3C8NA

Crystal structure of apo-fgd1 from mycobacterium tuberculosis
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
347
structure length
343
Chain Sequence
HHHSSGLVPRGMELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELAMNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable F420-dependent glucose-6-phosphate dehydrogenase FG
publication title Crystal structures of F420-dependent glucose-6-phosphate dehydrogenase FGD1 involved in the activation of the anti-tuberculosis drug candidate PA-824 reveal the basis of coenzyme and substrate binding.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 119
structure length 343
sequence length 347
chains with identical sequence B, C, D
ec nomenclature ec 1.1.98.2: Glucose-6-phosphate dehydrogenase (coenzyme-F420).
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 3c8nA00
4US5A 3B9NA 1Z69A 4US5D 5AECA 1XKJA 2B81A 1TVLA 1RHCA 1M41A 5LXEA 3FGCB 1NFPA 3C8NA 3SDOA 1NQKA 2I7GA 1EZWA 1YW1A 3B4YA 4J2PA 3B9OA 1LUCA 1BRLA 1FVPA 1LUCB 5DQPA 1BSLA 1BRLB 3RAOA 3FGCA 1F07A 4UWMA
chains in the Genus database with same CATH superfamily
1MW2A 2WNZA 3SUTA 4LTSA 1H60A 2PE4A 3SRFA 4GJ1A 4KFPA 3C8FA 2BVYA 4W9TA 1IQ8A 3KM8A 3GU1A 2PF8A 4MMWA 3KBSA 4DVOA 4LS2A 2V5CA 4A2SA 3F2CA 2NT0A 1XLGA 4U2YA 1LBMA 1XX1A 4FXRA 1KQZA 1GUVA 3R0DA 1ZJIA 5AHEA 2P3EA 3SY5A 3O6CA 3RXZA 2WSKA 3C56A 5AVHA 3NFUA 5B7ZA 5HWNA 3MUXA 5KMYA 1BPLB 1IZCA 3FVMA 4NG3A 5CKSA 2RDUA 2Q71A 3EGJA 4GGBA 2XJ7A 1HX0A 1Q66A 4JIEA 3H23A 1FKWA 4TOQA 4GRSA 5FF3A 4EX4A 3HQPA 3OVQA 3C3NA 5DELA 4G7EA 3O05A 5JVLA 2Z1SA 4UOZA 3UZZA 5BRBA 4G8TA 3URBA 3MCOA 1F2JA 1M68A 4HQVA 1S46A 2OO6A 2HNHA 3W7JA 4PYSA 2Y70A 5F4XA 1K8ZA 1RK5A 2YL9A 3SO7A 3ZZ1A 1XFBA 4Q6XA 3IGSA 3DFYA 4HA1A 4KBXA 1EJ7L 2YW4A 3KBNA 3VFLA 5J5DA 4HP5A 1P0KA 3M47A 3O06A 1A5UA 3MWCA 4UB9A 4HHMA 3TKFA 3IV3A 4ZE5A 1V0MA 1GOQA 1CT5A 2A79A 1Q2SA 3CZ8A 3DEQA 3PJUA 5G1MA 2HWGA 4LGXA 3RK8A 3H7RA 3N73A 1TPC1 3VGDA 4XVEA 1V6UA 2X0HA 1UHVA 1BVZA 4HU3A 1XH0A 3DKLA 3LCIA 5EBUA 3S2NA 3ABXA 4IIEA 2NSOA 3GY1A 3BG5A 1IT7A 4XIAA 1H63A 2CYGA 5CJMA 1XH1A 2QCEA 4XD4A 2C15A 3VC6A 4FXFA 1W2PA 1YBQA 1XLMA 3PULA 1TCMA 2C18A 4M8UA 4JX4A 3W2NA 4LFYA 5XIAA 1I2OA 1Q6GA 2HS6A 3UWEA 3P61A 2A2IA 3AU2A 3G22A 2J7FA 3S1GA 2YCIX 4FP1A 4LYPA 4HCHA 5C2XA 4KKXA 1XI3A 4EP8C 5RUBA 3NJ3A 3IJQA 4M51A 2HVNA 3KL5A 3MMDA 3QTPA 4IMAA 4Z1AA 2QCLA 2QVNA 3W7CA 4JFSA 5DEZA 4JBRA 2WVVB 3A6OA 3T42A 3LTYA 5SWUA 1OG0A 3LRMA 4E5TA 1L8NA 1RA0A 2X1RA 2ICSA 1E9YB 3SRDA 1JF5A 4JXCA 4TX6A 5HR6A 4IIGA 1ZCCA 2PDMA 1WCGA 1EGZA 2ZXBA 2WHMA 3NPVA 3AZSA 3WQ8A 2JE8A 4REQA 5EBAA 4I8YA 3MJYA 1R2TA 2UBPC 3AYVA 3RN6A 2WMFA 1XYMA 3FKKA 2CBVA 3VA8A 4I7WA 4MDOA 3N04A 2PODA 3HV8A 1DHKA 4HYVA 4XD5A 1NM9A 1VCVA 4J2PA 4H9XA 2J47A 3RLGA 3EOUA 3B8IA 3UG5A 3VKAA 5IOBA 2GWNA 4N42A 2OG9A 2R1PA 3TK7A 1EDGA 1ADOA 1FDYA 1UZ4A 3ZLGA 4MLRA 4OVXA 1KQYA 2PSNA 4A3RA 3QW3A 4LRSA 1PKNA 3T07A 3LV5A 3Q58A 1QNPA 1KKOA 5BXSA 1B0IA 1MEWA 1V79A 3GFYA 2Y7DA 2Z24A 3BL3A 5GJNA 1LZOA 2J78A 1XRFA 1UUQA 4JNYA 3AC0A 2EGZA 3WQOA 4W86A 2GGEA 5EA9A 1JYNA 4DI8A 1RA5A 4FX7A 1QPNA 1OF6A 1L9WA 3AXIA 1GVIA 2J62A 5FESA 2ZZ6A 4KESA 5HJLA 1NU5A 3EX1A 2WHJA 2QPUA 1XSKA 3G1DA 3UVIA 2BOGX 3S47A 4C1NB 1LJYA 3R6IA 1R30A 2IPGA 3V0UA 4M0XA 2PWVA 1XD0A 2FPTA 1X7IA 1VGAA 1TPVA 4UQ9A 2G37A 5GNZA 4J3VA 3H2NA 5I3KA 4UQAA 2OWXA 3G3DA 2P10A 1PXGA 2QYGA 2Q01A 1LT7A 1SZRA 3WG6A 3B40A 2PWDA 1PIIA 3REQA 2NUYA 1I2NA 2PTDA 1TQXA 3CHEA 3B9AA 2HPMA 4GZIA 2G97A 1XF0A 3L9CA 2QQ6A 2G96A 4IX0A 1H61A 3L66A 1K7FA 1F9CA 3TAKA 4ZZ9A 2G41A 2A7PA 5T91A 1VYRA 2E0PA 3TJXA 1F8MA 4WUIA 1YX1A 3ITTA 4NF7A 3WLLA 3LZ3A 3PNUA 4YCOA 2VCCA 1PEZA 5G2IA 3FGCA 7ODCA 4F9JA 4WD0A 3NZRA 3L21A 4XSMA 4W4QA 1RZMA 4ZTYA 3UWQA 1R3WA 3KE0A 1OQFA 3A12A 1YXDA 3ZIZA 1IWAA 4LUJA 4FEZA 1QI2A 1OCBA 3I7RA 1OC5A 1UUOA 2XDFA 3BURA 4LOCA 4JAWA 2DZVA 1JPDX 2NV9A 2PP1A 4MY9A 4XV0A 1GEHA 1HQTA 4AD4A 5AC5A 4QG8A 2EKCA 2DT2A 4GJJA 2GVGA 2WCSA 2WNQA 3V0TA 3W2UA 3F2DA 3LUTA 1HVQA 1REQA 4GQQA 3G77A 1OIMA 2EPNA 3PWGA 4IMEA 3SN4A 4QNWA 3WMSA 3RJYA 3R10A 5E9XA 1PJ9A 3ARQA 4F2TA 3UGRA 2VR2A 4CNNA 1VJZA 5HMDA 5LKYA 3V1HA 4M6PA 3GYEA 4HNVA 1VEMA 3WH8A 4B3KA 3BAKA 3MYPA 5DCEA 3UJRA 2B7QA 1RSCA 3FA3A 4R27A 3S6TA 5DO8A 5JIPA 3P60A 4S1FA 1BSLA 1UPMB 3DI0A 2GQ3A 2WVTA 3SY8A 3NSMA 1UR4A 4UR7A 3N9RA 5EMMA 2R14A 2OYLA 2VENA 2TSYA 3BXWA 3ICJA 4DUXA 3L4VA 4JTLA 4LWWA 5G4EA 1JDEA 3TUUA 4U2ZA 4K6AA 1YRRA 4YXGA 4GO9A 2VX5A 1PUDA 1RK6A 5LHFA 5M5DA 3AWOA 4AZ5A 1I60A 4HU0A 2E77A 1FDJA 3KFTA 3BLFA 2IPJA 1SR0A 2AGTA 1US3A 1TV4A 1LRQA 3CYVA 4KS0A 3W76A 4Y7EA 3TQPA 1W3JA 3NQ6A 4FAMA 4RW5A 4FLOA 2ZRXA 3W25A 4PBFA 4CCDA 4HT3A 9XIAA 4AVOA 2VVNA 1RQHA 3AIQA 2CLEA 4N2YA 5AOUA 2J88A 1R47A 1BVWA 3LXAA 5A6JA 3V5CA 4E2OA 4RW3A 3LHVA 4GKTA 1P1XA 3SCUA 5CBJA 2ZE3A 3FEQA 2DSWA 2ZUVA 3GDRA 1G4TA 3RLHA 3HU7A 1IXQA 1H1YA 2WAGA 4QS6A 4XWUA 4LV9A 1VCGA 2ZDRA 1SU5A 1KC7A 1BAGA 1CXIA 4M5PA 4FZIA 3GXFA 3LBCA 4QR6A 4FA3A 4L5ZA 4P7OA 3CL8A 3LXBA 4S3FA 3IIZA 3PPCA 3UWZA 1L6YA 3W7OA 1PVNA 1VPYA 3CQHA 4XZHA 2XHYA 5CG7A 1KR1A 5GQBA 2PDPA 1KM3A 4QLJA 