4W7VA

Crystal structure of xaccel5a in complex with cellobiose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
313
Chain Sequence
b'HMLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulase
publication title Crystal structure of XacCel5A in complex with cellobiose
rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 124
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w7vA00
5AC5A 4UR9A 5C71A 2WXDM 4GZEA 1JI1A 3KEHA 3EMZA 1KBBA 3IAQA 2OYKA 1F4HA 1PIFA 3ZT5A 3AMDA 3PZOA 1HP4A 3N9KA 1IZKA 1U33A 3GNPA 4GIAA 3AXIA 2JIEA 1W91A 3BLKA 3WNOA 1R7AA 4OJYA 2ZOXA 4CU8A 4KMQA 1LQ0A 1OT1A 2ZE0A 3MU7A 3KE0A 2GJPA 1J0KA 3PZQA 5CXPA 3ZJ8A 5E6YA 4DUXA 1BF2A 2WM0A 3AQUA 2J7FA 1KXQA 2W92A 3RM8A 4U31A 4W7UA 4B9ZA 2V5CA 3LPGA 4BZYA 1JG9A 3AMLA 1TZ7A 3WD2A 2VO5A 1JZ4A 3NJ3A 4BS0A 2XFFA 2VURA 4PMYA 1YQ2A 1UR9A 4UQAA 3WH7A 4Z2HA 1PJ9A 1JD7A 1E4IA 4FLQA 1XH0A 1EDTA 4D6DA 3G6MA 3AMGA 4WKAA 4IUGA 2ZX6A 4WKHA 4X9YA 2VQUA 4GI9A 3BAIA 4AEFA 1V02A 3K8LA 3CZEA 2CPUA 5CLTA 1C8XA 3S6TA 1XV8A 3AMCA 5A6KA 4AZ6A 2Y2WA 3VNZA 4DM2A 4C7GA 3VDBA 2X09A 1QNPA 1VEMA 4JFUA 1XH1A 4UNIA 3WQ4A 1V0KA 1EGZA 2ZX9A 2E4TA 1J11A 3MO4A 3U57A 1KXVA 5A2BA 1SMDA 2J7DA 1V6XA 3WQ5A 1XCXA 1US3A 2YDRA 3F5KA 5I78A 2XPKA 3OIHA 1SR0A 4Q22A 3CZJA 1DWHM 4MAVA 4W7VA 1GOWA 3RM4A 4GKLA 4AIEA 5CGTA 3ZT7A 4TTGA 5EFDA 1KR0A 3GTNA 3SUUA 3UCQA 3W37A 3DECA 3EMQA 1JAKA 1BGAA 1EXPA 1FHDA 3KZSA 1LWJA 3VIMA 5A6BD 4P7LA 2E3ZA 3MUAA 4F9DA 1GHRA 1MW0A 2VZUA 1KGWA 1QI0A 3AYRA 2DT0A 4ATLA 1CWYA 5LA1A 3LPPA 3NYDA 2OSXA 3QHMA 1QHZA 1OWQA 3VVGA 1BLIA 2ZX8A 2WC3A 2WNWA 1HX0A 5A6JA 2JIWA 4KRTA 4PSRA 4PTXA 3W6LA 2G3IA 3GNRA 1K9DA 3VGEA 4GZJA 1H5VA 2DH2A 1S46A 1JDDA 1V0LA 1P6WA 2CEQA 2F2HA 5BROA 4XX6A 3WF0A 2WMGA 5FOOA 1V6VA 2ZXAA 1UKSA 5A6MA 2CBIA 1UYQA 1J18A 3T2QA 5JBFA 4W88A 3B9AA 4WIWA 3W6MA 1MFUA 3DHUA 1CGVA 1PZ3A 1ESWA 2BHYA 3PZUA 5M3WA 4D6CA 4RE4A 2VZOA 1NP2A 3TTYA 4CVWA 4CD6A 1DEDA 3ZQ9A 3WH9A 3O9NA 1CLVA 1O6IA 2BFGA 1QBAA 4CN6A 4A4AA 2Y8KA 2D23A 5A6AA 2X2YA 4MB3A 2ZUMA 1VAHA 5D9NA 4J7RA 3PZMA 1BVZA 1UH2A 1MWOA 1HJSA 5TD4A 4ML4A 3IANA 4LQ1A 3AISA 3CMGA 1RP8A 1N82A 1Z32X 3VIIA 4AIOA 3CZ8A 2EXOA 2YL6A 3N04A 3TTQA 4AD0A 1L8NA 4Z2KA 1UD5A 2PWGA 1JZ3A 3VO0A 1JAEA 1UWUA 4B16A 4BF7A 1V02E 5I3DA 3SCVA 1HKKA 4M56A 1E71M 1H0IA 2J78A 1BSIA 3II1A 5BXSA 2E0PA 1W1YA 4MB5A 2YIHA 4DUWA 2VX4A 2NW0A 1XYFA 2DSUA 3VGDA 5A6BA 1W3LA 1BYBA 1Q6FA 3QR3A 1MW2A 2J7CA 3OGVA 3ARQA 3DC0A 2WCAA 2ZX7A 2EQDA 4AYSA 1GOOA 2ZUNA 1EO7A 3KL3A 3L4VA 3GH5A 1B3ZA 1KQYA 4KRUA 5CGMA 1WZKA 1G9HA 2YBUA 3W26A 5D9OA 1V3IA 2DSVA 3TONA 3UETA 1JYVA 1EOMA 4UOJA 1VEPA 1JZ7A 2PWHA 3WSUA 4E4PA 5I6SA 1LL7A 2CIPA 1MXGA 1WP6A 2VR4A 3O2LA 5BRPA 1BFNA 2VC9A 2BY0A 1E0VA 3VIJA 1WB0A 2J8FA 5IDIA 5A8OA 4JKLA 3CZGA 4CD7A 4W7WA 3OLIA 3OA5A 2Y4SA 1PAMA 1WZAA 3WDQA 1LL4A 3CMJA 4URIA 4UZSA 3T08A 2PI6A 4U3AA 1JXKA 3KWXA 3IK2A 5EFFA 1E0WA 4K68A 3FAWA 4YHEA 1X1NA 4ZXOA 3VMNA 4ATWA 4AZCB 1UD4A 2UY3A 4AEEA 1E6ZA 2D0HA 3SCQA 4AD3A 4ZXLA 2ZXDA 2JF7A 3ZSSA 3PTMA 3WUGA 1UQZA 2WKGA 4HPGA 3PTKA 4QCFA 3WL0A 3RCNA 1BAGA 2BVTA 5E0CA 3SCTA 5AC4A 1QI4A 3NUKA 4D6JA 4V27A 3NSNA 1CEOA 5HPCA 2VRKA 1OD8A 2WBGA 3CUIA 1ZBVA 2WLYA 1HF6A 3WN6A 3CH9A 1UR1A 5C8BB 3EDKA 4Z2GA 2GUYA 4MNKA 4D6EA 1MQPA 4H2CA 4GQQA 1OBAA 2DPEA 5E9AA 3ARPA 1RP9A 4TX6A 7TAAA 1ISWA 1W9UA 1GUVA 3AIVA 1B1YA 3RILA 4P7QA 4QDMA 4KH2A 3K4AA 3A4WA 2BY1A 1DHKA 2XSBA 2NT1A 2DT1A 1OIFA 1V3LA 3AXXA 2ZXQA 4P7NA 2C7FA 2WHJA 1D7FA 5HNNA 4PN2A 3FY1A 1E5NA 4UOQA 4AZIA 1UA7A 1V0NA 1CLXA 3VIKA 5BRQA 2O9TA 1EH9A 4UFMA 2VL4A 2FHFA 4UOZA 1UOKA 3A4AA 1US2A 3MUY1 1OIMA 1ZS2A 3ZSTA 2XM1A 4OZOA 5D9MA 3VGFA 3KL5A 4U5IA 3WUEA 2PB1A 1ZBCA 1JZ6A 1MW3A 3IJ7A 2YL5A 1A3HA 2CYGA 2WZIA 1LJYA 4PTWA 3PZGA 2J47A 1UWTA 3ARSA 4S3KA 4LGXA 1FH7A 1GW1A 2CBJA 1GQKA 2CBVA 1HVXA 3ARZA 2WHKA 3SUVA 3BH4A 4W5UA 3BCFA 4XZBA 2QHAA 3VIOA 1G01A 2D3NA 3GH4A 5CLWA 1E5JA 1JF6A 1VFMA 8CGTA 5LYRA 3MS8A 1RPKA 1LF1A 3OZOA 5JIPA 3PN8A 4HTYA 2FGLA 3I3BA 5I24A 3THCA 1JIBA 2JEQA 4LXFA 5I2UA 1E3XA 1QPKA 2VZTA 2WZEA 3W38A 4UZUA 3EYPA 4PMQA 3WY1A 1V6YA 3T2PA 4FLSA 4KGJA 1WCGA 4LYQA 1BGGA 1U2YA 3VM7A 1Q6EA 1EDGA 3WH5A 3SUSA 3D5HA 2D20A 2XM2A 4M29A 2VRQA 4PSPA 4HPHA 1QVBA 4J3SA 3VIGA 4AIUA 2OLHA 3BAJA 3RM9A 5AYIA 4B9YA 1E55A 3VD9A 1NWSA 3W0KA 1CXEA 4FLOA 1E6QM 2Q8XA 3BMWA 1H2JA 1HJQA 2Y8VA 3CHDA 1XCWA 4MADA 1AMYA 3WF4A 2E8ZA 4AZCA 2J4GA 2BXYA 2FHBA 4TVUA 3ZJ7A 3SIMA 5JIWA 4ATDA 1AVAA 3VD7A 2CNCA 3ZO9A 4J3TA 1XC6A 3WD4A 5I23A 3AHYA 3W81A 4TX8A 4E8CA 1UKOA 1FP9A 1H49A 2CETA 3QGVA 2J7BA 1V3HA 4QLLA 1C8YA 2W61A 4F66A 2Z1KA 3N12A 5E0FA 4A3HA 2G4FA 2GJRA 2F8QA 2JF6A 1UWRA 2D0GA 5LA2A 1PZ2A 4AMCA 1L0PA 3ARRA 2BNJA 3HU7A 1W1VA 4FLRA 1VFFA 1XD1A 1V03A 1OGBA 5ABFB 3AXHA 1DWAM 3VTRA 3GBEA 3VX0A 2ZWYA 1PEZA 4WF7A 1UQYA 1G5AA 3SCOA 4BQ2A 4MJ4A 2BS9A 1Q6CA 2G3JA 2A3CA 1DWJM 3W28A 2PWDA 1ZBKA 2WMFA 1KCLA 1NOFA 4H41A 4OBSA 2DSZA 3W29A 3B9DA 4JIEA 3WDIA 4OUEA 4IPLA 2ZUTA 1WDQA 1E1FA 1ZU8A 5HBFA 1TA3B 2XWEA 1VF8A 4D72A 2BY2A 3GNOA 1W3KA 1C91A 2XTKA 1E15A 4PMXA 5IXEA 3CO4A 1WDRA 3WUBA 