2NLYA

Crystal structure of protein bh1492 from bacillus halodurans, pfam duf610
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
216
Chain Sequence
MKRAAIIIDDFGGDVKGVDDFLTGEIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEPKPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMRAILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSRKEVIKNMRKLAKKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Divergent polysaccharide deacetylase hypothetical protein
publication title Crystal structure of hypothetical protein BH1492 from Bacillus halodurans C-125
rcsb
source organism Bacillus halodurans
total genus 70
structure length 216
sequence length 224
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04748 Polysacc_deac_2 Divergent polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2nlyA00
4NZ3A 3RXZA 4M1BA 4NZ4A 4NZ1A 1W17A 2CC0A 2C1GA 3WX7A 1XW8A 4NYUA 4F9DA 1NY1A 4V33A 2J13A 3CL7A 4U10A 4WCJA 2C79A 4OUIA 4HD5A 1Z7AA 3CL6A 3S6OA 2NLYA 3VUSA 4F9JA 1V6TA 2C1IA 2VYOA 5JMUA 2I5IA 3CL8A 3HFTA 1W1B1 4NYYA 2QV5A 5BU6A 2W3ZA 1W1A1 4NY2A 2DFAA 2IW0A 2C71A 4L1GA 4LY4A 2XU2A 4NZ5A 2Y8UA 2E67A 3QBUA
chains in the Genus database with same CATH superfamily
5D9OA 1MUMA 2RGLA 4ZTXA 3B9NA 3EOEA 4CKQA 1X7FA 2YYTA 1SU5A 2B7PA 4XBSA 1LLWA 4IMGA 1JGIA 4Z1CA 3CHEA 1TMLA 1ZBWA 2FKPA 4QLJA 3E2SA 1OC5A 3NTYA 3TZFA 3N6HA 3P14A 1W17A 2HRWA 1Y5XA 1XC6A 1ZBKA 4P8UA 4IFKA 3D6NA 4IICA 1YDVA 3EMZA 1NAL1 2XFRA 1YPIA 2WCSA 1J6OA 1OM0A 2WBKA 4WDXA 2NUWA 3OYXA 4Y9NA 3WF4A 5F1VA 4DBWA 1YLVA 3RXZA 5I5RA 4GI8A 5IDZA 4QJ1A 1FA2A 3HIJA 1PPIA 1J8VA 4XAYA 3A3HA 2OQYA 3RJYA 3M41A 1GOMA 4GC4A 1A5UA 2G96A 4MPKA 4UC5A 5LGXA 2O9TA 1W5MA 3WY1A 2VGBA 3GC4A 3GIQA 4NP7A 3E74A 2PE4A 4PRTA 4EACA 3UZJA 3BSGA 1RCQA 2DT3A 2FMOA 3LGDA 2VD9A 1KFJA 1TIMA 1JFHA 5DRCA 4K7YA 1OC6A 1SFJA 5K7JA 2Y8VA 3VMPA 3HU7A 4J3WA 2VRQA 1E4MM 3PZUA 4S2CA 4N7QA 2BXYA 2VKZG 5I02A 1P6CA 3JU2A 5HBFA 2QUMA 3B8UA 2J66A 3DFQA 1TUXA 4HNTA 2QJIA 5HMSA 1GVSA 1ZGDA 4LAZA 3NO3A 3HO8A 2A0NA 4W7WA 4A8NA 5EFFA 2X1TA 1UWAA 1XYCA 3OA3A 1SFSA 2QVHA 5TF0A 3BV7A 1C9DA 3FYPA 2PTDA 3DXIA 2W27A 3ZT5A 3MMTA 1RJQA 1ITCA 2PDIA 3N4AA 1O5RA 3N9SA 2GJXB 1Q2SA 4BI6A 1F4AA 1NQ6A 5JMUA 1I2NA 3QR1A 4F2TA 3OG2A 4M5PA 4QE5A 1W9PA 2CBIA 1J0YA 1YTKA 3QQ1A 4UWMA 1TV2A 1S1PA 2QR6A 2WKGA 3VIPA 2I9EA 3NQDA 3FV9A 3IJLA 2NUXA 5BRPA 3H2EA 1E56A 1TVLA 5JIWA 3WUFA 3K8LA 1D8WA 3MO7A 2GJXA 2C1IA 3WN6A 1ZALA 4O14A 5EMLA 4F40A 1H7NA 4GCAA 3SRDA 2MANA 2E1DA 1RHCA 2ZFAA 3L4TA 3TTQA 4OFCA 1XHGA 2QCFA 1Q6EA 4YMZA 2RH9A 3KVKA 1YDNA 5LIXX 3WNNA 3UZ5A 1O66A 1K02A 4QNEA 4P8WA 2ZOXA 3RYSA 3H4GA 4NF7A 2G4FA 1M7XA 1KQYA 1VIZA 4DUXA 3CZJA 1EF3A 3NZQA 2BOFX 1UR9A 3VOFA 4BKNA 5JH2A 4Q8MA 5A6MA 2XSBA 1JNEA 1OIFA 1NY1A 3A23A 2Y7FA 2VO5A 1XYFA 1JDCA 1E55A 1UUQA 4DN1A 4B16A 4B15A 2EF9A 2OZTA 2XPKA 1OGGA 4E4PA 4AD3A 2CZDA 4H8VA 4YL2A 3CHCA 3AMCA 2EKCA 3AXHA 3BZGA 1TWIA 5I77A 5LXXA 1SQ7A 2D69A 1CBGA 4UTFA 2W66A 1E5NA 1PKMA 4IQLA 3TWBA 4L9XA 3E12A 2BODX 4YU1A 4PL2A 4W5ZA 4PMZA 4U33A 3CNYA 2O4MA 3AI0A 3P2VA 4NZ4A 5MF5A 4XIMA 1NWRA 2GGHA 3MVTA 4HMCA 4P7LA 3QY6A 2R1KA 1J6PA 2WB5A 3R0UA 2YR1A 1Q8AA 2J88A 2C19A 3W29A 1BD0A 3OGSA 5A6BA 4M51A 1V3JA 1ZUAX 3M7WA 4UTUA 2VWSA 2J75A 2NWSA 1M41A 4NJIA 1US3A 2A5HA 3SY1A 1JZ3A 4DELA 1H4PA 2ALRA 1VJZA 3RCMA 3AS1A 3LEPA 3V36A 2DU2A 1JYWA 1Q4WA 3VNYA 3GTIA 3LB0A 4Q33A 4HB7A 4AXKA 3ZT6A 1ZCCA 3H53A 1TX2A 2R8WA 1X96A 3WK0A 1RVKA 2PDWA 2ZUNA 3N9RA 3H2NA 1V02A 1N8FA 1US0A 4GXPA 5E70A 3APGA 4ZQMA 1DVJA 3FNDA 4DWDA 4W87A 2QHAA 1R30A 1NARA 1OT1A 2PEVA 1P0BA 1QASA 1C8VA 3MUY1 1BVWA 2V3EA 1QI5A 2YW4A 3AMLA 3P8JA 5CJMA 2I14A 4YPJA 5EY5A 3CWNA 3O63A 1TCDA 2VCBA 3SGGA 4LEFA 3BLLA 1V6WA 3IAPA 2C8NA 4KMQA 4JIIX 1VJIA 1O12A 1EP3A 2WAGA 3AUOA 3DFOA 1SUXA 3BAXA 1CGTA 5EMYA 4R9XA 1HZYA 4KCVA 1ONEA 2XWDA 3M16A 1NDVA 3QOMA 1M1BA 1G0CA 2BWGA 2DY3A 4OV4A 1HO1A 3RF9A 1POJA 2G3JA 4O57A 4EWJA 4FIQA 3TYDA 4G8TA 4DM2A 3B0YA 1H7XA 4EXAA 1AD4A 3WQWA 2BGSA 1R85A 2OGJA 3GZ3A 1U22A 1UD4A 4GIRA 3LV5A 5HNNA 3UPBA 5C9UA 1ZRQA 4ZO9A 1ENUA 4PH6A 3THCA 1PTDA 2XHYA 1SW3A 1RP8A 1FCBA 3LRLA 1W37A 2A7PA 3B9OA 2GQAA 2VFEA 3NNTA 1KLZA 3D5HA 1G94A 3MWAA 2WZTA 2QJNA 3P8IA 4O52A 3OHIA 1G9HA 1ODUA 2BMBA 1IIHA 5LA0A 4QE1A 1TR1A 1KFKA 2L5HA 4CQDA 1QK2A 3SCQA 3K5XA 1CCWB 1MSSA 2WMFA 4UTWC 2PA6A 4UQDA 2PLMA 1DEDA 2ANUA 3PB2A 4I9MA 1JVNA 4M6PA 1ISYA 2QDGA 3NVDA 3O15A 4GXMA 4AIEA 1ZENA 3CH9A 4DIAA 3CPUA 5H6HA 1EJTC 4DUOA 2WPGA 2HCVA 1FDYA 3R89A 3W2MA 5C9XA 2OTDA 1M01A 2NLYA 4JTKA 2XYLA 3SCSA 3BTNA 1KKRA 3PBUA 2Y7DA 4DUWA 1UWIA 3EB2A 3WD1A 3YPIA 3TCSA 1JPDX 3KCJA 5LNWA 1VGAA 3NDOA 3IV3A 1JEZA 1UWSA 2F6XA 1DBTA 1CW2A 4N0RA 4MUPA 4UOQA 4CQ8A 4X0NA 3ZLHA 3UWUA 1IIGA 3VE9A 3WD0A 1TB3A 5CPLA 2FVKA 1JJKA 1A47A 1RAKA 4XZNX 4HNNA 3PR2A 5BOOA 1JPMA 4PMYA 1W3LA 1DYSA 2VHLA 1EFZA 2J78A 2OWXA 3VGEA 4PB4A 1ZB5A 1H11A 8XIAA 3AFBA 3BG9A 1MFVA 1RH9A 3F4WA 1A5BA 3HGRA 3II1A 2WC4A 1X1NA 2CFFA 2JQXA 2VQUA 3LA4A 1SMDA 1FWCC 1J2WA 4ML4A 3K1DA 4E2VA 1E6SM 4RZ5A 3AS2A 4WEVX 3V3WA 1ZU8A 3BAWA 2EO7A 3DEQA 3VIIA 4PODA 1W32A 4YYCA 4ZEPA 3B06A 