A 3QOMA 1XC6A 1UWQA 5CGTA 4XZWA 1ODUA 4TOQA 5BRQA 2VUYA 4V2XA 4QP0A 1NWSA 3GDBA 1GJWA 2Y8KA 1LL4A 5E6ZA 1W91A 1UD6A 3WH8A 7CGTA 2GSJA 3WH5A 4FLSA 4H8VA 1UG6A 1UH2A 4GZJA 4MNLA 3MS8A 3BLKA 3VIIA 1BG9A 4UOZA 2ZX8A 1JDDA 1Y7VA 1HT6A 3WQ8A 4UQDA 1S46A 1HNYA 2YLAA 2ZICA 2VNCA 1W9PA 3SUTA 3NDZA 1HIZA 3VDCA 1FP9A 4W8AA 1OGSA 1E4LA 1FHLA 1OSEA 1IT0A 2XM2A 5ABEA 1SFSA 3N18A 5A1AA 2ZX7A 4LYQA 3S6TA 2QPSA 3MV11 3A3HA 5A6AA 1OIMA 3T08A 3UG5A 2J79A 2XPKA 5M03A 3WH9A 8CGTA 1J0ZA 8A3HA 1CXFA 1UD4A 3VIOA 1TUXA 1BAGA 3ZOAA 1E5JA 3U5YA 4DM2A 1EDQA 3CUHA 3BXWA 3WN6A 4OOZA 3D5HA 1LWHA 3AIBA 1JYWA 4OBSA 3CO4A 3AQUA 5E0FA 3I3EA 3PZVA 2EO7A 2PWFA 4QCFA 4AZHA 3TOPA 2WCGA 3AXXA 4HU0A 2VX6A 5A6BA 2J8GA 1V3LA 2VRKA 1UKPA 1GQJA 3CTTA 1GOMA 4HOZA 1QVBA 3M07A 4W88A 2D0FA 3ARXA 1UOKA 3BAWA 4AZ5A 1RD6A 2G3NA 4AZ7A 2W66A 1VBRA 3TTOA 1MYRA 2BY3A 2O9RA 2WW5A 4MDPA 5DT5A 3WNKA 4BZYA 4J3UA 1TVPA 3ZJ8A 1JL8A 1CIUA 4PMDA 3CHCA 3MUY1 5GPRA 4JFVA 3AICA 2A3CA 1VFOA 1GORA 3RM9A 1MW2A 4L4OA 1JZ3A 1E0WA 4AEEA 3AZRA 2XGIA 4P7LA 3VINA 1IV8A 4EE9A 1R7OA 4DWSA 1DWGM 2E40A 1RP9A 2W61A 1M01A 2CKRA 2WYSA 1XSIA 1E15A 2UY2A 1VJZA 3II1A 5BXSA 2DSZA 4CD5A 1E6SM 1MXGA 5C8BB 5HXMA 3CMGA 3WDIA 4LQ1A 1ZB5A 2G3IA 4HA1A 4W85A 4PSPA 1KGUA 1GOQA 4D6FA 4TVDA 3GXDA 3THDA 4ZFMA 3RILA 4X9YA 2OWWA 1HX0A 2YA0A 1LL6A 1BTCA 2MANA 4PRWA 1UZ4A 3B8SA 1OGGA 4F9JA 3FY1A 3AS3A 2BV9A 5DO8A 1WP6A 1UWUA 4MNMA 2WVVB 1GVIA 5AC5A 3WF2A 1C8QA 3BAIA 4D6IA 1JZ2A 1EXPA 1UQZA 2CBIA 2JEPA 5A3HA 4QCEA 1C93A 2VQTA 3OLEA 5A6MA 1UH3A 4GPNA 1FOBA 2YLLA 1U2YA 3WNLA 4HMEA 1GOWA 2YL6A 1E1FA 1R7AA 3G6LA 1OM0A 5E70A 2XTKA 1K6AA 3IJ8A 4GQQA 4OZOA 4BA0A 4DWSB 1CPUA 3NYDA 1KBBA 3NSNA 1B3ZA 3B9EA 1ISZA 2YA2A 1PAMA 4HOXA 3AHZA 3OLIA 3EDEA 3FW6A 3NCOA 5AYBA 4MB5A 5D9PA 3ZT7A 4LYPA 3ZSTA 1UR9A 3AZSA 3ARQA 3VIPA 3GXIA 1ISWA 1WDRA 5ABFA 2WXDM 3O2LA 4J3XA 4Z2LA 1YHTA 4MB3A 2CYGA 5TD4A 4Q7NA 4CCEA 1C7TA 4W89A 1G01A 2CESA 4JFTA 4RE3A 2XIIA 1L0PA 5I23A 4NI3A 3G6MA 3T2OA 2WM0A 1EDTA 3EDFA 1W3HA 1WB0A 3PHAA 2D3NA 3OLDA 4ACZA 4AIOA 1K9EA 3PZNA 3A4AA 4GINA 2D22A 3ALGA 1R87A 3VGEA 4NSBA 2OWCA 4AIEA 4PMYA 2VO5A 3OLGA 1MVYA 4JHOA 5A2BA 1JFXA 2VX4A 3FNDA 3KWXA 3IJ7A 1U30A 3W26A 5AY7A 2UY5A 3WNMA 2J7BA 4JFWA 3VU2A 4FLQA 1H0GA 2WMJA 2GJRA 3KL0A 1G5AA 1UR2A 1XSJA 4MB1A 2GDVA 1HXJA 4NRSA 3OGRA 4PEEA 1UR8A 1MW3A 3DC0A 3ARSA 1KCLA 3WD2A 1W9UA 4BQ4A 3VILA 3WQWA 3SCQA 1GQIA 1TZ7A 4U5IA 5CG0A 4UFIA 4XZBA 3T2PA 2JF7A 1JZ6A 1GVYA 4CN6A 2ZWYA 1VIWA 1ZBWA 4A4AA 1OIFA 1W1PA 1B31A 3AYSA 4U3CA 3WH6A 1UD5A 2VTFA 1JZ4A 3WNNA 5ABHA 4DUXA 3BAJA 2WBGA 2VCCA 3CZKA 4MAVA 4UQEA 1O6IA 3WUFA 1W1TA 1W2VA 5C71A 1V08A 3WF0A 4QAWA 1Z32X 2D3LA 2RGMA 1B9ZA 3WEMA 3WMCA 1E71M 3T2QA 4D6DA 1B2YA 3ZT6A 1V03A 3CUGA 1Q4NX 2DIJA 1HP4A 3ZJ7A 3VD9A 3GH7A 1H09A 2J78A 4BCEA 4PTWA 5JIWA 3SCVA 2BY2A 2XG9A 3BSGA 1A3HA 1Q6GA 4IUGA 4W7VA 1JZ7A 2W4XA 2PWGA 4ZXOA 3N11A 3F4VA 3AIQA 3AZTA 2WZIA 2XWEA 1QI2A 3N15A 1CYGA 1NARA 5GNXA 1JXJA 3CHDA 5KZ6A 4GQRA 4P7OA 2GJXA 1UHVA 4UFHA 5EBAA 2CETA 4TX8A 4JL2A 1VAHA 3F5JA 5CZKA 2OLHA 2O9TA 3W28A 4WF7A 3W38A 3OA5A 2E3ZA 2D23A 3L4VA 1VBUA 1ZBVA 1EDGA 3ZSSA 2F8QA 2VT0A 3CLWA 4HOWA 1WNOA 3PTMA 1UUQA 2D0GA 1J12A 5I79A 4CCCA 1FFQA 3ZQ9A 1HJQA 1X6NA 4FK9A 4R27A 1MW1A 1E40A 2EJ1A 2OWXA 1NP2A 4B9YA 3AHYA 2ZE0A 4UQAA 4AD1A 1OGBA 1VFFA 1HKMA 2WWDA 1RPKA 1V6YA 1K9DA 3M6DA 5BXTA 5A6BD 3M46A 3UG3A 4ZENA 4Z2GA 5CSUA 4QFUA 3WELA 5HPCA 1ZS2A 4B3LA 1XH1A 1CTNA 4OIFA 1GCYA 2TAAA 2OSWA 3GXFA 3EDJA 3VGFA 1UD2A 3CZ8A 3OBAA 4FLOA 3A47A 1K9FA 2D24A 1QOXA 3BCFA 4BF7A 2JIWA 4CKQA 3K4DA 1NM9A 1EOKA 4AZGA 4AZCA 4DWSD 3VIGA 3WY1A 1CLXA 3ZJKA 2RGLA 4LYRA 1V6WA 2D2OA 2FHFA 4PMZA 2BNJA 1QHZA 3MMWA 5A94A 4CU6A 1CGWA 5D8WA 4PMVA 2WC7A 3I3BA 3WL1A 2J7EA 2XVLA 1NOUA 3L4YA 2ZUWA 4H04A 1JYNA 1R85A 3AXIA 1WDPA 3VD3A 2ZXBA 1JYXA 3MUIA 1E4IA 4N0RA 3IANA 3W81A 2FGZA 4P8VA 2QMJA 4PMUA 5HBFA 1Q6FA 1IZKA 3BMVA 1SYTA 3ARZA 5F7UA 1E6ZA 4JKMA 4LGXA 2J7GA 2BVTA 3NSXA 3WFZA 3ZT5A 5FIPA 5C70A 4V27A 3BGAA 4AYSA 4GZEA 3BLPX 4AISA 1UKTA 1MQPA 3PZGA 3VIFA 4GI8A 1HJUA 3HN3A 2J77A 1KBKA 2YIHA 1NP0A 2O92A 3O6AA 3AHTA 4HA4A 4B9ZA 4E2OA 7A3HA 1JD9A 4AZCB 3BSHA 3K1DA 2BHZA 2UWFA 5A8MA 4B15A 5EFDA 3W82A 1XGZA 4H2CA 1HN1A 4XB3A 4J28A 1TVNA 3WUBA 2W92A 4S3KA 4UFJA 5EB8A 1B3YA 2HVMA 3APGA 4U2ZA 4R5EA 5A69A 1PIFA 3GH4A 5JBDA 1NH6A 1QNOA 