4W7VA

Crystal structure of xaccel5a in complex with cellobiose
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
313
Chain Sequence
HMLKYVGVNLSGAEFNSRKKPGTLFKDYTYPAASDFSYFAGKGMNTIRLPFLWERVQPELNGPLDQAQLGLIKKSLEAAKANKQYLILDLHNYATYSGKRIGTSDVPAGALADLWRRLALEFKDDKAVIFGLMNEPNGISAPDWANAAQGTITAIRKTGAKNLILVPGTAYTGAHSWRSTSYGVSNAKALEILKDPGNNLAFEAHQYLDKDYSGTKPVCTSDSVGQEKLQGFTSWLRENKQKGFLGEFATANNPVCDKALEGMLTYMEKNSDVWLGWTWWAAGAWWKPDYPFTVQPGKDGSDKPQMAILSKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cellulase
publication title Crystal structure of XacCel5A in complex with cellobiose
rcsb
source organism Xanthomonas axonopodis pv. citri
total genus 124
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4w7vA00
2W66A 4B9YA 2CXGA 2YJQA 1CENA 1E4MM 1DWFM 3VNZA 3L2LA 4M1RA 1HL9A 5LA0A 1BPLB 3BMVA 3MS8A 1FFQA 3SUUA 1CTNA 2VX4A 3W82A 4MADA 2WHMA 4AXNA 1HKIA 4J3UA 3RM9A 5CZKA 4GZIA 1BVZA 3W25A 5D8WA 2FHFA 1HIZA 3M7SA 4PSPA 1WNOA 3VD4A 3SURA 4RL3A 1P6WA 3WF2A 2CBVA 3PZTA 5BYWA 2X05A 5IFPA 3BLPX 1ZBKA 3AYRA 3UEQA 3UERA 1MQPA 2WMJA 1E0WA 1JG9A 2VO5A 3WD4A 3F5JA 1TE1A 4H8UA 1BAGA 5EFDA 4Z2LA 2Z1KA 4GI6A 3FY1A 4DWSC 3N17A 3DYPA 5A6SA 3DYOA 1XV8A 4MJ2A 5GNZA 1OINA 2JIWA 4TVCA 1UD4A 3A4XA 3VD5A 3O9NA 2ESCA 4UZSA 2GJXA 5AC5A 1XSIA 5M5DA 1J10A 1UR0A 4LXFA 2E9LA 1Q4NX 3FXYA 3FNDA 4OBSA 2CIPA 3FHAA 5E6YA 1NP2A 3WD2A 1XRVA 1WP6A 2OLHA 1OD8A 3VD9A 1U30A 5CGTA 4GXPA 3T08A 1CGVA 1BHGA 3THCA 3T2PA 3CUJA 1HT6A 4AISA 1M03A 4CN6A 3VIMA 1G94A 2W5FA 1G9HA 2CHNA 3AIEA 2WVTA 3D3AA 3CUFA 2FGZA 1JYNA 2VRJA 1L8NA 1ITXA 1W1VA 1TFVA 2VVNA 3AMDA 3WNMA 4YN5A 5DMYA 4OIFA 1FP8A 1E73M 3AHYA 3GDBA 1UH4A 2JFEX 3L4YA 1UD5A 1VEMA 2DGAA 2D0FA 3UG5A 5FD0A 2FDMA 4JCLA 2XJ7A 1MVYA 5ABGA 3ALFA 2V5DA 2CETA 4HA1A 3T2QA 1OT2A 5I78A 3GNPA 2C7FA 4BA0A 4Q7NA 4UQ9A 3VMPA 2WM0A 3AIVA 2CKSA 1E3ZA 2AMGA 3MO4A 4W7UA 5I2UA 2CYGA 2VZVA 2DT2A 3CUIA 4LGXA 3JUGA 1E1EA 3PZ9A 1W3JA 1V02A 4XV0A 4QCEA 1GNXA 3OB8A 4AZCA 5IXEA 1PX3A 3TA9A 2UWFA 3NSNA 2QMJA 1J0KA 4B3LA 4AWEA 1LWJA 3N12A 1V03A 2XIBA 3WF3A 1UHVA 3WUEA 2YDQA 4JFVA 3U5YA 4QLJA 1QOXA 3VTRA 1XD0A 2DSUA 3OGRA 1B3YA 2GFTA 1UR1A 5D9PA 3ZT6A 3SCPA 1EA9C 3SUVA 1V3MA 3BH4A 2O9TA 2VZTA 4UQDA 1X6LA 2WHKA 3WFZA 3WF1A 3TOPA 4X9YA 4EAMA 1UH3A 1V6WA 1B1YA 3IAPA 1D3CA 1QW9A 5EFFA 2QF8A 3ARWA 3AXHA 4JFSA 3PTKA 3GM8A 2UY3A 4ZXLA 1JZ6A 3UG3A 4MPKA 3WDPP 3ZMRA 3WUGA 1J0ZA 4MNLA 3GTNA 1WZLA 3OGVA 3II1A 2WB5A 1EDTA 2DT3A 2E0PA 2JEQA 4LX4A 5GQBA 1BYBA 1OM0A 4ZFMA 2WMKA 2ZUVA 3NDYA 4D6DA 1VFOA 4TOQA 3J7HA 2PI6A 5D4YA 3DYMA 3VIHA 4U2ZA 1Q6CA 2WCSA 6CGTA 4J3SA 1EO5A 1OWQA 3FAWA 4PMQA 2BY1A 2PBGA 1EXPA 3OIHA 1E5JA 1KBBA 2WANA 3BCFA 3WD0A 1R7AA 1SR0A 2J79A 1O7AA 5A6MA 4AEFA 4KGJA 3WH5A 4LQ1A 2A3CA 4P8XA 1TVNA 4JKLA 4UFJA 1EHAA 2BNJA 5HPOA 1B0IA 1WZKA 1LL4A 4A3YA 1CIUA 1U33A 2G41A 5GPRA 4MJ4A 1E9LA 1J11A 4AY1A 4CD6A 3TP4A 2WVVB 4HZ6A 4UQCA 2NT0A 2VX5A 3KEHA 3VIPA 3PZGA 2GK1A 2ZE0A 4PUEA 1CGWA 4B3KA 3WDJA 3DHPA 2VZUA 2GJXB 2XFFA 1W2PA 2PWDA 1LG1A 4RE2A 2X0HA 3VX1A 1EQCA 3WMCA 3WQ8A 1CNVA 1NWSA 3OGSA 4CU6A 1E71M 1QI2A 2VC9A 4HZ8A 4R5EA 3CPUA 3W24A 4CVUA 4IPLA 2BVYA 1M53A 1MXDA 2CEQA 5AYIA 1JZ3A 3M07A 2PB1A 2X8RA 1W32A 3AIWA 5DO8A 3KL3A 4NI3A 1NARA 2XG9A 1UG6A 1WZAA 1E0XA 1Q6FA 1C7TA 3AS0A 5BRPA 1H3GA 3OG2A 4X0NA 1B31A 2J25A 2EPLX 4RE3A 1E4NA 3LPPA 3W38A 1XCWA 1EO7A 4W5UA 2IUZA 3IJ9A 3BAXA 2BVTA 3WNPA 4UFIA 1VEOA 2OYLA 3L4WA 1JYVA 2DH3A 5AC4A 1KBKA 5A8PA 1MFVA 3VPLA 5I77A 5DF0A 2PWGA 3MV11 5HDRA 8CGTA 4UQAA 1QNPA 2JEPA 2XSBA 3OZOA 1ZJBA 3ZR5A 3WY1A 1JXKA 1CLVA 2YA0A 5FL0A 3SUWA 4BZYA 4PTWA 1ISWA 4W84A 4F9JA 3CMJA 1EQPA 2CBUA 1UA7A 3WH9A 1VF8A 3NIYA 1EOMA 2PF0A 3IJ8A 1OIMA 3EDJA 3MMWA 2YBTA 1XCXA 1H4PA 3VMOA 3W26A 3NYDA 2GUYA 4FLRA 2X0YA 3VM5A 2YL9A 3AS3A 6TAAA 2PWHA 2OSWA 1K9DA 1H09A 1D2KA 1E6RA 1SYTA 1EDQA 2UY5A 3UESA 1KCLA 2MANA 5CGMA 1CDGA 4AW7A 2GVYA 1JYWA 1SFSA 2UY4A 4P7LA 3OLIA 1CXHA 2Y8VA 4OJYA 1JF6A 2J4GA 1MXGA 3FW6A 5E70A 1KQYA 2WMIB 2WMFA 4TX8A 1W9PA 3WMSA 1HKKA 1GUVA 2VX7A 1H49A 3O2LA 2J7FA 3IJ7A 3MV01 1NWTA 1GOOA 1W3LA 1X1NA 4A3HA 2J7BA 4IISA 2O9OA 3AS1A 2EEXA 5BXRA 4KMQA 3RCNA 2ZX8A 3AHTA 4AD2A 4PRWA 3WNNA 3KL5A 3NSMA 2WCAA 3SUSA 2ZUUA 3O6AA 2BY3A 5M17A 3SIMA 1V3IA 1LQ0A 3ARUA 2Y2WA 4MB4A 1B3ZA 4JL2A 4R27A 3A3HA 1JXJA 4U31A 4MB5A 2PWFA 2J74A 3S2CA 3NSXA 3VKKA 1GW1A 4GI8A 1R86A 2WWDA 3GYCA 3PBGA 2D0GA 1CGUA 3VIOA 3W28A 3VGBA 3G6LA 3F5KA 3T2OA 3BMWA 1QW8A 2YBUA 1DWIM 3VIFA 4AC1X 4U5KA 5DEZA 1K9TA 4ZXOA 1WPCA 3AIBA 4GO8A 1BGAA 1E15A 2VOTA 4W86A 1WDSA 1J0HA 1FH8A 4WLCA 2BXZA 3UCQA 3DECA 3VU2A 3WKZA 4WF7A 2YLAA 2G3IA 4W93A 3GXFA 3M46A 2XVKA 4ZE5A 2DH2A 2J77A 3CZLA 2VTFA 4PTXA 1W9DM 3W81A 1E5NA 3VDCA 1J18A 2XTKA 1MW1A 1GQLA 3L4TA 2QPUA 1UD2A 3AMKA 5A8QA 4L4PA 2WK2A 3B9DA 1UKOA 5A1AA 2A3BA 5DFAA 3WL0A 1B90A 4XUYA 1ODUA 4AD0A 1BVNP 4D1JA 3AMLA 2VCCA 2EPKX 1QI3A 1RPKA 4BS0A 5I5RA 3MU7A 1V6VA 2XIIA 1GOKA 1BYAA 4HZ7A 3AS2A 5JBDA 1E4LA 4UFKA 1V3JA 2ZIDA 4P8UA 4HA3A 1J0IA 3WMBA 1I1WA 4JKKA 2IXVA 4AIOA 3VVGA 5A8OA 1B3VA 1D7FA 1LF1A 2BVDA 1ISYA 1UKTA 3N15A 1HF6A 4MB1A 1V6XA 1FH9A 4HPHA 4B16A 1XH2A 