4YIWA 5DT5A 4XX6A 3UZXA 1MXDA 3I3EA 3RPMA 2R1MA 3VOIA 1EBGA 1FWTA 3VFLA 1M04A 1QAPA 3CL7A 1RY8A 1R7AA 4MZYA 4LYKA 4KEZA 1WAUA 4CD7A 3OIHA 3CXOA 4DXKA 2P10A 3G1HA 4C5ZA 3ERPA 3PJTA 4N9BA 1CGUA 2OB3A 1DXEA 4YWSA 2FJKA 4GG9A 3PPHA 1KM3A 4WD0A 2RHGA 1GJUA 2GJNA 2EPNA 5ENLA 4PL1A 3TVAA 4NNBA 3AS0A 4NL1A 1KCZA 2E0PA 3LTYA 4J2PA 1L6GA 3QGVA 3HGOA 5G2IA 3ITLA 5A8MA 4DXVA 3N2XA 3GHSA 5BXPA 3NQ2A 1FWBC 3BSHA 4MJMA 2DZXA 1V7YA 4V2XA 9RUBA 2P50A 1ZTVA 3AO0A 1QNRA 5C7HA 1KFBA 1DWHM 1B3YA 4IIHA 4RNJA 2GK1B 1UP2A 1V0LA 4ZQNA 4QCFA 4MLJA 4FLQA 2YL9A 3KCLA 1MDRA 2I5GA 4FHAA 3FJLA 3O1NA 2G97A 2FFCA 1BYCA 1VZWA 3QMRA 3VDGA 2ZZ4A 3HFYA 4TOQA 1ZZMA 2Y62A 3EPMA 2ZDSA 3MTWA 4MUZA 4MYXA 3MW7A 2R24A 4IH3A 3VM7A 2GK1A 3VK5A 3W84A 3ZLGA 1GONA 3FXYA 3WDPP 3BW4A 2X7VA 4EKJA 1Y65A 4JD4A 4HGXA 1E0XA 1X6LA 3E49A 4M3PA 2OT1A 3EWBX 4UQ9A 2Z6JA 5I3GA 1CXEA 1WE5A 3GUWA 3BC9A 4RCXA 2YCKX 2FH6A 5FD0A 1I6NA 3G3DA 1QNSA 4HNVA 4E8DA 3L2LA 3LHVA 1OZQA 2CXGA 2W6RA 2OXNA 2QIIA 1B90A 3APTA 1EIBA 1PYMA 4HP5A 1Q6GA 5D03A 3GH7A 5F2IA 3ZVHB 1B30A 2WVUA 1GVQA 2J6XA 1S2VA 3FKRA 4K39A 1K9EA 1ZHAA 2HWGA 3WLLA 1DWJM 4B2DD 1H61A 2C16A 3PN8A 3MQTA 1MXSA 1OG0A 1W56A 1IWAA 1MEHA 1XRTA 3ZR6A 5LA2A 3BLIA 4PCTA 5C71A 3C4UA 3AJXA 3UXIA 4IISA 3ZVHA 2R1NA 2TMDA 1KR0A 3M5VA 1AUSL 4YVPA 2VC5A 3VUSA 4F2UA 2AMXA 4W8AA 3DUGA 5FJOA 1GZ1A 1AQFA 3BWWA 2X16A 1VRDA 3U48A 3O2LA 4RE2A 4A2RA 9XIAA 1DIKA 2P1FA 2QCEA 2WJFA 2H3BA 1OFEA 3WF3A 4DZHA 3SCNA 2A3HA 1Z42A 1UC4A 1Q6LA 3RR1A 3RGTA 4K2SA 2HS8A 5CSSA 4GVHA 3G22A 3ARYA 4LS1A 5CC7A 1KRAC 1IZCA 1WZMA 5HUOA 3ELFA 1VBUA 4A05A 2ZX5A 2YBVA 3OPSA 1XPYA 1D3HA 3EWCA 3GR4A 2AKMA 2J7FA 4NX0A 4DO5A 1HP5A 2OT0A 2V82A 2A3LA 5HJLA 3TTEA 3EXSA 4F9JA 1JAEA 3L23A 3GNRA 4L1GA 5KZDA 1EHNA 1R0MA 4HNOA 2QIWA 4KRZA 2UY2A 2FPVA 4UNKA 2CW6A 3KHJA 2Z7GA 1IQ8A 1TELA 4HU4A 4GIEA 3MUAA 4DPPA 5U7SA 3UJFA 3VABA 3W1UA 1XLEA 4JTGA 1FH9A 2POTA 3MUIA 4UTTA 2VDIA 3BH4A 3L4YA 1S38A 1JZ2A 4GX8A 3W72A 2RGMA 3NQFA 1PIFA 2C3ZA 1QO5A 1FY6A 1YNPA 1GUVA 1KM0A 2B0MA 4OOZA 3KOZA 1HKWA 3WJZA 4CNNA 1MW3A 4QM1A 1HKVA 5IHSA 3C2VA 5CEWA 3DENA 4U4MA 3HGJA 5FSDC 1UD2A 1F6YA 3GVQA 2OKOA 5C0QA 3QMSA 1VBHA 4JTJA 4FPSA 5A8NA 3ZM8A 4ZB2A 3SZ8A 5CKSA 3A4AA 3WQPA 3WMCA 3KFTA 2OWCA 1F6KA 3QM3A 2J7CA 3A5FA 1EGVA 3CUJA 2PRMA 3MO4A 4QG8A 3WBAA 5AHIA 1EXBA 3DERA 2D2OA 1JNDA 4DYEA 5HPCA 4IQEA 1P6BA 3W1XA 5HR7A 1T0OA 3QW3A 4W88A 3TQ0A 3S5NA 5CLTA 4AVOA 4I5XA 4MY1A 3FW6A 1EA0A 1V0KA 3KP1A 1W6TA 3MCOA 3WLHA 4F0KA 1TMHA 4PMUA 1TWDA 3RUBL 1EQPA 1XLIA 5F1UA 4F0RA 3PUOA 1QNOA 1E5JA 3VGFA 3EB4A 4IUGA 3NSXA 2IQ0A 1B3ZA 1V8EA 2HISA 2POZA 2CLHA 1HJUA 2JF6A 2P5NA 1WA3A 3NQGA 3UXDA 1VCVA 2INFA 1JYNA 1LUCB 4O4WA 2O9PA 3G1VA 4AEFA 1NOFA 4HA0A 4QDPA 1UCWA 4DEFA 4GJJA 3SECA 2YDRA 2CLPA 2V3GA 5LZLA 3W7PA 1DWAM 4ZOAA 4L5ZA 3PSVA 3W4RA 3A21A 1DJXA 3O6AA 4IL0A 1AH4A 2HVOA 3WYZA 3VD9A 3S6DA 5A6LA 1N2VA 1LUCA 3VKKA 2OPJA 4AC7C 4ZFCA 2INEA 2VYOA 3NQVA 1WQ5A 2FZ9A 2DP3A 2NX1A 1CDGA 3QR0A 1B54A 1RLCL 4JZ5A 1OB0A 5HNTA 1V3MA 5I78A 1E15A 1GOXA 3JZEA 1V79A 3LBMA 3NGFA 5TAOA 3TEVA 2NV2A 4YNGA 1W3NA 1UWQA 3C2FA 3EWDA 1RALA 2CLKA 5TBOA 4ACZB 4GISA 3ZR5A 3NVTA 3OTRA 5ABGA 4HN8A 1JI2A 1UQYA 2B7NA 3ABOA 3VE7A 2PTYA 2Y7EA 1Q66A 4BI5A 5RUBA 5KZEA 3DBPA 3SQLA 3S9ZA 4QBXA 4B9ZA 4ZSTA 3UWVA 3B04A 4ACZA 3RNDA 2WANA 3H7UA 4GYKA 2P0IA 2HS6A 1CEOA 3W83A 1FHDA 3VAVA 1UR0A 1YHTA 5LIKX 3IJQA 2BY0A 2NV1A 4MMWA 1SYTA 1OK4A 4DO6A 4NT0A 2I57A 1AMYA 1G6CA 3OLEA 3IPWA 2ICSA 4Q3MA 2W9MA 2V63A 2DJLA 8CGTA 2V5BA 2YBUA 1RPKA 4AZHA 4HK7A 2Z2UA 3TJIA 1VFLA 1W54A 3CUFA 2YFNA 3W1LA 1EHAA 3FXGA 4Q8VA 3GC2A 2VOTA 4XD6A 2CZ5A 2ZZ5A 4AF0B 2DFAA 1LWIA 2NT0A 4IQDA 4N9CA 3OB8A 4AD1A 4WKFA 4JNYA 3WX7A 2J13A 4S1FA 4LV4A 3LHWA 3UWZA 5I06A 3RMJA 3KVMA 5HINA 4UOZA 3S4TA 3HM7A 3O0KA 4PN2A 3GBDA 1EJSC 1A3HA 4XZHA 4LVFA 2INZA 4U2YA 1WDSA 4H6RA 3U0HA 1JRCA 3N29A 2QYGA 3DZ1A 2HROA 1HTIA 4ADSA 4GOAA 1XWYA 4RE3A 2VEFA 5EB8A 2WM0A 2JGYA 4WK9A 3AYRA 3I4EA 4FSAA 1EBHA 1LM1A 3W7KA 2PTZA 4YLWA 3IJ8A 1YXYA 3J7HA 1H41A 1R3YA 3U2ZA 1KB3A 3ONCA 4UQCA 3QC0A 2QULA 2Y8KA 3WDJA 4O0ZA 3VOHA 3WLSA 3BAIA 3V5FA 1UJQA 5JUVA 3NQ6A 5HQLA 1N82A 2ALDA 2WLYA 1Q6RA 1LL4A 2KX9A 2QDHA 4A29A 4PTDA 4FX8A 5CQ1A 1MO0A 5D8WA 4DNHA 4FMVA 1ZJAA 2ADAA 1GQIA 4MWAE 4GFIA 3O07A 5FIPA 5IOBA 2WM1A 2J47A 5IFTA 3TYUA 1Z48A 4H2HA 1GGOA 4FS9A 3SIZA 2EJAA 1BAGA 3UYIA 4A8LA 1Q3NA 3Q37A 3LGGA 1C92A 1JDDA 1W0MA 4RZBA 2BG5A 5CSRA 1XIHA 3TWAA 2GWGA 2IKIA 3QY8A 4GQGA 1M7PA 4LS2A 4J4KA 1W9DM 1X8CA 5I23A 1LOSA 3QYQA 3RAOA 4W5UA 3PZ9A 4ZQPA 3BQ6A 1VPYA 1OFQA 1AH3A 3N14A 4FX6M 4CLMA 2G3NA 4DM1A 2PRHA 1UH2A 3V75A 4PCSA 1LYXA 3CHDA 3H23A 3STPA 4L64A 3L4WA 3QFWA 1AZ1A 3AU6A 3W37A 4TX8A 4AW7A 4GI4A 3F4VA 1YBQB 2CBUA 1V6UA 3OBAA 3WK3A 2Z7KA 3ZOAA 3PSWA 1RUSA 4EX4A 4E3VA 3BGAA 3LENA 3KW3A 3PB0A 1Q5MA 1V77A 3BG3A 1DP0A 4URIA 1A0CA 1QMLA 2CEQA 3OLIA 4WUIA 1HJQA 1RJPA 1HO4A 4I3GA 4ATWA 4HPHA 1JDEA 1YBQA 3AXXA 1VHCA 3AIQA 4GZEA 4MHBA 1GOKA 2F6UA 3KRBA 2Q09A 1CB2A 4JFTA 4Z2KA 3OGRA 1WDPA 3FGCA 4QTGA 4MZ1A 1ZBVA 1DIDA 3QSTA 1CX9A 3VIFA 1I1XA 1JCNA 4S3BA 3SADA 1MZRA 2PLCA 4UNLA 1CYGA 3DDMA 4KBXA 