5D8WA

Structrue of a lucidum protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
324
structure length
324
Chain Sequence
LQFAGVNIAGFDFGCGSDGTCNASGAWPPLTQYYGADGAGQMKHFVDDDGFNVFRLPVGWQFITDGVAGGDIDEDNWAEYDALVQACLDAGASCIVDVHNYARFNGEIIGQGGPTNQDFAALWSSIAAKYADNDKIIFGVMNEPHDVPDINLWADSVQAAVTAIRQAGATSQIILLPGNNWTSAETFVSNGSADALKKVTNPDGSVTNLIFDVHKYLDSDNSGTHEECTTNNIDNAWAPLAEWLRCNGRQAFNTETGGGNVASCETFMCQQVAYQNANSDVFLGYVGWAAGNFYQGYVLGEVPTDTNGVWTDTALVSACLAPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase
publication title Functional and structural analyses of a 1,4-beta-endoglucanase from Ganoderma lucidum.
pubmed doi rcsb
source organism Ganoderma lucidum
total genus 112
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5d8wA00
1CYGA 4CVWA 1TR1A 1C8YA 3ZT5A 1TMQA 1UD3A 3WF0A 2E8YA 5FL0A 1KGUA 3RDKA 1H41A 4GXPA 1HT6A 4JL2A 4IISA 3UESA 3ZJ7A 3OG2A 2D3NA 3WNOA 5CSUA 2O9TA 4MB1A 1GOMA 1KQYA 4E8DA 2WBGA 4PYSA 3RPMA 5A6MA 1JYXA 3GXDA 2DSWA 2VO5A 4MB5A 2Y24A 1W9BM 2AMGA 1UG6A 1CGVA 4QLKA 1U33A 3TTYA 2ZUVA 2GUYA 1OT1A 3IJ7A 4NRRA 5FKYA 3VO0A 3I3DA 4JKKA 4LYPA 1TE1A 2IXUA 3BSHA 3NJ3A 1NWRA 4CN1A 1M01A 3WH9A 3VTRA 4RE2A 4GINA 3MU7A 5DF0A 3G6LA 4AZCB 4AZBA 4BQ2A 4FLSA 2J7GA 2W5FA 3AXHA 1E4MM 3CBWA 4DWSB 1E71M 3ARPA 2W67A 3PZNA 4MNJA 1LL4A 7TAAA 1HF6A 2O9RA 4XZWA 3GBEA 4JIEA 2VX7A 3DYPA 1EDQA 3CTTA 1J10A 2IUZA 5CSYA 3MANA 3CHEA 4KH2A 4AD5A 3BLKA 2D22A 3CZEA 3OZOA 1ZB5A 4HP5A 3WNPA 3BAWA 1JDAA 4V2XA 3RM8A 5JIPA 3L2MA 1W91A 3WENA 2VNCA 3MV11 4OOZA 2A3CA 2OSXA 1CGTA 2O9PA 2D0FA 3TP4A 1EDGA 2EJ1A 1C3FA 1BHGA 3WF1A 2J7FA 4F66A 1J0HA 1E56A 4MJ4A 5CZKA 5BYWA 2DSUA 2XYLA 1VFMA 4BQ5A 2EPNA 7CGTA 3SURA 1W3LA 3WUGA 4TTGA 4JKMA 2WHKA 3OGRA 3THDA 5BCAA 1OCQA 1VFOA 2WVUA 1C8QA 1CECA 2FHFA 2WBKA 1K9TA 1KBKA 3VD4A 2DIJA 3EDFA 2GDUA 1G5AA 4H8HA 4MPKA 3CO4A 2E9BA 3AIUA 4JZ5A 2IXVA 2VZUA 4PMOA 2VRQA 3VGEA 4AEFA 5I23A 4PUDA 3OGVA 1JIBA 3VD3A 1ODZA 4UQCA 5CLTA 3SUSA 5A94A 2XM1A 2G3JA 4E4PA 1V6XA 3AISA 5A95A 1PIGA 2XVLA 1CTNA 2C8NA 4AZIA 4CCEA 2GK1A 3PN8A 3WIJA 1QNQA 4M82A 2OSWA 3WEMA 5ABHA 2VZVA 1C93A 3N18A 2OWXA 4UFLA 3ZJ8A 2OYMA 4EKJA 2WMIB 2WHLA 1BG9A 1W3KA 3UG3A 1E3XA 4DWSA 5C70A 2GJXB 3SUTA 2VR4A 1GQKA 3MMWA 4PSPA 1JD9A 1UZ1A 3EMCA 1IZJA 3GBDA 2BS9A 3BAXA 4UZUA 1XV8A 4WKAA 1KGWA 4N0RA 4JCLA 1JAEA 4FF5A 2CNCA 5DT7A 4J3SA 4A3HA 5IDIA 4D6FA 1OWQA 3AZRA 1WDRA 2A3EA 2QPSA 3BCDA 5F7UA 4TOQA 5BWFA 4TVUA 3VIFA 4MADA 3UR8A 4ZEPA 3CIVA 1W3JA 1E9LA 1XYFA 3U57A 2CPUA 4CD7A 4PMRA 4UFJA 1VEMA 1C92A 4BZYA 1BAGA 1CXFA 3VGBA 5D9PA 1JYVA 2D0GA 3KEHA 1UR9A 2D2OA 3CMJA 4FMVA 1NOUA 5BXSA 2GSJA 4LQ1A 4D6DA 1XRVA 5HXMA 1XGZA 5IFTA 1OINA 3AS3A 5CPTA 1LJYA 2WHJA 4PTVA 2W4XA 1XCWA 1E4IA 3OGSA 3ZO9A 5A8NA 1QHPA 1HJXA 3WNLA 1UH4A 3AIQA 1TFVA 3VDCA 1CXIA 1F4HA 1GONA 1B90A 1V02A 4PMYA 5C8BB 3WBAA 1QW8A 1H2JA 5A6JA 4D6HA 3PZIA 4HMEA 1UYQA 2VCAA 4BQ3A 3CLWA 3CPUA 1V3JA 1XH2A 1JZ5A 3ZOAA 2WMIA 3KZSA 2XJ7A 1GW1A 2ZUWA 1CXLA 1W2PA 5HBFA 2JE8A 2DEPA 3NDYA 2FDMA 2VQTA 3WMBA 2WZEA 1XYZA 4W85A 3VM5A 3U5UA 4U3CA 1NWUA 3VIPA 1HXJA 2BVDA 3CZJA 1ZJAA 1VRXA 2DH2A 1OD0A 3AZSA 2V3EA 2DSKA 2GFTA 3VMNA 2EQDA 2W92A 2J75A 2VURA 3THCA 2CKSA 3I3EA 3WDJA 1BSIA 2A3HA 1D2KA 1XC6A 3FHQA 3T2QA 4L4PA 1KR0A 2WMFA 5A6SA 1MW2A 2YL5A 2VZSA 3W82A 4X0NA 1OGBA 3L4VA 1JZ7A 1G1YA 3CUJA 3AYSA 3HN3A 1AQHA 1E6NA 3WF2A 4W5ZA 1ISZA 2YBTA 3CHFA 3N04A 4DM2A 4MJ2A 2ZX5A 1UR8A 3OLEA 3PZOA 2ZUUA 5EFDA 2OWWA 2DGAA 3DHUA 3GZAA 4UQ9A 1HKIA 2WMGA 1LG2A 1TA3B 1H3GA 4JFSA 3L4YA 2F2HA 3WH5A 3PZ9A 5EFFA 2YL9A 2PI6A 2JIWA 1HKMA 1X6NA 2EPOA 4YHEA 1UKPA 1JAKA 1VBUA 2HISA 3G6MA 1R8LA 2UY3A 4MNMA 3QHNA 4E2OA 5LA0A 5A8PA 3WFLA 3ZJKA 3VMPA 1DTUA 3W4RA 3SUWA 2YL8A 1UQZA 4AIOA 3ARUA 4OOUA 1ISWA 2CBIA 3SCQA 4GPNA 3AIRA 3IANA 3FW6A 2QMJA 3IJ8A 1NP2A 1W9VA 3MUIA 4J27A 1GOOA 4F8XA 1VJSA 4URIA 3EDKA 1QI5A 1WZLA 3PZUA 4W88A 1NWSA 3ARVA 4EANA 4U5KA 2E8ZA 3VGHA 3WBEA 1OD8A 4UR9A 1QVBA 1JZ2A 2VR5A 5ABGA 1GZJA 4HTYA 3VNZA 1R7OA 5A6BA 1B3VA 1QI4A 3NIYA 4MAVA 5FCZA 3OIHA 3BGAA 2XWDA 3SEPA 1ESWA 4M80A 5A8OA 4UQBA 1CENA 2V38A 2WVVB 3GH4A 4UQEA 5D9OA 3WMCA 1ITXA 4CCDA 4EE9A 2J8FA 1Q6EA 3MUZ1 4BS0A 1FH8A 2XG9A 3OLIA 1JDCA 3ZMRA 4FLQA 1J12A 1UWTA 4Z2IA 5LYRA 4GQRA 3ZIZA 5EBAA 9CGTA 4PEEA 1GHSA 1FP9A 4D6EA 2G3IA 1TA3A 3B9AA 1E0VA 2UY5A 2BY1A 1HL9A 4WSKA 3U7VA 3PZQA 1FFQA 4IM4A 4JHOA 3CH9A 5LA2A 3FY1A 3VUPA 3WELA 2DSVA 5KEZA 3VOCA 3RCNA 4KGLA 3APGA 1HJVA 