4PTXA 3RIKA 2WANA 3LMYA 3THCA 2A3AA 4W8BA 1VEOA 2ZUVA 3AXHA 3QOKA 2WC4A 2WPGA 2WNWA 3VVGA 1J10A 4KMQA 1KWKA 1Q6CA 3GYCA 3L4ZA 4AMCA 5D9NA 3HJEA 4HPHA 2G8ZA 1UWRA 1W3JA 3L4TA 1J0HA 3WNOA 2C0HA 5IXEA 2BVDA 1V02E 3W53A 4HPGA 3CMJA 3ARPA 2J25A 1HJSA 2XUCA 4HTYA 1E43A 4AC1X 4NRRA 2WVUA 1B3XA 1C92A 4U2YA 3AIUA 2B31A 1FHDA 3FAWA 3L4XA 4P8XA 3CIVA 1XCWA 4URIA 4ATWA 1OWQA 4W7WA 3ZMRA 4B3KA 2PWDA 1QNPA 3F5KA 1RP8A 4OUEA 4LXFA 3UCQA 1W32A 2PBGA 1W1VA 4W87A 4CGTA 1UA7A 5I24A 2FHBA 3SCSA 6TAAA 3A4XA 2WMIA 1UWSA 1JDAA 5ECUA 3U7VA 1WKYA 4D71A 3CH9A 1J11A 2YL9A 1EH9A 3AIVA 1V0NA 3M7SA 1BYCA 1WO2A 4V28A 2WMHA 1OT2A 2V5DA 4CU8A 4W86A 1OBAA 5A6SA 2XVGA 4WKHA 3UR7A 4HZ6A 4Q22A 3BAYA 1JIBA 4UFLA 4EAMA 2Q8XA 3VGDA 3AS2A 4D1IA 3CUIA 3MUAA 2PBOA 5A2CA 4ZEPA 2WVSA 1SMDA 4D6CA 3ZO9A 1KCKA 1VENA 1UKQA 1B3VA 2X0HA 3ARWA 3WQ4A 2D1ZA 1W9BM 1ZL1A 1LLOA 1VEPA 3GBEA 1OD0A 4RE2A 1UQYA 2EBNA 3AMKA 1LG1A 3WQ5A 1CXLA 4CD7A 2CBVA 2QPUA 4TTGA 4AEFA 3OZOA 3K8KA 3SUWA 3WQ6A 1Q6EA 4H7VA 4MPKA 1EQPA 1GZJA 2JALA 4UNIA 1BFNA 3KL5A 2VI0A 3OIHA 2J7HA 1V3JA 3VNZA 3DHPA 3ARRA 3KE0A 4Z2HA 1XRVA 4UCFA 1W1YA 1E73M 2DGAA 1QBAA 2CEQA 2CBUA 3U5UA 1WAWA 3GNPA 2IUZA 5FOOA 1AQ0A 2BVYA 3VD4A 4EKJA 2BY0A 1HF6A 4M1RA 3VDHA 1VJSA 4NZCA 1HKIA 4X0NA 4M82A 4WLCA 3VGBA 5BXRA 2WLYA 1GQKA 4M29A 2D0HA 4Z2KA 3SUVA 4AIUA 1D7FA 2QLYA 4AZBA 2YBTA 3N1AA 4GI6A 2VVSA 2XHYA 5E9AA 3WENA 2J47A 4J7RA 4E4PA 1V02A 4ZXLA 1GW1A 4KRTA 3FAXA 2CKSA 1EIBA 3EMZA 1DP0A 4XV0A 2XFFA 4B16A 3VNYA 3PN8A 2JF6A 1H41A 1BYAA 1MFVA 3WF3A 5M5DA 2WMKA 2ZX9A 3WUEA 2Y2WA 4PMOA 5E6YA 1KXQA 1PZ3A 2IXVA 2J4GA 5ABGA 2Y4SA 4UOQA 1I75A 1KGXA 1TR1A 3AFBA 1V3HA 4QLKA 1WDSA 1PJ9A 4TTUA 3AISA 5LA2A 3A6OA 4PTMA 2DT0A 1QPKA 3UEQA 2W91A 4UZUA 1HKJA 3MO4A 2G4FA 1V0KA 3AIEA 4CD6A 1PX4A 3VMOA 3BAXA 3POHA 1GOOA 3SCPA 1X6LA 2XYLA 3TA9A 1FH7A 3AROA 1EQCA 4UR9A 4Y7EA 4J3SA 5A8QA 2J7CA 1EHAA 2E9LA 1TMQA 2QMKA 2O9OA 3LPPA 3IJ9A 4MB4A 3ARUA 2E4TA 4AZIA 2VR5A 2J62A 3CZLA 3WDJA 1H1NA 1GQLA 2VOTA 5I6SA 1B0IA 1R8LA 3CHFA 2XSAA 1CGYA 3MU7A 2ESCA 2EPOA 3AMGA 1BVZA 2YDQA 2J7FA 5ABFB 1JZ8A 1PPIA 1XYFA 1XV8A 4BS0A 3QHMA 1KXHA 3W27A 4F79A 1ITXA 1KXTA 1DHKA 1CXIA 4BQ2A 3RO8A 3VOCA 5BRPA 1TA3A 1W9DM 5A6KA 4HA3A 3VIMA 2ZUNA 5D8ZA 5DEZA 4ACZB 3TTSA 4HP5A 1CGTA 9CGTA 1JF6A 2ZOXA 2VR4A 3IAPA 3POCA 4GO8A 3PZMA 4YPJA 2ZWZA 3CZJA 4MNKA 1D3CA 4UQ9A 3L4UA 4D72A 4F66A 3WBEA 2WK2A 2VQUA 4MTVA 4AD5A 2YKKA 3W37A 1N82A 5LA0A 3AHXA 3IAQA 1B3WA 1QI0A 1E6PA 2VL4A 1H4PA 1FH9A 4PYSA 1NWTA 1ISXA 1E4MM 1US2A 4DUVA 4E8DA 5EMYA 3VGHA 1TE1A 1AMYA 1E6NA 3VIKA 4YN5A 1E6XM 3WQVA 2YA1A 3W25A 2FGLA 1TFVA 4E8CA 1DEDA 5CPQA 2BXZA 3VX1A 1AQHA 2GK1A 2DEPA 4J3VA 1WZKA 5CGMA 5A8PA 1G1YA 2UY4A 1V3KA 4HMDA 3AS1A 1XD1A 4PCTA 2CERA 1E6RA 3L2LA 2XWDA 3VGGA 3D3AA 5I2UA 2A3BA 2PWEA 1TA3B
chains in the Genus database with same CATH superfamily
2YXXA 4GCAA 2JE8A 1MQQA 3GW3A 4NKCA 4S2CA 1A5NC 1L2QA 3JR2A 3CEUA 3CGTA 1HVQA 1VYPX 3GR8A 1QPQA 2V5LA 3WF4A 4UFKA 1QNVA 4Y8EA 3L4WA 2ZCGA 1QHPA 1PTDA 4RV3A 1Q5MA 1TWIA 4LALA 1PZ1A 4TXEA 2ZUSA 3TE9A 3PY2A 3N2CA 4JCLA 1EJSC 1RJPA 1GHRA 3QW4B 3VKDA 2VEPA 4LAOA 7TAAA 4KESA 3GLCA 3A23A 4H6EA 1JAKA 2WLZA 1WZAA 2RHGA 3IGUA 2FMNA 2GK1B 1M53A 4PUDA 5GNYA 1KQZA 1OD8A 1UBPC 4ZOEA 5HMSA 4CQAA 4QBXA 5HNUA 4EF8A 2W63A 1JJKA 3H12A 4H8UA 2F2HA 2Q6ZA 4F2TA 3B9DA 2ACQA 1ZFJA 1LBFA 2UY3A 2WKGA 4JFUA 3VC5A 1ZJBA 2OEJA 1UZ1A 2UV8G 4DXVA 1HJVA 2BLEA 3IUIA 2YL5A 2WHKA 3R6IA 4GD0A 4QS5A 4WOZA 4JNMA 3VKKA 5LNVA 4I5XA 2BFGA 5J5RA 1A50A 2DDXA 1CGUA 2ZRWA 4D1JA 2YCIX 4DBEA 1R86A 1WUEA 1EZWA 2GUYA 2ABBA 4GZ7A 2EQDA 5I77A 3QMRA 4MJ4A 1K03A 3STEA 3C5QA 3H21A 4QM1A 4LVAA 3EX6A 4LUTA 2V30A 3KTSA 2YZRA 3VO0A 2WZHA 4B3ZA 3GU9A 4YWSA 2X8RA 2CITA 1CXEA 3UZZA 1TPVA 1K77A 2WVTA 4OQVA 2IMRA 3BL3A 3WZ0E 4AZ6A 1NQ6A 5DFAA 5H6HA 4J3WA 5TQLA 3QPEA 3UY7A 2WQDA 3AMCA 3MUZ1 1TSIA 4RW3A 3DFOA 1B90A 3KS5A 1E1EA 3LG3A 4AY1A 2G3MA 5HNTA 5M17A 4MDOA 3M4HA 4FR6A 3N12A 1DIDA 4A21A 1UBSA 3DYOA 3GXMA 3CHEA 3E96A 3QM3A 3LHYA 4FNRA 5I3KA 4AXNA 5ABTA 1AA1B 3ME3A 4K7YA 1XRTA 3W87A 4DIAA 4PSRA 3W24A 3TV8A 2CBJA 1DOSA 1ZENA 3VIJA 1TV5A 1RVGA 1VGAA 3OQEA 1GOKA 3MV01 3TTYA 1G0CA 4A2RA 2OZ8A 3VKBA 1AQMA 1MFUA 3KOYA 3UXIA 4N6EA 2OTDA 3FHAA 3UP8A 3OG2A 3NL5A 2FHCA 2WSYA 1RJQA 4NJIA 1NWUA 3WNPA 5KMYA 5D4YA 2KZHA 4DJDA 2VC9A 1J01A 2C79A 3AMDA 3B4UA 