1OM0A

Crystal structure of xylanase inhibitor protein (xip-i) from wheat
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
274
structure length
274
Chain Sequence
b'AGGKTGQVTVFWGRNKAEGSLREACDSGMYTMVTMSFLDVFGANGKYHLDLSGHDLSSVGADIKHCQSKGVPVSLSIGGYGTGYSLPSNRSALDLFDHLWNSYFGGSKPSVPRPFGDAWLDGVDLFLEHGTPADRYDVLALELAKHNIRGGPGKPLHLTATVRCGYPPAAHVGRALATGIFERVHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase Inhibitor Protein I
publication title Structural analysis of xylanase inhibitor protein I (XIP-I), a proteinaceous xylanase inhibitor from wheat (Triticum aestivum, var. Soisson).
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 98
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2003-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1om0A00
1FH8A 1I75A 3BLPX 4X9YA 3ZJ6A 1IZJA 1D2KA 5A6BD 4QAWA 3B9EA 3DECA 3S6TA 3MSGA 1XYFA 3N13A 4RE3A 1VEOA 1XH2A 1E43A 3OIHA 4J3SA 3ARYA 1UD4A 4HZ6A 1XSJA 1UA3A 2CNCA 3AS3A 3M07A 3RM4A 3AIEA 4OOZA 4GQQA 2WVVB 3RDKA 3VD3A 3ZJKA 3II1A 1YHTA 2EJ1A 1UKTA 2D3NA 4J3TA 2WBGA 1GQKA 3ZT6A 4YN5A 2J8FA 2CKRA 3AIQA 4PMXA 1E15A 3PZNA 4P8WA 1E9LA 1M04A 2V38A 1V3MA 1UWRA 4UFHA 4HU0A 5A8QA 1AQMA 3LPGA 1NOFA 4BZYA 5DFAA 2OWCA 3AIUA 1HX0A 3WNMA 1Q6DA 3NUKA 1AQ0A 1HJSA 3ARRA 1EQPA 4TTGA 5D9MA 4XZWA 3WFLA 1MYRA 3KL0A 1W9VA 4YPJA 3AIBA 4ZXOA 4ACZA 1JI1A 1G9HA 1EH9A 1TFVA 4JHOA 1U33A 4MPKA 3BAKA 3WQVA 3AS1A 2NSXA 1E70M 1EDTA 2J7FA 1DP0A 4D6CA 4PEEA 4W5UA 2JF7A 3WH8A 4UFLA 2WAGA 1OWQA 3FHAA 4HPGA 4KWUA 3WH7A 5I24A 3PHAA 2XIIA 2DT3A 2VJXA 4U5IA 5DF0A 3SCTA 1WZMA 4Z2HA 1ZL1A 1UQYA 4LYRA 5LA1A 3F4VA 4C7GA 1OGGA 1W1TA 5I2UA 4HMCA 1RD6A 3VGBA 1DWAM 1VFFA 1WO2A 3WDIA 3BAXA 1WP6A 2NT1A 2WMIB 2OYLA 4M81A 4GI6A 2VI0A 1J0KA 1H1NA 1QHOA 5DT7A 3TTSA 1GQJA 4P8UA 4WF7A 3LPPA 4M24A 3EDDA 2RGMA 2E4TA 1V3IA 5D8ZA 1QI5A 3K4AA 1NM9A 4WIWA 1E5JA 4WKFA 3EBVA 1UH3A 5D9PA 1H09A 3BC9A 4S3KA 1MXGA 2XYLA 3WF4A 4EKJA 2E3ZA 4PRWA 2W91A 4BF7A 1M03A 5IFTA 4YHGA 4AZ7A 1GW1A 2UY5A 4AD0A 2J7GA 1V0MA 1OIMA 1UD3A 1XSIA 4CD6A 1VBRA 2ZIDA 3AS0A 1QPKA 2JALA 3EMZA 4UTFA 1NQ6A 2DSUA 2J7HA 1XRVA 5A2CA 1CZ1A 1CTNA 3QGVA 3WN6A 3CHEA 1JYVA 1SYTA 4GIAA 3BMVA 2FHFA 3DC0A 1OB0A 4ATDA 1PEZA 4J3UA 1JAEA 3ARVA 3I3EA 2W66A 4ZENA 1D3CA 2PBOA 3WBAA 2W67A 3WUEA 4JFVA 1P6WA 3W82A 2JEPA 3I3DA 1WCGA 5BWFA 5F7UA 4PMQA 2VOTA 1US3A 3THDA 4AZBA 3N18A 5FL1A 4GINA 3VDBA 4ZFMA 4W89A 1EO7A 4MNMA 4UCFA 3TTQA 3WDQA 1ZJBA 1E6SM 3U57A 3BAIA 3ZJ8A 2G3JA 5E9AA 3CIVA 3BCFA 3UCQA 5CPTA 1CLXA 1VBUA 3VDHA 3GDBA 4F8XA 4J7RA 1OD8A 1NWUA 2DSVA 3VGHA 1TA3A 2O9TA 4M80A 1LG1A 2E0PA 1WAWA 3ZR5A 3A47A 1HVQA 1HJVA 1MXDA 4C7DA 1PZ2A 2GJXA 3VD5A 4KRTA 1CNVA 5E0CA 5I0DA 1R7AA 2EPOA 1UZ4A 1VAHA 1CDGA 2GSJA 4Z2JA 5FD0A 3WENA 4PUEA 4AZIA 5IXEA 2WCGA 1FP9A 2ZWYA 2EBNA 1UZ1A 1BYBA 1QW9A 1D7FA 3K8KA 5ABEA 1H2JA 4HOWA 2XPKA 2AOSA 2UY4A 4PN2A 1K9EA 1JZ6A 2J75A 5AYBA 5EBAA 1DEDA 1DWJM 1GOIA 1XSKA 1WDSA 4JL2A 3DHPA 2XGBA 1H3GA 4XB3A 3W53A 4E4PA 4W8AA 3BLKA 2XHYA 4OBRA 1UR8A 4UFMA 3UG3A 4WKHA 1MW1A 4GZIA 1J18A 1ZBCA 5JBDA 1E6QM 5E0FA 5JIWA 4XV0A 1J10A 3MUZ1 4GXPA 1JF5A 1ZS2A 2XM1A 3PZTA 5A6MA 1FA2A 3WMSA 1V6VA 5AY7A 4OKDA 1WNOA 4Z2LA 3NDZA 1V3JA 2YL5A 2VCAA 4MJ2A 1HKMA 4W86A 1H5VA 3OG2A 4IUGA 4H8VA 2XGIA 5EB8A 3BGAA 4M8UA 1J0YA 3VX1A 5HXMA 1BLIA 4D6IA 3AMLA 2UY2A 1CENA 3RO8A 3B8SA 4TOQA 1CGYA 1JXKA 1VFOA 4UOZA 4BQ3A 1M01A 4NZCA 5GQBA 1DWFM 3W29A 1UHVA 2WSKA 4PSPA 3VGGA 2VZVA 1V0KA 4CUCA 1E1EA 3OBAA 1ZB5A 1JD7A 5A3HA 1V6XA 1XD0A 2J8GA 2WHKA 1J0IA 1JGIA 1QHPA 2ZX5A 3FAXA 1JFHA 1VB9A 2JFEX 5JUVA 3POHA 3ZJ7A 1NWRA 1C92A 1H4PA 4W87A 2UWFA 3B9AA 2OYKA 5I77A 4P8XA 2Y8VA 4JL1A 1U2YA 5CPSA 3CTTA 5CLWA 3W0KA 1G1YA 1W2VA 3SEPA 1BVNP 5BXRA 2VZTA 4AZGA 2XG9A 1SFSA 4UQDA 4P7OA 3T2PA 2WK2A 2YBUA 2G3IA 1KBKA 1B9ZA 2WZIA 1YQ2A 3LPOA 4CU8A 3CH9A 1JYWA 4HU8A 4B3LA 3U7VA 2BXZA 1CYGA 4PMDA 3OZOA 2A3HA 4HA3A 4CVWA 3MMWA 2HVMA 1BFNA 1UR0A 2OWXA 1JXJA 5DO8A 1A3HA 1GORA 2CITA 4MB1A 3VM7A 1TMQA 1X6LA 3AICA 1VEMA 3BMWA 3CGTA 2Y4SA 1Q6EA 5LYRA 2BY0A 1JNEA 1HT6A 1CGTA 4PMYA 3AZTA 2XFRA 2CKSA 3HJEA 3U7BA 4PMVA 1I1XA 1R87A 3E1F1 1ISZA 3FY1A 5FCZA 1C3FA 3JUGA 1HJXA 1KWKA 2VRJA 1E40A 2DQXA 1AMYA 5C8BB 3AS2A 3UEQA 1NOWA 1EA9C 3NJ3A 2WCAA 5IFPA 4PTXA 3FNDA 4PMZA 2VZOA 5CSUA 4TX6A 4KRUA 2J78A 3AZRA 5AYIA 3CLWA 3OGRA 1NARA 2ZWZA 2ZX9A 5A6LA 4W84A 4CU7A 1VFMA 1W1PA 1FFRA 3EYPA 1UH4A 1QI3A 2WVUA 1SMAA 4FLQA 1W9DM 2WC3A 4QFUA 5A95A 1TCMA 4WSKA 2WVTA 2W61A 2VUYA 4J3WA 4P7QA 3VILA 3UETA 2MANA 3DYMA 3SURA 4AZCA 5DT5A 2Q8XA 1BGGA 3WKZA 3WUFA 2ZXQA 3RMEA 1CXIA 1BF2A 1GHSA 3VIFA 5GNXA 5GNYA 3ALGA 2FH6A 2WPGA 2O92A 4MTVA 2ZUTA 3VMOA 4HTYA 5M3WA 2DDXA 2CBJA 2OWWA 2WMJA 2V5DA 1WPCA 4EANA 1BG9A 5A6BA 4A3HA 1KXVA 2VTFA 1JFXA 4D6JA 4NSBA 2WHMA 2J47A 2E40A 4H8HA 4CCCA 2ZUUA 1FOBA 1CECA 3VIPA 3VU2A 4TXEA 3S2CA 1VJSA 5E09A 3KE0A 1M53A 2GFTA 3UG5A 2XSAA 1JL8A 2BHUA 2JIWA 1WZLA 1J11A 3WQ8A 1C93A 3WH9A 3KL3A 1TVNA 3UG4A 2ZUSA 4CD8A 2ZXDA 2J62A 4MAVA 2VVSA 2WW5A 3K8LA 1GNXA 3WEMA 1CWYA 2E9MA 3BXWA 1FFQA 1ISXA 3QOMA 4W85A 3FAWA 5CGMA 1W9PA 4BCEA 4D6EA 5A6SA 1B3XA 1BVZA 1C8XA 3WNOA 3IJ8A 