2DT1A 4Z2HA 1M7XA 4CU8A 1NOFA 3RJYA 3AHZA 1Q6DA 1YQ2A 3QOKA 2E3ZA 3GM8A 5CJ5A 2DT0A 1F4AA 1M04A 3OA5A 4HA1A 2X8RA 4AIUA 4Z2JA 2XM2A 2CITA 2YDRA 1E5NA 1MXGA 3FXYA 3PZMA 4GO9A 2WSPA 5M17A 4CGTA 4HZ6A 4UOQA 4HOWA 1EDTA 1Q6CA 3ARQA 4H8UA 3WY1A 2QPUA 2DT2A 4AWEA 2QMKA 4AD3A 1OIFA 3W53A 4CCCA 2VL4A 1EHNA 4J28A 3GXFA 1G94A 4GQQA 1CGWA 2EPLX 1XHGA 3WH6A 4J3WA 2CBUA 2VX4A 1KR1A 3TTOA 3BH4A 2DSZA 4W87A 1WPCA 1KWGA 1CXHA 1GJWA 3B8SA 5I77A 4KMQA 1CNVA 5CQ1A 3UR7A 1V0KA 3KWXA 5DO8A 1V08A 1CGYA 4H7VA 3BLPX 2E9LA 3UCQA 3MV01 3WF4A 2CBJA 2VJXA 2BV9A 2X0HA 4CN6A 1U30A 2V3DA 1BPLB 4ML4A 1EQCA 4MDPA 1WNOA 2BXZA 1XD0A 4MNKA 1EOKA 1NQ6A 3N9KA 1R85A 2UY4A 4A3YA 3GYCA 1HJUA 2CIPA 3TOPA 1H49A 3GNRA 3O9NA 5D8ZA 4C7FA 2BY0A 1JZ6A 1IV8A 2ZX7A 4PTXA 4FLRA 1IZKA 2WLZA 2QV4A 1DWJM 1E73M 1KXVA 1VFUA 3W27A 2PC8A 2YL6A 3CHDA 3VGGA 3ZM8A 2RGLA 4AYSA 1KCLA 2WC4A 1BQCA 4QAWA 2J7EA 4GZEA 1BFNA 2J7DA 1HJQA 1XSKA 3VD7A 3HMCA 5E0CA 1W9UA 1H5VA 1JNDA 4AC1X 2XIBA 4OKDA 3WL0A 1J11A 2WCSA 1UD4A 4HMDA 2NW0A 1EA9C 3K8LA 3A47A 1UR4A 2F61A 4AD4A 1CIUA 3SCPA 1RD6A 1ZBVA 4UCFA 3W0KA 2OLHA 2G41A 4DWSD 1C90A 4H8VA 5JUVA 1BF2A 4D1JA 1A3HA 1UKSA 4JFWA 5FIPA 1UWSA 1UA7A 3AHTA 1EGZA 1B1YA 3CUFA 3LPGA 3OBAA 1C7SA 1E4LA 2E4TA 1J0YA 3ZSTA 4CD6A 3RIKA 2GJPA 1MW0A 1JI2A 3AS0A 4AEEA 2ZXDA 3BAJA 3DYOA 2ZX6A 2NSXA 4C7GA 5M03A 3WUFA 3WNNA 3AHXA 3F4VA 3D5HA 4LGXA 4V28A 2J77A 4JFTA 1J0KA 4WLCA 1XSIA 1WO2A 1E3ZA 1EOMA 2W61A 3OB8A 4GO8A 1J9YA 3GXMA 5D9MA 4AZ6A 1W9DM 4U2ZA 3RO8A 2WMJA 6CGTA 1DWFM 1I75A 3PZVA 5HPOA 4U5IA 2WCAA 5A1AA 4LYRA 2J47A 4AZCA 1WZMA 4GI6A 3W38A 2ZWYA 1Q6FA 2ZXAA 4NSBA 3ALFA 3QHMA 3SCNA 4WKHA 3T2OA 1V3IA 4PN2A 4P7NA 3SIMA 3NSNA 1OB0A 5BRPA 4JKLA 3EMZA 4B3LA 1UUQA 2X05A 3IAQA 4BF7A 3TA9A 3WNKA 4W5UA 2XIIA 2ZOXA 4HZ8A 5AY7A 3F5JA 1E6PA 3E1F1 2OYKA 2VQUA 5CPQA 1GVYA 3WD3A 2D20A 3PZTA 4R27A 1WE5A 3CMGA 2Y8KA 1TG7A 4UFKA 3AXXA 1EHAA 1K6AA 1LLOA 3RM4A 4GI9A 3W26A 5AC4A 1BTCA 4AD2A 2WC3A 2WZHA 2J8GA 1PBGA 2WHMA 4UNIA 3TONA 3T2PA 2FGZA 1FHLA 1UH3A 3EDJA 1GOQA 1FHDA 4AZ5A 1B3YA 1LL7A 3WQWA 1DHKA 1KXQA 1ZL1A 1JD7A 3W25A 3AFBA 3O2LA 1E1FA 3M07A 4X0VA 5IHSA 1RH9A 2XFYA 3W37A 1ZS2A 4AD0A 2YDSA 2W66A 3VILA 3IJ9A 1CBGA 4LYQA 3M7SA 1UD2A 4D6IA 4NZCA 4IPLA 1ISXA 1E5JA 1PX3A 2XVNA 4P7LA 3ARSA 3VD5A 1PX4A 3WL1A 2Z1SA 2WKGA 3AXIA 1W1VA 4PMQA 4HOZA 3AMGA 5LA1A 1CXKA 1V3LA 2DDXA 3N1AA 1E0XA 4X9YA 1MVYA 1VF8A 2DT3A 3PTQA 5A3HA 3PZGA 5GNXA 3W6MA 1I1XA 4JFVA 4UQDA 1GORA 3PHAA 4CD4A 2C0HA 5JBFA 2JFEX 1ZBCA 3JUGA 3AS1A 4ZXOA 2XUCA 4DUXA 1WB0A 1B3WA 2QHAA 3SCRA 5TD4A 3HJEA 2GJXA 3AICA 1WDSA 2WKLA 3SUVA 4UOJA 1IT0A 4AISA 3F5LA 4NI3A 3WH8A 4HU0A 4AMCA 2VI0A 5CXPA 3BAIA 2XVPA 1GNXA 1XH1A 1CWYA 2V3FA 3WEOA 1JG9A 5D4YA 4PMZA 1FH9A 1HP5A 1MYRA 4MAZA 4QCFA 2VT0A 1UWQA 3WEZA 3GTNA 3AI0A 4AW7A 2JIEA 3CZKA 4AZHA 4PUEA 4KWUA 1AVAA 3VU2A 4QCEA 1MXDA 2GJRA 3O6AA 3BMVA 3A4WA 1UD6A 2YLLA 1V6UA 2E9MA 4PRWA 3LMYA 2NT1A 1G0CA 3DHPA 3WQ4A 1TUXA 1UOKA 1UQYA 1V0MA 3A3HA 1MQPA 2XHYA 4MNLA 5I0DA 4W84A 4M56A 1JL8A 4Z2KA 1GQJA 3WFZA 3WDIA 3VM7A 3N11A 4P8WA 4V27A 4HPHA 1GCYA 1UH2A 3L4TA 3DECA 5HPCA 4PCSA 4U3AA 2J78A 4GKLA 2G3MA 1W1TA 3BXWA 2D1ZA 2D23A 4FLOA 1ZJBA 1O7AA 5A6BD 1H4PA 3WH7A 4B9ZA 1G01A 4BCEA 4P8VA 3BSGA 4AY1A 1M53A 3AMCA 2FH8A 3UG4A 4PTMA 1ZBKA 1GOIA 2X2YA 4U33A 1MW1A 1C91A 5GPRA 1QNOA 1BYAA 3VIMA 5IHRA 1E40A 3AIVA 3ARTA 1VAHA 3CZ8A 4K68A 3IAPA 3WUEA 2J79A 3TTQA 4XX6A 1JXJA 1MWOA 2YA1A 3FNDA 1R86A 4B16A 3L4ZA 3N17A 5D9NA 4AD1A 2ZUSA 2VZTA 1AQMA 3ARRA 1DWHM 1OM0A 2WC7A 1E1EA 1A47A 4XZBA 2VX5A 5E9AA 1TCMA 1D7FA 4ACZB 2F8QA 1WZKA 1X6LA 2W63A 3NYDA 4H04A 4ZENA 1UWUA 3WDHA 5I6SA 2JEQA 1WDPA 3N13A 5BROA 3QR3A 3RILA 3WQVA 1SMDA 1FOBA 4S3JA 3QHOA 4B9YA 1BGAA 1H1NA 5I2UA 4NRSA 4PMVA 2Y8VA 4TVCA 2V5DA 3CZGA 1E55A 3L4XA 4QFUA 1VFFA 4IUGA 2WM0A 2C7FA 4ZXLA 3CHCA 1HKJA 4JHZA 5KZ6A 3II1A 3KL0A 4J3VA 3BMWA 1H11A 1JF6A 3CUIA 2ZX9A 4RE3A 4QDMA 1W32A 4PTWA 2CXGA 2RGMA 3K8MA 5JBEA 2FHCA 2ZE0A 1JZ8A 2XGBA 1UKQA 1KBBA 2VRJA 3KL3A 1KWKA 3T09A 2BHZA 4DM1A 3BC9A 1HN1A 1MW3A 3AIWA 4LXFA 1S46A 4WF7A 3VDBA 2VC9A 1UD8A 3NDZA 4LPCA 4J3UA 2ZXQA 1GVIA 1JZ3A 1H09A 1E15A 2XSBA 4BQ4A 4BA0A 5DEZA 2UWFA 5EB8A 4GIAA 2JALA 3N15A 3WN6A 1FFRA 1TVPA 3MSDA 2ZXBA 4PMXA 1V02E 1HVXA 4QP0A 2OWCA 2XSAA 5D8WA 4M29A 3AMDA 1OGSA 4HOXA 1E4NA 4CU7A 3MUAA 5BXTA 3MS8A 5CGMA 3UERA 1LF1A 4S3KA 4UFHA 2WANA 1UR0A 1JYNA 3W81A 1QHOA 3CUGA 4ACZA 4KRUA 1J01A 