3OHIA 3A9BA 2C0HA 3KCLA 5A2BA 3FN9A 2A4AA 3VMPA 1J4EA 1R7OA 3FV9A 1HKJA 4E38A 1YXCA 1XBXA 3DHFA 3S5SA 3WKZA 2BXVA 3QN3A 3ZFHA 2VRJA 3TYAA 1E4LA 2CFFA 4P8VA 1F5ZA 3ENLA 4S3JA 2DFAA 4GH1A 1KCLA 1TTJA 4PMJA 2Y7EA 2JKAA 3ZJ7A 2CC0A 4PMYA 3A13A 2O56A 5CSSA 1F3WA 2VC7A 1QTWA 2HE5A 1OD8A 1EEXA 1W17A 2OGJA 1SZGA 3II1A 2UZ9A 1FWTA 1V7AA 1W37A 3WDPP 1UC5A 3APYA 4NRSA 1VHCA 3CC1A 2QNEA 3S2LA 2RDTA 2WKGA 5BWAA 3FKRA 1JYWA 2QCMA 2EBNA 4CNSA 4TUFA 4LX4A 5TBOA 3W53A 2X05A 2V63A 1FFRA 3QFWA 3NQDA 1BKSA 5DMYA 4M7TA 1ITUA 1W1IE 3U9IA 1XGZA 1TTIA 4QGCA 1VBHA 3QPYA 2IKJA 3OLIA 3W1UA 4C1KA 4AEOA 2J6VA 3VUPA 3KXQA 2ZWYA 1G94A 3P8IA 3CHCA 2VUYA 4JTAA 4GO8A 1WXZA 3AAMA 3VUSA 3AIEA 4Q32A 3M4HA 4H7ZA 4AZ6A 2VUNA 4I8DA 3VD3A 2HDJA 3L0GA 2PLCA 4AIEA 4OGZA 1EPVA 1G7VA 1K70A 1SO5A 2OLHA 2OZ0A 1QK0A 1K8XA 2OWWA 2CKRA 3U2ZA 1FCQA 4JHMA 4F2BA 5AHLA 2Y1HA 4H8UA 1EQCA 5BOFA 3QV9A 3RCYA 1IHIA 4L65A 3WDJA 1TZ9A 1EJUC 4GVGA 2ZUWA 4AHOA 2ZRWA 4WSHA 1UR9A 2GJPA 3EAUA 4TXEA 4LPCA 2JGYA 4ZE4A 4XBJA 3HZ3A 1ITXA 4DPPA 2DIKA 4Z2GA 3T2PA 4E8DA 4XKYB 5C9UA 4PUUA 3EA2A 2OMAA 1OYCA 2DZPA 1YDOA 3BE7A 4XAZA 1LLOA 2CESA 2IQ0A 1KCKA 3MUY1 3WQ5A 1NAL1 2E09A 1ZJBA 1ALDA 2I5IA 3R2GA 1KKRA 4ES4A 2J8FA 2X30A 4LUTA 3TQ0A 3QR1A 3CO8A 3KLKA 4HJFA 4MFDA 2G3FA 3T2QA 1W3TA 2DZSA 3B97A 2BOEX 2CLLA 2I56A 1MNSA 4C6KA 4WOZA 2WOQA 1FVPA 1KGXA 2VFGA 3SSJA 1HN1A 5I00A 1TPDA 3LGDA 3FFSA 2JKPA 4H8NA 3KP0A 4XO7A 5C9RA 3GLCA 4PMVA 4EAYA 3N2XA 3HG2A 1DWGM 1H5YA 1HJWA 3V1PA 3LBOA 2QAFA 3I6RA 4QG6A 1HT6A 3ZVIA 2GQ8A 2RAGA 3JW7A 1WDQA 5HUPA 3TJIA 1TX0A 4YWSA 4MZ1A 2CZFA 2GVYA 2ISFA 3I6EA 3W38A 2WJZA 4GUJA 1L0PA 1WDPA 1YPFA 1IEIA 5DMMA 3SJNA 1UG6A 1MXSA 1CXHA 1JDDA 3AMGA 4PUJA 3ZSSA 1F4AA 1P6BA 1PS9A 3STEA 4GINA 1DWFM 1E51A 3H2CA 3AHYA 4P7QA 1V0LA 2DT3A 1IXOA 2ZE0A 4GBUA 2Y8VA 2A85A 2GGGA 4I9MA 3L5MA 5F4SA 1U1UA 3SCNA 1WPCA 3GXTA 3GTIA 2FH6A 2BP1A 4GYJA 4ATLA 3M43A 4GXWA 3GZ3A 1UA3A 3L23A 4UMCA 5D05A 2EPKX 1UR3M 1OZMA 1ZGDA 3MSRA 4D6FA 3BZJA 4PMRA 3DIPA 2W91A 4BI7A 4ZL1A 1Z44A 2XFFA 2ACRA 3B0VC 5IBXC 4BCEA 2EO7A 3TROA 2NQHA 3LLFA 3WSUA 3QHMA 4JNZA 4WJXA 5HWMA 4KCUA 3UCQA 4B5VA 4O18A 4XUYA 2WMGA 2E28A 4XISA 3SCVA 1NSJA 3MKKA 1QHPA 3ZJ8A 1E4NA 2ADAA 1EP1A 2WWDA 2YKKA 4GQRA 4WQ6A 1JUBA 4XBKA 1MNZA 1FWDC 2Z1KA 1ZENA 3VK5A 2JIWA 2P1FA 2E7FA 3TN5A 3LLDA 2GGJA 2NUXA 4C6CA 2DP3A 3UJ2A 1O6IA 2VQTA 3D46A 3M0YA 3TONA 4TV6A 3R4IA 2CLIA 3L4YA 5BOOA 2YDRA 1SW0A 4AG0A 3UPMA 2QR6A 3PUDA 3DERA 4U3CA 1Q4NX 3K1GA 3GNDA 3GFXA 4Z1DA 3EKZA 1E1FA 4RZBA 3R0UA 2PZ0A 4K3ZA 3LCXA 2VZSA 1L2UA 1J0ZA 4U5IA 4F0SA 4PN2A 3S2JA 3OVGA 2J9YA 1NIUA 1VH7A 1F6KA 5CPMA 2HK0A 3DYOA 3OOQA 4ICNA 1AA1B 1GZ1A 2J24A 2Q09A 3LNPA 1E9LA 1EC7A 4LT9A 2PEVA 3W86A 4MYAA 3EDKA 4XK2A 3LZ5A 1XLCA 1NWTA 4M1BA 4OECA 1O12A 3M5ZA 3KCJA 1JCLA 3DGBA 1MUCA 4NX0A 3P62A 1IR2A 2E6AA 3D3AA 1PX8A 2W66A 4WOQA 2AAAA 4PEEA 1S1RA 4NAFB 1Z48A 4ML9A 1ISYA 3N2MA 1IZJA 2VZVA 4GA8A 3WQWA 2OJPA 4BWLC 4A22A 5F7UA 3H4GA 3HV9A 3MUIA 2E6FA 1E6QM 4YMZA 5K9XA 3WEMA 2B81A 2FB2A 3K46A 3TFXA 2CBUA 3N13A 2A5HA 2V5JA 3KLLA 1JRBA 4C1NA 4YVXA 2XPKA 1VYPX 4GLEA 5BROA 5DF0A 1JDAA 4L7ZA 2OTDA 4LYKA 1B3XA 5D2WA 3MP5A 3E2VA 2PTWA 1OFPA 2CNCA 1J0JA 1DIEA 3SQLA 2GOUA 3OODA 1ME7A 3F03K 1DJWA 4JX5A 2HMCA 3S6OA 3GBDA 3NSNA 4NJGA 4PTNA 1EJXC 4EACA 3AZRA 1NF7A 2FH8A 1H62A 3T0TA 1FTXA 3DHUA 2HEJA 2QCFA 2VWSA 1QI4A 4RPQA 4LBRA 4DJDD 2VO5A 1FP8A 4NZ5A 3UGVA 5H91A 4RV3A 3SY1A 3UPBA 4AC7C 2NZLA 1EL3A 4CNOA 3PK7A 3U2OA 1MXGA 3EXRA 1M7OA 3IJIA 2CU0A 3GDLA 2NQ5A 3WLIA 4WIWA 1JPKA 3F4VA 3KDNA 5H8PA 4X63A 2GFTA 2ZC8A 4K7YA 5C55A 1FHUA 3PPHA 2WBKA 3UWUA 3VX0A 1V5XA 2Z1VA 2EPHA 4Q4QA 3JUGA 4YPJA 5HAOA 2V81A 1NELA 2X0YA 1XIFA 1YQ2A 1UD3A 4BR1A 2A1YA 4CD5A 3CQKA 1OGBA 2UY3A 1IYXA 4BEQA 1GCYA 5M03A 3MCMA 1EWDA 4AU0A 4XBSA 3GTFA 3F5KA 5LIKX 2RJGA 4MZYA 1V03A 4AXKA 1JCNA 2D2OA 4UC5A 4HMEA 4MNMA 1EXBA 1E3XA 3GU9A 2Z2BA 3E2QA 2JF6A 3GD6A 1XLLA 4AD5A 1FWRA 2H9AA 1R5YA 1UP2A 3RO8A 3DYMA 2EG8A 1W2VA 3GSMA 3TCEA 3ORWA 1PZ2A 2G8ZA 3G2GA 3TC7A 4UTMA 4RCXA 1CXFA 1CI1A 1XBZA 4FPSA 5M17A 2VX6A 3UESA 1OC6A 2IKHA 2GJLA 1UKTA 3UWWA 5LIUX 3EMZA 3L4XA 3M7WA 2PDCA 4C6IA 4FI4A 3TA9A 1PV8A 1PAMA 3QY8A 1U83A 2E67A 3CZKA 3UG4A 3WLHA 4L4MA 4MFEA 3TTQA 2DUAA 2WVUA 3T09A 1SSDA 2HXUA 5A8QA 3KOFA 1BRLA 3VDBA 4J28A 3TN6A 4J4KA 2ATSA 2ZZ3A 2BX7A 3MYOA 1T5AA 1ODZA 3LV6A 3VGHA 2E8ZA 5CBIA 2A3AA 5KZDA 3LM7A 1CLXA 3IACA 2ZTJA 2PC8A 1XC4A 2YLLA 5HPCA 3FYPA 1XXXA 1TA3A 1R2SA 3N18A 4WHBA 3L12A 3C2VA 2FTPA 1DQWA 4DEFA 1NJJA 1Y7VA 1OGSA 3BOLA 4IM4A 1XIMA 2E5BA 3B4YA 1DE6A 5G2HA 4XKMA 3MVTA 4PUWA 1T96A 1T8QA 1KM6A 4ZQCA 4JTGA 4X9SA 2PRHA 1O5RA 4IPLA 3GXDA 1LBFA 3WX7A 1V8EA 3D6NA 4KWVA 3PFRA 3IGUA 3MHUA 3B8WA 3KRZA 3CUXA 1ZAJA 2E25A 1K4HA 1NVMA 4X3ZA 2GZXA 1TVPA 3V16A 1QVBA 3E0LA 3WBEA 4M80A 2BVDA 4O14A 2WPBA 2C79A 1QWGA 5EL1A 2OFJA 2EEXA 2XINA 4NXSA 1CYGA 1R87A 5C2GA 3N4EA 4UTWC 4O13A 4ZBCA 1HTIA 3TMQA 4N4PA 1Q7ZA 1ONRA 3R13A 1YPXA 1Q6LA 1NQ6A 1TPH1 4YTQA 5K2ZA 3RYSA 2VOTA 2E6DA 1K8YA 4ORMA 3ZWTA 2Y6ZA 3A5VA 2QS8A 5HMSA 3BOXA 2WW5A 4QSHA 3W2KA 1R3VA 2HQAA 4OBSA 1SYTA 2PDJA 5CGQA 1KXVA 1CEOA 3CWHA 