5M03A 1CEOA 2Y2WA 3BAYA 1JD9A 2ZUMA 5E6ZA 1C7TA 2WZEA 2VO5A 1EHNA 2WYSA 4JZ5A 2F8QA 1ODUA 3GXDA 1BYDA 1JIBA 3VM5A 1ECEA 1S46A 1WB0A 2BS9A 2YOCA 3W27A 2V3DA 4JHZA 1C8YA 2J7BA 2XIBA 1QNPA 3KWXA 2DH3A 2X09A 3L4XA 2OSYA 3AQUA 1B3VA 4W7UA 1QI4A 4UFIA 3OLEA 1U30A 2D23A 2YJQA 4JIEA 4L4PA 2O9PA 3RPMA 1E0WA 2VMFA 3CBWA 3WNNA 1NH6A 3CZEA 2PWGA 3VGFA 4B15A 4D6GA 4PMNA 4DWSC 2BHYA 2CHNA 3PN8A 3EDEA 4TVDA 2C8NA 1GVIA 2GK1A 1QBAA 1UKPA 2C7FA 4NI3A 1NWSA 3DYOA 1HKJA 4LGXA 3VIHA 4AD2A 3VIOA 1PZ3A 3LPFA 3VD7A 3GH5A 2ZUWA 3K4DA 4EE9A 2CCRA 2VX7A 3SUSA 3ARZA 5D4YA 1XCXA 4CKQA 4BS0A 1JAKA 1RPKA 3AISA 3CZJA 1DWHM 3CUFA 4FLOA 4WJXA 3ZM8A 2VL4A 3WF1A 1HF6A 5ABFB 3PZUA 1EQCA 2QPUA 2JF6A 2E9BA 3WEZA 3IK2A 4JFTA 4UQBA 1PBGA 3BH4A 1IV8A 2J7EA 3VTRA 2X05A 1E0XA 3VDAA 3J7HA 1JZ5A 1UKSA 3ZIZA 1UA7A 4DUWA 2JEQA 4W8LA 2CIPA 5AC5A 1JDAA 4CD5A 4XX6A 5FKYA 2J7CA 2GDUA 4UZUA 4D71A 3QHMA 2VZUA 4DM2A 4GI9A 2EEXA 3VVGA 5IHRA 3GTNA 1J01A 4TVUA 2YL8A 3KZSA 3L4ZA 3WQ6A 5KZ6A 2XWEA 3A3HA 8CGTA 1TR1A 4LPCA 4BQ2A 1QI0A 1JZ7A 3AIRA 1G5AA 5I78A 2ZICA 1R7OA 2D24A 4FLRA 3AHZA 3SCRA 2WMFA 4AC1X 2VC9A 4Q7NA 5E70A 1Q6GA 3CZLA 3T2QA 3W81A 1JZ4A 1BG4A 3FHQA 3UR7A 4P7LA 1V6YA 1GOMA 5FIPA 3RJXA 3CZGA 4TTUA 4MNJA 5JIPA 1GJWA 1LWHA 3L2MA 1GCYA 2WLZA 1WDRA 3O9NA 1NWTA 4CVUA 3N04A 1MWOA 3LMYA 1LL7A 1N82A 1XCWA 1W1YA 5AC4A 4JFSA 4M82A 2CPUA 1GUVA 2VQTA 2ZXAA 2G41A 1JYXA 3ARQA 3QHNA 2PBGA 4PTVA 2CYGA 4OZOA 4AEFA 3AJ7A 4A3YA 3AHYA 4U3CA 2X8RA 3WMCA 1LLOA 3CUHA 4AISA 3HMCA 2WMKA 3M6DA 1V08A 3A4WA 3AOFA 5BRPA 1NOUA 4HOXA 1E72M 2FH8A 3MV11 1KB3A 1L8NA 2D1ZA 1OSEA 2DH2A 2VR5A 5ECUA 1PPIA 5A2BA 5A6AA 5CG0A 1E6NA 1E4MM 1FH7A 2WVVA 1GOKA 2ZX8A 5HBFA 4CN4A 2A3EA 2UY3A 3F5JA 1W1VA 1QNOA 4OIFA 3PTMA 3F5KA 1A47A 2YA2A 5CLTA 1B3WA 2G3MA 3GM8A 3VPLA 4GKLA 1IZKA 3GBEA 5M17A 3CPUA 4RE4A 3MV01 4U31A 1X1NA 5GNZA 4RE2A 2CHOA 1E6PA 1W3KA 2J25A 1LJYA 3NSXA 1E0VA 1TVPA 2EQDA 1QW8A 1BYAA 1H0IA 3CHFA 2NT0A 3GXFA 3MO4A 4S3JA 3SIMA 2XJ7A 5GPRA 2CXGA 2Z1SA 3L4WA 2DPEA 2BVDA 2D0HA 4Z2GA 1FHLA 4KGJA 5CPQA 4DWSB 2BNJA 2CEQA 2WBKA 3CO4A 1TZ7A 1HNYA 2CBIA 1TUXA 1ODZA 3D5HA 1UR9A 2B31A 1AVAA 2EO7A 3GZAA 3GBDA 3OGSA 4JKMA 1KXTA 5DEZA 1C90A 1CBGA 3CUIA 1CGWA 2W62A 2RGLA 2ZXBA 3W38A 2ESCA 7CGTA 3W37A 3CZ8A 5HNNA 2GUYA 1DWGM 5LA2A 4WLCA 4JFUA 3U5YA 1UD2A 5D9OA 2C0HA 3WY1A 4CD4A 2DIJA 3T0DA 1CGVA 4AIOA 1QI2A 1Q6FA 2WXDM 4DUVA 3GH7A 3THCA 1GJUA 1ITXA 3W4RA 2ZE0A 4A4AA 1VFUA 1AQHA 1B31A 3AHXA 4PSRA 2WMIA 4M29A 4H8UA 2D20A 1XC6A 4N42A 3DYPA 4OOUA 1OM0A 4WK9A 1PIFA 3RIKA 3WDHA 5BYWA 2QHAA 3IANA 1LF1A 3AXHA 3GXIA 4HOZA 3RM9A 1B3YA 3RM8A 3VD9A 4AIUA 5BROA 2PWEA 1X6NA 4HPHA 1V03A 3VMNA 1NP2A 1E3XA 1HL8A 1KGWA 1EHAA 2XM2A 1DWIM 4W7WA 3GNPA 1MVYA 1H49A 2A3AA 1KXHA 4PCSA 4RL3A 1UWSA 1OINA 3ARWA 5ABGA 1E4IA 3VOCA 4XZBA 1H41A 1W3LA 1W2PA 3WEOA 3ARSA 1HJQA 1E71M 3CUGA 3OLIA 1PX4A 4U2ZA 1WE5A 4OJYA 1ISVA 1UUQA 1VENA 3AXXA 1MFUA 1CIUA 2VCCA 3VGEA 5I3DA 3SCNA 2VX5A 5A1AA 5A6KA 1BPLB 3SCVA 4P8VA 5EFFA 1HP4A 4UQ9A 3UERA 1BTCA 1CXLA 1WDPA 3CHCA 1W3HA 5I6SA 4UZSA 1HKKA 3VX0A 4ZE4A 1KCKA 2QV4A 2XSBA 1UWTA 3VINA 2VRKA 3BAJA 3EMQA 3AMKA 3W6MA 4ATWA 1BSIA 3SCQA 3MSDA 1HIZA 2PF0A 1KR0A 1F4HA 3TTYA 2E8ZA 1XH0A 4YHEA 1O7AA 1CXEA 4M1RA 1MW3A 1RP9A 1XYZA 3EDJA 2WKGA 4U3AA 2X2YA 3W28A 1E56A 1HKIA 5A2AA 4JAWA 4B9YA 2FDMA 2VT0A 3DHUA 5BRQA 5BCAA 3PZMA 3VO0A 3ZT7A 3SCPA 4D6FA 1FH9A 2EPLX 3ARPA 1ISYA 3AYSA 4AW7A 4B9ZA 4P7NA 1BQCA 1OT1A 5A6JA 2E8YA 4PTMA 2O9OA 4FF5A 3T0AA 3NYDA 1EO5A 1E1FA 5HPOA 2EPMX 2GVYA 2PI6A 3SUVA 1MFVA 4GZEA 6A3HA 1XGZA 1XH1A 3ZT5A 1ZU8A 1CPUA 1FP8A 3WBEA 4UQCA 1CLVA 4UFJA 2WNWA 1HJWA 4DM1A 2VX4A 5BXTA 1C7SA 4R5EA 4QLJA 2DSWA 1GHRA 1B1YA 1UR4A 2WM0A 2XFYA 2X0YA 3NDYA 3UESA 1MW2A 1B2YA 4FLSA 3QHOA 2YDQA 4TX8A 2W4XA 4AZ5A 3AROA 2DEPA 3SCUA 4AZ6A 1EIBA 3AMDA 1E6RA 1E4NA 5D9NA 2YA0A 1W9BM 3GNOA 2DT1A 2V3EA 1XHGA 2YL9A 2XFFA 1UKQA 1E6ZA 4AD3A 1CGUA 4PMUA 1PAMA 3WD4A 4IPNB 3WD1A 5HDRA 2A3BA 5FOOA 4PMOA 3N15A 1JNDA 3O6AA 1UR2A 1RH9A 1UD6A 2PWFA 1BGAA 2PC8A 4GO9A 4LYQA 1VRXA 3CHDA 3AMCA 1Q4NX 2W5FA 4EK7A 3IAPA 3T2OA 1E73M 4PYSA 1JF6A 3WF0A 2XVPA 2OLHA 4LQ1A 2V3FA 1OGSA 5IHSA 4HA1A 4JCMA 1UQZA 3CMGA 2W63A 4EAMA 1VF8A 1TA3B 3WQ4A 3OB8A 3APGA 4J27A 4HA4A 4NF7A 4CN6A 5KEZA 4Q22A 1KCLA 6CGTA 3WUBA 2XVNA 1VJZA 3VIIA 2GJXB 2X0HA 1BHGA 4H41A 2XWDA 2CERA 4ATLA 4FMVA 1K9TA 3MS8A 3WQWA 3WMBA 4MJ4A 1QNRA 2F61A 4JFWA 3MU7A 1HP5A 1WZAA 4ZE5A 3T0BA 3N1AA 4WKAA 1UR1A 5CSYA 2J74A 4MNKA 4N0RA 4MB3A 4PUDA 2ZX7A 5TD4A 4MB4A 1LQ0A 1K9DA 2JE8A 3MUY1 2BVTA 4AD5A 5JBEA 3WQ5A 5BXSA 2Y8KA 4UOJA 1UH2A 3WDRA 4OBSA 3ARXA 3NSNA 2YIHA 3WUGA 1IT0A 2V5CA 2GJRA 9CGTA 3IAQA 4NRSA 1V6UA 2WZHA 1W32A 3AZSA 2IXUA 4HZ7A 2D3LA 3SCSA 2BY2A 3QR3A 3G6LA 4W93A 4X0NA 4CCEA 3W26A 2VZSA 1KQYA 4IISA 1KBBA 3K8MA 2Y24A 1V0LA 2J79A 3AI0A 4GO8A 1XV8A 1QVBA 1LG2A 2A3CA 4GQRA 4U5KA 1GOWA 2PWHA 3WSUA 1OIFA 3UR8A 4V28A 1MQQA 2NW0A 4UQEA 2BV9A 4OUEA 5C70A 1JZ2A 4H04A 1J9YA 4H7VA 3BSGA 1GOQA 4X0VA 4GZJA 2GJPA 2WWCA 4M56A 4GPNA 2OSWA 3TP4A 3OA5A 4AYSA 1HVXA 1CXKA 1E5NA 3SCWA 3W25A 1C8QA 4NRRA 4J3VA 3SUUA 1GZJA 3OGVA 2Z1KA 1QHZA 4BA0A 1EOKA 