1CLXA 1CXLA 3GXMA 3VGGA 1PEZA 4FLQA 3CO4A 2G3NA 5I23A 3W37A 1QNQA 2J7CA 3VMNA 1UWIA 4UQEA 1XSJA 1QNRA 3EMQA 4CVWA 3PZVA 1US3A 4H8HA 2VT0A 1RP9A 5TD4A 1V3KA 2WBKA 3U7BA 1AQ0A 3POHA 1HKMA 3IAQA 1UKSA 4CU8A 5C70A 3HMCA 5I24A 1A47A 1HNYA 3WNOA 3VGFA 1MW2A 2WVVA 5HNNA 3EBVA 3PHAA 3VD7A 3N11A 3CHDA 1TZ7A 2J7DA 1CXFA 2WVUA 2VRQA 3CUGA 4P7NA 1HL8A 4KH2A 1IZJA 2BY2A 2GDVA 2QHAA 5HOSA 1CZ1A 3AZTA 2W4XA 4GO9A 4D6CA 1H1NA 3CIVA 1VBUA 3KZSA 3MSGA 1BYDA 4HMEA 4LYQA 1MWOA 3BSGA 1GVIA 4AIEA 2WVSA 1TVPA 3RJYA 3WBAA 5IHSA 4F9DA 3WDHA 4F79A 5A2CA 4XB3A 4C7GA 5CJ5A 2D23A 1BFNA 1F4HA 5DT5A 3RM4A 4M82A 1PIGA 2GJRA 1E6ZA 3CHEA 3MUY1 2OSYA 3MUIA 3CMGA 2D3NA 1UR4A 1JZ5A 3WBEA 2F8QA 4W8LA 4M56A 4QP0A 1I75A 1QHOA 4B9ZA 5BCAA 5FOOA 2WSPA 5A6AA 3UR7A 1QNOA 1B2YA 1KXTA 3W6LA 1E40A 1BGGA 3PZOA 2V3FA 4F66A 1M01A 5CQ1A 4HTYA 3VNYA 5BXTA 1VAHA 4WK9A 1TG7A 6A3HA 3GH4A 4AZGA 1K9FA 1R8LA 1E55A 1ZU8A 2WXDM 2XM1A 3PZMA 3RILA 1W9VA 1WDPA 5CSYA 4ACYA 3BSHA 1J0YA 3OZPA 2WBGA 1LL6A 2CESA 1R87A 3WNLA 1V0KA 1M04A 3MMDA 3MANA 1AQHA 5KZ6A 5A69A 1MQQA 4ATDA 3VGEA 1BSIA 1ITCA 2D3LA 4W89A 1GORA 1DWJM 3DHUA 3CHFA 4CCCA 4W8BA 4FLOA 3SCOA 2DQXA 2OWWA 2XUCA 1JL8A 1K9EA 3N18A 3EMZA 3RDKA 3ZJKA 1V0MA 3ZIZA 4W7VA 4IM4A 4KWUA 1UQYA 4J3XA 2XVLA 4HOWA 2C8NA 1QI4A 2D20A 4PN2A 1W1PA 3ZOAA 2J7HA 4TXEA 5ABEA 2Y8KA 4MNJA 2XHYA 4WKAA 2NW0A 1JD9A 1KXHA 4U33A 3BC9A 3QR3A 4UR9A 4N42A 5BXSA 4PCTA 2JF7A 3UR8A 1DWHM 2HISA 1GHSA 4EK7A 4NF7A 5FIPA 3BAWA 2WMIA 3EMCA 1V02E 4D6IA 1WAWA 3CGTA 3AQUA 1JZ8A 3ZT5A 5BWFA 3ARVA 4JCMA 3RIKA 4CD5A 3T09A 5IDIA 1NQ6A 1YQ2A 4C7DA 4CD4A 3QOMA 4TTGA 5DT7A 2J75A 4HOXA 1W3KA 2CNCA 1W91A 4FMVA 4GPNA 1GPFA 2VUYA 2E4TA 3VGDA 1MQRA 2O9RA 4PUDA 2FGLA 3GXIA 3HJEA 3ZT7A 3TTYA 3DC0A 2ZOXA 1C8YA 1CYGA 1QBAA 3ALGA 1W9BM 1LG2A 5CLWA 4M29A 3HN3A 1XSKA 2VL4A 3FAXA 2WZIA 4K68A 1H0GA 3F4VA 3WEMA 3WQ4A 1KGUA 2J62A 2DIEA 1FHDA 1JYXA 3L4VA 1DWAM 1ZBVA 3WD3A 1JFHA 2VQTA 4J3VA 5EBAA 4Z2JA 4H04A 3AOFA 3LPOA 4NRSA 4AZHA 2G3MA 3ZSSA 4MB3A 4D6JA 1JGIA 3T0DA 1WDQA 4W8AA 3GZAA 1HP4A 3UG4A 1E72M 1OT1A 1ZL1A 1C7SA 2RGMA 4PMXA 4BQ3A 3B8SA 2WC4A 2WZHA 3GXDA 3WDIA 1MW0A 3B9AA 2VMFA 3VIGA 3AHVA 4WKHA 5M03A 1UKQA 4OBRA 4L4OA 4M80A 3TTSA 1VEPA 1C90A 2CKRA 4HU0A 1EGZA 1TR1A 3WDQA 4UOQA 3AYSA 1V0NA 4QLKA 3BGAA 3AISA 3CZ8A 3WQ5A 1PZ3A 2BHZA 4EKJA 2YKKA 3CZGA 4CN4A 1OCQA 3ARYA 3VGHA 2YLLA 3RMEA 1J12A 4TTUA 3RM8A 1Q6GA 3MSDA 4DM1A 4U3AA 1JFXA 3A47A 4W85A 4AD5A 2TAAA 1W3HA 4HP5A 1JIBA 1TUXA 2GDUA 5BXPA 2G8ZA 1OBAA 4QLLA 4Z2HA 2ZXAA 5EB8A 4PTMA 1XYZA 5A2AA 1WB0A 3NJ3A 1VFUA 2WKLA 2EO7A 1VB9A 2W67A 3NDZA 7TAAA 1WZMA 5LA1A 5HBFA 1EHNA 2EPNA 2J8FA 4UFMA 2WC7A 1HKJA 5A95A 1HJWA 2WHLA 1Z32X 1DP0A 2ZXQA 2YA1A 5LYRA 3NCOA 1H11A 2CHOA 3OBAA 4D6FA 2CERA 3AMCA 2EJ1A 5F7UA 1JAEA 3LPGA 4TUFA 3D5HA 1W9XA 3VINA 3BXWA 3WD1A 1BLIA 5I6SA 3VDBA 2XFRA 4W87A 1GZJA 2XGIA 2CCRA 1PIFA 4JFTA 3CLWA 3T0AA 2W63A 1JD7A 2VQUA 1A3HA 5E0CA 2VURA 3AXXA 3L2MA 4P7OA 5BROA 4P8WA 4MNKA 1RD6A 3AZRA 4U5IA 4V2XA 1VFMA 5A6BA 4W7WA 3K4AA 1ZJAA 2FHCA 4D1IA 1J01A 1VJSA 2WCGA 4GQQA 4OOUA 4OOZA 1O6IA 2BY0A 4J27A 3B9EA 1GONA 3K8MA 3VILA 5FL1A 4AZ7A 4N0RA 2BS9A 4ZEPA 4W5ZA 3W29A 1JI2A 1KQZA 4URIA 5CXPA 3CHCA 1GHRA 1BG4A 3WEOA 4ATLA 4AD1A 7CGTA 1XYFA 4YHEA 2V3EA 3RJXA 1X6NA 1XH1A 3WH7A 2G3JA 2BFGA 2V3GA 2BHYA 2QLYA 4BCEA 3BAIA 1XD1A 2IXUA 4PBGA 1TA3A 3AICA 4YHGA 1CXIA 2EPMX 4E8DA 3AMGA 2WMHA 1KXVA 3ZR6A 2OWCA 3ARPA 1C93A 1KR0A 2ZICA 4CKQA 1WCGA 5C71A 1G5AA 1MW3A 1JDDA 3AHXA 4ML4A 2ZXBA 2ZWYA 4QDMA 1DWGM 1K6AA 1VFFA 5JIPA 3KWXA 3SCUA 1BTCA 4WSKA 4JFUA 3EYPA 3N1AA 2V38A 3N9KA 4DM2A 4UZUA 5JUVA 4AD3A 2XM2A 2XPKA 4D71A 4PMNA 1E6SM 4QFUA 2E8ZA 2D2OA 2QV4A 2XVGA 5ABHA 1YHTA 1ISXA 2G4FA 3SEPA 4PTVA 4X0VA 3SCTA 3K46A 5CSUA 4P8VA 4CD7A 2YL8A 1KB3A 4TVDA 3KL0A 4PEEA 3ZO9A 3G6MA 3WDRA 1JZ7A 2DPEA 3WELA 1BG9A 4EANA 3CZEA 4Z2GA 1KWGA 4J28A 2AAAA 1XC6A 1VBRA 4U3CA 3PTQA 1QI0A 2JIEA 1TMQA 2J8GA 1C3FA 5AYBA 3WEZA 2FH6A 2WC3A 2JALA 2DIJA 3IK2A 4WSJA 4FF5A 2HVMA 3WL1A 3MMUA 2Y24A 1IT0A 2VX6A 9CGTA 3U57A 8A3HA 3GNRA 1CXKA 3VIKA 1FH7A 5A6BD 1LJYA 2ZX6A 3THDA 4JZ5A 4UFLA 3ZQ9A 1DEDA 2BV9A 2DT1A 1HJQA 1AMYA 2VVSA 4M24A 3ZM8A 2V5CA 1EH9A 2C0HA 3W0KA 2DDXA 2V3DA 4ZENA 3AIQA 2EQDA 3BAYA 3ZJ6A 4AZIA 2F2HA 5HXMA 3WENA 3ARQA 5D9OA 2E8YA 1DTUA 2XGBA 2DSWA 2A3EA 3VD3A 1BYCA 4HPGA 2EBNA 1OSEA 3W27A 1ISZA 4CU7A 3WSUA 1KGXA 3MKKA 2DSKA 1IZKA 1C91A 2RGLA 4XZBA 4E4PA 2OSXA 1ZS2A 2W61A 3CZJA 1KWKA 4GZEA 4D72A 5CPSA 1E43A 1F4AA 1ODZA 5E6ZA 1GQIA 4NSBA 3VM7A 2WAGA 4D6GA 4PMVA 1E6XM 1E4IA 5BRQA 1PPIA 3NUKA 3CTTA 3ARRA 1GJUA 2VR4A 1C92A 1VIWA 1Y7VA 3WF0A 4CCDA 1CGTA 1VENA 4B15A 1JF5A 4FK9A 1JZ4A 4DWSB 1UA3A 4GINA 5A6KA 2D24A 3PZNA 1J0JA 1W2VA 3W4RA 5I3DA 5JBEA 1H5VA 1QNSA 3A4AA 1E1FA 1E6NA 3U7VA 4MNMA 1PZ2A 4OZOA 1H41A 4GIAA 5I0DA 4LPCA 1HJXA 3EDEA 4BQ5A 2X2YA 2ZUNA 3ARTA 4A4AA 5I79A 1ECEA 3ARZA 1UWQA 2XVPA 1W1YA 4TVUA 1C8QA 1FA2A 4S3KA 3OLDA 4D6EA 1TA3B 2O92A 2A3HA 2WHJA 2E9BA 1H0IA 4QAWA 3GH7A 5A8NA 2FH8A 1UD3A 2XFYA 3T0BA 4YPJA 4PMUA 2VCAA 4JAWA 3W6MA 3M6DA 2YDRA 4Z2KA 1US2A 1G1YA 3RO8A 4AZ5A 3PN8A 4CD8A 1I1XA 1JDAA 