1LWIA 1KXHA 4Y9NA 5JUVA 2XN1A 4QROA 1D7KA 2POTA 3OZMA 3EPNA 2Y8KA 4IPPA 1WBHA 2WLZA 4QISA 4YIWA 4U28A 3P93A 1U1HA 3NAVA 2F2KA 2NT1A 1UZ1A 2PLMA 4TO8A 4B9ZA 1KB3A 4NQ1A 3W24A 1TQJA 3KZPA 2WJFA 1JAKA 2D2HA 3G1RA 4PULA 1BWLA 4HA0A 3VIJA 3TR9A 4HPGA 1MWOA 1UASA 2BHZA 4U4MA 3U2CA 2AQOA 4KWUA 2XFWA 1FWFC 2DQWA 4MPKA 1DXIA 5AYYA 4N6FA 3PZUA 3P0XA 3IJDA 2F84A 3HPAA 3MMTA 2DU2A 3PB0A 1KFCA 1AK5A 4D8AA 3PZ9A 3OQ8A 3AJ7A 4WEVX 2R6OA 1TO3A 2XWEA 2P53A 1PZ3A 2TYSA 1EKOA 2GUBA 2BGQA 3M16A 1V93A 2ISVA 4LVGA 1OX6A 1TR1A 1TV8A 5H6HA 1KTNA 4XZBA 3LLXA 3CBWA 5F1VA 4AY1A 4KERA 4IG2B 1JR1A 4BS0A 5G5IA 2PFHA 3WN6A 4IFKB 4CD8A 3ZR6A 1XCFA 4CQ9A 4PSPA 1WXYA 2FQIA 3LENA 5FSEC 4D9PA 1IIHA 2PDHA 3CH0A 3KS5A 4KEMA 5BNKA 4Q8UA 2PDLA 3DFQA 4H9ZA 1TPUA 2B4GA 4FF7A 1UKSA 3AHTA 3NTYA 3TW6A 4N7QA 3LI1A 3MC5A 1R7AA 3TLLA 4C6MA 4DJDA 3MU7A 4NU7A 3BOFA 2PPGA 4XKYA 1E6SM 3AUOA 3NL5A 3PBVA 3UEQA 4DUWA 4IQDA 1ZU8A 4F4RA 1AW1A 1B3WA 1F7BA 2C1HA 1E1CB 4QS5A 3VIFA 3KTCA 3NO3A 1KBJA 1D7FA 2ISDA 1VJIA 1SJCA 4NILA 4KW2A 3MSGA 2EF9A 4F9DA 3LHYA 1PZ1A 3DX5A 2QEZA 4GCAA 1W1ZA 1QW8A 3A47A 4GFSA 1YTEA 4S38A 2O4MA 2VC9A 4P8WA 1GOIA 3W9ZA 2BDQA 3IWPA 5K9CA 4DNMA 1UB3A 4GISA 2OZTA 2Y85A 4PMZA 1ITCA 1WKEA 1JD7A 2DW7A 4E0CA 3R1ZA 3N6HA 3ARYA 4EPKA 3TCSA 4OE7A 3R8GA 5HNTA 2NSXA 4LALA 5DLCA 2HROA 4O8RA 3GC2A 3QY7A 3AOFA 1K03A 3M64A 2PI6A 3CEUA 4JY8A 1V3JA 5G2WA 1A4MA 4N9CA 2V38A 1VQTA 1PCKA 4IZGA 4OJYA 1VS1A 4JFTA 1ZBWA 1S2AA 5E70A 3BWWA 5D9PA 4H41A 3G3MA 3WQPA 3G0SA 1LUCB 1AW5A 2J25A 1XPYA 5G4WA 3HA1A 1A3HA 1BXCA 1PKYA 4Q7BA 1XR2A 1GKQA 1K3UA 1X96A 3VKBA 1DKWA 3L2LA 3IRSA 3STPA 4JTUA 4Y8EA 1TPB1 5KTLA 2BTMA 3OVRA 4H9MA 2DDXA 1I6NA 1R3YA 3USBA 3N2BA 1MFUA 2QVHA 1FBAA 3O2LA 5DCBA 3I68A 2PRMA 3BZGA 1CB2A 4UQBA 3ATZA 2Z0IA 4RL3A 2P88A 3KBJA 3FW6A 5KINA 4MF4A 3WK3A 3WLSA 2IMRA 2YDAA 1KBLA 3K2GA 3AROA 3HGSA 4ZSUA 4ILSA 1PWLA 2NXHA 2YGYA 3MZNA 4UTTC 1LWHA 3GNNA 2FZBA 4AB4A 4FIRA 4P2VA 3E2SA 4DN1A 3NZGA 4ZO6A 3M07A 4YTRA 3EZ4A 3CUGA 3V5FA 1ISXA 2B0MA 3GRIA 3H7VA 5M2FX 1QOXA 1MEIA 3W2LA 4IPNB 2RFGA 1TSIA 4B3ZA 1B30A 4C6DA 1MDRA 3CM4A 1ZJHA 4GBDA 4R88A 3PTKA 1XGDA 1S5WA 4J3XA 2J4GA 1B2YA 1E5NA 5FCZA 1MW3A 5D32A 4P61A 4I9JA 1C9DA 4E2VA 3AHXA 3G5EA 2WZMA 2WQDA 3VOGA 1XIEA 4B91A 4V2XA 4R53A 4AAJA 3NQ7A 1VB9A 5BRQA 5DX7A 3VGFA 5LXEA 4JYDA 3RU8X 1BGAA 3DKJA 3VNYA 3M0XA 1V0KA 4AF0B 1M65A 3ZLFA 2YPIA 5I2UA 2VGFA 1BVNP 2YBVA 4NAFA 4ZODA 3KL0A 3FIGA 3BMXA 4YTUA 2W5FA 4DJEA 3GB6A 3FX4A 1LBLA 3AMLA 3TVAA 2DSZA 2X2GA 4O1BA 1V02A 3B3DA 1CECA 1RD5A 3GKAA 1WA3A 2CBJA 1EC9A 2J7DA 3BV4A 2ZIDA 2ZZ5A 3E12A 3O9NA 4IXHA 4WX2A 1H4PA 4E8GA 2W63A 3T7VA 4QHRA 1DOSA 1HZYA 2F7FA 3PANA 2WSYA 1YTKA 2PWEA 2XM1A 4O1FA 4S2BA 1AD4A 3P2VA 3AZTA 3MVIA 5MHBA 4U5KA 1Y5WA 4L64A 2FMOA 1F6YA 2WKLA 3TQKA 4K36A 4A4AA 3NIYA 2A21A 1R8LA 2XVGA 4RE3A 3FA5A 3WQFA 5BU6A 3M0HA 1X97A 3OG3A 3WZ0E 2PTYA 1WOBA 4H8HA 2YXGA 2AKZA 3W75A 4JFWA 3OHMB 2J7HA 2VRQA 4O10A 3ZMRA 1M9HA 3UU0A 2SFPA 2NLIA 5CH9A 3FSTA 1GVEA 5FJOA 5AZ1A 4LJ3A 1GOWA 1E73M 3WDIA 1J6OA 4XZLX 3OZYA 4ZOEA 1ITQA 3B8SA 1HXJA 3EDEA 3GFZA 1A53A 1P7TB 2E9LA 5LHEA 3OGRA 3ERPA 3CAWA 5H2ZA 1IF2A 1MW1A 1CB7B 3WF0A 4UFKA 2Q8XA 3SRHA 1W3NA 1X6UA 1PYMA 2H6RA 4LVAA 1GVSA 3VABA 3G1AA 4V27A 1YDNA 1U5VA 4IMGA 1MSSA 4I5RA 3WMCA 5FOOA 1UD8A 5CC6A 4K2SA 4ERAA 1XDMA 2FJKA 5K9DA 1NDWA 3LY0A 3PBMA 4MNJA 1BG9A 5C5YA 1CWYA 4GVFA 5DBTA 4O4WA 4WXZA 3W74A 4MWAB 1EH9A 1CENA 2OELA 3UF9A 4DO6A 3I3EA 3KRBA 3VKJA 1JEZA 4B2DA 1MW0A 3NYZA 1JCTA 5EMKA 3KRSA 1VPQA 3HIJA 5T8GA 2DIJA 4LB4A 1FY6A 2CZ5A 1EX1A 3PHAA 3U8GA 1YYAA 4JY9A 3KX6A 3BCDA 4XTIA 2XSXA 4IP4A 3U7VA 4PCFA 3SFWA 1QNVA 3ARRA 2AGKA 4RKAA 3W1RA 3VZYA 2X1TA 3GUWA 5I0DA 4AISA 2HZGA 4Q22A 1X8FA 3MKVA 1U22A 1KD0A 3E0IA 4W8LA 2XUCA 2DORA 4JFVA 4IT1A 2VDHA 3W7MA 2VVSA 5M3WA 1XWYA 2QCHA 2QF8A 3A22A 4F0LA 1JULA 3C8NA 2H3BA 3VIKA 2GJXB 2VOMA 4ZB2A 1KBKA 1HJSA 4PCTA 1NARA 4IPJA 3I6TA 4MJ2A 5ABTA 1ZAIA 3KBVA 3CUJA 3S2CA 1E9IA 2OODA 2D3LA 4GY0A 3B9DA 1FWCC 2A6LA 3CUFA 4A8LA 1GW1A 1S3TC 4N9DA 5CEWA 3E5BA 1QK2A 1QAPA 1RLDA 5I02A 4CD4A 1XLEA 1VHNA 3T08A 1LRNA 1EZ2A 1WE5A 4NIRA 2Z2UA 1BLIA 3E5PA 3WF4A 1TMQA 4O17A 2XVPA 1W8GA 4ZTXA 3N15A 3GKFA 4H6QA 3H8AA 1XLIA 5FEPA 2WKJA 4GKLA 3P6LA 1BF6A 3RITA 2CW6A 2HK1A 3UR8A 1JZ5A 4WSKA 1LQAA 4LC8A 4GIRA 1W3IA 3QZ6A 4TTGA 3E1F1 4BFAA 1VBRA 2WVSA 1E0WA 1RY8A 2QJHA 1DJZA 1GW9A 2NQZA 4GI9A 1W9VA 4UQEA 3VNMA 1UKOA 3V0SA 1YBQB 3DXIA 2X8RA 5CBBA 2G50A 3EXTA 1X8CA 3O63A 3KWXA 1XG4A 4NKCA 5PTDA 2VJXA 3A4WA 2OVLA 2PGWA 3EKLA 1KXQA 1NWSA 2PDGA 5JH2A 1UP3A 3HQNA 1HL9A 2G4FA 1VP5A 3B04A 2ACUA 3PM6A 4W5ZA 2ZVRA 3RNDA 1JPHA 2AQWA 4NZCA 1AQMA 3EDDA 4P8UA 4TV5A 2ONEA 3E0WA 4OWGA 2JEPA 3SZ8A 3L67A 3EB3A 2XU2A 3NGFA 3ME3A 1DP0A 5J5RA 2PRLA 4Y9MA 2E1WA 4JTEA 3LA4A 4NZJA 2P3ZA 4JDYA 2UV8G 4PUKA 4QAIA 1JAEA 2J77A 4EPEC 4H9VA 3VCNA 2QUMA 4LRTA 2QGHA 4DO5A 1PHQA 2QXWA 4YLWA 2GYIA 3EBVA 4JTKA 5C9ZA 3C4UA 2PDUA 3TYEA 8RUCA 2YDSA 2YDQA 5FF2A 3KCOA 5LXXA 1BEUA 1CX9A 1EOKA 1XP3A 2R82A 3B9EA 2CLKA 3OZOA 3UY8A 4BI5A 3SGUA 2BODX 1AQHA 4QE5A 5G1TA 4ZB0A 1UWIA 1THFD 4HNOA 3A3WA 3B06A 2FIQA 5HJYA 