3AJ7A 3WK1A 1NDZA 4FF5A 1E3XA 4A6GA 5D04C 4MJ2A 2AQWA 1DWHM 4O8RA 3R0UA 4TR9A 3DYPA 3UFYA 2VMFA 3AOFA 1CDGA 4C7GA 4E5TA 1U5JA 1MWOA 1GWJA 4R85A 1JUEA 3RRXA 4NYYA 5LZLA 3WQPA 1G4EA 4Z42C 1T8XA 2PC8A 3BLEA 3QVQA 1WAUA 4KWVA 3W02A 4M24A 3H7UA 3TWBA 5KTLA 3ATZA 1ZAIA 1OINA 3HQNA 4IX2A 5KINA 4QITA 4I9TA 2G41A 4JICA 2E68A 3ALFA 2PU1A 1FWCC 1EUNA 1XUZA 1TTPA 3HV8A 1H7PA 4XAYA 5CC6A 1FCVA 4PUKA 3VOGA 3TYCA 1KBLA 1XXXA 4HMCA 4ATLA 3W2LA 3MSGA 1BKSA 1YBQB 1QHOA 1KTNA 4JN8A 4GJJA 4CN1A 4MLJA 3NDYA 4QG6A 4U31A 3RCNA 1QOQA 5CJ5A 4ZVJA 3G3DA 4HCLA 5LNSA 3W73A 1QWGA 3E5PA 2REQB 5DANA 3VKCA 4C5ZA 2WKLA 2PGFA 1QT1A 1G9HA 2WCSA 1TPB1 4YXGA 1SVDA 3OHMB 1Z44A 4L4PA 4PTDA 2G3JA 2C7FA 1EHNA 1JGIA 3TEVA 2X0YA 2GDQA 3LPOA 4LRSA 3SGUA 3TTQA 3PC0A 3LCXA 4WK9A 3I6EA 3N2MA 5CLTA 4QNEA 1IQ8A 3AU6A 1MXDA 3TYBA 2XIMA 2WOQA 3LHWA 1TQJA 4UNKA 1M03A 4EWND 1XLGA 1ZBKA 4HCDA 3VCCA 2W5FA 3B8VA 2XFWA 3DZ1A 4O1EA 3CAQA 1UJPA 3GDRA 3DDMA 2PTZA 4Q6XA 3FEQA 3M1ZA 4XZ9A 2VUNA 2Q09A 4AY7A 3QC3A 3M0LA 3BTNA 4P5UA 4OBRA 1G69A 5DLCA 2ICSA 3RITA 4XISA 4D6HA 4RKAA 1TV4A 3EWZA 4XSLA 4G5DA 1DJXA 3ID7A 4GUGA 3N6HA 3LM3A 1RH9A 4MZ8A 5LNWA 5K9DA 3VM5A 1LROA 3GFZA 2FPTA 2X2YA 4QNWA 1XS2A 2PDKA 2Y8VA 1ME7A 4DX3A 3ZR5A 4REQA 3BW2A 3W7KA 3W7HA 4UTFA 4K2SA 1OC5A 2GGIA 4KW2A 1C8XA 2FDSA 3EXRA 1Q7ZA 1HL8A 3EWXA 4PA8A 2YBUA 4QR6A 4XZNX 1RUSA 2DU2A 3PJTA 5JIPA 2VRJA 1LZOA 3EB3A 4HMNA 1MW0A 1AJZA 4CVUA 1XYLA 3VD5A 4JL1A 2CZVA 1TRIA 4M81A 1OT1A 2NQ9A 4JFSA 3H7VA 1YXCA 1H0IA 1KD0A 1H5VA 3NM3A 4FP1A 4A3RA 4L4LA 3LCIA 3MUXA 4NILA 3R4IA 4KCWA 2YCEA 1EO7A 5FL0A 4P7NA 2YZ5A 4YLWA 2OSXA 1KFWA 1E9LA 1W6TA 4MNJA 2NT0A 3K13A 1OX5A 5MKGA 4Q7BA 2BDQA 4GMEA 3VTRA 2Y7GA 4HPNA 4ZQCA 1LG2A 5AHIA 1JI1A 1M7XA 5GNZA 2X05A 4JZ5A 3L2MA 2E1WA 4LU0A 3MI6A 2ZXDA 1DJHA 3ABRA 1KQYA 2XGBA 3QGAC 4TUFA 1GUVA 4DF0A 3BCDA 1T96A 4CUCA 3XISA 2I1OA 1IWBA 3CLMA 4DLFA 2CXGA 2PTWA 1P0KA 4X9SA 4JAWA 2Y7DA 4Z1DA 1ESWA 4PGLA 3TN4A 2OEKA 4Q4MA 4J3TA 3RLGA 6CGTA 4TMBA 3W9ZA 1TG7A 2WPBA 3T55A 3H8AA 3MTWA 3RHGA 1LP6A 4GX9A 1ZJAA 3RJXA 3W7PA 3QY7A 3WBXA 3GH5A 4HJFA 5D03A 3WMSA 1MDRA 4V1YA 2P10A 2DQXA 1W9XA 3NQ8A 3QYQA 3QTPA 1CT5A 3PS7A 1EKOA 4RW5A 5IHRA 4A8IA 5AC7A 3C6CA 3FYOA 1KWGA 4AD4A 1TPUA 5M3WA 2IKHA 3L66A 3W01A 3LCHA 3VFLA 2ZX5A 6REQB 4DJDD 1W3KA 5CPTA 4PMJA 3P80A 3UT0A 2X1TA 2Q02A 4DN1A 2PI6A 1V6TA 4E4FA 5D9MA 1Y8BA 1LT7A 2H3DA 1ZAJA 3R2GA 4LVDA 1KR0A 4LC8A 2XFYA 2G37A 3HTWA 3KHJA 1FY6A 3I68A 3OGVA 2PDUA 2CIPA 4Q8WA 2A5HA 3H4GA 4PUEA 3MQTA 2WMGA 1VH7A 1QNRA 4OJYA 5H8MA 2V81A 3AYRA 1ZNNA 2DV0A 3PBWA 1FWGC 3VFCA 1KM4A 5LNRA 3M43A 2HISA 5CLWA 3NO1A 4LV4A 3T8QA 4UNLA 4WGXA 1DXEA 2H90A 3ZJ6A 3WIJA 3P7YA 2DSVA 1XJBA 3LXCA 4TO8A 1ITCA 3UR8A 3M16A 1GW9A 4WOQA 2X1UA 2PGEA 4GQGA 3B4YA 4PUJA 2QCEA 4QE1A 4E8GA 3I10A 1V4YA 3CUFA 2E9BA 1TELA 1B57A 4LJ3A 3H7RA 5A2AA 2ISWA 3W4RA 1EJVC 7REQB 1F3WA 3TROA 4XZLX 2B0MA 4GKLA 2QVHA 1YXYA 1XLHA 1VYRA 5G5IA 3AIRA 1J0IA 1POKA 4S2BA 3CC1A 1TRDA 1I0DA 4Y9PA 4QJ1A 3SM0A 1OCBA 1W5OA 1OFEA 2O7QA 4WX2A 5BRQA 4QP0A 1PHWA 2PDYA 2Y8KA 1JQVA 3W1QA 1M1BA 2GQ3A 4KRZA 3WH5A 2PD5A 1WOBA 1UH2A 4GZJA 4F0KA 1MEIA 5CH9A 1IXQA 3B0UX 1H60A 2YW3A 3IIZA 3GNDA 4GUIA 4S3EA 1I45A 3UXDA 3VDCA 2QCNA 3MDUA 4C6FA 2PU0A 1OGSA 1OSEA 1IT0A 4HYWA 3GFYA 3GDLA 2R8WA 5ABEA 4JPGA 2ZX7A 1SPQA 5HWJA 1FWNA 1W1B1 3Q67A 1NQKA 3T08A 2FVKA 1W8SA 2GJLA 4LBRA 5DMMA 1UP3A 3NL2A 1CXFA 3VIOA 3S5NA 3U5YA 3GHSA 2CLKA 3CUHA 2PTYA 3WN6A 2E5BA 3D5HA 3UY8A 1JCNA 4GK8A 3AIBA 3W6YA 3CO4A 2QJJA 3AQUA 3PZVA 2EO7A 2Y85A 4QCFA 1QUMA 4A3QA 4OWGA 1X7IA 3AXXA 1OFRA 3H2AA 5FJRA 3AUJA 1RAKA 4JQ2A 3M07A 1EFZA 1VCGA 4UMAA 4Q4PA 3UWUA 2HNEA 1F6YA 1MYRA 1RSCA 1LYXA 2Z7KA 3WNKA 1A5AA 3H23A 4J3UA 1TVPA 3ZJ8A 4PMDA 5GPRA 3DI1A 2A3CA 1PKNA 1GORA 2VD8A 3TFXA 3WK0A 3TSMA 5FF0A 3NQDA 3AZRA 2XGIA 4EPEC 2D73A 4GY1A 4L61A 1LBLA 4DWSA 4KETA 1DWGM 2E40A 3TU9A 1XLFA 3ABSA 2CKRA 2OKOA 1E15A 2UY2A 2BGQA 1JRCA 4PZVA 5FEXA 1YTKA 2QJHA 1E6SM 4CD5A 5DRIA 5HXMA 3S1UA 3DUGA 3UD6A 3GSMA 1GOQA 3THDA 1EXBA 2XDFA 1JGMA 4ZFMA 4X9YA 2OWWA 1QK0A 2YA0A 5C9UA 1BTCA 3Q37A 4Z1CA 3B8SA 3FY1A 7ENLA 2YW4A 3LCFA 4HA0A 5FF4A 4C1KA 1UWUA 2GWNA 5A5WA 3WF2A 3BAIA 3CAVA 1RQBA 2G97A 3U2ZA 3W1RA 2CBIA 5C0QA 4Q4RA 1KM0A 3ELFA 4QCEA 4DYJA 1EYWA 3GW0A 1U2YA 1GOWA 3LLDA 2Y6ZA 1YNPA 2YL6A 1E1FA 1R7AA 1W0MA 3G6LA 4NYUA 4EVZA 2R1LA 