4D72A 1P6WA 1SMAA 5A2AA 3AHYA 1CZ1A 2VRKA 1GOWA 5M5DA 3CUHA 4WKFA 4CUCA 3T0DA 4JAWA 1SFSA 3GH7A 1QI3A 2PWDA 2WYSA 2CERA 4AXNA 1WCGA 3MMUA 3I3BA 5A6AA 3VNYA 1LWJA 2BXYA 1QI2A 2WVVA 1HL8A 4HA4A 4W8BA 2GDVA 1B0IA 1HJWA 4F79A 4M24A 2YOCA 1QI0A 2Q8XA 4PBGA 3WKZA 2WZIA 3T0BA 3VGFA 4GI8A 3SUUA 4Y7EA 1AMYA 3MMDA 2G8ZA 3QGVA 1QHZA 1E6QM 1V03A 1EO7A 3ECQA 4C7DA 3A6OA 2ZUNA 2WVSA 5FL1A 2WB5A 2EXOA 1GQIA 3W24A 3POCA 1B9ZA 4Z2LA 2BFGA 2UY2A 4M81A 1WZAA 1FP8A 1BG4A 1OBAA 3T08A 5HDRA 2CESA 3PBGA 3AIBA 5CPSA 5BRQA 3AZTA 3AROA 3MO4A 5AYIA 2CEQA 3QOMA 4XB3A 3AMKA 1JDDA 1PJ9A 5BXRA 2PBOA 2Y2WA 5A8QA 1HIZA 4KRTA 2GK1B 3SCTA 4FK9A 1W9PA 1V0NA 3KE0A 1R87A 1RP9A 5FD0A 4U2YA 4OZOA 1D3CA 1M03A 5A2BA 4AIEA 3EMQA 1WAWA 2YKKA 2E0PA 5JBDA 1PPIA 3AS2A 5E6ZA 2XVGA 5IFPA 2Y4SA 4EAMA 2PWGA 4U31A 1V3MA 2JF6A 3VMOA 3UG5A 1J0JA 1O6IA 2ZUMA 4TUFA 2BVTA 4M1RA 1KXTA 3WD0A 1HKKA 4P7QA 3ZT6A 4HA3A 2JF7A 2EPMX 2VMFA 2G3NA 4JFUA 2XTKA 3RM9A 6TAAA 5A6KA 2ZX8A 2VTFA 3T0AA 4UTFA 7A3HA 3AHVA 1H0IA 2VCCA 1XCXA 4UQAA 2X09A 2PWHA 2XVKA 2D0HA 4L4OA 3ARWA 4QLLA 3K8KA 2A3AA 4OUEA 3VPLA 3POHA 5ABFB 1VB9A 2TAAA 2PB1A 1WP6A 3UETA 2BHYA 2BY3A 3FAWA 2J4GA 5CG0A 1BVZA 3VX0A 1QOXA 1ZBWA 3TTSA 2WWCA 1PEZA 4P8UA 4D6CA 1B3ZA 1W1PA 1QBBA 1VEOA 1WDQA 3ALGA 4MB3A 3SCUA 2BVYA 1KFWA 1XSJA 3L4WA 1JF5A 2WMKA 1LG1A 3NSXA 4TXEA 4YHGA 1QPKA 4ZFMA 4CKQA 4B15A 1BLIA 4AZGA 1NARA 1G9HA 4B3KA 6A3HA 3WSUA 4XV0A 1E6RA 2J7CA 2WVTA 1MFUA 1EQPA 2CCRA 1Z32X 5ECUA 2XWEA 1MFVA 2CKRA 1JFXA 1MQRA 4W93A 1PZ2A 2AOSA 1PX8A 4ACYA 4N42A 5JIWA 1UR1A 1GJUA 3NSMA 2CYGA 3EDEA 4H2CA 2CHOA 3ARZA 3K1DA 3WD4A 2CBVA 3M46A 1U2YA 3U5YA 4M8UA 2QF8A 4H41A 1V0LA 1TZ7A 1TVNA 4OJYA 2WMHA 1US3A 5GNYA 3VIJA 3J7HA 3WDRA 1OIMA 2J62A 3KL5A 4P7RA 4W7WA 4D71A 1E0WA 2DQXA 3WF3A 4F9DA 1B2YA 3VIKA 5DMYA 1E43A 2EBNA 4ZE5A 1JNEA 1UZ4A 1JZ4A 1J18A 3VKKA 1J0IA 1WKYA 4F9JA 2XGIA 1DWAM 1NP0A 2WAGA 1Y7VA 2PWFA 2O9OA 2ESCA 4YN5A 4CVUA 3BCFA 1GPFA 1CXEA 1LL6A 1NWTA 5DFAA 4OBRA 4CD8A 3OLGA 2OSYA 5ABFA 2EEXA 3RJXA 2YA2A 1DWIM 5IXEA 1PZ3A 3LPOA 4A4AA 4PCTA 3EBVA 3VDAA 2YBUA 3GDBA 1UWRA 3VD9A 1E6SM 2XPKA 1QNRA 2YJQA 1OT2A 1DWGM 1Q6GA 3CZLA 4WK9A 2VX6A 3PTKA 4CN4A 3BAYA 4OIFA 1KQZA 5A8MA 1DP0A 2W62A 2Z1KA 1AQ0A 3K46A 3WD1A 1H0GA 1PAMA 4D6GA 2VVSA 3RMEA 2DIEA 4MTVA 5E70A 1GQLA 1Q4NX 3AYRA 1V6VA 4RE4A 1HX0A 4HMCA 4W8LA 4MDOA 1E6XM 3L2LA 3WDQA 3WUBA 3LPPA 8A3HA 4Z2GA 3HU7A 3WDPP 3VVGA 2VCBA 2CETA 3VIOA 3N12A 3SCVA 5A2CA 3SCSA 3CGTA 3W28A 4HPGA 1B3XA 2DPEA 1ODUA 3ZR5A 2J25A 3IK2A 3WMSA 1DEDA 1CEOA 1GOKA 4PMNA 5GNZA 2W91A 1V6WA 1W3HA 2NT0A 4LX4A 2ZUTA 2MANA 5HNNA 2EPKX 2WCGA 3LPFA 3PTMA 1KGXA 1W2VA 3ZT7A 1PIFA 3UEQA 4YPJA 1EO5A 1VBRA 4IPNB 2PBGA 3K4DA 2J7BA 2FGLA 4UOZA 8CGTA 4E8CA 1QW9A 4W89A 4ATLA 1V6YA 2X1IA 1QBAA 1UA3A 1BGGA 1US2A 2WWDA 1E70M 3WD2A 3S2CA 1JFHA 1MQQA 1CPUA 1FH7A 1EH9A 2G4FA 3VIIA 1X1NA 3WQ6A 4MB4A 2FHBA 4W7VA 5EMYA 3VINA 5E6YA 3EDDA 1CDGA 2YLAA 4NF7A 4QLJA 3WNMA 4UFIA 2PWEA 3EYPA 2Y5EA 1OGGA 2WLYA 3F5KA 3DC0A 1SYTA 1C8XA 1VJZA 2WPGA 4TX6A 4AZ7A 5I24A 1ISVA 2WW5A 1HNYA 1ISYA 1NH6A 4TTUA 4ATWA 3WQ5A 1ITCA 2YA0A 1KCKA 5A6LA 3ZSSA 2XFRA 3A4XA 5I5RA 1FA2A 1UWIA 1B31A 2J7HA 1QNSA 2AAAA 3K4AA 3AOFA 1ZU8A 1L0PA 2D3LA 4WJXA 4R5EA 1EIBA 2VUYA 3FAXA 5A69A 1GHRA 1UKOA 3VDHA 2CHNA 1BVNP 4TVDA 1SR0A 3WQ8A 2VVNA 1XH0A 1K9EA 3OLDA 3VIGA 5I3DA 3A4AA 1KB3A 5I78A 2WK2A 5CGTA 1CLVA 4J3XA 5CLWA 3B9EA 5C71A 4PMDA 3AJ7A 4PMUA 2EO7A 1KXHA 1J0ZA 1VEPA 1V3HA 2OYLA 4ZE4A 4XUYA 1B30A 3ARXA 4UFMA 2WNWA 2ZIDA 1LQ0A 2O92A 1HP4A 2FH6A 1E6ZA 2YIHA 3NUKA 5DT5A 4D1IA 3AQUA 4W8AA 2YDQA 3ARYA 1BYCA 2DH3A 2V5CA 1RP8A 3ZR6A 1L8NA 3FN9A 3ZJ6A 4WIWA 1CGUA 1HVQA 4J7RA 1W1YA 3S6TA 3GNOA 2BNJA 2ZWZA 3FHAA 1JI1A 3B9DA 2D24A 2JEPA 5ABEA 3DYMA 3U7BA 4JCMA 2ZICA 5E09A 3VIHA 1JXKA 1NOWA 1JGIA 1VENA 3W6LA 3MSGA 4Q7NA 4HZ7A 1UHVA 3W29A 3MKKA 4GZJA 4RL3A 5FOOA 4W86A 3AMLA 1NM9A 4UZSA 1K9DA 2A3BA 4Q22A 2VZOA 1ECEA 2QLYA 3L4UA 2WSKA 1OSEA 1VIWA 3SCOA 2WXDM 4GZIA 5I79A 3D3AA 4HU8A 1QNPA 3AIEA 3GXIA 4D6JA 2GVYA 3GH5A 4WSJA 2XFFA 3VX1A 1W9XA 1C7TA 4P7OA 3M6DA 3ZQ9A 1HJSA 2HVMA 4CU6A 1BYDA 1GUVA 4KGJA 4OBSA 3SCWA 5AC5A 3VGDA 4W7UA 2BY2A 1LWHA 5GQBA 4J3TA 1XD1A 3OZPA 1YHTA 1JYWA 1UKTA 4DUVA 4P8XA 2BHUA 4EK7A 1RPKA 4ATDA 2J74A 2B31A 4PSRA 1BYBA 1CGXA 5E0FA 3BAKA 1V3KA 5HOSA 1UR2A 3MUY1 4JL1A 4CD5A 5BXPA 1EXPA 2X0YA 4DWSC 1I1WA 1CLXA 5M3WA 3GNPA 4DUWA 1UD5A 3NCOA 2E40A 2VOTA 5AYBA 2PF0A 1R7AA 4TX8A 1E72M 1N82A 1K9FA 2V3GA