1JI2A 4BQ4A 5CZKA 3VKKA 4AD4A 1QNSA 4ZXLA 3M46A 2O9RA 4DUXA 3AIVA 1R8LA 2D0GA 3L4TA 1BYCA 3L4YA 4MAZA 3WD2A 5EMYA 3VDCA 1V3LA 3W24A 3PTKA 4AZHA 3GXMA 2J7DA 4B16A 3VD4A 1CXHA 3MMDA 4Z2IA 5A8PA 4HZ8A 2IUZA 2VX6A 2W92A 1LWJA 2D0FA 2DIEA 1ESWA 3CMJA 1G94A 2YDSA 3SUWA 4AWEA 2QMKA 1OGBA 4UFKA 2CESA 2XVKA 3D3AA 2WMGA 2BVYA 4D1IA 5I23A 4MB5A 2XTKA 3NSMA 3PZVA 3W6LA 1O6IA 5A94A 3IJ9A 2YLAA 2IXVA 1ITCA 3N17A 1KR1A 5CQ1A 4QLLA 4CU6A 1UWIA 5C71A 3VMPA 4UNIA 5ABHA 2HISA 1Z32X 5D8WA 1LL6A 1UD5A 2BFGA 3FXYA 1LL4A 1L0PA 3AIWA 3WNKA 3KL5A 1E3ZA 2EXOA 2QMJA 1V3HA 2AMGA 3RILA 1G01A 2J77A 3WNPA 5A8MA 3PZ9A 3SCOA 1Y7VA 4BQ5A 3WELA 4MADA 3AHVA 2DSKA 2JIEA 1MQPA 1ZBVA 2WB5A 1J0ZA 3N9KA 1NP0A 2FHBA 4CN1A 1FHDA 1UKOA 4KMQA 1US2A 4J3XA 3ALFA 1J0HA 1E4LA 2DGAA 3HN3A 1C91A 3VNYA 5BXPA 2V3GA 3OLGA 2G4FA 5FL0A 4IM4A 3EDFA 4TVCA 3ARTA 1B3ZA 1J0JA 1EDGA 1G0CA 3NIYA 1Q6CA 1EGZA 1XD1A 5A8OA 4ML4A 3VIMA 4HMEA 2WHJA 1E6XM 1JZ3A 4TUFA 3BCDA 3SUTA 4XUYA 1E55A 1PX8A 1KGUA 2QLYA 2WMHA 1R85A 2ZUNA 1GOOA 1GONA 2G8ZA 3ECQA 2PWDA 1TG7A 3MUIA 3VIGA 2CBVA 2XVGA 4JCLA 3PZQA 3ZMRA 3PZIA 3T08A 2YBTA 1ZBKA 4ACYA 2TAAA 7A3HA 4AZCB 4QP0A 1QNQA 4CCDA 4W88A 1PJ9A 8A3HA 1UWUA 4K68A 4W7VA 1WZKA 4LXFA 3VGDA 5LA0A 4JKLA 4AIEA 1OD0A 1KXQA 1KQZA 3L2LA 1QBBA 4E2OA 3G6MA 3OLDA 2WC7A 2VCBA 1R86A 2F2HA 3O2LA 1WDQA 3CZKA 2QF8A 2GDVA 3TA9A 2E9LA 2EPNA 2FGZA 3PBGA 3AFBA 2VQUA 2VRQA 1JG9A 3NCOA 4JKKA 3GYCA 1UOKA 1UD8A 1UG6A 4PTWA 1EDQA 1HN1A 2BXYA 1OCQA 3VUPA 1B30A 2WCSA 1H0GA 3MKKA 5ABFA 4PMRA 3ZO9A 3N11A 4PBGA 3TTOA 3GNRA 3MUAA 3AXIA 4MDPA 1HL9A 1GPFA 3A4XA 4B3KA 2DT0A 4UQAA 4F66A 2WSPA 2WVSA 3FW6A 4W8BA 1V3KA 2VVNA 2WLYA 2CBUA 4FK9A 2ZOXA 1W3JA 4GI8A 1MW0A 4LYPA 3WH6A 3WD0A 4URIA 1DTUA 2BHZA 5CXPA 1JDDA 3BSHA 1ISWA 2WHLA 4H2CA 3TONA 4KGLA 3K1DA 1GVYA 2YLLA 4MNLA 3WIJA 4F79A 1MQRA 3WD3A 3OZPA 4L4OA 4AMCA 3ZR6A 3AYRA 2OYMA 3B9DA 5EFDA 3ZOAA 5M5DA 2CETA 1B0IA 4E8DA 4V27A 4E8CA 2XUCA 3EDKA 4D6DA 5I5RA 4F9JA 3PZOA 5E6YA 1ZBWA 4D1JA 4ACZB 4D6HA 4R27A 4AD1A 3RCNA 3GH4A 1RP8A 5DMYA 2YKKA 5CGTA 3ZSTA 2GK1B 3BAWA 1EXPA 4D72A 5JBFA 1HXJA 3RJYA 1KFWA 1JYNA 4QDMA 2QPSA 4Y7EA 4PCTA 4AY1A 3A6OA 3VIKA 3WDJA 4CD7A 3HU7A 3WFZA 2X1IA 2XVLA 3PTQA 4CGTA 1BAGA 1M7XA 2DSZA 5HPCA 1J12A 4HP5A 2BY1A 4IPLA 1ZJAA 3T09A 2WKLA 5I79A 3MANA 3ZQ9A 1PX3A 3POCA 3WH5A 1GQLA 4J28A 1V02A 3TOPA 1KWGA 4V2XA 1GQIA 1H11A 1W9UA 1I1WA 3AMGA 1CXFA 4QCEA 1EOMA 3WL0A 2WANA 5A69A 1W9XA 2D2OA 2DT2A 3U5UA 4W5ZA 4LX4A 4C7FA 1CGXA 2FHCA 1K9FA 4UR9A 1OBAA 3WF2A 3WL1A 1DHKA 3QOKA 2ZUVA 3L4VA 3VNZA 1VIWA 3M7SA 2YDRA 1V0NA 1KGXA 3N12A 4UOQA 3ARUA 1HJUA 6TAAA 2D22A 1SR0A 4P7RA 1TE1A 1OT2A 2J4GA 1VEPA 3VIJA 1PIGA 3WDPP 3FN9A 4AXNA 1SMDA 4Z2KA 7TAAA 2BY3A 2WWDA 3MMUA 1F4AA 2G3NA 1V02E 3CUJA 2VURA 1QOXA 2OSXA 1K6AA 2WC4A 3K46A 5IDIA 2FGLA 3PZGA 4KH2A 4DWSA 4AEEA 2VR4A 2YA1A 2VNCA 3I3BA 2EPKX 1JZ8A 4F9DA 2AAAA 2ZX6A 2PB1A 1UWQA 4WSJA 4U2YA 2Y5EA 1JDCA 4QCFA 4ZEPA 4MDOA 3IJ7A 3EMCA 5CJ5A 5HOSA 4HMDA 3KEHA 1V6WA 1W91A 4QLKA 3WF3A 3ZSSA 3L4UA 3AHTA 1B90A 5A8NA 1WKYA 2YL6A 4U33A 1UYQA 3A4AA 4DWSD 3WNLA 3F5LA
chains in the Genus database with same CATH superfamily
1YLVA 5FSDC 4IIGA 1IZJA 3NQFA 2P53A 3GWQA 4O10A 2A21A 3S8HA 4QAWA 3DECA 3S6TA 1XYFA 3N13A 2D2GA 2ICSA 4OECA 3SIZA 3EX2A 3P74A 4J3SA 3W7NA 1UD4A 1XSJA 3CQIA 1R3VA 2CLFA 4KCUA 4OOZA 1MSSA 4GVGA 3VD3A 4JTGA 2Y61A 3II1A 1DIKA 2ZKMX 1UKTA 2F7FA 1GQKA 3AWOA 1DXIA 4H83A 4DJEA 5DY2A 3VDGA 4LSBA 2C18A 2CKRA 3AIQA 5D2YA 1PB0A 3V0UA 3PZNA 1L9WA 4DZHA 3GVRA 1AW2A 1XS2A 1V3MA 1BKHA 2NV9A 4H8NA 4WDWA 2YCLB 5FEPA 2PWVA 1U1UA 3NUKA 3REQB 3ARRA 3GK0A 3CWOX 4US5A 5D9MA 4XZWA 1RY8A 1MYRA 3AIBA 3IJ6A 4ZXOA 4JTCA 3WK2A 2R82A 1G9HA 1TFVA 2HNEA 2OJPA 3FK4A 3RX3A 3W2NA 1U33A 4FIQA 4MPKA 4BI5A 3AS1A 2NSXA 4L7ZA 4D6CA 1MRQA 3LCFA 2VFIA 3WH8A 3BG9A 3FHAA 1M7OA 2ONEA 1VH7A 3S4TA 3TUUA 2ZDRA 3PHAA 1OADA 3N2CA 5FF3A 4AIBA 1XLEA 2Z6JA 3UYIA 2VJXA 3U9IA 1ZL1A 3TCSA 2BODX 4NZ3A 1LBLA 1Z69A 3GTXA 2ZA2A 2F84A 4NL1A 1VPXA 1G4TA 1XG3A 3UWZA 4CEUC 3TU9A 1RD6A 4PUMA 3OJGA 3BAXA 5I03A 1TMHA 4S3CA 1KM3A 2HNHA 2OYLA 4IT1A 3RMJA 3UPMA 4Y9OA 1J0KA 1QHOA 2A6NA 2XH4A 3TTSA 1GTHA 3N4FA 4M24A 2E4TA 4MHBA 3K4AA 3CMFA 4ZB2A 1OG0A 5D9PA 3BC9A 1MXGA 1J8VA 2Z25A 3T4WA 4EKJA 3TE9A 2BOEX 1VLWA 3E96A 2WJDA 1VBRA 2V2DA 1QPKA 1KFKA 2JALA 4G1KA 1TV3A 4YS1A 2VC7A 1NQ6A 1XRVA 1V5XA 2YX0A 3IV8A 3MHUA 5A8GA 3MYPA 4V15A 1KKRA 4GIAA 3HZ3A 1JAEA 4WUIA 4H01A 3I3EA 2YZ5A 4WZHA 1XUZA 4UTTC 5HJLA 3VAVA 4JR5A 2EG8A 1MMFA 3MJMA 2VEFA 3WBAA 1DIEA 4HKPA 4O57A 4H9ZA 3I3DA 4NAFB 1Q3NA 3A64A 1US3A 1KRAC 3UJRA 3VDBA 2QXWA 4LC6A 3DG7A 3CLMA 2HE5A 4W89A 1EO7A 3TTQA 4H9XA 4AXKA 4KEZA 1E6SM 3U57A 2GVJA 3TAKA 3UR2A 4FA3A 3ZJ8A 2ZRUA 2R1NA 2RJGA 3CIVA 1P0NA 1CLXA 3H70A 3GDBA 2XDFA 3CPGA 3CIXA 1SUXA 3PBUA 2E0PA 2PDHA 2V67A 2Z0IA 1AH3A 1MXDA 5FAJA 1PZ2A 1KW1A 2E25A 1CNVA 5E0CA 4B5VA 1R7AA 3THUA 1UZ4A 1VAHA 1LRTA 1CDGA 3N4AA 2GPTA 3QFEA 1EP2A 5LHFA 5BU6A 4KCVA 1AZ2A 2ISVA 1RA0A 3GW0A 4DO7A 5ECVA 4AZIA 4XAYA 3E0LA 2NLIA 3P2VA 3S9YA 1Q7ZA 2EBNA 1BYBA 2FZ8A 4ZMGA 1TPWA 4QITA 1FWJC 2UY4A 1JZ6A 2IPFA 1H5YA 1JPDX 