1UMYA 3TP4A 3HGJA 1ZLPA 3V35A 4BI6A 3S5ZA 3EWXA 4YN5A 4Z1YA 2QULA 3NDYA 4J3SA 4UTFA 4QDMA 3BO9A 4Q33A 2GSJA 3SDOA 3STFA 4C1LA 3QXBA 4IG2A 3QQ1A 1XW8A 3BAWA 3M46A 4HBKA 4IFKA 1EHAA 5BWFA 2AL1A 3KZSA 4Z42C 3QZEA 1Z8AA 4L4OA 4M24A 3SGGA 4J3TA 1FWNA 3H53A 1FKXA 3VNJA 4UOQA 1H7WA 2A3BA 1TPWA 1O5QA 3B8DA 4IMCA 1JJKA 2Y62A 5IRPA 3WF3A 5KEZA 4QJ3B 2EPLX 4O11A 4S3BA 5D02A 4Z2HA 4FNSA 1S2CA 3QY6A 3BQ5A 1B54A 1BD0A 1H3GA 5LGXA 2WHKA 1Q8JA 3WQDA 3UVAA 1GOMA 1RR2A 4W8AA 1X98A 2G95A 1GKRA 3GTXA 3W6YA 1OX4A 2G3IA 3C2EA 2VEPA 3EOEA 3QTGA 3SCRA 1E1CA 3KS6A 1VEPA 1W1A1 5D37A 3FK4A 1DWAM 3W2MA 2WJEA 3RAOA 2GGIA 3U5UA 4DWSB 4K1GA 1VCFA 4DBSA 2V67A 3REQB 5AHNA 3GE7A 4PMQA 5JBFA 3OJGA 1LDCA 1Z3NA 4DRSA 4W89A 5DBUA 1U30A 3C6CA 4AIBA 4PMXA 3RR1A 3ZSTA 3TOYA 2G3NA 2R94A 2Z26A 2UWFA 1R3QA 4HYRA 4RE4A 4CLMA 1A50A 5LGZA 3UR7A 3SEPA 3CGTA 1S1PA 3DFTA 1A3XA 1Q63A 2OZ3A 1XINA 1XYCA 5JH1A 3LM3A 4WDWA 4HZ6A 3W84A 2GSHA 2AQVA 4F0KA 1UJPA 3MBFA 3NR0A 2V30A 1B3YA 4EXQA 1NEYA 4X60A 5EMYA 1EP2A 1JCYA 1IXNA 2ATMA 1OEPA 1TWSA 3K8LA 3OBEA 1L8PA 4BF7A 3E49A 4DQWA 3MDUA 5E6YA 3DESA 3UNDA 3W26A 4NY2A 4R7JA 3LPPA 4CGTA 2IQTA 1TPEA 3I3BA 1XQKA 4LV4A 1RPKA 2YOCA 3VE7A 1KM0A 1TTPA 1MEHA 4Q8NA 1A0EA 4FO4A 1UH2A 3AYRA 1B57A 4K37A 3PPGA 2RDWA 1IV8A 3PZTA 3THQA 4ZQOA 3LU2A 5LZLA 1DJYA 5BZAA 4N9EA 3IUIA 3HBLA 1XIBA 3CMFA 1VBUA 4LAOA 1E0VA 4E3VA 2J13A 3QMRA 3SECA 5ECVA 1K7EA 4DHGA 4M82A 1E0TA 3DFOA 4IISA 1KRMA 1XS2A 3PZQA 5HA7A 4UZUA 1M03A 4XIMA 4X2RA 5I03A 3BLIA 5BMWA 4HOXA 3SB0A 1JXJA 4A8NA 4HU4A 5LNVA 5A69A 2H8XA 3PJWA 1Y65A 2BLEA 1TRDA 3K4DA 3NSXA 4WDXA 2XN2A 4GZ7A 5M1TA 4IF2A 3ARTA 4O19A 1DXFA 1WZMA 4DELA 3FDGA 5EMJA 2D2GA 4ZOCA 2QDEA 4Q4OA 2GOKA 2O9TA 3XISA 4C6PA 2XH2A 3MT1A 3UJEA 3CZGA 3GR8A 3W28A 1RJQA 3RILA 4YWIA 1S38A 2J7EA 3GHSA 6XIMA 1PBGA 1M04A 1VZWA 3G0UA 3GR4A 1DIOA 3NL3A 1NQKA 1A5AA 1GG0A 4RPPA 4K8GA 1GONA 2ZX5A 3GH5A 1TB3A 2ZZ2A 3NDOA 6XIAA 3UR5A 3S2MA 3TWBA 3NQBA 3N3TA 3M44A 2ISWA 2BY1A 4QQUA 1ISZA 3JZUA 2ZX9A 1XISA 1TCDA 4B90A 4H2HA 1ME9A 1KLYA 2W61A 3L4UA 1S2TA 4GWEA 4RNJA 4PBEA 3HQ1A 4IICA 5I79A 3LS9A 2NX3A 2RHGA 4F8XA 3WCZA 5BYWA 2XH4A 2Y24A 1FWJC 4AF0A 3VO0A 1P5BA 3R94A 4RZ6A 2V5BA 4HN4A 2VEIA 4FR6A 3T1GA 1A80A 1C8VA 2YX0A 2KAUC 5DFAA 4ZCWA 4W85A 1PWMA 1VBGA 1E55A 1NH6A 2WWCA 3NVDA 2QIWA 4DZAA 4WJ8A 2VZOA 1VAHA 2BHYA 1GVQA 1AZ1A 2NXGA 2Z7GA 3CUHA 3J7HA 4ZQMA 3Q94A 3WJXA 3CIVA 1PTAA 2F6KA 4B4HA 4W7VA 1V4YA 4MKVA 5IDIA 3ZQ9A 5FJIA 3OQEA 3H2OA 1J10A 3WH9A 5FJPA 4N4QA 3W02A 4M19A 5I23A 2Z1BA 1BYBA 1QBBA 3MSDA 1Z69A 4D72A 1Z7AA 4CNTA 4B15A 3D0CA 4UNLA 4I5XA 4R33A 5HOSA 2WC3A 2XVKA 1RALA 2PP3A 1QASA 1MQRA 2J9XA 5CCZA 1B90A 1WNOA 1XYBA 4J3UA 4IJRA 1F4HA 2OB3A 5I06A 1P7TA 1E6ZA 3BGGA 3MY9A 4GI4A 2FYMA 1J0IA 4BQ4A 1JDFA 1TZ7A 5AYXA 1XV8A 1OT1A 4JIPA 4ADTA 4H83A 5C2CA 1VEOA 1ZFJA 4YHGA 4DWSD 2XTKA 3LTPA 4QSFA 2ZX6A 2HBXA 1XIDA 4GPNA 2PD5A 2FB3A 3CO4A 1A5LC 4D6HA 1DV7A 2BVWA 3KVJA 1M6JA 2QCGA 4GIAA 5AY7A 3USZA 4RLIA 2HJPA 5C9XA 1IWBA 1OCQA 3CEPA 1VJSA 4FIQA 4AD1A 2V0TA 4GNJA 1ZNNA 5HMFA 4HCDA 4FALA 3WLMA 1DE5A 2DZTA 5MF5A 2FJUB 4YU1A 4UOJA 1CXLA 3PNZA 4C5YA 3N34A 3K8MA 2I5QA 5EGRA 3BLLA 4LSBA 4S39A 4Q4KA 4DF2A 3SJ3A 3WLOA 1OY0A 2C16A 4OT7A 3K4WA 2DPEA 3IANA 1EUNA 3W2JA 5LSMA 3TC6A 4GC4A 2BY0A 2ZUUA 1RXOB 1W1PA 1SJAA 2IUZA 4IQEA 5AYZA 5U4NA 4YYFA 3OYXA 3ZOAA 3VD9A 1UIPA 4CQAA 1W1YA 3UZ5A 1AUSL 4HGXA 5ECUA 2DJLA 3QV6A 4KETA 1HF6A 2RDXA 1ZSXA 3NOEA 4HSOA 1ZBVA 3RR4A 5E6ZA 2R9RA 2BY3A 1I0BA 1FWGC 2I9UA 1XRVA 1H7RA 2PC4A 3U4FA 4P8XA 2Z1XA 4QEHA 2IKIA 3A4XA 4LUTB 3KVLA 4E4PA 3VKKA 1A5KC 2GJXA 2OEMA 5DXXA 2CLMA 4CQCA 7ENLA 4EIVA 4Q3MA 2YB1A 7A3HA 1HL2A 8XIAA 4UTUA 4ATWA 4PMOA 4S3DA 1TE6A 4NHVA 3BLDA 4B5SA 4GI6A 4X22A 2KZHA 4DB7A 5FF0A 1JF6A 3SUVA 3DECA 5TIMA 4JTFA 4L80A 1EA9C 4KQNA 1H50A 3ISIX 2FPYA 3QPZA 2BBFA 4G1KA 4Q7NA 5F2GA 2OX1A 1UJQA 1C93A 1OZQA 3STCA 5A6SA 3UFYA 2V69A 5FJTA 1YE4A 2XZ9A 3MDWA 4KMQA 4DIAA 3GHTA 1J8VA 1GHRA 2Y2WA 2VX4A 2PWHA 2ACQA 1HGYA 2DZWA 5AZ0A 2RJHA 1LLWA 4R7WA 4CCZA 3OEXA 1JCXA 2ZXAA 3WD3A 1LQ2A 4XX6A 4GVHA 4MAZA 5MKGB 4MJZA 1QOQA 4QDWA 1K6AA 1XHGA 3ZM8A 2DUXA 1X7FA 1E72M 4XZMX 5HANA 3KOYA 3QGAC 1X6LA 3DZ1A 1Q2RA 2W62A 4AY7A 2QT3A 4JTHA 3WFAA 2R1MA 3QV8A 1JVNA 3BG9A 4KRZA 4AMAA 5CAHA 1E6NA 3F5JA 1TX2A 5GVJA 1V08A 4J40A 3WIJA 3C3UA 1S5MA 2XSBA 1HP5A 2CIPA 2XFRA 3OG2A 2HPIA 1QW9A 3MUZ1 1EJSC 1ZUAX 4LUIA 3TEVA 5A6BD 4Q8TA 4Q7IA 3WJYA 4MKNA 1P1MA 2WZHA 4X0NA 4GQBA 2ZDSA 3AXMA 2HE8A 2Q6ZA 2YZ5A 3W7QA 3LGGA 3Q65A 3E3HA 2RH9A 4DXKA 1B9BA 1JG9A 2XISA 5CGTA 1IT0A 2L5HA 1XG3A 1A4LA 3DAQA 3HG3A 5TD4A 3LG3A 1FWWA 2JKEA 1ZPTA 4E2DA 2CITA 2PU0A 3VNZA 3ARPA 1YDYA 2XH7A 2YCKX 3G8EA 4H9TA 4BA0A 4OBTA 5H8MA 3W1PA 2QPSA 4UMAA 4L56A 3M6YA 2Y88A 3HF3A 4KH2A 4GACA 3CQIA 2NUWA 1Q6EA 1KV8A 1DQUA 4ACZB 3W22A 3NM1A 2WC7A 3BLEA 4I7UA 3UXAA 3C0LA 4P7NA 3BMVA 2QDDA 3TIMA 1XKYA 2WZIA 4URIA 4XAFA 1RHCA 3MSYA 3HG4A 1I9CB 1NFPA 1S39A 1X1OA 1GGOA 4R9XA 4HA4A 2BMBA 1LOQA 3K4AA 2X40A 2A3LA 2J27A 3KL3A 4FOJA 2GQ9A 1W1B1 3GG7A 1RLCL 4W88A 1VFHA 3GK0A 2ZXQA 1P48A 4DAFA 8CGTA 3ID7A 3UJFA 5AC7A 1JCMP 3WFLA 3NWRA 4N9BA 2DSUA 