2NLYA

Crystal structure of protein bh1492 from bacillus halodurans, pfam duf610
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
216
Chain Sequence
MKRAAIIIDDFGGDVKGVDDFLTGEIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEPKPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMRAILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSRKEVIKNMRKLAKKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divergent polysaccharide deacetylase hypothetical protein
publication title Crystal structure of hypothetical protein BH1492 from Bacillus halodurans C-125
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 70
structure length 216
sequence length 224
ec nomenclature
pdb deposition date 2006-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04748 Polysacc_deac_2 Divergent polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 2nlyA00
4NZ1A 1W1A1 2C1GA 4WCJA 4NZ5A 1V6TA 2VYOA 3CL6A 4F9DA 4NYUA 2I5IA 2W3ZA 1W17A 4NZ4A 2Y8UA 4M1BA 2C79A 2NLYA 4V33A 3QBUA 2J13A 1W1B1 4NY2A 3WX7A 4LY4A 5BU6A 2E67A 2CC0A 2QV5A 2DFAA 2C1IA 1Z7AA 1NY1A 2XU2A 4L1GA 1XW8A 3HFTA 4NZ3A 3RXZA 4OUIA 3CL8A 4U10A 3S6OA 3VUSA 5JMUA 4F9JA 2C71A 4NYYA 2IW0A 3CL7A 4HD5A
chains in the Genus database with same CATH superfamily
1ZCCA 3B9OA 1R2RA 2J88A 8XIMA 4C1KA 4EWND 3DFPA 1Z8AA 4JFVA 5C7HA 1S3HA 4DJDD 4XAZA 4O28A 1LTDA 1NF0A 2AQVA 2BWGA 2GJXA 1E72M 1T41A 4TOQA 2PDNA 5CJMA 1SJCA 1OADA 2VJXA 5REQB 2IQDA 3P3BA 4L6DA 3GG8A 3W01A 3VNDA 4EE9A 4QISA 3WMCA 4AZ7A 3TA6A 5DANA 3CTLA 2O92A 2E40A 5F7UA 2VX4A 4M0XA 1FH9A 2E1DA 4ZE4A 1EP1A 3N4AA 1UHVA 2DT3A 2PTDA 4HNTA 3ARTA 3C2RA 4XISA 4R34A 1KKOA 4FB7A 3SUTA 3CWOX 1F8IA 4BJHA 1UZ1A 1SO4A 3VX0A 4EPDC 2FGBA 3BMVA 4UOQA 3UNTA 5IRPA 4L4PA 4NZJA 3KCOA 3KRZA 1CGVA 1BVZA 1GPWA 5JH2A 1UBSA 1BYAA 3TXVA 1TZZA 4NF7A 4F48A 3C0LA 1B3XA 5A6JA 1HG3A 1XYFA 4M6QA 3N2MA 4W4QA 3E74A 8TIMA 1EHNA 5I00A 3WG6A 3PWGA 4NT0A 2BY2A 3SSJA 3ZLFA 3KVKA 4JTRA 2JE8A 3SQMA 3GQYA 4J3VA 4B92A 1XCWA 3L2LA 1M65A 4BFAA 1XICA 4IM4A 3QMRA 4CLMA 3P67A 4QITA 2DZSA 3WEZA 3IK4A 3W1RA 2H3BA 3REQB 1QNSA 3DFSA 4W93A 3R2GA 4E8DA 2NX1A 3BGAA 3LHYA 2PUZA 3DKLA 3CM4A 3GSMA 1U1UA 5CBBA 1HO4A 2I57A 1IT7A 3GNRA 1I2RA 5T91A 4QHRA 1IEXA 4DBWA 3PTQA 4YVXA 5I06A 6TAAA 4HSNA 3NQ7A 3ZJ6A 4CCCA 4GUIA 3GFYA 3LRLA 2V9DA 4FPSA 4RE4A 2VWTA 1GZJA 3VNJA 2BHZA 3W38A 3QZAA 5I23A 4H9ZA 2EPHA 1QPOA 4ZOAA 2XIOA 3VINA 1SZNA 2NQZA 5HQMA 3C3UA 4O18A 3ZZ1A 3NFUA 2E28A 5I0DA 2MANA 3GVWA 3ZIZA 3E5BA 1P43A 1UW9A 3ZOAA 4O4WA 1YDOA 1TFVA 1XDJA 4RZBA 3RR4A 1FWDC 1LOQA 2CW6A 1XKYA 5E9XA 3RO8A 3WDIA 4H9YA 3RMEA 1KA9F 2AOSA 4B90A 4E8CA 5HWMA 4NILA 3G77A 3PPCA 2IMRA 2TAAA 4OKDA 7ODCA 5F4XA 3NG3A 2I5GA 4D6HA 2JBMA 4E2OA 1C8VA 4NRSA 4PH6A 2J7FA 2F84A 4LH8A 2VM8A 2YA1A 4AD2A 3TTQA 3L23A 1E51A 4GVGA 4UQAA 1TSIA 3U4FA 3CAKA 1L6YA 3LBOA 4HT3A 3ABXA 2ZKMX 3LMYA 3BSMA 1XYZA 4EACA 4GC3A 1UG6A 4OBSA 1TTJA 2IPGA 5D9OA 4K7YA 5HMDA 2BFGA 4HD5A 5E0CA 1TCMA 1UR8A 4A6GA 3AIUA 2VDHA 1MDLA 2E9BA 2PP3A 3HJZA 3T78A 3QPYA 1XYCA 3W7LA 1VCVA 3KS6A 3LPOA 4J7RA 4W7UA 1UZDA 3CWNA 3C2FA 5D2WA 4PB4A 4XIMA 4E6MA 1R38A 4CVUA 1VFUA 1VS1A 2Y24A 3I3DA 1RHCA 1Q2SA 2PCQA 3ID7A 1I2NA 1XLHA 4X9SA 4DAFA 3AWNA 3MSRA 4JTUA 4IICA 3VIKA 4MWAB 4KETA 3G1YA 4EP8C 1QFEA 3B9AA 3LLFA 2EGZA 5CAKA 3N73A 1P5BA 2Y2WA 3PPHA 4JTTA 1KCZA 4H2CA 4ATDA 1B0IA 1TUXA 3MC5A 2YR1A 3ES8A 1US3A 4FLRA 1W91A 4WR3A 2C0HA 3AHVA 1F05A 5JVLA 3RLUA 4LTSA 5I3IA 1W1VA 4J3WA 3FJ4A 3SFKA 4GYKA 3M5YA 4PEKA 4JR5A 4OHQA 4ATLA 2ZADA 1NP0A 3DGBA 2BV9A 1MI3A 2VMFA 1OD8A 1E4LA 4ZCWA 1UUOA 3PF3A 1J93A 3T2OA 3JUGA 2BOEX 4B9YA 4S3JA 4GFIA 3ARPA 4R7JA 4LY4A 1F73A 5CSUA 3IVSA 3OO2A 3K4DA 3CQKA 4UZSA 5I6SA 1XLIA 4V1XA 1E55A 1K7EA 4CNTA 1KM4A 1TYGA 4S39A 1UIOA 3P82A 3UG4A 5M17A 4H9TA 1SMAA 5H8PA 4WUIA 3ZR4A 3GR8A 4P61A 1QW7A 2CBJA 4GCAA 5DY3A 1K8CA 4F0LA 2Y8KA 2Y8VA 1DJWA 2ZZ3A 2DSVA 3GC5A 4I5RA 1CXIA 2IKGA 1E6QM 1EC9A 1XH2A 3BAJA 1KFLA 5BRQA 3PZIA 3PUDA 4CQBA 2FMNA 3NZRA 2OCZA 2ZUVA 3NEHA 3IJ9A 1L2QA 2EPKX 5K2ZA 3PNUA 3VIHA 3NZQA 4BI6A 2HE8A 1U2YA 3MKCA 4HP5A 2Z1SA 1TV3A 4JYEA 4MJ4A 3A47A 1J01A 1GOXA 1ZBKA 2D2HA 1W9UA 4NXSA 4DQWA 1LF1A 1W3IA 3C6CA 3SADA 4A8IA 1B3OA 3G24A 3AIWA 4W8BA 2G96A 2VXNA 2ZA1A 3DN5A 4D1IA 5M3WA 4HCLA 5HXMA 4PC8A 1ZJHA 3EBVA 3W9ZA 3ZWSA 3LXBA 4M56A 2GZXA 1J10A 3VC6A 3SDOA 1GYNA 5CQ1A 4HYWA 4S3DA 1PB0A 1XBYA 4JYFA 4XWUA 1EXBA 1KBBA 1NEYA 4QEEA 3SCVA 4GHRA 3EWUA 1EIXA 4YYCA 2ABAA 3S42A 1R3WA 3WYZA 2QJGA 3J7HA 5LNUA 1GQKA 3HFTA 3BZJA 1CGTA 3VOJA 1OF6A 4ZVJA 3LA4A 1OIMA 1FOBA 2OYKA 4A35A 3RK8A 4XAYA 2CLIA 3LTYA 2OO6A 1E6ZA 3AYVA 3TLQA 2DZBA 2Y8UA 4AD1A 4B9ZA 5DT5A 2C1HA 4Q8UA 5CPOA 1G94A 5D02A 2TMDA 3BJSA 3LXCA 4FXFA 1OX4B 5LXXA 1F7BA 3R5EA 4TUFA 2V3GA 4LAMA 1EP2A 3TN3A 1KD0A 2YL5A 1E0UA 1PYMA 3L4VA 7REQB 1RP8A 4M7SA 4LW7A 2Y61A 5HUOA 2HBVA 2P10A 1E0XA 1RD5A 3KOXA 4U33A 4QSHA 3A3XA 2CWXA 4H01A 4PB5A 4G7FA 3L67A 4EK7A 3EXSA 3V5CA 3MUAA 4GNKB 2QF7A 3A12A 1F3XA 4IP5A 4U4MA 3LHUA 5GPRA 3WK1A 3A13A 3BURA 3T8LA 5AHFA 1A53A 4YIWA 4O11A 3PBMA 3C5QA 3UP8A 4J35A 1WO2A 3TLLA 4QX4A 3CUJA 3N17A 2PDJA 3UXLA 1JYXA 2J62A 