1DWJM 1GOIA 2Y7EA 4XB3A 4E4PA 1NFBA 4DQWA 3BLKA 1BWKA 1POKA 3NVTA 3UG3A 3ORWA 1ZBCA 1E6QM 3IUHA 4WY0A 1JF5A 4UTKA 4YYCA 5A6MA 5H6HA 3GHRA 2QW5A 4OKDA 4ZGYA 2CFFA 2NQJA 2OGJA 1H5VA 1PHQA 3A9BA 1BLIA 2OZ3A 3ABXA 1XQLA 4CNOA 4I90A 3AMLA 2UY2A 3RO8A 3NZGA 4TOQA 5C2XA 3GIPA 1JXKA 3A22A 1VFOA 3KRZA 4NZCA 1KLZA 2XN2A 1VYRA 3W29A 3NQVA 1Q2RA 1AH0A 3KLKA 1UHVA 2WSKA 3NO1A 4BWLC 4K36A 3GDTA 4CUCA 3OBAA 2R91A 2TYSA 5A3HA 3WK3A 2NQHA 4XSMA 2WHKA 1IXNA 1QHPA 3FAXA 2R9RA 4FNPA 4H9MA 1S1PA 1H4PA 1H7RA 4W87A 4M19A 3B9AA 3VOFA 1F05A 4P8XA 4HCLA 5FJPA 4XD6A 1BVWA 1LORA 1ZP3A 1W2VA 5BXRA 1SFSA 4RZBA 1FWFC 4UQDA 4B2DD 2CZVA 3T2PA 2YBUA 1KBKA 2H9AA 3QLDA 1IEQA 1ONXA 2BOGX 4CU8A 3CH9A 4DPQA 1JYWA 4B3LA 2A3HA 4FNQA 3MMWA 2VHLA 2X1TA 2HVMA 2QCFA 1AUSL 1A3HA 1XICA 2V5KA 1C29A 1E9YB 1GQNA 2YZRA 2O7SA 4GVFA 3AICA 4MUPA 3HA1A 1Q6EA 5LYRA 3NPVA 1JNEA 1HT6A 4GJJA 1YRRA 3AZTA 3RN6A 1NU5A 5HATA 1W5QA 1KV5A 4PMVA 2DIKA 3ZLFA 1I1XA 3ZVIA 1ISZA 1G7VA 1RBOB 2C16A 4AAJA 5FCZA 2JGYA 4JPGA 4PUUA 1O95A 2DQXA 3LG3A 2RUSA 3RU6A 2WCAA 5IFPA 4NYUA 4PTXA 3FNDA 3TQVA 1PWMA 3G2GA 3GVVA 4TX6A 4KRUA 3M5VA 2W0UA 4OHQA 2L5HA 2ZWZA 3CH0A 2ZX9A 4RXFA 3RU8X 3SAZA 6XIMA 5J5DA 1Z9AA 4W84A 5D02A 3MCMA 1LCOA 1CI1A 2WVUA 4LRSA 4FLQA 3PC0A 1AJZA 4WSKA 4R88A 1FTXA 5CPMA 2VC5A 2P1FA 4P7QA 2Y88A 3V16A 3DUGA 2YXOA 2MANA 3SURA 3M41A 1BGGA 4GUGA 3WKZA 1BF2A 3VIFA 1DQUA 3T7VA 3ALGA 2VOMA 4HGXA 1T8XA 3VMOA 3B0YA 4ZQMA 2CBJA 2IKGA 1XPYA 1G67A 1EKOA 4A3HA 4MG4A 4XZIA 1JFXA 5G4EA 3W2LA 2BASA 3LLDA 2E40A 4H8HA 3UR5A 5KZEA 2Y5SA 2ZUUA 3OODA 1FOBA 4DNMA 3VIPA 1VJSA 3UVIA 4RJEA 3QYSA 3SR7A 2QULA 3ICJA 4TMCA 1B4EA 3VNLA 3WLQA 4NVTA 2ZRVA 2YDAA 3GDLA 3WQPA 2ZA3A 3LCXA 1EPXA 3BXWA 1ISXA 4KFNA 1PVNA 3QOMA 1EC8A 3BSMA 1W9PA 2Y62A 4IIBA 4D6EA 4IIFA 2B7OA 3EWXA 5M03A 3PJWA 1CEOA 2Y2WA 1HQTA 4HJFA 4HCDA 4QHRA 2VO5A 1PZ1A 2F8QA 3TSDA 3M0MA 1BYDA 1JIBA 1DIDA 1S46A 4KIEA 1WB0A 4N2YA 3EOOA 2XIBA 2Y89A 4IXHA 2DH3A 1DL3A 2QJGA 3K5XA 4K38A 1ZHAA 3W6YA 3EWCA 2QDHA 3HQNA 2HROA 4ZOCA 3I7RA 2V2HA 5EMUA 3FJ4A 3KUMA 4MFDA 3SQSA 2AGTA 1IWBA 2D23A 4L4PA 3RPMA 1EJVC 3TLQA 1XLHA 2VMFA 4DEFA 2BVWA 1T96A 1ADSA 3VOJA 1TE6A 4EOUA 4D6GA 4C1KA 3VZXA 1J79A 3G3DA 1SZFA 2E1DA 2PDNA 1RK5A 3DYOA 1XF0A 3LPFA 3QMTA 3VD7A 4DAIA 4KWOA 3GH5A 3GFXA 4EE9A 2PDXA 1HZYA 2CCRA 4Y90A 3P82A 2VWTA 3GTHA 1DWHM 4FLOA 3IGSA 3ZM8A 2VL4A 4AH7A 4WDTA 2Z7KA 4I7WA 3P67A 2JF6A 3UZXA 2OQYA 3WEZA 2GDQA 3MBFA 4JFTA 1FKXA 4WHBA 2J7EA 3UCCA 3WQOA 3ZIZA 2JEQA 2CIPA 5G2WA 3KAOA 1I2OA 4NJJA 2NX9A 1XLGA 4GI9A 4D8ZA 2V2CA 1J01A 4DJEC 2QR6A 3L4ZA 3WQ6A 2XWEA 5GJNA 3S5SA 2QGYA 4BF9A 4Q6JA 3LENA 3SBFA 4JQ4A 1OX4A 2PCEA 1JCLA 4MMWA 4N9DA 3PWIA 1R7OA 4DYKA 2Z28A 4Y9NA 3AHZA 5GVJA 5EMJA 2VC9A 4REQA 3T2QA 1BG4A 4X63A 3RXZA 4GH1A 9XIAA 5D2TA 3NURA 4LVDA 2YXGA 1V6YA 1GOMA 5FIPA 4Z1AA 3L5AA 4HYWA 3VCRA 5DRIA 1LWHA 4C6IA 3L2MA 3RAOA 1RXOB 5G2IA 3DN5A 3LMYA 1UW9A 4LY4A 1LL7A 4Y96A 3THQA 5AC4A 1W1YA 3QFWA 1K8CA 1NVMA 1FX6A 1LRNA 2NQZA 1V79A 1JYXA 1T40A 4OZOA 3L5MA 2GWNA 2PDGA 5I3FA 4HSOA 3IACA 3WMCA 3PPHA 3HMCA 2WMKA 3PBMA 4FPSA 2WNZA 4ZZ9A 4MFEA 4EPEC 1RCQA 4HOXA 1FDJA 4MJMA 1E72M 3MV11 1W5MA 1L8NA 1OSEA 3RO6A 1TWWA 3WQFA 3BJTA 2VR5A 1PPIA 4QQ3A 4YWIA 4L6OA 3T05A 2ZRZA 1E6NA 4GJ1A 3GS6A 2OX4A 1S2TA 4PUNA 2YA2A 2ALRA 2WKJA 2G3MA 2XH0A 4QE1A 3VPLA 5A6TC 1TO3A 1IZKA 2PC4A 3PPGA 2G4JA 3MV01 3P8IA 1O5XA 5GNZA 4RE2A 2J25A 1LJYA 3NSXA 1OVDA 1TVPA 4JGDA 3AYVA 3CHFA 2PDIA 3L4WA 4B91A 2PZNA 3E5PA 1FHLA 1DTNA 1S5NA 3B40A 1HO1A 1TUXA 1UR9A 3EPMA 3KP1A 3OGSA 4JKMA 4IQEA 3USBA 1CGWA 2ZXBA 4KCTA 3DDMA 1P5BA 4BEQA 1FDZA 3W37A 2A3LA 3BW2A 1LRQA 5EMKA 7REQA 2XN0A 4JFUA 3U5YA 1QCWA 2Z1VA 2ZTKA 4NASA 4CD4A 4DHGA 2AL1A 2DIJA 1XIJA 3QTPA 4J40A 1SW7A 2EG6A 1I0BA 4A4AA 1XPGA 3AHXA 4FZIA 1XYAA 1FCVA 2D20A 2QIIA 4S23A 4WK9A 5BYWA 1PIFA 3EWZA 5DY3A 3RIKA 3IANA 4MY9A 4B2DA 3Q2DA 4C6LA 1F7BA 1B3YA 3KBWA 3VD9A 2HVNA 4AIUA 3QN3A 4HPHA 2Q6ZA 4ASTA 2XU2A 4A2SA 1R9YA 3FEMA 2OT1A 2Y8UA 1EHAA 1QTWA 2YFNA 1DWIM 1F3WA 2QVHA 3GNPA 1MVYA 1PUDA 2A3AA 1KXHA 4X22A 3C61A 2GVEA 1A5MC 1D8CA 1E4IA 5HQMA 4XZBA 1W2PA 4YMZA 2YYUA 3ARSA 1TJPA 1PX4A 1WE5A 3P84A 4P5UA 3HFTA 1UROA 3BDKA 4HA0A 1Q45A 2Z29A 3VGEA 5I3DA 3P3BA 2XISA 3MT1A 3HG4A 1E0UA 5EFFA 1LOLA 1MUMA 4LOCA 3ITCA 3N2OA 1WDPA 3IEBA 1W3HA 2NZLA 1XWYA 2WJFA 4UZSA 3OVRA 3W7QA 4ZE4A 1J2BA 3KCJA 1KCKA 3HPSA 2NWRA 3VINA 1ZLPA 3BAJA 3EMQA 4FSAA 4A3QA 1TX2A 1BSIA 3SCQA 2PF0A 1F4HA 3TTYA 4H3DA 2AGKA 4TU1A 1CXEA 4M1RA 2CHRA 1W8SA 3C8NA 4GNVA 1E56A 3T07A 2QYGA 2VC6A 5A2AA 4MUZA 1X6UA 3L12A 1XIHA 4JAWA 5CPNA 6REQA 4R33A 4C6KA 1FWEC 4I7VA 3ZT7A 1YTKA 4L1WA 3TR9A 4D6FA 1HKWA 2PDFA 2I9UA 3T0AA 2VFFA 4GZ7A 5LNSA 4FIRA 2PI6A 1XDLA 3FGCA 1MFVA 3OP2A 4UMBA 3JZUA 3M47A 2HTMA 2FFIA 1XLDA 3COTA 1IR1A 2WNWA 4DM1A 3HPZA 3CNYA 1C7SA 3C6CA 3NZQA 2O56A 2YSWA 3UESA 1MW2A 3G0UA 2TRSA 1PYMA 3NOEA 4L6HA 4GYPA 5HWNA 3DERA 4O28A 1W9BM 3GNOA 2V3EA 1XHGA 5CC7A 1EP1A 1SR9A 2A1YA 4AD3A 1PAMA 4JTRA 2OX1A 5AFDA 3MHGA 2J88A 2A3BA 5HDRA 3U2CA 5FOOA 3BG3A 3FEQA 3BQ5A 3OVQA 3NQDA 1BGAA 2OPJA 3PBWA 2PC8A 1YBQA 3D47A 4US6A 3FXGA 3AMCA 4EK7A 5FAGA 3TSBA 