4AIUA 4DBSA 1EYEA 2H8XA 4NHVA 1BFNA 2XN1A 3TC3A 1JPIA 4ZL1A 3QH2A 4GI6A 1TPWA 4HIBA 1XIGA 2QDEA 4DJDA 1S46A 1RQHA 4LBSA 1T7LA 2GQ3A 2V67A 1Q7ZA 1L6SA 5E9XA 3GS6A 3KL3A 3M47A 3W86A 2Y5JA 1AODA 3KRSA 2E3ZA 1KA9F 2O0TA 2V30A 2XM2A 2FLIA 5J8LA 1DPMA 3EX2A 3T05A 3W2KA 4KWWA 1XBZA 3NCOA 3SAZA 1SO3A 4P7OA 3W28A 1ADOA 4FLRA 3WMSA 3VIGA 4CNTA 1PWMA 1QI0A 3SY8A 1JF6A 5AYBA 1UQZA 3QHNA 2DIKA 3WLRA 2PUZA 2VZSA 1U83A 5HJXA 4PMNA 1N7KA 1JZ6A 1PX3A 1R38A 2B7QA 4RL3A 1F3TA 4DUVA 4JPGA 1R46A 2QJGA 2OX4A 1XL9A 4JTTA 4H8HA 2FGBA 5LGZA 1UUOA 3E2QA 4L6HA 2NQHA 3S1UA 1DORA 4AY7A 3C2RA 4WRHA 3I3BA 4NSBA 3TYAA 4ZZ9A 4PEEA 1D3CA 2VVSA 3EA3A 3G1DA 5XIMA 3HPAA 1Q85A 1WAWA 3IVSA 3W38A 5TD4A 2FB2A 1VS1A 5BCAA 2PDCA 4Z2LA 3VKJA 2YCLB 4P8XA 4M1RA 4FK9A 4GQQA 3TYBA 1AH0A 1IEQA 5A69A 1VKFA 4BA0A 3N4EA 3RM4A 4V27A 4AIBA 4DWSC 1PZ1A 2XIBA 1DJZA 4ADUA 4I9AA 4AYGA 1FWIC 2ZIDA 3MT1A 2GZXA 2Q01A 3ENLA 4TU1A 2J7HA 3BAJA 2GQ9A 5D33A 4LUJA 3N2TA 2YCLA 3G1FA 3IJ9A 3GWQA 2CKRA 1E4LA 4BQ2A 2PDJA 1ISWA 3RPDA 3SUTA 3E96A 5I7GA 3MU7A 3S46A 5MKGB 3W7IA 3GW3A 5AHFA 3ITTA 1AJ2A 4IMFA 1I1WA 3SGZA 1IEVA 3FYYA 2V5CA 4ZOEA 3UFYA 2P8BA 3OO2A 4FXRA 3TW9A 5KZMA 3FS2A 1X98A 3NWRA 4PMJA 3UGVA 4AZIA 2RDTA 3O6DA 2NW0A 2OYLA 3TJLA 1ICQA 3PAJA 1REQA 2PMQA 2CYGA 1FDJA 2DZUA 5MKGA 1W1B1 2IXVA 2V3FA 1UMYA 5CCZA 1TV5A 3LLFA 2J25A 4PUJA 2WHKA 1YXDA 2CHNA 1JCYA 4MADA 1A4LA 3Q58A 3PTKA 4CCDA 2EPHA 2FDSA 4D72A 2TAAA 3N13A 1K6WA 5JIPA 1QOQA 3CZKA 4AZ5A 4E5TA 1BG4A 2VFDA 1H7PA 1GJPA 4I8YA 2XN0A 3ZVIA 1XSIA 5LIYX 4Z2IA 1KM2A 3UJRA 2PWVA 2X1IA 4BF7A 4DNMA 1CXKA 1V6YA 6CGTA 4OZOA 1IV8A 3LPGA 3VKBA 4MB5A 2VEIA 2QPSA 1F73A 1QI3A 4ZQOA 4RV8A 3BAKA 5EPDA 3S2NA 1PCWA 5EGRA 3P81A 4AVFA 2VDHA 1XLDA 3NQAA 4GQRA 1OJXA 1C29A 1J18A 5ABTA 1EZ2A 1K8ZA 4UFJA 3CUIA 4N02A 2FQIA 4ZO7A 5BRQA 1YNYA 4JKMA 2X40A 3GR7A 3RITA 1M53A 2EPMX 3VIJA 2GVLA 1RY0A 4WCJA 1LQ2A 1OIMA 3XIMA 4JIRA 4YXGA 4YHGA 4PMQA 5DX7A 2DZSA 5AY7A 1UD8A 3OA5A 2DW6A 5B7YA 4NZ5A 4AZGA 3B03A 1HKJA 3UCCA 4ILSA 2QCGA 6TAAA 3A6OA 3SCVA 4ZO6A 5EA9A 1GWJA 3WNOA 3CASA 4AQLA 2OVLA 2NXGA 2MUCA 3GVWA 1HFBA 5BMWA 4HVXA 1PYFA 3DG7A 4AD5A 4C6JA 5DN1A 1L6WA 1TG7A 4R7JA 1OEPA 2VZVA 1KFEA 1OT2A 1H49A 2MNRA 4PMVA 3GDBA 4PMRA 3WLQA 1V6XA 2PCEA 3WMBA 2YL5A 1IGSA 1S5TA 2ZDRA 1GVOA 3OGVA 1D7FA 4FOKA 3BMXA 3UWYA 4FI4A 1SJBA 1W1A1 3W85A 3IS4A 3T09A 2DDXA 1V0NA 2Y7GA 4H3DA 2HDJA 4WDWA 4NRSA 3AXIA 5I07A 3P93A 4RR4A 2YDSA 1TV4A 5EYWA 3VNZA 5G4EA 1KFCA 3H24A 4KCUA 3KBMA 5CJNA 1UC5A 3VUPA 3CZEA 4D6JA 3DFSA 2D0GA 2FHFA 3STCA 4CCCA 3B0VC 2R9RA 1PIIA 3PF3A 2PCQA 3AYSA 1QOXA 1SSGA 5IBXA 1QR7A 1XQLA 4H9UA 4W7UA 4XB3A 2I16A 3DFHA 3DI0A 2Q3RA 1OFPA 2QAPA 4NVTA 3W27A 4MGGA 1R3QA 3LMZA 3KTSA 4K8EA 1P7TB 2VJXA 4XSLA 4X9YA 2YLAA 3PBVA 1MW1A 4JFUA 4RV3A 4DJFA 4M6QA 1P1XA 3OIXA 2DV0A 5HMEA 4OGZA 5EMKA 3EWXA 3RLHA 1V3IA 2PWDA 4BI7A 4A2SA 4IZGA 1N55A 5D09A 1EC8A 1P7TA 3R1ZA 4ERGA 3TN5A 2OOGA 2WW5A 1LLZA 3BW2A 3KX6A 4JHOA 4JTFA 1K6AA 1EWEA 1IEWA 2WVVB 4EF8A 3JZUA 1LQAA 3XINA 3SCRA 5KMYA 1R2RA 1U33A 1L0PA 5JBDA 4HZMA 3KXQA 1GTHA 3AWNA 4HOWA 2OR2A 1QNQA 3M0KA 3LERA 4KERA 3EMQA 1XLHA 5D37A 5FF0A 1HGYA 2QJJA 3N34A 3U9IA 4A21A 4XAPA 2F84A 4O10A 3TNOA 2RDXA 4Q4OA 1UA7A 4CVUA 2WVVA 3AROA 3PVFA 1XKYA 2WVTA 1ZQ5A 3ATYA 1SGJA 4XBKA 4WKHA 3IGSA 3K46A 3VYLA 4PB5A 3VVGA 3KDOA 4AZCB 2YFOA 4X2RA 4AMAA 1FXQA 1TMQA 5C55A 5AVHA 1R8LA 1LRQA 4HMEA 4AB4A 1XP3A 2AGTA 4TMCA 2P53A 3C0JA 2QJMA 2WMKA 3BGGA 1E1CA 4JQ4A 1PZ2A 4Y96A 5HWMA 3HV9A 2Z00A 1W1IE 3VX1A 1H50A 4AZCA 1BWVA 1RPXA 1GYMA 3URAA 4FNSA 4XV0A 1B1YA 1ZNNA 4RUBA 4DJED 2NSXA 3AC0A 2VD8A 5I3HA 1HJWA 4EE9A 4C1LA 2BDQA 1LZOA 1BQGA 1GTEA 1SPQA 5I3IA 5C70A 2O7QA 3M5YA 1ESWA 3WJXA 2VX7A 3R2GA 4A6GA 3M1ZA 1N8WA 1IF2A 3PBYA 4QDMA 4OOUA 4DF1A 4LVBA 2FZBA 2PDPA 4Q8WA 1ZY9A 4W8LA 1TTPA 1EC7A 3A22A 4IPJA 3UWWA 4PCPA 1X97A 1OQFA 3CPRA 3PULA 4P2VA 3O06A 3SCWA 3C56A 1ZCOA 1ITUA 3QJAA 1XM3A 1XYMA 3T0DA 4JN7A 3P67A 1Y5VA 4Y8EA 1VFFA 3HA1A 4UZUA 3ZJKA 4YJ5A 1LF1A 2G3FA 4Y2WA 3W2LA 3W6MA 1QK0A 3ZXWA 2BVDA 3FHQA 1QPRA 2DT1A 4W86A 4J28A 4F48A 3I7SA 4CD5A 3RLVA 3MSDA 2VTFA 3CLWA 4M0XA 2PF8A 2BXZA 1QU4A 4H7ZA 2A3CA 1LRTA 3DFYA 4Z2GA 5LIWX 3L4VA 3T44A 3R12A 5HNRA 1TE6A 1GJWA 1XLGA 4DY1A 1P0DA 2QUNA 2PDUA 3ME3A 4U5KA 4QXIA 1OG6A 1QW7A 2FZDA 2NQLA 2ZRZA 3NL3A 3E2VA 4ZE4A 4Q4PA 3CQKA 3NL5A 3G0UA 4G1NA 5DELA 5DBUA 1YKWA 1OX4A 1PZ3A 1X6NA 2WBGA 4G2DA 3KTCA 3T8QA 3DC8A 2G37A 1G4EA 1U1UA 2YA0A 1SMAA 4CNUA 3S47A 3R8GA 3IACA 3C3UA 1JQVA 4F3HA 4FA3A 4I5UA 1MQPA 1UWTA 5FEXA 2W62A 7PTDA 2ZXDA 3U6WA 4XKYB 1YTDA 3RU6A 2XGBA 3O6CA 4JY9A 3HMCA 2QF7A 5HDRA 4MNKA 2PDQA 2ISDA 2BOEX 3W7QA 3F2BA 4NJJA 5HMFA 2ABAA 1XKJA 3LCFA 3WF2A 1DTUA 4LCRA 5FL1A 3D0CA 3WJYA 2F2HA 4EVZA 2WJDA 1IZJA 2CIPA 3QPYA 3E2RA 3V0SA 1I9CB 3QPEA 4XKYA 1A5OC 4RDWA 3GYEA 5J04A 3ARUA 2GGEA 5E93A 3G24A 3EOLA 2PDGA 1OGSA 4IM4A 3FA4A 2PWUA 2ZXQA 3EPNA 4MB4A 2NZLA 3ABRA 4C1KA 2E6AA 2CESA 1WP6A 1OCNA 3M5XA 1M65A 3N6JA 1UZDA 3ORWA 5GJPA 5FL0A 2A21A 3WD4A 3W76A 4D6FA 2YL6A 3C2OA 3K4DA 5AVNA 3MS8A 4I5RA 3QV9A 3ZIZA 1UWRA 4TVUA 1EP1A 3LI0A 1XH2A 1XCFA 2E5CA 4JTEA 4YVVA 3S83A 3FVDA 