1EF3A 1Z69A 1TREA 1HJUA 2JKPA 2V5KA 4IP7A 1I1XA 2ALRA 4E4PA 4H7VA 3P2VA 2BX7A 3LS9A 2G50A 2VEMA 2QUVA 2R9RA 3H2MA 3G22A 4GGHA 2YJQA 1W9BM 2VR5A 2ZUTA 1TPFA 2AL2B 3R43A 2WANA 3H2NA 2YDRA 3CMFA 4ZODA 3RLGA 3CMJA 3GDRA 2X40A 3U7VA 1ME9A 2QUTA 4K8EA 4IQJA 3MI6A 4NY2A 5BU6A 2PDQA 2JKEA 1ZJAA 3G1HA 1KRBC 2J9YA 3L5MA 3VKKA 2X0YA 2O55A 3RIKA 1RQHA 3KX6A 4MNMA 3LCHA 3OVQA 4C6DA 3NQCA 3WL0A 2WJEA 2PWFA 4UNLA 3MJMA 4AYGA 4A21A 2Z1WA 3MHUA 1TV5A 2XSAA 1F2JA 3C61A 2O56A 1TPEA 3GXIA 4PMQA 3S8HA 2EO7A 1UWSA 1NM9A 3GG0A 4DM1A 2VVNA 1YADA 1GNXA 2RHGA 2PDPA 1H09A 2PDMA 1TJRA 4GY1A 1KLZA 1JJKA 3C2OA 3H23A 4NQ1A 1HKVA 2WK2A 1EX1A 4K39A 5EKYA 4KFPA 4O13A 1ZUAX 4WJEA 1EUNA 2HWGA 5C2GA 2WVTA 3Q65A 1K6WA 3B3DA 1YMYA 3O06A 4G7EB 2CHRA 3EA3A 4CQ9A 1NH6A 4GI8A 1OY0A 2VUNA 5AYIA 4AVFA 2ATMA 5CZ0A 4IOTA 3WELA 1KM5A 3LZ5A 1OBAA 5BRBA 3G6MA 1FWHC 3ZLGA 2EPMX 2WQDA 2V68A 1E5JA 1XR2A 1QHPA 2OWWA 1LJYA 3KLKA 4MSSA 1ISWA 1I9CB 3GLCA 3GYEA 4L65A 4RNHA 1S38A 3FJNA 4Q7NA 1SW7A 1TB3A 4DF0A 4L9YA 4LRTA 4E2DA 4TR9A 2YCKX 4XKYA 3NZ1A 2HXUA 3MV01 3BANA 4IPIA 1XLMA 3HGSA 3EX3A 4BI5A 1OFRA 1VBJA 4MMWA 1EL3A 2VOTA 4NJGA 3N9KA 3VAVA 2W3ZA 3UR8A 1EO7A 4E38A 2ANUA 3KRBA 3VO0A 4GO8A 4D6DA 2ZOXA 3LGEA 1XW8A 1VB9A 4FLOA 3U8GA 1RR2A 1E1FA 3LENA 3WQFA 4IXXA 2Y89A 2OJPA 1PHWA 5CPMA 3TNBA 4M82A 1W0MA 4LAUA 4CU6A 1XLJA 1EKOA 3EWDA 2Z28A 4Q8PA 4AF0A 2WQPA 3NSMA 3GDTA 2G3IA 4REQA 3C0SA 1TVNA 3UR2A 3R79A 3KWSA 2HS8A 4C7GA 4PL2A 5DBUA 2BVTA 4IT1A 2V67A 1ZNNA 3TW9A 3R8GA 4H9MA 3C2YA 3G1XA 4PN2A 1GK8A 2DVUA 1H1NA 1P0DA 3RX2A 1O94A 2IUZA 1RH9A 5DXYA 1EUAA 4IQLA 3TYDA 4Y7EA 2J7GA 1ZS2A 4O52A 3LB0A 2P53A 4AVOA 3PUOA 4JTDA 1WKEA 1HFBA 1P0KA 4DUWA 2PE4A 1Y65A 5PTDA 1W2VA 1B90A 4D6IA 5IDZA 1WP6A 3DHUA 3CH9A 1BYDA 1LZOA 5FESA 4A3YA 4OIFA 5HNRA 1ODUA 1HKJA 3L68A 1JPHA 1OJXA 2DVTA 3K2GA 3P61A 2OOFA 4HHPA 3VGFA 1DJQA 4JD4A 4V27A 1JQXA 3FIGA 2PP0A 1BGAA 4G1KA 3LOTA 1ENUA 3MI3A 3D0CA 3IARA 6REQB 5FEPA 1RVKA 1XGZA 4MY9A 1G01A 1Q45A 1B5TA 1IGSA 1ITCA 2DSWA 1XDMA 3OGRA 1MDRA 4UTLA 4F4RA 3E5PA 1NWSA 2NSOA 2YXOA 1O12A 4KFOA 2C19A 4UTTA 2QPUA 3NVDA 1Y5WA 4FX6M 4ILSA 1JL8A 3PJUA 3NGJA 4UQEA 2PGWA 1RJQA 1XQKA 3T7VA 1XHGA 4L1GA 3CAWA 3S9YA 5AB3A 1TV2A 1ISVA 2YB1A 4RW3A 3VNZA 2G4FA 2QZRA 4BQ4A 4HJWA 5EYWA 5HANA 3CYVA 1W8SA 1Q5MA 1FWCC 3BV7A 3N14A 1WBHA 1U1HA 3TYUA 2BHYA 4AZCA 5LNVA 1RUSA 1NQKA 2GGIA 3MQTA 4IFKA 3I6RA 2OT1A 2B7QA 3AALA 2PGEA 4ZQCA 4IFOA 3WH9A 4KCUA 4YTTA 4Y8FA 2ZZ2A 2E9LA 3K13A 5GJPA 4H6RA 4S2BA 3QTPA 4C6PA 1C7TA 1V6TA 3PBUA 1KBLA 4DUOA 3QQ0A 3GC2A 5K4ZA 4J1OA 2V69A 4XD3A 1NFPA 4JGDA 4UBPC 1R0MA 5DRCA 5BOFA 1EJUC 3W6YA 5MF5A 2E9MA 3UJFA 4JFTA 1UOKA 2OWCA 3IJLA 4G9PA 4MFDA 2OT0A 4YVVA 2ZRUA 3APGA 2EPNA 5FAGA 2D2OA 3NPUA 2I56A 4QLLA 3B06A 3ZO9A 3M1ZA 4GYFA 1YNQA 2PDLA 2OQYA 4I7UA 3BARA 4XD4A 3PN8A 1XG3A 3T09A 2VR2A 1OSEA 3S2LA 1F5ZA 1E56A 1X1ZA 1KGUA 2X1IA 4B15A 4AC7C 4JFSA 2ZWYA 4GUJA 5HWJA 4HZMA 3SRDA 3EX6A 5CJ5A 4C6BA 3UGVA 4X0VA 2DZVA 3H2EA 2CEQA 2ZDRA 5HDRA 3VD3A 1JYWA 4XBJA 1ZHAA 2VGGA 4ICNA 3M64A 4B5XA 1R7AA 5FL1A 3EWXA 1L6WA 2J7EA 2VFDA 1L9WA 2WVVB 1SZGA 2FHFA 3LCWA 3P0WA 2QXWA 4DO6A 3ABOA 3KDNA 4IZGA 3AS2A 1GOOA 2NV2A 4QIUA 1TTPA 3IJDA 4LYRA 4JTSA 3EEGA 3EDFA 1GVSA 3QC3A 1UKOA 2QPSA 6CGTA 3WD1A 4K36A 4NU7A 4XAGA 1WX0A 1JRBA 2OEMA 2BHUA 1FTXA 4ACZA 1PHQA 2WZIA 4R88A 3MY9A 4FNPA 3SCSA 3SGZA 3CZGA 3WBXA 2J66A 1M03A 2YGYA 3L4YA 2WNWA 3UFYA 3UD6A 1EWDA 3M0IA 2Y4SA 2DZPA 4L64A 5JU6A 3UR7A 3EXTA 4JIQA 1IEQA 4Q4SA 5KZEA 4V15A 4CD8A 4ZBCA 4BKNA 2AMXA 4RR4A 2WWDA 3SCPA 2ZZ7A 2WJFA 4AIOA 1XSKA 4KWUA 2D20A 3UXAA 4N02A 3FA3A 4KESA 1VEMA 1Y5XA 4P2VA 3EOLA 5LIXX 1TPDA 4B5WA 4CEUC 3S0CA 4A2RA 2QV4A 5A6KA 2QMJA 3OP2A 2BODX 1GKRA 3ZLHA 2XN0A 2DZAA 4GVHA 4DJDC 5BXTA 3ANUA 1Q8AA 1LOLA 3WH8A 3H8AA 1XRSA 1JZ5A 3F4NA 3EKLA 1NFGA 1JG9A 2GK1A 3R8RA 1MQRA 2B81A 4YTSA 1YTEA 3FW6A 1R2TA 4N6FA 1RD6A 3UCDA 4QQUA 2EG8A 3PAJA 2RJHA 5K9CA 3UWWA 2HK1A 2HV5A 1CGXA 3R10A 6PTDA 1ICSA 3HN3A 5DXXA 1X8CA 4CCDA 4RKAA 2X30A 3KOWA 3DYMA 3N13A 4CNSA 1I60A 3CBWA 3GTXA 3VXGA 1HGWA 5FF7A 3NQ8A 1FH7A 3IAQA 3FS2A 3KL3A 4FLQA 3O07A 1KV5A 2JIWA 1JPIA 3SI9A 2EAWA 4LVBA 4F3HA 1W32A 1HN1A 1XLBA 2WPGA 3GB6A 3AJXA 4A2SA 1MXGA 1DXEA 4NUWA 2V5DA 2PBOA 3E2QA 3ARSA 1UWIA 1C8XA 2QJJA 2ZXDA 4WGHA 1TPH1 3W7DA 3OHIA 3FVMA 2VC6A 4EOUA 3BAXA 1UR3M 1GYLA 1JDCA 5LIYX 1XUUA 2DSUA 1L8PA 4IHCA 1OX6A 3K30A 2PA6A 3WK0A 1YQ2A 4MG4A 3UZZA 1S2CA 4GA8A 2WMIB 3CU2A 1VRDA 3A23A 3RLVA 1OG6A 3MSGA 4JDBA 1GUVA 1KXHA 4LAKA 2ZUUA 3FCPA 3TN6A 1MSSA 1V77A 1B3VA 4FIRA 2OZ0A 4DX3A 1PIFA 4JX6A 4DI9A 3EB4A 2DVXA 4PMJA 1K9DA 1F3TA 3VIFA 4XBKA 1E0TA 2VNCA 3VMOA 2FB2A 4PODA 1HL9A 2CLKA 1KTCA 4ICMA 4Z1AA 4PFHA 3RDKA 1UP0A 3M7SA 1RJPA 1F6YA 2YDAA 3EWBX 3MMWA 2XTKA 3SR7A 5CAHA 2VDIA 1Z48A 3S5SA 3BOXA 4RZ6A 3HG4A 1I2PA 3ZVIA 1G69A 4IL2A 3TYBA 1ZAJA 1HJXA 3EMCA 1GOIA 4IFRA 3WZ0E 3UCQA 2VUYA 1JD9A 1NDZA 1UH2A 3M0KA 2WKGA 2NWSA 3HO8A 2REQA 2A3BA 5A2BA 1RLDA 4WQ6A 4E5TA 4Z2LA 1FY6A 1LRQA 4LGXA 4N0RA 5BWAA 1XIHA 5GJMA 1IZCA 1LG2A 1YXYA 3QY8A 5D9PA 4FF7A 2JK2A 2HSAA 4AYSA 3EDJA 1GVEA 3WH7A 2A5HA 3H6OA 3KBVA 2HEJA 4DI8A 2X7VA 1S5VA 4H4IA 