1V3HA 1SMDA 2AOSA 4PMOA 3MUAA 4J3WA 1QI5A 1JI1A 2J47A 3PZQA 3OA5A 4OUEA 3AROA 2XVNA 4MAVA 1GOWA 3EDFA 2E9MA 5FCZA 4UNIA 5A6LA 4GQRA 3VX0A 2ZX5A 3AIUA 2PC8A 3GH5A 2CBJA 2OWXA 4MDOA 1LWHA 3K4DA 1JNEA 2XWDA 3APGA 4PSRA 5ECUA 2W91A 1ISVA 4V28A 4CUCA 4AZBA 2VI0A 1V08A 3AXIA 5E09A 3WQVA 2WPGA 1AVAA 1GQJA 4KGLA 1H2JA 3BAJA 2J7GA 4UCFA 1EOKA 5EMYA 2ZUMA 3I3DA 3SCWA 4E2OA 2YA2A 2ZXDA 3GBDA 3L4ZA 4PMRA 4D6HA 1J9YA 3N04A 3AJ7A 1HJSA 1LLOA 1B3WA 5D9NA 1WDRA 4V27A 4ACZB 3CH9A 2X09A 4MDPA 3WH6A 4WKFA 4M81A 1MYRA 3AIRA 1WE5A 1CPUA 2UY2A 3WN6A 3QOKA 2DSVA 3KE0A 5A94A 4Y7EA 1NP0A 2YIHA 1CGXA 1B9ZA 5GNYA 4H2CA 1FHLA 1PX4A 4H8VA 1OD0A 4J3TA 3LMYA 1OGSA 2WLZA 2D0HA 4LYRA 1AQMA 2XWEA 4LYPA 4BF7A 2BHUA 3SCQA 1WO2A 5E9AA 1UZ1A 1R7OA 4CN1A 3WIJA 2WNWA 4DUXA 5D9MA 4HA4A 3CUHA 4JFWA 2QMKA 5LA2A 3E1F1 4JIEA 1VJZA 3HU7A 1UR9A 1V6YA 1PAMA 1NOFA 4EE9A 4KRTA 4JL1A 2OYMA 1UKPA 1V0LA 1NWUA 3TTQA 4H41A 4NRRA 1XH0A 2B31A 2DSZA 2ZUWA 2YL6A 3CZKA 1QBBA 1VRXA 3ZJ7A 4HMDA 1OIFA 3TONA 2VCBA 1GOIA 1UOKA 2ZX7A 4IUGA 1R85A 3EDDA 1CEOA 1L0PA 3L4XA 1G01A 3K1DA 4U2YA 2ZUSA 4GZJA 1ESWA 1Q6DA 1B3XA 5CPTA 4DUVA 4TX6A 4UFHA 5A6JA 2E40A 2JE8A 1GJWA 4PMZA 2FHBA 2J7EA 1NOUA 5KEZA 4UOJA 4XX6A 3TTOA 4UOZA 1NM9A 3PZIA 1M7XA 3QHMA 3OLEA 1V6UA 2EXOA 2J78A 5ABFA 2D22A 3VOCA 4ZE4A 3I3EA 3K8KA 4BQ2A 2YOCA 4DUWA 1U2YA 1HXJA 2YDSA 2BXYA 2E3ZA 1JDCA 4JHOA 3RPMA 3W53A 3WNKA 2WWCA 5HPCA 1UWSA 3S6TA 1UZ4A 3WUBA 1QHPA 1GQKA 1QHZA 2Z1SA 1UUQA 1PBGA 2WKGA 3WFLA 1HVQA 3AFBA 4MTVA 3VO0A 1JNDA 1V3LA 5D8ZA 4FLSA 4BQ4A 1BQCA 1ZB5A 2W62A 4QCFA 2VR5A 3EDKA 2W92A 3WUFA 1GOMA 2CITA 5A3HA 3BAKA 4MAZA 1QVBA 2YL5A 1FFRA 4JKMA 1NWRA 3VIIA 1GCYA 1N82A 4PMYA 5JIWA 2GJPA 4JHZA 1QPKA 1OB0A 5CLTA 4Z2IA 1UD8A 1HVXA 1PJ9A 4AZCB 2F61A 3ZJ8A 3F5LA 1SMAA 2Q8XA 5CPQA 1UR2A 7A3HA 4XZWA 2GSJA 3WH8A 4NZCA 2D1ZA 1MFUA 1KXQA 3ZSTA 2Y5EA 1HJVA 3A6OA 2OYKA 3FN9A 3ECQA 2X1IA 3I3BA 4PMDA 2VZSA 4CCEA 1HN1A 3PTMA 4HU8A 5M3WA 4PYSA 4Q22A 2VRKA 4J7RA 2WSKA 1W1TA 4DWSA 2ZX9A 3N13A 3U5UA 1B30A 1EDGA 1UWRA 4RE4A 4ATWA 1GVYA 1JAKA 2WZEA 1UH2A 4KRUA 1E6QM 1ZBCA 1GOQA 3GNOA 3LPFA 4UTFA 4P7QA 1ZBWA 4P7RA 1E56A 3PZUA 1UWUA 1BF2A 2VNCA 3IANA 1CGYA 3SUTA 4GI9A 1G0CA 2VZOA 3WQ6A 1C8XA 2QPSA 3VDAA 1UQZA 4GKLA 4M8UA 1OGBA 3BCDA 3QHOA 2DEPA 1IV8A 3SCNA 4UQBA 4W88A 2WYSA 3MUZ1 3VDHA 3POCA 4PCSA 1Q6EA 3BLKA 1E70M 1HJUA 4E8CA 1RP8A 1JZ2A 2PWEA 4AD4A 2ZWZA 2XYLA 3CBWA 1OGGA 4AZ6A 3A4WA 2WMGA 3ARXA 1S46A 1NOWA 2WLYA 5CG0A 2VJXA 4S3JA 5FKYA 3FHQA 1LL7A 2GK1B 2O9PA 3UETA 4WJXA 1E3XA 4H7VA 3VUPA 4AYSA 1PX8A 3SCVA 1KGWA 1XHGA 4OKDA 4CGTA 3ARSA 2NSXA 3WQWA 2WW5A 3OLGA 3GBEA 4AIUA 1XGZA 2NT1A 4HMCA 5JBFA 2EPOA 3QHNA 4F8XA 1CWYA 1E0VA 1TCMA 1CBGA 3AI0A 2DT0A 2CPUA 4AEEA 5A8MA 2ZUTA 5A2BA 2PBOA 1UWTA 3SCSA 1CECA 1W9UA 3AZSA 5ABFB 2Y4SA 1FP9A 3WF4A 5GNXA 3QGVA 5E0FA 1RH9A 2XSAA 1WKYA 1DHKA 1HX0A 4C7FA 1HP5A 1KR1A 4WIWA 1KFWA 1UD6A 1UR8A 5IFTA 4AMCA 1EIBA 1CXEA 5IHRA 3L4UA 2A3AA 1E6PA 1NH6A 3AHZA 3SCRA 5AY7A 2CBIA 3K8LA 1KCKA 1UYQA 4ACZA 3VIJA 2JF6A 4HOZA 5C8BB 1FOBA 4IPNB 4DWSD
chains in the Genus database with same CATH superfamily
3QKEA 3H6OA 2CU0A 1BWLA 5I09A 1DWFM 2B81A 2GUBA 3VNZA 1HL9A 3U4AA 3M0ZA 1FFQA 2VX4A 5AHNA 4LAKA 3ANVA 1BEUA 1FCQA 2J8TA 3RM9A 3W7KA 4QSFA 4D8AA 2DJXA 3OHIA 3W25A 4AB4A 2FHFA 4CLMA 4GCAA 4M5PA 1X1OA 1RHCA 5XINA 5JVLA 4MKSA 3QH2A 1S5NA 3QZ6A 1POJA 5H8PA 3H2AA 4HNLA 1XLMA 3R2GA 2TRSA 4E2BA 4S2BA 3WF2A 2X05A 3LMZA 3BLPX 2VEKA 4FEZA 3UERA 1O94A 3M47A 2VGGA 1JG9A 3F5JA 5BU9A 3W6YA 3L66A 1F6PA 3G1XA 5A6SA 4JN7A 3DYOA 4AX6A 4JPGA 1OINA 3NPXA 3IJQA 4TVCA 3XISA 4IQDA 3FFSA 4A05A 1FBAA 5AC5A 4DY1A 3Q67A 4DXVA 3WJXA 3CTLA 3GXTA 1NFPA 4QROA 3COTA 3O05A 1KCZA 2IPJA 2QDDA 3U2CA 1ZAHA 2HTMA 3WD2A 3MUCA 1WP6A 1YRRA 3VE9A 1OD8A 3VD9A 2FPTA 3FJNA 2I5IA 3ZR4A 2YR1A 1S2WA 5HK4A 3T08A 1ZY9A 4KWVA 3CUJA 4V1XA 2XN1A 3TYCA 4AISA 1VBGA 5FESA 1M03A 4R3UA 4QX4A 4F0SA 3EOLA 3O0FA 3ERPA 2GOKA 1EJTC 3AIEA 3OEXA 1A53A 3FDKA 1W1VA 2IKHA 5DMYA 3QQ1A 3UWVA 4FIQA 4JTEA 1E73M 3NQ2A 1UH4A 1UD5A 3CEPA 2VOMA 2FDMA 4JCLA 4DN1A 5ABGA 2V5DA 3EXTA 4HA1A 4NZ1A 1OT2A 3BJFA 3GNPA 5CC7A 4UQ9A 1ZENA 3VMPA 3LENA 2HQAA 3R0KA 3TH6A 2R1PA 2Y5SA 2AMGA 3KOFA 1ME9A 3PB2A 2CYGA 1OC6A 5G5IA 3W7JA 4ZB2A 3TN4A 1L6SA 5IXEA 4G56A 1IXNA 1J0KA 1OEPA 4M6PA 4GC4A 4B3LA 4S3EA 1LWJA 3JU2A 2V69A 4JTCA 1YX1A 3WYZA 1BXNA 3WF3A 3GRIA 5KSWA 3U5YA 3UZXA 1XD0A 2PLCA 5HMSA 1Z69A 3VZYA 3WQEA 3ZT6A 3WBWA 3PANA 3BH4A 3DOPA 1ZQ5A 3I6RA 4UQDA 1FVPA 3WFZA 2PD9A 4EAMA 4OHQA 3W9ZA 1M7PA 3GQYA 4ZXLA 3UG3A 3LS9A 4MPKA 3WDPP 4MNLA 2E0PA 4LX4A 3USZA 1OM0A 2WMKA 2VFDA 3NDYA 4D6DA 1YNPA 1VFOA 4TOQA 3J7HA 4PRRA 2PI6A 4U28A 2C1IA 3EOOA 2WCSA 3MTWA 1EO5A 2NQZA 3TW6A 1ONWA 4PC8A 4XD5A 4FSAA 1JCNA 3G0UA 3OIHA 2WANA 1A5NC 4RV8A 4RX0A 1O7AA 4AU0A 5AECA 4AEFA 4KGJA 2FJKA 1SM9A 4P8XA 4Q4RA 1AL7A 1EHAA 4IIHA 4RW5A 3BCJA 4QQ3A 2G41A 4MJ4A 1E9LA 1XLAA 1J11A 1AZ1A 4PEKA 2BDQA 3TP4A 4XZHA 3KEHA 3VIPA 3QTGA 2HWGA 2GK1A 4ZO6A 2PDYA 2ZE0A 4NNCA 4LSBA 2DVTA 2XFFA 3WJWA 2W27A 1KM1A 2XFWA 2X0HA 3VUSA 1CNVA 3O6CA 3E3HA 4CU6A 4QISA 3KBVA 4HNUA 4LY4A 2VC9A 1IIGA 3CPUA 