1VLWA 1QI3A 2WM1A 1R6WA 1ONXA 3N4FA 3CAQA 1WZKA 3BSMA 3W71A 1RPXA 2VXNA 1SUXA 4EWND 3H2AA 5FKYA 5C9WA 1OABA 4WF7A 1DJGA 4UTJA 1AJZA 2R1KA 4HA3A 3QW4B 2J7CA 3CMJA 4D6JA 1A5MC 2QJJA 1KW1A 3URNA 5AFDA 5DY2A 1KGWA 2VM8A 1OFBA 2LLEA 3ZLHA 2D3NA 4WRHA 3R43A 4JEQA 4DWSA 2EG7A 4C6QA 1XDJA 1YDVA 4EOUA 4WK9A 3R25A 4LUSB 2MUCA 3GW3A 1PKLA 2VNCA 4TU1A 1RJPA 1J0KA 5I09A 3Q37A 1NOFA 3M0IA 3EWDA 5C54A 3GH4A 3EX4A 4JKLA 1DJNA 3SURA 5DT5A 1BXBA 2GQAA 2D69A 5K7JA 2DEPA 1W5NA 4S3GA 4LAZA 3H2MA 4GXPA 4QG9A 3GDBA 3B8VA 3V4BA 4BF5A 3A9IA 1UP0A 1MVYA 3GUGA 4FNRA 5BXRA 4P7LA 4O1AA 2QCDA 3IEBA 3SCOA 4DXVA 3CMGA 3PSWA 5IFPA 1RCXB 1EB3A 4KIEA 2FZDA 3F5LA 1KR0A 3N2TA 4QAWA 1XH2A 4TIMA 4HMCA 1VLIA 5DCDA 3V7PA 3N19B 1T8XA 3LMYA 4LF1A 1DJHA 2QPXA 3TFCA 1KM4A 2DZAA 3W6LA 3FHAA 3W70A 4F2UA 3FHQA 4QDPA 1J18A 4GUGA 1EOMA 1VBJA 4JD4A 3ZJKA 2O7QA 4HOWA 3ONCA 1YTDA 2F8QA 5FI8A 3VIIA 2H9AB 3CHDA 6REQB 4JTIA 1OFDA 1UR1A 5JXQA 1KV5A 1RBLA 1BQGA 3BW2A 3NGJA 3HM7A 3BJTA 4PR4A 1WO2A 4PEKA 1OM0A 2OSYA 3LPOA 3T4WA 1FFQA 3KRUA 1FWEC 3N25A 4O16A 2O9RA 3MCNA 1BXNA 3O07A 4JR5A 2A6NA 4Y9OA 1O66A 2QF7A 2CZDA 3BW4A 3EEGA 3WL0A 3AXHA 5HQLA 2FHFA 3SW6A 1GQIA 1KBBA 3HFYA 4RJEA 2ZWZA 2WYSA 4W8BA 3RRXA 3K1DA 2V5LA 3MANA 4MHBA 1BRLB 1GEQA 5LIYX 4AC1X 3EYPA 4NRRA 4IP5A 3VIMA 1V3MA 2E8YA 1KFEA 4WVXA 1O1HA 4AIUA 3G0XA 1RY0A 4JTDA 5A8NA 4NZ4A 4E2BA 2YBTA 1ISVA 3ZWSA 1SMDA 4Y6GA 1G1YA 2XVNA 3PTQA 4DJEC 1XM3A 4RNHA 1TJRA 4ZFCA 3VM7A 1TA3B 3OBAA 2NX9A 4IJBA 3G1HA 4A29A 3UJSA 4UQCA 4KWSA 1BWKA 1IEQA 2HVMA 2JIEA 4GQ0A 5IBXA 1KWGA 3QYQA 3NNTA 4O57A 1AH3A 3PBUA 4U31A 4RDZA 3DG3A 3F4DA 1BYDA 3LCGA 3KOZA 1I2QA 4C6BA 1QT1A 1AH4A 1EWEA 4Z17A 3W87A 1GQNA 1XIJA 1WQ5A 4Y9AA 2B7OA 3LTSA 2XIBA 1TVLA 4AXNA 2VR5A 3IGXA 1FWIC 5D04C 5FL1A 3OB8A 1GOXA 1JCJA 1MMFA 4K8HA 1XL9A 1NFGA 2OT0A 3P5YA 3GAYA 2E9BA 3HJEA 1S2WA 2HV5A 4H8VA 5A6BA 1Z41A 3IK2A 3TA6A 2CLOA 4OOUA 5E0CA 1DIKA 5LIWX 5BXTA 3O8AA 4MZ8A 4CN1A 4LF2A 1KRBC 4CU6A 3CWOX 3QC0A 3DGRA 2HISA 1Q6RA 1JPMA 4DM2A 3PBWA 3PUOA 2RGMA 2E5DA 3M0JA 1QATA 4XAYA 3KAOA 3QQ0A 3ZXWA 4RDYA 5FEZA 4JOMA 1HP4A 3B0XA 4QJ4B 4Y2WA 4PMNA 1VFSA 3OYZA 4G56A 5D2VA 3WH5A 4ATDA 2ZKMX 4PUEA 1MFVA 2XWDA 1XSJA 5E0KA 3CJPA 2ESCA 3W7LA 1NDYA 4CVUA 2DSKA 2R1LA 3KDOA 5TNVA 2ALRA 3O16A 1R0MA 4DBUA 4D6CA 3GQYA 4UFIA 4IL0A 3EX3A 1QW7A 4UTLA 4GY1A 4EWJA 1MUMA 4TX9A 4GOAA 3TTOA 3VGBA 4YTSA 4PRRA 3RU6A 4ZVJA 1CGYA 2F61A 4B16A 2VT0A 4RE2A 3RPTA 3CIXA 4JIIX 2EKGA 1JGIA 1LCOA 4JDBA 5HQEA 1EJTC 3L0KA 3EMQA 4TVCA 2D24A 3T8LA 5CZJA 4V1YA 1LG1A 1PYFA 4WR3A 1TMLA 1IXPA 5DXYA 4CKQA 2E9MA 2BVTA 2AMXA 2NLYA 3W01A 4AD0A 3INPA 2YL5A 4GZJA 4KEZA 6ENLA 3B0YA 3WEZA 1GKPA 4AFYA 2VC6A 3PAJA 1G6CA 5FAGA 3LSBA 5GJPA 4ASTA 2V82A 5IXEA 3VFCA 4ZMGA 4JQ1A 1WXJA 2ZX8A 2V68A 4ERIA 3W27A 3POHA 3WQ6A 5K4XA 1JI2A 5E9AA 3NQ8A 5CLTA 2FTWA 4MGGA 4AW7A 4IQJA 2DT1A 1PTDA 4ZQRA 4X2PA 4H7VA 4NJIA 3VNDA 4FR1A 2ZVIA 3ABZA 1V0NA 2WO5A 2QJMA 3LN3A 2I5GA 2ZA2A 4M1RA 1HKVA 4FLSA 1HJQA 1OSEA 3WK2A 3AS3A 4ZGYA 1I8JA 1C29A 1B3VA 1XLBA 4G1NA 4JKKA 1G4EA 1UWSA 3IUHA 3PN8A 3N9SA 1E0UA 3W7RA 5FJUA 2D20A 1KXTA 3LOTA 4KFOA 4XZNX 4DLMA 2CLPA 5HINA 1V02E 3LCLA 1G67A 4O52A 2ACSA 3W1NA 1WZAA 3TC3A 4GYFA 2VEFA 3OVPA 1H1NA 5GJMA 5B7YA 2BWGA 1Y5XA 1S2VA 2XH0A 4GE8A 3WNKA 4OV4A 4ZEPA 1A5CA 1ESWA 4A3HA 2O9PA 3QSRA 4ZQPA 3M7SA 3TV8A 2CHOA 4ACYA 4IWWA 1LTDA 4FXJA 5D09A 3LD5A 3KBMA 2Q02A 2ZUNA 3A3XA 3TU9A 3LPGA 4M6UA 4S3CA 1JZ3A 3JVAA 1I2PA 4PMUA 2PWFA 2WMIB 2BXZA 5C7HA 1CCWB 2OU4A 2DIEA 9XIMA 4L4PA 1XLHA 1O68A 5GNYA 3MP4A 3NPWA 4XZWA 1DHPA 3H24A 1KFLA 1DIDA 1R3TA 1UYQA 3HGOA 4Q4MA 5EY5A 5AECA 2J7BA 3W1AA 1ELSA 5J04A 4C6OA 1KBIA 3CH9A 4A3UA 4IJCA 4QFUA 1EXPA 3F7JA 1M3UA 1JGMA 3UG3A 3TSMA 4UTHA 2VEKA 4GVIA 3UETA 3S42A 3NM3A 3VZZA 4RDWA 1WDSA 4XO6A 2WQPA 4OQVA 3I4KA 7TAAA 3UD6A 3MQTA 3U4AA 1AH0A 4QBXA 1GYLA 3PWAA 4AQLA 5A94A 1HJUA 3IUDA 4ML4A 3S3GA 3V36A 3SN0A 1KCXA 2Y5SA 5FJJA 1TUFA 1OBAA 2ANUA 3HQOA 3VD4A 1SW7A 4C91A 1MDLA 5I3HA 3E96A 4QE1A 2YSWA 3U48A 4YCPA 2H90A 4O8AA 5H8UA 3MUAA 5MKGA 4MB5A 3GVRA 4DAIA 1E6PA 1OF8A 3GBEA 4DJFC 3B4UA 1JXKA 3RPDA 3RUBL 5AYIA 1ZHAA 3S9IA 1W1VA 4B9YA 4J3ZA 1ZY9A 4E6MA 2DJXA 5CAKA 3MMUA 3N2CA 3TZFA 4IPIA 3WJSA 3HO8A 3ALGA 2WZTA 3JR2A 3W85A 1N8FA 1XLDA 2PDQA 3GU2A 1R86A 1A5BA 4JQ2A 1E70M 2TPSA 2VKZG 1M41A 5CC3A 5CPNA 5E5CA 1OFOA 3BANA 5EMLA 3RDKA 2GDUA 1FA2A 4PGLA 3M5YA 1BWVA 2TAAA 3GC5A 1JNEA 1HO4A 4AZBA 1CIUA 1AVAA 4RNIA 3PJTA 4AHQA 3OGSA 3CTTA 3W1TA 1W8SA 1PTGA 1F05A 5A6MA 1TJ0A 2E40A 1CLVA 1BTCA 1NTHA 2A7NA 1D3CA 4LU0A 2J9ZA 3EWWA 3S1UA 3R79A 2A3EA 3PS7A 1GQLA 3RMJA 4PCNA 2V3EA 1VC4A 2Y5EA 4AZCB 4Z1BA 2X2YA 4GX9A 3ARSA 3VGEA 5FD0A 1TE1A 4JIRA 3M0ZA 4C6NA 4X61A 1ODUA 3BUVA 3L5LA 4J2MA 1FDZA 3TW7A 5HPOA 1PIGA 2X1UA 1D2KA 4HMNA 1UCWA 5EFDA 2E4TA 2ZFAA 3AUJA 4JQAA 4HPXA 1G69A 3BPWA 3CNYA 3WNPA 2VX7A 4ACZA 3NG3A 1QO2A 1KNWA 4W87A 2HVOA 1JFXA 2OWCA 4FLRA 3PG8A 1E40A 2QAPA 3WL1A 1H1ZA 3MB9A 1UMLA 3KTXA 1B5TA 4UR8A 2H8ZA 2OQHA 4AIOA 1H7NA 3QYSA 1VFLA 1SFTA 3WENA 3VXGA 3MUCA 4N02A 1KFBA 1UQYA 4V28A 5I07A 2CXEA 2J6XA 4MUPA 2QV5A 4V33A 2A3CA 2E3ZA 3VKCA 3EB2A 5D2XA 4GD0A 