4RNFA 1Q65A 4X61A 2OLHA 3BL3A 3PANA 3CMGA 2FGBA 1VF8A 3AXMA 3KBVA 3OB8A 4ZTXA 4A6GA 3N2TA 3CL6A 3WUBA 1VBGA 2XVNA 5CJMA 3UNTA 4LVAA 4QE5A 3PK7A 1WDWA 2CERA 1XLFA 3P60A 1EJRC 4MJ4A 1O12A 1QNRA 1XLBA 4ZSUA 3M0KA 1SFJA 3N3TA 1YDVA 4JFWA 3MU7A 3T0BA 3N1AA 2J74A 1RALA 3PUDA 4MNKA 3UZWA 3M0YA 5KZMA 5TIMA 2PWUA 1RVGA 1BF6A 2FTPA 3DESA 1TUFA 4PUDA 2Q3RA 2ZX7A 3C2EA 4MB4A 5C9WA 1LQ0A 1ML1A 3A5VA 1SZNA 5JBEA 4QJ1A 4AB4A 3W7EA 4RXGA 1K77A 2PA6A 3H53A 3OHIA 1UH2A 3WDRA 4OBSA 2HDJA 3NSNA 4GACA 1IT0A 4G2DA 1EPVA 3OW1A 1VFSA 1MZHA 4C6DA 2XGZA 3VOGA 1W32A 1VD6A 3UXKA 3SCSA 5I02A 9RUBA 3QR3A 2RAGA 5KETA 4Z1DA 3W26A 3K8MA 1LBFA 3CYJA 4S3BA 3ISIX 5CZ0A 1XV8A 1LG2A 2E1WA 4Q7BA 1GOWA 1M7PA 1PCKA 4HK7A 2NW0A 1JPMA 3BOXA 4PB4A 4JNMA 4QR6A 4GZJA 3WQCA 4M56A 4GPNA 4MIMA 2XINA 3SCWA 3FKKA 4JTTA 5EBUA 4O1DA 5I3JA 3ITYA 4EF8A 1QRQA 3H22A 1JI2A 3H4GA 1BWLA 3TR2A 4JX5A 4AD4A 1QNSA 4ZXLA 3D46A 5FF2A 2O9RA 1PKMA 3DENA 1P1MA 2D0GA 2GWGA 3L4YA 4KEVA 1XI3A 4UXDA 1R6WA 3MCNA 4Q8NA 4B16A 1XRSA 3MMDA 4Z2IA 1ELSA 4H00A 4HZ8A 1PSCA 4BK9A 1N2VA 2E7FA 2RDUA 5H1WA 4A8IA 4YTRA 1FCBA 4LUJA 3QR0A 2H9AB 1OGBA 3GU9A 4UFKA 2XVKA 1ITQA 1EZWA 3KOWA 5CPLA 1A3WA 4HYRA 5I23A 3H55A 3SGGA 1RBLA 4PH6A 2W27A 4I3GA 1DJQA 1OFEA 2D2HA 2IXVA 2WZTA 3BLLA 4TMBA 4YIWA 2ANUA 1PTGA 2CZ5A 4UNIA 2IQTA 4GVIA 1NIUA 2BFGA 3BARA 3LM3A 2Y85A 1LL4A 3FXYA 3BURA 5FF7A 3T8QA 1XQKA 4JTLA 3U2ZA 2EXOA 2QMJA 1V3HA 3D3FA 4ORMA 1G01A 1W8GA 4AG0A 2X0SA 3EGJA 3UXAA 1RUSA 2JIEA 1B4KA 3LHUA 3G5EA 3N9KA 1PS9A 4CN1A 1US2A 1MNZA 4J3XA 3ERPA 1E4LA 2DGAA 3HN3A 4QAIA 1AW1A 2G97A 3VNYA 4XO6A 4QEHA 5HMFA 3R43A 2G4FA 1DJIA 1J0JA 2WO5A 3F1QA 1AH4A 3IRDA 3VKJA 3PS7A 2QUTA 1MUWA 1EGZA 3NAVA 3MTWA 3BG5A 4HMEA 2WHJA 3W83A 1JZ3A 3BCDA 4Q8VA 1E55A 3F2CA 1PX8A 2C71A 1R85A 4XVEA 1A5KC 3TJXA 3OTRA 4X3ZA 1GONA 3EWUA 4IZGA 1TG7A 4BHYA 4N9EA 3ZMRA 3PZIA 3BUVA 2YBTA 4ACYA 2TAAA 1PTDA 1AD1A 2PDQA 3UGVA 1QNQA 2H8XA 3AALA 1PJ9A 1LUCA 4UMCA 3E9AA 3R7MA 3DKJA 5CBBA 1WZKA 3VKDA 4AIEA 1OD0A 1JPKA 3UYCA 3RRXA 2CWNA 3SGZA 3GXTA 3G6MA 2WC7A 2VCBA 2VEMA 2F2HA 2JKAA 3STEA 3V75A 2QF8A 2E9LA 2FGZA 2VRQA 3GYCA 5K4ZA 2HMCA 1RVKA 1ECQA 1OCQA 3UXIA 3ZR4A 3MKKA 1H0GA 1T99A 4HN8A 1IT7A 4IF2A 5AECA 4O1BA 3ZO9A 3TTOA 2X41A 1LWIA 2GGEA 3AXIA 2DJXA 4HU3A 1YXDA 3TN3A 1TWDA 3QQ0A 2OKTA 3A4XA 2WSPA 1BEUA 5CG7A 1J6PA 3FW6A 4W8BA 3GAYA 2VVNA 1XFCA 4JTEA 1RJPA 1S5MA 2PLJA 3WD0A 4URIA 2BHZA 6XIAA 1L2UA 3LXAA 3M5YA 1JR1A 4KETA 4WRHA 4PRRA 1EJSC 2FVMA 2WHLA 3TONA 3IIPA 4IPIA 3KOYA 3SSZA 2Y0FA 4YU1A 3B9DA 3G1SA 2UV8G 4I5RA 1F6YA 4LF1A 1Z42A 4E8CA 4LAOA 3GQYA 4D6DA 1TKKA 5I5RA 4F9JA 2PP0A 3PZOA 5E6YA 2ZFAA 1VHCA 5DXYA 5BOFA 4ACZB 1L6YA 4HPNA 4MZYA 2EGZA 2DP3A 4AD1A 1N8FA 1FRBA 3GH4A 3O6YX 4S38A 1Q63A 1NTHA 4L61A 1HXJA 2FJKA 1KFWA 2AKZA 3IARA 3A3XA 4Y7EA 4CD7A 1A5CA 3HU7A 4UTJA 4V1XA 2XVLA 1LBMA 1BAGA 4FP1A 4HPJA 2BY1A 3T09A 4LUIA 1PX3A 3FLUA 4Q4MA 3G1VA 4DYEA 3M43A 2QUMA 1GPWA 1EOMA 4QJ3B 4JIQA 3WL0A 4LAUA 2D2OA 3RITA 4XD5A 3DFHA 4YCPA 6PTDA 2FHCA 2H90A 1OBAA 3U3HA 4DZ5A 3QOKA 2PE4A 1PZ0A 4HK5A 3RCMA 4ICMA 1V77A 1FWDC 3CT7A 4E2VA 1V0NA 3WX7A 5DN1A 1HJUA 4LVBA 6TAAA 4GCAA 3CASA 3GR4A 3W84A 1I60A 1OX4B 5L9FA 3VIJA 1PIGA 3PM6A 4B4FA 4AXNA 2O0TA 3VUSA 4GD0A 1TWSA 3EXTA 3MMUA 2OCZA 1V02E 1V93A 3VFLA 4QSHA 2I5GA 4REQB 5E9XA 2ABAA 3PG8A 3HV9A 2WC4A 5IDIA 1XBXA 1TX0A 2CLMA 3SRFA 2J27A 4O0QA 2A7RA 4C6QA 1KC7A 3I3BA 4JHMA 3B4UA 3R0DA 4U10A 1TPUA 5LGZA 4WSJA 1UWQA 5G4HC 1PCWA 4U2YA 4ZEPA 3AHTA 4U33A 4GJIA 1P7TB 4AHQA 3R58A 3WNLA 2YPIA 1WX0A 4X9YA 3ZJ6A 3SW6A 5A6BD 3HV8A 4KF1A 4FNSA 3MSGA 4UR8A 5MKGA 4RZ6A 4Z08A 1O66A 4R7OA 4LBUA 4HZ6A 3H7UA 2OEJA 1UC4A 2CNCA 3TMLA 4J9JA 3PJUA 1OABA 1HGWA 5I07A 4TIMA 1S2VA 3HFYA 5FA5A 2NXHA 1H7XA 2PSNA 3G1YA 2I9EA 5G4WA 4YN5A 2J8FA 1F76A 1TTJA 1FHVA 1C9DA 4WCJA 4HU0A 4PUKA 3M0IA 1AQMA 1QPQA 2R1MA 4IQLA 1NOFA 4BZYA 5DFAA 3DHDA 4U4MA 4CQDA 3AIUA 4A8LA 1XISA 3WLOA 4LALA 3R25A 1EGVA 3LN3A 3T1GA 4GYPC 1TIWA 4UTLA 4TTGA 4AVFA 2Y63A 4YPJA 2B7PA 2PP1A 4OWGA 1JI1A 1Q2SA 4LB3A 4HHPA 2ZCGA 4HNVA 3WQVA 3BCJA 1EDTA 1DP0A 3UVAA 4PEEA 4LH8A 4W5UA 3NPXA 4JX4A 5K3VA 3GU1A 4C1NA 1QJWA 4HPGA 3PF3A 1DVJA 7REQB 3UU0A 2DT3A 3U4AA 4U5IA 3E0FA 5DF0A 2FZNA 2TSYA 4LYRA 2E68A 5LA1A 1GVEA 1VJIA 3SSJA 3O15A 3EZ4A 4O54A 1OGGA 2I57A 4FR1A 4HMCA 5BRBA 3GG7A 1WO2A 3WDIA 1LQAA 1WP6A 3EKLA 3PSVA 5BWAA 3O0FA 4GI6A 2FDSA 1GQJA 3TFXA 4WF7A 3LPPA 2RGMA 2J66A 1AMKA 3GC5A 1NM9A 3HPXA 4GI4A 1SO6A 3EBVA 3TOYA 5C5YA 5B7ZA 3IVTA 1ZCCA 1HO4A 3PWGA 3WF4A 3PAOA 2E3ZA 1S38A 1VQTA 8RUCA 2OGYA 3ANUA 3SN1A 5BMWA 4HIBA 1GW1A 2UY5A 1V4YA 4AZ7A 4X2PA 1V0MA 1OIMA 1UD3A 4CD6A 3AS0A 4UTFA 1ICQA 1GYLA 2J7HA 3WN6A 3CHEA 4K3ZA 2FHFA 4FR6A 2BLEA 2C0AA 3MKCA 1PEZA 3WK0A 1F2JA 4J3UA 1HL2A 3S42A 3ARVA 4IG2A 5RUBA 2X42A 5CBIA 2PBOA 2C1IA 2W67A 3WUEA 3W82A 2JEPA 5HULA 1WCGA 3PR2A 4WR3A 3CT2A 1KM6A 4GKTA 1XBYA 3N18A 1TWIA 1U5HA 2BDQA 1IZCA 4AYGA 2WSQA 3S83A 1ZJBA 5FSEC 1WYIA 4RDZA 2G3JA 1UZDA 4FXJA 4ICNA 3M5ZA 2YBVA 5CPTA 4MWAD 1VBUA 5FESA 4PCNA 4F8XA 4J7RA 1I8JA 1OD8A 1NWUA 2QT3A 2HBXA 3VGHA 1TA3A 1WKDA 1XLLA 1WAWA 3ZR5A 6REQB 3A47A 3EEZA 2QUVA 