3BMXA 4ICMA 3UY7A 5GJMA 1JZ3A 1A0CA 4R9OA 3M07A 3O6DA 2OEMA 5DO8A 1NARA 4XWUA 1UG6A 2XIJA 3T9PA 1E0XA 1LT7A 1Q6FA 2IKJA 2R8WA 1W1B1 3I68A 4RXGA 1H3GA 4NAFA 1B31A 1WYIA 2J25A 1QJWA 4ML9A 1XCWA 1EO7A 4HPJA 4FX7A 4KRZA 4J2MA 1O5QA 3QSTA 1XLCA 2DH3A 1KBKA 5JXQA 4GG9A 5DF0A 4GWEA 4I7VA 3ITLA 3MV11 4PL1A 4CEUC 3CASA 3F2DA 2XSBA 1Z44A 1ZJBA 4UTIA 2ZZ3A 2YA0A 4HKPA 4WX2A 4BZYA 1KNWA 3GXPA 5MKGA 3FXGA 1ECQA 2PDMA 2A4AA 3WLRA 1YNQA 1UA7A 5C55A 1VF8A 1J5TA 2VEPA 1OX6A 2XSXA 3IJ8A 2ZVRA 1YBQA 1TRIA 3VC5A 1EZ2A 3HF3A 3W26A 5E0KA 1E9IA 1LOQA 3GG8A 1TTQA 2FPVA 3KCOA 3VM5A 1LOSA 1Q6LA 3AS3A 6TAAA 3GAYA 3VOHA 3V4BA 3TQ0A 2CLKA 2JK2A 5HQMA 1YXYA 3DI1A 3TQVA 3WCZA 1UBSA 1CDGA 1V93A 4O11A 2GVYA 1SFSA 5HWJA 4OJYA 4YL2A 1U83A 1QW7A 4MUZA 3FW6A 5CBBA 4HCHA 1AH4A 1YTKA 1N8FA 2RDXA 2E6AA 2VX7A 1H49A 3CQHA 1VZWA 2IPFA 4FXSA 3MV01 3PVFA 1LT8A 2NLYA 3A22A 5FAGA 3AS1A 2EEXA 4KMQA 4ONVA 4N6EA 3N4EA 3W7EA 1OX5A 1P0EA 3BICA 3KL5A 2WCAA 3NL3A 2BY3A 1DORA 1V3IA 4GY0A 1B3ZA 4MB4A 3RAOA 2WOQA 1OFQA 1VPYA 3FCPA 1H60A 4MB5A 1X96A 2PWFA 2ZRWA 1L8PA 3BGGA 2V9DA 4C65A 1R86A 3PBGA 4O57A 1KBLA 3G6LA 2V2CA 3F5KA 3GFXA 3BMWA 1N8IA 2YBUA 3GHUA 2DV0A 5DEZA 2ZTJA 3CQJA 4DUOA 3L5LA 2GQ3A 1WPCA 4G8TA 1TPB1 1E15A 2VOTA 1OCJA 1Z41A 2DU2A 3C5QA 1FH8A 4WLCA 1JPMA 3DECA 2QJJA 3TSMA 3WKZA 4ZOBA 2G3IA 5DELA 3QC0A 3FIGA 4ZE5A 2Q3RA 2J77A 3NQDA 4KERA 4IIGA 2E6DA 2PDBA 5K9DA 2IPGA 4GQBA 1GQLA 4NZ5A 3OG3A 1YTEA 2QPUA 4H6QA 4IMGA 4L4PA 1ZCOA 1DYSA 3L65A 2CLLA 3GUWA 5A1AA 1Q13A 5D38A 5AZ1A 1AJ2A 5GJNA 2PE4A 1BVNP 1I2PA 1QDSA 3PG9A 2Y5JA 3VC6A 5G1TA 1RPKA 4Y9NA 3I6EA 1ZHAA 1E4LA 2ZIDA 5FF3A 1FWDC 1UPPA 5BOEA 3KBMA 4JY8A 1EJUC 2Z28A 4AAJA 1TJ0A 1SGJA 2OG9A 1UKTA 2A21A 3FGCA 1YPIA 1R2TA 1K8ZA 2Y0FA 5DMMA 5K4ZA 3S6DA 4Y90A 3M0VA 1CLXA 3GXMA 3A13A 2QVNA 3VGGA 1P6CA 2J6VA 1JPHA 2CZFA 2ZRZA 5TIMA 5GVJA 3D3FA 4EACA 3W37A 1QNQA 3RFAA 3VMNA 1WKEA 4UQEA 1US3A 2BOFX 3H21A 2AL1A 2Y85A 2WBKA 1AQ0A 4W9TA 3B0XA 3S5YA 1A47A 4LU0A 2XDFA 3T07A 7ODCA 3NG3A 3N11A 3UU0A 3CHDA 3ABQA 2J7DA 3VA8A 1L2QA 3SY5A 2PAJA 1IZJA 1DQXA 4G1NA 5LSMA 1J79A 5CG7A 3DERA 1CZ1A 4GJIA 3NM3A 4WOQA 2YX0A 4HD5A 3G1AA 3CIVA 2C3ZA 1TPFA 2H90A 3DXIA 3K2GA 2QIWA 3AU2A 1IWBA 4EF8A 4I9MA 3L5MA 3BSGA 5I02A 1UP0A 3A5VA 4XSMA 1K8YA 4F9DA 2YGYA 1LRNA 1BFNA 1Q7ZA 2YPIA 1YDNA 3CHEA 3MUY1 3BL3A 3MUIA 3CMGA 3WBEA 3PUOA 3E5PA 2F8QA 2PP0A 2QGHA 5FA5A 4F0RA 1O5KA 4ZQRA 1I75A 1U1JA 5A6AA 3P6LA 2P5NA 3I4KA 3GE7A 2V3FA 3KTCA 5B7YA 5CQ1A 3VNYA 1XI3A 1TG7A 1W5PA 5CGQA 4AZGA 3WX7A 3TSDA 1ZU8A 3RILA 1OFEA 2RUSA 3Q4DA 5EMMA 4ACYA 3UVIA 1W5NA 4B91A 4KBXA 3BSHA 4RDWA 2WBGA 2E25A 3IK4A 3TR2A 3FYOA 4WXYA 1K8CA 1AQHA 5KZ6A 5A69A 3OTRA 5HNTA 4V1YA 2VC7A 4C5YA 3VGEA 1BSIA 1MZRA 4W89A 3KVKA 3DHUA 2YB4A 2DQXA 5C9WA 2XUCA 3VXGA 1K9EA 3N18A 1OC7A 4C6DA 4IM4A 4JTQA 4KWUA 4K39A 1R46A 3E0IA 2RDUA 3DFOA 2C8NA 3S0CA 2XN2A 2F7FA 3ZOAA 2J7HA 5ABEA 2OX4A 3PUGA 4C1NB 2F6KA 1KLYA 2NWRA 1A5OC 4UR8A 2YCLB 3QSRA 2INZA 5HJXA 1DWHM 4FO4A 2HISA 1KBIA 3TUUA 4YTQA 3VZZA 3BG5A 2WMIA 3CGTA 1OYAA 2G95A 5FF0A 4XKYA 4CD5A 5IDIA 3UJ2A 2XIQA 3UR2A 4C7DA 4LT9A 3CYJA 3PAJA 4O19A 2CNCA 2O9RA 4PUDA 4ZODA 3LOTA 1QK0A 1TELA 2ZOXA 3NL6A 4N02A 1C8YA 1XW8A 3WBXA 1CYGA 1XIJA 3TXZA 3ALGA 1W9BM 3IJIA 4HJWA 1Q7MA 1XIEA 5CLWA 3BLDA 4NIRA 4AF0A 1NFBA 2VL4A 4PTDA 4K68A 3F4VA 5E93A 2P0IA 1UUOA 1E9ZB 1FHDA 1PZ1A 3KTSA 3L4VA 4IFKA 4S3DA 1OY0A 1UP2A 2GSHA 5EBAA 5FJIA 2G3MA 4D8ZA 5CH9A 3DDMA 4LAOA 1IIHA 3UG4A 1HP4A 2RGMA 1YW1A 3P14A 2GQ9A 3GXDA 5C2XA 1TE6A 2VMFA 5F2LA 2A6LA 3UWYA 1SO5A 3BTNA 1R5YA 3C0JA 4GUJA 1Q66A 1VEPA 1X7IA 3THAA 2CKRA 2E7FA 4O1FA 2IQDA 1UC4A 4UOQA 2YXXA 3AYSA 4QLKA 1XLFA 3WQ5A 2BHZA 4HCDA 3JZEA 3CZGA 3NQFA 3RMEA 4TTUA 1Q6GA 4DM1A 4W85A 4KCVA 3RRXA 2ZRVA 3LYEA 1REQA 1W3HA 2GDUA 5BXPA 3TYZA 2VKZG 5AKQA 1G7UA 1Y5VA 1XR2A 4PTMA 5A2AA 1OG0A 2X16A 4M6QA 1VFUA 4NZFA 3LM3A 3MSYA 4L9XA 5LA1A 2POTA 3QR1A 1EHNA 4O53A 2F6XA 2EPNA 1Z6KA 1X7FA 1HKJA 3URBA 2AQOA 5A95A 1XICA 3SR7A 4MFEA 1DP0A 1WXJA 3H55A 5LYRA 4MY9A 1H11A 3OBAA 5JQ9A 4IPIA 3AMCA 3VKJA 5F7UA 3D5HA 3DBPA 3IUDA 1S3HA 1RXOB 4ECLA 1ZTVA 3MKCA 4UTWA 3TVAA 2BGSA 4XK2A 2OFJA 1TQXA 4D9PA 3NO3A 4FP1A 3QVQA 2GUUA 4JFTA 3CLWA 4IQJA 2AKMA 4B90A 1JD7A 5E0CA 4ZB0A 3P7YA 3TN6A 3L2MA 1VYRA 5CAHA 3AZRA 4U5IA 3LQLA 3DESA 3K4AA 1A5AA 3W73A 4LUSB 1ZJAA 3R8RA 4NHVA 3M64A 2OEKA 1MDRA 4J9JA 4F0KA 1O6IA 4X3ZA 1GONA 4KEZA 4R53A 2EGZA 3VILA 4IX0A 3F7JA 3TX9A 4N0RA 1P7TA 2BS9A 4ZEPA 4W5ZA 3W29A 4ZQNA 3CHCA 4R88A 4LALA 4DO4A 3V0SA 3W2LA 1ZAIA 2P8BA 2V3EA 3AYVA 1XH1A 3LN3A 2BFGA 2V3GA 1SZEA 2QLYA 3BAIA 1XD1A 3FJ6A 1TA3A 1EWEA 3VOGA 3AMGA 3TSBA 1KXVA 2F6UA 4ERAA 3ARPA 1C93A 1TUFA 5AYZA 1KR0A 2ZICA 4CKQA 5C71A 2QJMA 1JDDA 3AHXA 1VD6A 2ZWYA 3G3MA 4QDMA 1DWGM 1K6AA 5CPNA 1AL8A 4WSKA 4LUTB 2W6RA 4B5NA 4D71A 4X22A 4ZOAA 1E6SM 5ENLA 3H53A 1X6UA 2D2OA 4O54A 4H6EA 1ADOA 5ABHA 2G4FA 3GSMA 4C90A 4ZVJA 1ZZMA 4JN6A 4CD7A 1WXYA 2YL8A 4Q7BA 3BJTA 3CT7A 1Q45A 2QCCA 3QFWA 1KFEA 1JZ7A 3NO5A 3VCRA 3K1GA 3B0UX 2VC5A 4Z1CA 1X38A 2CW6A 3PTDA 2HK0A 2D73A 1QI0A 1IR1A 3B8TA 1I2QA 3WLSA 3S5ZA 4AWSA 1UZHA 3K30A 1C3FA 3PR2A 