1M7PA 2Y7FA 4QM1A 1XUZA 3S5YA 3IIOA 3MO4A 3SIMA 2J74A 3LK6A 5G1YA 4IGSA 1QNOA 1WZLA 4B5NA 4C7GA 3RRAA 3U5YA 1SZEA 1PPIA 3O3RA 4FXSA 2QJNA 2F2HA 2EPOA 3VKDA 2EPMX 3LNMA 1SMAA 1VIWA 1G4PA 1SJDA 2ZOXA 1XQLA 1N82A 4RV8A 1W9PA 1AFSA 3BSHA 5DRIA 1PX3A 2GJRA 2IW0A 3UZJA 5A6KA 3R58A 4CVWA 1WAWA 1ECQA 2PF0A 1RJRA 1GZJA 2PGFA 1PB0A 1T40A 3UXKA 4F79A 3H26A 3CV6A 3QKEA 3WNNA 3EWBX 3FS2A 3S0CA 2P0OA 1QXLA 4WKAA 4MTVA 4LUSA 5L6UA 1H7OA 2VRKA 4HOZA 3ELFA 4KGLA 4CN6A 4LAMA 3M6DA 3W1QA 3CASA 3HMCA 2PDYA 4HNUA 3TR2A 4DUVA 4EXAA 2EJ1A 4GUFA 1DPMA 3E0FA 3U3HA 4AWSA 1W54A 4F3HA 2OQLA 4WDUA 4GG9A 1FCUA 2YA2A 2OO0A 1J6PA 4J1OA 5I3DA 1SZFA 3MV11 2YBUA 1AJ2A 1O5KA 5ABHA 3P67A 3SR7A 1IR1A 1SFLA 3RCMA 2VZTA 3WBXA 4A05A 4DBDA 3QLDA 2OSWA 1GORA 1WUFA 3WNOA 2MANA 4S2CA 4ROQA 2VL4A 2WSQA 3SM0A 3W7NA 3ZO9A 3JU2A 4O1EA 3R12A 1YNQA 2BSLA 5D8WA 2CPUA 3S1WA 3IJ6A 3W4RA 4JTSA 3GVQA 3VI2A 3CTLA 1IEVA 3VIOA 3LSCA 1Z6KA 4BZYA 4YVPA 1H51A 4PRTA 5KZ6A 4BKNA 3UBPC 4DF0A 3UA3A 2PBOA 6REQA 2VCBA 3UY7A 4HK7A 4D8ZA 1FX6A 1Q8AA 1H0GA 2YYTA 1UKPA 4NYUA 3BGAA 3COTA 5HATA 1XC6A 1ZBCA 1W31A 2FFCA 1DWHM 4NNAA 4AEEA 1DYSA 1ML1A 2Q3RA 4RK8A 3UZXA 4QNEA 4CU7A 3SUSA 1XBVA 4IIFA 3RPMA 3NDZA 3T0DA 2GK1B 2QMKA 3UPWA 1EJVC 1US0A 3LMZA 4AZHA 1E4IA 4I90A 3GVGA 1A47A 3HJZA 4ZOBA 4I5UA 3AMKA 1HKWA 1HG3A 2Y5JA 2I1OA 1SQ7A 1K7XA 4V1XA 2FFIA 3C2OA 1F76A 3Q67A 3GDMA 4TX8A 1D9EA 3VOIA 4ROPA 3NOYA 3HPFA 2EHHA 4IFRA 1CGTA 1C91A 4KT2A 5REQA 4AZIA 4JCLA 1M5WA 4XZ9A 5TF0A 4TR9A 2XYLA 4QJ1A 1XUUA 2QKFA 3ANYA 5I24A 2D1ZA 2REQA 3THUA 1H0IA 3NQAA 2C14A 3TQVA 1EFZA 5I3IA 1RBOB 1D3GA 1HFBA 2ZCGA 1NP2A 3IAQA 2DY3A 4XAPA 4Q4SA 3SCTA 3C0SA 3N12A 1ZTVA 4B5TA 4HMDA 3BH4A 1TV2A 3BGJA 4FMVA 4L1WA 3A21A 4DYEA 2AKMA 4J9JA 1PO9A 4UTTA 2V3DA 4NUWA 4JTTA 1S2UA 3RF9A 5EMUA 2P76A 1L6SA 3WD0A 4QJ5B 1AMYA 2QDHA 4OUEA 3RHGA 1QBAA 3DBNA 3W88A 1T0OA 3AS2A 4S3KA 2ASHA 4MNKA 2BB0A 4CCCA 4LVDA 4NP7A 1IGSA 1GVRA 1Q6FA 1VFOA 1Q85A 1O60A 1UR0A 4UFLA 3URAA 5KSWA 2OX4A 3GVVA 1I75A 3W82A 3BLPX 1F73A 2FDMA 1UOZA 3IIXA 3R8RA 4UTKA 4I6VA 3BJSA 4GNVA 2Z25A 3IPWA 1UR8A 2D0GA 2XN0A 3PBYA 4UQDA 5IHSA 3E0VA 2O4QA 1JQVA 1KFKA 3VD5A 1FCVA 3MPGA 1FP9A 2POZA 4D6GA 3VOJA 2CZEA 3T55A 4IUOA 3LI0A 4AVFA 1FHDA 1C3FA 4P5UA 3LHUA 4OUIA 1QNQA 1NOUA 3P74A 2JFEX 2PDWA 4NZ1A 1LG2A 4Y8FA 5A6LA 1TMHA 1HJXA 3NQMA 3WK0A 4MWAC 1UIOA 4US5D 4IXXA 1R3SA 4D1JA 4JZ5A 3DG6A 2YCLB 5CPSA 2PDFA 3GH7A 3VOHA 2UY2A 2VEMA 1BKHA 4AWEA 1Z89A 1YXYA 4GYPA 1FH8A 4C7DA 3GNRA 4NZFA 4O53A 5CPQA 5HR7A 4LXFA 3NZPA 3LXCA 5G4HC 5HULA 4W84A 1H7PA 4ZR8A 2CHRA 4LBSA 4JYEA 2CBIA 3DHPA 2OOFA 4FF5A 5CQ1A 3UP8A 1GVFA 3GNOA 1P0BA 4NL1A 3BAJA 1ZRQA 3MHGA 2OYMA 1CNVA 2PA6A 2QZRA 2ZQ0A 2ZZ1A 1F61A 2WSRA 4LS0A 1NDVA 2WSPA 3QVQA 2PWUA 4MJ4A 3T0CA 4PMDA 4YYCA 3OLEA 3QBUA 1R38A 1HO1A 4PUNA 1V6XA 2J8GA 3JS3A 3W7EA 3AU6A 2W67A 3F4CA 4CU8A 4HVXA 3FSUA 2XM2A 1O95A 2BFGA 3E6EA 5IM51 1PE1A 3NVTA 4ENLA 1Y0EA 5A1AA 4PH6A 4Z1CA 4GMEA 2CZVA 5FAJA 4XD3A 3QOKA 1QPRA 4WKHA 3G18A 5ENLA 2XIMA 2C13A 1B9ZA 1WKYA 3LDVA 3A5FA 1W9BM 1EBHA 1FH9A 1QHZA 3N17A 4PODA 3T0BA 1QOPA 3N14A 2ZZ4A 2ZYFA 2D0FA 2VFHA 1OX4B 5HBFA 2VC5A 3OU8A 3QHNA 1UD2A 3N6QA 1XICA 3TYBA 1Q7QA 3LQLA 4O0ZA 3FJNA 4E4UA 2W3ZA 4F40A 1TELA 4NNBA 1JUKA 1SO6A 4LYRA 2WMIA 2YR1A 4Z0SA 2NVCA 1M1BA 3PJXA 2P50A 2FVLA 2R91A 5HXMA 1TWZA 1C7SA 3AHVA 3WD4A 1VFFA 1W0MA 4EANA 1Q6CA 1GJUA 4GCXA 4R7OA 3PP7A 3Q4DA 3OZPA 4AY8A 1LRTA 4OOZA 3U6WA 2DVTA 3CPGA 3AQUA 3EA1A 1BG4A 4K1WA 4AD3A 4MKSA 2IQDA 3TSBA 3WQVA 3RX2A 1RCOB 1AQ0A 1J5TA 3T8QA 4PFMA 3SBFA 4RX0A 4UFHA 3SUWA 2X16A 1Z9AA 1XYAA 5AVNA 4ICMA 2Z2AA 4PTXA 5DRCA 3NCOA 4HZMA 2X7WA 4IIHA 1P0EA 1BGGA 3DENA 4A3QA 1UPPA 1GTEA 1K9DA 1G0CA 5C6MA 2A7RA 2W4XA 1GPFA 4IH3A 3GWQA 4XD6A 3TH6A 4EPBC 4U3AA 4NZ3A 2VFFA 4Q4RA 3EX6A 3P80A 5A8GA 1LL7A 3NZ1A 3VOFA 1WYIA 4HNLA 2B7PA 2YFNA 1TWIA 2Z28A 3SQSA 4MWAE 5D4YA 2VDGA 1JZ8A 3BVJA 3VAVA 2TODA 3GDTA 3P5ZA 1JZ2A 3UCCA 3FAWA 1VRXA 4C6JA 2PDKA 3ARZA 4O28A 3ARWA 2QUVA 4B5XA 1B31A 3GVWA 1GVYA 3H54A 3BMWA 1ADSA 1OCNA 4MYXA 3CHVA 3APTA 5BCAA 1HJVA 1KM1A 1XLJA 2ZRYA 1XLKA 5C0QA 3ABQA 3C0QA 2YFOA 1U2YA 1SVDA 3MJMA 2E1DA 4DBEA 1KTCA 1OB0A 4JICA 4KWOA 4Q8MA 4NYYA 1C9WA 1JQXA 5XIMA 3WMLA 1FOBA 2ABBA 3BLOA 3AS0A 2Y4SA 1W9XA 4X9YA 3ATYA 3ZT6A 3EDFA 1OFRA 4R3UA 1SSGA 1XCXA 7REQA 3L2MA 1UBSA 1T6MA 4QE4A 1M7XA 1PIFA 1DVJA 4IGMA 1KGUA 1VYSX 3ECQA 1XIGA 3NA8A 3NQFA 4AZCA 3OA3A 4Z2KA 5IHRA 5LNSA 4M6QA 3H7UA 1FWAC 3CV2A 3AHZA 4IMFA 1KFWA 1X38A 5AHIA 3ZT5A 1RP8A 2WNWA 4C90A 2YW3A 5E0FA 5F2IA 2I7GA 4M7SA 2W0UA 2ZICA 4HHPA 5CSYA 1W5QA 1W6TA 4GXMA 1SFSA 3VDCA 7TIMA 3LQGA 4F66A 4AWTA 3EOLA 3GS6A 3VMOA 2C71A 4L1GA 4XG1A 5A95A 3UCDA 3W7KA 4Q4PA 4JN6A 3FOKA 4EPDC 3CS2A 1SZNA 2XFYA 4C6FA 2JBMA 1NWRA 5D2TA 3QJAA 4GZEA 3RM9A 1VIZA 1WDDA 3RM4A 2INFA 2XGIA 3W00A 4C7FA 2WMJA 3E9AA 1G9HA 3RX3A 4AZ7A 1Z42A 1KM5A 4D6EA 1T99A 4QRNA 4NJKA 4I6KA 2CERA 1GQJA 2F9RA 3H22A 3UXIA 4DWSC 4JTRA 4HN8A 5FF7A 1PSCA 1Z32X 3UG8A 3BAIA 1E43A 1YKWA 1CXKA 1EPXA 1A3WA 2XGBA 1OD0A 3PZIA 3AI0A 2WANA 1DWJM 5EU9A 1K4GA 2P8BA 1XIHA 4IGNA 1GOKA 2ZUTA 2GWGA 5DANA 1V77A 3IGHX 3FY1A 3ABOA 