2NUWA 4QE4A 1KBBA 1B3ZA 1WA3A 1GKQA 3NCOA 1EGMA 2IQDA 1LQAA 4H9TA 4YCPA 1ICSA 4MB5A 3ZT7A 2I14A 2XN1A 2NXIA 1KTBA 3ARQA 3HGOA 3GXIA 2C71A 4Q4QA 3EPOA 2WXDM 1E51A 4FEZA 2Y70A 1B5TA 5TD4A 3H26A 5K9CA 3LSCA 1DJQA 1M6JA 4JFTA 5B7YA 1G6CA 3GNNA 1L0PA 2YSWA 5I23A 2CC0A 3MKCA 2DIKA 2D3NA 4ACZA 4AIOA 3CV2A 5LKYA 4GINA 3ALGA 1P0DA 1KM5A 3OLGA 1L6YA 4A8LA 3S46A 3IJ7A 1IEXA 1IXNA 3H2CA 2E6DA 1U30A 1YNQA 4ERAA 4NAFA 4JFWA 2WZTA 2QJGA 2GJRA 4NXKA 3SJ3A 4ES4A 4DQWA 4IQEA 1HXJA 4NRSA 5XIAA 1UR8A 2OG9A 5EGRA 2CLLA 1HGWA 3WQWA 1GQIA 2X7VA 4WDUA 4U5IA 2C16A 5AN7A 3T2PA 1PHQA 5AFDA 4UTUA 3MJMA 4A4AA 2VOMA 4HNOA 1OIFA 3AYSA 2H3BA 3TCSA 2YBVA 4K37A 4GUJA 3G0SA 4HD5A 5EMJA 3QTGA 3CZKA 1O6IA 5C71A 4O13A 2VYOA 2DZAA 3FYPA 4HK5A 2ZYFA 3UWEA 3GVVA 4RUBA 1Q63A 2RGMA 4HN8A 5EMMA 1B2YA 1EUAA 1J4EA 2DIJA 4IGHA 3VD9A 3O15A 3KBNA 1SSDA 3C0LA 1TZZA 3NR0A 2J78A 3G1DA 3RLHA 5JIWA 2DZPA 3PF3A 3PUGA 4O57A 2BASA 1Q6GA 1V7AA 3M44A 3S3GA 2PWGA 2Q3RA 3AALA 3CO8A 6ENLA 3AIQA 3AZTA 2WZIA 4HQVA 3SRKA 1NARA 3T44A 2ZZ5A 2W3ZA 4P7OA 4AHPA 4BEQA 5CZSA 4TX8A 4JL2A 3GDMA 5CZKA 4R9OA 2O9TA 3OA5A 3DG6A 1YPIA 2E3ZA 1VBUA 3CL7A 1ZBVA 4X60A 1H1ZA 1LT8A 3GU1A 3ZSSA 3P5ZA 4IMAA 4DXKA 4HOWA 1PIIA 1J12A 4R88A 4LANA 1FFQA 2PCEA 3TWAA 1HJQA 1KV5A 1X6NA 3SRDA 1F8IA 3EOUA 1OY0A 1MW1A 4WXYA 1E40A 2EJ1A 3NG3A 2AMXA 3B9OA 3MKVA 4N02A 4OV9A 4UTLA 2HXTA 5D2VA 1OVDA 5F1UA 1JPMA 3S2LA 3LS9A 2ODOA 1HKMA 2WWDA 1XP3A 1V6YA 1L9WA 5BXTA 3RO6A 1A5LC 3MI2A 5CPNA 2HRWA 3UG3A 2H8ZA 4QFUA 3S83A 4DB7A 4B3LA 1J6PA 4QXIA 1CTNA 3W1UA 2NLIA 1JULA 4LUSA 2G0WA 3EDJA 5H91A 3ZYZA 4AAJA 1UD2A 1FWBC 4XBKA 1EL3A 1ZPTA 3CZ8A 4AWSA 3NQBA 3OBAA 4FLOA 3PJXA 3EZ4A 3BCFA 1IZCA 4X2PA 2NLYA 1O66A 4CKQA 3R13A 3NA8A 1Y5XA 1A4LA 2O7SA 4DWSD 3WY1A 1H5YA 4IP7A 3LGDA 1W56A 3ES8A 1QHZA 4RE0A 5D8WA 3G0UA 2OU4A 4PMVA 2WC7A 3I3BA 1P48A 2XVLA 3L4YA 2ZUWA 1JYNA 1R85A 4RNJA 1WDPA 2WJZA 2ZXBA 4MWAB 3MUIA 3LSBA 3IANA 5FAJA 4HTBA 3W81A 4P8VA 1QK2A 2C13A 5HBFA 1W3TA 1SYTA 4M5PA 1E6ZA 3PANA 1KM2A 3TJ4A 4BWLC 3BOFA 2J7GA 5RUBA 5G1YA 2YDAA 1IEQA 3W7IA 1FCQA 2QDHA 1MNZA 3BLPX 3PZGA 5H8UA 4GI8A 4GJ1A 3HN3A 3O6AA 4GH3A 4UXDA 4AZCB 3NPWA 4JIHA 5EFDA 3W82A 1V7YA 1ADSA 3FVMA 5FJIA 1TVNA 3FLUA 1B3YA 1MSSA 2MNRA 3APGA 2VC7A 5A69A 1KC7A 1NH6A 2QAFA 4GRSA 3BW3A 4CQDA 3LMYA 4W8BA 3N25A 2DVTA 3RUBL 4L65A 5LIWX 4ZR8A 3QOKA 3L21A 3W1AA 3GVGA 2WNWA 3VVGA 4KMQA 2QIWA 4JTHA 3MPGA 1P0BA 2X1RA 2PDLA 1UWRA 3BGJA 1EEXA 3A9IA 1W3JA 4BJHA 1FDJA 1SW7A 3WNOA 2C0HA 1SZRA 4C1NA 3W53A 4E4UA 3UVAA 3TNOA 1JCMP 4F2BA 2DZWA 1CB2A 1Q6LA 4HTYA 4AC1X 1KRCC 1G7UA 3GDTA 3EPMA 1XLBA 4HNTA 1O1HA 4O0QA 1ONEA 5D30A 4YJ5A 3EOOA 4P8XA 4XZMX 3ABOA 3UZJA 1OWQA 4W7WA 1SJAA 2PWDA 5FAGA 1B9BA 3TN5A 3UCQA 1W1VA 3JU2A 3GHUA 1TQXA 2Z26A 4D8LA 1EP2A 1FHUA 1UA7A 5I24A 3NZGA 4LB3A 3PAOA 1US0A 1JDAA 3U7VA 1J11A 2BGSA 1O5XA 2C15A 4L6DA 3G1HA 3VNMA 1SFTA 1BF6A 1S5NA 3OBKA 4O12A 1MZRA 2PTDA 3FCPA 6TIMA 1AD4A 2CZDA 2V5DA 2QPXA 1EWEA 3QZ6A 4WKHA 5F2MA 4C90A 4WDTA 2JK2A 5FA5A 2WV8A 2Z2AA 2R1MA 3VGDA 5CPMA 4Z17A 2ZA2A 4ZQNA 4D1IA 3QPZA 4HNNA 3APYA 3HQOA 3AXKA 5A2CA 3EWUA 2PDQA 2WVSA 3MWCA 1A5SA 4ICMA 1ZL1A 4PC8A 2ZA3A 1VEPA 2I16A 3VNKA 4LS0A 2Y7FA 4YTUA 3EEZA 3S6OA 1W31A 2QCDA 2ZA1A 2QPUA 4JQAA 4AEFA 3OZOA 2OQYA 3DBPA 3SUWA 2ZC8A 1Q6EA 3L5AA 4MPKA 4YTTA 3UXKA 1W54A 3HPSA 3H4WA 1V3JA 3VNZA 2PLJA 2RUSA 4BWLA 1Z3NA 1OFBA 2DGAA 4HVXA 1K8CA 1QBAA 3LTYA 2DORA 5I7GA 1WAWA 1AQ0A 5HINA 3O63A 2ACRA 4M6VA 1ZJHA 1OFOA 2QT3A 3E3HA 1IXOA 3GRIA 2WLYA 4M29A 2D0HA 4RNHA 5HNRA 4AIUA 1VCFA 4AZBA 3KAOA 2YBTA 3N1AA 4HZMA 3JZUA 2AQVA 3CHVA 1XIEA 3GNXA 3BARA 4ZXLA 4L6HA 3FAXA 3CTLA 1Z69A 1X1OA 5C54A 3N4AA 3QQWA 4MZYA 4U28A 3UBPC 3MSRA 1WOAA 1H41A 1MFVA 3WF3A 4IFRA 3CT2A 4Q4KA 1ZP4A 3JS3A 3GIYA 4XWUA 1KFCA 3M0VA 3RXZA 4MUZA 5DMLA 1J93A 1TR1A 1TPH1 1VHCA 1IE7C 3AISA 3NM1A 5LA2A 1BRLA 4PTMA 4Q4SA 3GUWA 1V0KA 2PGRA 3AIEA 4CD6A 1PX4A 4CEXC 3VMOA 4B5WA 3SCPA 1X6LA 4BHYA 4M0XA 1UROA 4R9XA 1WDWA 1I2PA 1FUYA 4J3SA 4JR5A 4LAUA 3R11A 2PDJA 3I6TA 4D9PA 4AZIA 3OIXA 3LGEA 1ME8A 1H1NA 3WDJA 1L6GA 2XSAA 4L7ZA 2OLSA 3AMGA 1XDMA 3W1LA 1BVZA 3F4DA 4AH7A 5ABFB 2VDIA 1P6BA 1DYSA 1NEYA 1VP5A 1XYFA 4NG3A 1XDLA 1SSGA 3W1PA 1KXHA 2PLCA 2PRMA 1LLZA 3W7DA 2QKFA 1DHKA 2POZA 1K3UA 1GOXA 3T7VA 3IJLA 3QQ0A 4HN4A 1UR3M 1ADDA 3R1ZA 3RMJA 3TTSA 4HP5A 3W1MA 1VBHA 3WQEA 4K38A 