chains in the Genus database with same CATH superfamily
5CC6A 4RDZA 3W1NA 1UD3A 2R24A 5FL0A 3B8DA 4XTIA 3H2CA 1JCJA 3B03A 3GFZA 3TN6A 3RLVA 2EG8A 3CM4A 3UESA 1QR7A 3OBEA 5FEWA 3OG2A 3BICA 2D3NA 3L12A 3K4WA 3WNOA 2GGIA 2ZTKA 4M7SA 3CQIA 1W3TA 5LGXA 1Z48A 3HV9A 4PYSA 3LENA 2PZNA 5A6MA 1X39A 1P6BA 3MMTA 4PMJA 1A3WA 4B92A 2DSWA 1X8FA 1A5CA 3IPWA 1UG6A 3PK7A 1U33A 4ZOEA 3IJ7A 5FKYA 3WQFA 1JVNA 3LK6A 3GC5A 1Q5MA 4FALA 4K1GA 2V8ZA 3WBYA 2PTZA 4NAEA 3R4IA 3WH9A 3TA6A 2X41A 3G6LA 4O1DA 2POTA 3RG6A 3WQPA 5DX7A 4JQAA 1OK4A 3ITYA 4L4MA 3CBWA 3MWCA 3LCIA 3D46A 2OJPA 5LHFA 4DZ5A 5AYZA 7TAAA 1X38A 6REQB 2B7NA 4JIEA 2VX7A 4MZ1A 1NTHA 1Q4WA 1XPGA 4KEZA 3Q58A 4CLMA 3CHVA 1HGWA 2QDDA 3JZEA 1POJA 4LUIA 3EA1A 3PY2A 3BAWA 1JDAA 5HQEA 4V2XA 3SSZA 2EJAA 1GWJA 3WENA 2VNCA 3M7WA 2A3CA 2EG6A 3ZVHB 4G7FA 2EJ1A 7ENLA 1C3FA 3F1QA 1J0HA 1YADA 4LEFA 2XYLA 2EPNA 1OCBA 4PB3A 1VCFA 2ZCGA 5MHBA 3GVRA 4Y90A 3I6EA 3KM8A 1OCQA 4ZL1A 2QUTA 4BI6A 2ISDA 1C8QA 1K9TA 4QQ3A 4DF2A 3A3XA 4CQ8A 4YL2A 3CO4A 2E9BA 3AIUA 2VZUA 3VGEA 4AEFA 4XUGA 3UWQA 1JIBA 1TRIA 4HNVA 2PDXA 3AISA 1S3TC 3H55A 3RN6A 2C8NA 4CCEA 2GK1A 5HATA 2Y70A 1KA9F 4NVTA 5JVLA 3N18A 3XISA 4QEEA 2OYMA 2WHLA 3KUMA 3UG3A 3WJWA 4DWSA 4KCWA 1SZGA 3ZS4A 3ES8A 4PFMA 1GQKA 3MMWA 4AHPA 4FHAA 4IP4A 3W2KA 4MIMA 3GBDA 1XP3A 4JN7A 1ONRA 5E93A 3GE7A 3QV9A 4N0RA 4GYJA 2RDTA 3SZ8A 2A3EA 2QPSA 4CQDA 2OZ0A 4R7WA 2R1MA 2FB3A 3VIFA 2IKGA 4C6MA 1SSDA 4ZEPA 5I07A 2R1KA 1E9LA 3BOLA 2INFA 4UFJA 4MJMA 1VBHA 3UY7A 3IS4A 4UCGA 1EGVA 1UR9A 3CMJA 1H51A 4YJ5A 1A5AA 4JTLA 5FESA 1SW3A 5HXMA 1XGZA 5LIKX 1XDJA 4CNPA 1LJYA 2WHJA 2W4XA 4QSHA 1E4IA 3ZO9A 3P80A 3DI1A 1HJXA 1CXIA 1F4HA 1B90A 3UP8A 1V02A 4HHHA 5LIUX 3T8LA 5C8BB 3K13A 4I9TA 1X96A 1QW8A 1ALDA 1H2JA 1P1MA 1TYGA 1OYAA 1ADDA 5CSSA 2VCAA 4IXXA 4BQ3A 4F0LA 3CLWA 2VGIA 1V3JA 1XH2A 4YU1A 4G6CA 3KZSA 3R79A 1LWIA 5HBFA 3G77A 2Y7GA 1UC4A 1R9YA 3WMBA 1TTJA 4U3CA 1NWUA 1HXJA 3V16A 2C71A 2IPFA 1JUKA 1HKWA 2GSHA 2GFTA 3CS2A 1WV2A 4NZ1A 3URQA 2RJHA 1SFTA 1ONWA 2J75A 1LZOA 5EMMA 2HXTA 1E9YB 2XH0A 1FCQA 2P1FA 2CKSA 2FVKA 3I3EA 3WDJA 5I00A 1BSIA 3U4FA 1NF0A 3T2QA 3PTDA 4L4PA 4RE0A 2WMFA 3W82A 3E0FA 2XIMA 1MI3A 4PCNA 3AC0A 3QMTA 4FF7A 1XIJA 1PB0A 1T40A 2BG5A 3THAA 5DXYA 3CUJA 4IJRA 1TZ9A 1E6NA 3RUBL 3WF2A 3OVPA 3CHFA 5FACA 1PL9A 1XKJA 3FKRA 1GKRA 4DJDD 4JTTA 2ZX5A 4GH3A 3KVMA 3OLEA 4ZR8A 5AYYA 4IP7A 3APTA 3WFAA 1H3GA 3L4YA 4C1KA 3WEZA 2WM1A 4GNJA 4E2OA 2E09A 1EB3A 2Z7GA 3M0HA 3VMPA 1DTUA 4MY8A 2NQZA 2Q09A 4DBUA 3L0GA 1T6MA 1UZHA 1OX6A 4QE4A 4L7ZA 4US5D 4GPNA 4HCHA 1VPQA 4H2HA 4TQTA 3EXTA 1CLKA 3TFCA 3S4TA 4QNWA 5XIMA 3P3BA 3VI2A 4R88A 3VOJA 3UPBA 1W9VA 3RO6A 2PTWA 3LI0A 3LS9A 4F8XA 2EKCA 3EDKA 1REQA 1J6OA 3G0SA 4JTAA 3KVJA 3VGHA 3C86A 3TR9A 4HNLA 4S23A 4UR9A 3PUEA 1OFEA 4LBUA 1KBJA 7REQA 1MO0A 1RPXA 3DFNA 3GW0A 4IFKA 3T07A 3BGAA 1OABA 3PPCA 4AWSA 4I5RA 2WVVB 1SW7A 3GH4A 4K6AA 4LAOA 3BARA 5D9OA 3G1XA 3WMCA 4DBWA 2J8FA 2R94A 2CWXA 1VR6A 3TE9A 2FTPA 3NQEA 3SGZA 4ZO9A 2PDGA 3ZMRA 1JPDX 3WLNA 1W54A 3SY8A 4I90A 5EBAA 4DZHA 9CGTA 1GHSA 4D6EA 3QTGA 2G3IA 1ZJIA 1SR9A 3IIPA 4IM4A 4JHOA 1ZAHA 3V5FA 2PFHA 4L6HA 5LA2A 5KEZA 1TPC1 3APGA 1HJVA 1OFBA 1WQ5A 3NL5A 2FTYA 3AHZA 2V30A 1U5JA 2DT0A 1F4AA 4AWTA 1BQGA 1M04A 3UWZA 3RLHA 2Z26A 4AIUA 3V0TA 4WJEA 1A3XA 4YMZA 2VR2A 4LBRA 5IBXA 3FXYA 3DU0A 3PZMA 4GO9A 5EMJA 4ZQMA 1OYBA 5M17A 1S2VA 1FWNA 5LXEA 4UOQA 4FPSA 2DZPA 3WLQA 1QDSA 3B05A 4H8UA 3WJYA 4QTGA 1GVQA 3WY1A 4ZQOA 4MYXA 2QMKA 3W53A 4GH1A 2VFIA 4TIMA 1KFEA 1G94A 2C16A 3E6EA 1XHGA 1XRTA 5CC7A 3TTOA 5FI8A 3A64A 1RCOB 2PWUA 3H4XA 4M3PA 1GJWA 1ZQ5A 4NAFB 3UCCA 3NYZA 2PU1A 1DE6A 1V0KA 4K37A 1Q63A 4IUOA 3HURA 3UCQA 1K8CA 3WF4A 1PS9A 1P0NA 2J66A 3N6HA 3LV6A 1K1DA 2BV9A 2QIIA 2WKJA 3RCMA 4H6QA 4TV5A 3Q4DA 4D8LA 1DHPA 2D73A 4LV9A 3OYZA 4KETA 1BPLB 2E6YA 2QDEA 5D30A 5LNUA 1EOKA 5AVNA 3CO8A 3QLDA 1YPXA 1NQ6A 4J3ZA 5ECVA 2UY4A 3KBNA 2CIPA 2PU0A 4A21A 1H49A 2NQLA 3EOLA 4Q4MA 4C7FA 1BRLA 4UMAA 4HSOA 2PC4A 2WLZA 3CHDA 3QEZA 3VGGA 1PXGA 3S5NA 2NLYA 1TJ2A 5CPMA 1XLLA 1BQCA 4QAWA 2J7EA 1U5VA 1K3UA 2ZRZA 3KOZA 3HMCA 1DBTA 4HCLA 3A9BA 1XLEA 2O4MA 4KWOA 4MWAC 3WL0A 3V36A 3GSMA 1EA9C 4RZ6A 4YLWA 4LY8A 3NTYA 4E2BA 1CIUA 3FJNA 4B4HA 3HG4A 3MO7A 1ZBVA 4UCFA 4US6A 1UMLA 9XIMA 3LBOA 3HO8A 3F2DA 1AD4A 2HNEA 1UKSA 4IGMA 1UA7A 3VNLA 3SN1A 2OX1A 1EGZA 1B1YA 3IVUA 2WJZA 1C7SA 4CD6A 4XIMA 3AS0A 1A5BA 1K8XA 