1A5AA 1E9YB 8RUCA 1S5WA 2PC8A 5AECA 3T42A 2VZUA 1V02E 1MW0A 3WQWA 1T8XA 1VC4A 4GUGA 4Q4QA 4AD0A 3WMSA 4AMCA 1ADOA 4AW7A 3UEQA 4MLJA 5GJNA 3W0KA 1DV7A 1JYVA 3LERA 3AS3A 3AZTA 1M68A 4W8AA 5KITA 3K8LA 1PYFA 1DTNA 4BQ2A 4AEEA 1AK5A 1KXQA 5F2GA 4F9DA 1XRVA 3LDVA 4JQ1A 3N3TA 1HF6A 1E3XA 1LLWA 1YTKA 3TNOA 2GWNA 3NZPA 1GQIA 5D2YA 2YA0A 4E4UA 3TTYA 2EKGA 4IISA 2PCEA 2YX0A 1LWJA 3DG6A 3ITXA 3B0XA 3PUEA 1U5JA 4A3HA 4BQ3A 5AHLA 3LX9A 1K7FA 2WHJA 3QY6A 4V28A 5GQBA 1AH3A 3STGA 5DMMA 5HNNA 2BVWA 2IXVA 4HCHA 2HJPA 3SGUA 3BOFA 2BXZA 1QT1A 2GGJA 2ISVA 3MCMA 3ZJKA 1UJPA 4GISA 1REQA 4WSHA 3T1GA 4WJ8A 1N8FA 3MZ2A 1KLYA 3WSUA 2B7NA 3OVPA 3SUSA 5E9AA 3TN5A 2Z1XA 3URNA 2QCDA 3OGVA 1O5XA 3W1LA 4LYPA 5AFDA 4O0KA 1DEDA 1WNOA 4LJ3A 4RV8A 1IT0A 4JIPA 4GZIA 1P48A 3LD5A 4TV5A 2J6XA 1HUVA 2DORA 1C92A 2OVLA 4WSKA 3B4UA 4QE4A 5ABGA 4HBKA 5LA1A 1VQTA 4I3GA 2Z7GA 3VIJA 2P3ZA 2VZOA 3KBNA 3URAA 1CBGA 1SR9A 1T0OA 3BW4A 4GACA 5LA2A 2ZBTA 3BG3A 1O95A 5KTLA 4JBRA 3VA8A 2NVAA 4UOZA 5A8PA 4UC5A 4FX7A 2CLLA 4I8DA 2OSXA 1A3XA 4M8UA 3N2OA 4I8YA 1F76A 1V8EA 1X96A 2CHNA 3N6QA 3H2AA 4U5IA 2G4JA 1YPXA 3GKFA 4DLMA 3BXWA 2PLKA 1KCKA 2DFAA 3O6CA 4JTKA 5FD0A 4E2VA 4JOMA 4WX2A 1LLOA 3OOQA 3ALFA 1BAGA 2O9PA 3NPXA 3OLGA 3W1QA 4HA0A 5D04C 4MPQA 3TP4A 4KWSA 3PZUA 2UZ9A 5AC4A 1KGWA 1YYAA 1NARA 4QG6A 3LGGA 4LS0A 1DOSA 3NQAA 4GZEA 4UTMA 5HNUA 3DECA 4GQBA 4H41A 1JPDX 2R94A 4UNIA 4HPNA 3NQEA 4QRNA 2HZGA 3SUWA 4WY0A 2Z25A 3SQLA 3OPSA 1P6WA 2FHCA 1BXCA 1TMLA 1XLGA 3W7JA 3PZ9A 3FXYA 1HIZA 1SO3A 1K6AA 3UYIA 1UZHA 3UGRA 1K4GA 4M7TA 1GW9A 4ZOBA 4HNUA 5HQEA 1KW1A 3E2RA 4C6NA 4NZCA 1D3HA 3AHXA 1J0KA 3B9DA 2F38A 2OLHA 4H9UA 4JKKA 4JNZA 3W2UA 3PHAA 2PWGA 5AZ0A 3AYTA 4YJ5A 3G1SA 4DN1A 4RX0A 3OZOA 1BSIA 1DWFM 1QNQA 4POCA 1SZEA 4GJ1A 5HPCA 2WM1A 4ZR8A 2XIMA 2OMAA 3O0FA 1LT8A 2W79A 4P7RA 4QAIA 3CZ8A 4J3UA 3WLNA 2IQTA 2FLIA 2HVOA 2VOMA 1EO5A 4XKYB 5BNKA 3U2ZA 2XIBA 2OYLA 3DUGA 3KZPA 1RCOB 1H0IA 3OA3A 2A3AA 2AGKA 3UJ2A 1C7SA 3RPMA 3L4UA 4LBRA 2PSNA 1E9LA 1SJBA 1OM0A 3V7PA 1F6PA 3LI1A 4E4FA 1OCQA 5TD4A 4ZEPA 1MUMA 1QASA 1QK0A 3MBFA 3PM6A 1CLKA 4LV4A 5EB8A 3T4WA 3GY1A 1GG1A 1L8NA 3T0AA 4D6CA 1E5NA 2E5CA 4US6A 4MYXA 2A6NA 1CEOA 4UTWA 3MHFA 4JQ3A 2QQ6A 1AW5A 1R2SA 2VCCA 3W72A 3W22A 3AHZA 2YCIX 4NAEA 2RJGA 3AAMA 5JXQA 1GEHA 3RGTA 4GPNA 3MS8A 2OSWA 3TSMA 3A4JA 3ARWA 3PNZA 1OGGA 2VCAA 4UMBA 1OHLA 3DXIA 4DLFA 3PANA 4LUTA 5J5RA 4NXKA 3VOCA 3M0HA 1AQMA 1QI4A 3XIMA 1UUQA 4WEVX 3M0YA 2LLEA 3M43A 1I0DA 4JN7A 4NAFA 2PTZA 2PODA 3GG7A 4IIHA 4Z2JA 1OABA 5D09A 4OWGA 2VEIA 3F4CA 4IH3A 1XD0A 5CJNA 2GQ3A 4AU0A 2ISSA 3T9PA 3WFZA 3EA2A 3S9ZA 4M19A 2W62A 1EGMA 3EDKA 4IPLA 4TX9A 4JNYA 1RA0A 3GAKA 3PFRA 2RAGA 3D47A 3CT2A 2C1GA 4GJIA 4AXNA 3K4WA 3QLDA 1LL4A 4F2UA 3AWOA 4D8LA 3V5OA 5REQA 4Z42C 2X42A 2C6QA 4CQDA 1E15A 1K4HA 1MXSA 1MQPA 2DZXA 1GJPA 4O1AA 4XZIA 4X0NA 1DWIM 3U7BA 3OLEA 3PPFA 3QV9A 5A6BA 9CGTA 4R9OA 2I14A 1B3WA 5D03A 3WQPA 2RDXA 2J9ZA 3F2DA 1OCNA 2F61A 4W7WA 4RLIA 4DZ5A 3M0JA 4OOUA 2OSYA 3LLDA 4GXPA 4QG8A 3II1A 2NX3A 2V6AA 3L4XA 2ONEA 3VDHA 2WMFA 3IVUA 4I9MA 4ZSUA 4IUGA 4PCFA 4CNPA 1J96A 4MKSA 5G2HA 1KXVA 5I7GA 3PG8A 4LUIA 3S3GA 2G97A 3O63A 4UR7A 3W7PA 2FKPA 1E4IA 5I02A 3TUUA 3M4HA 1UD5A 1DQXA 4RV3A 1QXLA 3GBDA 4HA4A 3S1GA 2FZ8A 3W02A 1XRFA 3TH6A 1GVIA 2OG9A 3MYOA 1BG9A 1GT8A 2VX6A 1PWMA 1I2QA 3VABA 1TMQA 2FFCA 1YEYA 4JTLA 4O54A 1BYCA 3C8NA 4LSBA 1DYSA 5AHMA 1AQFA 3M0XA 1ZBWA 4MKNA 4D6GA 1T6MA 3GIQA 1MVYA 5BXSA 2DIKA 4DWSB 2D0FA 3LNPA 2VC7A 4PMRA 2NLYA 5CBIA 1TPWA 2P88A 4NJIA 2Y0FA 1OC7A 4F2TA 3H21A 2HPIA 4O1FA 4Q4OA 3S6OA 2ZXAA 2JALA 1V3KA 1JDFA 2POZA 3W70A 3DZ1A 1ITXA 1GKPA 4RNJA 3A4AA 2YCJA 4QJ4B 2Y1HA 1AQHA 1S5TA 3R0KA 1L6SA 3OB8A 3VOFA 1DWGM 1V93A 4GFSA 4IGHA 1V03A 2YZ5A 1YBQA 3ORWA 4LNCA 3LHZA 3S83A 1ONEA 4UZUA 3RUBL 3G8RA 3V3WA 3OU8A 1XCFA 3EB2A 2GOKA 2BTMA 5M2FX 3ZYZA 1I4NA 3AYSA 4P7NA 4C6JA 5G4HC 2QGHA 4L9XA 1OZQA 3OW1A 4B2DD 1CECA 3A3HA 3OZPA 2JEQA 1RBLA 2GVYA 2Z26A 5F2IA 1FWJC 1NOFA 5RUBA 3LCIA 3NSXA 1HP5A 4W8LA 5LNSA 3QQWA 1KRMA 3K1DA 4GXMA 5CC7A 3BG9A 4IX0A 3WDRA 3GO2A 3PR2A 2ZRVA 2VR4A 3BAWA 5D8ZA 3GWQA 4HOZA 1V0MA 1DIKA 2RH9A 3VOGA 1PZ0A 1LWIA 2PDUA 1UROA 2WLZA 4FO4A 1MRQA 3UWUA 3P81A 3CXOA 4HZ6A 3RN6A 1JCYA 1UQZA 1VPXA 1JCTA 4U31A 5C54A 1RAKA 3I7SA 2QAFA 3IJIA 4WCJA 5HPOA 4YHGA 4GD0A 5H2ZA 4FAMA 3NNTA 1LG1A 3AQUA 3RM8A 3ONBA 2VQTA 3FJ6A 2F8QA 1N8WA 3WEOA 2E67A 3WBEA 1DIDA 1XWYA 3O15A 4Z2GA 3R94A 4WKFA 2WKJA 4UFLA 4LUSA 3CJPA 4MIMA 1N7KA 4P7OA 1M01A 6XIAA 4ES4A 4KT2A 3STEA 1MUWA 4FX8A 5A94A 1JULA 3QOMA 1P0EA 1YPFA 3MDUA 4ZENA 3FKRA 4DUXA 2GUYA 1J2WA 2X2GA 4QSFA 3WD2A 3LV5A 4HPGA 4JTCA 1ITQA 4L4MA 3VYLA 3KVJA 1TQJA 1X6LA 2TPSA 3MSDA 3QW3A 3WDJA 3UG8A 4OU1A 1MFUA 1DJYA 5A8OA 4GKLA 2ZE0A 2VCBA 1VFTA 1H7PA 2PU1A 1XCXA 3KOZA 2FZBA 4WOZA 1OIFA 2X2YA 2CLOA 3UF9A 3WBWA 3IV8A 4EXAA 1B4EA 3CQ0A 1XM3A 4J2PA 1W5NA 1TJ0A 1TWZA 1W1PA 5A6TC 1BF2A 3JRKA 2RDTA 4PUUA 3WKZA 3JZEA 1E6PA 2PTYA 1ZJIA 3S5ZA 2I5QA 3A5FA 3GR4A 1S46A 1FFRA 3N11A 3BSGA 3N2XA 1CLXA 5FEWA 3W25A 1PKYA 4CCZA 1OFPA 3TOPA 2CETA 1PE1A 3B0UX 3DFTA 1ZP3A 1R7OA 3HV8A 1JZ6A 4HU3A 4H7ZA 4RPQA 4S3CA 2P1FA 