3DC8A 2PPGA 5I0DA 4J1OA 1H63A 4UTWA 3ID7A 2GGIA 3FGCB 5FD0A 3WENA 1A4LA 3B3DA 3RF9A 3L7RA 1DPMA 3QPZA 4TQTA 2ZWYA 4I9MA 1D7FA 4BI6A 3TFCA 4AQLA 2XPKA 1QFEA 4M1BA 4PN2A 3QGAC 5U7SA 4GA8A 3GHSA 5KSWA 3TYBA 1FWGC 5EBAA 1CX9A 1WDSA 4EPKA 4N6FA 4JL2A 3DHPA 3W53A 3WK1A 1Z3NA 1THFD 3W2KA 3OQ8A 3REQA 4WKHA 3GY1A 3UG8A 3NQ7A 5JU6A 2G95A 5E0FA 4FOJA 1P0DA 3MW7A 1ZS2A 2XM1A 4UIOA 1G4PA 4IWWA 1V6VA 5HANA 5AY7A 1WNOA 4Z2LA 4AMAA 3L0KA 1TTQA 4DBEA 3UA3A 4HTBA 2VCAA 3ZVHA 1HKMA 1MUCA 4IUGA 1J0YA 1YBQB 3NG3A 3B8IA 1VGAA 4PMJA 1GK8A 3SB0A 2OQHA 3MKVA 1CENA 4AU0A 3B8SA 6TIMA 1DE5A 2XIMA 4UOZA 4BQ3A 4O1CA 1ONEA 1M01A 4G6CA 4A21A 3UY7A 4BY3A 4BR1A 2YCIX 1UMLA 1T41A 2GQAA 3ABQA 4PSPA 2G37A 4ZO7A 4A05A 4M3PA 5IM51 3KVJA 5BW6A 5GJMA 1V0KA 1Z6KA 4XD3A 2O7QA 1ZB5A 4GK8A 4JYEA 2Q01A 2J8GA 1F3EA 3LX9A 3TK7A 1JGIA 1CW2A 1JFHA 5JUVA 3POHA 3UWVA 3ZJ7A 1NWRA 1C92A 4Z42C 3UBPC 1W37A 1Q66A 4Q8MA 3O0KA 2Y8VA 2CZEA 5CPSA 4UWMA 3W7RA 2HPIA 2ZE3A 4J2MA 3G1HA 1AA1B 4YJ5A 1B9ZA 3KM8A 3P6LA 2PLKA 3S2JA 3M6YA 2ASHA 4V1YA 1N8IA 4DJFA 1YNQA 4JN8A 4PMDA 3OZOA 3I6RA 1H61A 3GKFA 2BWGA 1UR0A 2JKPA 4WXYA 1H1YA 5DO8A 3QZ6A 5DELA 2X7VA 1K7FA 4QGCA 5HJXA 3G77A 1YNPA 1TMQA 1X6LA 1VEMA 1M6JA 3DFSA 1TIMA 2BY0A 4IGNA 2D69A 2XFRA 3TMQA 3HJEA 5CEWA 4DPPA 3OU8A 1C3FA 1HJXA 4PEKA 4AVNA 2VRJA 1E40A 2E09A 1AMYA 4IX0A 5C8BB 1GVOA 3M1ZA 1O4UA 3C3UA 1KFEA 3F4DA 1NOWA 1EA9C 3NJ3A 4HPXA 1OCJA 2NVDA 3S1VA 3ATYA 3BICA 5AHMA 4Q3MA 3CXOA 5AYIA 3CLWA 2Z24A 2NSOA 4AWUA 3LXCA 1W0MA 1B54A 3ZFHA 3E5BA 2C79A 3EYPA 1UH4A 2VEKA 3HQOA 4M0XA 4QFUA 4H6QA 5A95A 1TCMA 1BQGA 3DBPA 3QPEA 1JCNA 3DEQA 4J3WA 3SDOA 2OKOA 2PDMA 5DT5A 3H7RA 2Q8XA 3EA1A 2Z2BA 3KVMA 2ZXQA 3RMEA 3EWWA 3LBMA 3A24A 1U5VA 1XC4A 5M3WA 2OWWA 4WGXA 3MWCA 3SI9A 1S2AA 5JQ9A 1BG9A 2HE8A 1R9ZA 5A6BA 1KXVA 3FDGA 3NQEA 4NSBA 2WHMA 3SY1A 4OVXA 3IRSA 3N29A 1DE6A 3S2CA 5E09A 1TQJA 1FWAC 2DZWA 1WDDA 1NFGA 2BHUA 4WQ6A 3GTFA 4Z1BA 3WQ8A 5HJYA 5HINA 2A85A 2Z6IA 3EKGA 4H9VA 4QDPA 5E93A 2ZXDA 2J62A 4MAVA 3UJSA 2WW5A 1U5JA 1BXCA 4AX6A 1TV7A 1FFQA 1XIDA 5F1VA 3N19B 3FAWA 5CGMA 3THAA 5A6SA 1C8XA 1XIIA 3OOQA 3IJ8A 1D9EA 3AYTA 2NWSA 2D73A 2I5IA 2ZUMA 1R0MA 2WZEA 1R5YA 1XRFA 4ONVA 4JZ5A 3GXDA 1XM3A 4XZLX 2DVUA 2PLCA 2BS9A 4I5UA 4GX9A 1AW5A 4F0KA 1QNPA 4KWVA 2YCKX 4NP7A 1B3VA 3RPDA 3WLTA 4UFIA 4GUFA 1HG3A 3KLLA 1EB3A 4XWUA 7XIMA 4JIEA 3LYEA 4AX7A 1LUCB 4E5TA 4JXCA 1R3SA 1H51A 3CBWA 2AQOA 3JS3A 1LTDA 3SO7A 1N8WA 4PMNA 2BHYA 4F48A 2PTXA 1V7AA 3PN8A 1RJRA 2F38A 4JIPA 1VYPX 3P0XA 3SY5A 2GK1A 3CU2A 4NI3A 3P5YA 1HKJA 2ZVRA 5FJOA 3LZ5A 2TPSA 3ARZA 1XCXA 3R11A 3C2OA 3AISA 4C91A 3CZJA 3CUFA 1D3HA 1TZ9A 3NQ8A 4I6VA 1P1XA 3UQNA 3GTIA 2C19A 4KFPA 1HF6A 3PZUA 1EQCA 2V82A 2Y7GA 2E9BA 2PMQA 1Z44A 4D8AA 1TV2A 4GC4A 1AL7A 3GUWA 2FKPA 4CD5A 2GGGA 2J7CA 2GDUA 3VFCA 2FMOA 4D71A 3ITVA 1JGMA 3I7SA 4IUOA 4CNSA 1ADDA 1X1OA 5JVLA 3VVGA 4R85A 3GTNA 3C52A 4D2JA 3BO9A 3R89A 3NQ2A 5AZ0A 3A3HA 4GABA 1NFPA 8CGTA 4BQ2A 1ME8A 1QI0A 3LD5A 4ZOEA 1JZ7A 1Q6QA 3TYDA 3AIRA 3CAVA 3CEPA 2WMFA 3NL5A 5H8UA 4Q7NA 5E70A 2DUZA 3W81A 1A5SA 3W2MA 1JZ4A 2F6KA 3OZYA 4GFSA 3DFYA 1E51A 3WJYA 4IX2A 1TTPA 3M0HA 3KTSA 3BJSA 1SO3A 3RJXA 5JIPA 4MWAA 1MZRA 4RW5A 2Q3OA 2OMAA 1GCYA 2WLZA 4AWTA 3O9NA 5C9UA 3DKLA 3CV1A 3GNNA 5AVNA 5AYYA 3UZJA 1XCWA 4DWDA 4M82A 2CPUA 1TR9A 3WLNA 1Q4WA 4PFHA 2PDYA 3RYSA 4O11A 1OZQA 4NT0A 2G41A 3KOFA 4I9TA 1EJ7L 3ARQA 4PTVA 3UJFA 3NTYA 3DAQA 4LAMA 4B5XA 3AHYA 4JTSA 4M6VA 1LLOA 4KEUA 1TV8A 3ANVA 3NL6A 3AOFA 3MA8A 5BRPA 1NOUA 3TNOA 1O5RA 2D1ZA 5IDZA 2DH2A 1ONRA 3K1GA 2RH9A 4GYFA 3RHGA 4IJCA 4K8GA 3DG6A 2DZTA 1K8XA 2ZX8A 3W2UA 1YPXA 3EA2A 3F5JA 1W1VA 4OIFA 4LYKA 1X7IA 3NGJA 3PTMA 3NM1A 3F5KA 1A47A 5HWJA 4H6KA 2E77A 1FWNA 3U2EA 3NZRA 1IWAA 4NAEA 1OJXA 3GM8A 4F2UA 3CWNA 3RLVA 1EX1A 4RNHA 4DJDA 1T5AA 5M17A 3CPUA 4XBJA 2PDWA 3C5QA 1W3KA 3HGOA 3OIXA 2OFJA 3CS2A 3OA3A 2PTZA 1SZRA 4OGZA 1FY6A 2PD5A 4RPPA 3SADA 2CXGA 2D0HA 2XN1A 3SQLA 4KGJA 5CPQA 5DMMA 2BNJA 2CEQA 4S2CA 1GWJA 3IJDA 2CBIA 2VEGA 3EPOA 2B31A 1AVAA 3GYEA 3GZAA 3GBDA 3FA4A 2FLIA 3CUIA 1QASA 2W62A 2ESCA 4XBSA 1SSGA 3WMLA 5LA2A 4IP7A 3HTWA 1UD2A 3OBKA 5D9OA 3LU2A 2WXDM 1H50A 1GJUA 1KA9F 4R7JA 4KBXA 1YTEA 3B06A 4FX8A 1H7PA 2NV2A 5MKGB 1B31A 1I4NA 4GY7A 2YYTA 2WMIA 4M29A 4H8UA 4YCOA 1E0TA 1XC6A 2ZTJA 3W22A 2HEJA 1XG4A 1Q6LA 4E8GA 2ADAA 1LF1A 3KZPA 4DBWA 1XJBA 4LV9A 4UTWC 3RM8A 5HK4A 2I5QA 1VPQA 2PFHA 4JEJA 1I9CB 1NP2A 4FF7A 3HGRA 4N4PA 3B8UA 3SRHA 1FUYA 2XM2A 2QKFA 4W7WA 2GSHA 3I4EA 2G5WA 3HQPA 4J4KA 4P2VA 3TTEA 2XZ9A 1UWSA 4E0CA 4FXRA 1OINA 5ABGA 3OYXA 5CJNA 3CUGA 3OLIA 1K3UA 1EWEA 4WX2A 4OJYA 4NU7A 3H26A 3EX1A 3R8GA 2PU0A 3G1XA 1AL8A 5LNUA 2C1GA 3V36A 2PLMA 1Y5VA 4WDXA 4IP4A 4NZFA 4P8VA 4ZODA 4BFAA 2WSRA 4C6FA 1SGJA 3UERA 1BTCA 3ZZ1A 1CXLA 1QATA 3LCHA 3NZ1A 1I2PA 1HKKA 3VX0A 4C1NB 4F3HA 2R14A 1ZAJA 3TN4A 1FWRA 3T8LA 2VRKA 3KBMA 4R53A 3AMKA 2QCDA 5F2IA 2I7GA 2JK2A 3W6MA 4ATWA 3MSDA 3V3WA 1KR0A 2KAUC 3R94A 1O7AA 3TQPA 3TXVA 5K9XA 1QOPA 1RP9A 1XYZA 3NPUA 3N34A 4JICA 3KRBA 4H9YA 4U3AA 2X2YA 3W28A 2A7NA 1HKIA 4YXGA 3S1WA 1EJWC 4A29A 1F9CA 4B9YA 4PRTA 3STFA 2VEIA 3AYSA 4B9ZA 5LSMA 