2C71A 1XLBA 3BLLA 4WSJA 2DIJA 3IK2A 4NT0A 3S42A 4IPPA 2FZBA 5AFDA 1IT0A 2VX6A 9CGTA 8A3HA 1FKWA 1FH7A 5A6BD 2ANUA 1WA3A 4JZ5A 3ZQ9A 4IXXA 1HJQA 4LVAA 4JTRA 1UROA 5K2ZA 3G77A 2V2DA 3CPRA 4Q4OA 3RX3A 3AIQA 3LI1A 3GDTA 3JS3A 4OT7A 3N73A 4EXBA 5D9OA 3C0QA 2XGBA 1GEHA 4ZO7A 3N29A 1JPKA 2ISVA 4HPGA 4ZCWA 4JTJA 1Z89A 4UTWC 3E2QA 4HYVA 2ONEA 4S23A 3FA5A 2ZADA 3MT1A 1KGXA 1WOBA 4N9EA 4E4PA 4FHAA 2A7RA 4BEUA 3VM7A 4JIIX 3T81A 4D6GA 2QYGA 1E6XM 3IACA 2P88A 3QN3A 1XC4A 1YDYA 1ICPA 3WF0A 1C92A 1VIWA 1G4SA 2ACRA 2WQPA 4C6BA 1JF5A 3HPFA 4LB3A 3G8EA 1G4TA 3BDKA 3TIMA 4KFOA 1UA3A 4GINA 3OYZA 5I03A 4KF1A 3C8NA 1F73A 2AL2B 1W2VA 5D32A 2FJUB 3TFXA 3A4AA 2Y7DA 4XVEA 5G1MA 1PZ2A 1OK4A 4O4VA 1RA0A 4UNLA 2PGFA 4GH1A 2CLEA 4OV9A 4O12A 5AYXA 3ARZA 2HXUA 2XVPA 3IJDA 3HB9A 4TV5A 4H1ZA 4LVDA 3S9ZA 3ZWTA 2FZNA 2D2GA 1EEXA 1EC9A 2A3HA 2WHJA 3YPIA 5HQLA 1KW1A 2ZA1A 3HURA 1FWRA 1RLDA 3KCLA 3GR8A 5L6UA 1P0KA 1QOQA 4GVGA 3W6MA 2YDRA 3HQ1A 4US5D 1US2A 2GWGA 3K13A 1Y5XA 3EXRA 2X7VA 3RO8A 4AZ5A 4H19A 4CD8A 1NDZA 3BW4A 4PMOA 1M41A 3AALA 2WKJA 4IGNA 2Q71A 2AMXA 5L9FA 4NX5A 2V0TA 3EDFA 4C6OA 3VDGA 3NQ7A 3GFYA 3MPGA 2Z7GA 3HGOA 2V5JA 1WQ5A 3APGA 2W91A 3SGZA 4CUCA 5I3FA 4NAEA 3AXIA 3WQVA 1AVAA 1GQJA 4KGLA 4L6OA 3G5EA 3W1RA 3BAJA 1EOKA 3PWIA 3I3DA 4E2OA 1RQHA 4D6HA 1TX2A 3QGAC 4XZ9A 3WLTA 2VEIA 1WDRA 4ACZB 5I3JA 1FWGC 2W3ZA 3MHFA 4MDPA 4QR6A 1GGOA 4OTKA 1NAL1 1PB0A 3WN6A 3QOKA 1YDVA 2YIHA 3UW6A 1OABA 1XGDA 5DBUA 4TV6A 4L64A 1UP3A 3C6CA 1XS2A 3GTFA 1FHLA 4NU7A 2QCDA 3CMFA 3I7QA 3P3BA 4LCRA 3DHDA 5D2TA 2PDNA 2XWEA 1WO2A 3UZJA 1M9HA 4DUXA 3SAZA 2QAPA 4HA4A 4V33A 5D30A 2GVJA 1VJZA 3STCA 1KM0A 4EX4A 5D09A 3IGSA 5AC8A 2Y63A 1NOFA 4OQVA 2OYMA 2PTYA 4F2TA 1UKPA 4LNYA 1ZCCA 3FEQA 4GBDA 2P76A 2ZUWA 3SRFA 1SFJA 2GVEA 1OYCA 1HW6A 4HMDA 1P43A 3NZRA 1TIMA 5T9BG 3BUVA 4IUGA 1CEOA 3SN4A 1Q8JA 3L21A 2NQHA 2ZUSA 2PDCA 3V75A 1ESWA 4TX6A 5A6JA 5EMJA 2E40A 2JE8A 1GW9A 4MY1A 4PMZA 4JDBA 2HE5A 2WSYA 4WSHA 3BANA 4UOZA 3TTOA 1TPUA 3IS4A 3KBJA 3W00A 3T7VA 2PF8A 4KQNA 1M7XA 5HNRA 9XIAA 4O18A 1W8GA 6REQB 2EXOA 2J78A 3TR9A 3IIVA 3GS6A 4BQ2A 3SFKA 3DFSA 2GL5A 1MEWA 2ZE3A 3HBLA 2DZPA 2E3ZA 5EMKA 4JHOA 5HPCA 1UWSA 1ME8A 3QYQA 3TEVA 4M6UA 1QR7A 2F84A 3WFLA 1PBGA 3AFBA 4Q4QA 3C52A 1MMFA 3L7RA 3VO0A 2I16A 4WEVX 1FWEC 3DFQA 5D8ZA 2W62A 2J6XA 4QCFA 3C3NA 3LCIA 2W92A 4Q8WA 1EP3A 5A3HA 2I7GA 3BAKA 1FWAC 4H9MA 3VAVA 1FFRA 4O0ZA 4MJZA 1GCYA 2G37A 5JIWA 1P4CA 5CLTA 3TMQA 4Z2IA 2Y62A 2HK1A 4LRTA 3ZJ8A 1PS9A 2Z1BA 4IUOA 2XH2A 4GNJA 4XZWA 3RN6A 4GY1A 5FACA 2PD5A 2PDIA 3V1HA 5DCBA 1TX0A 2Y5EA 3LXCA 2I17A 2YCEA 5HQEA 2X1IA 3GR7A 3I3BA 1EC7A 5M2FX 4PMJA 2RH9A 1HN1A 4HU8A 3CLMA 4H6KA 4MKVA 4PYSA 3TC7A 2PGEA 4A22A 4DWSA 2ZCGA 4QS6A 3V0TA 5HMFA 4OBTA 4HN4A 1H50A 3M0YA 4XAGA 1EP1A 1X98A 3GNOA 3PZUA 1UWUA 3C8FA 4LAMA 1FRBA 3IGUA 3IANA 3SUTA 1G0CA 3QFEA 4Z42C 1C8XA 4UBPC 4HPXA 4S3FA 2GSEA 1ADSA 1SJBA 4M8UA 3GDKA 1R47A 3D6NA 2DEPA 2CLIA 5HUPA 1IV8A 4E3VA 5LNUA 4JYDA 2PWEA 2XYLA 3W2MA 4K38A 3ARXA 1KCXA 3N6QA 3FHQA 3PPHA 4LUIA 2GK1B 3BGJA 2DQWA 4H7VA 3IVTA 4C60A 3B8UA 2O0TA 4AYSA 3SCVA 1T8XA 3ARSA 2WW5A 2G96A 4XVDA 2NT1A 3CAWA 1TPH1 1CWYA 1CBGA 1RQBA 3AI0A 3ELFA 3GC5A 3UWUA 2CPUA 3IUHA 5HWNA 3E0WA 7ENLA 1ITQA 4LF1A 2Y4SA 1FP9A 2A2IA 1ZGDA 1M6JA 2B7PA 3QGVA 1RH9A 1ZSXA 1WKYA 3A3WA 3EX4A 1HFBA 3OO2A 1HX0A 1KR1A 1UR8A 1FDZA 4XD3A 5IFTA 4X63A 1EIBA 1CXEA 5IHRA 4PL2A 4DYEA 1TV7A 3K8LA 3V5CA 3VIJA 3HPXA 3HPAA 1A5SA 1EJVC 3R5EA 2D2JA 3N34A 3OU8A 2PCQA 2W66A 3M0LA 1E4MM 3GC4A 1EA0A 3N9RA 4XIMA 3MS8A 1Z7AA 3SUUA 1CTNA 5I3GA 2WHMA 4O4WA 3QEZA 4N4PA 2B7NA 3LTSA 4Z1DA 1W3IA 2HZGA 5D8WA 1DVJA 3M7SA 3LCGA 2HJPA 1VPXA 4IH3A 4ZQCA 4G2DA 5MKGB 3T0TA 4RL3A 3CB3A 3TOYA 3P80A 3G1DA 3EXSA 3PZTA 1DJGA 3O3RA 3FS2A 3MI6A 1MQPA 2OOGA 1E0WA 1IE7C 1BAGA 2BWGA 3S4TA 4FZIA 4Z2LA 2Z1KA 5LIKX 3FY1A 4DWSC 5LGZA 4JTKA 1WDWA 3DYPA 4J2PA 2B4GA 4LV4A 1K03A 1XV8A 5GNZA 2JGQA 2JIWA 2GGHA 3VD5A 1IWAA 1U1UA 2ESCA 2Z26A 1EFZA 3SQSA 4UZSA 3GNXA 3WJZA 4JS3A 1VYPX 3PULA 5E5CA 3DN5A 5M5DA 2Y1HA 1DPMA 1PL9A 4NJJA 4FXFA 2E9LA 4UUIA 1XF0A 3STEA 3W1PA 1ADDA 3FXYA 2YDAA 5XIMA 3FNDA 5DMLA 2CIPA 3FHAA 1KO0A 5E6YA 3SSJA 1HUVA 1DJQA 3O6YX 1B3OA 3IV8A 5REQA 1BSLA 3R4IA 4GNKB 1L6GA 2GOUA 3W7HA 1VIZA 4IPJA 1LUCA 4G6CA 2GVGA 4PZVA 3RPTA 2W5FA 2CHNA 2WVTA 1VS1A 3ABOA 3CUFA 4L6DA 1JYNA 2VRJA 1L8NA 1ITXA 1TFVA 3WNMA 2KZHA 4GX8A 3BE7A 3L4YA 3A4JA 2DGAA 3B03A 3UG5A 3TJXA 4HHLA 2XJ7A 3G24A 1GOXA 3ALFA 5HJYA 2CETA 3Q94A 4LBSA 1T7LA 2C7FA 1RY8A 3FK4A 1XYBA 3AIVA 2I9UA 4FOKA 1E3ZA 2O4MA 1XLHA 3E5BA 2V67A 4HJFA 2BLEA 3B0YA 3GVGA 4NNAA 2DT2A 3CUIA 1FWSA 3NXFA 4RR4A 5AHMA 1PIIA 2UWFA 2WPBA 2OR2A 1GJPA 5LIYX 5A6TC 4FXJA 4PBFA 3M5XA 4RV3A 3N12A 1YADA 2XIBA 1UHVA 1AW2A 4QLJA 2DSUA 1XQKA 2ZDRA 3OGRA 1D8CA 1B5TA 3UZZA 3KBWA 2GFTA 4K1WA 5EMLA 2YZRA 1RJRA 1YPFA 5D9PA 1JDFA 2NXHA 3SCPA 3AXMA 4WDWA 1V51A 1X6LA 5LNVA 3WF1A 3TOPA 3TWBA 3HG4A 5A5WA 5LIUX 1D3CA 5EFFA 1XYMA 3PTKA 3EWCA 4QDPA 1J0ZA 3GTNA 1WZLA 3OGVA 3QPEA 3GG1A 5GQBA 1BYBA 4DB7A 2ZUVA 3S2JA 5D4YA 4RDVA 4U2ZA 1Q6CA 9XIMA 1XWYA 3FAWA 1E5JA 2VWSA 3BLOA 2PLJA 3BCFA 4Q4MA 