4AB4A 2FZNA 2EJAA 4UQ9A 1I2OA 3DOPA 2E5DA 2VQUA 1T8QA 4AD5A 4Z1BA 1N82A 4AIBA 5LA0A 5GJPA 1I0BA 3M0ZA 5F2GA 4HBKA 1ZGDA 1H4PA 1FH9A 1EJRC 2JKPA 1YKWA 5G1MA 1DQXA 1SO5A 3VNIA 4E8DA 3VGHA 3B04A 4YN5A 1E6XM 3WQVA 4HCHA 1VCVA 3JW7A 4BF5A 3NPXA 1OADA 2BXZA 4LEQA 2GK1A 5CGMA 1V3KA 4H7ZA 2CERA 4C6BA 1NDYA 3L2LA 2WKJA 5I2UA 1TA3B 3RYSA 4MY8A 3HPXA 3WD4A 2XZ9A 1OC6A 4BEUA 1V0LA 4XBJA 1O94A 4HU8A 2NQLA 1BQGA 5KEZA 2HS6A 4S3FA 4IISA 1XCXA 3WLSA 4JN7A 2GPTA 3S2MA 3ARYA 1CZ1A 6A3HA 4B5VA 1CGXA 4XUYA 2ZE3A 1O60A 4CLMA 4KFOA 2Z1SA 3LDVA 3PZUA 1PIGA 2QIIA 3RGTA 3G1FA 1S2CA 3TZNA 1TO3A 2QCCA 1GEHA 1OF6A 4GFSA 3CB3A 4PMXA 4IX0A 3HV9A 3CPUA 3GTNA 1YPFA 1QI5A 3L2IA 4XO6A 1JDFA 1L2UA 4ADSA 2PB1A 3M0IA 1UR4A 5TF0A 1E0XA 2WHMA 2NQ5A 1CBGA 3EMCA 1HL9A 4ADUA 1J0YA 4XBSA 4J4KA 1ZRQA 1PSCA 5M2FX 2DZVA 1Z9AA 4EACA 1BSIA 4NZ5A 5HDRA 3T0CA 1I8JA 1QNQA 3LGGA 2Z4GA 2IKIA 2GGHA 1AVAA 4P8UA 4IXHA 3PZIA 1XLDA 2V8ZA 2QNEA 1EA0A 1RJRA 1QPRA 2XIBA 3DYMA 3HZ3A 3SCTA 1DTUA 3PP7A 1AJ2A 4ZE4A 3EYPA 1MRQA 2KX9A 3SO7A 2A7RA 1GONA 5FJOA 1IEWA 1YNYA 5H8PA 3B40A 3QHOA 1RHCA 1S5WA 5E0CA 4C65A 3H2EA 5EYWA 3TJIA 3MYPA 2PF8A 4JOMA 1W2PA 3GY1A 3ENLA 1NFBA 2DSUA 1GOIA 1BGAA 1EX1A 3DFHA 1EJTC 3VD7A 1LL7A 1MDLA 1XSKA 3ARTA 2WWCA 2OSYA 4K8EA 2XVKA 3WLHA 4OBTA 3P74A 4K3ZA 3TC3A 3TAKA 2Z2BA 2YOCA 3PBUA 1I60A 2FIQA 2FPVA 1SQ7A 5DMYA 4G7EB 5T9BG 1XBYA 4FI4A 4FNSA 5FL1A 1RY0A 1UA3A 3BUVA 5I3IA 1AL8A 1TCDA 1BLIA 3W88A 1XBVA 3WJSA 2OKTA 3E6EA 4MG4A 3DIPA 4WSJA 3MMDA 2F6UA 2OT0A 2VURA 3NWRA 2HE8A 1PKMA 2ZADA 1HP5A 2DPEA 4IHCA 5CSYA 4FXRA 4X61A 2E6AA 4MYAA 5M1TA 4Z2IA 3VNLA 3HM7A 5T91A 2Z1KA 1PCWA 3SCWA 4W8LA 1EOMA 2V3DA 3C0SA 3P62A 2UZ9A 1XHGA 3K2GA 2EXOA 3WD3A 2HVNA 5AYZA 2PEVA 3C86A 1WZMA 4JQ4A 4ML4A 2W6RA 3CZGA 1PX3A 3MSYA 1DJGA 5BNKA 4BKNA 4JY8A 2ANUA 1L6WA 4ZMGA 1GVFA 4GIRA 1KGWA 3E0VA 1OX4B 3PTQA 2YPIA 1D2KA 4PTVA 3R10A 3V0TA 2HWGA 3LMZA 2VFDA 2X09A 3PZ9A 2HTMA 4HIBA 3DHDA 3EOLA 4FB7A 4KCUA 2R94A 1JI2A 2E67A 4H19A 4N4QA 2HK1A 3SY1A 1K02A 5CC7A 1A3WA 4RK8A 2V5CA 2INFA 4ZODA 1OYAA 3CV1A 5I5RA 5JUVA 3GM8A 4HSOA 4JTTA 1GJUA 4AD3A 3ECQA 1C3FA 4CVWA 3PWGA 4AY8A 2WVVA 1VD6A 3I3DA 4IJBA 1UD3A 3CQHA 1H3GA 4WJEA 3W86A 4FXFA 5BYWA 1GEQA 5AC6A 2QW5A 4A2SA 4H9YA 4HK6A 1GKPA 3WFLA 1PUDA 1FWFC 3SEPA 1KRMA 1QI4A 1A47A 1B1YA 2WQPA 4AVOA 2OZ0A 5J8LA 4ICCX 1TUFA 4GE8A 2HROA 1I1WA 1LOLA 3CK5A 3LD5A 4I7WA 3UCDA 1DXFA 2YL8A 3LCWA 4U10A 1GVQA 1VYSX 2DH2A 2R1PA 1H61A 4J27A 2XJ7A 3SURA 1NY1A 4JCMA 3RM4A 4LBUA 2QXWA 4CEUC 5DELA 2EPNA 1UW9A 3NGJA 2QV4A 3UJSA 3HGJA 1OYCA 4KWOA 1GHSA 4YYFA 1KFKA 3EMQA 5A8NA 1N2VA 4Q4OA 2GDUA 3EX1A 3P82A 4TV6A 5EFFA 3KBMA 3FVDA 1XR2A 4GACA 3WJYA 3T0AA 4WDWA 4GCXA 5LHFA 1KM6A 4PMQA 3VX0A 1KM1A 4PMRA 3B8IA 3GKFA 1JG9A 2JKEA 2V6AA 1LRTA 4WXZA 3NVTA 3VNJA 2X16A 4NZ3A 4C6IA 2FDMA 3TIMA 3ZLHA 3T09A 3OU8A 2NZLA 1I2RA 4R34A 2WB5A 4BK9A 2Z24A 3A3XA 1X38A 2J27A 4D6EA 4NF7A 4QX4A 1IEVA 3U8GA 3N17A 3BMWA 5D2XA 4WIWA 3QV8A 1TPC1 3R7MA 2YX0A 3MP4A 2WHJA 4LY4A 3RU6A 4BQ3A 1TCMA 1Q3NA 3URBA 3RG6A 4LW7A 1PWMA 3AIWA 1JPDX 1KNWA 2VJXA 3IIXA 2PA6A 3G22A 4CQ9A 2E0PA 1VLWA 3MP3A 2ZZ6A 4ATDA 4F48A 4AWTA 4AFYA 5T9CE 3A22A 2JGYA 3EX2A 4UBPC 1KTCA 1EPVA 5CG7A 1H1YA 1JXKA 4MWAE 1H7WA 2YDSA 4MADA 1VFMA 3SY5A 4JD4A 3SY8A 3UG4A 3U48A 3ISIX 1JNDA 4ZE5A 2BHYA 4MAZA 4PN2A 4KWUA 3MCOA 4DZAA 1A53A 5DT7A 2WNQA 5A95A 2W62A 4JIIX 1X39A 5HPOA 1GG0A 2QCFA 1S2TA 2DSWA 2PDFA 4FIRA 1HO1A 1R30A 4XK2A 5CPSA 3MI3A 3G5EA 1VS1A 4XX6A 3SR7A 1WCGA 3IVUA 2HNHA 1NOWA 4O15A 1P43A 5C9RA 1TPDA 4PMNA 2HDJA 1C90A 4L1GA 1K9TA 1P7TA 3C2FA 1KKOA 1IR2A 2Y24A 5JH2A 2P0OA 5BWFA 2C3ZA 2J6VA 1ITUA 1BHGA 1UIOA 1UKOA 3BICA 4CNOA 2WMFA 1DL3A 1EX5A 1OF8A 1CENA 3WLPA 1XH2A 3UXLA 5CCZA 1ICQA 4D8AA 5LA1A 2PTXA 1QI3A 3I7SA 1MZHA 6REQA 5AHFA 3LERA 2GVJA 1W5NA 4QQUA 4F9DA 3SRFA 4GYPA 4X3ZA 1OK4A 1HKVA 4ZGYA 4Q8QA 1CB7B 1JQXA 2CLOA 4JHZA 4EPDC 3BLIA 4IPPA 3ERPA 1LQ0A 3DHFA 3FYYA 1JR1A 5CPOA 4DJFC 2JIEA 2NX1A 3H4XA 3WMBA 4G1NA 3HF3A 3GR4A 1ZHAA 1LWJA 2VEMA 2BBFA 3TFCA 4LUYA 2NVCA 3BOXA 5LIUX 2PRHA 2ZVRA 1JAEA 2NSOA 2DUAA 1KA9F 1BXNA 1XLEA 4GZIA 1BQCA 1N8WA 1R3RA 3DKLA 5GJNA 1QO5A 4H9VA 1YDNA 3LXAA 1DJZA 1YPXA 1LRQA 1ZBCA 1L8NA 1ZLPA 2VZTA 3AAMA 5BWAA 4NAEB 1K8ZA 1IT8A 1VF8A 2G50A 3RLVA 1FA2A 4MUPA 3BANA 3T78A 5CXPA 5JQ9A 5IHSA 4QEHA 1WDQA 4I9JA 2PWHA 2R91A 3PZTA 4D6JA 