3VILA 5AY7A 4M1RA 2W67A 1KR1A 2OYMA 3FHQA 5I5RA 1J01A 2XVGA 1UR4A 2D2OA 1VBRA 2DSKA 1IT0A 4IISA 4F8XA 1A47A 1K9EA 4PYSA 5D8ZA 3BCDA 4H04A 3AFBA 1V08A 1C93A 3RMEA 1JF5A 1BVNP 1D2KA 2WBKA 1NH6A 1QNQA 3AS3A 1XSKA 3L4UA 3K46A 4GXPA 4N0RA 2FDMA 2VT0A 4KGLA 1EO5A 1J0IA 1WPCA 3OG2A 1YHTA 1LG2A 5CPSA 1R85A 3MSGA 3VINA 3WQ6A 1CGYA 4JL1A 4PMDA 5HOSA 1ISYA 1C7TA 3F5LA 2E9MA 5GNXA 1C8QA 4D1JA 2CXGA 4ZFMA 3B9EA 1B30A 3WQVA 3CLWA 1R87A 3WIJA 1B3YA 2E9BA 1VRXA 3S2CA 3BAXA 3THDA 4B15A 3I3DA 1I1XA 4W8BA 1JNDA 3E1F1 1G0CA 1ZJAA 2QPSA 4V2XA 4MNJA 3A4XA 1HN1A 4X0VA 2QMJA 5ABGA 5EBAA 3WL1A 3TTOA 2XVPA 4ZE4A 3PHAA 1OT2A 5BXRA 4CCCA 1DP0A 4TOQA 3WNLA 2G8ZA 2Y5EA 1M7XA 4ACYA 3W25A 3ALFA 1GVYA 2OSYA 1FHLA 3FNDA 2QLYA 3DHPA 1TR1A 1UWIA 2DH3A 2VX7A 1BG4A 1OSEA 1XRVA 4TUFA 1CGWA 1Q6DA 3WH6A 2CITA 3VPLA 1NARA 2J25A 2AMGA 4JHOA 3WKZA 4AZ5A 3WDHA 3W24A 1FP8A 3GM8A 1H1NA 3VMPA 1V3MA 2J7GA 3VUPA 2X0YA 5LA0A 3RPMA 5CSYA 1J0HA 4D6FA 3VD3A 1WO2A 3CTTA 2D0FA 4UFHA 3FAXA 1JZ2A 2XVKA 1C90A 2DSWA 5A69A 1M01A 1KXHA 4F79A 4EANA 3POCA 4JFTA 3QOMA 2WSKA 1EQCA 2YLAA 4MDPA 4QFUA 1ISXA 2FH8A 1GQJA 3OGRA 1C3FA 1CXKA 2G3MA 1G1YA 2VR5A 3L4ZA 3T0BA 1BTCA 4U33A 5A2CA 1GOQA 5ABFA 2J77A 1TVPA 1XGZA 4F9JA 1HJWA 2UY5A 4N42A 4MAZA 3CHCA 1W1PA 3RO8A 1J9YA 2CESA 3AI0A 5A8NA 3WF1A 5EB8A 3A3HA 4MNMA 4X0NA 1XHGA 3MANA 2W66A 4UTFA 1FOBA 1KXTA 2YBTA 4OKDA 3EDJA 1UKTA 1TA3A 1E6SM 5D4YA 5A95A 4WLCA 2J7EA 3DYMA 4D71A 2VZSA 1W9DM 3WF2A 2ESCA 1Q6GA 7A3HA 1DWGM 4CUCA 1UZ1A 2QMKA 3BXWA 3FXYA 2XVNA 2XVLA 3MKKA 5DO8A 3BGAA 2EO7A 4PMUA 1TE1A 3AHZA 1JNEA 3WDRA 5BXPA 4QP0A 4HA4A 4CCEA 2RGLA 4UQBA 1KBKA 1VJZA 1E0XA 3BAWA 3FN9A 1ECEA 3IJ9A 1B3XA 4J27A 1BYCA 3T0AA 1PPIA 3SCWA 3L4YA 4LX4A 4PRWA 3AHTA 1JD9A 3WD0A 1B90A 2V38A 1UR2A 2UY2A 2J79A 1TFVA 1HKJA 2X1IA 2AAAA 2JE8A 1W2PA 3AZSA 4YHGA 3UR7A 2VCBA 4FF5A 1VJSA 3L4XA 3VGGA 1H0GA 1CXIA 5CG0A 4W87A 4BQ3A 4WK9A 1XYZA 1G94A 3W53A 1SYTA 3WFZA 1NM9A 2WWCA 2DIJA 3RDKA 4PCSA 1DWIM 2BY3A 3AIUA 3GXFA 4IPNB 3WELA 4NRRA 5CJ5A 4E2OA 4JL2A 1W1TA 4Z2JA 1B0IA 3NDZA 1I75A 4CVUA 1HVQA 2O9RA 1UD2A 1E6XM 4GI8A 3BAKA 3APGA 2WVSA 2CKSA 4C7DA 1OM0A 4HA1A 4QLJA 3WD3A 1V3JA 5CPTA 4Q7NA 1W9BM 2WVUA 1E56A 4R5EA 1E4NA 1CTNA 5GPRA 3WNPA 2O9OA 2QV4A 4CKQA 5M03A 1E6PA 3UG3A 5BYWA 3F4VA 4JFWA 2WHLA 1GPFA 1CXHA 3AIRA 4Z2LA 2XSAA 2D3LA 2YKKA 2XGBA 1B2YA 3MMUA 2GVYA 4AD5A 5F7UA 3AIQA 1OINA 3A47A 1K6AA 3D3AA 4OOZA 2ZUSA 4H8HA 1FH9A 3HN3A 4ZENA 3OB8A 1UWQA 3GDBA 3MSDA 4EAMA 3T2OA 1KWGA 1H3GA 1BQCA 2X05A 3JUGA 4MTVA 1EQPA 3SCUA 5CPQA 3PZ9A 4EKJA 4MNLA 1GOMA 1QI3A 4W5ZA 1W3HA 2YA0A 5M5DA 5HDRA 2RGMA 3AJ7A 3WNMA 2WC4A 5I79A 3U7BA 2BVDA 1JI2A 2UWFA 5FD0A 5FKYA 3TTSA 6CGTA 4Z2IA 3WFLA 1CXLA 3WMBA 2C0HA 1GHSA 4JKKA 4J28A 4KWUA 2WW5A 5JBEA 1GCYA 3ARXA 3VIPA 1HXJA 3WH8A 4E8DA 5D9PA 4M8UA 2Y24A 1JL8A 1KGXA 4OIFA 3CZLA 4M82A 4PCTA 4NF7A 4WJXA 2E8YA 2V3GA 3W27A 3MUIA 2FGZA 2XYLA 1BPLB 2AOSA 4D6HA 3SCNA 2OWCA 1OD0A 1GZJA 2C8NA 1JDCA 3AMKA 2GK1A 4MB4A 3WEMA 1PX4A 3M6DA 1UUQA 3N17A 1OB0A 1UR0A 5FCZA 4HZ6A 4WSJA 1UH4A 1BYAA 1VFOA 2XHYA 4U2YA 4JFVA 4EK7A 4CN1A 2VQTA 1E9LA 2CCRA 1UR8A 2MANA 3VDAA 1JDAA 1M53A 1NQ6A 3N13A 1JYWA 2X8RA 1Q4NX 5A94A 5I0DA 1E1EA 1DWFM 3SCSA 1JFHA 4AW7A 1WZLA 1WAWA 1HL8A 3RIKA 2GJXB 1UH3A 1J12A 1HIZA 1HJUA 1H09A 2XIIA 1W9VA 3WDJA 2IXUA 4JKMA 3IAPA 3ZIZA 3CUFA 1E73M 4AY1A 3OGSA 4B3KA 3EDDA 2EPMX 3BMVA 2PC8A 3PTQA 2YA2A 4NSBA 4HOWA 2VJXA 3UERA 3VGHA 5A6LA 2J8GA 2YA1A 3W82A 4GO8A 4AZBA 3L2LA 2GSJA 5KEZA 2PF0A 4HMDA 1QBBA 4XUYA 4YPJA 4BQ4A 1R8LA 3PBGA 2EPKX 4B3LA 4CU6A 1V0MA 2WHMA 2CHNA 4TVDA 4TTUA 1E70M 3TOPA 2QPUA 2OSWA 4AXNA 4Y7EA 3SURA 4BQ5A 2EEXA 2O9PA 4HZ7A 1JZ8A 2OWXA 3K4DA 1TUXA 1U30A 4RL3A 1M04A 4XZWA 3PZTA 4P8UA 5E09A 1QW8A 3RJXA 1CGUA 4P7OA 4MPKA 4U2ZA 5CSUA 5JBDA 3AICA 2WCGA 2HISA 4YN5A 2EPLX 3AHVA 1ODZA 2WMJA 2D24A 2VVSA 3K8KA 1H41A 2WCSA 4CD4A 1ZJBA 1CNVA 4GPNA 3AROA 4H8UA 4PMZA 4CD5A 1J0JA 3UG5A 1RD6A 4GQRA 1B31A 4HU0A 4FMVA 3AS1A 1FFRA 1W32A 2W5FA 5D8WA 1CIUA 4L4PA 5IHSA 1J0YA 3BAYA 1NWUA 1TG7A 3AS2A 1CECA 2EPOA 2WVVB 4J3UA 4ZE5A 4MB1A 4PTMA 2BV9A 3CUJA 3FHAA 3ECQA 3TP4A 2IXVA 2DIEA 2EBNA 2WC7A 1V3KA 4PEEA 5E6ZA 4R27A 1QHPA 3VM5A 1AQ0A 5DMYA 3T09A 3OLEA 2J7HA 3ZM8A 2GDVA 4L4OA 3T0DA 3EBVA 2OWWA 4AC1X 1O7AA 5A8QA 4HOZA 1JZ5A 1E6NA 2YOCA 1CGXA 1B9ZA 2IUZA 2YLLA 2DQXA 5DEZA 1W9XA 2VNCA 2D1ZA 2W62A 1E3ZA 1UD8A 3AIWA 4FK9A 1NWRA 3ZT6A 2JEPA 4W84A 1WDPA 3BLPX 1QOXA 1NP0A 3N18A 1QI5A 3M7SA 4GINA 4D6IA 5FL0A 1W2VA 2Z1SA 3DYPA 4W89A 1Y7VA 4JHZA 2WWDA 2W4XA 1TMQA 5I77A 4GO9A 2EJ1A 3WQWA 2WSPA 2YDSA 3KL0A 4WKFA 1SMAA 4TXEA 3ARUA 2VX5A 2WPGA 2JALA 3CHFA 3LMYA 4W85A 1HP5A 4CU7A 1X6LA 3WMCA 4QAWA 2WK2A 1ODUA 4XV0A 4NZCA 2CKRA 1KQZA 4MJ2A 5ABHA 2NSXA 5CZKA 3MMWA 1CYGA 1PIGA 3I3EA 3SUTA 1BYDA 2X0HA 3N15A 3WD1A 3ZR6A 2ZX5A 4DWSC 4HZ8A 1UZ4A 5E70A 4AZGA 3VGBA 2GJXA 3HMCA 4PBGA 3U5YA 2GFTA 4JCMA 1VB9A 1IZJA 3NIYA 4P8VA 3L2MA 2W63A 1EHNA 1UKQA 2O92A 1LG1A 1C92A 3WQ8A 4D6GA 2XJ7A 1ITCA 1GQIA 1GOKA 3O6AA 2XG9A 2PBOA 3LPOA 1GNXA 1LWHA 3ZR5A 1E6RA 2VI0A 2J74A 4LYPA 1UG6A 3DYOA 