3UZWA 1XX1A 1WOAA 1I45A 4A3UA 4IGHA 1KXTA 4MZ8A 5AC4A 3TE9A 1RVGA 5FEPA 2FDMA 4B90A 4QEEA 2E9LA 2PB1A 2XVNA 4DLMA 3WH7A 2WPBA 4R27A 4JTDA 3GHRA 4JYFA 3PJXA 1H51A 1M5WA 3N2BA 3ABQA 3HOJA 3W1AA 4E2OA 1CXIA 2OJPA 4B5VA 1UR2A 3NA8A 4GX9A 1J2BA 4LUYA 2BVYA 1GVYA 3ZLFA 4WSJA 2JEPA 3FCPA 4DWSA 3ABXA 1JZ4A 2QZRA 3WNPA 4S23A 1XYAA 5D2TA 4W8BA 2Q8LA 1IZKA 4EAMA 2ISWA 4J5NA 4IUOA 2X2GA 1L9WA 3AJ7A 2PP3A 5AC8A 2RDUA 4UFHA 2HBVA 3W7MA 1L8NA 2F61A 4RW5A 3S1GA 3L66A 4KGLA 2YOCA 1WOBA 1YE6A 3IRDA 1JAKA 1QATA 3PG9A 5DT7A 2PDNA 4XD3A 3W26A 1ONWA 2ZX9A 2X42A 3FVMA 1EJ7L 4FR1A 1W5OA 4PCFA 2J79A 3VIOA 3W81A 1XIDA 3THAA 4ERIA 4HNCA 1UMLA 2GUBA 2I5QA 2DZVA 2GUYA 2ZC8A 4KKXA 4LRSA 4HBKA 2WQPA 3T0BA 4R3UA 1HGWA 4M29A 5D2YA 4DBUA 1GG1A 4YCPA 2Q71A 4G5DA 4RK8A 3EXTA 3VIKA 1GOOA 4JDBA 3UY7A 1WBHA 1PO9A 2JKEA 3R4IA 5DFAA 2EPOA 3LCLA 4EPKA 1H2JA 1HW6A 4BS0A 1KQZA 3WIJA 3VDHA 1I60A 3GFZA 2X09A 4JL2A 4ORMA 2VGFA 3UPMA 1OADA 2W79A 2UV8G 3A5VA 4PMOA 3IJIA 4NX5A 3MKCA 1EWDA 2UBPC 3PZMA 4ZFMA 1UBPC 1QHOA 4MTVA 4HPNA 3LCXA 1CXHA 1XQKA 4F0MA 5FJTA 2EEXA 3IK4A 1UKPA 3RDKA 1FWJC 1C8YA 1IT7A 4BK9A 1KM5A 3V4BA 4DHGA 1XI3A 3VCCA 3B8SA 4XG1A 5FEWA 4F4RA 1H5VA 3SGUA 3ARRA 3PFMA 3TA9A 1VBJA 4PB3A 3FAXA 3AICA 2AQWA 4OIFA 4GE8A 4CU6A 1XJBA 3IARA 1TPH1 3W73A 1ISVA 2PS2A 4RNIA 5LIUX 4BHYA 3W87A 4Q8UA 2PD9A 2YZ5A 1S5NA 1FHLA 1ITQA 1FWSA 3R13A 1NFGA 3U2EA 1R9ZA 2A4AA 4K1WA 4Q4RA 4WSHA 4NUWA 3F2CA 4JEJA 4K68A 4H4IA 1EXPA 4JTHA 5FJIA 5LNRA 1F05A 2ZRUA 5BW6A 2QUVA 2JK2A 3KRUA 1B3VA 1Z7AA 3GNXA 4S3GA 1V3HA 3PY2A 3TCEA 2PGWA 1KGWA 4IFOA 2O4QA 5LXEA 1KM4A 1EL3A 3CT2A 2ZWYA 1TRDA 4MWAB 3H8AA 7CGTA 3WUEA 3H54A 3WSUA 1H5YA 4NZ1A 4W9TA 1EGMA 4ASTA 3TN4A 1JXKA 1CTNA 3GE7A 1RP9A 1NSJA 3M7SA 4IIEA 3DBNA 3KM8A 4AG0A 1A5SA 5H8MA 4GD0A 4H9MA 4MWAA 2G8ZA 1NFPA 1Y8BA 4LUTB 4GACA 4AD2A 4Z2JA 4B3LA 2VCCA 1XSKA 2BFGA 2GWNA 2ONEA 5FF3A 4HN4A 1GORA 2PU0A 4QE4A 3PBGA 4RE0A 1RCOB 2IMRA 2A1YA 3HQ1A 3N25A 4GKLA 4IF2A 4HMNA 4MKVA 2DVTA 2ZRXA 1WNOA 4JNMA 1TJ0A 5A6JA 2WNQA 3FIGA 3W7DA 3CV7A 4LUTA 3ZSTA 3ARPA 4L6DA 4JX6A 3NZRA 3WDHA 1JUBA 3CO8A 2OEJA 3OLGA 2UY4A 2FH8A 3ABSA 3W7LA 2QT3A 1YNQA 4B91A 4WZHA 3AALA 1J96A 1CECA 4LVGA 1IGWA 3T9PA 3N17A 4CEUC 1JG9A 4NJHA 4BWLA 1YE4A 5BROA 5I24A 3QR3A 1GOIA 4JAWA 1QUMA 4HSNA 1UZ1A 3NQ8A 2XH0A 2F38A 2VX6A 4ZR8A 1Q6CA 3AU2A 3CQHA 3IWPA 2VEMA 4H9TA 3IIVA 4J3UA 3GG7A 4MNLA 3TTYA 4QG6A 2P3EA 4H6EA 4A3RA 3WH5A 1P1MA 1Q8JA 4WQ6A 2E28A 1DWGM 3DCPA 4QISA 3AYVA 4JS3A 3HURA 3FLUA 4HZ7A 3BSMA 3V0UA 4DAIA 3MI2A 1BXNA 1I2QA 6XIMA 3QC3A 3BARA 1H60A 4GVFA 2NQ9A 5C9RA 4MOZA 4GH1A 5AZ1A 3BCFA 1BXCA 2VZOA 4XAGA 1WKEA 1XH0A 3L0NA 4JHMA 1C8XA 1K77A 1VPQA 7TIMA 3AMDA 3GXDA 1UROA 2ZZ6A 4I7VA 3UEQA 1RCXB 3OU8A 3IGHX 3IVUA 4UQAA 2J7GA 3NXLA 2RDWA 1K70A 3GQYA 1QI2A 4C6KA 1MW0A 3BAYA 1QJWA 1V4YA 3LMYA 4RJEA 4ES4A 3VTRA 1SJAA 2OKTA 2DZPA 1LQ0A 3E0IA 4RLIA 5LSMA 1UKSA 5CSUA 1KW1A 3MPGA 2HPMA 1TIWA 3EX3A 1R3TA 4MKNA 3H4WA 1W8GA 3Q65A 5I03A 1B4KA 1VYRA 1YXCA 5D9NA 1LDCA 1U1HA 1PTGA 1A0DA 2HSAA 4WKAA 5FESA 3MI6A 3VX0A 1HT6A 1S39A 4F2BA 4UFMA 1XIEA 1OINA 4MAVA 3EDFA 3R0DA 1J93A 4XZBA 2W63A 1AZ2A 3MV11 5T91A 1TX0A 1M03A 4KEVA 5AHNA 3OJGA 1AQMA 3AIEA 4Q8QA 5I09A 5BYWA 3M5ZA 3QQ0A 1UD3A 1MRAA 1Q63A 2IUZA 3U5UA 1SO6A 3WNLA 1XR2A 3I7QA 5EBAA 1HJVA 3A4WA 4LALA 2Z1VA 5C9WA 2IS7A 1W9UA 3W74A 3B0PA 3PBMA 3SUSA 2GDUA 1F07A 2WKJA 3C61A 5EBUA 3UR5A 1B9ZA 4GRSA 1TSIA 3VD4A 2BP1A 1NEYA 1E6NA 2D73A 4CQ9A 4R88A 3UF9A 3IIOA 2VT0A 4JN8A 3RRXA 2G41A 3MHGA 4MJZA 4AH7A 1XIIA 1NM9A 4JX4A 2AL1A 5K3VA 1KV5A 3K4WA 3L12A 4UR9A 1QPKA 4H9VA 3B0XA 2ZUMA 1Y0EA 1L2QA 3N73A 3GKFA 3VGBA 5REQB 2DIEA 4MY8A 3MJMA 4QP0A 1HJSA 3L68A 4DF2A 3H70A 2FTPA 2VELA 4LCQA 3NOYA 2XWEA 3R5EA 4C6DA 3I4KA 4JFWA 1FBAA 2V5DA 1GK8A 1YIXA 1O4UA 3VOCA 2Y0FA 3QTPA 1Q4NX 3L2MA 4Y9MA 3FA3A 3PM6A 1QWKA 4HHPA 1UP3A 2YB1A 4P5UA 4LUIA 3TQPA 3CLMA 4WSKA 5A2BA 2XSAA 2BV9A 4S2BA 2WHMA 3BJFA 1K03A 1ZAJA 1XDJA 4Y7EA 4AX6A 1K1DA 3PK7A 1RD6A 1XRVA 1K8XA 1V6VA 1TVPA 3TK7A 2XFFA 2OO0A 3QQWA 4J1OA 2D0FA 4J2MA 4BZYA 1SJCA 1PTAA 1UKQA 3EBVA 9CGTA 1ZS2A 2Q6ZA 4XKMA 5DQPA 3TA6A 3TIMA 4GLEA 4AWUA 4DZAA 4PBFA 4NILA 3DYMA 4YTUA 2XDFA 1XLFA 1MNZA 4DYJA 4ZE5A 5M3WA 2XFWA 3R58A 4OE7A 5K9XA 5M17A 3DKLA 1E71M 3WNMA 2IPFA 2XIQA 4JYDA 5BWAA 4HK6A 1K3UA 2V2CA 3ARTA 4N42A 3M0XA 4GUHA 3NM1A 4K3ZA 3WQOA 2FVMA 3IANA 1R87A 1TV3A 2NVDA 4FO4A 5LHFA 4AU0A 3FY1A 3R8HA 3LU2A 3CV6A 3L4ZA 3R11A 4HOXA 3DH7A 4GYPC 3QXBA 3TN3A 4WOZA 3WBEA 1JD9A 2I1OA 4PUMA 2EKGA 3LM3A 5C54A 1KFWA 3NPUA 1EH9A 3OEXA 1VFOA 4K36A 4LVAA 2HBXA 1FWEC 3I68A 3G1AA 4IMCA 4OBRA 1QTWA 4IPNB 2HK1A 1X8FA 3CYJA 2V69A 5CGQA 3GX9A 1XIFA 4Z1DA 4FNTA 1XLBA 4AAJA 5AHLA 1FCQA 1TPB1 1V93A 1R3RA 1JL8A 2X2YA 1E0TA 3TLLA 3VPLA 2YGYA 2YA1A 2JF7A 2JALA 1X7IA 3BANA 3WD3A 3T0CA 2XINA 2DQWA 3K13A 1C90A 1GEQA 3F1QA 1H1ZA 2BY3A 2VFHA 1PZ0A 1EJWC 2ZBTA 3G77A 1TO3A 4C65A 3NM3A 1LCOA 3W23A 6ENLA 4KGJA 4MNJA 4RNHA 3UR2A 4UQEA 4B5NA 2XSXA 3OODA 2E7FA 3NQMA 4JQ1A 3HJEA 1NIUA 4INFA 5IRPA 1PEZA 4HU0A 4DVOA 1TVNA 1DWIM 1ZP4A 3W7JA 5GJNA 4DO4A 1YMYA 3T8LA 1TTJA 3MYOA 3P61A 4JIQA 3BICA 2ZUUA 3IIXA 4A22A 