1ODZA 2JFEX 3SDOA 1OC7A 1ZUAX 3Q58A 4WHBA 2XN2A 1QW8A 3B0PA 4XAFA 3TKFA 5CAKA 1DJIA 3PBGA 4S3JA 5I00A 3HQPA 4AX7A 1XWYA 3DEQA 2XSBA 3BH4A 3KCJA 2Z1WA 1KB3A 4LY8A 3CAKA 4IIFA 3I4KA 4IPNB 3MANA 4XTIA 2WCAA 1CW2A 1TVLA 1XYBA 3HU7A 5I3GA 2QHAA 1DBTA 3LM7A 5I07A 3SFKA 4XZHA 4GUHA 3OYZA 5HR6A 1OCJA 5C55A 5JH1A 1H7NA 2R24A 4JKKA 3MVIA 3QGVA 1Q65A 3G77A 3EA3A 4FO4A 4N9CA 4CCDA 3TQ0A 2OOFA 2VVNA 3OYXA 4WDXA 1HQTA 3IVSA 4FMVA 4TVUA 3L0KA 3QRHA 3NQCA 2J8TA 1CEOA 1BF2A 2BXYA 1WZLA 1AZ1A 5KITA 1XYZA 4HSHA 4B90A 3MMUA 3QF0A 3CZEA 4OGZA 4XZIA 2ZBTA 1HGYA 3J7HA 1CWYA 1OK6A 1GZ1A 5U4NA 1C7SA 1G94A 2F84A 4CD8A 2QS8A 4X0VA 1S39A 3GS6A 1UH4A 5DCEA 1ODUA 1SJDA 4TOQA 4D2JA 2VUYA 4V2XA 4EP8C 3EKGA 1LTDA 1MI3A 3KCOA 1LL4A 3RRAA 1W91A 2ZRYA 1UD6A 3UJ2A 4FX7A 4B5UA 1O12A 3DH7A 3MDWA 2H9AA 4QG9A 4JHMA 1A5UA 3MS8A 4XKYB 2C6QA 2OFJA 4YCOA 1F61A 1BG9A 3IGSA 4UOZA 1JDDA 4O19A 2PWUA 1U5VA 1RCOB 1RPXA 2VGIA 5HQLA 3FEMA 3V18A 3WQ8A 4UQDA 2NVAA 2ATMA 3PPCA 3SUTA 4DJFA 1FP9A 3OPSA 1GQNA 1XKJA 1Z8AA 3UQNA 1RA5A 1SFSA 5A1AA 3MT1A 1PDYA 3S6TA 3MV11 4YWIA 3LHUA 4NNCA 1V93A 2E6FA 4GG9A 2FZBA 4O1CA 3MW7A 5ENLA 4NNBA 3UG5A 3M0KA 3A5VA 3R58A 3S2NA 2EKCA 8CGTA 1J0ZA 3E49A 3LZ5A 8A3HA 1UD4A 2NUXA 4DO6A 4DM2A 2H6RA 1SZFA 3BXWA 4OOZA 3O7UA 3VCNA 1LWHA 1JYWA 4OBSA 3URNA 1Y5VA 1YIXA 1A5CA 1TWSA 1WXJA 4HU0A 5A6BA 3VOJA 1W5MA 1V3LA 3C3UA 2BOGX 3CTTA 3TTEA 1QVBA 5I3JA 4ZSTA 3TMLA 2D0FA 1UOKA 3BAWA 3E74A 4AZ5A 1R3YA 1XIHA 4AZ7A 2P3EA 2W66A 1VBRA 3TTOA 2BY3A 4BZYA 2EG6A 4C6NA 3VK5A 1GTEA 1OZQA 3AICA 4IP5A 3RM9A 2YGYA 1FWTA 1IV8A 2J9XA 5EMUA 3I7RA 1R7OA 5XIMA 3CQ0A 1RP9A 2W61A 2Y7EA 1XSIA 3GO2A 2VEFA 2D2HA 4GISA 1VJZA 1MXGA 3GYEA 1R3VA 3CMGA 3WDIA 5CZJA 2OZTA 3W70A 4PSPA 3B9NA 4D6FA 3WLJA 2ISSA 4IJCA 3P84A 5HMFA 1VBGA 2MANA 4GUFA 2BV9A 5DO8A 1FBAA 1VPXA 1VPYA 1G4SA 3GK0A 2DP3A 3VE9A 4GIEA 4GJIA 4D6IA 1UQZA 2P53A 1TIMA 3GTXA 2JEPA 3SQLA 4EX4A 1S5VA 2VQTA 1BTMA 1WXYA 3L12A 4HMEA 1PL9A 4F0LA 1XLIA 4GNJA 1MUWA 2XTKA 1K6AA 3NEHA 4GQQA 1SW3A 4OZOA 4BA0A 1B4KA 1ISZA 2R1KA 1PAMA 2F6KA 3AHZA 4UIOA 5AYBA 4LYPA 5G4EA 2PE4A 3AZSA 3HURA 4WCJA 4HHMA 1ISWA 4W4QA 4X22A 3GIPA 4IIDA 5EA9A 5GJMA 2ZZ3A 1JEZA 4J3XA 5F4WA 1YHTA 1WUFA 1OG6A 4W89A 3RU8X 4DVOA 4RE3A 1LUCA 5K4ZA 3T2OA 4O17A 3EDFA 1W3HA 3PHAA 4K8GA 4MYXA 2C14A 2VWSA 4B5XA 3PZNA 3U4FA 4AG0A 4O28A 3IVTA 4ZCWA 1R87A 4CQBA 2OWCA 3NZRA 3PR2A 2ZFAA 3TR2A 3FNDA 3STGA 4LTSA 3KWXA 2O4QA 4Q8TA 3W26A 2J7BA 3MB9A 4FLQA 1Q66A 4M19A 3IJDA 4F4RA 3WJXA 3SN1A 4JQ1A 2GDVA 1AW1A 3SSZA 1OEPA 4OECA 1W9UA 3VILA 3B8DA 1B3OA 3N6JA 3SCQA 1Q2RA 4Q8MA 1N8FA 1TZ7A 1PYMA 1HZYA 1VRDA 2JF7A 4Y8FA 4CN6A 2ZWYA 1ZBWA 4LS2A 5LIYX 4DELA 5AZ1A 4DI8A 3MC5A 3JVAA 4U3CA 3WH6A 2VTFA 3OVGA 4ILSA 3H2NA 1HG3A 3F4WA 2WBGA 3RCMA 3W76A 1Z6KA 3H6OA 4LNCA 1W2VA 2VR2A 3SFWA 3OO2A 1V08A 2PSNA 3NQGA 3VKAA 4H6QA 4NZFA 4XAPA 1KCXA 3O0KA 1E71M 3ZVHA 3S47A 5CBIA 3ZT6A 1V79A 2ZZ2A 2FFIA 2ASHA 4C1LA 1O5RA 3T05A 4JTQA 1H09A 3NQEA 1UMLA 5EMKA 4PTWA 3BZGA 3GHRA 3SCVA 3BSGA 4IUGA 3N2XA 2O56A 1EGVA 4RNFA 4CNNA 6XIMA 4ZXOA 3W00A 3F4VA 2XWEA 3R8HA 3N15A 2WZMA 8XIMA 1VFLA 4GQRA 4DJFD 2PD9A 2V2CA 2GJXA 3ZWSA 3SGZA 3UA4A 5EBAA 2CETA 3W7MA 4W9TA 2Z28A 1D9EA 3QLLA 1YDYA 4N2YA 3F5JA 4MJMA 2D23A 3L4VA 1RD5A 5MKGB 2ACUA 3O6YX 2Z27A 2F8QA 3S9ZA 3WCZA 4FOUA 5CSRA 1WNOA 1FCUA 1I2NA 3PTMA 1UUQA 2D0GA 4ECLA 5T8GA 5I79A 1PKLA 4C6OA 3ZQ9A 3H22A 3NQFA 4JTCA 3KVLA 4R27A 4NASA 3W2JA 4LVBA 3AHYA 2JBMA 5D09A 1OGBA 4OE7A 4GABA 1E0TA 1WKEA 4U4MA 5A6BD 1ZAHA 3F03K 1XLMA 3MY9A 5FI8A 4WQ6A 3TR9A 3WFAA 1E9YB 4DJDC 5HPCA 3REQB 1XH1A 2QDGA 3M5XA 4OIFA 2TAAA 3PG9A 2OSWA 1UIPA 4L1WA 3GXFA 2NXHA 3VGFA 4JIQA 5D32A 1FHVA 3PG8A 1SZGA 5BOOA 3CPRA 3NGFA 2HVOA 2HV5A 3OQ8A 3WX7A 1QOXA 1AODA 1GYLA 4ZOCA 5D38A 2NXGA 3IJ6A 3WLRA 3K4DA 4J2MA 2PMQA 1EOKA 1Q2SA 4AZCA 2VENA 2RGLA 3TLQA 4J9JA 1V6WA 2EG8A 4JDYA 2FHFA 3OG3A 2P50A 5AVHA 4A8RA 2EAWA 4C6QA 5DRCA 4Z1YA 3W1TA 4XAZA 3N3MA 4PFHA 4US6A 1QO2A 3WL1A 3S0CA 5G4HC 1PZ0A 5SWUA 1XDJA 3GXNA 4G7FA 2BB0A 3YPIA 3OVRA 4O4WA 3IRDA 2QZRA 2HS8A 2GGEA 4FHAA 1XINA 1DKWA 5K4XA 3IACA 3O0FA 4UR7A 1IZKA 4LRTA 3BQ5A 2VXNA 3W84A 4M6PA 2BVTA 3WFZA 5C70A 2NQHA 4E38A 1NFGA 4AYSA 3LHZA 2TYSA 3ITOA 4AISA 1W37A 3FGCA 3A4JA 4Q3MA 1HJUA 4WGHA 4TX9A 4FAMA 1KBKA 2YIHA 4GY0A 4HHHA 4KERA 4B9ZA 4E2OA 1JD9A 3BSHA 2NUYA 2HBXA 3CIXA 3DN5A 1X98A 