2HCVA 4LS1A 3H24A 4HNCA 1XDLA 2IW0A 3NUKA 1BTCA 2J8TA 2CXGA 5B7ZA 2F2HA 4BWLA 3RAOA 4AZGA 4MB5A 5DCBA 2QJIA 4HSOA 4I6KA 3H4XA 3NL2A 3PWAA 2TRSA 3GU1A 1SSGA 2VRJA 1NDYA 4UQ9A 2AGTA 3PVFA 4XUGA 3U3HA 1EB3A 3GH7A 2PWUA 4E2BA 3VDAA 4GI6A 1K8ZA 1XBXA 4LANA 1OT1A 4N2YA 3V1HA 4OFCA 1XBZA 2XIJA 2Z1KA 3RF9A 1YNPA 3CV7A 4F79A 6A3HA 3N2TA 4DBSA 4Z1DA 4E3VA 1XLEA 2QCLA 1BEUA 5C9RA 3WD3A 3PTKA 2X7WA 2KAUC 1WDQA 4J3XA 3W27A 1IXOA 1QU4A 1EH9A 4D6JA 3W86A 3F7JA 3SEPA 3B0YA 1WZMA 3K8KA 5A2CA 1UR0A 3M5VA 3VE9A 1E0VA 1V7YA 3IIVA 5J8LA 2FPTA 1OVDA 5FJRA 4LVGA 3A5VA 3FYYA 3MPGA 1IZJA 3BSHA 2GVJA 4NASA 4AHOA 4MJZA 4AEOA 1ZGDA 3XISA 1X1NA 1LRTA 1CGYA 3JR2A 4RDVA 4QNWA 1Q7ZA 5XINA 5CCZA 5LYRA 3ZMRA 2Q02A 1MMFA 2QCEA 4YNGA 1JDAA 1ZB5A 3VMPA 4XIAA 1IWBA 1UKQA 2GJRA 2WSKA 1EQPA 3NQGA 2YBTA 1D9EA 2YDQA 4NYUA 3VOIA 1BTMA 3W1AA 3CT7A 5CG7A 3A4WA 4NRRA 4GXWA 1C3FA 2OR2A 1W5OA 1OB0A 2Y5SA 4LVAA 5D2VA 3HM7A 1OCBA 1RQBA 4O17A 3E38A 4KEVA 1VEOA 4AZ6A 4MGGA 1DJNA 2VGFA 3B97A 2OEKA 2XN2A 3F2BA 3LGDA 7REQA 4IWWA 4OT7A 5C70A 1JUEA 3SSZA 2J24A 4JKLA 4X63A 4PGLA 3BCFA 3F4DA 5HMFA 3WLTA 5CLWA 3AS0A 1A0DA 2I17A 1VZWA 4MZYA 4L4OA 1XQLA 1FKWA 2R82A 1J5SA 4I7VA 2FB3A 1RCXB 1AFSA 3TTOA 2L5HA 2VZVA 2G41A 3PB2A 4KFNA 4KIRA 3GR7A 2JQXA 3RNDA 1BD0A 1G1YA 4ZE5A 4MJ2A 4JCLA 2ZA2A 3MANA 1QVBA 5G1MA 3VD9A 1ZAHA 3M07A 1GOWA 4QG9A 2HNEA 3T08A 2B7OA 3N4EA 2VL4A 4CVWA 3BCJA 2ACRA 1KO0A 1HJQA 4AWEA 4ZMGA 4GYPA 1NY1A 5DELA 1OX5A 1SZRA 5DCEA 2IQ0A 3T55A 1BWKA 3MO4A 5E1QA 2WBKA 4AWTA 1R6WA 2AL2A 3FA5A 3W7RA 3TWBA 3WMBA 3GNPA 3NYDA 3CMGA 1Q6RA 3MDWA 3V5FA 5BXPA 4ZFCA 1NQ6A 4P8UA 1QBBA 1QUMA 4JPGA 1C9WA 1SUXA 1UASA 2FDSA 1LYXA 3DGRA 4TQTA 3NXLA 1QBAA 2A7RA 3K46A 3WH5A 3EB3A 4DZAA 2YW3A 2V0TA 5D05A 3WLSA 4O15A 5G4EA 5AN7A 1L0PA 4D8AA 5JIWA 3DBNA 1YTDA 1UD3A 3TFCA 3GH4A 1AJ2A 4EX4A 1VF8A 4OECA 3CUIA 3M6YA 1ICQA 4LYQA 3U2CA 2ZZ5A 3A9IA 2C91A 4W5ZA 4QS6A 4Q4MA 2ZTJA 1NTHA 4YCPA 2PF0A 3NL5A 1W1IE 3G5EA 4DO5A 3S5OA 2Q8XA 1KRAC 1PV8A 4ORIA 1G4SA 1EJRC 1NU5A 4UXDA 3P5YA 3GBEA 2RGLA 3DAQA 3OBKA 1A47A 4XAFA 2J6VA 3HQNA 1FWTA 1UA3A 3VNYA 7XIMA 2H90A 4H6KA 4G6CA 5IFPA 3LTSA 3TQKA 4FR1A 3KOFA 4OVXA 4G7EA 2ZRYA 3BW3A 4KWOA 1M7PA 4ECLA 3P80A 4MDOA 4A4AA 2DJXA 5A6AA 1UWTA 4O10A 1K3UA 3CQHA 3F4VA 4FXSA 3LCFA 3LRKA 4WKAA 3TW7A 3QHOA 4LY8A 4CKQA 4FHAA 2ZYFA 2HK0A 5CZKA 4Y9NA 4B3ZA 5DY2A 3K1GA 4K1WA 3E12A 1RY0A 4JHZA 5E0FA 4F2BA 1UD4A 8XIAA 3H2CA 3JU2A 1KTNA 1O5KA 1BRLB 4JXCA 1CZ1A 1GVOA 1E0WA 2QDDA 3QTGA 1W5QA 4D8ZA 1CW2A 1HZYA 2ASHA 3COTA 2FVLA 3AHYA 3QZ6A 1XIFA 2F6KA 3K8MA 4PBEA 3AC0A 3BLPX 4AY1A 3CB3A 4ZO8A 2QJHA 3V0SA 3STFA 4GZ7A 4XZ9A 4Z2IA 5CSSA 2R8WA 3GVRA 4YWIA 1JPMA 1US0A 1W37A 1ZBCA 3G1VA 3MWAA 2DT2A 5M5DA 2CYGA 2V5LA 2C14A 3B0PA 2QS8A 4QJ5B 2A4AA 3OODA 1GG0A 1NIUA 2EJAA 2X1SA 4HU0A 2HTMA 4R7WA 1QNRA 1JNDA 2ZE3A 4FOJA 1H60A 4PL1A 4MNKA 4HU4A 3D5HA 4MM1A 3N4FA 2HMCA 4ERIA 4KEZA 4PZVA 3DG3A 3VCRA 1NDWA 3L65A 4PUWA 4PR4A 3VIOA 1SFSA 1IXQA 1XIDA 4S3GA 1ZZMA 1K8YA 5IBXC 1OWQA 1ZAIA 3NYZA 4X3ZA 3VUPA 4CEXC 3SO7A 3RXZA 2W67A 4KRTA 4TTUA 2PDIA 5IXEA 4UTHA 1M53A 1O66A 4CD4A 4PMXA 1SU5A 3FAXA 3LRMA 1S2TA 3A64A 3I68A 4L5ZA 2GUBA 2WHLA 4R33A 4G1NA 2NT0A 1JI2A 3VDCA 3QHMA 3LXAA 4W84A 2GSEA 3B05A 1TKKA 2GJNA 3ICJA 2GGHA 3USZA 5U4NA 3XINA 4Y9AA 2WJDA 3IWPA 4OOZA 4KW2A 2CKRA 1KXTA 2YXXA 1KGXA 5JMUA 2R1KA 4UNKA 3PC0A 3HG5A 4N9CA 3I10A 3N19B 5LGXA 3IVTA 2IPWA 5U7SA 1A0CA 4PTWA 4ACYA 1PTAA 3FFSA 2UY2A 2JGQA 3ME3A 2WM0A 1AD1A 5HJLA 4ADUA 4YMZA 1XLKA 5KSWA 3UZJA 1MQQA 1EFZA 1OFAA 1FWNA 1EA9C 1HXJA 3UERA 5TNVA 1V6YA 4O12A 2EHHA 4K6AA 3AJ7A 5F4SA 1I1WA 4HHMA 5A8QA 3OBAA 4DJDA 2XN1A 2E6AA 1SMDA 1E4MM 1H63A 1ZRQA 3QW4B 2FGLA 3W7QA 2BDQA 2G8ZA 3DKJA 2QVNA 3N29A 5FEZA 5ABFA 1LORA 1RBOB 2YBVA 1JGMA 4MDPA 5AHNA 4IQEA 3E1F1 4YXGA 3GVQA 4LB3A 2B0MA 3TDFA 4HTBA 5D32A 1IV8A 1VPQA 1OC6A 1IQ8A 1JUBA 4D2JA 2NQHA 3LM7A 2Z27A 3CPGA 4D6EA 2E09A 2J13A 2ADAA 4LOCA 1RK6A 2A7NA 2ACSA 2XVKA 1J0IA 1DWAM 3NJ3A 3WMLA 2F7FA 3DBPA 2FZ9A 3RX3A 1H7OA 1WA3A 4KRUA 1JF6A 2E8ZA 1HP4A 3Q45A 2PLJA 1X7FA 1JNEA 4XTIA 2Z00A 1TX0A 4OTKA 3WLRA 9RUBA 1S2VA 2Z6IA 1XC6A 4K8GA 4CD6A 1CNVA 1IWPA 3HGOA 5A8NA 1J5TA 1W5MA 3EXRA 1MW3A 5A6LA 2OODA 4AZIA 2QDGA 4IMDA 1Q63A 3VZYA 4HHHA 3WEMA 3ZVHB 5JIPA 1Y0EA 1UZ4A 2FTWA 1W9VA 5TF0A 2CZEA 1CGWA 4JNMA 1S1PA 3U4AA 3W7GA 2FJUB 4AWSA 4JIEA 3I3EA 5K9DA 4IF2A 1KV8A 2WC4A 1MXDA 1R3SA 1PL9A 3AYRA 4RCXA 2QCNA 4LX4A 1DORA 3INPA 3WQVA 3L7RA 4MAZA 3BLEA 4EXBA 1MEWA 3DFQA 4ICCX 4NNAA 1X97A 3NA8A 4WKHA 1LBFA 2X41A 1OFEA 1IXNA 1EX5A 5ABHA 3M0LA 5HULA 4QJ3B 3HG3A 4A05A 1GGOA 4S3KA 2QKFA 2WVVA 1FQ0A 2GDQA 4ZQNA 2OWXA 1OINA 3QHNA 2YIHA 1VFLA 3CEPA 4C6EA 3KBSA 3N1AA 2XG9A 4QE5A 2VTFA 1C29A 1C91A 4UQBA 4KWVA 5FL0A 1YKWA 2X1RA 1E71M 3EKGA 2Q8LA 3FAWA 4W85A 3FSTA 1ITUA 3LZ3A 3AXMA 1Z9AA 1YBQB 3AMGA 3NM1A 1W1YA 3UBPC 2KX9A 1IT8A 3CTTA 2XIIA 3RFAA 3BQ5A 1J18A 4P8VA 3CC1A 4TU1A 1HGYA 5A6MA 3E3HA 1WZLA 2YYUA 3ABSA 1QNPA 2QCCA 4BQ5A 2GVLA 2WHMA 4PTXA 1EYEA 3SM0A 4NZ3A 2PBGA 1V6XA 3GTHA 3T07A 2YZRA 3TYCA 1RXOB 4NKCA 2ESCA 1C9DA 3UWYA 3NQ6A 1YDVA 4ONVA 1W17A 1PTDA 3LV6A 3VNKA 4LB4A 1V6WA 2QHAA 