5L6UA 3BAJA 3PJWA 4C7GA 2NSXA 3WNNA 3F4VA 3D5HA 4LGXA 5C7VA 3SB0A 4GO8A 2W61A 3T81A 3A12A 1J9YA 5D9MA 4JD4A 2PTYA 1OC5A 3JRKA 3BGGA 1UW9A 3RO8A 4C6IA 4C1LA 4MUPA 6CGTA 1AFSA 2AQWA 1I75A 3PZVA 5HPOA 2FZ8A 4S3DA 2WCAA 3BG9A 2J47A 4AZCA 2A7PA 5AFDA 3RHGA 3NXFA 2ZWYA 1W37A 3MWAA 3QKEA 3ALFA 3QHMA 2I17A 2QCHA 8XIMA 4LFYA 3T2OA 4LCQA 2QPXA 3NSNA 3NA8A 3P93A 5BRPA 3H22A 3W7JA 4GUHA 4K8GA 2X05A 1I0BA 2H3BA 4W5UA 2XIIA 4HZ8A 4KFPA 1E6PA 4NI8A 5H8UA 1SM9A 2Q01A 5FAJA 3TU9A 3CMGA 4UFKA 3UXIA 1EHAA 1K6AA 3A9IA 4GKTA 3HG2A 4K1WA 4GI9A 3W26A 1J2WA 3JVAA 4AD2A 5AC4A 3XINA 3TONA 2V69A 4ZB5A 1UH3A 1GOQA 3EOOA 1B3YA 1SGJA 1JPIA 1KXQA 4JN6A 1ZL1A 3NO1A 1W3NA 5DRCA 1YMYA 4FOUA 1CW2A 1KCXA 3TJ4A 3VILA 3IJ9A 3M7SA 3EOUA 1V7AA 3H4GA 4Z1BA 1MUCA 3HPAA 3QRHA 3GQYA 1D8WA 1QPQA 5HJYA 1RBAA 3QGAC 3PBVA 3PJXA 5LA1A 1YXCA 2DDXA 3N1AA 1VF8A 5JXQA 1YW1A 2DT3A 3HMJG 3PZGA 5GNXA 2AL2A 4JFVA 4CD4A 1UPPA 1BWKA 1F6PA 2JFEX 4HYRA 3REQB 1C8VA 3B8VA 3F4WA 5CPLA 3SCRA 1YLVA 2GJXA 4F48A 4NI3A 4AMCA 2GGEA 5EMLA 4NG3A 5F2LA 4B90A 1FWSA 3CV7A 4FOJA 4WSHA 4XBJA 5D4YA 4PMZA 3LTPA 4MF4A 1HP5A 1MYRA 3CIWA 4AW7A 1AVAA 3DHFA 2P50A 3VU2A 3EPNA 4QCEA 3R7MA 3A4WA 1UD6A 5IBXC 2YLLA 1V6UA 2NXGA 1MDRA 1MUWA 2NT1A 3DHPA 3WQ4A 1UQYA 1V0MA 2X16A 3A3HA 3ONCA 1L2UA 4MNLA 2P5NA 3GG7A 1XW8A 1E1CB 1AJ0A 4O12A 1JL8A 3TXZA 2DZAA 3HZ3A 3WFZA 3N11A 4P8WA 4V27A 4HPHA 3R6IA 3YPIA 1BXNA 4GKLA 3DOPA 5CBJA 3HQOA 5AHMA 1W1TA 3GYEA 2QUMA 5A6BD 4L80A 1IR2A 1NFBA 3WH7A 3BSGA 1M53A 1R2SA 5GPRA 2NVDA 3CTLA 3WUEA 3TTQA 1M9HA 4D8ZA 3FYPA 4MVAA 1K7FA 1JXJA 1LLZA 2YA1A 4L4LA 3FS2A 3DGRA 1NDZA 4B16A 2RDUA 3L4ZA 3N17A 1W1A1 2I5GA 2R1LA 3ELFA 2PP3A 3KOWA 1LCOA 1F8MA 3FLUA 5FF2A 1DWHM 1EYWA 4F2BA 4XZBA 1IWBA 2VX5A 1TCMA 3ABXA 2PLMA 2W63A 1X6LA 3IIXA 4ZSTA 4H04A 2REQB 4ZENA 5BROA 3OEXA 3QR3A 3RILA 3MYPA 3ABOA 4GIRA 3T8QA 4NRSA 3CASA 4CNOA 4A3UA 1VYPX 4O4WA 1E55A 3BVJA 2WM0A 2FZDA 3CHCA 1YKWA 2VEKA 3BJFA 5KZ6A 3II1A 5T26A 3CUZA 1M6JA 2DU2A 2ZX9A 4RE3A 2PP0A 3W01A 4QDMA 3GFXA 3BGJA 4LYKA 2QJGA 4HD5A 2RGMA 3SADA 1I8JA 4NJGA 3W7EA 2FHCA 5JBEA 1ZP3A 1KBBA 5EYWA 2VRJA 4PUMA 4DM1A 2BHZA 1WUEA 1TTPA 2Q8ZA 5I03A 3W7QA 5EY5A 4HK6A 4YYCA 3FOKA 4FO4A 1S46A 3GXPA 3LXBA 1FCBA 2OMAA 1EC8A 4RR4A 3HM7A 4LPCA 2YDAA 4UTJA 2YXOA 2IQ0A 1TZZA 3GU2A 1H09A 3ZWSA 4BA0A 1FDYA 2UWFA 4JIRA 1UUOA 1FFRA 4JTGA 4LVGA 4BFAA 3MSDA 3SW6A 4BI5A 4NAEB 4H9VA 4QP0A 3T42A 1M7JA 2XSAA 3UXAA 4M29A 5HMSA 2C14A 1OGSA 3B04A 3OHMB 3QZ6A 5A8GA 3AYTA 1E4NA 5CGMA 3R58A 4UFHA 3ABSA 2WANA 3TSBA 5KTLA 4H9ZA 4D72A 2HPIA 1SMAA 5B80A 4A3QA 3CV2A 3CUHA 4FNPA 2G97A 1SFSA 2PWDA 4Q4RA 4AXNA 3M0MA 4O1AA 5A6AA 3E96A 1QI2A 5G4HC 3HGSA 4HA4A 4PODA 3K1GA 1HJWA 3LHVA 4F79A 4GQGA 2IMRA 4H9MA 3PB0A 3TZFA 2PTXA 3T0BA 4JQ2A 3KZPA 3R11A 2G8ZA 1JULA 3QLLA 4PRRA 4DJED 1EO7A 3A6OA 5DANA 4CNTA 4DHGA 4GX8A 1EZ2A 2OFJA 2HK1A 3U3HA 1R9ZA 2KAUC 4GBDA 4JIQA 1BG4A 4RLIA 2FPVA 5G2WA 4R85A 4I6KA 5BRQA 3AZTA 4RJEA 2YZRA 5AYIA 3QTPA 3NQBA 3M6YA 1F6KA 1F73A 4N02A 4WUIA 4YXGA 5BXRA 1RCXB 1VYSX 4DJFA 2GK1B 3DBPA 4U2YA 2E5CA 1RQBA 1CB7B 5A2BA 1BXCA 3IGUA 4IJCA 2YKKA 1LYXA 5E6ZA 4S39A 2XVGA 2Y4SA 5LSMA 1B4KA 1G7UA 2JF6A 3VMOA 4UMBA 4UIOA 3WCZA 3SY5A 2BVTA 4M1RA 1KXTA 2VMFA 3NL6A 3ERPA 1I60A 5A6KA 1TV4A 2G95A 5FA5A 5FF4A 3AHVA 5MKGA 2CLMA 1GK8A 3GAKA 3DFQA 3KP0A 4WX2A 5CC3A 3BLEA 4OUEA 1EFZA 1VB9A 1VHCA 5E1QA 3KTSA 3PPHA 4D6CA 3ZXWA 5D2WA 3P5YA 3CQKA 1WDQA 3I6RA 4DXKA 3SCUA 4Q32A 2BGNE 4GVGA 1XSJA 1JF5A 3EB2A 3NSXA 3T0CA 4YHGA 1LQ2A 3BLOA 5H91A 3CAVA 1LUCB 4AWUA 4Q8VA 3WSUA 2FLIA 4D2JA 1Q6LA 1MFUA 1EQPA 1A50A 3OVRA 1PZ2A 4O0KA 4JEQA 1N8FA 2GGGA 4ACYA 1SU5A 1GJUA 3B06A 2CYGA 3EDEA 1DV7A 5EU9A 2GGJA 3W7LA 2V81A 3FSUA 4GGBA 4UUIA 5ENLA 1V0LA 1TZ7A 1TVNA 4ZO6A 2WMHA 5D32A 1YTDA 2GWNA 4MY9A 3WLJA 1IWAA 3J7HA 1I2QA 4W7WA 3PB2A 4D71A 3WF3A 2C79A 5LGZA 2E28A 4O1CA 2EBNA 1EJ7L 4QJ4B 4LAMA 4QAIA 1UZ4A 3W1PA 3VKKA 1J0IA 3NQMA 2XGIA 1DWAM 2B81A 2WAGA 4CEXC 4CVUA 3BCFA 1CXEA 1NWTA 5DFAA 4OBRA 3U0HA 3WQOA 2EEXA 1F07A 2V5JA 3FEMA 3RJXA 5IXEA 1XBXA 4A4AA 3VDAA 3DEQA 2YBUA 3VD9A 1E6SM 4O10A 2YJQA 5CZSA 2QCDB 1OT2A 3CZLA 1D3GA 2YYUA 5HINA 2G37A 3PTKA 4LJ3A 4EXBA 4XKMA 3A24A 4D6GA 2VVSA 5I3FA 4UB9A 3N4AA 3NPXA 3RMEA 4A22A 3TW7A 4DX3A 4MTVA 4HU4A 1GQLA 1Q4NX 3LUTA 3LBMA 5GJNA 2FZ9A 4QE1A 1LBLA 4NNBA 4NXSA 4M5PA 3G24A 4HMCA 4MDOA 4HNTA 5LNWA 3NEVA 3WUBA 3UQNA 1PTDA 4IL2A 2H9AA 1GTHA 2VCBA 4WRHA 4GACA 3SCSA 3CGTA 