5D2XA 4LB4A 4ENLA 5B7ZA 4AWTA 3VOJA 1W1ZA 3SURA 1PKNA 3MI3A 4PR4A 2QW5A 1OWQA 2EG6A 3E9AA 4ZSUA 3B9AA 3WBYA 3FFSA 2XZ9A 3I6TA 1U5HA 4M6VA 4CNOA 2ZRWA 2C7FA 3GNDA 4UTTC 4XZWA 1TQJA 1IYXA 1FWAC 2WSKA 3S5OA 5F2MA 3PUGA 1NFBA 5T8GA 3OW1A 5ECUA 1S5MA 2QCDB 3S5YA 3VZYA 1NWSA 1FHUA 1SW7A 4D6IA 1M9HA 3RG6A 3TQKA 3SQMA 1ZSXA 1EX5A 1W9BM 5C2XA 3SCPA 3BDKA 2XH4A 4RE4A 3TSDA 5EL1A 3S42A 1XDMA 3DYPA 1VB9A 3KOYA 1JZ7A 4D8LA 4WGHA 2Z1SA 1JZ5A 1ISXA 3W3OA 3ZJ8A 2QCDA 2AL2B 4YN5A 3PNUA 1UZHA 3LPFA 1ZJHA 3ZWSA 1P4CA 4JDYA 4UTHA 2AQOA 3QYSA 1MXGA 4GA8A 1F4HA 1WUEA 1RBOB 3B4UA 3MA8A 1KD0A 4X3ZA 1PDZA 2YXXA 4LV9A 4O13A 2AL2A 3SFWA 4EANA 4GY7A 4HYWA 4JICA 3U2OA 3NQEA 4I6KA 2FZMA 2IQDA 3BLEA 3CIWA 4O0QA 3IGUA 1M6JA 2NWRA 3MSRA 3ZSSA 1NP0A 2PDXA 1S1RA 3O16A 4Q7BA 3TAKA 1A3WA 3UCQA 4ADTA 3DKJA 1J9YA 1P48A 4B4FA 1OVDA 4KEUA 3EWUA 1WXYA 2ZQ0A 5M5DA 3EA1A 2ZRVA 2YCEA 2LLEA 1FRBA 3LK6A 4A8IA 3MKKA 3NURA 1HVQA 1W3HA 3RM9A 3BW3A 3EDEA 1EDQA 4S38A 2XIMA 1F3EA 5HANA 3KVJA 3UJEA 1SM9A 1CGVA 2FHCA 1FOBA 2YJQA 4UFIA 3W07A 4S3KA 3WLJA 2OMAA 2PP0A 1OX6A 3UXAA 3FN9A 4HPGA 3ARZA 4QS5A 4DF0A 4Y8FA 3STEA 4C6OA 4KH2A 1TUFA 4WGXA 4C90A 4GJ1A 1BPLB 1QCWA 4OJYA 5KINA 1GVRA 4Z1YA 1MEIA 2OZ3A 1KLYA 2DJXA 2DT2A 3V7PA 4D6GA 2Z0IA 5PTDA 3H7RA 1CB7B 2FZNA 1KBBA 1QPOA 3N04A 4LU0A 1I2RA 3SN4A 2A6NA 2WNWA 1W1TA 3W7HA 4GO8A 4US5D 1UR1A 4ZMGA 2VEKA 4EIVA 1CLVA 3HF3A 1P6WA 2GGJA 3HQOA 3CO4A 3T42A 2P3ZA 3HPXA 3R7MA 5CLWA 3LHTA 3G8EA 3FA5A 2XIJA 3C52A 4EPEC 4MVAA 3S2JA 4O1CA 3KAOA 3S2LA 4HTYA 4EF9A 4JKLA 5FAJA 4HZ8A 3LRKA 3A47A 5IFPA 3TAOA 3PBWA 5A94A 1DJNA 1E1FA 1PDYA 5FOOA 1P43A 5G1YA 1H62A 1EYWA 3LGEA 1I75A 1YDYA 5DXYA 1AW2A 5IDIA 3KZSA 4HCDA 3NZGA 4MB3A 1QFEA 2E5BA 4XD5A 3RX3A 5CGTA 4HHMA 4LFYA 3BPWA 4OHQA 4HT3A 4JTSA 1J5TA 2GOUA 2J9ZA 2XGZA 3H21A 5GVJA 4LX4A 4GIAA 1U1JA 3W1NA 2ZUVA 3MUZ1 4B5XA 4HMDA 1A53A 5I2UA 2V2DA 1JULA 2CWNA 2CLIA 2G95A 4OWGA 1VBGA 4RX0A 1J5SA 3PJWA 4FNPA 4RPPA 1JYXA 5E0CA 4Z1AA 1FKXA 4IXXA 4QNWA 2PPGA 3ARWA 2ZA2A 3ANUA 1M7OA 1NDYA 3HGSA 2OELA 1O60A 4LS0A 4C7DA 4GABA 3JRKA 4IMEA 3OQ8A 5I79A 4H2CA 1XLMA 3V5CA 5HXMA 4U2ZA 5A2AA 2PGRA 1ZAIA 1AL7A 1YPFA 1WV2A 3DHFA 2D20A 4PSPA 4A8RA 1G4PA 5E6YA 1AG1O 3QMTA 1FH8A 2ZZ1A 4L9ZA 2OSXA 2BGNE 1EIXA 2WV8A 3NL6A 4IMAA 3AHYA 1NDZA 3URNA 4RKAA 4IJRA 2BS9A 5DY3A 4LAUA 4HCLA 4L4MA 3NQCA 2YXOA 4IPIA 2WZHA 4GJIA 4PULA 4LOCA 4KIEA 1WKDA 3RU8X 3FJNA 7XIMA 3OBEA 2KAUC 3GHTA 5CPMA 1G5AA 2BY2A 4CCEA 4DZ5A 1NQKA 2OOFA 3GO2A 1C93A 1B4EA 3RX4A 3DECA 4MFDA 1VFMA 1XRFA 3TFXA 5J5DA 3WKZA 4PMDA 4CU7A 4O4VA 1CGXA 3PZQA 2W67A 3KS6A 5KEZA 4GUIA 3H2FA 2WSPA 2AOSA 3KOXA 4K1GA 2CXEA 4P7RA 2HQAA 2FVLA 4GO9A 1G69A 3EWYA 4J7RA 5JU6A 1UBSA 3CMGA 4L4LA 3PNZA 4UUIA 3UG4A 3HZ3A 3Q67A 1A5LC 2OLSA 4YYFA 4H9YA 2HE8A 4I6VA 4MDPA 4XQ6A 1SO5A 3LBCA 3TN6A 1PXGA 4GZIA 2D24A 3K30A 2FTWA 1FKWA 1MQRA 3LM7A 2ZUWA 2X05A 4C7GA 1S2TA 4R85A 1UR3M 3L7RA 5CZTA 3HPSA 2O56A 3PUDA 2HNEA 5CC6A 3NDYA 3TROA 2BXVA 4LGXA 4ECLA 2X0YA 2OQHA 5BNKA 2WVSA 2YYUA 4KWVA 3WQ5A 3NPVA 5JBFA 4TQTA 7ENLA 5H8UA 5AN7A 1LBMA 4AWEA 4DJDC 3W75A 4GYFA 2QNEA 4GY1A 4D71A 2VVNA 1I0DA 3DI1A 4ZQRA 1KBKA 1RA5A 4NZ3A 3KBJA 4M1BA 5BOEA 3MHUA 2ZX8A 4L56A 1R9YA 2C79A 2KZHA 3U57A 2OZ0A 2FYMA 2F7FA 1T8XA 1A49A 4J35A 2VC7A 3A4JA 2H9AB 5DCEA 5L6UA 2YXGA 3T2QA 1QW8A 1TCMA 4ERAA 1J11A 3HPZA 4AC1X 4IQJA 4KT2A 5D8ZA 1FTXA 4FOJA 1MW2A 1FWFC 3VM5A 3UG3A 2ASHA 5LHEA 4IJCA 2H90A 2W0UA 3B8VA 5GNZA 3ID7A 1BYDA 3LOTA 3LRMA 3W71A 3ES7A 2H9AA 2TYSA 3WEOA 1FHVA 1MUWA 4NXKA 1XC4A 4BF9A 4JCLA 3T1GA 4PRWA 4QX4A 5KETA 3TU9A 4IX2A 2XVKA 5JQ9A 5L9FA 3VD7A 2A3EA 4GYPA 1JCTA 5A6BD 3GVVA 3P82A 3BMVA 4U5IA 1XYBA 4PRRA 5HA7A 3ZWTA 5FA5A 1MVYA 3VDBA 1WDWA 5CXPA 2YKKA 1ONXA 1PCKA 2ISVA 1UIOA 4MY9A 1WZAA 1EF2A 2NLIA 2JGQA 4GIYA 5LKYA 4I7WA 4LC8A 1G7VA 1W3TA 3I6RA 4TO8A 2FJUB 3EDKA 1XIJA 5HNUA 3E0LA 3PS7A 1GVFA 3K4AA 4ICCX 3QSRA 5FJRA 1S2CA 1DJHA 2FGLA 2WZEA 3LN3A 2PC4A 4Z2HA 4C6IA 2BX7A 4B4HA 5DANA 1BF2A 3GNPA 4MAZA 1P0KA 3N3MA 2VENA 3SRFA 3RCYA 1TTIA 3KWXA 2FZ8A 1J12A 1UD5A 3GD6A 3VKAA 2HK0A 1EDTA 2BASA 3AZSA 3GIPA 4W85A 1K4HA 2VGIA 1A5MC 4M56A 2Y8UA 2VURA 1KFLA 4UTLA 3LI1A 1HX0A 2Y70A 3BV4A 3GM8A 2GL5A 3NQ7A 4JXCA 2WSYA 2X41A 4C6PA 2CPUA 3GZAA 4JFVA 1NU5A 4CUCA 4J27A 3LUTA 1Q6QA 4WJEA 4R53A 4IIDA 4CD6A 3UY8A 4QHRA 3GIYA 2NT1A 4MNMA 3IEBA 2QCMA 1RZMA 3BGJA 2B7OA 2VM8A 3V0TA 5FJUA 3WUBA 4JOMA 3KBWA 2J8FA 2WNZA 3BVJA 1R2TA 2R1PA 4UFKA 3IUHA 3L0GA 1PVNA 1U5JA 3CHFA 3KBVA 2XIIA 4O12A 3LNPA 1I4NA 1RXOB 2I9UA 1B57A 4DLFA 3M0YA 4GC3A 3UJSA 1HQTA 1TPFA 3NYZA 2QAFA 1PKYA 1JIBA 5I6SA 2TPSA 2CHRA 1KXQA 4LYPA 5BOFA 5FEZA 3Q94A 2CKSA 4R7OA 1ICSA 2VR5A 3WZ0E 4U10A 3L65A 3VGGA 1H0IA 5IXEA 4YTRA 1TPVA 1XGDA 3DHUA 1DTNA 1AFSA 1KRBC 1QPQA 3M43A 4GZ7A 2E8ZA 1C91A 2JBMA 2PODA 2XUCA 3LXAA 1BKSA 3QF0A 4YTQA 3GXIA 3B40A 4IG2B 3W7CA 4EAYA 5KZ6A 5AZ0A 2NXHA 2WJZA 2AGKA 2EQDA 1XH1A 3P0WA 2PBOA 3LLXA 4IX0A 5DY2A 2JFEX 3CTTA 4JIEA 3CUXA 4P61A 3WEZA 4JBRA 3QW4B 3SEPA 3KCOA 4IG2A 2V2HA 1XUUA 3CAWA 3M0IA 4RDZA 1SZFA 2NV9A 1VRXA 1XLLA 1QHZA 4IIFA 4L9YA 4WXYA 4ZBCA 4N9DA 2X7WA 2AMGA 1HL2A 2GSJA 2F8QA 3DU0A 