4P7NA 1ME9A 3DG3A 4FF5A 5E1QA 1CCWB 4G5DA 1E1FA 3Q67A 3W7JA 3EOEA 1QPOA 4GZEA 2ACRA 6A3HA 3MDWA 4HU4A 1XH1A 4S1FA 1ZU8A 1FP8A 2PS2A 1KRMA 4XQ6A 1YTDA 2FFCA 1J5SA 4JNYA 4QLJA 2DSWA 2J6XA 4JDBA 2X0YA 4QRNA 4H6EA 4CQCA 2W4XA 1PDZA 3BJFA 4FEZA 2VENA 3CQ0A 3AROA 5HR6A 2XFWA 1OYCA 1EIBA 3MO7A 4DJFC 3BMXA 4AFYA 1E6RA 4CCZA 2DT1A 2GQ3A 3PJXA 3O7UA 2YL9A 5FEXA 2QIWA 3BANA 4IG2B 4RX0A 2XFFA 1DHPA 4XG1A 1CGUA 5F2LA 4B90A 3NOYA 2XIJA 5J5RA 4PGLA 1UUOA 3LEPA 1ADOA 1UD6A 2PWFA 4RDYA 5I06A 3FA5A 1S2UA 4GO9A 3CHDA 2H3DA 3VI2A 4F2BA 1DJXA 3PUEA 1E73M 4XTDA 1TCDA 1JF6A 3WF0A 2V8ZA 5IHSA 2ZQ0A 3SRDA 2NLYA 3UPBA 3OPSA 1TA3B 3WQ4A 2YB4A 3APGA 3R10A 4J27A 3P8JA 4CN6A 2NVAA 3DGBA 1PKLA 3IIOA 4ENLA 3INPA 3QBUA 3KWSA 2XWDA 1W3TA 2QAPA 4FMVA 3TROA 3WQWA 4EWJA 1EYWA 3WMBA 4HVXA 2RJHA 4AVOA 4S3EA 1HP5A 2C1HA 5D33A 1JUBA 1UR1A 1QO5A 5CSYA 1DJYA 5GJPA 2VKZG 4PB3A 1JQXA 1S3HA 1VBHA 2DORA 3GIYA 3QMRA 1YKWA 4MLRA 3QV7A 1LT7A 1K9DA 1JRCA 2BVTA 4IGSA 4HNOA 5BXSA 1UJQA 3ZXWA 1IT8A 4ZQOA 4Y9PA 4S2BA 3IAQA 4QQUA 1CT5A 4EAYA 4JD4A 3C56A 3P7YA 5HQEA 4L1GA 1M65A 4CNUA 1GJPA 4ZL1A 3AZSA 2IXUA 1Q7MA 1R2RA 2BY2A 1J96A 3A13A 4X0NA 1ZAIA 1KBBA 3ZVHB 1GTEA 2W79A 3OYZA 1EUAA 2E5DA 1OIFA 2R94A 2E67A 1EP3A 5SWUA 1MQQA 4XAGA 2G50A 4UQEA 5HWMA 3URNA 4H04A 1J9YA 3LV6A 1GOQA 3P81A 3MP4A 2GJPA 3G1AA 3T9PA 2PF8A 3OA5A 1HVXA 3WJWA 3LHVA 4IHCA 3CAKA 4FHAA 4J3VA 3N4EA 1GG0A 4K8HA 1EOKA 1UASA 3VKKA 4INFA 6ENLA 1WOBA 4H9TA 3BLFA 5J8LA 4L65A 4UUIA 3AIVA 1R8LA 1GVRA 4WDUA 3L4TA 4N02A 4MAZA 5EMYA 3EPNA 3W24A 2J8TA 1VR6A 2A6LA 2J7DA 1O5QA 5LIYX 4UTHA 4K7YA 1TQXA 1GGOA 3MI6A 1QPNA 4IFOA 4JTAA 4WVXA 5A8PA 1TJ2A 3BW3A 2IUZA 5G5IA 2VX6A 2W92A 1LWJA 2D0FA 1M9HA 2DIEA 1ESWA 4DLMA 4ZB5A 9XIMA 1H7NA 1SM9A 4ILSA 2OR2A 1S5WA 3F4WA 3OEXA 3W1RA 2BVYA 4D1IA 1VS1A 5AYZA 3H12A 3N6HA 1ALDA 3NSMA 1FWIC 2H8ZA 4KESA 3W6LA 2VGFA 5A94A 3IJ9A 3OBEA 1PDYA 3JR2A 1ITCA 3N17A 5CQ1A 5C71A 1X8CA 3H8AA 2DZBA 1G7UA 5D8WA 1UD5A 5EYWA 1L0PA 1HW6A 3TYUA 3LB0A 3R79A 3W7OA 3WNPA 4QIUA 1Y7VA 3CC1A 3JRKA 3AU6A 1MQPA 1FHDA 1NELA 4KMQA 1EX5A 4KS0A 1KRBC 1IIHA 2V3GA 2Z7GA 3A9IA 2GJLA 3XISA 5FL0A 4IM4A 3EDFA 4LTSA 1KLYA 3KRUA 1K7EA 2CZDA 5A8OA 4OV9A 1ZPTA 2OG9A 7ODCA 1EYEA 1P0KA 4JBRA 3SY8A 4IJRA 2YW4A 4XUYA 3TEVA 3BK0A 1KGUA 3GZ3A 2QLYA 3LGEA 2G8ZA 3MP5A 3VIGA 1KM5A 4JCLA 3QW3A 4ZOAA 4PZVA 4HBKA 7A3HA 3AWNA 3V0TA 4RW3A 1CB2A 2AQWA 3BGJA 4W88A 3UZYA 2DUXA 2ABBA 2PODA 1RQEA 3VGDA 2C14A 5LA0A 4MWAC 4ADSA 5C9ZA 4S39A 1QBBA 2YCJA 1NEYA 5F4WA 4O1FA 3O2LA 4BEUA 5AC6A 3C2VA 2GDVA 1X38A 3RK8A 3Q4DA 2EPNA 3PBGA 3ITLA 3AFBA 2Y7DA 3NCOA 5DX7A 3TYAA 4A8NA 3T44A 1UD8A 1Z89A 1EDQA 3I6EA 1TV5A 1A50A 2PDUA 2CXEA 3PAJA 1B30A 2WCSA 5ABFA 1RAKA 4PMRA 3M7WA 3GC2A 3N11A 4PBGA 3MUAA 3MBDA 2FVLA 1OZMA 1GVQA 1GPFA 2B7QA 2QPXA 2ODOA 2DT0A 1KCZA 1TPC1 2WVSA 4R9OA 5LHEA 5G1MA 1V3KA 2Q09A 1EIXA 3RLUA 2OZTA 2WLYA 3LS9A 4DY1A 4FK9A 1W3JA 1E9ZB 1MW0A 1CB7B 4MZ8A 1GT8A 1LOQA 4UTUA 4KIRA 1JDDA 4DIAA 1ISWA 1RCOB 4M6QA 3W1PA 1GVYA 4RPQA 4ERGA 4F79A 2IQDA 4DJDC 3WD3A 1XGEA 1M41A 4AMCA 3AYRA 1PO9A 3NA8A 2OYMA 5EFDA 4NXSA 4E6MA 2CETA 5AOUA 2A0NA 4E8DA 4V27A 4L4LA 3EDKA 4ZO8A 2AL2A 1F5ZA 1OYBA 1ZBWA 4K6AA 4HK6A 4D1JA 4Q32A 3W1LA 4NHVA 3BTNA 1RP8A 2VXNA 1WOAA 5CGTA 2GK1B 3BAWA 4HNLA 4D72A 3QGKC 4RV8A 2QPSA 3A6OA 1SVDA 3LNPA 4NJGA 3ZWTA 3L9CA 5REQA 3NPWA 1EF3A 3PTQA 4NQ1A 2CC0A 3QEZA 1J12A 4HP5A 2VFEA 3PSWA 4IPLA 1P6CA 5D30A 1TRDA 3MANA 4DUOA 3NEHA 1W5PA 3V5FA 1FVPA 3DHFA 1KWGA 4HQVA 3JU2A 4NJHA 2PEVA 4Q7IA 1H11A 2GUUA 1I1WA 1W1IE 3WLKX 5A69A 3N6JA 2R6OA 1IE7C 1DJGA 1ZRQA 1O94A 4TO8A 1CGXA 1JEZA 1KM1A 4UR9A 2CLHA 3WF2A 4HYVA 1DHKA 2ATSA 2ZUVA 1VIWA 2FPVA 4TX9A 3WJXA 3CM4A 2YDRA 3N25A 1KGXA 4UOQA 4M6PA 1SR0A 1O68A 3MDUA 1I2NA 4IMCA 5D03A 1NSJA 1OT2A 5AYXA 1ZALA 2POTA 3WDPP 1SMDA 4LS0A 4C90A 1XIMA 2IQ0A 1HGYA 4LF2A 2BY3A 2QDGA 4S3DA 2G3NA 1TWZA 3IGHX 4EXBA 2VELA 3KS6A 3CIWA 3W01A 1MO0A 2IPJA 4WOQA 3K46A 3HGSA 2BGSA 4DWSA 3TYZA 4MWAB 1DXEA 2EPKX 2BX7A 1KBJA 2PB1A 3B9NA 3NL2A 3KRSA 1EUNA 3BGGA 1JDCA 4QCFA 2PGFA 1Q5MA 3IJ7A 3IV3A 3IPWA 1BRLA 4HMDA 5HOSA 3KEHA 3L4UA 4KWWA 4B4HA 3P93A 3SECA 1WXJA 4JTQA 1QR7A 3CV7A 3AJXA 2WQPA 3EX6A 4DF1A 2I14A 4MKNA 1FH8A 2D2JA 1QWGA 2C15A 2HCVA 4NG3A 3B9EA 4RE3A 1VEOA 2AAMA 1XH2A 1L8PA 1E43A 3U0HA 1MEIA 3AS3A 3M07A 4NZ4A 4H7ZA 4GQQA 1Q6OA 1MDLA 1OX6A 3RDKA 2EJ1A 3S2LA 5DXXA 4F2TA 4KPLA 2INFA 4NAEB 2WSYA 1VC4A 1PHWA 1E9LA 2J24A 1UWRA 4UFHA 2F6XA 5A8QA 3LPGA 3TC7A 3S9ZA 2OWCA 1Q6DA 2W3ZA 3QM3A 5KTLA 4DJED 1XXXA 3QVQA 7PTDA 1HJSA 3DBNA 3GIQA 4O13A 1A53A 3WFLA 3KL0A 3EAUA 1JRBA 4ACZA 4GX8A 2Z4GA 3N6QA 4AWSA 5ABTA 1PKNA 2JF7A 4DVOA 2WAGA 3ANYA 2QDDA 3RUBL 4Q4PA 3EA3A 4KWUA 3N2BA 3WH7A 3ZYZA 5I24A 3GG8A 2XIIA 4US5D 1SW3A 3S1XA 5I00A 1WZMA 4Z2HA 1T0OA 4FALA 3F4VA 2BP1A 4RDWA 3QTGA 3NQBA 1W1TA 2NX3A 5I2UA 3IIXA 5DCEA 3VGBA 1AJ0A 2VR2A 1VFFA 4H1ZA 2NT1A 3L5LA 2WMIB 3MJYA 2B81A 4M81A 4XBKA 3NNTA 2OLSA 1M7JA 3GXNA 3ZS4A 4O1EA 2HK0A 3W86A 4P8UA 5D32A 1NF7A 3EDDA 1V3IA 5D8ZA 3KDNA 4WIWA 8XIMA 4CLMA 4WKFA 4XVDA 2XH7A 1UH3A 4WSHA 5CH9A 1H09A 3ITTA 4S3KA 2XYLA 3VCNA 3L66A 3LM7A 1W1B1 4I7UA 3LY0A 