4ACZB 1K9TA 4PMVA 3GBDA 3OLDA 3EMCA 3F5JA 1XH2A 5A2AA 2HVMA 4UQDA 1I1WA 1MVYA 1KCKA 1ZBWA 2VX6A 1MQRA 5GNZA 5A8PA 2CERA 2GDUA 1JXJA 1FA2A 4P7RA 1QNOA 3NCOA 2WLZA 4XB3A 2XFRA 3VOCA 4H7VA 5KZ6A 3WEOA 2F61A 2DT3A 4HP5A 4J3XA 4PMOA 4AISA 3VDHA 3SCPA 2A3EA 2WZHA 1JFXA 5A1AA 4PUDA 3BSHA 5CQ1A 3SCRA 2V3DA 1B3VA 2ZUWA 2ZXBA 3BSGA 3K8MA 3M07A 5AYBA 1UD3A 1ZB5A 2ZICA 3M46A 2W91A 2YJQA 1H4PA 3LPFA 2VUYA 1JYXA 3N1AA 3SUWA 1QNRA 3OZPA 3WBAA 5FIPA 4UFLA 3CIVA 3VU2A 5ECUA 2WVVA 3UG4A 3GZAA 4JCLA 3AHXA 1ZL1A 1QNSA 1E72M 1WKYA 4W8AA 1EIBA 4DWSB 2VTFA 4DM1A 2GK1B 3B8SA 4M80A 1HKMA 4CN4A 2JFEX 2VMFA 1MW1A 1C7SA 2VOTA 3WNKA 1VEOA 1E43A 1E4MM 3ALGA 4JAWA 3NSMA 4WSKA 2G3NA 3OBAA 5A3HA 1CENA 1FH8A 1KWKA 4UFJA 2VZVA 4HU8A 2ZIDA 3ZJKA 1CZ1A 1H11A 3SEPA 3CPUA 1IV8A 1GOIA 3ARTA 5DF0A 3U5UA 3ZJ6A 5GQBA 4AD4A 3RJYA 2BXZA 5EMYA 5BXTA 2WMIB 5ABEA 3MV11 2G41A 3AIBA 1ISVA 1MFVA 4UCFA 3GYCA 3A6OA 1OGGA 3VDCA 3MUZ1 2XFYA 3J7HA 2BHZA 3UESA 1E4LA 4M81A 4LYRA 3VIFA 1ISZA 3CHEA 1TVNA 4UQCA 2YDQA 4DWSD 4CCDA 1JYNA 2WAGA 1GQLA 2DT2A 3WF3A 1CDGA 1WE5A 4QCEA 4A3YA 2WVTA 3W4RA 4W93A 1NWTA 4V28A 2XIBA 3N11A 1CPUA 6TAAA 1HT6A 2WB5A 3AYSA 2A3AA 5BCAA 1PX3A 2J62A 2VRJA 3WMSA 5IFPA 5HXMA 2E9LA 1CXFA 3L4TA 4PMRA 2V5DA 3WEZA 3FW6A 4CGTA 1GONA 1FFQA 4NI3A 3ZOAA 1R7OA 4BA0A 4ACZA 3QOKA 2CHOA 2ZWZA 4W8LA 4GI6A 4P8XA 1VBUA 3WENA 3QHOA 4RE3A 3MV01 3GXMA 1F4AA 4MDOA 5DT5A 2WANA 2A3BA 4P8WA 2FHCA 3VX1A 5BWFA 5JUVA 4GZIA 1V6WA 1HJVA 1QW9A 1WZMA 3PZVA 1EHAA 4UFIA 4AWEA 2XUCA 3EDFA 2ZUUA 2ZUVA 2WYSA 1HL9A 1KFWA 1GJWA 4NRSA 4D1IA 4C7FA 2EPNA 7CGTA 3ARVA 4U3CA 4J3WA 9CGTA 3BC9A 4M24A 1LL6A 2V3FA 2WMHA 3L4WA 1AQHA 1MXDA 3AIEA 1WNOA 1AQMA 3CGTA 1R86A 4UFKA 1B3WA 1QHOA 3GXIA 1E40A 1KB3A 2V3EA 1BHGA 1XD0A 4ZEPA 3QHNA 1TCMA 3WBEA 4AD2A 2NT0A 1HKIA 1SFSA 2DEPA 1HJXA 1X6NA 4H8VA 1UD6A 3NDYA 4DWSA 3AOFA 2D22A 6A3HA 2FH6A 3VNYA 2VCCA 4U5KA 1UWSA 4J3VA 3IJ8A 1J0ZA 1XSIA 2OYLA 1HNYA 1EDQA 4TVCA 4IM4A 5DFAA 2BHUA 5GNYA 2UY4A 5HPOA 1MQQA 2DDXA 1W9PA 3CZKA 1VFUA 4JZ5A 3CBWA 1QI2A 2XGIA 3MMDA 2XWDA 2CBUA 4PMNA 1M03A 2WMKA 4W86A 4AZHA 2WKLA 4JFSA 3ARYA 1V6UA 3PZIA 1CGTA 4QLKA 1UA3A 4AZ7A 4PUEA 2VVNA 3CUHA 1UKPA 2VCAA 1NOWA 4HMEA 1CBGA 1XSJA 1DTUA 1RH9A 1VIWA 4EE9A 2B31A 1GORA 1PX8A 2WMIA 3AZRA 3VKKA 3GH7A 2DGAA 1MYRA 3TA9A 3AS0A 3EDEA 4UQ9A 1J10A 2A3HA 3WNNA 5IFTA 4BCEA 1GJUA 8A3HA 2QF8A 1VENA 4UQEA 3POHA 3G6LA 3VD4A 2PWFA 1NOUA 3VMOA 1OCQA 2PBGA 3NSXA 3GXDA 3K1DA 3VD5A 3VIHA 1JGIA 1GVIA 3ARWA 4LPCA 2PWEA 3ZMRA 4DUVA 3CUGA 4HA3A 3UR8A 1ITXA 5FL1A 3PZNA 1EOKA 1KGUA 2YL9A 4S3JA 1WDSA 4RE2A 3HJEA 4OBRA 5A8MA 1W3JA 4CD8A 1PBGA 5M17A 5A6SA 4HOXA 2BVYA 2YL8A 5C70A 5DT7A 4OOUA 3AZTA 1EA9C 1UHVA 3OLGA 1LLOA 4PTVA 3U7VA 1OGSA 2J75A 2E40A 2TAAA 1D3CA 4AD1A 3WDPP 3UEQA 5IHRA 3WUFA 1K9FA 1BG9A 4HMCA
chains in the Genus database with same CATH superfamily
3IEBA 3N4EA 5G4HC 4GZEA 4R7OA 3UVAA 5TBOA 1EBHA 1O66A 5I09A 2QUTA 3G1HA 3AMDA 4BEQA 1XG3A 3O7UA 3IWPA 1IZKA 3GNPA 4RDWA 3W1PA 1GPWA 3DU0A 2JIEA 3BLKA 3L12A 4IG2A 1N7KA 3DI1A 4K38A 1JCXA 3W1LA 2CZEA 4GHRA 1NFGA 3DHDA 3E12A 4MY9A 1J0KA 1FWHC 3PZQA 1ELSA 1GZ1A 3FJ6A 3FK4A 2WM0A 2J7FA 4J9JA 3MDUA 4Q6JA 2W92A 3UA3A 3RM8A 4U31A 3U4AA 5I3GA 1JG9A 3AMLA 3KVKA 2HK0A 4PMYA 4F0LA 1NDVA 3TYAA 3UY7A 2YCJA 3BLLA 2A4AA 1GVQA 1ONWA 2UZ9A 3AMGA 2ZX6A 3S1UA 1THFD 3FVDA 4GCXA 1TJ1A 3KDOA 2X7WA 1H1ZA 3WQCA 2HZGA 4K3ZA 3KBVA 4G1NA 1PTDA 3MVIA 3CZEA 3RHGA 5HNTA 1C8XA 3VI2A 3FFSA 2I57A 3S0CA 4C6BA 2X09A 3TZFA 1EGZA 1LWIA 3U57A 2ZTKA 3RNDA 3WQ5A 1XCXA 3F5KA 4Q22A 4HK5A 2D2GA 5LNWA 4QHRA 5JH1A 1Q7ZA 3GDMA 4CQAA 3IJQA 4GKLA 4ZSUA 5CGTA 2TODA 1X98A 2VEPA 3SUUA 1XC4A 3E6EA 4IOTA 2VD8A 3VIMA 4AYGA 5A6BD 2YFOA 5CPNA 4C6MA 2PDLA 4P7LA 3MUAA 1KM2A 3CQHA 3EWBX 4F9DA 1V77A 3UP8A 1H7RA 1OJXA 4B5WA 1WUFA 4DIAA 3EWXA 1OCNA 4LS2A 1F3WA 3UJEA 4S3GA 3TLLA 4A3UA 1OWQA 3VVGA 3EA1A 4XSMA 1HX0A 2PD9A 4YU1A 4KRTA 1OC6A 2ZA1A 1RLCL 4PTXA 1V5XA 5A5WA 2DZUA 1BD0A 1S46A 1P6WA 2F2HA 2RDWA 2IS7A 3NXLA 4M7SA 4XBKA 5FOOA 4MKVA 1V6VA 5FI8A 5A6MA 1J18A 4W88A 4XKYA 3DHUA 1JJKA 1PZ3A 2PZNA 3B8UA 3T78A 1ESWA 3PZUA 3HFYA 3RFAA 4IPPA 4RE4A 1NP2A 1POJA 1XLAA 1F07A 3CXOA 2I16A 1O6IA 4IZGA 4Y8FA 1K7XA 3TSDA 2R14A 3PZMA 5L6UA 1MWOA 3V0UA 2NV1A 5CPMA 4UXDA 4AIOA 2JGYA 3CZ8A 2EXOA 2NQLA 4YIWA 1L8NA 1B3OA 3LCXA 3SECA 4LBUA 4M0XA 4C6QA 1JZ3A 1VR6A 2POTA 4B16A 1WA3A 3SCVA 1XWYA 1EYWA 1E71M 2VXNA 3GVWA 4B2DD 1BSIA 3II1A 2YIHA 2RDUA 4FX7A 2NW0A 4P61A 1XYFA 3P2VA 5FJPA 1FWSA 1W3LA 1PTGA 1Q6FA 3QR3A 3ARQA 1RA0A 3HB9A 2WCAA 4IMGA 4PC8A 4WX2A 2ZUNA 1EO7A 5BNKA 3MKCA 4NUWA 3GH5A 4MUZA 4GQ0A 4X9SA 1KQYA 1WZKA 3EB3A 1KBLA 3W26A 3RMJA 5D9OA 1R38A 3HPZA 1Q6RA 1V3IA 4JX4A 4ZTYA 2DSVA 4ASTA 4UOJA 3SADA 3ZXWA 2PWHA 3WSUA 5I6SA 1WP6A 5XIAA 3ABOA 3DG3A 4LRTA 3CTLA 3TMLA 2VC9A 1E0VA 2CLFA 5E1QA 4AY7A 2J8FA 3I6EA 4JKLA 3RAOA 4W7WA 1TZ9A 3OA5A 2Y4SA 3WDQA 3T08A 5K2ZA 2XIMA 2PRLA 5H91A 1EGMA 4K68A 2YZRA 3FAWA 3VMNA 2UY3A 3NL6A 4AEEA 1VBHA 3WLHA 2ZXDA 5T8GA 1UPMB 1XLGA 2JF7A 1EJ7L 4ZO7A 1L6GA 2EAWA 2FIQA 3WL0A 1N55A 1OG0A 3TFXA 1ZZMA 4ZO6A 