1VBHA 1AL7A 4CQ8A 4MNJA 1Z32X 1TZ9A 2XISA 2NQ5A 3THCA 5HR6A 1I45A 4PUKA 4XSMA 3THAA 1P6CA 4F40A 3LHVA 3P8JA 3ARZA 4JL1A 1FWEC 4LAOA 1W3JA 4IMCA 3SRHA 3B4YA 3ENLA 3QFWA 1EWEA 1B2YA 2PD9A 2E77A 3FSUA 1W1TA 3T0CA 5IHSA 3AMKA 2JEPA 2G3NA 4MY1A 4XX6A 4AIUA 4Q32A 2BASA 3HZ3A 1B31A 4V1YA 4WDTA 2FIQA 4I5UA 3BAKA 2Z7KA 5ABTA 2YL6A 1R30A 1GQJA 2Z24A 1I8JA 4IPJA 2BS9A 3R58A 4UTKA 4K8HA 4DELA 4RZ5A 1LL6A 5TIMA 3QGAC 5CKSA 3U5YA 4KEMA 3VFLA 1EF2A 3UNDA 2HBXA 3Q94A 4LUSB 1V79A 3W81A 3UZ5A 1TJ1A 2DT0A 4CUCA 2WO5A 4BF5A 3WLMA 1UKTA 2XSXA 1WUFA 3GDBA 1PZ3A 3EWZA 3PK7A 3W7CA 4TIMA 4GRSA 4CN6A 5D2TA 3OYXA 1UCWA 3MUCA 9XIAA 1AMYA 1OFOA 1ONWA 5I79A 1OFQA 2WC7A 4L4LA 2ATSA 2CITA 2GJPA 1KQYA 2P3EA 1VYSX 5F1VA 5CGTA 3B03A 4Q4KA 4GBUA 4OV9A 1R47A 5AC6A 2E0PA 3HIJA 4GQGA 3DC0A 2WLYA 2YOCA 5DMYA 1H49A 2VELA 5BOOA 1BF6A 4O8RA 1VCGA 3CYJA 5I3JA 2PTWA 1Y7VA 3TMLA 1YXDA 2AQOA 4JTIA 4IL0A 4GY0A 2GJLA 5EMLA 1EDQA 2XFWA 3ARVA 3ARRA 3FGCB 3FEQA 4AZ5A 5EMUA 3VIMA 1SO6A 4GQ0A 3GHSA 7ENLA 2F6UA 2WMIA 2PDHA 3TAKA 1U5VA 3NL3A 1HKIA 1VENA 4DJED 4HMEA 5LIUX 2INZA 1Q6FA 1EJWC 5FACA 2KZHA 4UFKA 2WBGA 3O05A 4UTIA 3UA3A 1JZ8A 3NSNA 5HJXA 2CCRA 3WQCA 2XYLA 6ENLA 2J27A 2OU4A 1PVNA 4XBSA 2VT0A 1J4EA 2GOUA 3P84A 3PTDA 3C52A 4ZQMA 1WB0A 1ZP4A 3WFAA 1CT5A 2X1UA 5EY5A 3BAYA 3R0UA 4M5PA 5AC7A 1HNYA 2D24A 3AHTA 4PTNA 4D1JA 2JGYA 1DJXA 2ZX7A 1E6SM 2WVUA 1MUCA 3FKKA 4A8NA 4O50A 4DPQA 2BXYA 4FSAA 4H19A 1S2WA 3S1WA 3R1ZA 4C5YA 4NJJA 1D3GA 2TYSA 4FOUA 2WKLA 3T2PA 4Y9MA 3TAOA 2H6RA 1IR1A 3SY5A 3THDA 3TTSA 1F6KA 4B3KA 2DV0A 1W54A 4ZB0A 3R8HA 3N6JA 3LEPA 4B16A 4Y90A 1EBHA 1UA7A 4L6OA 3U9IA 3H2FA 3QLLA 3I7QA 2XM1A 3VFCA 4PRWA 3TXZA 1M7JA 3VTRA 2W61A 3DFOA 1DJIA 3AXKA 1VPYA 2A2IA 1R3VA 1ZBVA 1LRNA 2ZX6A 3VKDA 3PULA 3E9AA 3IEBA 2Q3RA 3IAPA 5F1UA 3OIXA 3CO8A 4GBDA 4N9EA 3ES7A 3WF0A 2XUCA 3U0HA 4JHOA 2CZDA 3PZQA 1O68A 2C3ZA 4PUNA 3DYPA 4IJBA 1XG4A 1HKKA 4MWAD 3SUUA 1G5AA 3IRSA 3L2MA 1G0CA 3HQOA 4DWDA 3QGKC 3SIZA 1Q6CA 5C6MA 1XC4A 3VE7A 2GSJA 1UD8A 2PDYA 2CU0A 4Q8WA 3QPEA 2HDJA 4G56A 1KNWA 1DTUA 2UV8G 5CXPA 4RUBA 3E0VA 3F4WA 1EJXC 2WC3A 4DO7A 1XIEA 3U5UA 1TJPA 1E6NA 3QY7A 1EYWA 1P1MA 2D0GA 3GZAA 4PMYA 1X1OA 1IIGA 2XJ7A 1FRBA 3OLIA 3ITOA 4J3SA 7TIMA 4QCEA 4AUBA 3B0VC 3H70A 1XF0A 2PDKA 1E3ZA 3N25A 4US5A 2NQ9A 4DJFD 1W2PA 5DMLA 2ACUA 3WJWA 3ANVA 2PURA 1RVGA 1BGGA 3NEVA 4PCTA 1B4KA 4GK8A 4PEEA 1RALA 3I6EA 4RE3A 3TYZA 2QUUA 5ECVA 5JUVA 3W74A 4WJXA 3UETA 2DW6A 3TJLA 4UFJA 2V30A 1GOMA 1G4EA 1ZQ5A 1KQZA 4GI9A 4ZO6A 3E2VA 3VVGA 3UPMA 3V35A 2CXEA 1SFLA 3NQMA 2DUXA 3D3FA 3B8TA 3EYPA 1KFWA 1T40A 3ITVA 3NDOA 1BKSA 3QQ1A 4AEFA 2XU2A 2WWCA 3PJTA 3FV9A 2XWDA 3BLKA 3IACA 5CGQA 3BE7A 4PUEA 1SJDA 4KKXA 5FJOA 1PTGA 3UPWA 3AICA 2G0WA 1JUKA 1YX1A 1ZALA 3GKAA 5HMSA 1GZGA 1PZ1A 3EAUA 3AMLA 4I6VA 4FEZA 1MYRA 3H7UA 4AX6A 1M3UA 5BOEA 1WDDA 2QDHA 5FIPA 3B8DA 3G0XA 4XAPA 4TXEA 3BCDA 4HOXA 2D3LA 2J78A 1DXFA 3WIJA 2X1TA 1UUMA 4C7DA 1IEVA 4WGXA 2JF6A 3HPXA 1TPC1 2FZNA 3WJYA 3RO6A 3UPBA 1F4AA 1RV8A 3Q4DA 3PZMA 1XX1A 2EG7A 1WAWA 1YPIA 1O6IA 4F0HA 3GU2A 3WLQA 3W7OA 3L21A 3DI0A 4AQLA 3N2BA 1H7WA 2EEXA 4MB3A 2C8NA 3ISIX 3BLDA 4GX9A 4ZQOA 4PTVA 5DX7A 4H00A 3WQDA 3V4BA 3WDQA 4RXFA 3VX1A 2BY0A 3VDGA 4IMAA 1VFFA 3CH0A 3EPNA 3HG2A 1SVDA 1PIGA 3B9NA 2V2HA 2O9TA 3GVVA 3AU2A 1E9ZB 4B5TA 5FEXA 1CDGA 3HQPA 1I0BA 3P93A 1NWRA 1A5MC 3P7YA 4FA3A 4UCFA 1PCWA 2CBVA 4YU1A 1XYAA 2Y7DA 3DU0A 5FKYA 4M81A 1B30A 2W91A 4INFA 2HXTA 2YXGA 4X2PA 3IIOA 4XZMX 5KMYA 1NAL1 2O9OA 3M5ZA 2J25A 2ISFA 5I3HA 1K9EA 1B3YA 4QTGA 3M0MA 4LU0A 3E0IA 4WDUA 1V7AA 2QVHA 3FX4A 1BVNP 3BMWA 4F9JA 2XM2A 4C6IA 4Z0JA 3SCWA 5XIMA 2ZUNA 1W8GA 4PMDA 3WNPA 3GXFA 2RFGA 4QDPA 1LDCA 1QI5A 5BW6A 2HE5A 3VCNA 3R12A 3VCCA 3W2LA 5E0KA 5L9FA 4HNNA 5IDIA 4O0QA 3JS3A 3PZVA 3TX9A 5D2XA 5BMWA 2EPLX 3VZXA 1ZTVA 4YPJA 3WLKX 5LSMA 2XH2A 3BUVA 2FTPA 3TQPA 3BQ6A 3RG6A 3IUDA 4MAVA 3ZFHA 3IJ8A 3OG3A 3FHAA 4IP4A 3N9RA 1EJTC 4XZHA 3CAQA 5LHEA 4FNTA 2FGZA 2YCLA 2V63A 4JHMA 2Z29A 1VFSA 4O1EA 1QPNA 3IGSA 4OJYA 1WCGA 1IEIA 3STCA 2FH6A 3WNOA 2BSLA 2BG5A 1QAPA 1WDSA 2AMGA 1ME7A 1QOPA 3KL0A 1AUSL 2YFOA 4LALA 5DF0A 3NURA 2X09A 4WVXA 2Y63A 1A49A 5CPQA 5CBJA 1MNSA 2PWHA 3MBDA 4F0KA 1QWGA 2GGEA 5EBAA 5AZ1A 5DN1A 1FA2A 4QXIA 4ROPA 1CX9A 1Q8JA 3LCGA 3UZXA 1TELA 1RBAA 1EZ2A 3TK7A 2ZICA 1JR1A 2YLAA 5FSEC 3MV11 1QI3A 4GMEA 3AXHA 4QQ3A 1GHSA 2JF7A 3CUFA 2WZEA 3ITTA 3N15A 2OO0A 1X6NA 5EMYA 2EPOA 1IGWA 5I3FA 5A1AA 1BXNA 1LBLA 2PC4A 1IEWA 5LNRA 1J79A 2CERA 1Q4WA 2W27A 1Q6QA 4HK6A 2GPTA 5D9MA 1T7LA 1DPMA 3W28A 3P6LA 1JF5A 4UUIA 3HMJG 1JEZA 3LQLA 1BFNA 1Q6OA 3VNMA 2Z2BA 3LN3A 3I4KA 5CSYA 1CXEA 1XFBA 3SCNA 3WLPA 3MCOA 4P5UA 4LCRA 1BYBA 1H41A 2D3NA 2OX1A 3W1NA 4DBUA 2Q8ZA 1W3KA 4DYKA 3ARXA 3MP4A 3CQJA 3W6MA 1PZ2A 3GTNA 1TPB1 2XZ9A 5E6ZA 3NAVA 1PKLA 2Z4GA 1AL8A 1LOSA 3WQ8A 2CNCA 1DJGA 3L0NA 2FTYA 1XL9A 1VBGA 1MW2A 1H7NA 4JQAA 2C13A 1P1XA 5GNXA 3MWCA 1TA3B 1JZ2A 3KAOA 1TPUA 5FF3A 3EKZA 7A3HA 4TTGA 2W0UA 1SR0A 4JIHA 3UVAA 2DW7A 4F0RA 5DCDA 1NOWA 1MEHA 1MRAA 2J7CA 1DKWA 2E8YA 1SO5A 2V2CA 1XIGA 5ABFB 3N6HA 1TV8A 3NM3A 1PEZA 2ZZ1A 4G8TA 3ATZA 4YS1A 4CNOA 2ZQ0A 3R7MA 3QFEA 4JIRA 