5A6MA 3W7CA 4LQ1A 3E0LA 2A3CA 4AWUA 4JKLA 2BNJA 5MHBA 3R43A 1B0IA 3M0XA 3TZFA 1DJIA 1CIUA 1U33A 2QKFA 1XIHA 3W71A 3E02A 5AYYA 1FX6A 1RQEA 1LDCA 4CD6A 4GOAA 2NT0A 2VX5A 3BOFA 3PZGA 1WDDA 2J24A 1F76A 3LGDA 1KFJA 1UIPA 4S39A 4B3KA 2VZUA 2GJXB 1GG0A 2H3DA 4RE2A 1Q8AA 4BR1A 4GVIA 4GA8A 4MWAE 3WMCA 5HJLA 3W74A 1NDVA 4YCPA 1E71M 1MSSA 3BO9A 4Y8EA 4S2CA 4HZ8A 1W8SA 3W7OA 4UXDA 3I65A 3H23A 3MZNA 2PB1A 1BVWA 2FVKA 3B4YA 3QPYA 1XKJA 5TBOA 2XG9A 2A85A 1TV8A 4H9ZA 3DIPA 3ABXA 1C7TA 3NFUA 5BRPA 4GIYA 3B8VA 3GKAA 1S2CA 2EPLX 4RE3A 3IPWA 4CNPA 3KHJA 3OVGA 2IUZA 4RZ5A 3WNPA 2KX9A 1TZZA 4IMEA 4QBXA 3SADA 1B4KA 5FF2A 3L4WA 1GWJA 4M6VA 1M7JA 3MJYA 2QCMA 3P62A 1M3UA 3LERA 2JEPA 2V68A 1CLVA 3UZ5A 2TMDA 2ODOA 4W84A 4F9JA 3CL7A 3P0WA 2ACUA 4UTTC 5CC6A 1EOMA 2CC0A 3EDJA 4UWMA 2YBTA 4Y9PA 1H4PA 3NGFA 4HHHA 4Z1YA 2GUYA 4LS0A 3B0VC 5IBXA 3UWZA 2OSWA 1SO6A 1L2UA 2X40A 1MI3A 1SYTA 3CQKA 1EDQA 3LHVA 3UESA 5DRCA 2TPSA 3W7GA 4PRTA 1EYEA 3UJRA 7XIMA 3NZ1A 4AG0A 1CXHA 4AVFA 4C6LA 1JF6A 3MSRA 2QJGA 1IWPA 1MXGA 2NZLA 2OMAA 1V5XA 3AC0A 2WMIB 3UWQA 2WMFA 4AFYA 2F38A 1W9PA 4REQA 1R3YA 1GUVA 4J4KA 2G3FA 4QM1A 4XKYB 2J7FA 3IJ7A 3QKZA 2FB3A 3R7MA 4ROPA 4MUPA 4XAFA 2R9RA 4A3HA 2DZTA 3N2BA 5D2VA 4DAIA 4ICNA 3RCNA 4QAIA 1JCYA 3UR5A 4PRWA 3RR4A 3R0UA 4DAFA 3SUSA 2REQA 5G2WA 3ARUA 4R27A 3A3HA 5CJMA 3QF0A 1GVEA 2J74A 3NSXA 4AF0B 3VKKA 4GI8A 2C14A 3GYCA 3TC6A 2OLAA 4GFIA 2PODA 4IFKB 1H7WA 3T2OA 2TYSA 3EA1A 1IEQA 1K9TA 4ZXOA 4MIMA 4GO8A 1BGAA 3W1NA 4W86A 4HGXA 1VCGA 3UGRA 4I8YA 1SZRA 3UCQA 4Q8VA 3VU2A 4YIWA 5EKYA 1MEIA 4WOZA 1YE4A 4W93A 1GTEA 3GXFA 4O50A 2VDGA 2DH2A 5IDZA 1W9DM 3W81A 2QCLA 1E5NA 3A23A 1J18A 4GHRA 4QNWA 3VDCA 3ITVA 3L4TA 1GVRA 1UD2A 4C6QA 2WK2A 2QVHA 2PWVA 2PP3A 3E6EA 4B5VA 2A3BA 1ITUA 3WG6A 2RDWA 2Z1WA 3AAMA 3GB6A 4D1JA 2PS2A 1OYBA 3MU7A 1V6VA 2XIIA 1EB3A 1GOKA 4EWJA 4LS1A 3AS2A 5G2HA 5JBDA 4UFKA 5KTLA 1V3JA 2YCLA 3LX9A 1I1WA 2FTWA 1XFBA 3B04A 2PDQA 4C6MA 1D7FA 1LF1A 2BVDA 4O8RA 1KV8A 3CK5A 3UPWA 3N15A 5J5DA 4Q7IA 4WCJA 2NVCA 1R9YA 3KRBA 4S3CA 2FLIA 1KFLA 4WQ6A 3NPWA 3M16A 1W1IE 4B16A 1XH2A 1CXLA 3VCCA 4HNNA 4FR1A 4UMCA 1PEZA 4FLQA 4XZNX 3WLJA 3M5ZA 4YU1A 4GNVA 2NQ5A 1SZFA 1DE6A 5IBXC 4HK5A 1I9CB 3PZVA 4QHRA 1PHQA 3BARA 2VT0A 1RK6A 2ALRA 5TD4A 1V3KA 3U7BA 1Z42A 5RUBA 4CU8A 2A6NA 4TU1A 5C7VA 4QITA 2GZXA 2PWUA 4K36A 5I24A 1MW2A 5HNNA 3LM7A 1NIUA 2V82A 1TZ7A 4Q8UA 2I1OA 3KZPA 4AHOA 1H62A 1Y0EA 5FJPA 2RJHA 2ZDSA 2QCNA 3PPCA 1TVLA 2BY2A 2QHAA 4D6CA 4AWTA 1H1NA 1VBUA 1XINA 3EWBX 2AGTA 3MSGA 1BYDA 4HMEA 1MWOA 4DZHA 4A8IA 4AIEA 4BK9A 2BOEX 2ZRUA 4IQEA 1Y8BA 4F79A 1P7TB 4TO8A 1X39A 3FEMA 4C7GA 1PIGA 1XG3A 5C6MA 1E6ZA 2OSYA 2D3NA 5AC7A 4M56A 2GQAA 3UGVA 4X60A 3UWEA 3H2NA 2PMQA 4N9CA 4B9ZA 5BCAA 1FCUA 2WSPA 2FFIA 3UR7A 1B2YA 1KXTA 4O1EA 1E40A 3PZOA 3RLGA 3ZLGA 1M01A 4DWDA 3GVVA 1HZYA 3TJ4A 5BXTA 1VAHA 4GISA 3SBFA 3GH4A 3PC0A 3FKRA 3PBMA 1K9FA 1E55A 2PP1A 1WDPA 4OVXA 1L6YA 4OWGA 1LL6A 2CESA 1R87A 3RPDA 4ORIA 3WNLA 5BW6A 3LCXA 3GHTA 3ITOA 1SO4A 2ISDA 4DF0A 4ATDA 3KRUA 5HMEA 1JEZA 4ZTYA 3CO8A 3GAKA 1AQFA 1K1DA 1GYMA 4W8BA 1I2OA 3CIXA 1JL8A 2Z1VA 3PAOA 3JVAA 4NUWA 3W85A 3ZIZA 3R13A 1NVMA 2PTWA 1Q5MA 1IHIA 1Z3NA 1TMLA 4PN2A 1W1PA 3CWOX 2E1DA 2Y8KA 4MNJA 2XHYA 3DKJA 4HZMA 2NW0A 3WQOA 5AZ0A 1KXHA 5H8MA 4UR9A 4N42A 5FJOA 1A5BA 3UR8A 1O5XA 2PGWA 3TU9A 4CCZA 3R58A 3BAWA 2HS8A 5BOOA 5F2MA 2FPYA 1V02E 3RX4A 4Q6XA 3BOXA 3ARVA 4JCMA 3EWXA 3T09A 1KV5A 3DKLA 1YQ2A 3TYBA 5U4NA 3NPVA 3AUJA 1ZUAX 3PJWA 3BURA 1I60A 3L0NA 5KITA 3FDGA 4HOXA 4O1DA 4FMVA 3GG7A 1MQRA 3QV8A 1DQWA 4C6EA 4XTIA 4KKXA 3HJEA 2WZTA 3HGRA 4ZQMA 1EPVA 1BQGA 3RG6A 4XZMX 4FNPA 4M0XA 4DJFA 4M29A 3HN3A 1XSKA 2WZIA 1H0GA 3WEMA 3WQ4A 4GUHA 2CLPA 3N6HA 3ITXA 1JVNA 4JTHA 2BGNE 2R1KA 1ZBVA 1YE6A 1JFHA 3VKAA 4HNOA 3LPOA 4NRSA 5D37A 4PUUA 3ZSSA 1F07A 3T0DA 2A5HA 1WDQA 3DCPA 4W8AA 3RNDA 3FKKA 1OT1A 1ZL1A 1EJSC 4BQ3A 4E2DA 3B8SA 2WC4A 3TQPA 2Y7FA 2WZHA 1E9YB 5AHEA 4IICA 1MW0A 3B9AA 1CX9A 4WKHA 1UKQA 4OBRA 4L4OA 4M80A 3W7MA 3TTSA 3LB0A 2CWXA 4I7WA 3NOYA 2ZVIA 1EGZA 4DQWA 3WLHA 4UTKA 1PUDA 4AY8A 1T96A 3ZLHA 2FVLA 2QEZA 3U9IA 3BGAA 3AISA 3CZ8A 2ISFA 1PZ3A 2YKKA 4CN4A 2ISSA 1J12A 5BRBA 3U6WA 4IMAA 1BRLB 3HM7A 4M1BA 2ZC8A 2TAAA 4B5UA 1IYXA 3DG3A 2FGBA 1BWKA 1EP2A 3M0KA 2DIKA 2ZXAA 3LBMA 3B05A 5EB8A 1XYZA 2B7OA 1WB0A 3VI2A 2W67A 1SFTA 2YCIX 2ABAA 7TAAA 2E1WA 4DPQA 3MWCA 5HBFA 4AC7C 2J8FA 4UFMA 2WC7A 2Y6ZA 4C1KA 3F2CA 5HNUA 1HJWA 2WHLA 2ZXQA 4L61A 1US0A 3U3HA 2CHOA 4D6FA 2CERA 1FUYA 2EJ1A 2Z29A 3LPGA 4CQBA 4NAEB 5FF4A 2DZAA 3VDBA 3MCMA 3CIWA 3CAVA 2XFRA 1P1XA 2DJLA 4QJ4B 2XGIA 3U2EA 3T0AA 3KVMA 2VQUA 3B4UA 3GXNA 3LHTA 2XH0A 4V2XA 3W87A 1VFMA 1Y65A 4W7WA 2ZRYA 1J01A 4JY9A 3SJ3A 2WCGA 1AA1B 4GQQA 4JTLA 4BI7A 1UOZA 5CSSA 5DBTA 2BY0A 4J27A 1YEYA 1S1PA 3PUDA 3SRHA 4H6RA 4JNYA 3O06A 4L1XA 4Z08A 1PWMA 3LA4A 4B5XA 1NDWA 4ZQPA 2Z2UA 3O63A 4URIA 4GYPA 1BG4A 1DJWA 4DJFC 1VFTA 4AD1A 1LCOA 4C6CA 3B8IA 2QCFA 4YHEA 1X6NA 2ZBTA 5EMUA 2XGZA 2BHYA 3IGXA 1ONRA 4YWIA 3G0SA 2IXUA 3R0DA 3AICA 1Q6QA 2EPMX 3NYZA 2JKPA 1TWZA 2FQIA 1Q63A 1G5AA 4LAZA 1C29A 3BVJA 4EPKA 5DRIA 4DM2A 5JUVA 1H7OA 