1QI4A 2BDQA 3KS6A 3NUKA 4DVOA 1TCDA 3PUEA 4UUIA 5HPCA 3CH9A 1UR1A 5C8BB 3EDKA 2QYGA 4MNKA 4D6EA 4QE1A 4H2CA 1RP9A 3G0SA 4IH3A 4WDUA 4C91A 1B1YA 3UZXA 2ISSA 3KBSA 4G6CA 4QEHA 4I5UA 3TFCA 5LZLA 4O15A 2W79A 3A4WA 2XGZA 1DHKA 3EOOA 4TMBA 4NZFA 2Z26A 3SQSA 2QDDA 2WSYA 4P7NA 3TSMA 2WHJA 4IL2A 3FEMA 2HNHA 4KS0A 2MNRA 3JZEA 4UOQA 1DKWA 4AZIA 1TX2A 4S2BA 7TIMA 4YL2A 4ZVJA 1TJRA 4LF1A 5IDZA 1CLXA 3ZZ1A 1XIEA 2O9TA 1EH9A 2V9DA 4UFMA 3DOPA 3GE7A 3RCYA 2Y70A 1UOKA 2EPHA 2XM1A 4KF1A 2HBVA 3F4DA 3KL5A 4U5IA 3WUEA 4EPEC 3IJ7A 1A3HA 2LLEA 3KXQA 3DHFA 1YDNA 1LJYA 1VYPX 3IVTA 1VC4A 4CNPA 5HNRA 3ME3A 3QR0A 1AJ0A 2ZZ3A 4QDPA 1XLKA 3SAZA 2AQVA 3LHVA 1HVXA 1RSCA 3ARZA 3H7RA 3BCFA 1XYAA 3GH4A 1OX5A 1VFMA 2G3FA 1LF1A 3HQPA 1GWJA 3NYZA 4XG1A 3PN8A 4HTYA 5D37A 1WKDA 2FGLA 1JIBA 3HPSA 4ZSTA 5HWMA 3MUXA 3W38A 3EYPA 1CI1A 3WY1A 1V6YA 3T2PA 3W1UA 1OZQA 3N2CA 1RR2A 1WCGA 1XYLA 4RJEA 3QC0A 3E38A 1U2YA 3VM7A 2NWRA 4N2YA 3D5HA 2D20A 2XM2A 4M29A 3S6OA 3VUSA 4GNJA 4PSPA 2XDFA 2Z1WA 1QVBA 4DQWA 4AIUA 3RM9A 2NV9A 4B9YA 4MWAD 2F38A 4FOJA 2Z28A 3M47A 1XIGA 1S5NA 2YCKX 3BMWA 1H2JA 1ONXA 4JTUA 1DE5A 3VC6A 3TN3A 2Z1BA 5J8LA 4YTQA 9XIAA 8RUCA 3B8DA 1V7AA 5I3FA 4K1GA 2VC7A 4NJKA 3SIMA 3PK7A 3EAUA 2YZ5A 2P1FA 1XC6A 1S39A 2DY3A 3UPMA 4O14A 2ACSA 3AU6A 3AHYA 2R82A 3M5XA 2ONEA 3QZEA 4LVGA 1XDJA 4Z17A 2QJJA 4GUFA 1UPPA 4TR9A 4TX8A 5BOEA 3BLOA 1UKOA 3BOLA 2V0TA 4JN6A 1LOLA 1O95A 4RV8A 4QLLA 4IGNA 2W61A 4DXKA 2Z1KA 2XIQA 2F8QA 3G3DA 3GAKA 2DVTA 1XLLA 1PZ2A 4AMCA 3ARRA 2BNJA 1W1VA 1U83A 2GSHA 1VFFA 1TWZA 4AB4A 3W2LA 3HPFA 1S2CA 1YDVA 2OKTA 1ZAIA 4WF7A 1G5AA 4BQ2A 4MJ4A 2BS9A 5D32A 4MJMA 2G3JA 2A3CA 2GQ3A 1ZBKA 2WMFA 2F84A 4HHHA 4V15A 3USZA 3KOZA 4LVFA 4OUEA 1VFLA 2ZUTA 1W8GA 3UR2A 5AYYA 1VF8A 2BY2A 1OY0A 3GNOA 1W3KA 3RLHA 1AMKA 2X1UA 2ABBA 5T26A 4UTTA 1KR1A 3TKFA 2OYMA 3C56A 3LI1A 4A3QA 4CQDA 4I90A 2IQ0A 1MNSA 2CLKA 2YDAA 5E5CA 4FNUA 2PAJA 1GVSA 3SDOA 3AO0A 2DSKA 1IT0A 3E2RA 1EUNA 2OQHA 4WXYA 3SZ8A 4PYSA 5D8ZA 3N4FA 3BCDA 2A79A 3AFBA 5D30A 1C93A 3NL2A 1KM6A 1PO9A 4HK7A 1M1BA 1JEZA 1LORA 1XSKA 4N0RA 2PDXA 2VT0A 5DY3A 2OMAA 1UOZA 1WPCA 4NG3A 3T9PA 1PZ0A 1DJQA 3GXNA 4HVXA 1R85A 3RU6A 3N6QA 5D2WA 3M41A 3K5XA 4IL0A 1NF7A 2E9MA 5I03A 5GNXA 1C8QA 1FVPA 1GG0A 1LRTA 3U2CA 1K03A 4V33A 4ZFMA 1GVFA 3EX6A 3B9EA 1B30A 3STFA 1C9DA 1R87A 1VRXA 3S2CA 1P0BA 4GFSA 3CEUA 1QT1A 3BDKA 2O7QA 1JNDA 3D3FA 1IZCA 4Z08A 3RRAA 1G0CA 1K6WA 2PMQA 1ZJAA 4JTDA 4MNJA 4QISA 3A9IA 1TTIA 3NZPA 5HMDA 2GGHA 4UNLA 2DU2A 4ZE4A 5BXRA 3RRXA 4X2PA 3VYLA 3G0UA 4IF2A 2G8ZA 4ACYA 5HR6A 4KCWA 1UIPA 1FHLA 3FNDA 2QLYA 1TR1A 3S2LA 2I5QA 2OZ8A 1L2UA 1CGWA 3WH6A 2ATSA 4Q8TA 1NARA 1SJCA 1R5YA 3BJTA 2Z6JA 5LNVA 3WKZA 4NZJA 1EP1A 3L65A 3BG9A 4AZ5A 1K8YA 3AC0A 5CC6A 1TPWA 5LA0A 5JH2A 1J0HA 3VD3A 1WO2A 2QIIA 4F48A 3FAXA 5H8MA 3EPNA 3ABSA 4EANA 5DY2A 3POCA 1Q8JA 5BWAA 3BMXA 4L64A 4GJIA 2YLAA 4QFUA 1O5RA 1ISXA 3OHMB 4KESA 4DB7A 1GQJA 1R6WA 3OGRA 1C3FA 5LGXA 4OE7A 4O52A 3P62A 2G3MA 3L4ZA 2G97A 2R91A 2FVLA 1A5CA 2H3DA 2G50A 1HJWA 4MAZA 3CHVA 1ZAJA 1J9YA 2CESA 5A8NA 3WF1A 1ZENA 5AOUA 5EB8A 1U5HA 4MY8A 5FEPA 2IKHA 3TN5A 1OK6A 3TOYA 3FS2A 4RR4A 1I2QA 3ES7A 3VKBA 3F03K 2RHGA 3LS9A 4JIPA 3S6DA 3RUBL 1E6SM 5I06A 1HQTA 2R6OA 4DO7A 3JS3A 4WZHA 4H6QA 1F7BA 1NU5A 7A3HA 3KWSA 4NXKA 1UZ1A 3DESA 4AH7A 3FXYA 2XVNA 2XVLA 4AFYA 2W6RA 3BGAA 1C9WA 1TE1A 4PMUA 3LMZA 3WDRA 4J4KA 4FIQA 1F6YA 4FR6A 4JIIX 3SBFA 3S9ZA 1PCWA 3VKAA 1ECEA 3IJ9A 4J27A 1PPIA 4LX4A 3PB2A 1B90A 2FQIA 2X1IA 4IIEA 3GXTA 5HMSA 1VJSA 5CG0A 4CNSA 3EXRA 4QG6A 1TIMA 1XYZA 3TUUA 1G94A 3W53A 1XYCA 3V35A 1H7XA 2WWCA 4UMAA 4PCSA 2KAUC 3HQ1A 2AQWA 4O19A 1ICQA 4IPNB 2X0SA 1FWJC 4IMFA 2NXIA 1W1TA 4Z2JA 3NXFA 4GYPC 4PUWA 2O4QA 3GNXA 4H9MA 1I2RA 3SFKA 2O9RA 3VNMA 1MI3A 3TWAA 4R88A 4NHVA 3BAKA 3AXKA 1W5NA 4WOQA 4C7DA 2AL2B 3GDRA 1KKOA 3I6TA 2E1WA 1YXYA 2R94A 1TTJA 4R5EA 1TV7A 1CTNA 4GVFA 1R3RA 5M03A 3W70A 1E6PA 4S2CA 4DEFA 2I5IA 3F4VA 1EC7A 4JFWA 5FA5A 1CXHA 3CYVA 3AWOA 4DJDD 5CPOA 1RAKA 2Q09A 4AD5A 4C6DA 4HPXA 3C86A 1UMYA 4OV4A 1AW2A 2ZBTA 5C2XA 4O11A 2NXGA 3Q94A 3D3AA 4OOZA 3H53A 3VE9A 2FB3A 2P0OA 3HN3A 4AVFA 2PURA 1UWQA 3EX1A 4EAMA 3FSUA 1KWGA 1XIIA 1BQCA 2ZA2A 1H60A 3JUGA 3UNDA 1EQPA 3BICA 3LGDA 2PDWA 4EKJA 2OVLA 1GOMA 4N9BA 3BUVA 5AHLA 2IKGA 3WNMA 2XSXA 5I79A 2OTDA 3U7BA 3M0VA 2BVDA 4RUBA 2UWFA 4ROQA 3HBLA 3WFLA 4ML9A 4JKKA 1ALDA 4G7EB 4KWUA 5JBEA 1GCYA 1TV2A 4M8UA 3STPA 4B4FA 1AODA 5ABTA 1KGXA 3CZLA 4PCTA 4PUJA 4FOUA 4HNOA 2CZDA 2WSQA 3M44A 3TIMA 2XYLA 1QATA 1L2QA 5BOFA 1OD0A 2OLSA 4GXWA 2PFHA 2C8NA 3OBEA 3CASA 3QFEA 4Q32A 4AVNA 1H51A 1VIZA 3LI0A 3MA8A 3Q65A 3ATZA 3QFWA 1Q6QA 5HAOA 1VFOA 3EX3A 2XHYA 2POZA 1W5QA 1M5WA 1ADDA 2OLAA 4CN1A 1R9YA 3TCSA 2CCRA 1FHUA 3I4EA 4FXRA 4QEEA 4BKNA 3T05A 4NVTA 3R1ZA 4MYAA 1DWFM 3AUOA 4DHGA 1FWAC 2Z29A 4AW7A 2A1YA 1AL7A 3H2MA 1TRIA 3RIKA 4JIQA 1H09A 3SJ3A 1MEHA 4JKMA 3IAPA 5D33A 2C19A 4N4PA 2FDSA 3NO1A 4X3ZA 1FXQA 1Y65A 2YA2A 1SO4A 3UERA 3VGHA 2J8GA 2YA1A 4GXMA 1IXOA 3L2LA 5KEZA 3O05A 1QBBA 4XUYA 2C91A 2AL2A 2PP3A 4QAIA 4BQ4A 4OQVA 1OF6A 4GX8A 4QTGA 4FALA 