1F3EA 4EXAA 3QR1A 1XKYA 2DPEA 2YFOA 4E4UA 4FIRA 3LY0A 2QUNA 1PCKA 4LX4A 2ZUTA 5HNNA 2PDMA 2EPKX 3LPFA 2Z6IA 1KGXA 3BK0A 2NX9A 4YPJA 1EP2A 3VNIA 4Y8EA 4GD0A 7REQB 3QKZA 3VNMA 1TB3A 4E8CA 3UA4A 4GJIA 3H4WA 2V5LA 3ITTA 1BGGA 4R9XA 4M6UA 5KSWA 3M0JA 4GBUA 1DIEA 3U2EA 1TPEA 2C1HA 1CPUA 2G4FA 2ISFA 3VIIA 1X1NA 4X61A 3EDDA 2QGHA 4GIYA 4QLJA 3N2XA 3L2IA 4UFIA 3OPSA 4O16A 1M7PA 1SYTA 2WPGA 1AW5A 5I24A 1ISVA 3MVTA 4E8GA 3C61A 4ATWA 1L6YA 4LRTA 1B4EA 3S9YA 2YA0A 5A6LA 3ZSSA 5I5RA 1FA2A 2J7HA 3IUIA 2WQDA 3TEVA 2V6AA 4AHOA 4Z0JA 2G50A 2PP1A 1TO3A 1EIBA 2Z00A 1GHRA 3DKLA 1UKOA 1JPHA 4C5ZA 2VVNA 3DC8A 1XH0A 3TXVA 3UWYA 3O8AA 4C6LA 4L1XA 5I78A 2EPHA 2WK2A 1GGOA 3CWHA 4XD4A 5CLWA 1LTDA 1ADOA 2OU4A 2YXGA 4PMDA 4Q4KA 4M7TA 1F6YA 1U1JA 1KXHA 1V3HA 1VC4A 1LQ0A 2YIHA 1WX0A 3NUKA 4XKYB 2QS8A 3AQUA 3S0CA 1NFGA 1PO9A 1XYMA 2V5CA 1AL7A 3EX2A 3G8EA 4XQ6A 3KBMA 4D9PA 1PVNA 3ZJ6A 3BQ5A 4ZOCA 1HVQA 4J7RA 5I06A 1RLDA 4RNFA 2BNJA 1O12A 3FHAA 1Y0EA 3E0LA 2JEPA 5ABEA 3DYMA 4JCMA 5I3GA 2ZICA 2ACUA 2YX0A 3EX3A 1EBHA 4PULA 1UPMB 4Q7NA 3LGEA 3MKKA 3W7RA 1MXSA 3AMLA 1K9DA 2W9MA 4H7ZA 4US5A 1KFKA 4Q22A 3MY9A 2GVEA 1OSEA 4ZA0A 3VYLA 1H7OA 2PDYA 5I79A 1XLGA 3FVMA 3T7VA 1QNPA 4XAGA 4D6JA 3GXIA 1NQKA 2GVYA 3E2SA 3BANA 3EWXA 1B54A 2XFFA 1YX1A 4XZLX 4EAYA 3B0UX 4QRNA 1Z69A 4CU6A 4FA3A 1IGSA 1WAUA 2ZZ1A 3CQHA 5D2VA 1BRLB 3GNXA 2WSRA 1ZTVA 4J3TA 4E2VA 3OZPA 4O50A 1JYWA 1UKTA 4P8XA 4AC7C 4EK7A 5LIXX 1CI1A 1RPKA 2J74A 1CGXA 1SJBA 4S3AA 1QXLA 3MUY1 1EXPA 1EXBA 3TYZA 4KQNA 2IKHA 4AVOA 2GSEA 2P88A 4L56A 3WLPA 1OQFA 1OG6A 1IZCA 4NX5A 3DZ1A 5LHEA 2VOTA 3LZ3A 4E0CA 5AYBA 1N82A 1TR1A 1C8YA 4QJ1A 1JCXA 1TMQA 3D0CA 3KBJA 3WF0A 3M16A 3QMSA 1YNQA 1KGUA 2Z27A 1EUAA 4GXPA 4UTKA 1EX5A 3F7JA 4RXGA 1WKEA 3P62A 4JL2A 3ZJ7A 4I3GA 1RZMA 3LXAA 1L8PA 2O9TA 1Q7ZA 2VELA 1KQYA 2ZRUA 3GXDA 3RGTA 3EX1A 2QGYA 4MB5A 2Y24A 4Q4SA 1CGVA 3GNDA 1W5PA 3TTYA 1OT1A 4FR1A 3FXGA 3BSHA 3NJ3A 1X97A 5B7ZA 4CN1A 1TJRA 1XQLA 5HWMA 4DO5A 3VTRA 2ZC8A 3LMZA 3MU7A 4GINA 4HT3A 2P76A 4AZCB 1GVOA 3OIXA 4FLSA 3TYBA 3CV6A 1TREA 1PSCA 2WJEA 2W5FA 3RX3A 1E71M 4DB7A 1UP2A 4BY3A 1HF6A 2O9RA 4XZWA 4LU0A 3CTTA 3KAOA 3MC5A 3VFLA 3VDGA 2IUZA 3KOXA 3MANA 3CHEA 3BLKA 5HK4A 1CX9A 3HFYA 3OYXA 3OZOA 3TDFA 4YTUA 4L1GA 1VFHA 3WNPA 1FDJA 4ZODA 5JIPA 3L2MA 4N9BA 1W91A 5DCDA 1I6NA 4TU1A 1CGTA 3VCCA 1KTCA 3MDWA 3LM7A 2V82A 1K8YA 3TP4A 5DCEA 3WF1A 2J7FA 3C56A 2HSAA 4MJ4A 5CZKA 1RBOB 5BYWA 2DSUA 2OZ3A 4RX0A 3GTFA 4ZZ9A 2E6DA 4HNOA 1FQ0A 4H83A 4TTGA 5BCAA 4NZFA 2GYIA 1VFOA 2WVUA 1O5QA 1XR2A 2E77A 4L9XA 5C5YA 3VD4A 1H61A 3R1ZA 1G5AA 5HMEA 3C2YA 4LB3A 1LLWA 3STEA 5G2IA 4PUDA 4C6QA 3UYIA 2E1DA 3OGVA 4IOTA 3CL7A 1J79A 4U10A 5AC8A 1ODZA 2QJJA 3SUSA 3H54A 4WGHA 1V6XA 1PIGA 2XVLA 3STFA 2AL2B 3M9YA 4FXJA 2R1NA 3ABQA 3B40A 4IQEA 4MY1A 4DWDA 5EL1A 3N19B 1R3SA 5ABHA 3MYOA 2VZVA 4HTBA 1C93A 4MJZA 1VCVA 1SJAA 2OWXA 5T9BG 3MZ2A 2WMIB 3KLLA 3M5XA 1VGAA 1E3XA 2Y85A 2GJXB 4JTSA 4JHMA 4IMGA 4PSPA 6REQA 1JD9A 4MKNA 1JQVA 4DN1A 1UWAA 3TN5A 3MSYA 3BAXA 4WKAA 2QCLA 1KGWA 4YWIA 2QKFA 5I3KA 3KCOA 3QPZA 2I16A 1Y65A 4LNCA 5I09A 1TTQA 5DT7A 1IEVA 1IIHA 4W4QA 3AZRA 1WDRA 4BK9A 1DJQA 2ALDA 2HK0A 5F7UA 3MUXA 5BWFA 3MP4A 3GXTA 3PAOA 4TVUA 3E5BA 3ZVHA 5J5RA 2DVTA 1P5BA 1F05A 3UR8A 4DJDC 3CIVA 4PC8A 1XYFA 3TLQA 4CD7A 3QW4B 5DXXA 3M64A 1VEMA 1C92A 2GDQA 4BZYA 3MB9A 3VOHA 1CXFA 1A80A 2XU2A 4AG0A 3KEHA 2D2OA 1NOUA 5BW6A 5BXSA 3SN4A 4E5TA 3FX4A 3KBVA 1S2AA 4WCJA 3VKCA 1B3OA 5D2YA 1B5TA 1MRQA 5G1MA 1IXOA 1XCWA 3TC3A 3LSCA 4XD6A 1UH4A 3VDCA 2W3ZA 3ORWA 3BW3A 1XG4A 1TWWA 2B0MA 1ME7A 1DXIA 2CZDA 2G4JA 2OOGA 2WSQA 4IIDA 4JTIA 3PZIA 4HMEA 3DDMA 1Q7QA 2VXNA 1GZ1A 3CPUA 3ZOAA 1GVSA 2QQ6A 2DIKA 2XJ7A 1GW1A 2ZUWA 4NU7A 2DEPA 4JX4A 3LLXA 2VQTA 1FCVA 2WZEA 1XYZA 3VM5A 1AL8A 5DQPA 2H90A 3F03K 2XIQA 3CZJA 1KKRA 4S3EA 3VKJA 4GY7A 3RRAA 2DSKA 1DJIA 1A5LC 4JDBA 3VMNA 3UVAA 2FFIA 5H1WA 1YPIA 2W92A 2JGYA 1B9BA 1TRDA 3MCNA 4AY7A 1N55A 1FWEC 3TQ0A 4MYAA 1IT8A 2A3HA 1XC6A 3TAOA 3C8NA 2ZDSA 2HPMA 1KR0A 5HQMA 4Q33A 2VZSA 3A4JA 4PCFA 1RXOB 1OGBA 3L4VA 1JZ7A 3AYSA 3E2RA 4MPQA 1R2RA 1AQHA 1BD0A 2PF8A 3AUOA 1ISZA 1YTKA 1OFPA 1VKFA 3QR0A 4JTCA 4MJ2A 5EFDA 2OWWA 3DHUA 5K4XA 3P6LA 5CH9A 1LRQA 2QIWA 2ZRXA 2F2HA 2PTDA 1TWIA 3MP3A 1VBUA 2HISA 2UY3A 1TE6A 2BVWA 1ELSA 3QHNA 2BMBA 2P3ZA 5A8PA 4G1KA 5REQB 3NZRA 1GVEA 4OOUA 4WXZA 3U2ZA 3LGDA 4GI4A 1A0EA 2CXEA 1KM5A 3H8AA 3LNMA 3IVSA 3RPDA 3IANA 4C6KA 3IJ8A 1NP2A 