3QPEA 2D23A 3QHOA 3VM5A 3WLJA 4US5A 1BSIA 2DZBA 3EWCA 3W1LA 3ANVA 3AXXA 4GNKB 2VD8A 3AIRA 1EP3A 1CXEA 4CN4A 2V5KA 2VWTA 4H1ZA 3QRHA 5CPOA 1I1WA 1N55A 4K7VA 2FLIA 3EA3A 1S5TA 2UY5A 2NWRA 2EAWA 1E4MM 4PTMA 3K30A 1F07A 1PCWA 3RG6A 3P0WA 2V5DA 4L6DA 4D6DA 3I3DA 1MRAA 1LF1A 4MLJA 3GIPA 1QU4A 2F38A 1Q3NA 3AS1A 3TN4A 4O1CA 5CZ0A 2Q3OA 3BJFA 2OQYA 1SFJA 2KX9A 3CV7A 1TZZA 4LCSA 3QR0A 5I77A 3FDKA 4E4FA 4PTWA 2VGGA 2B7NA 4WY0F 2OR2A 3GC4A 3VZXA 1OG6A 1ZAHA 3STGA 9RUBA 4AX7A 3W07A 1V6TA 1FXQA 2JALA 2JF7A 5BMXA 3E74A 1FCBA 3GIYA 2Y7GA 3MI2A 3IVUA 3CAKA 4OU1A 2ZTKA 3DHDA 4YS1A 4LVFA 4R85A 3KBWA 2QCNA 5BRPA 1OCJA 1HIZA 2VHLA 3AIWA 2W27A 1RD6A 6TIMA 3S46A 3MV01 5H1WA 1B4EA 4Z0JA 2I57A 2Y63A 4FNUA 3QM3A 4JCMA 4EF8A 3G1SA 2FGZA 3KVKA 3TXVA 2QV4A 3B0PA 3TE9A 4FHAA 4CNPA 1P6WA 3N11A 3BCJA 2OGYA 3O6DA 3GZAA 1EIBA 1C8YA 1PHWA 1XGEA 1LQ0A 5EFFA 4UFJA 1V3LA 4CQDA 4O0QA 1OX5A 4GX8A 2X7VA 3SRKA 3XIMA 3EXSA 5D2YA 4H6EA 3UZWA 4IIBA 2J8TA 3CV1A 4MPQA 3RO6A 1CLKA 2FZMA 3IAPA 4AUBA 4GIEA 2O0TA 3WDQA 5LIXX 1FH7A 4S3AA 2FMNA 1FXPA 4DM1A 4H6RA 1K77A 5I6SA 1D3HA 3NL6A 3LHTA 5LNRA 3I7SA 3IJ9A 1TJPA 1UOKA 3NL2A 1T41A 2IKGA 4L6HA 5JBEA 1QNSA 4JIQA 3UXDA 1V3KA 2NQ9A 4FS9A 2GK1A 4HPNA 4K8EA 4ZO7A 5HNRA 1LROA 2VCAA 3EKGA 1QPOA 3RM8A 2WJDA 2WVVA 2J66A 2BG5A 3EWUA 1TWWA 2EG6A 2XVLA 4MSSA 4RDVA 3V18A 1FRBA 1UH4A 2DV0A 4QCFA 4KRTA 4GK8A 1MZRA 1VR6A 2WMHA 5J8LA 1R9ZA 1U1JA 4US6A 5CZTA 2PLKA 6TAAA 4A3YA 1JNDA 4K39A 3AISA 5JMUA 1TJ2A 4HTYA 1GPWA 1JZ7A 1OYBA 3T9PA 3Q45A 4FNPA 5HDRA 5ABGA 3ANUA 1TREA 2VI0A 2P5NA 4R9OA 2DQXA 5IFTA 3OBKA 3D5HA 3C86A 5EB8A 3UT0A 2Z6IA 3AALA 2C91A 3MP3A 3R0KA 3NXLA 5K4ZA 3DC0A 1O1ZA 4HPJA 4JL2A 2ISSA 3GIQA 3IS4A 4J27A 3TOPA 1K02A 2CETA 2OOGA 2CWNA 4IFOA 2X0SA 4UXDA 2DZXA 5AHFA 2G0WA 5AN7A 1KLZA 3EWZA 4POCA 4GJIA 5HNNA 1TPFA 3BW3A 4PZVA 4K38A 3CLWA 1JUEA 4CEUC 1NDZA 1FHVA 4L9XA 1QUMA 3LRKA 2ZC1A 2GGHA 3GXNA 2IXUA 1MI3A 3H2FA 2V6AA 5T9BG 1UWTA 1QR7A 4JS3A 1RQBA 4NAEB 3AIBA 1R85A 2O55A 3TTEA 5D30A 5A8MA 1VKFA 3QSTA 2AL2B 1XRTA 2QHAA 2V3GA 3EX2A 2GVJA 3M41A 1TUXA 2OT1A 1US2A 3SQMA 5I5RA 1YADA 3M0KA 3EPMA 2J7GA 3BICA 3QF0A 4IUGA 2NQLA 4OBRA 2BV9A 5CZKA 3WUBA 6ALDA 2PS2A 5D33A 4FNTA 2YZRA 1ZB5A 1ZALA 1U5HA 2HBVA 3UW6A 3WLPA 3GNPA 5FEXA 4ZO8A 2A3HA 4W93A 1VFMA 2FGBA 1G7UA 3FA4A 2YCEA 4DYJA 2VD9A 2GVLA 1H49A 1POKA 3BAYA 4LS1A 1E3ZA 1UZDA 2QIIA 4BF9A 5I3FA 5FIPA 3EMCA 3O0FA 4OIFA 4H6KA 5FF4A 5CSRA 5A2AA 4B4FA 1DEDA 3WLTA 4TMBA 4MOZA 4Z08A 3DCPA 2PP0A 3WQGA 3IRDA 2YCLA 3SAZA 3U2EA 3GX9A 3WH6A 3W37A 1PDZA 2A0NA 2Y8UA 3PTMA 1WKFA 3T44A 4DZIA 3ITOA 2WMKA 4OTKA 2JEQA 3IARA 2HS8A 4O0KA 5LA2A 3UNTA 3TWAA 2Q8LA 5FJRA 1J11A 3N9KA 3FLUA 1H5VA 4AD2A 1QFEA 1SR9A 4AYGA 2GL5A 4NJHA 3W7PA 2BZNA 3PSVA 4QP0A 2ZRZA 4FOKA 4DYKA 2PBGA 2V2HA 3QFEA 3WD2A 3W7HA 1OT2A 3NQCA 1Q65A 1I4NA 4AH7A 2QUTA 4GIYA 3L7RA 1ZP4A 2DVUA 4UUIA 1ONEA 5JBDA 1KO0A 3W6MA 1YLVA 4G7FA 5I78A 2WPGA 1TVNA 4PUDA 4LC6A 3IK4A 3VE9A 2V8ZA 8TIMA 3T05A 4HJWA 1EHNA 1XCWA 1S5VA 4KEUA 3ITLA 2XIQA 4ICCX 4JNMA 3S1VA 3M0VA 1EYEA 3IV8A 1DTUA 3IVTA 3TYDA 4MB1A 3G1YA 4LUYA 3LPFA 3BLKA 1JZ4A 1H11A 1A0CA 3AYSA 3MHFA 1E6XM 1V6VA 1C8XA 1KM2A 4EAMA 1K9EA 3H4WA 3C2RA 5I3JA 3MZ2A 2WK2A 2YLAA 1X1NA 3N3MA 4NNCA 3OP2A 4HSNA 3C52A 2PUZA 3NQEA 3BQ6A 3ARXA 1FWSA 1F8IA 2BHUA 3APGA 3AMDA 1LOLA 1XLFA 2ZBTA 4MVAA 4LEQA 4PRWA 1ISWA 2Z1WA 3KW3A 3BAXA 4ZOAA 1PZ0A 2W9MA 1W9UA 3BTNA 3ZS4A 3EWYA 3WMBA 3OLGA 1BYAA 5D03A 1MUWA 3TW9A 4NT0A 2INEA 1W5OA 4UMBA 5AC8A 4Q8QA 4BQ2A 4WLCA 4IIDA 5HUOA 4HNNA 1LOSA 3UYCA 4CD7A 1EUAA 1UC4A 3M1ZA 2OKTA 1OADA 4RNFA 4JEJA 4UIOA 2R24A 1FQ0A 4NI3A 4S3EA 3UA4A 3BDKA 3UYIA 3NUKA 3MO7A 1QI5A 1XD1A 4I3GA 4YL2A 3KHDA 2QCDB 4PE8A 2ZUMA 4PL2A 3VINA 2Y0FA 4MJMA 3IJ8A 4MNLA 4XQ6A 3F2BA 1R46A 4YVVA 5FACA 4LEFA 3OTRA 4H00A 2X42A 4OV9A 4A2RA 3U57A 2FTYA 3THAA 3VNIA 1DJQA 1J2WA 2X41A 3GR7A 4UNIA 3WUFA 1E15A 4C6EA 2VFEA 3N29A 3CB3A 4HCLA 3TJLA 2NW0A 1EJRC 5CG0A 2C1IA 4WXYA 2BS9A 4CCEA 3UWYA 4KEVA 1AODA 1ZQ5A 4PA8A 3RX4A 2GDQA 2PTZA 3IJ7A 4TMCA 3GTHA 4L1XA 4Q8OA 4G9PA 2EJAA 3QV7A 3GHUA 1LM1A 3DFHA 3N4AA 5D9MA 4JGDA 3VOCA 4WJEA 3O15A 2PURA 2ZA3A 5I3GA 2DSVA 3KHJA 1MO0A 3TYZA 1XYLA 3PR2A 2PDNA 1TV7A 2IXVA 4WCJA 4KCTA 4NXKA 4XVDA 4QTGA 4IX2A 1P43A 4Y9PA 5CSUA 3WLNA 1F3XA 2PB1A 1GYMA 4Y90A 3ZR4A 3PPFA 2WBGA 2I17A 2PMQA 2QJGA 3GXIA 2Z4GA 4DO4A 2WB5A 3EOSA 3HOJA 4IL2A 4OHQA 4HYWA 4JTJA 5ABFB 3HPXA 1DWIM 4XTDA 1QO5A 2ZX7A 2NXIA 1FUYA 4OKDA 1TJ1A 4Q8VA 5AKQA 1HVXA 4JFUA 1O4UA 4DJED 1IIGA 5CLWA 1L6GA 1NF0A 1SPQA 1UQZA 1V51A 3LRLA 1ICPA 3L4TA 4GFIA 2C7FA 2C6QA 5D38A 3QMTA 5IDZA 3FJLA 1GK8A 1ME8A 4D2JA 4Z2JA 3KUMA 2WC4A 5HQMA 1VFTA 4X0VA 3BC9A 1Q6OA 3QR3A 3PC0A 2DZUA 1J0HA 4UTIA 2GUYA 1FHLA 3CIWA 4E8CA 1AL8A 5U7SA 3MBDA 4O54A 3OPSA 4MG4A 1TWDA 4J5NA 4F0HA 3URQA 4HK6A 1ONWA 3R8HA 2VDIA 4RR4A 4AX6A 2BOFX 4GY7A 5F2MA 1TR9A 3CK5A 1OK6A 3FEMA 3FNDA 3P84A 5A6TC 1GT8A 3SFKA 4B5WA 1XSIA 4EKJA 3TLQA 2E5CA 4FX6M 2JQXA 1JYVA 4O4VA 1OFEA 3WEOA 3VPLA 1RCQA 3GDKA 1QI0A 1KA9F 2NVAA 3GNXA 3DUGA 1CGXA 4WGXA 4D8LA 4IP7A 4FNQA 3S1XA 2I14A 1TKKA 3V75A 5BU9A 2MNRA 4C60A 1CGUA 1WP6A 1QHOA 