4TVDA 1E70M 3ZLHA 2QPUA 2OSWA 5CC5A 5FJOA 4BQ5A 3MVTA 3WLRA 1EJUC 1U30A 4E5TA 1S3HA 4RL3A 4RXFA 2BP1A 3QTPA 3L0GA 4XZWA 4Y8EA 1DYSA 1UJQA 1A0EA 3MZ2A 1J4EA 1XIJA 2HISA 1WUEA 3D6NA 1VZWA 3R4IA 2D24A 3K8KA 1H41A 2VWSA 3EWCA 3C52A 3AROA 4CD5A 1B31A 4G8TA 2E77A 4LUSB 1FFRA 2W5FA 4L4PA 5IHSA 3LA4A 1ICSA 3BAYA 1NWUA 3AS2A 1IWPA 2WVVB 1XLEA 2PZ0A 3W72A 3LD5A 1PTAA 3CUJA 3FIGA 2DIEA 1O60A 3CK5A 3LK6A 5DMNA 3GG8A 5E6ZA 4G7EA 4R27A 2E5DA 5DMYA 4H1ZA 3GK0A 2J7HA 3ZM8A 2GDVA 3T0DA 4GOAA 3LLDA 1PB0A 3SM0A 5CPLA 2OWWA 1NDZA 4AC1X 3MHFA 4HOZA 2IUZA 2PDGA 4I8DA 2ISWA 2XISA 2VNCA 3H2EA 1ONRA 3AIWA 4FK9A 1NWRA 2JEPA 4IMEA 4HJFA 3M7SA 1XYMA 4LRSA 3UCDA 4Q33A 1W2VA 2CC0A 2VDHA 3DYPA 1T96A 4IQJA 3IRDA 2EJ1A 2Z25A 3TJ4A 3KL0A 1SMAA 2Z6IA 3KM8A 3ARUA 4TXEA 2VX5A 3CHFA 3LXBA 3MO7A 3LMYA 4JIRA 3WMCA 2WK2A 3L23A 5H2ZA 4XV0A 1F5ZA 2CKRA 1KQZA 3ITTA 3UWQA 4MJ2A 4O1DA 4R3UA 3GHSA 1R2TA 3WJSA 3R5EA 4ZO8A 2ZC8A 2AMXA 1PIGA 1QMLA 4W9TA 1TPVA 3N15A 3URQA 5E70A 3R12A 3HMCA 2HBXA 4MKSA 3U5YA 3KRSA 1VB9A 3QYSA 4NZ4A 3NIYA 3L2MA 3UCCA 1DJNA 3G22A 1EHNA 1KRCC 3CAWA 2PE4A 2OX4A 1XPGA 4HSHA 3L67A 4PFHA 4GUJA 4L1GA 3JU2A 2FJUB 3SSJA 2XJ7A 5LIKX 1FTXA 1WBJA 2Y7GA 3R43A 4JNYA 1DIOA 3GUGA 2GGGA 1GNXA 3BQ6A 1DBTA 2PODA 4UTLA 5MKGA 2FFCA 1R30A 4PMVA 1GTEA 3EMCA 4WR3A 1V7YA 3F7JA 2NVAA 3LHYA 3QSTA 1KD0A 3RPDA 3N25A 1XH2A 3UZYA 3CB3A 6XIMA 4JD4A 4MKNA 3EXTA 4L4MA 4N6FA 1D8CA 4PA8A 3GRIA 2QVHA 2WLZA 4MVAA 1UZDA 3VOCA 3E96A 4H7VA 2C16A 1R2SA 3LHUA 3H7VA 5CBBA 4PMOA 2WNZA 5AZ1A 3P6LA 2H9AB 5A1AA 4PUDA 1Q5MA 4PULA 1T41A 1KRMA 2V3DA 1A49A 3H54A 3WK2A 3M07A 4LUSA 1H4PA 5FIPA 3VU2A 4MSSA 2WVVA 2HCVA 4PRTA 5J5DA 1GT8A 3AU2A 4QM1A 2PUZA 4JNZA 4Q4KA 4DWSB 2DVUA 3TLQA 2WJFA 2YX0A 3W2MA 2VOTA 1G6CA 3WNKA 4ZB0A 4JTLA 5U7SA 2B4GA 3O0KA 4GISA 1D8WA 3NQ6A 4L80A 1CENA 1FH8A 5AFDA 1LRNA 3QV9A 1SUXA 2VZVA 3VABA 4HU8A 4QSHA 4I9JA 3ZJKA 3LXAA 5D03A 1RUSA 3U5UA 2Y7FA 3PB0A 5GQBA 1PL9A 1PYMA 3MV11 2G41A 4EF9A 3EZ4A 3H70A 3TYCA 4KCTA 4H9UA 3L2IA 3MUZ1 1VD6A 5HNUA 5D38A 2Z1XA 1EKOA 4LYRA 1YEYA 3RG6A 2ZYFA 4FPSA 3VCNA 4O4VA 3ATYA 5AVNA 1K8ZA 2WAGA 3DXIA 4IFKB 1GQLA 1VPXA 3UJRA 2DFAA 1KTNA 1CDGA 1HGYA 1Q6OA 1VP5A 1PYFA 1Y5XA 4W93A 1L6WA 3CAQA 4HNVA 1NWTA 4Y9OA 4KWSA 3N11A 4M5PA 4HB7A 3W7PA 3WLOA 3E74A 2RFGA 3GHTA 4PB5A 3M64A 3WMSA 1CXFA 3EOLA 1KCZA 2HJPA 3DUGA 1Z44A 1QOPA 4DJFC 1MZHA 1TQJA 2V5DA 3FW6A 1RHCA 2X30A 1FFQA 4NI3A 5CCZA 4EVZA 1XR2A 3GHRA 2CHOA 4W8LA 4P8XA 3D47A 1VBUA 3WENA 1PZ1A 1XLCA 3QHOA 3ORWA 5D05A 4DJEA 2EKCA 5FACA 1IHIA 4EWND 1OK4A 4MDOA 1JCYA 4IIHA 3GG1A 2A3BA 4P8WA 2FHCA 3VX1A 3UZ5A 2DV0A 4R85A 5JUVA 2NLYA 1P0NA 4LOCA 3W7LA 2XUCA 2VEFA 1EA0A 2ZUVA 3W7CA 1HL9A 4GFIA 4D1IA 4C7FA 3DGBA 3JVAA 4KPLA 9CGTA 1FWWA 1W54A 4ADUA 1ZNNA 3AIEA 1GKQA 1UASA 1TWIA 1R86A 3LXCA 1KB3A 3G1XA 2ZDSA 4A29A 2OQYA 4ZEPA 1L9WA 5B80A 1ZCOA 2OFJA 1UD6A 4DWSA 2D22A 2RDXA 3VNYA 2WNQA 3IJ8A 4Z1BA 4A05A 2I9UA 2BHUA 1WOBA 5HPOA 3B4YA 1W9PA 1PSCA 3CZKA 1PS9A 1QI2A 3TA6A 4UMCA 2XGIA 4YVPA 4GCAA 4J40A 2XWDA 4XTDA 4C1KA 4AZHA 5AVHA 3U2OA 2RJHA 3RR1A 3LSCA 4AZ7A 2VVNA 3M0JA 3VCCA 1UKPA 4C60A 1NOWA 3ITGA 3BGGA 1XSJA 4ZOBA 3SSZA 3H6OA 3EB4A 1VRDA 5HJXA 4XAZA 1MYRA 1GTHA 3UPBA 1UMLA 4XZNX 2J8TA 3WNNA 4GQGA 2QF8A 4UR7A 4GIYA 1NOUA 1FWIC 1XIDA 3GXDA 3K1DA 3VD5A 4LPCA 1M7PA 3CUGA 1IGSA 4US5A 4IFKA 3MMTA 4IIBA 1XLHA 4JY8A 4E0CA 4XQ6A 4S3JA 1WDSA 4HU4A 4KWOA 1F73A 5BMXA 2WZMA 4ZOEA 3I68A 2ZZ7A 5A8MA 2Y89A 4L65A 4FNPA 1F3XA 2PP0A 5DT7A 3OTRA 2PTXA 1I2PA 3OLGA 4H01A 3BCJA 4PTVA 3IPWA 1QRQA 1J8VA 3B8WA 4GK8A 2C1GA 4AD1A 4K1WA 3WUFA 3TV8A 5AC5A 3N9RA 3GVQA 3W2JA 3EOEA 3KEHA 2J6VA 1KBBA 2HMCA 1EJSC 2CLMA 2EF9A 2ZCGA 5U4NA 3R7MA 3QQ1A 3ZT5A 1F8MA 3H2CA 3H22A 2WM1A 4GIAA 2V5LA 3AXIA 3M6YA 1R7AA 2G95A 4CU8A 4O16A 1UWAA 1LQ0A 2CZVA 1S1PA 2R1NA 2NQ5A 1ME9A 1K77A 5E6YA 4DUXA 3QN3A 4O1EA 4W7UA 4KFOA 3O3RA 2V5CA 3LPGA 4ILSA 2ZE3A 4NJIA 4IUOA 1TZ7A 3GAYA 3WD2A 3IJ6A 3NJ3A 4BS0A 2XFFA 2CWXA 4UQAA 3WH7A 1IEXA 1E4IA 4FLQA 2NVDA 1EDTA 4LNYA 4WKAA 4IUGA 4Z42C 4X9YA 3NL5A 2VQUA 4LS0A 3GQYA 2GL5A 5LIUX 3M5ZA 1V02A 4R33A 3HGRA 3R6IA 4O1FA 4BJHA 4HCLA 5A6KA 1KFCA 3GVRA 1SJBA 3VNZA 3VDBA 1FWGC 1QNPA 3QM3A 1OVDA 3VC5A 4UNIA 5D02A 2E6AA 3WQ4A 1F2JA 1XL9A 5BU6A 2OO0A 4JEJA 2J13A 3P0XA 1KXVA 1SMDA 2J7DA 2DUZA 1V6XA 5C2CA 1W1ZA 4NT0A 5G2HA 3OIHA 1SR0A 4NY2A 4O1AA 2PRMA 3PY2A 4TTGA 3NWRA 4QQUA 5EFDA 1KR0A 4AWTA 3GTNA 3UCQA 1ZHAA 1EXPA 4C6LA 9RUBA 1J79A 2E3ZA 2P0IA 4ENLA 2OZ0A 3W87A 2VZUA 2DT0A 4ATLA 1PDZA 1OEPA 2BSLA 3LPPA 3FA4A 3VOGA 4LCQA 3C8FA 1UUMA 5A6JA 3TQ0A 1K9DA 2DH2A 1V0LA 3MYPA 1T6MA 3NEHA 5BROA 2RKXA 4XX6A 3SY5A 3WF0A 1SSGA 1XLDA 1YYAA 3T2QA 3WLPA 5KMYA 1S3TC 1SM9A 3W6MA 1MFUA 3YPIA 1CGVA 1UR3M 1J96A 4PR4A 4WEVX 4PFMA 3RITA 1KC7A 1DEDA 3WH9A 1CLVA 3E2QA 2DZTA 2BFGA 1OFDA 5A6AA 2D23A 1GW9A 3U9IA 4MB3A 3LY0A 3V4BA 5IM51 1W3TA 4Q8VA 3CQJA 1HJSA 3QQWA 4MYXA 3VNIA 3VNLA 5TD4A 4ML4A 1WKEA 4LQ1A 2PGWA 1N82A 3SI9A 3VIIA 3NDOA 1SO3A 5CEWA 4AU0A 1XRSA 1R3TA 2PDCA 3GDLA 1UD5A 1QPNA 3L21A 5FF2A 2ZFAA 3KLLA 1UWUA 1E1CB 1JPDX 2CLEA 5C9UA 5J04A 