3E3HA 1HXJA 1T5AA 1CXLA 2OYMA 2DVUA 2PGEA 5AC5A 1AMKA 3GSMA 4LAKA 4DB7A 4OV9A 2TRSA 1ADSA 4YCOA 5H8PA 3W82A 1EQCA 2FHBA 3TJXA 1R47A 2CBVA 2XFYA 3PWGA 4KESA 3T0AA 2YBTA 4BY3A 4H7VA 3GB6A 1A5CA 1ALDA 4LWWA 1QDSA 1S5WA 2EAWA 1KM6A 3EOOA 4UB9A 1V0MA 4K8HA 3M0JA 1WCGA 2NQ5A 4Q6JA 4XAFA 4BQ3A 3PUEA 5HQMA 3KE0A 1EB3A 3SR7A 3CQJA 3EWWA 2Y85A 2PTWA 4A3QA 1AVAA 5IBXC 3L9CA 1AA1B 1HP4A 2ACUA 2R91A 4DXXA 1ZLPA 1J0ZA 1XYZA 3BQ5A 4HNLA 4H41A 1AQ0A 4LY8A 1WB0A 2G3IA 3UZZA 1DXIA 3A64A 2ZUTA 3QHMA 5BU9A 3EWZA 3RILA 3APYA 1A5AA 1Z41A 2E5DA 4JKKA 3E6EA 2WXDM 1IR2A 3C2EA 1BTCA 5CPNA 2ZICA 2W91A 4DJFC 1C9WA 4WDTA 3QV6A 4AY1A 1G4TA 3GG1A 3EX4A 2QV5A 2QPUA 4GKTA 1I2PA 3S9YA 4O8RA 1EX1A 2IKHA 3RMEA 3NOEA 1XBYA 1E6ZA 4IFKB 2VOMA 4IMDA 1E0UA 4J3VA 5FF2A 2GUUA 1K9FA 1NWUA 1KBJA 3U8GA 2YA2A 3GXPA 1M7JA 3U4FA 4CCZA 2RUSA 3LPOA 4H19A 4S3FA 2J9YA 2B4GA 4LBUA 1AW5A 3DC0A 3GTXA 4O1BA 2VDGA 3I65A 4HU3A 3WK2A 1R3VA 3Q45A 9XIMA 2ZKMX 1PWLA 2Q02A 2PF0A 3B4YA 1TPDA 1PUDA 5CAHA 3PP7A 3GG0A 4ZOBA 3ZZ1A 4AISA 1RK6A 4CNSA 4MM1A 2VGGA 4KWOA 1E72M 4Q4KA 1A4MA 5D38A 2XH7A 1A5KC 4OUIA 1TREA 5D9MA 2A79A 1E9YB 3LV6A 3CUZA 2FB3A 3NSNA 4AF0A 1ML1A 4B5SA 4XWUA 4Q32A 3SRKA 4L4OA 1DJGA 7ODCA 2CU0A 3A24A 3HTWA 5BZAA 4J3XA 4MLRA 4Y6GA 3WNKA 2C18A 3W0KA 5BXRA 1F3XA 1G1YA 1W8SA 4AHQA 4YTSA 3JR2A 3H7VA 2G50A 3TW7A 3AUJA 5CJ5A 4JN6A 5HOSA 5KSWA 3H2CA 1OABA 4O0KA 3UWEA 4QLKA 4UTJA 4IP5A 4NAFB 4GFSA 3FYOA 3ATZA 4OQVA 3ABZA 4KCWA 2VFFA 3WH6A 1EEPA 4FNUA 1Z89A 3AOFA 4ZENA 1G67A 1KO0A 3NAVA 1IHIA 4AIOA 4NQ1A 4HOZA 2XISA 3E02A 3LHYA 2XIOA 1IWPA 4NYUA 4DBDA 4NAFA 4C6QA 1GQLA 2Q3OA 1XIMA 3BLPX 4JEQA 2PDBA 1K8YA 4NXSA 1A50A 5CH9A 3TQVA 5A1AA 4MDOA 3WL1A 1OD0A 3HQNA 3ITCA 3SM0A 1US2A 3UD6A 3BXWA 2F9RA 4HYRA 1PB0A 3S1WA 1DJIA 4MB1A 3IIZA 4OKDA 2W4XA 4B3ZA 1VCFA 3QZAA 1YEYA 4A35A 5FACA 3A3XA 2P0OA 1SW0A 4L6OA 2D3LA 3XISA 2VP8A 2EPKX 4KIRA 1YDOA 2CLOA 2R82A 3C6CA 3JVAA 2PDHA 1FX6A 2Q8ZA 2ISFA 5BMXA 1E9LA 3BL3A 5IM51 4R5EA 5H91A 1YQ2A 4QS6A 1Q7QA 1D3GA 1ODZA 5MHBA 4B5UA 1JI1A 3FOKA 4LJ3A 3DFNA 4XZMX 3WF0A 2ZCGA 3HN3A 3CQ0A 4I9TA 5A3HA 3PPGA 4RPQA 1O95A 1K9DA 1XUZA 4O17A 4H8UA 4AXNA 3SI9A 1JRBA 1CXFA 3GBEA 3N6QA 5CG0A 2WC7A 3WQDA 4J40A 3N2CA 2XJ7A 3ZS4A 2Z6IA 2FFIA 5CZSA 2WMJA 2QV4A 4ROQA 4AUBA 4DI8A 7TAAA 5E0KA 2Y1HA 4XTIA 1S5VA 1O5XA 2E6FA 3WLTA 5JH1A 3P5YA 3AYTA 4JTCA 1RK5A 3W1TA 3MDUA 1IT0A 4M82A 1FWHC 1WZLA 4NNCA 4UFLA 4UBPC 4CN1A 1VIWA 3BURA 3OVPA 2E77A 3E5PA 4H9ZA 4B2DA 1TE1A 4H01A 2HZGA 4G1KA 4CEXC 2OODA 5CBIA 1NF7A 3OP2A 3F5LA 1ECQA 8RUCA 1BGGA 4JNZA 2JKAA 1J0JA 1C8QA 1NJJA 3DGRA 2REQB 1MFUA 1LLOA 1BTMA 3DFPA 4GNKB 3F4CA 4P7NA 1ME9A 1TJ2A 1HF6A 1R7OA 1ME7A 3UVIA 1W2VA 2W5FA 3WENA 1OFOA 3T6CA 2VC9A 4Z42C 4Q4SA 2VCAA 1KXHA 3UYCA 5TNVA 3W6LA 1WO2A 5BWFA 1QXLA 2J27A 3W7NA 6REQB 2F6KA 1WYIA 3HQPA 3SCOA 4N6FA 1LROA 3FHAA 2REQA 4KRUA 3G2GA 1K7FA 3TKFA 1E40A 1EDGA 3U7VA 4ALDA 2WCAA 2NX9A 3P0XA 4RW3A 1UOZA 2Z26A 4UTIA 2VNCA 3Q4DA 1PS9A 4FF7A 4E38A 6REQA 5C7VA 2WZIA 2PZ0A 5CC3A 4CVWA 2ACSA 1GHSA 4LH8A 2J8GA 1O68A 3R43A 1MYRA 1OYAA 6PTDA 4XVDA 5BXTA 2NQJA 3W1RA 3ITGA 4PA8A 4LB3A 3L5MA 3RR4A 3SUVA 1V3KA 4H6QA 2D2JA 2X0SA 2BHZA 4NU7A 4JCMA 8TIMA 2GGIA 3POHA 3AMKA 4QR6A 4YS1A 3BCDA 2DSKA 4R33A 4K7VA 1ZJBA 3H2MA 5HPOA 2G3MA 4PFMA 3CZLA 3PFRA 4XTDA 1XS2A 1Z32X 4GXWA 4IL2A 1KWGA 3GDTA 2EJ1A 4WJ8A 3VCRA 2I56A 1GYLA 1DIEA 1Z8AA 1S2UA 4WIWA 3BCJA 3IJDA 3U7BA 1RBAA 3ARXA 1C7SA 1X1ZA 1QBAA 3KVLA 3IGXA 1W5PA 1GW1A 4WF7A 4DX3A 4Q8NA 3LSBA 1T99A 4K6AA 3LCGA 3H6OA 2PP1A 2PDMA 1BHGA 3KDNA 2YCJA 4GK8A 5A8QA 3UA4A 1GYNA 4Q4MA 2E8YA 4IGMA 2B81A 3REQB 3ALGA 1DOSA 3EDDA 2IPWA 1SSDA 2WHJA 3KHDA 4IGSA 5I3KA 2H3DA 3QBUA 4NAEB 4IGNA 4AWSA 5DCDA 2EG8A 4X61A 1XCWA 3GXMA 3F2DA 2QQ6A 1WPCA 4D8ZA 5DBTA 4O53A 1ZFJA 3VNKA 4QAWA 2QMJA 3GKAA 2A7RA 3REQA 2QMKA 2DUAA 2A85A 4A3YA 1OGBA 2OO6A 3MDWA 4XSMA 1UH3A 2O7SA 3AS3A 3WFAA 4NAEA 3NQBA 2C1GA 1GEHA 3GDLA 3OVGA 4EPBC 3P62A 3NSMA 3EEGA 3AIBA 3TUUA 4W84A 1VCGA 3SCUA 3HJZA 1IT8A 4Y9PA 4KFNA 3LTPA 1QPNA 3B97A 3NUKA 4XZLX 4DO7A 1XXXA 2V5KA 3V16A 6XIAA 4I7UA 3UZYA 2YZRA 1GT8A 3GR8A 3LD5A 4PC8A 4D6HA 2UWFA 1H3GA 4UR8A 1OX5A 4C6MA 3QRHA 1BKHA 2ZA1A 5BRBA 2XN2A 2VUYA 1GVIA 4O1DA 2VX5A 2A2IA 5TQLA 4BCEA 4PMXA 1XD1A 3LDVA 4D6EA 3KL0A 4S3CA 2PRLA 3BK0A 5DEZA 1DV7A 4IIGA 4X2PA 1VC4A 3TH6A 1PKLA 2YW3A 5CSYA 1XLJA 3LLDA 3GFYA 4C6CA 2AKZA 4WLCA 4RXGA 2BOGX 1XISA 2YSWA 2R1LA 2J8TA 4NZJA 2VC6A 4TR9A 3M0LA 1E43A 1QVBA 3BLFA 3CBWA 3W2UA 1I8JA 2PTXA 2C15A 4GNVA 3MCNA 3LTSA 3P3BA 3AXMA 1WDRA 4HYVA 4HZ6A 4DI9A 1TTQA 4ZXLA 2YCIX 2FIQA 2F2KA 3E38A 2GQ8A 3W2NA 3LHUA 5G2HA 4S3AA 4H83A 2CBJA 3CU2A 1FFQA 1JFXA 1X6UA 4LANA 2R94A 1E0WA 2Z1BA 3W6YA 1XDLA 3PTMA 1T96A 1WDDA 1OF8A 2E68A 4HHLA 4BEUA 3ANVA 1HKIA 1VENA 4DPQA 4MWAC 4AX7A 4E8CA 5TIMA 4EWND 3AHVA 3RFAA 1EJXC 4LY4A 4LNYA 3RHGA 5E0FA 4ICMA 1AQHA 1KGUA 4RZ6A 3T2PA 1J10A 3BJTA 4LXFA 3VKCA 3OVQA 1W9XA 1L6FA 4GY0A 5M1TA 4LT9A 3N2OA 4JR5A 3N12A 3QV8A 1R9XA 2VZTA 1PE1A 2QCLA 4UZSA 4ZB5A 3KS5A 2QCNA 4CU8A 3COTA 4ZTYA 1F61A 1W3JA 4JGDA 4OBTA 4JL1A 4C7FA 5A5WA 3WD2A 3CB3A 1CT5A 1VF8A 4QFUA 4BWLC 3OHMB 2WMIB 