3RCNA 2J7DA 3BVJA 1G6CA 1LWHA 1WQ5A 3B04A 3MA8A 3A9BA 1UC4A 3TMQA 1AZ1A 2WMGA 1DP0A 1ISZA 2F9RA 2ZIDA 5EFDA 4DWSA 3OLDA 4CNUA 3GX9A 4PMOA 1KCXA 1FHUA 3GHUA 3IUIA 4WZHA 3USBA 4AIEA 3LHTA 4HIBA 3WQOA 2NQJA 3RCMA 1EC7A 3D3AA 1R87A 1OEPA 4NVTA 4TVDA 1CLVA 3DOPA 3VD7A 4ERAA 2BGQA 2XIQA 5C71A 4K37A 2OX4A 3CK5A 3WDHA 2QF8A 3W75A 3DENA 1H7XA 4XVEA 3UJEA 3C8FA 9XIMA 1XIMA 4S3BA 1YW1A 4JN8A 3RPTA 4C6FA 3WLIA 3BH4A 3SCQA 2WZMA 1Q6DA 5AOUA 4GIEA 4N9DA 1WXJA 1F4HA 4Q8OA 5T26A 3TFXA 2I1OA 2GGGA 1VLWA 1AD4A 3RM4A 1E1EA 3KP0A 2E6DA 3T6CA 4AHQA 3GG1A 1XGDA 1DE6A 3GXNA 3G1AA 3POCA 4KF1A 3KCJA 1VIWA 1CXFA 3NQBA 3PTMA 4FALA 1UR1A 2EKCA 1AQ0A 4QROA 4JTEA 2ISWA 3WJSA 3BJTA 1GJWA 1Q7MA 3HQ1A 4CU7A 1WKDA 2O4QA 1A0EA 1BXBA 2DUAA 2BY3A 5DT7A 5HATA 1M7OA 2Q71A 1T8QA 1QCWA 3N9SA 4M1BA 1K77A 3W2JA 1OK6A 5F2LA 4U2YA 4HSHA 2PDWA 1TTIA 2YB4A 1ADDA 1KM1A 3SY1A 2YL8A 3AS1A 3KP1A 2Z2UA 3RITA 5A5WA 4B4HA 1O60A 1H50A 4GNJA 1RY8A 2UY4A 3IV3A 2V5CA 2R6OA 1XLAA 3TKFA 4DZIA 2R91A 3DG7A 2YFNA 1XYMA 1U22A 4Q4PA 4L80A 3OVRA 1W9XA 3ERPA 5EL1A 5AY7A 2YLLA 1A5BA 3LK6A 2VWSA 4PE8A 4O14A 2P8BA 3F1QA 1ZSXA 2PWDA 1TQXA 1PKNA 1PDZA 4YLWA 3W1MA 3RMJA 2INEA 1DWHM 4GX8A 3HGRA 3N04A 3O3RA 3AMDA 3BAIA 1FWBC 2D1ZA 1TWSA 3CHFA 3CHVA 3WL1A 1VRXA 2F2KA 2AL1A 2Z1BA 4TV6A 5A6SA 1GOKA 2GL5A 4J9JA 3QYQA 3CV2A 3EMZA 2HROA 1QJWA 2VVSA 1TJ2A 4N7QA 1E6RA 3CLWA 4LBUA 3HPFA 4NZ1A 3C86A 4L56A 4URIA 1J0YA 1UD6A 2A3LA 3OIHA 3PJWA 1NOUA 3VD4A 3VC5A 5EFFA 4C6MA 3P5ZA 2O7SA 4Z1YA 4QS5A 1ESWA 1B57A 4JX5A 3L66A 1Q85A 3GW3A 4LEQA 4AZBA 4C65A 3BO9A 4S3FA 4LVFA 1DQWA 4TMCA 3IRDA 1PWLA 4BA0A 4XD5A 1TV4A 2BB0A 4Q8QA 4E3TA 1ZLPA 2C7FA 3BW2A 1JCMP 1FWWA 4H6EA 1GEQA 2E68A 2YSWA 4KERA 3P62A 5DO8A 2RGMA 3FEMA 4DY1A 1M6JA 1UQYA 5AYXA 3OYZA 4EAMA 2PZ0A 2CZVA 1WYIA 4IJRA 4XKMA 5EBUA 3MUY1 3W1TA 3CNYA 1HVXA 5ABEA 4LQ1A 1CB2A 3IIPA 4H1ZA 3QBUA 3EOUA 1H51A 3CHEA 4M1RA 2E7FA 4M3PA 4JEJA 1BKHA 1CYGA 3AI0A 2V5JA 5J5DA 3GZ3A 3GIYA 3MP5A 4RDYA 3PZOA 1DJZA 3WFLA 4PMUA 3HGJA 1JXJA 5BCAA 2BBFA 1DL3A 2WMJA 3CL6A 2PAJA 3N2CA 2UWFA 2NUWA 4UTWC 3T4CA 2WXDM 3S2JA 4RDZA 3Q37A 1GZ1A 1BHGA 3SZ8A 3R4IA 1IIHA 1XISA 2PZNA 3JVAA 1NDVA 4HPJA 4IPNB 3F03K 1XH0A 2NVCA 3KOYA 3T8QA 3STPA 1FCVA 2X16A 1WE5A 3NDYA 1KRCC 1A50A 5H8UA 3I7RA 4S3EA 3S1VA 1V6UA 1SPQA 4JEQA 3O8AA 4BHYA 3SCUA 1VAHA 3WH6A 2OLSA 5XIAA 1P7TA 1W1A1 4QJ1A 4NZ5A 3DCPA 4JL2A 2NV1A 2NQLA 3IK2A 2R14A 4AHPA 4Z2HA 1QO2A 3EPOA 3VGDA 3B9EA 3OJGA 4IX2A 1LT7A 1SW3A 4AB4A 4MB1A 4D9PA 3WNMA 4ALDA 1VP5A 3PG9A 3RRXA 1N8IA 4U28A 1JCXA 3F2CA 1BWVA 1R46A 1S1RA 4U3AA 2G3JA 3C2VA 4A29A 5BROA 3RPDA 4JAWA 4WDWA 4A8LA 2OZTA 4LC6A 2QCGA 3C4UA 1EPVA 3V0UA 2BLEA 1YIXA 2GDUA 1NP2A 2V3DA 3NO5A 3VU2A 1YDNA 1FXQA 2W92A 1BQCA 3GW0A 3DX5A 1XLLA 3UESA 3ZJ7A 4LRSA 4W89A 2OZ8A 1F3WA 2Y62A 4PCNA 2H9AA 4MTVA 3W1XA 1AH0A 2ZVIA 3PBYA 1A4LA 4X61A 3DHPA 3VKCA 1KC7A 3FK4A 2Y5JA 2ICSA 3M41A 4FLSA 1FUYA 4LBSA 3NIYA 1P6BA 2XWEA 4OQVA 4K38A 2W9MA 3GDKA 3KTSA 3GH5A 1S39A 1A3WA 1DIOA 4CGTA 2XFFA 5G2WA 5IBXA 6ALDA 2G37A 3GUGA 1P0BA 4KEUA 1H11A 1P4CA 1WZAA 1ZL1A 4IIDA 3CEUA 1ZPTA 1A5LC 4AVNA 1LUCB 4K7VA 4V33A 4IMFA 1MFVA 4O53A 3DFHA 1UP3A 2POTA 1N55A 2R1MA 4HOWA 4FNQA 5HR7A 1XSJA 4L1WA 4AD5A 4RE2A 4A3RA 1O7AA 3FVDA 3AIRA 1KBKA 5HQLA 4LCQA 2CLHA 5A95A 1R5YA 1L2UA 1Z44A 4OE7A 1CWYA 3ONCA 1YRRA 1R9XA 2V8ZA 4JQ2A 3BWWA 4EAYA 4PYSA 3ITCA 1WUEA 2NSXA 4IGSA 3WQ5A 1XPGA 1WDWA 3RU6A 4U2ZA 1LROA 1VJSA 1M9HA 1PAMA 4LNYA 1I75A 3DHFA 1V02A 4I5XA 1U30A 3CV6A 4MFEA 4E0CA 4DUVA 1UJQA 5ECUA 1W9DM 2NWRA 3CV1A 3S1XA 3QSTA 4HHLA 1FKXA 1VLIA 2WZTA 4A3UA 4HB7A 3PZTA 3VOHA 1R3TA 4M29A 5DRIA 1OYBA 5C7VA 2W4XA 1FDJA 4A22A 4L9ZA 2UBPC 4AAJA 3CIVA 2J77A 3JZUA 2Q09A 1JD7A 3S2MA 3RR1A 4EPBC 5BWFA 3B8UA 1M5WA 4Y9OA 1V0NA 2W5FA 4DJEC 4P7LA 1VJZA 3L4ZA 5I09A 1KFCA 3WBAA 2G5WA 1EXPA 5LGZA 1WOAA 3OBEA 3DYOA 2V3EA 3PUGA 2C1IA 5T9BG 4XQ6A 4GZJA 4QP0A 4NJHA 3EPMA 3VIIA 1FP8A 4DB7A 3E2SA 3NWRA 3RHGA 4DF2A 3UY8A 4CD5A 3FA4A 1BSLA 4PMZA 4LWWA 2X0SA 2VI0A 4UFHA 3CL8A 4F8XA 3KEHA 1I2OA 2BXVA 2E3ZA 1X38A 1KM0A 2VKZG 4DBEA 1EBGA 1ELSA 4EWJA 1JPKA 1HKMA 3UU0A 4B5SA 3NVTA 4DNMA 4YWSA 1PCKA 3CLMA 2IKIA 3HJEA 3QV6A 1BRLA 2ZUSA 2DH2A 1TE6A 1XIIA 3UY7A 2D23A 3CUXA 3KL5A 3FDKA 4QE1A 2WCAA 2MUCA 2D2JA 4AISA 1YHTA 1UH4A 3H53A 3U2OA 2WMHA 5SWUA 3W37A 3NQDA 4Z17A 4ZA0A 2NUXA 3LPPA 2QLYA 2Q6ZA 3RLHA 2BY1A 4I9JA 2NXIA 4C5ZA 3NR0A 4AMAA 5BYWA 1ECEA 2PS2A 1UMYA 3ABZA 3NQVA 4MJMA 1VIZA 4UQCA 1GHRA 2X0HA 4P7QA 1RZMA 2ZC8A 1V3HA 5GNYA 4US5D 4RDWA 6XIMA 3UQNA 3W53A 1FH8A 4ERGA 3W4RA 3WJZA 4GLEA 4MWAC 2R1NA 1GONA 1JZ7A 1S2AA 3DH7A 3QOKA 1Q4NX 5HMEA 1KBJA 5H1WA 2PTXA 2GSHA 1TMHA 2ALDA 1X7IA 2RKXA 3AIBA 2F6XA 1GTHA 3S2NA 2PDCA 5FOOA 4JTGA 4C90A 4PA8A 4UQDA 3ALGA 2PMQA 2OB3A 2VD8A 5I2UA 2WV8A 2WMKA 5M03A 1JDEA 4ADTA 4ZO9A 1QNOA 2NLIA 1CXHA 5AYYA 3E0FA 1OZMA 2PF8A 3M6DA 1CPUA 1W3NA 4DJFC 4YTRA 3TIMA 3BGGA 1MO0A 3WLHA 1SJAA 4AY8A 1WBJA 5CPLA 3H4GA 2GQAA 2YCLB 4ZQPA 5EMJA 4C6KA 3RRAA 5EMMA 3DDMA 3LCXA 2GYIA 1EC8A 3L4WA 5HUPA 2YL9A 4Q6JA 3OQEA 3ZR5A 3IPWA 1V6VA 3GFZA 3T44A 4ADSA 4DHGA 4WK9A 1RJRA 1AJZA 3O2LA 4GGBA 2FYMA 3TZFA 2OGYA 1SSDA 