1FKXA 5CAHA 2E0PA 1F05A 3HQOA 4MB5A 1FDJA 3H4XA 4DUWA 2VX4A 4FXJA 4E2VA 4AG0A 1XP3A 1XBZA 3W2UA 4LC6A 1MW2A 2J7CA 3OGVA 5I7GA 2EQDA 2HE5A 3L4VA 4FXSA 5CGMA 4O17A 4O13A 3FEQA 3D0CA 3UETA 1NJJA 1LL7A 1LROA 3R0KA 1MXGA 3FOKA 1DIDA 2VR4A 3UF9A 2EHHA 4NX0A 1BFNA 3TW7A 1WB0A 4NNAA 4A35A 4HPNA 3OLIA 5CSSA 3EX2A 3PWIA 4JTAA 4UZSA 2R1PA 1JXKA 3NQMA 2OJPA 2QGHA 1P7TB 3PJWA 1TPEA 5EFFA 4ZXOA 3NL3A 1E6ZA 3NQ2A 1E9YB 4AD3A 1LRQA 2KZHA 3ZSSA 3PTMA 4C6IA 1UQZA 2WKGA 2Y5JA 4A2SA 3ABXA 4QCFA 3RCNA 1UJPA 3RR4A 2BVTA 1KM3A 3NQBA 3GU9A 3IJIA 5E0CA 3SCTA 3WJXA 4BK9A 4V27A 4K39A 1ME8A 2PDHA 1ZBVA 2WBGA 2WLYA 3WN6A 1HF6A 4C6JA 2PDJA 3V7PA 2DPEA 5E9AA 4TX6A 4AF0B 7TAAA 1ISWA 1W9UA 1GUVA 4GH3A 1AH4A 4P7QA 4GE8A 1W3NA 2ODOA 2GGIA 1EYEA 4IX2A 2BG5A 3KCLA 1KA9F 4GYJA 3AXXA 3F4NA 1XUUA 3EWYA 4B5UA 2C7FA 2HE8A 3QTGA 4XAYA 4HN8A 4CNTA 2OEKA 5GJPA 5XINA 1Y0EA 1HL2A 1OG6A 1E5NA 3F1QA 3BV7A 3SQMA 3B04A 4MLJA 5BRQA 1NFBA 1EC9A 3MC5A 4LH8A 1JPHA 3BWWA 4HTBA 4HCDA 3TN6A 2X1TA 3A4AA 3GR8A 4Q4MA 2PTWA 1ZBCA 2P8CA 1JZ6A 1JUBA 1YXDA 3EA2A 2CYGA 4AAJA 3FYYA 2X2GA 2B7NA 1LBLA 4J35A 4JY9A 1YLVA 3KBNA 5G1YA 2Y5SA 1IT7A 4HHLA 2NQJA 2PDNA 1E1CA 3CT2A 3BH4A 1P6BA 4IHCA 4LFYA 1G01A 1MUCA 2D3NA 6ALDA 3CMFA 5CLWA 2Z2AA 4NKCA 8CGTA 1T99A 3ANYA 3RX3A 4AXKA 3CEPA 1P1XA 4S3CA 3P80A 5JIPA 1G4TA 3I3BA 5I24A 1TPUA 4E2DA 2HROA 2JEQA 3MHUA 5G1TA 1E3XA 1QPKA 4UIOA 4ZA0A 2PD5A 3BO9A 4IFOA 1EDGA 3GC5A 5HK4A 3WH5A 4D8AA 2VRQA 4Q4PA 3QRHA 1IXQA 4QITA 4RPQA 5AHEA 4J3SA 4C6PA 1LM1A 1FWEC 3BAJA 5HQMA 2BMBA 3M0MA 3S8HA 3LTYA 5DRCA 2NX1A 2NUYA 1R9XA 2AL1A 1U5VA 4FLOA 2Q8XA 1JVNA 1HJQA 4JQ3A 1P7TA 2Y8VA 3CHDA 4B5NA 1XCWA 5EBUA 4AWUA 4MADA 5DBUA 4EPKA 3BURA 3TE9A 1OFAA 2J4GA 3H2NA 4ICMA 3NPUA 3W22A 3VOJA 3ZJ7A 5F2GA 3MI3A 5JIWA 4J3TA 1SW0A 1PE1A 1YTEA 5RUBA 3TNBA 4LALA 1AZ2A 3PF3A 3W76A 4H9ZA 3BSMA 3WK1A 3L68A 2HSAA 1KLYA 1TELA 2WJEA 1XLIA 1Z41A 4CEUC 1X8CA 1H49A 2ZRXA 1AW1A 2EG8A 4F66A 3B06A 5E0FA 4RW3A 2ZQ0A 2GJRA 1RALA 1UWRA 4AF0A 4F0RA 3MCMA 2D0GA 2B7QA 3HG2A 4FLRA 1U1JA 1DXFA 3W83A 1OGBA 4I5XA 1A5NC 3B4UA 3LCLA 3GBEA 5KZDA 3HIJA 1A5UA 1PHWA 3HJZA 3QR1A 4Y2WA 1UQYA 3KOFA 1LLZA 3CV7A 3KOWA 1Q6CA 1DWJM 3ONCA 3W28A 4BI6A 1KCLA 1NOFA 4OBSA 2FPTA 5AB3A 3DG6A 1MO0A 3GR4A 4JIEA 3QZAA 3WDIA 4KEVA 4OTKA 4DF1A 2XWEA 1XF0A 3U48A 5G2WA 2Y61A 5M1TA 4PMXA 5IXEA 3CO4A 3SRHA 1WDRA 3WUBA 3VILA 5AY7A 5DCBA 1N8WA 1Q8AA 1DJWA 1K7FA 3GG0A 3G2GA 1CB7B 3PBYA 1ZLPA 4QJ1A 4ADTA 4JTCA 3PSVA 3UYIA 3G0XA 1O12A 4FX8A 4H04A 1V08A 3RMEA 1BVNP 2WBKA 2A6NA 3EEZA 3L4UA 3IIZA 4GXPA 1G4PA 2FDMA 3LCIA 3S4TA 3O6YX 2GVGA 1J0IA 4PBEA 2NXHA 1A5LC 1NY1A 4RXGA 1FCUA 3VINA 1CGYA 2CLIA 1VYSX 3IGHX 3L66A 3DERA 2FZDA 1POKA 3N6HA 1EZ2A 3M0KA 4F3HA 1B3YA 1Z6KA 4IXXA 4CQ8A 4B15A 3I3DA 1SW3A 1PKMA 4LB3A 1VLIA 4X0VA 5JVLA 2GLKA 4NX5A 3C0LA 5EBAA 5ABGA 1Q4WA 4D8ZA 4WSHA 3COTA 4TQTA 1EIXA 1V8EA 3W25A 4JICA 1GVYA 3DHPA 1UWIA 1ADOA 2DH3A 3CYJA 1BKSA 3C6CA 4KIRA 1BG4A 1OSEA 1XRVA 3KVMA 1Q6DA 3VPLA 4JBRA 4TV6A 3CAKA 1NF0A 3MI2A 4JHOA 1QNVA 3WDHA 3W24A 1FP8A 3GM8A 3W74A 2J9YA 3WLJA 3VUPA 1O1ZA 1I60A 3RCMA 1O68A 2X1SA 3PPFA 4D6FA 2VUNA 2ON3A 5EMLA 1JZ2A 2PTYA 2XVKA 4GY0A 4Q8OA 2DSWA 4F79A 4DO4A 1QAPA 3OW1A 4JFTA 1OC5A 2P8BA 3QLLA 1XCFA 4AHPA 4WUIA 4DLMA 3VDGA 1GVRA 1G1YA 3FKRA 3QMTA 1VHCA 1BTCA 4XIAA 4EAYA 1GOQA 4GBDA 1OZMA 1TV4A 1V51A 2PDQA 5HWNA 2J77A 1WDWA 3FJLA 1EXBA 2UY5A 3LB0A 4N42A 4RNHA 1UC4A 1TPFA 3AI0A 3LCWA 1IEWA 2QJHA 3A3HA 4MNMA 5FESA 4G5DA 4X0NA 3NM1A 4XD6A 5KINA 3MANA 2XN0A 1XYBA 3LEPA 4HMNA 1FOBA 2FZ9A 4DF2A 5DANA 2QCLA 4OKDA 5GVJA 5CJNA 3A23A 3I6RA 1BWKA 5C9RA 5D4YA 4R9OA 1YMYA 4WLCA 3MT1A 4NASA 4D71A 3TAOA 1W9DM 2ZZ6A 4E3VA 2H8ZA 3BG3A 1DWGM 1ZJIA 4RDVA 3B0UX 5DO8A 3Q4DA 3KRBA 4HA4A 4JTSA 4DNMA 4UQBA 4M6PA 2ZRYA 1EF3A 4BF5A 1VJZA 3HQNA 2QV5A 3K13A 3W1AA 4PRWA 2BOEX 4MLRA 4JQ2A 4A22A 1UR2A 5LHFA 3UXDA 1IEQA 4DZ5A 4FF5A 4LB4A 1VPYA 2EKGA 3L4XA 3VGGA 1H0GA 3WJWA 4W87A 4GLEA 2G37A 4DBDA 3PSWA 4N02A 1O1HA 1YTDA 1UC5A 1VJIA 1Z3NA 1O5XA 1N2VA 4IGMA 2DIJA 1XIHA 2WJZA 2NSOA 1DWIM 3V18A 5CJ5A 2O55A 1B0IA 4LUTB 4N7QA 2F6KA 3P61A 3QF0A 1HVQA 1UD2A 4GNVA 1K8CA 3APGA 4OVXA 4FZIA 1V3JA 4OGZA 4JTHA 2ZZ4A 1E4NA 2PA6A 5K4XA 4RPPA 1RBLA 5BYWA 3DCPA 1VCFA 1G4SA 3BLIA 2R1KA 2XSAA 4AHOA 2TYSA 3LQLA 4JTJA 1BTMA 4OECA 1HFBA 3T81A 5F7UA 3B0PA 4I7UA 1QO2A 5EU9A 4L6HA 2V5KA 3RPTA 4QRNA 5BOOA 2ZUSA 2HEJA 3P0WA 5HR7A 2YFNA 1HG3A 2OZ3A 3WLIA 3OB8A 1ZP4A 4OHQA 2QJNA 1X7IA 1YNQA 4GA8A 2E09A 2VEMA 4IQEA 4K37A 3PS7A 2VD9A 3IUHA 3ABQA 4MTVA 5CPQA 3PZ9A 4JX5A 3KZPA 5KITA 4MNLA 2AKMA 4Z1DA 4W5ZA 1W3HA 1SO6A 1DPMA 2WC4A 1OQFA 4RZ6A 2HRWA 3NQDA 4YWSA 1JI2A 5FD0A 3TTSA 5FKYA 1X39A 4ZQRA 6CGTA 3QKZA 4PUMA 1EPVA 2C15A 5C55A 2C0HA 2V2DA 1ZPTA 3T07A 1XM3A 1I2OA 3VIPA 5KTLA 4E8DA 1CT5A 2Y24A 1JL8A 4LNCA 3DZ1A 4M82A 4NF7A 5AC8A 4WJXA 3IUDA 3W27A 3WK0A 2E5BA 2FGZA 3NQVA 2FVMA 4N6EA 7XIMA 3T40A 5C7VA 3MHGA 3UT0A 3WG6A 3AMKA 2GK1A 2NQ9A 4GUIA 2KX9A 3N9SA 1UUQA 4Q4SA 3APTA 2Z2BA 3N17A 1QW7A 4UTJA 2I9EA 4QQ3A 4XIMA 4WSJA 1UH4A 1OX6A 4L6OA 3V5OA 3W1XA 2VQTA 2YBVA 2MANA 4H6KA 