4GUGA 4MIMA 3QFEA 3L4XA 1UPPA 5D2WA 2V81A 2JE8A 2X1RA 4QGCA 3D3AA 5EKYA 3H26A 1RLDA 1IXPA 4XVEA 2P76A 1L8PA 5FF4A 4L1WA 3M6YA 2WMIA 1TV7A 2X1UA 3CWOX 5CPQA 2Z25A 3P5ZA 3L0KA 3WBWA 3ZR4A 3WLNA 4K37A 6A3HA 1EPVA 1SZRA 1XFBA 4HTBA 2Z4GA 3UG5A 2PSNA 1Z69A 4LEQA 1K7EA 1VLIA 3EXRA 3GTHA 3CAKA 2HMCA 2ZZ3A 4NY2A 4PUWA 1DIOA 5C2GA 4DJDD 1EA9C 3MJYA 5D30A 2RAGA 5F4SA 5FCZA 1FWDC 3H12A 4ZODA 1FWRA 1X39A 3IAQA 4N9EA 5G4HC 1BRLB 5HMDA 4DJEC 4KRTA 4JQ3A 5EFDA 1EJUC 1GKQA 3GK0A 1GW9A 1JCMP 2HJPA 4XAZA 3LQGA 5HR6A 4UTKA 5EMUA 4ROPA 1R2SA 2QXWA 4MSSA 4O15A 4US6A 4TX9A 1BRLA 3EDJA 4D1IA 5DCBA 1Y5WA 4IHCA 2Z24A 2PBGA 2J6VA 5AHMA 1B3XA 3F4DA 2XTKA 4YTTA 1TFVA 2ZVRA 3NG3A 3SJNA 3QOKA 4AHPA 3CL8A 4O18A 4REQB 1R6WA 3K8MA 3ZT7A 1GOWA 1PIGA 3V1HA 2V6AA 3M0VA 3WDQA 5C8BB 1QRQA 3GHUA 3ZO9A 3C0QA 5G5IA 2CLMA 4UMAA 3LBOA 3MUXA 3F03K 3R10A 4PTMA 3B9DA 3TMQA 3WH8A 4C6EA 1H63A 4REQA 1ME8A 2XH2A 1EP2A 3UESA 5LNVA 3PZIA 1W9VA 1O7AA 2WO5A 3VC6A 2X8RA 4FR6A 3WG6A 1JCXA 3DX5A 3BOXA 3PZGA 4ZGYA 2JKPA 3CMFA 3R0KA 1J0HA 3M4HA 1QNVA 1UW9A 2W3ZA 4R7WA 1QO2A 1FWWA 3MP3A 1THFD 3PC0A 3THDA 3T7VA 3GXNA 1EJVC 3UW6A 3QV7A 3SUUA 1LTDA 2D1ZA 3MYPA 3SRHA 4F8XA 3M6DA 3RLGA 1RD5A 3SY5A 5GQBA 4M24A 1SFLA 3TTOA 3WCZA 1SR0A 2AQVA 3QEZA 3NL2A 5D05A 4BEQA 4WXZA 4ML9A 3WDRA 2OEMA 3F4NA 3SN1A 1EO7A 1GVEA 4MYAA 2VX4A 3CL6A 1E6XM 4PUDA 1CENA 4P7QA 1EEXA 3A4XA 4GBUA 4UNIA 3O3RA 3W7EA 3LCIA 5HULA 4KW2A 4E2BA 5XINA 1F5ZA 1W91A 3TC7A 3QKEA 4V1XA 3T2OA 4HA4A 3C8FA 3MSYA 3LXBA 1GZGA 4W7VA 2ZVIA 2GDQA 2PLJA 4IWWA 2OYKA 2XZ7A 5HWNA 3BMWA 1W3IA 3S1XA 3BOFA 4GGBA 4MPQA 1NH6A 3MP5A 1FWGC 2DQXA 4ICNA 3N1AA 1HIZA 2DPEA 5I00A 4G7EB 2RFGA 4LTSA 3DFTA 2OQLA 3R25A 3GYCA 1F8MA 1W2PA 3S1VA 1JZ8A 3IIPA 4GI9A 3TNBA 4MKSA 2G0WA 4GQ0A 4CN6A 4AHOA 5E6ZA 2OLAA 4TMBA 2WWDA 3VKDA 5SWUA 4PTVA 3OLDA 2E1WA 3HBLA 2HXTA 4G7EA 4XO6A 2I5IA 3UG8A 4KFPA 3MMWA 2DIJA 3OYZA 4V1YA 1R5YA 1GG0A 1F8IA 3PG8A 3RJXA 2WYSA 3M44A 3WH9A 2X30A 3CEUA 5G4WA 3M9YA 2WOQA 4O8AA 3K8KA 4U31A 5B80A 4EXBA 1H7OA 1E6QM 2XG9A 1OY0A 3TXVA 3WJWA 3NIYA 1CLKA 3B0UX 2E25A 1OFRA 1D7KA 1RBLA 1W5NA 2CLLA 2GVEA 3CAQA 3D46A 2ABBA 3TV8A 2NVAA 3SIMA 2E6DA 2DSUA 3VNJA 1S3TC 3T55A 3NYDA 5FJPA 2FPTA 1BLIA 2ZUSA 4RZ4A 4PE8A 3E0VA 4QIUA 4NNAA 3LG3A 1O1HA 3HB9A 3DIPA 4GBDA 4JTRA 3WQEA 3L21A 3TC6A 3VC5A 5CZKA 2DGAA 1UKOA 2HNHA 1R3SA 4Z08A 3C0SA 3EKGA 3DG6A 5CPOA 3USBA 5FF7A 5I0DA 3N15A 1QT1A 1B0IA 3BOLA 4AY8A 1V5XA 4WDUA 3CM4A 4ZA0A 4HKPA 4E4UA 3DGBA 4YWIA 4E4FA 2IKJA 3DESA 4E3TA 5DMMA 5ABFB 2V68A 1F3WA 1FCUA 3SN0A 1UASA 2Q8XA 3MV01 3GH5A 3UGRA 2NVCA 4CN4A 1G7UA 1F2JA 3UNTA 4C5YA 2QCCA 3A3WA 3RPTA 3IVTA 1YRRA 1E3ZA 1KCXA 3T07A 1ECEA 2PI6A 3A12A 4OECA 4K38A 5ABFA 3FAWA 4FXSA 3LNMA 2DW7A 1V03A 4BQ4A 2D2HA 4C91A 4G6CA 1BVZA 4XBJA 2WJEA 3A13A 1UR8A 3NDZA 5DMNA 3UA3A 3L5LA 1DXFA 3P80A 1VFTA 2D0HA 4FXFA 3SSZA 1DE6A 4Q8TA 1K4GA 1B3OA 1TWWA 2G4JA 2ODOA 3EOUA 3VNDA 5A6AA 1KBIA 3VD3A 4LUSB 3WLIA 1UP0A 5C9ZA 4DJFD 1U30A 3HG3A 1J79A 3OZMA 3P6LA 1UKTA 3W70A 2VI0A 4V33A 2IQTA 1JXJA 4EXQA 4HCHA 1JR1A 4DRSA 1VHNA 3VXGA 2ZXBA 2WWCA 4LUSA 5G1TA 4LPCA 1UYQA 3GNOA 3QTGA 4ATLA 1A0EA 2CHOA 3BG5A 1Q65A 1VFHA 3GU9A 1VEOA 1LG2A 1XPGA 3H2OA 4C1NB 2DZWA 2J9XA 4UTWA 4BQ5A 3ISIX 2IKGA 2XVGA 1YADA 1YX1A 2Y24A 3ARSA 4UQBA 1A3XA 1ITXA 4KQNA 1VPXA 4IJBA 3MMUA 4O11A 4D6DA 4L80A 5HATA 3ITYA 4E0CA 2Z27A 1GCYA 1RV8A 4C1NA 3O0FA 4HA1A 1NOUA 3W9ZA 3QGAC 4LYRA 4TTUA 2C1HA 4XUGA 5F7UA 1JDFA 1JCJA 1RJRA 4ZB0A 3IJ6A 5F4WA 3A9BA 3M07A 1SJDA 3MVIA 4O16A 4KS0A 1UZ4A 3WMLA 3B8IA 5A6TC 1BGAA 1XRSA 1DL3A 3CT7A 3MBFA 2OGYA 4Y9AA 4JIPA 4EP8C 4X63A 3JW7A 3CIXA 3ECQA 3E5BA 4U3CA 2GLKA 4LAOA 1XYLA 3M0ZA 1LBFA 2ZA3A 3WO8A 4QJ3B 4HPXA 3OVRA 5A8OA 3STFA 5HQEA 3TZNA 4XZ9A 2HPIA 2PDKA 1EGZA 1GZJA 4MJ4A 5K9CA 3PANA 3QLDA 3VZXA 1XG3A 3N3TA 1YTEA 3N9KA 4X60A 2PDFA 1Q13A 1EPXA 1F9CA 5CC5A 4UMCA 4WY0B 2BTMA 2PWFA 2W61A 4PSRA 2RJGA 4V15A 2JEQA 3W00A 1OZMA 1VP5A 3F5JA 4Z17A 3EEZA 2GDVA 4JTUA 2J4GA 4PTXA 5G1MA 1MWOA 2HTMA 2E9BA 4FEZA 4LQ1A 4KWUA 2C14A 2RJHA 2V5LA 3ZMRA 3LCHA 4GH3A 4WY0A 7A3HA 2ZX6A 3QN3A 1KCLA 3QVQA 3GC5A 3PZNA 1TWSA 3WELA 5CAKA 3FGCB 1X38A 3W24A 3T40A 4AYSA 1DQUA 4FB7A 1XBXA 2QS8A 4PCNA 1F7BA 3PWAA 5H2ZA 4R9OA 3CC1A 5LYRA 1CWYA 1LORA 5JVLA 3P7YA 1OK6A 4QSFA 1KR1A 1XBVA 3CZ8A 1X1OA 2Y5SA 4HQVA 3USZA 3HG4A 1V51A 3KTXA 4TTGA 3VDCA 2WCGA 4C60A 2V3DA 4M7TA 1OC7A 1FQ0A 3QPZA 3CPGA 3TYCA 3DHDA 1KRMA 3EKZA 1B31A 4HPJA 5JXQA 4NJKA 3V18A 3URBA 1G01A 4GVIA 1ZBCA 3MKVA 2BGQA 3MP4A 3EGJA 4NIRA 1YYAA 3W1MA 4J3ZA 1IE7C 5ECVA 2HVNA 4PGLA 3GAYA 4KETA 4L65A 2C0AA 4Z0JA 3VMOA 4DQWA 3V5OA 4F0HA 2FGZA 3NO5A 3TOYA 3LZ3A 2OLHA 1J0KA 1MNSA 4BR1A 5HWJA 1J4EA 4J9JA 5D02A 4Q4QA 1HKKA 3TSBA 1E70M 3GU1A 4X0VA 4JYEA 3SFKA 5FI8A 4AEEA 5DMLA 2CWXA 4F79A 5E09A 3VI2A 3ITOA 1OBAA 2QJHA 2H8ZA 1PBGA 1E51A 1D2KA 2IXUA 1BSLA 2ZWZA 6ALDA 4GHRA 2DZBA 1S2WA 2HV5A 3ZYZA 8XIMA 1JPHA 4NRRA 5A2CA 2VRJA 3OOQA 3CAVA 4F9DA 4C6BA 2OEKA 2AAMA 4FLSA 1CLXA 1TJPA 2BVWA 3TMLA 1KC7A 4CD8A 3CZGA 3GNNA 3KBNA 1U2YA 3TX9A 3WQ4A 3ARVA 4D8AA 3WJSA 4DJEA 5CG7A 4ONVA 1AJZA 2WMGA 3WLPA 3PTDA 2A7NA 1TPEA 4CNPA 5JBEA 1UB3A 