4XO6A 2ZFAA 1UWRA 3A4XA 3LSBA 4PRRA 2IXUA 4BWLC 4XK2A 3LUTA 4QLKA 1R8LA 2XPKA 1SQ7A 4C6LA 4GIAA 1FCQA 3BOLA 4TX6A 2QULA 4B91A 4WY0F 4ZB5A 4GJJA 3M44A 1J0ZA 4I90A 3PBGA 2QJMA 2QIIA 1BVWA 4MKVA 1ONXA 3OTRA 1CB7B 4ZQRA 5C2CA 2DZWA 3W7HA 2WYSA 3WX7A 3VPLA 4HA1A 4I7WA 1Z89A 1W3HA 2QV5A 5CC6A 2P50A 1H4PA 2B31A 1XFCA 2I9EA 5I07A 4ZFMA 2Y7FA 3KXQA 5CPNA 1JZ3A 3VM5A 4TMBA 1C93A 1JAKA 4HN8A 2HPMA 1GVQA 4N4PA 1X6UA 4IQDA 3SCRA 5HNTA 4HJFA 5CG0A 3HU7A 3BTNA 1DQUA 2A79A 5HWNA 1W5PA 1CGUA 2WSPA 1KM3A 4RPPA 2XGIA 2VEPA 4UFIA 4FXRA 2OGJA 4PB3A 2CFFA 1AVAA 4LUJA 2ON3A 1KR1A 2ABBA 4GIYA 5HOSA 2J79A 1V3MA 2J75A 3VM7A 3VGEA 1HL8A 3I6TA 3I65A 1JXKA 2VYOA 4X22A 1VKFA 2OLAA 1D3CA 1A5SA 3W2MA 3C3NA 3O0KA 4XUYA 2XVPA 3CHCA 3PY2A 1HJVA 1R86A 2C16A 1H62A 3RILA 1EIBA 4MUZA 2IPJA 1IZKA 4O19A 3ARQA 3CUZA 4Q7BA 4C60A 1U5HA 4I9TA 3ZVHA 3FY1A 5DFAA 3VNLA 2ZRWA 3CASA 1IXPA 1Q6EA 1CTNA 2GQ9A 3UT0A 3VIPA 3BICA 3HFYA 3A22A 3QC0A 4HU8A 3GNNA 3SGGA 4LAZA 2J7HA 3W7NA 3HPSA 3S9IA 1BLIA 2FPYA 3CAVA 4UR8A 2CIPA 1XUZA 5I24A 4L7ZA 4M6UA 1EZWA 1QOXA 4IG2A 5D8WA 4W9TA 2D0HA 1Q66A 4RNFA 2YPIA 4HN4A 3NPVA 1UR9A 3HURA 1EOMA 2IS7A 1EEPA 2V81A 1J11A 5LA0A 1Z7AA 3GC4A 4GYPC 1Q3NA 1GPFA 3EGJA 1H0GA 1WDRA 3CZLA 4K3ZA 4OBTA 1QR7A 5LKYA 5D33A 2YW4A 4KGLA 2VC5A 2WVSA 1GCYA 1SYTA 5EPDA 1FWGC 3H7VA 3MT1A 2EBNA 4ML4A 4CD7A 1NSJA 4B2DA 2VX5A 4U10A 4Y8EA 1OF8A 3NQ2A 3HBLA 3MUXA 3L0GA 3P8IA 1U1JA 1G7UA 4XZNX 2XZ7A 1FHLA 4X9YA 1WV2A 3AU6A 3CUGA 2ZRXA 1JZ4A 3QVQA 1E6XM 3SB0A 3KE0A 3BLIA 1Q6LA 4DF1A 4Y6GA 3LM3A 3MU7A 2XDFA 3H2OA 2WSRA 4MOZA 2XH0A 2Q3OA 3PWIA 3CIWA 4IXHA 3ATYA 4AFYA 4OBRA 1OQFA 2ZXBA 1QRQA 3LHWA 1GW1A 5GNZA 4DNHA 2VRQA 2PP1A 4GO9A 4BZYA 1VFMA 2V2DA 3KRUA 4FOKA 5MKGA 3MW7A 1OK4A 3MMDA 1QMLA 3ZM8A 2Z2AA 2DZUA 4K2SA 2FVMA 3C0JA 4AZHA 1SW0A 5G2IA 2XVNA 3H7RA 5BU9A 2QDEA 4FXJA 3W88A 1FHDA 1HVQA 3V18A 3K5XA 3L0KA 1JGIA 5AC5A 4TO8A 2RDUA 3QSRA 3EX2A 3QEZA 3ITLA 3GNDA 2WSQA 1UKSA 3WLJA 3W00A 3THUA 2P8CA 3OVGA 4GNVA 3QJAA 2GJXB 3WBYA 3UCCA 3UWEA 1UD2A 1JAEA 1VR6A 1ADSA 3KHDA 1LBMA 2IKJA 2FVKA 1LQ0A 3TZNA 1JI1A 3G0UA 2SFPA 3TWAA 1O4UA 2WCSA 4DYEA 3TEVA 1QPRA 4KBXA 4EVZA 3R0DA 3WK3A 3IJQA 1MZHA 1VEPA 4EPEC 3LU2A 3AIVA 4PULA 4DWSD 2PDBA 4DXXA 5I3DA 4M80A 2DPEA 5G1TA 5F4WA 2Y5EA 1GJUA 1ZU8A 1PX3A 4B3LA 4PBFA 4D6FA 3WQGA 2BMBA 4DZHA 3KUMA 2G95A 3W1UA 1HQTA 4DPPA 5IHRA 4FI4A 3MZNA 2PDXA 3SECA 3WF1A 4FR6A 1W6TA 1EGZA 1QWKA 3DFYA 4ZO7A 1XPYA 1K02A 1EDGA 1XINA 3RJYA 1VYPX 2AQWA 2VQUA 5CZSA 5HINA 2B4GA 1PX8A 1JDDA 3BL3A 5HA7A 2D2GA 5HBFA 1OYAA 2AKMA 1PX4A 2IKHA 1IYXA 2NX9A 3IS4A 2P0IA 4FIQA 3W85A 1UWQA 2V82A 2GWGA 5CGMA 5HAOA 1TR9A 1XLCA 3ZR6A 2I7GA 2Y88A 1VHCA 4UMAA 3FGCA 4BEQA 2QYGA 1HT6A 3AFBA 3EWCA 1AJ0A 4QFUA 2XINA 3ZXWA 3FDGA 4H7CA 4DEFA 2DZTA 5FF2A 3VNIA 2J9XA 2OEJA 1KWKA 4O4VA 3GE7A 1XGEA 3CHDA 3QF0A 2H3DA 3F5LA 3UJRA 4JS3A 2PRLA 3O9NA 4MLRA 3U48A 4E8GA 3BLOA 2FPVA 3LMZA 2FFIA 3TE9A 1JCJA 1TV7A 2A6LA 4ZSTA 4J3ZA 4JX4A 1J2BA 4HGXA 4BY3A 1E1CA 1ICPA 4GQQA 4GE8A 3EOOA 4K1GA 4IGNA 3W2NA 3B8WA 5FA5A 2E1WA 1QI2A 3NO3A 3NO1A 1QOQA 2WCGA 2ISDA 5HJYA 2WB5A 1YLVA 5A8GA 3OEXA 2HS6A 4YCOA 3LSCA 4N9BA 1ODZA 1XP3A 3APYA 1AH4A 3GUWA 4ZXLA 4GWEA 4J28A 3QV8A 4HQVA 2YYTA 4H2HA 3UZWA 2AAAA 4Z0SA 3GDLA 1V3IA 4NZFA 1NVMA 3SW6A 1VH7A 2A3EA 3VKAA 2YDSA 4DVOA 1FWAC 1MZRA 3QPZA 4GCXA 1KM2A 5C9ZA 1H5YA 1M04A 1FWFC 3TJXA 1PPIA 1VYRA 4HZ8A 3PFMA 2BGSA 2G3MA 2ZZ4A 3PB0A 3W83A 1V3LA 4MPKA 5D9NA 1W3LA 4J2MA 3R13A 2Y7GA 4PSRA 5GVJA 3UR5A 3MKVA 2O0TA 3DESA 1P7TB 1PKMA 5E70A 2J74A 1GYMA 3BPWA 4N4QA 4AIBA 1V5XA 3S4TA 3GTFA 5D4YA 4YTQA 1N2VA 2ZX9A 2VFGA 4C1NA 1C8QA 5C0QA 3SUVA 2VO5A 1ML1A 1TG7A 4GH3A 3WNNA 4AH7A 4ENLA 2PEVA 1OFDA 2PGFA 3WUFA 1VGAA 3OA5A 1GQLA 2BVDA 4R27A 1S2UA 1U33A 3WLOA 1WAUA 2ACQA 4GC4A 4XZWA 3HF3A 2VC9A 4IIBA 1G67A 4UFMA 1E9IA 5B7YA 1EP3A 3E96A 4MYAA 2O7QA 1Q6GA 4Y96A 3U2EA 1FWIC 2ZDSA 4HNOA 2VP8A 3GHTA 5H8MA 4LXFA 3FJLA 1QDSA 5I3GA 2H9AB 2QT3A 1SZFA 2VFHA 4PUMA 2O9RA 4Q8TA 1W56A 2NT1A 3IIXA 1PSCA 1DXIA 3SAZA 3S2CA 4P8WA 3VGHA 4IJCA 1HKWA 3AXXA 5BZAA 3M0VA 4GY7A 1AZ2A 5AHIA 3AISA 2P0OA 4WIWA 1CIUA 3TC6A 3HB9A 4AC1X 4Q8MA 3H54A 3SQSA 1WXZA 3WNKA 2MNRA 1VD6A 3LBCA 2CWNA 4NX5A 3A21A 5TBOA 2B7PA 2Z1VA 4JZ5A 5CEWA 2QGYA 4HZ7A 1HTIA 3N12A 1GOQA 5A3HA 3QR1A 4ZOCA 1UPMB 1TIMA 3AZSA 2PI6A 1F3EA 3Q2DA 4BS0A 2WAGA 1NJJA 1UH3A 5F2MA 4YL2A 3ZWTA 2CLEA 4M6PA 3TVAA 1OFBA 3PZGA 3KHJA 3W1PA 1RSCA 2PU0A 3H22A 4R5EA 3O1NA 4UIOA 3QH2A 4JY9A 3UW6A 1TE1A 3SBFA 3PBVA 4UTUA 1ECQA 4PUJA 2EG6A 5C55A 2WZHA 2FZDA 4KIEA 4H04A 4QNEA 4HTYA 4ZGYA 4EPKA 1XXXA 3GK0A 1AMKA 2HVNA 3B8IA 1TCDA 3FNDA 1NF7A 3D46A 3FXGA 3IIZA 4PTMA 4QDWA 2ZVRA 2DIJA 1ME8A 2PLMA 2H8XA 3G1RA 1JFHA 4CU8A 4Z2KA 1WKFA 3BGJA 4NJKA 1R9YA 4YN5A 3O16A 1E4NA 2WPBA 3S47A 3KBWA 4Q3MA 3M7WA 4C7FA 4J40A 4M24A 2J8FA 1XKJA 1K7XA 1ZJBA 2E6YA 3MCNA 3WUBA 2GQ8A 5I3KA 1FCUA 1TIWA 3HV9A 3W07A 1B9ZA 1DWJM 2CPUA 4GKTA 4S23A 1C90A 1E70M 1SM9A 2HNHA 1TVPA 1NELA 2P76A 1F07A 1US2A 1W1ZA 1J8VA 2OKTA 4Q22A 3UWZA 1QHZA 2VENA 3GTIA 2H8ZA 1UOZA 4KH2A 2VZSA 4B5VA 4F0SA 3VK5A 1UR4A 4CQAA 5E6YA 5A69A 4MZ1A 1N82A 1JQVA 4R3UA 4YHEA 3ZT7A 3AUOA 