3L2IA 4QCEA 1AJ0A 4E3TA 1VRDA 4JL1A 2NQJA 2XG9A 1N8IA 2VFIA 1OGGA 4RXGA 2Z7KA 4EXBA 2OEKA 3CUIA 3ZT7A 4IMDA 5LNUA 3I65A 4F0RA 4FSAA 1W1TA 2WHLA 2J75A 3RLVA 3BCFA 5JIWA 1XYZA 3T81A 3PZOA 3BSGA 3S9YA 1JFHA 4UWMA 2B31A 2IPWA 1WAUA 3FYYA 4G6CA 3ZVHB 3EEZA 5CGMA 1Q7MA 1B4KA 3TTYA 3CT7A 1GWJA 5C8BB 3ES7A 4HZ8A 4MB4A 2YA1A 2W79A 2NV2A 1Q45A 4B2DD 3CB8A 3KOWA 1R9YA 2GVEA 4HPHA 5CC7A 3VCRA 4TQTA 4MADA 3TNBA 4IQLA 3TJ4A 4LVBA 4DZ5A 1Q6QA 2CCRA 2JGQA 3Q2DA 3MS8A 3LGEA 4QLLA 1AQFA 3IVSA 4DO7A 4TVDA 2C3ZA 3HURA 6A3HA 3DBPA 4JPGA 1WDRA 1U5JA 2ABAA 1E71M 4Q8PA 2OSXA 4KPLA 1VPXA 4QX4A 4I9TA 1S5NA 1M7JA 3DFNA 2Z27A 5KZEA 2XIJA 3WUGA 2FDSA 4TVUA 2QW5A 3DU0A 2C1GA 2I9EA 4OZOA 3NO5A 1OWQA 4AEFA 1ZZMA 1JD9A 3N1AA 3VIHA 1D8CA 1MQQA 3LYEA 1N2VA 4A35A 2ZRVA 2FVMA 3WQCA 1I1XA 1P4CA 2Y61A 4KCWA 5CPLA 3M0MA 1POJA 3VTRA 4BQ3A 2PDBA 4LBUA 3OA5A 1ZJAA 2CEQA 4PL1A 3JRKA 3M0LA 1GG1A 1VF8A 4LYQA 3TZNA 5FSDC 1OJXA 5HK4A 4PB3A 8XIMA 3B9NA 3PF3A 3L68A 3VDHA 3NURA 4S23A 1AD1A 3B03A 1PKMA 4HIBA 3EDJA 2AAMA 3A4AA 1N8WA 2BASA 1EYWA 5DT7A 4WY0B 1I0DA 1R3RA 3L65A 4WSJA 1EF3A 3ZJ6A 1LWJA 4JQ3A 4H2CA 3FAXA 5DY3A 3FXYA 5LYRA 2OLSA 4PFHA 2FHBA 1UWRA 1EF2A 2OEJA 3SGZA 2HNEA 1J12A 3OW1A 4L9YA 1F3EA 1H41A 3WY1A 1UUMA 4F0MA 2V2DA 1SM9A 1WKDA 3D3FA 3KWSA 2FPVA 2W6RA 3M5XA 3L0NA 3RGTA 3WK1A 4PBGA 4RXFA 3CL7A 4RUBA 3HPSA 1EBGA 3ABRA 5A3HA 3K13A 1UD4A 3MWAA 2YYUA 2BY2A 4LCQA 1Q4WA 2WXDM 1XKJA 3EOOA 4JTQA 3GG0A 4LW7A 3WD1A 2J79A 1DJIA 3ARVA 4A8RA 4ZA0A 1SJBA 3FYOA 4AVNA 4UFMA 4WGHA 1OFAA 1OK4A 1EC8A 5FEWA 3QC3A 4CQBA 3H4XA 1ECEA 2VR4A 2CKSA 1RQEA 4DJFD 3CXOA 4W5UA 4K68A 2Z00A 4O12A 3CYJA 4HHLA 2WCGA 3C61A 3P14A 3HG5A 1EO7A 3TN3A 1X39A 1YPIA 3FXGA 4UBPC 5KETA 3W7GA 4M56A 4AWUA 1A5NC 4JHOA 3W1XA 3CL6A 1C90A 4NAEA 4KWWA 3UR2A 3NQVA 2FVKA 3VCCA 3NZQA 3B0UX 4LAKA 3V3WA 2V3FA 5FL0A 4L4LA 2AL2A 3MI6A 4DX3A 1JL8A 1ICQA 4DLFA 1YHTA 4ZQNA 3W23A 5AC6A 3QQWA 1PDYA 3S5NA 1AW2A 1MQPA 3W7DA 1EX5A 3C2FA 4GGHA 1CGVA 4H01A 1LLZA 4IGHA 4O50A 4LNCA 3BG3A 1UWQA 3PZGA 4GYPC 3SI9A 3ITCA 1DTNA 1HKIA 2E68A 4Q8WA 5A8PA 3CWNA 3F1QA 1XFCA 1P0DA 1W3KA 2GPTA 1NFBA 1X1ZA 2YCJA 4L9ZA 4BHYA 5LNWA 2OPJA 1JIBA 1XIIA 2TMDA 2C8NA 3UWVA 4W7WA 3QGVA 3PB2A 1HKMA 1IEXA 4ORIA 1WB0A 3DG7A 4PB4A 1ENUA 2V9DA 4DNHA 3RIKA 5A2CA 3WLQA 4F48A 1JI1A 1UW9A 1XRSA 5CXPA 1OFQA 3BV7A 1QPQA 2YB4A 1RBAA 5JU6A 3B05A 4LQ1A 3ALFA 2XZ7A 3WELA 5BW6A 1V6WA 3ITGA 1EA0A 1F6PA 3QEZA 2DH3A 4GYKA 2OLAA 1IEWA 3TMLA 4R5EA 4HZ7A 2HSAA 4QITA 3WQEA 4Y96A 3W1MA 3O0KA 4LY8A 2VURA 3DFPA 4W7UA 1V7YA 3G1FA 2VEGA 3OIHA 1GJWA 5EPDA 4ECLA 3IIVA 3I4EA 1SO3A 3FVDA 2Y89A 1T7LA 1GZGA 4NASA 3KP1A 5TAOA 1AG1O 2WNNA 3TAOA 5DQPA 4DJDC 1W3HA 3PTDA 1AZ2A 1JDCA 4A21A 1UA7A 3VC5A 3RFAA 4RE0A 3R11A 4DF1A 1BTMA 1H2JA 3E38A 2PWGA 1B3ZA 3LHWA 2QLYA 3ITVA 3CAVA 3OLDA 2ZZ7A 2G4JA 3PAOA 2O7SA 4HNCA 3H6OA 1QWKA 3PWIA 3FJ4A 4MAVA 1EIXA 1TYGA 4DPQA 7XIMA 2GJNA 4PTVA 1OIFA 3WH7A 1WBJA 1LL6A 1K8CA 4DZHA 1KCZA 4ZFMA 4CQ8A 1L6WA 3R5EA 1TRIA 1HKKA 2WZEA 3GG8A 3NQ2A 1TFVA 5HMEA 4C6LA 3GHRA 2OZ8A 2NV1A 3ARUA 3YPIA 3F4NA 2O9OA 1UD5A 2QCCA 3B8TA 2X1SA 3GW0A 2PCEA 1A49A 2R1NA 5CJNA 3NQGA 4JN8A 1MXDA 3N6JA 1G5AA 2XSAA 1S3HA 1K1DA 1QJWA 1CPUA 4MIMA 5C70A 3UXLA 1EEPA 1GQKA 4DBWA 2YL6A 1LT8A 2FZNA 4XSLA 3LX9A 3WDRA 2RUSA 2CXGA 2EQDA 1KFJA 2FHCA 4XB3A 2FGLA 5E93A 3T4CA 1E56A 5CZSA 5C71A 4QIUA 3NO1A 1VENA 3G1XA 1WOAA 2VTFA 3O6YX 3T40A 1I2RA 4JQ4A 2QUNA 3TNOA 3IIPA 1CW2A 3SIZA 2FZ9A 4V15A 2F6UA 2XGZA 1G4SA 2BNJA 3DYPA 1L2QA 4RZ5A 3SCQA 1BHGA 3AO0A 4DWDA 2FZ8A 4JKMA 5D9NA 2GLKA 1UWUA 4G7EB 1IGWA 4PCPA 1Q6DA 1W5MA 3WLKX 5LA1A 4MDPA 4P7RA 1KTBA 1DBTA 2CLFA 1K6WA 3H21A 3L4WA 1XYFA 3VX1A 3QLLA 2RGLA 1QRQA 2D73A 3U7BA 3AJXA 1CDGA 2YXXA 2INZA 4JHZA 5AC4A 1SW3A 3ABSA 1O94A 3MKCA 2OYKA 4XUGA 1VFUA 2BGSA 4EF9A 1DQXA 2PD9A 2PAJA 3GM8A 2VQUA 4EVZA 3H12A 3PBGA 2OCZA 4LY4A 3VIPA 4GUIA 1XJBA 5HNUA 3UERA 2G3JA 1IE7C 3CUZA 3QGKC 3LCFA 3AMCA 3SCPA 3PZNA 4YHEA 1IWPA 5AHMA 2WV8A 4PCSA 3NYDA 3CHFA 2Z29A 2CHNA 4GUHA 4MUZA 2VP8A 4WZHA 1X6NA 2OKOA 3S8HA 1F3TA 5AYBA 3T78A 1GOOA 1XDLA 3IJLA 1OHLA 4Z2IA 4FOUA 2ON3A 1RH9A 4M3PA 3NPXA 1RVKA 3DFSA 3DH7A 5T9CE 4JX6A 4KF1A 3MTWA 5KZMA 5GNXA 3FJ6A 3QH2A 1EZWA 4J35A 3HN3A 4A8IA 4GQGA 5ABFA 5BXPA 1UH3A 3JZEA 2ODOA 2PLJA 1YNYA 3D47A 3K8KA 5A6AA 5T26A 1U33A 4KIRA 1CZ1A 2ZXDA 9CGTA 4U10A 4AYSA 4DY1A 2R8WA 2X09A 1CGWA 1QNRA 2ALDA 3GG1A 1LL4A 4L61A 2RKXA 3RCNA 1W9DM 3GXPA 4DJFA 1OC7A 4UCGA 3W29A 4NVTA 5KITA 1E1EA 1NP0A 3WUEA 3CLMA 1GNXA 3E2RA 3NPUA 1YEYA 1BF2A 1R2RA 4REQB 1P0NA 3AWNA 4LB3A 5REQB 5E09A 1FWHC 2GDVA 4ADUA 4QQ3A 1O5XA 2QUUA 2VGIA 3G8RA 4HSHA 5XINA 3M9YA 4BK9A 1B3OA 3OIXA 3I10A 2REQB 4NX5A 1AL7A 1EDTA 5A8OA 3S4TA 2YA0A 5HJXA 4AMCA 4GC3A 3TSDA 3LHZA 5BOEA 2PGEA 1JYXA 1HGWA 1TTQA 4Q6JA 4DXXA 3GTNA 1M53A 1J01A 2PGRA 4J3WA 4QLKA 1PL9A 1A5SA 1V3IA 3HFTA 4M29A 1GVOA 2P8CA 5DMLA 1UWAA 3PUGA 5K3VA 2F6XA 2H3DA 1QCWA 3PUEA 4ZO9A 3BARA 3G24A 4HB7A 3ZYZA 2C19A 1IT8A 2Q8ZA 3LERA 4PSRA 1OINA 2G3MA 3T6CA 5B80A 4YJ5A 1UKQA 4MM1A 1W5PA 4O1DA 1L6FA 5FA5A 1GTHA 1MZHA 2D22A 3KTSA 3VILA 3EB4A 1YNPA 1W3LA 3WFZA 1BQCA 3A24A 4B3LA 3M5VA <