1H7WA 1MMFA 1LOLA 4LW7A 5HJYA 2HXUA 3B8WA 2NSOA 4GPNA 4LCSA 2QLYA 3SW6A 4DBEA 2DZTA 1FCVA 4WX2A 1B9BA 3L5AA 1KXVA 4JQ2A 2CNCA 3P74A 4NZCA 3WQGA 4JTQA 3CQIA 5GNXA 1TKKA 4IFRA 2DSZA 1WZKA 4WY0F 2VQTA 4IPPA 1PV8A 3BE7A 1TPC1 4DYKA 4AVNA 2OCZA 1UPMB 4OU1A 3SJ3A 3CYVA 3DG3A 4JFSA 1CZ1A 1LBLA 3VGHA 1REQB 1SZNA 1E4IA 1ZJIA 4TX6A 3B3DA 3H2AA 4HK5A 3TTSA 5F2GA 1UJPA 5ABEA 2NXIA 3PAOA 1Y7VA 2GFTA 3W01A 4Y90A 3WBXA 3GG8A 2YL8A 2D23A 4OTKA 4AZBA 3ITXA 2EPLX 2QGHA 3NO1A 3G6MA 1XFCA 2WLZA 3QGKC 2NQZA 3H22A 1ISZA 4C6LA 4M80A 3EYPA 4DWSD 3LSCA 2UY3A 1TQXA 1P0NA 3QKZA 2CCRA 4I8DA 4PUKA 3EOSA 2GYIA 3GLCA 3GXTA 3CH0A 3CK5A 4W4QA 3G1XA 4NYYA 3K1GA 1UOKA 4H00A 2D3NA 2PU1A 3N19B 3P60A 1QBBA 3NFUA 3M0MA 1J0IA 4FX7A 3S6TA 3VD5A 1RSCA 1CGWA 2H6RA 1W1PA 3PZVA 1WUFA 1Z3NA 3W7RA 3FKKA 4BJHA 4HNUA 3VU2A 4NJGA 2E9MA 2J77A 2QF8A 5DF0A 1R86A 3T0TA 3LPPA 3PPFA 2EXOA 3LHZA 1GPFA 4HU8A 2A3AA 3T78A 3WDIA 3LX9A 1W31A 4OVXA 3S0CA 1TWZA 3EB3A 1VLWA 3WUGA 1ZP3A 5REQA 1O6IA 4XISA 1VAHA 3L67A 4TV6A 3NR0A 1AL8A 2BVTA 3TOPA 3QLLA 2QKFA 3CHVA 3T4CA 1O94A 3S5SA 1CI1A 4AZ6A 5D04C 4KPLA 4NZFA 2IPJA 1LL7A 1PHWA 2PD5A 4QITA 4RDVA 1QW9A 3LYEA 2Y5EA 4Q8PA 3UR7A 5LA1A 4Z0SA 3ALFA 2Y4SA 2DVXA 1V6TA 1AK5A 2QDDA 1FWNA 3KRZA 2WZMA 2PURA 1ZPTA 1FUYA 4XZIA 1XLAA 3T4WA 4MG4A 1XF0A 2JIEA 1XW8A 1T41A 2CLFA 2Z1XA 3AIVA 3IV8A 2OX1A 3AAMA 4L61A 1E6RA 3IRSA 1OCQA 4LNCA 3RM8A 2C13A 4JHZA 5H1WA 1JD7A 3UJ2A 5AKQA 3U3HA 5LNUA 3KUMA 1IEIA 4H8NA 3FJ4A 1DQXA 4Q7IA 4B3KA 3N11A 5KTLA 1TV8A 4JX5A 2CETA 1FXPA 3U4AA 3TYZA 4QEHA 1LT8A 1ONRA 1KBLA 4L7ZA 3CUHA 2V0TA 3D3FA 2ACQA 1NVMA 3MB9A 2PFHA 1JQXA 1VR6A 1OFAA 1POKA 3VINA 1HG3A 4PTWA 2VFGA 3W53A 3KEHA 1VBRA 3L4UA 3S9IA 4NI3A 3BLKA 1ZL1A 5GPRA 2GGGA 5T9CE 4POCA 5K4ZA 3CV2A 1XD0A 1NOWA 2YDQA 2XU2A 1KRCC 2Z29A 4UR7A 3G1YA 1B5TA 2Z2AA 2PWEA 4MWAD 4NI8A 5F2LA 2ZXAA 3ICJA 1FH7A 1DE5A 2BBFA 4QJ5B 3N2MA 1XICA 5DRIA 1B2YA 1JUKA 1WBJA 2PWHA 1LOQA 3RIKA 1GKPA 4O1EA 3TXZA 3EA2A 1R3WA 1JGMA 4H9XA 3WQVA 2V9DA 1EUAA 1VH7A 3GXFA 5T9BG 1GQJA 5HAOA 4KWSA 3EX6A 4F66A 3EX1A 3LCWA 5DMYA 4RNFA 2BZNA 4FIRA 1E73M 4MF4A 1IXQA 4D9PA 4PBGA 3TLQA 4HD5A 5CGMA 4PTNA 2PLKA 1SR9A 4V28A 4FAMA 5A8PA 1HNYA 1RQEA 4YVXA 4GQBA 3JUGA 5A6SA 4IT1A 1E6PA 3GVGA 1MI3A 2R14A 3NEHA 3G18A 1XINA 1NTHA 3KBSA 4O50A 4AD0A 2O9RA 3N4FA 1E1CB 1GOQA 3BUVA 5LNSA 4H7CA 3V1PA 3KL5A 4GUFA 2PC8A 3GTNA 5CBBA 1UR4A 4GZJA 5K2ZA 4HJFA 3LQLA 5D9PA 2BHUA 1HVXA 2XVLA 4JQAA 3H55A 1SVDA 2UY5A 3CV1A 1MEWA 5D2VA 2OSWA 3MUCA 5HUPA 4FALA 3BO9A 3S3GA 4OUEA 3B8TA 3CS2A 3GFXA 4LBRA 3VNLA 1Q7MA 2GJPA 3C5QA 1AW1A 3I10A 4PUUA 1D8CA 4B92A 3R6IA 1H7RA 5AC7A 1V02E 2YLLA 3CB8A 4ZVJA 3VILA 1RQBA 1GPWA 4GCXA 1HL8A 2E4TA 2Y2WA 2TODA 3NJ3A 4HSHA 4G56A 1VYSX 2DSVA 3THUA 1CIUA 2IPGA 4CQCA 4JIHA 4WOQA 4HA3A 2ACRA 4GMEA 1MQQA 2FPYA 2DEPA 4HSOA 2Z28A 5M03A 1DHPA 4YHEA 4ORIA 5AB3A 3CIVA 1H0GA 3FEQA 3MZ2A 1BQCA 1O1ZA 2DH3A 4F0SA 1S2AA 2I17A 2VFIA 1FP8A 1A80A 4X9SA 2O9OA 2VZUA 5K9DA 3VZZA 4J3TA 3QZ6A 1NELA 5D32A 4FZIA 4PYSA 1LWJA 5AC6A 3TR9A 1JF5A 1LP6A 1OX4B 1K8CA 3VFCA 3NPWA 2CLEA 2E6YA 4LVDA 3HV8A 3TJ4A 3WQCA 2IW0A 3VDAA 1DJYA 1OHLA 4MJ2A 3E0FA 4KCTA 3G5EA 3MWCA 2FMNA 4ZO8A 1W1VA 3OZYA 3MY9A 1IXOA 3OQEA 3DN5A 5E1QA 4KFOA 3WQ8A 1I0BA 2A6LA 2ATSA 5G2WA 3POCA 3W1QA 2PAJA 4DAFA 2VL4A 3DHPA 1DHKA 5ABHA 2D2GA 2O55A 3VIMA 3CTLA 4D2JA 3FX4A 3AMGA 3SSJA 3ARQA 1BWKA 1DQWA 3RO6A 5D4YA 4IOTA 2CERA 1Q6OA 2VRKA 1PHQA 3PZOA 4CQBA 3F7JA 4FNQA 2XGIA 4FF5A 3W88A 1EOMA 3AHZA 4M8UA 1TRIA 2QPXA 3OG3A 1QHPA 3URQA 3D47A 4J3SA 3ZJ6A 4R34A 3B9EA 3IJ7A 4EK7A 2EGZA 1LRNA 1V08A 4WVXA 3S2MA 2WNNA 4PUNA 5DXXA 3UBPC 4I9JA 1KNWA 1H09A 1HN1A 3W2JA 8A3HA 3U2CA 4JTLA 4OT7A 1PX4A 4MFEA 3TW6A 3AHTA 1Q45A 2ATMA 4BFAA 1CGYA 3O6YX 2QVNA 1JYVA 2X0HA 3SBFA 3MCMA 2XVPA 1XCXA 2YB4A 4QJ4B 3W22A 4ACYA 1LG1A 2OFJA 2DSWA 2ZTKA 1AJ0A 4E8GA 5T26A 2GSEA 2QCHA 3AXKA 1TJRA 1OD8A 4H6KA 1UIPA 3MBDA 3BJSA 1IXNA 1UUMA 3FDKA 2VEGA 2BNJA 3AZRA 2BSLA 3MC5A 5A8GA 4FLOA 2PDLA 5E5CA 2J24A 1KWKA 2ZRYA 2WSQA 1TPUA 4AD4A 1Q6FA 2WSRA 4GNJA 4C6FA 3KZPA 5F4XA 3M64A 1DJWA 1VEPA 1TYGA 2AAAA 2CZVA 2DUZA 1WXZA 4DWSB 1TZZA 2BHYA 4WR3A 4X22A 5AYZA 4EOUA 1HL9A 5DO8A 2C71A 3T81A 1TA3B 4O19A 2PGFA 4O54A 1K7XA 4A3HA 2VR2A 2E67A 1M3UA 1PX8A 1RR2A 4TV5A 3WLKX 1W3KA 3EAUA 1SZGA 3INPA 3S8HA 4KEMA 1CNVA 4U28A 1WKFA 4IPLA 3VIHA 1TA3A 1OSEA 1JDAA 2JIWA 3MMDA 2OWWA 1ADDA 5C6MA 3MSGA 1NF0A 2NX3A 4FP1A 3FSTA 3ZFHA 2Z2BA 1EJRC 1SFTA 1BF6A 1BXBA 3I6EA 4QAIA 5CZJA 1L2UA 4F0LA 3SQSA 3R94A 1Z6KA 1BG9A 4GWEA 1ELSA 3NEVA 3FEMA 4TVDA 2ON3A 1NWTA 1TR9A 2TSYA 2GSHA 2DORA 3TP4A 1S3HA 1B3WA 3FK4A 3C8NA 2Y63A 2J7EA 5EMJA 5BU6A 1O5QA 3SCTA 1JCLA 1MRQA 2WK2A 1FFRA 3OZOA 3AWOA 5E9AA 2YDAA 1C3FA 5CPSA 1KKOA 3GDRA 1T6MA 4B9YA 1BYBA 5AYXA 1EO5A 3WFLA 7REQB 2OG9A 2O92A 1QI4A 2ZADA 5U4NA 3HG2A 3SDOA 2WQDA 4HHHA 4XK2A 2BY1A 3VCNA 2WMHA 3NGJA 2PWGA 1CPUA 3G3MA 4UCGA 2GJLA 2DH2A 3ITVA 4XIAA 2C91A 1QOPA 1UG6A 3JS3A 3O8AA 1PL9A 7REQA 1QNPA 2YIHA 2HVMA 4E2DA 4QG9A 2J7DA 3DYOA 5K4XA 3C86A 2OSYA 3N18A 4JTIA 1E4NA 2RKXA 3L2IA 4PFHA 1KGXA 1UH4A 1E1EA 3TYEA 1EC9A 4QSHA 4DZIA 1UA3A 4OBSA 4Q6XA 3PWIA