1RP9A 1ZCOA 5I5RA 1XLDA 4RJEA 1UBPC 3AO0A 5FSDC 4LV9A 4ZOEA 1J12A 3PP7A 1ISYA 3M0ZA 3NPWA 4HNVA 3BJFA 3EEZA 3S1UA 1LLZA 1EA0A 2QEZA 3KVLA 1GKQA 1XI3A 4JCMA 2V5BA 1Z3NA 2ZCGA 5E93A 2VX7A 1R85A 4F0MA 3H55A 2GFTA 4XZLX 5FJJA 3WQEA 3UXKA 3UYCA 3TJIA 2TODA 1EEXA 4S2CA 3TR2A 4KQNA 3APTA 4BF9A 4NYYA 3H4WA 3NTYA 2BZNA 5FI8A 4NP7A 5KZ6A 1FBAA 1HW6A 1CXLA 4DIAA 4OUEA 2NXGA 2D22A 1TWWA 3SIMA 2O4MA 4W86A 3AMCA 1U83A 4Q8NA 1OCJA 1WXYA 2VRKA 5EU9A 1W31A 2JKAA 1QO5A 3WD0A 5BXRA 5C8BB 2QUNA 4KMQA 1UWAA 1D2KA 3QR3A 5IOBA 4A3QA 2PWVA 3F5JA 3W76A 3O6YX 3KTXA 1OD0A 4IUOA 4D71A 1IWAA 2WOQA 2D69A 2VFEA 4TVUA 2CLMA 2J4GA 3EX1A 4IPPA 2ZWZA 2A0NA 1BWLA 2FH8A 3NOEA 3T0BA 2I16A 4DO4A 4B5NA 1QPKA 2Y85A 2NVDA 2C0AA 3EOEA 4FS9A 1TVLA 3SJ3A 4EANA 3LI0A 1UPPA 2XH4A 3PPGA 3GYCA 2BOFX 4QM1A 4PCPA 4MZ8A 2W63A 4ORMA 4NI8A 4JFWA 2XVGA 2QMKA 4BK9A 4KRZA 1PO9A 1DVJA 3EMQA 4HMCA 4UTJA 1OGBA 1S5MA 4OV4A 2NXHA 3LNMA 4AD3A 1GWJA 3VI2A 2VFFA 2HQAA 3FYOA 1WPCA 3PS7A 5T9CE 1L6FA 1OGSA 1FP9A 1YDYA 4LS2A 1PS9A 1GVYA 4PMNA 3E6EA 4BEUA 4QLJA 4KS0A 4UMCA 5LHFA 4NSBA 2VGIA 5IFTA 4J5NA 4I9AA 3NGFA 5HK4A 5K7JA 4NIRA 1V3JA 3MYPA 4XZBA 5JBDA 2JIEA 2EJ1A 2RDWA 4CN4A 3NXFA 3VKJA 4UOJA 2A1YA 1S3TC 3P74A 4DXKA 1B3ZA 3WK2A 4XSLA 1MWOA 3QKEA 4KGJA 3GXMA 1TA3A 3MKKA 4D72A 2QUMA 1B54A 3WN6A 2CZFA 4M51A 2DDXA 3MUIA 3MJYA 5D30A 1O1HA 5LIKX 2R1PA 3KZSA 2VURA 3KVMA 4XD6A 2PD5A 2UY5A 3E0LA 2NZLA 1TPVA 3AXIA 3G3MA 1MNZA 1IHIA 1UKPA 1Y8BA 4F66A 3L5LA 5FJTA 4RXGA 4PMVA 3KBMA 3OZYA 4Z1BA 4FF5A 4KCWA 3TSBA 2C71A 1A5KC 3MMUA 5CPTA 5EGRA 4ATWA 1F9CA 4J4KA 3URQA 3K4AA 2CLPA 4J27A 3ITGA 4GQRA 3UXDA 2OZ3A 3FOKA 3QGVA 2VD9A 3TR9A 1K1DA 3G18A 4AWUA 4NNBA 2J47A 3E02A 4KWWA 1UR2A 1K70A 2C15A 5ENLA 2IPFA 3M16A 3LLXA 1S5NA 1J6OA 3SY8A 3WJXA 4EF9A 1K03A 3U57A 2ZXQA 4O16A 4QDMA 4HPXA 3MTWA 5CSRA 3W71A 3R6IA 1PDYA 2HVMA 3VILA 4JYDA 1EJ7L 2XGZA 1G9HA 5AHEA 7PTDA 3HMCA 3HPZA 4H3DA 3TYEA 3S6TA 3KFTA 3G1FA 3KS5A 4JFUA 1GVRA 2OELA 3GIPA 1IE7C 1LQAA 3NDZA 3GVGA 1XV8A 4RE0A 4GVFA 2AKZA 2GLKA 1FWSA 3GS6A 4PTDA 3PBWA 3FYPA 2R1LA 4AF0B 5LIWX 3QMTA 1PUDA 2CBIA 4REQB 4HMDA 3QZEA 4WD0A 5CPSA 3TSDA 4HYVA 2CBUA 1CCWB 4NZ4A 3UG5A 4EKJA 3FHQA 1J9YA 3C2EA 2DU2A 3T0DA 1AW2A 4DM2A 1E40A 1A3HA 1B9BA 4IG2B 4LFYA 3CQIA 2DGAA 3W84A 1FWRA 1PJ9A 4LPCA 1H1YA 2ZC1A 1A80A 3T0TA 1B1YA 4UCGA 3W29A 2A7PA 3GXPA 4CNNA 4BF7A 5I03A 1PXGA 4HMNA 3SN1A 2UY3A 3LBMA 1XJBA 1QI0A 3UJSA 4FNUA 5LZLA 3QYSA 4NX0A 3MVTA 3VIGA 3GXTA 4MUPA 4ZZ9A 1ALDA 2DH3A 4RNIA 1T96A 2PFHA 1V51A 5JQ9A 2CLFA 4XO7A 1AODA 1YNYA 3VMNA 1V08A 3U6WA 3L5AA 3ARUA 2DSKA 3Q67A 4NL1A 2VEFA 3T40A 2DEPA 3L2IA 3W7IA 1QW9A 3SRKA 4GUFA 3GNXA 3PZNA 3VKBA 1V0KA 3QR0A 3BZGA 3PSVA 1H3GA 4GOAA 4K68A 2DIEA 2QR6A 4ML9A 2VDGA 3B8VA 4XV0A 3SRFA 3A24A 5A6BD 3WCZA 3TONA 5MKGB 2E4TA 1KFEA 3H26A 3MO7A 1DHPA 3WDPP 4HNLA 4GINA 4P8XA 4A8RA 3IGHX 3M46A 4IGMA 2OTDA 3WLLA 1EQCA 3TCEA 4IMGA 1FDYA 1A5UA 2I9UA 3AUJA 2DSZA 3GU9A 4NG3A 3UVIA 3G3DA 3CWHA 2A3CA 4ZB2A 2R24A 2JFEX 3DI1A 2E5DA 2ZUWA 5DBTA 2AAMA 3OQ8A 4AZCB 1BQGA 1T99A 4IFKB 1QK2A 4LCSA 4O1DA 3DERA 1DBTA 3REQA 4IIEA 3C0QA 2FDMA 2A21A 4Q33A 5C9UA 3E49A 2BVYA 3BC9A 1A5NC 4WDXA 4WLCA 1SGJA 3VDBA 2X8RA 4S38A 1EDTA 3W26A 2QAPA 2BGNE 2YA2A 3WQ6A 1YE4A 1H5VA 4JQ4A 4EXQA 1YE6A 3ELFA 2OPJA 3IGXA 2D73A 2PGRA 4JKMA 5CZTA 4PUDA 4G5DA 4N42A 4C6QA 3ITYA 1E73M 1JRCA 1RPXA 3PAOA 3UA4A 3CS2A 3UXIA 2ZA3A 3L12A 3N3MA 3BK0A 5AVHA 1VJIA 5IM51 1J6PA 4UR9A 3W6LA 4DJEA 3OZMA 2WJZA 5JBFA 3RJXA 2EF9A 8A3HA 4CN1A 2NUYA 4S3AA 3ABQA 3L9CA 1GORA 3KM8A 3G2GA 3GM8A 4BCEA 5A2AA 4C91A 2WNZA 2QJNA 4FNSA 4MWAE 3SFWA 1E43A 1FHVA 2G3FA 3GDMA 3NL6A 4MVAA 4GVIA 1TRDA 5LNWA 2XH7A 3OHMB 3KCLA 2PLCA 3MB9A 3T81A 5FF4A 1H61A 3BLLA 1XRTA 1WKYA 2A85A 2ZTKA 3WNLA 1ISXA 1RQEA 2GUUA 1EPXA 4R53A 2X05A 4DAIA 4DXVA 3B40A 3MP3A 2Z0IA 1W3TA 3MHGA 3NZGA 1QTWA 4ACZB 2C79A 5L6UA 4EF8A 4XG1A 1IF2A 1TZ7A 1D8WA 1E1CB 1JVNA 3P0XA 1JCLA 3MUZ1 5CH9A 3CPUA 1W9PA 3W82A 3ZSSA 2WSYA 2HRWA 5FCZA 1FXPA 3WO8A 3EWYA 4MB4A 4M6VA 3VGBA 1WDPA 2A3HA 4LT9A 4PCSA 4X2RA 1QPQA 4H6QA 1TWDA 1Y5VA 4JIIX 4NHVA 4JTHA 2WW5A 3T05A 3WF3A 2QIWA 4O57A 4MWAA 4O0ZA 3RU8X 4H8VA 3TW6A 2ZUMA 2VFIA 2PPGA 4UTFA 3N18A 3TROA 3VZZA 1YXCA 4UTTC 2EXOA 2RUSA 4ZTXA 4RK8A 3HPAA 3QV7A 3S5YA 3W7MA 3ANYA 2DJLA 4AG0A 1KR0A 1KCLA 2CC0A 1OYCA 4YVPA 4DBDA 1R3RA 1XSIA 4JTJA 5D37A 4HKPA 2W6RA 3F5KA 1XBVA 3DHDA 3QRHA 2GK1B 4C1NB 3B8SA 4AX7A 1R3QA 4R7OA 1LUCA 3QM3A 3LG3A 2VEKA 1T5AA 2EQDA 3DIPA 3KWXA 4BI7A 4DJFA 3IJ7A 3TTEA 3PJXA 2CZ5A 4NI3A 3LPFA 3GRIA 2VEGA 3UWVA 6TIMA 4JDYA 4W5UA 4C6OA 3D6NA 1VCFA 5KINA 3HA1A 1F74A 2FMOA 4DWSC 3DC8A 3W2KA 2OQHA 2QW5A 2YCEA 2YKKA 1K8XA 1K9TA 4B5UA 3TQVA 3BG5A 3W24A 3LYEA 1XIJA 1R9ZA 4LYKA 3W3OA 1X8FA 4LC8A 2DUZA 3THQA 1UIPA 2Z6JA 3AIQA 1UYQA 4PRTA 4GYJA 4MNLA 1ZY9A 3CPRA 4G2DA 1DJHA 4IIGA 4BR1A 5EMKA 1UP2A 4L6HA 3WF2A 3AROA 4R85A 1KFKA 1D8CA 8CGTA 5B80A 1V0LA 1JYNA 4Q7IA 3SN0A 5FAJA 1TO3A 1G7VA 5DEZA 2QCHA 4PBGA 7CGTA 4OZOA 1XS2A 3W23A 3AZRA 3R25A 1Q7QA 4J3TA 5K3VA 1AG1O 3CIXA 3QXBA 1XH1A 1LP6A 1VBRA 5KETA 5KZMA 1XYLA 2E6FA 4WF7A 3CZJA 3VGGA 3EOSA 4KPLA 3QMSA 1F8MA 3TCSA 2WHKA