3GD6A 4J2MA 3H2FA 1W0MA 3N2MA 2PGWA 1QI5A 3RYSA 1T96A 1NWSA 2RUSA 3ARVA 3LLFA 4FXFA 4XZMX 1EC9A 2E8ZA 5G4EA 2ATMA 3SQSA 1OD8A 3E12A 4DI9A 2AMXA 4MZYA 4N6FA 1R7OA 5A6BA 1B3VA 3BTNA 3RX4A 3OHIA 1F8IA 3TN3A 4M80A 3O6YX 4UQBA 3URNA 4JNYA 4UQEA 3S1GA 4O8RA 4XZIA 2GGHA 1KRCC 4BI7A 4CEUC 2VDGA 4EE9A 3EWCA 1KW1A 5SWUA 4BS0A 3PULA 2XG9A 2OQYA 4UXDA 3OLIA 3IJDA 4AVNA 1NDYA 5DLCA 4GQ0A 3GC2A 4FLQA 1UWTA 4KKXA 2H8ZA 3S1VA 2AKZA 2ISWA 5FJIA 5I02A 1FP9A 4GC3A 5DY3A 3TYCA 3B9AA 5HR7A 2BY1A 4WSKA 2UBPC 1FFQA 3JR2A 3EWWA 2NUXA 3IIVA 4NJJA 3FY1A 3VUPA 2DSVA 3FVDA 3O07A 3VOCA 1SPQA 3RCNA 1Q2SA 1M7XA 4EXQA 4HN4A 2V5BA 1O60A 3NG3A 1XDLA 2W0UA 3QOKA 2QJMA 1PWMA 2VEMA 2HV5A 1F5ZA 3DXIA 4HA1A 3QY8A 4Z2JA 3NQDA 2VFGA 3WQDA 3ZLFA 1E5NA 4AQLA 3Q65A 4C6BA 5BRBA 2WSPA 5H8PA 5DMLA 2ZZ5A 3ARQA 3BCJA 1FKWA 3O05A 1M5WA 1O66A 2QPUA 2DT2A 2ZVIA 4Q8NA 3CNYA 2X30A 2QUUA 3LCWA 3R13A 5JH1A 2EPLX 2HXUA 1ZP4A 1L6GA 2DSZA 3TIMA 4W87A 1WPCA 3MTWA 5MKGB 1MSSA 3B8SA 3TW6A 3KWXA 4WHBA 3TYDA 2GZXA 4AH7A 3HPSA 1XIIA 4L6OA 3W1MA 2Z28A 3E9AA 3R94A 1DJYA 3URAA 4B3ZA 4Q8PA 3BWWA 3LEPA 3S9ZA 3LCGA 2VJXA 3MSRA 3WLMA 3IGHX 2R1PA 3OO2A 2C0AA 3DBNA 4ML4A 1EQCA 4MDPA 3H7UA 2RAGA 3ANVA 4JQ3A 3USBA 1XD0A 4DBDA 1R5YA 5D02A 4IGNA 4A3YA 3RMJA 3TOPA 3PFMA 3M0KA 4XVDA 5D8ZA 2ZX7A 4FLRA 4LY4A 3W27A 2ZRVA 3V75A 3BZJA 3ZWTA 3UJ2A 1HJQA 3DENA 1RK5A 3PUDA 5E0CA 3OU8A 1W9UA 3TC7A 1H5VA 1JNDA 4AC1X 4A29A 3TCEA 3SO7A 4DJEA 1K7EA 1UUMA 4HMDA 3A47A 4GNVA 2YXXA 3C2RA 3L5MA 4AD4A 3HG5A 1XG3A 4AVFA 2OLHA 3L5LA 2WNNA 1C90A 3S3GA 2I5QA 5BWAA 3KFTA 1S5WA 4JFWA 5FIPA 1UWSA 2NXHA 4NAFA 1C9DA 4FNTA 3GC4A 1BWVA 3LPGA 3OBAA 4E3VA 2E4TA 3RIKA 2GJPA 2Z4GA 4AEEA 4HYVA 1DQWA 3DYOA 3QPEA 4PUJA 3N2TA 2INZA 4EPDC 1YDNA 4IPIA 4V28A 3EPOA 4H01A 4HA0A 4JFTA 3WLLA 2I1OA 4JTDA 3G0XA 3GXMA 3T40A 4GJJA 4U2ZA 2VEIA 1N8WA 4J4KA 2WMJA 1DWFM 4IQDA 1IEWA 4U5IA 3PG8A 4LYRA 1WZMA 1RSCA 3W38A 1ICPA 1Q6FA 2ZXAA 3WJSA 1DXFA 1T5AA 5C9ZA 3SN0A 4H6EA 1FXPA 4FB7A 4XSLA 3MI6A 4P7NA 1YRRA 1ONEA 3FYYA 1OB0A 4JKLA 3EMZA 4B3LA 1UUQA 4MOZA 3C3UA 1PZ1A 2ZOXA 3HQNA 5J5DA 3E1F1 2BX7A 5CPQA 3LQLA 2QAFA 4R27A 2PPGA 3ME3A 1TG7A 3AXXA 2J13A 3E02A 2WZHA 3SGGA 2J8GA 4XISA 3CB8A 1QAPA 4POCA 4FR6A 3EDJA 5HQLA 2ZZ4A 2PDBA 4BEQA 1FHDA 2CZEA 1LL7A 4QITA 3WQWA 1DHKA 3W25A 5KZMA 3O2LA 3M07A 5E9XA 3HV8A 4UC5A 1RH9A 2A85A 5C9XA 2XFYA 1ZS2A 2OLAA 3BLDA 4AD0A 3PNZA 1H60A 3RLUA 3EKZA 4QR6A 1CBGA 4LYQA 1E5JA 3L23A 1HUVA 1SZEA 2FGBA 4C65A 4P5UA 1TELA 5EA9A 3UZ5A 4P7LA 3M0VA 4LF1A 4YYFA 4HQVA 2WKGA 2Q3RA 1W1VA 3WK0A 3AMGA 4AHQA 4H9TA 3W1TA 2INEA 1V3LA 5U7SA 4JIIX 3NZGA 3W6MA 1I1XA 4QROA 2GQ3A 4W9TA 3PHAA 3GG0A 3VOIA 3NOYA 2C0HA 5JBFA 4NQ1A 2Z0IA 3EWUA 1RLCL 2TPSA 3QM3A 3NFUA 1FWHC 4AY8A 1WBJA 3M44A 3NL3A 3SECA 3HJEA 1K70A 1PKNA 2OO0A 4HU0A 1TQXA 4GE8A 3QY7A 3RAOA 1QO5A 3BAIA 2EAWA 4N9EA 1MNSA 3BURA 3S5ZA 3LOTA 2DW7A 1XH1A 1O5XA 1T0OA 3ITLA 3WEOA 4LEQA 3UWVA 3UZJA 3ISIX 2H6RA 2VC7A 4QCFA 3DH7A 1UWQA 4KWUA 3STGA 1DIKA 2JBMA 3W7OA 5JU6A 4UTTA 1MXDA 2GJRA 4DXXA 1DQUA 2NUWA 2E9MA 1XLIA 3EGJA 3LHZA 1MQPA 1S2WA 3B0VC 4RZ5A 2AGTA 5I0DA 1Z44A 3S9IA 2J27A 3N14A 4NHVA 4Z0SA 1XUUA 1GCYA 2PDJA 2VFFA 3TN4A 1I45A 2NV9A 4BJHA 5HPCA 3NPUA 3LGGA 2VUNA 1W3IA 4GUIA 3W02A 3E49A 5E5CA 2PDKA 3DG7A 1O7AA 3ABZA 3PJUA 4WVXA 4RDYA 3C4UA 4KFNA 1O4UA 2BLEA 1G01A 4P8VA 3HOJA 4AY1A 4CQBA 2ZFAA 3UG4A 3GVVA 3RCYA 4Y96A 1UBPC 4JYEA 1H50A 3VIMA 5IHRA 1E40A 1Y5VA 3C0SA 2Y61A 2PS2A 5F4SA 4Y9OA 3HPFA 1WOAA 3FNDA 4JXCA 2X7VA 3K2GA 2V67A 2PD5A 3KXQA 4YIWA 2IS7A 4AD1A 2ZUSA 1KCZA 2VZTA 3DN5A 1AQMA 1US0A 1F9CA 4DPQA 4R53A 1OM0A 1E1EA 2Y7DA 1YE6A 1D3HA 5E9AA 3WQCA 5AZ1A 4ACZB 2QJHA 2F8QA 3W74A 4J9JA 3NYDA 1D9EA 4WJ8A 2A3LA 3UT0A 5I6SA 2JEQA 2C3ZA 2XH4A 2CFFA 1BGAA 3DUGA 1XYCA 4Z17A 2FZMA 4PMVA 4DJEC 1QK0A 3CZGA 3L4XA 4QFUA 1XYBA 4IUGA 3IUHA 4HN8A 5HWJA 2C7FA 9RUBA 3HJZA 1UJQA 3KL0A 1H11A 3PP7A 3GU9A 4XO7A 1S38A 4PZVA 2V2CA 1H7WA 3UBPC 4PTWA 1D7KA 1U83A 3T0TA 3K8MA 3RRXA 4WZHA 2ZE0A 1ZZMA 1JZ8A 1KRBC 1UKQA 4BWLA 2YW4A 3PR2A 2XSXA 4DNMA 5LIYX 1HN1A 4IGHA 4ONVA 4F4RA 3VDBA 2VC9A 3QZEA 5FSDC 3KVLA 3S1WA 4QX4A 5G1YA 2DW6A 3TYEA 3NDZA 1ZLPA 1QO2A 2ZXQA 3P60A 4QXIA 6ALDA 4BQ4A 2PDIA 2WSYA 1Q65A 2JALA 1AK5A 1TVPA 2EKGA 3ATYA 3W1LA 2CW6A 4I7UA 2V63A 4ICCX 4XVEA 5BXTA 3JW7A 3W7NA 4S3KA 3CMFA 4ZSUA 1Q66A 1UR0A 1JYNA 1QHOA 2VENA 3W1AA 2REQA 4AU0A 2YB1A 5A2AA 1AZ1A 1I9CB 3DFYA 1CZ1A 4IMFA 1SFJA 5CZ0A 4REQB 