1JYWA 2P5NA 4TU1A 2RH9A 4LTSA 4JTGA 1S5VA 4O0KA 3W00A 1WAWA 4DAIA 1YNPA 2GJXB 4L6DA 1J12A 1LCOA 4H3DA 3AAMA 3OYZA 3UU0A 2FTWA 3C2OA 4GUHA 3UJSA 1EL3A 3GKFA 2F6UA 2IXUA 3QKEA 3CUFA 1E73M 3OGSA 2OPJA 4AUBA 3KX6A 3PTQA 4BEUA 3OEXA 3VNKA 1V6TA 3KVLA 3QBUA 1D3HA 1DOSA 2VJXA 3A9BA 4LUTA 3TYBA 5A6LA 3HG4A 1OCJA 3A4JA 4AZBA 3EX4A 4ZR8A 2PF0A 2Q3OA 2J88A 5F2MA 5C54A 5T9BG 6ENLA 3PBGA 5GJMA 1V0MA 4E38A 4TTUA 1WYIA 1OCBA 4RCXA 4E4FA 4AXNA 4Y7EA 2EEXA 1MUMA 4HZ7A 3K4DA 1M04A 4FP1A 1W5PA 3PZTA 5HMFA 5E09A 1QW8A 2A21A 4P7OA 5HINA 4RDYA 5JBDA 3W2KA 2WCGA 7ODCA 1J6PA 4K8HA 2WMJA 4XBSA 2VVSA 4CD4A 1TKKA 3LM7A 5BU9A 1P0KA 2P53A 2PEVA 1CNVA 3GHUA 4H8UA 4PMZA 4E4UA 4GQRA 2P3EA 4YMZA 1VH7A 4AMAA 3I10A 1SJAA 1CIUA 3KCJA 3ZLGA 1YIXA 1OX4A 1TG7A 4KIEA 1CECA 2EPOA 3E3HA 3UZJA 4IP7A 1EP2A 3U4FA 1V93A 4NAEB 1D7KA 3JRKA 3ECQA 1EJWC 2EBNA 3EWWA 3GIYA 1GKRA 3Q67A 3W1NA 2CXEA 3VM5A 1AQ0A 1JR1A 1SFJA 3K30A 3ZR4A 4RLIA 4L4OA 3TNOA 1FWNA 4DJEC 3EBVA 2B81A 3VOHA 4OV9A 2F9RA 1Q3NA 3K2GA 4QE5A 3CB8A 2DQXA 1UZHA 5DEZA 1W9XA 3NPWA 4L7ZA 1UD8A 1EWEA 6TIMA 3USBA 4HHMA 3ZT6A 1WDPA 3N18A 3RK8A 4GINA 3CQKA 2ISVA 2Z1SA 4W89A 1Y7VA 3VZZA 1TMQA 4GO9A 3LSBA 4WKFA 3V3WA 3QMSA 1Q65A 5H6HA 2VWTA 4F0KA 3KRUA 3A24A 4CU7A 4QAWA 5FF4A 3TN4A 4NZCA 1F9CA 3V1PA 2BGSA 3GU1A 5HMEA 4DJFA 3VOFA 4H2HA 3R25A 4AVOA 3TQKA 3SUTA 1DV7A 2VR2A 2X0HA 3OVRA 3WD1A 4DWSC 1UZ4A 4AZGA 2GJXA 3E5BA 4P8VA 5M2FX 2I1OA 3RF9A 2Z24A 4ZZ9A 1C92A 4OWGA 1TMLA 2YCLB 4EWJA 2XU2A 3JW7A 1GQIA 3MSYA 2PBOA 2V2CA 4DJDC 1QWKA 3Q45A 3CU2A 4ZQPA 2VI0A 2J74A 3DYOA 5EKYA 3LTPA 2E25A 4AWSA 3F5JA 1AW5A 1SW7A 2AQOA 2EGZA 3WLLA 5A2AA 3XISA 3TC7A 2VEKA 3P8IA 3GG7A 1MVYA 1TJPA 2O4MA 2DW7A 3IIOA 2VX6A 1SZNA 3GIPA 5A8PA 2GDUA 4FEZA 4P7RA 3NCOA 4Y9AA 2AAMA 4XO7A 4MZ8A 1M65A 2F61A 2QCEA 4ZQOA 1ITUA 3ERPA 3GD6A 3L9CA 3VDHA 3SCPA 4EPDC 2A3EA 4XISA 1WQ5A 4S39A 2A5HA 3PG9A 4BR1A 1AA1B 2VP8A 3KHJA 3SCRA 5CC3A 1B3VA 2ZUWA 2ZXBA 4XAGA 3BSGA 3G18A 7ENLA 2ZICA 1OFBA 3PC0A 3LYEA 3N1AA 1QNRA 3PAOA 3S2NA 3KOYA 5A8GA 3WBAA 3CIVA 2HQAA 3GZAA 4KW2A 4JCLA 4NL1A 3TVAA 1D3GA 1T0OA 4NAEA 1EIBA 3TCEA 1J6OA 3UFYA 5H8UA 3VKJA 4M80A 1HKMA 3P67A 1GEQA 2JFEX 2VMFA 4GIEA 1AK5A 5TQLA 4JS3A 3TC3A 1VEOA 4LS1A 1F76A 1E4MM 4REQB 1YADA 4JAWA 3NSMA 2BVWA 4WSKA 1RCXB 4TMCA 3MDWA 4NU7A 4QGCA 4UFJA 4JTEA 3SEPA 1MDRA 3CPUA 1XLBA 4KEZA 1IV8A 5DF0A 3OP2A 4J2MA 1RA5A 3ZJ6A 1GKPA 3V75A 1WAUA 1GEHA 5EMYA 2WMIB 2OEJA 5ABEA 1Z8AA 4KT2A 3S5SA 4YJ5A 3ZLFA 1YRRA 4PE8A 1QASA 3GYCA 1OGGA 3VDCA 2PGEA 4DNHA 2XFYA 4RX0A 1RQHA 5F1UA 3UESA 2OEMA 4I5RA 1ISZA 1NQKA 1AJZA 3BG5A 3CS2A 3TQPA 5FF3A 4O10A 3CIXA 5FSDC 3R8RA 4DZAA 3O06A 1HW6A 3MWCA 2RUSA 4E8GA 4QCEA 3W4RA 2XIBA 1CPUA 5D04C 1DQXA 1HT6A 2WB5A 1KRAC 3T0CA 2H8XA 5BCAA 1PX3A 2J62A 4H9VA 2YCLA 4NP7A 1BWLA 3L4TA 1KO0A 4L9YA 1GONA 3ID7A 4UTIA 5G4WA 1SR9A 1R7OA 3G1YA 2A7NA 2FJKA 2ZWZA 4GI6A 1JGMA 3MV01 2FZBA 2ZVRA 2O7SA 1F4AA 3WJYA 4O1CA 3CQ0A 1T8XA 4FSAA 2PDFA 5BWFA 4EOUA 2C0AA 4GZIA 1V6WA 4CCZA 3PZVA 1OYAA 4AWEA 3WQGA 3B0YA 2ZUUA 4R7WA 3EKLA 4I6VA 4DI8A 7CGTA 2YYUA 4UTHA 3SIZA 4N4QA 4GUGA 4KKXA 2JKAA 3T44A 3BC9A 1GYNA 5JXQA 4M24A 1LL6A 3BJFA 1R2RA 1VFSA 3L4WA 2V82A 3QEZA 1WNOA 4JHMA 3S1XA 4B4HA 2Z1VA 1VHNA 1AQMA 1RCOB 3CGTA 4Y9PA 1QHOA 1XD0A 3GUWA 3WBEA 1TCMA 4DLFA 1HKIA 3NDYA 2BWGA 4C1LA 2VCCA 3C2EA 3DFOA 3FCPA 3PFRA 5FEXA 2R9RA 4TVCA 4I3GA 1TJ2A 1X7FA 4C65A 3E2VA 4REQA 1VFUA 2Y85A 4JZ5A 3CBWA 4PL2A 3FYPA 3MMDA 5G1MA 2WMKA 2WKLA 4JFSA 4HJWA 1V6UA 3IUIA 3PZIA 1CGTA 4QLKA 1ZJHA 4LAOA 1LTDA 4Q7IA 3W1MA 1Q13A 4GQBA 5I02A 3THQA 2VCAA 3ITCA 1G7VA 1S2WA 3NVDA 2B31A 4AX7A 1PX8A 2WMIA 1A5KC 4WY0B 4N9DA 3VKKA 3W1QA 4C6KA 2W0UA 3TA9A 3AS0A 3EGJA 3EDEA 4UQ9A 1J10A 4Q8MA 4YYFA 3T4WA 1AQFA 5IFTA 1DJHA 8A3HA 4BI7A 1VENA 2AGKA 3POHA 3VD4A 1XBYA 1A5BA 2NUXA 3NSXA 3W7NA 1NTHA 2PWEA 1QK0A 3ZMRA 3DENA 1EZWA 5HUPA 4EIVA 1OF8A 3R13A 2VENA 2FTPA 1HUVA 4OBRA 3NNTA 3B3DA 3OODA 1W3JA 4XZ9A 3WLSA 5M17A 5A6SA 2GJNA 1XICA 4XAPA 4X61A 4HNTA 2YL8A 2D69A 3A22A 3QV8A 3XIMA 2ZVIA 6PTDA 1EA9C 1DIEA 2TMDA 1OGSA 4WRHA 1CW2A 4O50A 2E40A 3UWZA 3WQDA 2GQ8A 2IQDA 1K9FA 2AGTA 2IW0A 4UR9A 2WXDM 2WOQA 3EMZA 3IAQA 4S3FA 1F4HA 1PIFA 1LZOA 5PTDA 4DYKA 5G4EA 3EKZA 2YPIA 1H7PA 5DCEA 3N9KA 2ZKMX 2R8WA 1W91A 3H26A 3WNOA 4KQNA 1XINA 2YXXA 4KMQA 5DMLA 3N2OA 3WLNA 1OT1A 2RAGA 3MU7A 3KE0A 1EBGA 1REQB 2GJPA 3LDVA 2E5CA 4NJGA 2HVOA 1BF2A 3LCFA 3R8GA 1JULA 3W7HA 1HTIA 4GACA 4EXBA 3M9YA 1KXQA 3MCNA 3HMJG 3T6CA 1TZZA 2VO5A 2GJLA 4DRSA 5B7YA 3C2FA 1XH0A 3UG8A 5IRPA 1EUAA 3G6MA 2A85A 1A4MA 1DIKA 3GIQA 4EP8C 3PUOA 3K8LA 3SN4A 2CPUA 3DFTA 5CLTA 5HJYA 3S6TA 1XV8A 1I0BA 4C7GA 2DORA 4IICA 1B4EA 4C6NA 1V0KA 2ZX9A 1YPIA 1E0TA 3ISIX 2E4TA 1J11A 3MO4A 4C6OA 3DX5A 2A7RA 2CLPA 3M1ZA 1WBHA 2OXNA 4PL1A 2XPKA 2EG6A 2FB2A 4MOZA 4HD5A 5E93A 3CZJA 1DWHM 2DQWA 4MAVA 4YTRA 4F2TA 1GOWA 1OFPA 5AYZA 3RM4A 4FNTA 3KTCA 5XIMA 3ZT7A 2XFWA 1TVLA 4F0HA 3W37A 3EMQA 3IIXA 4DO5A 3LV6A 3HFTA 3UWYA 2GGEA 2C3ZA 1DQUA 3TR2A 1MW0A 4CQ9A 1KGWA 1JPIA 1QI0A 1VQTA 3AYRA 4RNJA 1CWYA 5HANA 4Y96A 4JNMA 4XD3A 1F74A 4NNBA 