3G8EA 4C6EA 3N14A 1RD5A 3A21A 2V9DA 4PBEA 3LQGA 1TTIA 2DSUA 5CAKA 2JGQA 1CTNA 3NDOA 3QGVA 4MKSA 2O55A 1SYTA 3M0XA 4H19A 2WNQA 3BMVA 2OTDA 3DC0A 4ATDA 1T8QA 3MUXA 1S2CA 1DIOA 2PTYA 2WV8A 3KP0A 1WUEA 1NAL1 1YE4A 4ZENA 3BWWA 1EC9A 2CZFA 1P6WA 1F3TA 5BWFA 5F7UA 4PMQA 2VOTA 1S39A 2ZDSA 3THDA 4GINA 4GBDA 5HA7A 4Q33A 3SRKA 3VZYA 2R1LA 2QCDB 4UCFA 3WDQA 5LIWX 2ZRYA 2B7NA 3BAIA 2RKXA 3QC3A 1P7TA 3FVDA 5E9AA 2BZNA 3KTCA 1Y5WA 3F2BA 3MI2A 3BVJA 2QS8A 1BKSA 2DSVA 2V63A 4LANA 2Z00A 4TR9A 2O9TA 4M80A 1LG1A 3IS4A 3TV8A 3KDOA 1HVQA 1KNWA 4GLEA 2GJXA 3VD5A 4KRTA 5XIMA 2EPOA 1XGDA 3E6EA 2FZDA 2DZSA 1Q13A 4O15A 4Z2JA 4DBUA 1NDVA 2WCGA 4R7WA 5LXXA 4IP5A 1UZHA 1QW9A 2P0IA 3LTPA 3GRIA 4LAZA 2GOUA 3HBLA 2J75A 5AYBA 2IS7A 3H2MA 5DCBA 2XGBA 1M5WA 4OBRA 4UFMA 3GUGA 4O4WA 1MW1A 1J18A 1FCUA 4H7CA 5JIWA 3EB3A 1J10A 4GXPA 2ACUA 3LRKA 2ZZ1A 2QJNA 1OK6A 3WMSA 3W1AA 2CLOA 3NDZA 2YL5A 3ABZA 4IL0A 1RLDA 4LVGA 3W72A 3W74A 4GXMA 4ZBCA 1EFZA 2INZA 3OG2A 4DXKA 4M8UA 1A4MA 3LV5A 4JIIX 3VX1A 3E0VA 4M6UA 2VDGA 1IYXA 1CGYA 3A5FA 3N9SA 5GQBA 1DWFM 2FIQA 4IJBA 3S2NA 2VZVA 1AZ1A 1IIGA 3G0SA 4POCA 4KRZA 4FI4A 1E1EA 4TV5A 1JD7A 3R6IA 1V6XA 1XD0A 2VDHA 3VNJA 2GGHA 1J0IA 3P80A 3ZWSA 1HFBA 2ZX5A 1VB9A 2JFEX 1XIEA 4NZ1A 5JH1A 4OT7A 1R3WA 4H4IA 2OYKA 3W2JA 4OUIA 3B4YA 4JL1A 3CTTA 4PTNA 3W0KA 1AK5A 3L21A 4ZO9A 2XG9A 4P7OA 4GE8A 3L0GA 5H8PA 2EG7A 1GKQA 4ZB0A 2ISWA 1YQ2A 5LKYA 4IFKB 4IOTA 4J5NA 3D0CA 4RUBA 3LSCA 2GGJA 4HU8A 2FPYA 3W7CA 1CYGA 3MSRA 4CVWA 2DFAA 1JQVA 2Z2UA 4D8LA 1OF6A 3NWRA 1BFNA 2OWXA 3LRLA 1YDYA 1WA3A 1X8FA 2CITA 4MB1A 3VM7A 4Y2WA 3BMWA 3CGTA 1XP3A 3CQHA 1KV8A 1CGTA 1GEHA 3STGA 3TLLA 8TIMA 1R87A 3E1F1 3Q94A 4IXXA 1F74A 1KWKA 3DCPA 3MHFA 1YE6A 1QK0A 4GQ0A 3AS2A 1H60A 4RZ4A 1W31A 1NJJA 4PMZA 1M1BA 3O63A 2VZOA 2GVLA 1UBPC 2F6UA 3AZRA 3OGRA 4A22A 3M4HA 3H24A 3NVDA 4IPJA 5A6LA 1BSLA 3EOLA 1FFRA 2Z1WA 4GRSA 1W9DM 4YNGA 3TZNA 1IHIA 2WVTA 4XZMX 1WKFA 1DV7A 2W61A 2REQA 5CAHA 3DYMA 4AZCA 1F8IA 2E5BA 3L65A 1CXIA 1JCTA 3TYEA 3HURA 1JULA 3GHTA 2FH6A 4MTVA 2ZUTA 4HTYA 2A79A 3QZEA 2CU0A 2WMJA 4NJKA 4EANA 4DZAA 2VTFA 4D6JA 1PIIA 3CUXA 2EAWA 1CECA 7ENLA 1SJDA 4HN4A 4TXEA 3V7PA 3VU2A 1M53A 4JTFA 2GFTA 3BZGA 4LBSA 3UG5A 1A80A 5FJJA 5G1YA 3CB3A 1WZLA 1J11A 3TKFA 3UF9A 4IGHA 3CYVA 5KINA 1A5OC 1BXBA 3KL3A 4LCSA 2RFGA 4CD8A 4GHRA 1TRIA 2EJAA 3LCWA 3TIMA 3WEMA 3TCEA 2GLKA 1CWYA 3VC6A 1KTNA 4GY1A 4L64A 4W85A 3IVUA 1DOSA 2QNEA 1B3XA 3GFYA 3MC5A 4UNKA 1E1CA 4DELA 1GYNA 2V30A 5ENLA 1XINA 4LUSA 4NY2A 1WQ5A 4HZMA 1JD9A 3NXFA 5E6ZA 5C0QA 4I8YA 1C7TA 4LCQA 2WYSA 3BLDA 1ODUA 2ACQA 3VM5A 1ECEA 2YOCA 3W27A 4ZTYA 3APYA 2J7BA 4K1WA 3B04A 3KWXA 1X96A 2OSYA 3TX9A 3GDRA 4QS6A 1FBAA 3GSMA 4C5YA 3DFQA 3L23A 2OO6A 2YJQA 3BZJA 2O9PA 3R0UA 2E6AA 4GFIA 1EA0A 2HZGA 3QQ1A 4JN6A 2Y1HA 4EIVA 1I6NA 1NH6A 3CZEA 3VGFA 5I3IA 3T0TA 5I7GA 3WJSA 4DWSC 3GU2A 3M0VA 2CHNA 3VOHA 3EDEA 3KCOA 4TVDA 1GVIA 1TB3A 2PDKA 1FWWA 3NM3A 2A5HA 5HMDA 2GJNA 1PZ3A 4EF9A 3R12A 4H2HA 4IH3A 2VX7A 3SUSA 3TVAA 4CKQA 1RPKA 2PURA 2ACSA 3VE7A 4LS1A 1IGWA 3PUOA 3WF1A 4FXFA 5ABFB 3PULA 1AD4A 2QPUA 2R24A 1NY1A 1Y5XA 1LDCA 1JCYA 1XLKA 3BH4A 3P61A 2V81A 3RRAA 3QPYA 3IK4A 3VDAA 1UA7A 3UZ5A 1JDAA 2PDCA 4JDYA 3P14A 5FKYA 4ZA0A 3H54A 4UZUA 1VCGA 1LLZA 2QAFA 3QHMA 3WLMA 4DM2A 5LNWA 1H7WA 2FZBA 1P43A 5IHRA 2X1UA 3AXKA 4G8TA 1TR1A 4Q8OA 5BMXA 2NVCA 4YVXA 2GYIA 1G5AA 5I78A 2ZICA 1EWDA 4FLRA 2XIOA 4K37A 3TA6A 1KFCA 3SCRA 3TJLA 4AC1X 2AL2B 1Q6GA 3CZLA 4PODA 1TYGA 2OLAA 3KHJA 3S9IA 3NO3A 2HBVA 4K39A 3I10A 4TTUA 3VOIA 4NNAA 1GJWA 4CQ9A 1RHCA 2OZ8A 4V33A 3E0WA 4QX4A 4CQAA 1WDRA 3WYZA 3B0PA 1NWTA 3PG9A 4S3AA 3LI0A 2WNNA 3N04A 4O18A 3F4CA 4JFSA 2GOKA 1IXQA 4CNPA 4C6JA 3ELFA 5REQB 1H7OA 3WQEA 2ZXAA 3K2GA 3PB0A 3QHNA 3FDKA 2PBGA 3S6OA 3HG5A 2HXUA 4A3YA 4U3CA 4XSLA 4AISA 3M6DA 4ROQA 5D04C 2ZC1A 1PTAA 1V08A 2E6DA 2VFDA 3A4WA 3VKBA 3KHDA 1OG6A 4DLFA 1KB3A 3FYYA 4YLWA 3LCGA 4GQBA 4UR7A 1Q8AA 5ECUA 1TV4A 1UP0A 4M7SA 3R5EA 4Z0SA 5CG0A 4MWAE 2OELA 3LCLA 1FH7A 1S3TC 2WVVA 1GOKA 2A3EA 2UY3A 1OC5A 1QNOA 2QCGA 4ERAA 1UOZA 2IKJA 5CLTA 1RPXA 1QW7A 1KRCC 4QTGA 3GX9A 3NQMA 3UWUA 1L6WA 3R1ZA 4LAKA 3ABRA 1X1NA 2CHOA 1E6PA 2WZMA 2EQDA 1QW8A 3SM0A 1H0IA 3UCDA 1EJXC 3QY7A 4YTQA 2Y70A 1R3TA 4EX4A 1QWKA 3HJZA 3GXFA 3MO4A 1W54A 4GISA 3SIMA 1OFPA 2DPEA 1OC7A 3L2IA 2BVDA 2NUWA 2PGEA 4DWSB 3CO4A 2H3BA 4R3UA 1TZ7A 1ODZA 2EO7A 1OFBA 5DEZA 1C90A 1EGMA 3W38A 3CAQA 7CGTA 1BRLB 2GUYA 2DQWA 3W85A 1DORA 1HKVA 4GYKA 2ZYFA 3VYLA 3G18A 3CL7A 2C0HA 1Q8JA 3WY1A 3QRHA 3T0DA 5DBTA 1CGVA 5CGQA 3CTLA 1QI2A 1RY0A 3KCLA 3GH7A 3THCA 4JS3A 2UZ9A 3M5XA 1YADA 5T91A 4FOUA 2FYMA 1VFUA 4JY9A 5K9CA 3KOXA 1EEXA 4N42A 4ML9A 3DYPA 4XZNX 2HJPA 3CB8A 4GIYA 2QHAA 3G22A 3AXHA 3UWYA 3WLRA 3GXIA 3HPFA 5B80A 1IEVA 1P48A 3HG2A 1RK6A 1QAPA 3QSRA 5BROA 2CW6A 1EZ2A 1V03A 3NQ6A 3B03A 1E3XA 3KOZA 1R3YA 5FJTA 1H49A 5DCDA 2QJIA 3NZPA 4PCSA 2Y7FA 1ONWA 2YXXA 3ME3A 3VOCA 4E4UA 1H41A 1W3LA 1ZTVA 2NQLA 1HJQA 2O4MA 1E71M 2P5NA 4U2ZA 3AUOA 1ISVA 1UUQA 3A23A 3AXXA 4GQGA 5T9BG 4P61A 5TBOA 1FWHC 3SCNA 2VX5A 5A1AA 3WG6A 3URQA 1Y8BA 4NIRA 1Z8AA 1HP4A 1WUFA 4UQ9A 1SW0A 1K7XA 3FYPA