4UZUA 1TR9A 4AD3A 2XM2A 4PMNA 4QFUA 2E8ZA 4RNHA 2QV4A 1YHTA 2H3BA 4FALA 3W3OA 4PTVA 4YTTA 3K46A 4CQAA 1XLJA 2Z24A 1GVOA 3GDRA 1KB3A 3LTYA 3PNZA 4PEEA 4G9PA 3QQWA 1FDYA 2Q8LA 3G6MA 3VFLA 3Q58A 1ME7A 6XIMA 3U48A 2ZZ7A 3WQCA 1P6BA 3WELA 3EEZA 1BG9A 1GQNA 1KWGA 2AAAA 1HKWA 4DI8A 2AQWA 1XC6A 3UCCA 3QV7A 4U3CA 3WLOA 4DYJA 3AYTA 4L4LA 1TWWA 3FA4A 4B5WA 1AJ0A 1TMQA 1ZFJA 5FEPA 3H12A 2QZRA 2FH6A 2WC3A 2JALA 4RKAA 3WL1A 3URAA 4PCFA 3U57A 4YTUA 3GNRA 1CXKA 3UG8A 4NJHA 1VLWA 4UFLA 4N4QA 1DEDA 1AMYA 4AIBA 3ZM8A 2C0HA 4LH8A 2DDXA 3GZ3A 4ZENA 4Y96A 2XIOA 4AZIA 2F2HA 3WENA 3ARQA 3LU2A 2E8YA 1DTUA 2GYIA 3UF9A 2VD9A 1BYCA 1RUSA 4EXQA 1S2TA 2PU1A 4A35A 1ISZA 5CPOA 3MKKA 2DSKA 5TNVA 1EKOA 1C91A 1M1BA 1ZS2A 3H2OA 2W61A 4H83A 3EB4A 1L6FA 3H26A 4JQ4A 1DE5A 3RMJA 1S2AA 3L2IA 1F4AA 5E6ZA 3EKLA 3LLFA 4PMVA 2QULA 3A9BA 4HNTA 1G7VA 5BRQA 1PPIA 1V77A 2VEGA 4BFAA 3UVAA 4BI5A 3ARRA 1GJUA 1Y7VA 2WJFA 2Z27A 4JEJA 4CCDA 1VENA 3FSUA 4FK9A 1W56A 4DWSB 3BW2A 5K3VA 4GYPC 5I3DA 4JIRA 4IGHA 1QNSA 4EVZA 1YKWA 1RLCL 4CQDA 1WXZA 1O1ZA 1MRAA 2P0OA 1IT7A 1HJXA 3EDEA 2ZUNA 4ZTXA 4A4AA 3TAOA 1K7EA 1FA2A 4YTSA 6REQA 4S3KA 3G18A 4LEFA 4D6EA 1K4HA 4AYGA 1H0IA 3TFCA 2XN0A 3IIXA 3RU6A 4ROQA 2J88A 4GUIA 4Z2KA 4EF9A 1TQJA 3F03K 5I07A 3PN8A 4NP7A 3MUAA 4J3WA 1QI5A 3IV3A 2J47A 4XISA 3W01A 4OUEA 1SSGA 4F2BA 3SRKA 4MAVA 1GOWA 2E9MA 1GZ1A 2PTXA 4JXCA 3EPOA 4WDTA 5A6LA 2Q8ZA 2QJHA 2ZX5A 4C6PA 3AIUA 2PC8A 4KETA 2OWXA 4MDOA 1LWHA 3K4DA 1SQ7A 4FI4A 2XWDA 1XX1A 1ALDA 5ECUA 4ZSUA 1ISVA 1JCXA 1RSCA 2VI0A 1QPOA 1V08A 2WJEA 5E09A 4I8DA 2D2HA 5LHEA 5K9CA 2WPGA 3V0UA 4IGSA 3U0HA 2J7GA 2ZZ1A 3SCWA 3L4ZA 4PMRA 2WV8A 4GBUA 3W7IA 4KS0A 1HJSA 3FYYA 5PTDA 4MFDA 3M5YA 5CPLA 1H7NA 1B3WA 4V27A 2O7QA 3E0VA 5EY5A 1EUAA 6PTDA 5CZSA 3Q65A 3N3MA 2VGBA 1YDOA 4M81A 1MYRA 5C9UA 3AIRA 3W7DA 2UY2A 2R14A 3UNDA 1GKQA 1V8EA 4V15A 3S2NA 3T55A 1CGXA 4Q4PA 1Q6OA 4H00A 4H2CA 1OADA 1EJ7L 4IP7A 1ZP3A 2A7PA 3C2OA 1Z9AA 4J3TA 2WLZA 1O68A 2I9EA 4GIRA 4R7JA 2BHUA 1RCXB 5E9AA 5K7JA 1H1YA 1R7OA 4AMAA 2O7SA 3OQEA 4NJGA 4JX6A 1XLIA 3CV2A 4JTSA 1VH7A 5LA2A 4JIEA 3S5NA 3SECA 2GWNA 4WGXA 2FMOA 3MI3A 3WJSA 4A2SA 4A2RA 2BB0A 4EE9A 2W0UA 2R1MA 4I3GA 3IIPA 1V0LA 1NWUA 4H41A 4NRRA 1XH0A 3PSWA 5F2IA 3WLLA 1QBBA 1OIFA 3H22A 3MMTA 4QS5A 1P1MA 1GOIA 2YW3A 3EDDA 1L0PA 3CH0A 3K1DA 4O16A 3A3XA 2FTPA 4XZLX 1I45A 1N7KA 5CZTA 3QV6A 1ONXA 4UFHA 4L1GA 4UOJA 4XX6A 3KXQA 2I5QA 3THQA 1V7YA 1TWSA 5REQB 1TIWA 3QHMA 1V6UA 3MCNA 3K8KA 2UV8G 3OYXA 1LUCB 4A8NA 4DUWA 3PJXA 1JDCA 5HR6A 4JTAA 3REQA 3S6TA 1UZ4A 3WUBA 1XKYA 1IT8A 1AD4A 3UA3A 3RYSA 1RVGA 2Z1SA 3DGRA 3CXOA 4NG3A 1HVQA 5CC5A 4NXSA 4FX8A 5C0QA 5J04A 3LZ5A 1JNDA 3WQGA 4FLSA 5KMYA 1ZB5A 4CEXC 2G4JA 3FVMA 5B7ZA 3WUFA 4EPDC 2CITA 3MBDA 1QVBA 2YL5A 3F4NA 3WK2A 1XUUA 3R6IA 1N82A 2QUTA 3MVTA 4AHPA 4B92A 4PMYA 4GFSA 1QO5A 1F3XA 1XYLA 2BVWA 2Z4GA 3G1VA 2TSYA 1HVXA 3EB2A 1PHWA 1SMAA 2Q8XA 3H7RA 3BG3A 5G4HC 4CNSA 3WH8A 3TCEA 1VRDA 1MFUA 3ZSTA 2BZNA 1G4PA 2NLIA 1D3GA 3FN9A 5DY2A 2Q6ZA 3JR2A 4CCEA 3I10A 4ILSA 3SN1A 4HPNA 1O66A 3CC1A 1W1TA 2VDIA 2ZX9A 4POCA 2DZWA 1UWRA 4RE4A 1W3NA 2WZEA 2HPIA 3NXLA 3W83A 1TPEA 1FWHC 3GTXA 2FMNA 3LPFA 4R34A 1ZBWA 3L23A 4P7RA 1EGVA 1SJAA 1LQ2A 4MWAB 2A1YA 1W5MA 1XLKA 5KZDA 5I06A 3RGTA 3TYDA 3VDAA 1V6TA 1O60A 3MA8A 4GKLA 3CV7A 1OGBA 3W75A 1IZCA 3QHOA 1RBOB 1SPQA 4W88A 4Y6GA 3L67A 2WYSA 3B0PA 3VDHA 3POCA 3SQLA 3E2RA 1Q6EA 3BLKA 3LTPA 1E70M 3R25A 2VD8A 1OGGA 3W7PA 2WMGA 2VEFA 1S46A 3GC2A 5CG0A 4QJ1A 5FKYA 3VNIA 1KM4A 2O9PA 3TWAA 3PF3A 2DW6A 1PKNA 1AK5A 3NM1A 3TTEA 4FNUA 3QRHA 3VUPA 2R1LA 4PULA 1BTMA 3WQWA 4BKNA 1TJ2A 3GBEA 4AIUA 1XGZA 5JBFA 5BU6A 3UA4A 1TCMA 1E0VA 1RJPA 3G1FA 3NAVA 4AEEA 3MWAA 4FPSA 3S47A 2PBOA 5DCDA 2PUZA 4GK8A 3R89A 4DNHA 5ABFB 2C15A 4DBEA 3CT2A 3RF9A 5E0FA 4C7FA 3W70A 1KFWA 2F2KA 2X1RA 3RK8A 3TNOA 3EOEA 5LXEA 1NH6A 3AHZA 2JGYA 3UP8A 2X1UA 1DL3A 3KOWA 4NI8A 3RLUA 3MP4A 1EJXC 5C8BB 4QNEA 4A3UA 1FOBA 4JGDA 4IPNB 4E8GA 4RCXA 3WQDA 4GMEA 2Z0IA 4DWSD 4O52A 2CXGA 3KUMA 2YJQA 3GIQA 1CENA 4M1RA 2FDSA 2OO6A 4JTUA 3BMVA 3RO6A 4IWWA 4MADA 3M0MA 4IIEA 3SM0A 1D9EA 4AXNA 1HKIA 4O1AA 4IIBA 1MZHA 4J3UA 1O1HA 4LVBA 3BQ6A 5CZKA 4TMBA 4GJJA 1BVZA 1MNZA 3EA3A 1H61A 1LP6A 4DBSA 4BF9A 4K8HA 4RNJA 2CBVA 2HVNA 5BYWA 3H7VA 2ALDA 2WMJA 4B5TA 1DIKA 5CC3A 1TE1A 4WR3A 4XO7A 5EFDA 4GI6A 2VR2A 3S8HA 3AJXA 4GZ7A 3NGJA 2X30A 4MJ2A 5EA9A 1BKSA 3IWPA 3A4XA 1V7AA 3O9NA 2Q01A 2GJXA 3HO8A 4CNTA 3CS2A 5HAOA 5D33A 1NU5A 1TWIA 3EX6A 4J1OA 3VOFA 3U2OA 1J10A 1UR0A 1E1CA 4LXFA 4REQB 1FWFC 1Q4NX 3WLMA 5KZEA 1W1ZA 3GVQA 4P2VA 3ZZ1A 1XRVA 3NWRA 5LNRA 3CQIA 3P5ZA 3RCMA 4H4IA 1JJKA 2P10A 1FTXA 1IXOA 3N9SA 3T2PA 4NZ3A 1HT6A 3CB8A 2E28A 5HR7A 3N4FA 1OFPA 2REQB 4PBEA 4DZAA 3NDOA 4J40A 3ISIX 1Z8AA 1M7OA 1ZLPA 2FGZA 1F61A 3AMDA 2VVNA 2G50A 2VELA 3NPUA 3T44A 3AHYA 3H70A 3Q45A 2PDWA 3W1AA 5FD0A 1S39A 2DVXA 3OZYA 1MVYA 3G1HA 3T2QA 2BOGX 1W5QA 4Q7NA 2CKSA 4WGHA 3WMLA 1SO3A 3MHGA 2VM8A 1SJDA 1F6KA 1J6OA 3EX3A 4W7UA 4X2RA 2BASA 4LGXA 3W2KA 4C5ZA 3JUGA 3QR0A 3OVQA 1W3JA 3LHUA 3L0GA 3P82A 4XV0A 4QCEA 1GNXA 3OB8A 2CLMA 2BMBA 3NSNA 1XDJA 4XD6A 4P5UA 1WBHA 3W1QA 