3QHMA 1QHZA 4CNOA 3F4WA 2WC3A 3UZWA 3BQ5A 4DBSA 1R3YA 3G5EA 3IACA 4PSRA 5LXXA 3STEA 3W6LA 2G3IA 5HQLA 3M7WA 4K7YA 3V1HA 4ZODA 4GZJA 1H5VA 1KFKA 5EMKA 3O6CA 3FA5A 3T8LA 2HPIA 1H7NA 3NGFA 4GABA 3QLDA 2PDPA 3MUCA 2QT3A 3B9AA 2REQB 2NLIA 3F2BA 2I56A 2E6FA 4D6CA 1MEWA 6XIAA 1UBSA 4OU1A 4N9EA 3NQCA 3TTYA 2YGYA 3O9NA 2Q3RA 3QSRA 1QBAA 4CN6A 4A4AA 2Y8KA 1K02A 1FWDC 1UP2A 3A12A 3TAKA 4J7RA 1BVZA 1UH2A 4GBUA 2FGBA 1RLDA 3E0FA 3AISA 3CMGA 1RP8A 2Q01A 1Z32X 5BRBA 1A80A 3SY8A 2CHRA 1JQVA 3HO8A 2D73A 1A0CA 1QR7A 3TTQA 4AD0A 5KSWA 4Z1CA 1ENUA 2PWGA 5T91A 3W7GA 3NQ7A 1V02E 1HKKA 2J78A 1H0IA 3WQOA 4GY1A 1RK6A 5BXSA 1W1YA 1XGDA 1MRAA 4L56A 4AHQA 3W2NA 2DSUA 3VGDA 3IIVA 4TX9A 3M0ZA 3NR0A 5A6BA 3PAJA 1BYBA 4ZOAA 4US6A 3DC0A 2ZX7A 4AYSA 1GOOA 3KL3A 1TRDA 4KRUA 5I3KA 2PP1A 1G9HA 3PBMA 4IPIA 1XRFA 3M0YA 4ROPA 1I6NA 2VFEA 3IV3A 5J5RA 1JYVA 2HXTA 1VEPA 1QPOA 4HNUA 1JZ7A 4E4PA 2CIPA 2V5BA 3TH6A 2C18A 1LYXA 5BRPA 4Z0JA 2BY0A 3HA1A 4FF7A 4KRZA 5A8OA 1HKVA 4CD7A 4H00A 2DUAA 4L1XA 2QJMA 3T4CA 1PAMA 2PGFA 4WOZA 1LL4A 3CMJA 2QCGA 1W0MA 1TV3A 3KWXA 2XH4A 4LBRA 1GYLA 1FDYA 3P82A 1X1NA 2QVNA 4ATWA 4AZCB 1UD4A 4WD0A 2OX1A 3AJXA 2CLLA 3HZ3A 4ZXLA 4PEKA 2MUCA 2QEZA 4UTUA 1TX0A 3PTKA 3LRMA 3SRDA 4YXGA 1BAGA 4FAMA 5AC4A 1T40A 4XD5A 3H2OA 4D6JA 3A5FA 3QPYA 2TPSA 4LCSA 3NSNA 1CEOA 4FNQA 2VRKA 2Y7EA 1S2UA 4Z2GA 4HNCA 1PKLA 2D2JA 1LQ2A 1EJXC 3R58A 3QY6A 4GQQA 1OBAA 3ARPA 1M41A 3AIVA 3UGRA 2VGGA 3AXMA 3PJXA 3KTXA 3RILA 4KH2A 3NZ1A 4JTRA 3W7QA 2BY1A 2XSBA 3C61A 1S2TA 2PRHA 1OIFA 2OT1A 1V3LA 4B2DA 1RVGA 3B8VA 1D7FA 5HNNA 2V6AA 4PN2A 1LDCA 2REQA 3ANVA 3VIKA 1BRLB 3CUXA 5HULA 3RYSA 2FHFA 4UOZA 3T1GA 1FCVA 3N3MA 1ZS2A 4G1KA 4OZOA 4H7CA 4DYEA 3TXZA 2WZIA 2DZXA 2J47A 4MWAB 3MTWA 1TO3A 3TYUA 3ARSA 2HV5A 3IGSA 4S3KA 3DDMA 3GC2A 4LGXA 1KNWA 4LY8A 1GW1A 2NVCA 2CBJA 3M43A 1QWGA 2CBVA 2BB0A 2WHKA 3SUVA 1FHVA 4FHAA 4XZBA 1H63A 3VIOA 2GGJA 1VKFA 4GVHA 1JF6A 1V4YA 4W4QA 2V5JA 4L5ZA 4ONVA 3W1RA 1J93A 2OZTA 1KKRA 4H9XA 3GU2A 3UXKA 3L7RA 3DKLA 4LXFA 5FAJA 2WZEA 4UZUA 4PMQA 4FLSA 3DN5A 4LYQA 1BGGA 1Q6EA 3SUSA 3WBYA 1NIUA 4CNUA 4F0MA 3DEQA 4HPHA 3TSBA 4JR5A 3W7JA 1H5YA 3VIGA 3P8JA 2OLHA 2VELA 4PB4A 1E55A 4JX6A 3VD9A 4FNRA 5AKQA 3OA3A 3W0KA 1A5MC 4HIBA 4YVXA 1CXEA 3KCOA 2YCEA 3QY7A 1Y8BA 2OT0A 4FXFA 4MG4A 3XINA 4AZCA 2BXYA 4M1BA 3IV8A 4TVUA 4D2JA 4XZHA 4ATDA 1AVAA 1S2AA 2CNCA 3BPWA 3VD7A 3ZO9A 4B5SA 1W6TA 3VOIA 3WD4A 1PV8A 1US0A 3WQPA 3O15A 4MY1A 2HVNA 3W81A 3SFWA 1DJZA 1FP9A 2Z7KA 4G2DA 3SRFA 3Q2DA 4XKYB 1E0UA 2CETA 4KFPA 2INFA 3QGVA 2J7BA 3VA8A 1G4EA 1C8YA 4S3AA 2ZZ1A 4A3HA 3I7SA 2QDHA 1JRCA 3IGXA 3UZZA 3HU7A 1ZALA 3FA3A 2A0NA 1V03A 3NOYA 3AXHA 1DWAM 1NAL1 3VX0A 4NYYA 1DE6A 2ZWYA 3V36A 3SCOA 3PWGA 3ITOA 4WHBA 1XDLA 1VYRA 4PCNA 2PWDA 3FXGA 5CBJA 2DSZA 3B9DA 1QFEA 4IPLA 1BRLA 2NX9A 4WGXA 5C0QA 5HBFA 1TA3B 4D72A 1C91A 1R3SA 3MW7A 2XTKA 3W6YA 1OFQA 2ASHA 3A13A 1SZFA 2W67A 3UD6A 1ICPA 3FHQA 3F4CA 3TC6A 4DBWA 4LUYA 4MWAA 1E51A 5I5RA 1CLKA 3NQAA 3WYZA 2HWGA 1J01A 2XVGA 3SB0A 1R3VA 2D2OA 3EPMA 4F8XA 4ES4A 3SQLA 1SU5A 1JF5A 1D2KA 3L0KA 1NH6A 4D9PA 1QNQA 4JQAA 3R8HA 3K46A 3C3UA 1AUSL 3P60A 4YWIA 3ITVA 1HGWA 4KGLA 3GVGA 3OG2A 1YHTA 1LG2A 5CPSA 3MSGA 3C0SA 4UC5A 3WQ6A 1TWDA 1OYBA 1HO1A 1C7TA 2E68A 2R24A 4GJJA 4YS1A 2WQPA 4H6EA 2R1LA 4D1JA 3P7YA 2VM8A 3CLWA 1YE6A 3T7VA 5AYXA 3HG3A 3D46A 3PUGA 3THDA 1I1XA 4YCOA 4KEUA 4BY3A 1RZMA 4L4LA 3A4XA 3TX9A 2O56A 4KBXA 3BW4A 3PHAA 1MEIA 3M5YA 4ZO9A 4CCCA 1DP0A 4TOQA 2I7GA 4I9TA 4O53A 4Y9NA 2G4JA 2Y5EA 1M7XA 2OSYA 5TAOA 1A4LA 1DHPA 4M6VA 1SO5A 4M7TA 1XI3A 1PIIA 2CITA 2VC6A 4HYRA 2J25A 2AMGA 1P6CA 4ZQNA 1JUKA 3R0UA 3QH2A 1H1NA 3N34A 3VMPA 4PUUA 3TK7A 4GC3A 1UBPC 3BOFA 5CSYA 3GFXA 3S47A 1S2VA 2ADAA 3GYEA 2D0FA 1C90A 5A69A 1KXHA 5DXYA 3QOMA 4QS6A 2WSKA 3EKGA 3W07A 1EQCA 4DI9A 2JGQA 4QIUA 4MDPA 2FH8A 2E28A 3TXVA 1CXKA 3G77A 3HV9A 2EG7A 2VR5A 4LF2A 4U33A 5A2CA 6REQB 1K8XA 3ABZA 1MXSA 1TVPA 2X41A 3LRLA 4F9JA 2ZRUA 3L5LA 3N2TA 2FYMA 1XS2A 3CHCA 2C1HA 3M0XA 3TJXA 5I3JA 3HGSA 1FDZA 3QXBA 1XHGA 3GVVA 4QJ5B 1GYMA 5EPDA 4UTFA 2YBTA 5K9CA 4QJ3B 3CPRA 5EMUA 2QDGA 4Q8NA 1TA3A 4KWVA 1FBAA 5A95A 4WGHA 3V16A 2J7EA 3DYMA 4PRRA 2VZSA 2YW4A 3WF2A 2ESCA 4CUCA 2A7PA 1GQNA 4XD4A 2QZRA 2GDQA 3MKKA 3MBDA 2EO7A 4H9YA 1Z89A 3AHZA 1XIMA 5BXPA 2GQAA 5FEZA 4ADSA 1YXCA 1KTBA 1K4GA 3S5NA 3PPGA 1E0XA 4ZFCA 3BAWA 3FN9A 4S3EA 1TJ0A 3MWAA 3WJZA 3TW9A 3SCWA 1L6SA 3L4YA 3AHTA 1JD9A 2V38A 2J79A 3NQGA 1TFVA 2AAAA 3WCZA 1W2PA 3AZSA 1GVEA 2BGNE 3CLMA 4YHGA 3U2EA 1IXNA 3G1SA 4GGHA 4B91A 4LUJA 1CXIA 4JYDA 5LXEA 4HU3A 1YDOA 4E2BA 2FZ8A 1SYTA 3WFZA 3HGJA 1UUOA 1NM9A 3RDKA 3QV6A 1MZRA 1UP0A 3NPVA 3TW6A 3OHIA 4JL2A 3WFAA 3A5VA 2QAFA 3NDZA 1I75A 4CLMA 4CVUA 4PTNA 4EX4A 3B8TA 4KEMA 1E6XM 1X1OA 2C6QA 2WVSA 2CKSA 1AH3A 4EPBC 4HA1A 3MYOA 4QLJA 4JQ1A 5CPTA 3U3HA 1W9BM 1E56A 4QDWA 4RE0A 5GPRA 2QV4A 2GVLA 3UG3A 2WHLA 1SQ7A 3EWZA 4DX3A 3AIRA 1TUFA 4Z2LA 4EXQA 5C9XA 2D3LA 2YKKA 1BXBA 4NZ1A 3MMUA 3ITXA 3LHZA 2GVYA 3UR5A 1EPXA 4DN1A 2I14A 5ECVA 3LZ3A 1H7WA 1TYGA 3AIQA 3IRSA 1BSLA 3A47A 4C5YA 2X42A 2VC5A 1SZRA 4H8HA