1EP1A 3F4CA 1Q6QA 2ZZ7A 1XGZA 4XB3A 4J28A 2I56A 2W92A 1P0NA 1K7XA 2QUNA 2ZRVA 3C0JA 3S5ZA 1NVMA 3NURA 5JBDA 3VCRA 3HPFA 1QNOA 4PTXA 4IFKB 1YMYA 3RIKA 3DBNA 3PNZA 3C2YA 2ON3A 3HGSA 1O5QA 3XINA 5FEZA 5AHMA 1J10A 2FVMA 4P61A 1F5ZA 2PDHA 3GYCA 3L4ZA 5REQA 2G8ZA 3L4TA 1F9CA 4UTJA 1V02E 4FA3A 2XIJA 1TWZA 2RAGA 3CMJA 1GK8A 2XUCA 3WQGA 4IQJA 1B3XA 4HSNA 3LI1A 2B31A 3L4XA 3CIVA 4QE5A 4TMCA 4ATWA 1QNPA 2LLEA 3F5KA 4OUEA 4LXFA 3MVTA 4OTKA 3RX2A 2PBGA 3S42A 3Q94A 1VJIA 3KM8A 1ZSXA 1S2VA 3G8RA 2WMIA 2NWSA 4D71A 2IPJA 1V0NA 3GAKA 1Q85A 3KUMA 4L9XA 4FX6M 3N6QA 5A6SA 3B8WA 4DPQA 4HZ6A 2VGBA 3WLLA 3VAVA 3OEXA 4UFLA 4O4VA 4LB4A 2XH4A 4ZL1A 1TE6A 1UUMA 2PODA 1XISA 3MUAA 3LEPA 4O50A 4R7JA 1B3VA 3WQ4A 2D1ZA 1W9BM 5FESA 1F6KA 4XD6A 1LLOA 4RE2A 4GVHA 2EBNA 3CJPA 1VFHA 4UTMA 2X7WA 4GWEA 3EAUA 1KBIA 5MF5A 3WQ6A 4QROA 3GG8A 3LBMA 4H7VA 4H00A 1T41A 4NIRA 1GZJA 2JALA 4UNIA 3KL5A 4DF2A 2VI0A 4HHPA 4A22A 1Q8AA 3DHPA 3FOKA 5FJTA 1XYAA 3DFYA 1W1YA 3E2VA 1QATA 1SUXA 2CBUA 4O54A 4WUIA 3U5UA 3GNPA 2IUZA 3V36A 5FOOA 2HSAA 2P8BA 4EKJA 3NOEA 1HF6A 3U0HA 4BY3A 5HMEA 3N34A 4YTRA 1GT8A 4WLCA 3EPNA 1Y5WA 3VGBA 4ZQRA 5FJUA 4UCGA 3WLKX 1GQKA 1JPKA 4GIYA 1P4CA 3URQA 1E1CB 3MUCA 2B7QA 3LRLA 1ME9A 3TA6A 1NTHA 3BVJA 2XHYA 5E9AA 3ONCA 1MO0A 4I3GA 3QC0A 1M7OA 4E4PA 4Y2WA 1R9YA 2IW0A 1W1ZA 1SO6A 1EIBA 1DP0A 4XV0A 2XFFA 3T1GA 3M5ZA 3KS6A 3VNYA 1VZWA 1BYAA 2FZ8A 1ONWA 1WXZA 3H53A 4PL1A 1HKWA 2WMKA 4IGNA 1YADA 1PZ3A 4JQ3A 4WD0A 3FFSA 3E2QA 3AC0A 4UOQA 1KGXA 3AFBA 1V3HA 3UNDA 1NAL1 3WLQA 3UJFA 2Z0IA 1YW1A 4YL2A 1FXPA 3ITXA 2J66A 4P2VA 1QPKA 3UEQA 2W91A 1HKJA 2G4FA 4KEVA 2FQIA 5GVJA 1ZALA 3AU2A 3BAXA 1GOOA 4G8TA 2OGJA 3N2BA 4FNQA 3TA9A 3W7JA 1EC9A 1LDCA 2DUXA 4PL2A 3O1NA 4A05A 2AL2A 1EHAA 3MO7A 3TXZA 2O9OA 3KCLA 2HK0A 4MB4A 2E4TA 2P76A 2VR5A 5I6SA 1E9IA 1R8LA 1WKFA 2PDXA 2ZTJA 2ESCA 2EPOA 4JTRA 2YDQA 1MXSA 3TOYA 4ZOAA 5LNUA 1J6OA 4N9BA 5IM51 2QCGA 2VEIA 3ZS4A 3KBVA 1YDVA 3E0IA 2PCQA 4AXKA 1TA3A 2HQAA 3M41A 4Y9MA 2ZUNA 5D8ZA 4ACZB 2AGKA 1CGTA 4PUWA 5D33A 3WO8A 2VR4A 3BV7A 4J2PA 4MY9A 4GO8A 3CZJA 1TV3A 4MNKA 1D3CA 3L4UA 4D72A 4GYKA 3WBEA 5HAOA 2G5WA 3V16A 2YB1A 2GGJA 3UNTA 3NYZA 2FMOA 5KZMA 2YKKA 1M9HA 3AHXA 1B3WA 1PB0A 3WLOA 1E6PA 4NAFB 4PYSA 4GHRA 1NWTA 4F0HA 2FVLA 3VOFA 2CLFA 1E4MM 3QKEA 3WLIA 4L6OA 3TMQA 3CWOX 4DUVA 5EMYA 2X40A 2GYIA 1AMYA 4E2BA 3WK3A 2F2KA 3E12A 1XGDA 2YA1A 3W25A 4E8CA 1A3XA 4O52A 2P1FA 5CPQA 1BXCA 1AQHA 1EC8A 1ZY9A 4J3VA 3CNYA 5I06A 3A24A 4RXFA 1XF0A 1XD1A 3LNMA 3PPGA 3ITLA 1Q7QA 3VGGA 4K1WA 3D3AA 3CQKA 2BOFX 3GBDA 1CX9A 2PF0A 3RPDA 1F3TA 2RDWA 1ELSA 3SRHA 1FH8A 1DQWA 3G1VA 3RN6A 2Z1BA 3O06A 1GGOA 3TW9A 3QHNA 4UZSA 5BU6A 4DRSA 1B4EA 3CUXA 2XGZA 3EDKA 3P67A 1X96A 3KDNA 4FLRA 3QQ1A 4KFPA 3WEOA 3U6WA 1TB3A 1JDCA 2L5HA 1T6MA 3NSMA 2WSKA 1AW2A 2QDEA 3MYOA 2V3GA 4KFNA 2VC5A 4CQ8A 4AHOA 3M0HA 3MZ2A 2XIOA 3GXTA 1DJNA 2HMCA 2WAGA 3S2JA 4XKMA 1GG1A 2CCRA 5FD0A 2W27A 2BS9A 1V6XA 3GWQA 3LPGA 1GPFA 1T0OA 1UPMB 1IXPA 2GVEA 4DXXA 1W3LA 3DHUA 5C6MA 2EGZA 3L7RA 4ZO9A 4I5RA 4M6QA 3PFMA 1H7OA 3C8FA 4WJXA 3SUSA 4LOCA 3MSDA 1L6SA 2J9ZA 3LQGA 1RY8A 4K36A 1OFPA 4WKAA 3V5OA 4Q33A 3W3OA 4QDMA 3MHGA 4W5ZA 3W7OA 4F0MA 4DWDA 3B9AA 3QY6A 2FH6A 3C4UA 5LGXA 2V82A 4KEZA 3BC9A 1QW7A 4OUIA 1XBZA 4GIAA 4GI9A 5K9XA 1BYDA 1BXBA 4DWSC 4RZ4A 5AYIA 1XX1A 4FOJA 4C6PA 1SZNA 1BG4A 4EXAA 3DFNA 4UQCA 2R9RA 1IR1A 2ZXAA 3QXBA 4HT3A 5IFPA 1UKSA 4UTWA 3N13A 1JPIA 4HGXA 4LUSB 5KZDA 3TW6A 3CB8A 1WE5A 2ZVIA 3SZ8A 5FF3A 3DFSA 1NFPA 4E2DA 4GKTA 1DVJA 4GXWA 1O68A 2G4JA 4NX5A 3HOJA 4FX8A 2ZDSA 3LRKA 5I3FA 4P8WA 4EK7A 3CBWA 2DH3A 4LAKA 3KWSA 1QTWA 1XUUA 5BXPA 3IPWA 3I6RA 3C2OA 4HK7A 1AG1O 3WLMA 1SR0A 3C2RA 4IQLA 1M65A 4CQCA 3KZSA 4JKLA 4WSHA 1FWIC 3LLFA 3UVIA 2ONEA 4D6GA 4RX0A 3LB0A 4QEEA 3LUTA 3PVFA 2XFRA 3S8HA 1DWJM 4B5TA 1CNVA 3L0NA 5IFTA 1N7KA 3E0FA 2D20A 3SCUA 3GDKA 5G2WA 4YHGA 1BSLA 4NT0A 3Q2DA 3URAA 1SFLA 3FIGA 2V38A 3N73A 1LBMA 3KLKA 4LUIA 4RE4A 4K68A 2ZRUA 2Q8LA 2QUVA 3W83A 4IICA 3GVQA 3T0TA 1NWRA 4A3HA 1YYAA 4NHVA 3WUGA 4NX0A 3DFTA 4IL0A 2C19A 3DFPA 3CM4A 1E4NA 1LLWA 3N29A 3EA1A 1XQKA 1LRNA 3PTKA 4C5YA 3DENA 2Z1VA 4BF9A 4M3PA 1Q8JA 4YTSA 3RMEA 1XG3A 3ZXWA 5HJLA 4LX4A 3FXYA 4IIEA 3SCNA 2O0TA 3RM8A 4H4IA 2A2IA 4GLEA 5MHBA 1PO9A 3OW1A 5C9XA 2DT2A 4HPJA 1SMAA 2E9MA 1T40A 1XD0A 4UB9A 4NJJA 5B7ZA 1LF1A 1KR1A 2PP1A 1US3A 3KRSA 4NU7A 