3S9YA 2XISA 5E9XA 1E51A 1SZNA 1X8FA 4HK6A 1DOSA 2YDQA 1PZ0A 4O0QA 5E1QA 4DBDA 3ATYA 1LOLA 5BZAA 1PO9A 4R7WA 1FWBC 3B40A 4EPEC 4BY3A 1ENUA 1V3MA 2O9TA 3NQ6A 4ORMA 2WHKA 4Q32A 1JGMA 2EJAA 1QW9A 3GM8A 2PZNA 4IL2A 1NQKA 1THFD 3WUGA 3O16A 4C6JA 1EDTA 2VDHA 3MBFA 8RUCA 2FYMA 4ZFMA 4FNQA 2PLMA 2NX3A 1S5WA 3DYMA 4PGLA 1TRDA 5BOFA 4J3SA 1K7XA 1KRAC 1XL9A 2BY1A 2PBGA 2YXGA 3MW7A 4G7EA 3WD0A 1R7AA 2Z00A 1DIOA 3NQGA 2OQYA 1SR0A 3BSMA 3WH5A 1TMHA 1XLGA 1R30A 3LHWA 2QCGA 5FEXA 1A5KC 3LCLA 4UFJA 2UZ9A 7REQB 3KOXA 4LJ3A 3IIOA 4MSSA 2OGJA 3M6YA 1XRSA 2NXIA 5GPRA 2ACSA 1EX5A 4HZ6A 1VHNA 4HU4A 3ITCA 4DLMA 2MNRA 3GR4A 4PUEA 1CGWA 2VFHA 4GH3A 5AVHA 1W2PA 2PWDA 2VP8A 5AHIA 1BWVA 4NY2A 3N2TA 1FQ0A 1EQCA 3MO7A 3N2OA 4CNNA 4IOTA 5J8LA 1H7PA 2OGYA 3BW3A 2GLKA 2P50A 3LNPA 3GU9A 3BLEA 5D05A 4TQTA 4ZL1A 4R5EA 3KDOA 3LGGA 4CVUA 4IPLA 4L9YA 4JD4A 3THUA 4QEHA 2BP1A 2HBXA 1MXDA 1F05A 5FI8A 5C2GA 1CB2A 2X8RA 1W32A 2E67A 1W54A 3PBUA 4O0KA 1XG4A 3MB9A 1HO1A 3W1XA 4QE4A 3MVIA 3EWWA 1X97A 3P5YA 4F0HA 3OG2A 4X0NA 1R3WA 3VK5A 4LAUA 1E4NA 3LPPA 4WUIA 4B2DD 5EPDA 1PKLA 4W5UA 4U10A 3IJ9A 3BAXA 4QG8A 3H2EA 2QJNA 1FCVA 2NVDA 2VGIA 2YCKX 3TJLA 1E0UA 2DORA 3NEVA 5A8PA 1O4UA 5C5YA 4QDWA 2PDHA 2C0AA 2PWGA 1A5LC 3KBNA 5HDRA 8CGTA 4PODA 4UQAA 4HYRA 4F0MA 2PEVA 3ZR5A 3WY1A 1JXKA 3MZ2A 5FL0A 3ZVHA 2OPJA 1ISWA 1U5JA 1EEPA 3CMJA 4LW7A 4JDYA 4DJDD 2QT3A 3ANUA 1N2VA 2DUAA 1K6WA 4AX7A 2PGRA 1OIMA 1KTBA 3MMWA 4K7VA 1XCXA 3VMOA 1XRTA 3IGHX 2E77A 1KBJA 2YL9A 3GNDA 1A4MA 4K37A 2HDJA 2PWHA 1H1ZA 1K9DA 1H09A 1D2KA 4I6VA 1JR1A 2FZMA 2Q3OA 1UBPC 2UY5A 3E9AA 2MANA 1VLIA 4AW7A 4KIEA 2UY4A 2Y8VA 3PG8A 4HNVA 1F74A 2OZ3A 3EWYA 2ACQA 3UZWA 5E70A 3BLIA 3ID7A 4UC5A 3O2LA 1SW7A 1YXDA 1ICQA 4LB4A 4MLRA 1VFHA 1NWTA 3NZPA 1GOOA 1X1NA 2J7BA 1W37A 1YPXA 4IISA 3RR1A 5BXRA 1VKFA 4XBSA 3AHTA 5HUOA 1DJNA 4MY8A 3NSMA 2ZUUA 5M17A 2DY3A 1IGWA 1NY1A 2V5LA 6ENLA 4JL2A 4WY0B 4KT2A 2HE8A 4GRSA 4Q4KA 1JXJA 2ZYFA 3S2CA 2BG5A 1GW1A 3NNTA 2OODA 4AVOA 2YBVA 1NSJA 2Y70A 3VIOA 3W2UA 4HT3A 4PUMA 4JQ2A 3VGBA 1AJZA 2CWNA 4LF2A 3WQFA 4QE5A 1QW8A 1DWIM 3VIFA 3HFTA 1AH0A 1OCBA 4U5KA 3FVDA 3GFZA 5LIWX 3GO2A 3OBEA 4ADTA 4EPBC 3C86A 2BXZA 3HMJG 3SZ8A 1Q7QA 4WF7A 2YLAA 3PJTA 2MUCA 4ERGA 4YYFA 3M46A 2WNQA 2OELA 2XVKA 2H9AA 1K70A 3V1PA 4PTXA 3V35A 2XTKA 4YLWA 1MW1A 3HZ3A 1UKOA 3WL0A 3A21A 5M1TA 1XIDA 2VFGA 3RITA 4O28A 1ODUA 4AD0A 5FSEC 1J93A 5T9CE 4W4QA 2VCCA 1TWDA 2EPKX 2OTDA 3AU6A 1QI3A 4BS0A 5I5RA 3W07A 2GGJA 1BF6A 2QNEA 4HZ7A 4C6IA 3TXVA 4OV4A 3WLKX 3IEBA 4IL0A 3WMBA 3MP3A 3JZUA 3MC5A 4AIOA 3VVGA 5A8OA 1B3VA 1SFLA 3B97A 4Q33A 3TYAA 1HF6A 4MB1A 4X61A 5AOUA 1V6XA 1QRQA 4NQ1A 1A0DA 2X7WA 4FAMA 3U2ZA 1T5AA 4LUJA 1GG1A 4I7UA 4JYEA 3RUBL 3P0XA 3VABA 3GD6A 3PB0A 5GJPA 3CO4A 4E4FA 4MLJA 2J7CA 1OF6A 4JBRA 1XSJA 1VFSA 4CVWA 2WZMA 3SDOA 2C79A 5D2XA 2OKTA 3UD6A 4C1LA 3IAQA 4FNRA 2EKCA 3SO7A 1HNYA 2WVVA 4WDXA 3EBVA 3PHAA 1K4GA 1A50A 4Q8NA 1KM2A 1CXFA 2WVUA 2VRQA 1FHVA 4P7NA 2YZ5A 3OIXA 4KH2A 4R33A 3EX2A 2GGGA 2GDVA 5HOSA 2W4XA 3QY6A 3DC8A 2QF7A 3KZSA 4MZYA 4FS9A 4LYQA 4Y9MA 3LI0A 3GY1A 3APTA 1GVIA 2IS7A 3TV8A 4UTMA 1TVPA 1FWCC 1ZNNA 4E6MA 3WBAA 3OVPA 2QDEA 5IHSA 1UMYA 3LBCA 4XB3A 3UYCA 5DT5A 2Z6JA 4RE0A 4DVOA 1UZDA 3M7WA 1J2WA 1UR4A 1JZ5A 4W8LA 4O8AA 2YYTA 4QP0A 4Q8QA 3TDFA 5FOOA 1SW3A 3W6LA 4F66A 2BBFA 5LKYA 4HTYA 2PDLA 4QEEA 1BRLA 4IG2B 6A3HA 1TYGA 2NVAA 4HQVA 1R2RA 4B4HA 4UTJA 1R8LA 1GKPA 3U8GA 2WXDM 4UR7A 3PZMA 3F2BA 1EYWA 2PDKA 4JR5A 1TPDA 1J0YA 3OZPA 2HROA 1NEYA 2PC4A 1IR2A 1XFCA 5BNKA 1M04A 3MMDA 3M0JA 1C9DA 4DELA 2VENA 2HVOA 4HSHA 1MQQA 3W02A 2D3LA 5DY3A 1GORA 2PZ0A 3QC3A 1YNYA 4FLOA 3SCOA 2OWWA 2DUZA 4YCOA 3EEGA 1OC5A 3EMZA 3RDKA 3ZJKA 1O95A 4W7VA 1TPC1 2XVLA 3DFTA 4HOWA 1QI4A 1FWNA 1UMLA 4PB4A 2QS8A 1M5WA 4TXEA 1XIFA 3P74A 1JD9A 4U33A 3BC9A 3QR3A 3UJFA 4KEUA 4PCTA 1IQ8A 2JF7A 3UXAA 1GHSA 4NF7A 5FIPA 3DX5A 5C9RA 4L7ZA 5DANA 3CWNA 3H2MA 3PSVA 8TIMA 4JX4A 2FTYA 4E5TA 3RIKA 1GVQA 4IF2A 1AH3A 4CD4A 3HIJA 3QOMA 4TTGA 5DT7A 3HG5A 2J75A 4DF2A 4JNMA 3E38A 4QRNA 1W3KA 2QCEA 3VGDA 4IJBA 4WRHA 3DG7A 1EBHA 1EUNA 1O12A 3NQ8A 3ZT7A 3TTYA 4N9DA 1QK2A 3LRLA 2PURA 2CXEA 1QBAA 3GVRA 2WSRA 1LG2A 4JQAA 5D02A 2DIEA 1DWAM 2ZC1A 3AOFA 1HTIA 3KM8A 3UBPC 4LFYA 2Z2AA 1ELSA 3NURA 4D6JA 5AHLA 3VZXA 5DLCA 2X41A 3GZAA 1OX4A 3FYPA 1NELA 3UPBA 1PCWA 5F1VA 3WDIA 1QU4A 3ABZA 2J13A 5CJNA 5BWAA 3VIGA 5M03A 4J35A 4HHPA 1PTGA 1XISA 4N7QA 4J5NA 4IP5A 1TR1A 3WDQA 1K02A 2PRHA 4O10A 3STGA 5I3KA 3UXLA 4GQ0A 1AODA 4PFHA 1V0NA 4FR6A 4EKJA 4E38A 3VGHA 4RPPA 1W3TA 1R3RA 4L80A 4AHQA 1I2RA 3QGKC 4XBJA 3A47A 3PPGA 1J8VA 1AW5A 1JDEA 4AD5A 1JIBA 1TUXA 3APYA 3LDVA 3EPMA 4QLLA 4Z2HA 3TW9A 4QJ5B 2PDXA 4LS2A 3ENLA 3RLVA 4H7CA 4R9XA 3NJ3A 4TMCA 4DZ5A 4JIPA 3I4EA 4AQLA 1TPVA 2TODA 1S5MA 4YTRA 1VB9A 2HPMA 5K4XA 3KRSA 3LV5A 2WNZA 1WZMA 2HRWA 3CNYA 3RHGA 3M1ZA 2ZQ0A 2VGFA 3GIYA 3MYOA 1I0DA 4FXRA 1UC5A 2LLEA 2OEJA 3QV9A 3EAUA 4L6HA 2EG8A 1EF2A 3WLNA 2CZVA 1R0MA 1JAEA 4TUFA 3RXZA 4I5RA 4IGMA 4DJFD 3VINA 3BXWA 2OT0A 1BLIA 5I6SA 1QUMA 1QCWA 3LXBA 2PCEA 2PPGA 3KFTA 2OO0A 4HYWA 3BWWA 4JIQA 2VURA 3S1GA 3E0FA 4MNKA 3QPZA 1PTDA