1OB0A 3RPMA 3B0VC 1EZ2A 2BY1A 3KBJA 3BSMA 1S38A 4V1XA 5TIMA 4DHGA 2VFEA 3BG9A 4I90A 5G4WA 5F2IA 4WRHA 1E3ZA 2DZSA 3AUOA 5I02A 1MQRA 3H70A 3FDGA 3VPLA 3OTRA 5LYRA 2PP0A 2ZUTA 4JTIA 4DO7A 3BGGA 4AD0A 1HVXA 1BPLB 1M41A 4YHEA 1KFLA 2VCBA 3GIQA 1REQB 5IRPA 2FJKA 2NQJA 1RCQA 3GTIA 2PDIA 3PPFA 1UCWA 3EWWA 3OZPA 4Y6GA 2A79A 3EWDA 4GGHA 2RDUA 2CZEA 2ZC1A 3NQ7A 3DESA 3C56A 3DAQA 5D2YA 4F8XA 1WDDA 4I5UA 1VRXA 5CBBA 2VEKA 1RLCL 4JTEA 3G1YA 3KDOA 1TZ9A 1HW6A 5DF0A 1KLZA 1E0VA 2G3FA 3ARVA 1DXIA 3GG1A 3PBMA 3GNRA 2EKGA 2XVPA 2VX5A 2V9DA 2P0IA 2GUBA 1V77A 4XAGA 4DBSA 1LOSA 1R46A 1D3GA 2GVYA 1KFBA 2JGQA 4HNVA 5I0DA 5LXEA 1R2TA 2V3FA 4DUWA 3UJEA 4J3ZA 1J2BA 5HJYA 2RH9A 3U2OA 3H2MA 5HMDA 3WD1A 3U57A 4X2RA 1R9XA 4M6UA 4ORIA 4IG2A 3TN6A 3IGXA 5HULA 4N42A 4FOKA 2QCDB 4MKVA 1L6FA 2I5QA 3GU2A 1EA9C 2E8YA 5FACA 4PBGA 5DBUA 1Y0EA 1TYGA 4YVVA 1OCQA 2AQOA 3LPFA 3GZAA 3K4AA 3HPAA 1XPGA 3VUPA 1JFHA 5BRBA 2V5KA 4J40A 1YQ2A 1IIHA 3HG2A 1Q7MA 2QAPA 5E1QA 4FPSA 1S5MA 3LYEA 2O9PA 4BQ5A 2TMDA 5CBJA 1VBJA 1C91A 4PUMA 1IGSA 1J18A 3HG5A 4YTQA 4FR1A 1O95A 2EPMX 1E9ZB 4W7UA 1QBBA 5AKQA 3MJYA 2QUUA 3OODA 3W2NA 2TRSA 2BHUA 2HPIA 3N04A 1J0KA 3PUOA 3A4WA 2HE5A 3WLTA 3QV7A 1LCOA 2GSEA 4ZB0A 1OHLA 1PTGA 2J74A 2F9RA 4FZIA 3VZYA 2IQTA 4M1BA 3UWZA 2Z00A 4QS6A 4OU1A 1F73A 3S9IA 4H9XA 1WV2A 2ZKMX 2Z29A 3DC8A 3TZFA 3ZLGA 2QF8A 2PFHA 1A5OC 5CQ1A 3WH7A 1H11A 1QU4A 5DN1A 3HIJA 1CXKA 4TIMA 3WDHA 3SAZA 1J0JA 3EXSA 1K4GA 3M0MA 4UQBA 1E5NA 3T4CA 1QW9A 5CJNA 2W67A 2AL1A 2A3HA 4DPPA 3LA4A 4IPLA 2XH0A 2J9YA 1SZEA 3KVKA 1R9ZA 3GNOA 3K5XA 3ITGA 5E09A 2IXUA 4Z2JA 3D47A 5BOEA 4B92A 4ZB5A 2J75A 1V6UA 2XVNA 1UZDA 1UD8A 2PDPA 1DE6A 1X8FA 1EJUC 3UA3A 2VX7A 1J9YA 3FXGA 3VDBA 3BAKA 3TSDA 1SFJA 3A64A 3LTSA 1TMHA 3PSVA 4HU3A 1E6QM 2VC6A 1XKYA 4EANA 3L68A 3KLLA 4IH3A 4OVXA 2P5NA 2WC3A 3IARA 4JXCA 4HZ7A 2DVXA 2B7NA 1UR0A 3EEGA 4UMBA 5C7VA 1HKKA 1DE5A 3WMLA 4RDWA 4LCQA 3EWBX 2DUZA 5TAOA 4UFMA 1ZZMA 3N14A 4S1FA 1U33A 2DT3A 1W1IE 2Y62A 2GZXA 1EEPA 2ZZ4A 3HPZA 2Z6IA 1A4MA 1SO4A 1AK5A 3PZQA 5HA7A 4W93A 5L6UA 5AC4A 3W1XA 4UTTA 4I6VA 3JRKA 2PDNA 2WHLA 1UZHA 3PZOA 1HJWA 3W6MA 5G1TA 2ZX6A 3LHTA 4HNLA 4NI8A 5BROA 3CYJA 4TX6A 4KRUA 4L56A 4KIEA 3WBAA 4GA8A 1W17A 3VA8A 3KL3A 1SM9A 4P7RA 5HR7A 5F2LA 2VWTA 3NXLA 5FEWA 3RR4A 3OZMA 5DXXA 3UESA 4G2DA 4ADTA 1E70M 3AMLA 3VI2A 1XLKA 3S9YA 1D7KA 4ZQOA 3LBOA 3OVQA 4DZ5A 2OB3A 4O1DA 4AU0A 2ZRXA 3EX3A 4M8UA 2VFHA 4W84A 1ECQA 2V5BA 4JGDA 2VFFA 3AWNA 2IPGA 4ZSUA 4M56A 4QIUA 3GC5A 3FJ6A 4HU4A 4BI5A 2VZVA 1UR1A 3IEBA 2PS2A 4RNIA 4XKYA 1C9DA 2E09A 3SJNA 6ALDA 5C7HA 4NL1A 4O0ZA 4LCSA 3ZLFA 2P88A 1IWAA 3CAWA 5I3DA 1F8MA 3R12A 1SR9A 2RJGA 2VZUA 3DX5A 2ZXQA 1UC4A 4IIGA 3KEHA 4DZIA 1TJPA 2AAAA 1XIJA 4LCRA 3TQPA 1VB9A 1T5AA 2Y5EA 4GY7A 3C2VA 1W9VA 2QJNA 1Q6DA 3K46A 1NU5A 2VEGA 1XQLA 3HMJG 3QOMA 2F38A 1GVEA 3TK7A 4IMCA 2DW7A 4LWWA 4YVPA 3FA5A 4ROPA 4H7CA 4FLSA 1UG6A 3D0CA 3FS2A 2A1YA 1H62A 3L9CA 3EWCA 3BLKA 3VXGA 4XTDA 1EP3A 2BODX 1S2AA 4TV5A 1X7FA 2ZICA 2EPHA 3NO3A 3LXBA 3NAVA 1W9PA 3T40A 3NDZA 1HIZA 4W8AA 5BU9A 3Q4DA 2XM2A 3P8JA 1D3HA 3BCJA 4LYQA 4S3BA 4JYEA 2QPSA 1IWPA 2D2GA 1O5KA 4IIBA 3EOSA 5E9XA 4B5NA 4EPKA 3D6NA 1A80A 2J79A 5M03A 4PULA 1AJ0A 3WH9A 1F3EA 1OFQA 1TUXA 3ZOAA 4AMAA 1E5JA 3KVJA 4FXSA 1EDQA 3B0YA 1POJA 5FEPA 1YE4A 3KRUA 1KCZA 4FIQA 3I3EA 4AZHA 3FJ4A 1U1HA 3TOPA 1D8WA 1RQEA 3HGRA 3W7GA 2VX6A 1JCTA 4F3HA 2J8GA 3SGGA 3STPA 1UKPA 2F7FA 1GQJA 1GOMA 2IKJA 3ARXA 3ZR4A 2A85A 4O1BA 2G3NA 4C6JA 2D69A 4CNTA 2I9UA 2WW5A 2G96A 1KBJA 4MPQA 1CIUA 3CHCA 4KT2A 2QGHA 1YX1A 4JFVA 4RR4A 3VOHA 1AZ2A 1VFOA 4Q7IA 1MW2A 3U2EA 1KO0A 4L4OA 1JZ3A 1E0WA 2QCLA 1A0CA 4P7LA 2I7GA 2I57A 4EE9A 3D3FA 3R94A 5HJXA 3BJTA 3OHIA 1S3TC 4Q8OA 4ORMA 3KP1A 1A0DA 2CXEA 3ES7A 4AF0A 3II1A 1TWDA 1UP0A 4LF2A 4JTFA 3V5CA 3GTHA 4LQ1A 2Z25A 2G3IA 4JS3A 3PB2A 3O05A 3W2UA 4TU1A 2ZRZA 2OVLA 3GXDA 2A7NA 1HX0A 3H2FA 1LL6A 1OFDA 2BG5A 1UZ4A 1OGGA 4F9JA 3AS3A 1DIKA 4AUBA 1R2SA 1TMLA 3L5MA 4AEOA 5BW6A 1WP6A 2YCLB 1RCXB 1MRAA 2Y89A 2WVVB 1FKXA 5AC5A 5BMWA 1C8QA 4RDVA 5U7SA 4XVDA 3VUSA 1JDEA 4J1OA 1UJQA 4PRRA 1JZ2A 1EXPA 4I8YA 3R8RA 5CKSA 5A3HA 4US5A 2PLKA 2GQ8A 1C93A 3OLEA 4GPNA 3WNLA 2GVGA 1FRBA 4Q8PA 5K3VA 5E70A 1OM0A 3NZQA 3GVRA 3QN3A 1CPUA 3NYDA 2RKXA 3F2CA 3NSNA 3B9EA 3M0YA 4LYKA 4HOXA 3OLIA 3IIPA 3FW6A 5D02A 4AC7C 3IV3A 1QAPA 4MFDA 5D9PA