4JAWA 1QI3A 2CERA 5BU6A 1WCGA 3LU2A 3WX7A 3PWIA 2XH7A 3VNYA 1LWJA 4PUWA 1KFBA 1TTIA 4DJFD 4FXSA 1EJSC 4M24A 1VCGA 1YPFA 4PBGA 3QBUA 3VGFA 3SUUA 3GDLA 2YB4A 1AMYA 3C6CA 3EOSA 2Z6JA 3MMDA 4KEMA 5TF0A 2DQWA 1QWGA 2FB2A 5CZTA 4XAZA 4C7DA 4P61A 3ANUA 3TAKA 5HR6A 3CEUA 2WVSA 5FJPA 2WB5A 1KTBA 2EXOA 5H6HA 3BMXA 4WR3A 1IT7A 1T8QA 3U9IA 2BFGA 3NQ2A 3EXSA 3EWZA 3H7VA 1AW2A 1OY0A 2PDHA 5B7YA 2Q3OA 1TJPA 3AIBA 5CPSA 3PG9A 3AROA 3RR1A 4XB3A 1FTXA 2GLKA 4XZNX 2PGEA 4G5DA 3B8WA 1DYSA 1TV7A 2PBOA 2Y2WA 5A8QA 4WOZA 5C6MA 1SUXA 4JS3A 4LANA 3KS5A 5M2FX 4TMBA 3O06A 3LCXA 1R87A 4RPPA 5FD0A 2PCQA 3THQA 4XD3A 4AIEA 3R8GA 3EMQA 1ME8A 4OU1A 3AS2A 3W75A 5FF7A 4EAMA 2PWGA 1QCWA 2KX9A 4DLMA 3G1DA 1G4EA 4TUFA 3MI3A 3FFSA 1HKKA 3N2BA 4LT9A 2JF7A 2O4QA 1DIOA 2G3NA 4GUGA 2FVMA 1DKWA 4OUIA 3KDOA 4UTTC 2XIJA 4UTFA 3H70A 4UQAA 2OGYA 4QE5A 2Z24A 3VNJA 2A7RA 2XVKA 2D0HA 1TUFA 2JKEA 3S2MA 1W5QA 2A3AA 3VPLA 5CCZA 1PHQA 3IARA 4UTUA 1PDZA 1AUSL 1WP6A 1OADA 2BY3A 3W7GA 2XINA 2J4GA 3INPA 5C55A 1TVLA 1OYCA 1B3ZA 1Z6KA 4JTRA 1W1PA 1VEOA 4LAZA 2E5DA 4MB3A 2ZZ2A 2EGZA 4ZB0A 3L4WA 3CU2A 4A35A 3GTIA 2W6RA 1LG1A 5HUPA 2X7WA 4X2PA 4TXEA 4AZGA 2A6LA 1E51A 4I9MA 1W1B1 3UWUA 3VOGA 4XV0A 1E6RA 2J7CA 4PBEA 4QHRA 2WVTA 2FIQA 2CCRA 1Z32X 5ECUA 2XWEA 3LYEA 1MFVA 2CKRA 4W93A 1MQRA 1Q7MA 3DX5A 3LRLA 1X6UA 5DMMA 5JIWA 2ADAA 3MI2A 5BNKA 4AAJA 1ZSXA 1J5TA 1DJNA 1ZAJA 3M46A 1ZENA 2EHHA 5IM51 4LB4A 1QT1A 4ZOAA 4M8UA 3LTYA 4H41A 3VCRA 1S3HA 2BODX 4OJYA 3P8IA 5AB3A 3T4CA 3UWEA 1F61A 3VIJA 2OT0A 3R10A 1FBAA 3EA2A 1JR1A 1E0WA 4N4PA 1B2YA 1PE1A 1EA0A 3VIKA 4K7VA 1JNEA 2GVGA 1S5NA 5AYXA 4B5NA 1G4PA 1UBSA 3F2BA 3G2GA 2PWFA 3B0PA 2G5WA 3IIZA 4YN5A 1GPFA 1JDEA 3V1PA 2NQHA 3OLGA 2RHGA 4A8IA 1IEXA 3EBVA 3W2NA 4TO8A 3GDBA 4X2RA 5J04A 2QR6A 2XPKA 1QNRA 4FEZA 1XUZA 1Q6GA 3BSMA 1DJXA 4OIFA 1KQZA 5EMKA 2W62A 2WZMA 2Z1KA 1YDOA 3K46A 4M51A 2PGRA 1DORA 4ZBCA 9XIAA 1QK2A 4XZHA 3UR5A 3SQMA 5F1UA 1VHNA 1LUCA 5KITA 3AYRA 1V6VA 3KRBA 4RE4A 3LNPA 1HX0A 3SIZA 1S2TA 4W8LA 2NWRA 2F7FA 3LPPA 3W2MA 3VVGA 3NL2A 3GIYA 4H9UA 2WOQA 3KX6A 5A2CA 3L68A 3W28A 1RJPA 3ZR5A 3IK2A 1O5KA 3E38A 1CEOA 1J5SA 1GOKA 3LXCA 4JX6A 1VFSA 1WOBA 1V6WA 3TZNA 5IRPA 3PTMA 4GQBA 3UEQA 4IPNB 2PBGA 1P48A 1Q13A 3MDUA 2JQXA 3K4DA 3NQ6A 3H53A 2X1SA 1H7PA 3F4CA 5HUOA 1EEXA 2WQPA 3BO9A 5CJNA 2GPTA 4NL1A 5LKYA 3TLLA 3GY1A 2IPWA 4ATLA 1V6YA 3WJZA 1G67A 3U6WA 1QBAA 2WWDA 1WA3A 3WD2A 2A2IA 4KCUA 1RVGA 1FH7A 1EH9A 5PTDA 1IEQA 3NO5A 3AWOA 4GISA 3Q45A 4GGHA 3W84A 1IXPA 3WQ6A 2Y62A 2QCDA 4ERAA 1OFQA 4NF7A 3L65A 2DJLA 2WLYA 3F5KA 2I57A 1Z7AA 1VJZA 4TX6A 3NQAA 3DHDA 3H2NA 2PRLA 3WQ5A 1ITCA 5LIWX 1KCKA 3S47A 1UWIA 5CSRA 2AAAA 1XLJA 4FOKA 3AU6A 4JY9A 2D3LA 3C0JA 4R5EA 2VUYA 3FAXA 2VFEA 1SR0A 3LERA 4GY0A 1XLFA 4KIEA 3VIGA 3S42A 5CGTA 5LXXA 3B9EA 3MUCA 3QVQA 3WQEA 1G4TA 3H2EA 4O18A 1J0ZA 3W7KA 4ZE4A 5D2XA 4I6VA 1EJVC 4UFMA 4UTWA 3C52A 5EBUA 1HP4A 1XISA 2FH6A 4ALDA 1E6ZA 3IIOA 5DT5A 4D1IA 3KRZA 4W8AA 3LBCA 4A2RA 1BYCA 3OA3A 3WO8A 3QYSA 2OX4A 3ZR6A 2CZ5A 1XLKA 1FHVA 5CJMA 3KBWA 3P84A 3DI0A 3C8FA 1CGUA 4ROQA 3GNOA 4F0RA 2ZWZA 3D6NA 2BOFX 4DZAA 4GUFA 5E09A 3O1NA 4Z08A 4B5VA 3MSGA 4KRZA 1NELA 1UHVA 4AX6A 4RL3A 5FOOA 4W86A 1NM9A 1ENUA 3NQFA 3NQ8A 1VBGA 1QMLA 4Q8OA 2VZOA 1TV8A 3GU1A 3L4UA 5HA7A 4K3ZA 4GVIA 1HO4A 3I4EA 2HJPA 3MCMA 3SCOA 4GZ7A 3V5OA 3RNDA 1LRTA 2CLPA 3AIEA 4Z1AA 3GH5A 3AXMA 4DVOA 3W7MA 1NU5A 1VIZA 3CEPA 3N2OA 3ZQ9A 2HVMA 1W5MA 1BYDA 1RCQA 1GUVA 3WZ0E 1XGEA 3AYVA 3SCWA 4O19A 1AJ2A 3BPWA 4W7UA 3AAMA 5K9CA 4LTSA 1XD1A 5HAOA 1P1XA 1FWAC 2ZQ0A 1NIUA 1YHTA 5LZLA 1OFDA 4ATDA 1XIBA 4GX9A 5E0FA 3BAKA 5HOSA 2H3DA 4XKYA 5BXPA 4DWSC 3GIQA 3OOQA 1CLXA 3SGUA 2PE4A 1SZNA 3OBKA 2WNZA 3A22A 3NCOA 4O4VA 3HGOA 2FDSA 4WOQA 4PR4A 1E72M 4R9OA 2V3GA 4ZQNA 3UXDA 3GXNA 4CVWA 3KLKA 3F4DA 2ZZ6A 2E8YA 4DAIA 4ORMA 1H62A 4KT2A 2JKPA 2RKXA 3GB6A 2YCIX 1SJCA 1HT6A 3WK3A 3BG3A 4IISA 3W07A 4CNSA 1EP1A 4S1FA 2I14A 4MB1A 1RJRA 1GOMA 4E8DA 4MLRA 4RW5A 1PHWA 2Z29A 2WBGA 1FWBC 2VO5A 4GYKA 4JDYA 2PWVA 3FJLA 3AJXA 4QLKA 1PTAA 4NRRA 3VO0A 2PDPA 4PH6A 4JKKA 3LTSA 4XAFA 3STPA 3EZ4A 1R0MA 1ZNNA 3D3FA 4RE2A 1XLMA 3EEZA 3UY8A 5DF0A 4E6MA 5FJTA 3UWWA 4DRSA 3VABA 4BQ2A 2QCCA 3ZFHA 1O94A 1YNPA 2F2KA 3AXHA 1E4MM 1XXXA 1MZRA 5D2TA 3ARPA 4MNJA 1LL4A 2HMCA 3VZZA 5DCBA 1YXDA 3DYPA 2PUZA 1EDQA 1X1OA 4HGXA 3Q67A 3BE7A 1VYRA 3NURA 2A21A 1M68A 4KH2A 4AD5A 2JKAA 1QFEA 2YPIA 2D22A 2OGJA 2OZ8A 3PM6A 1TPB1 3EEGA 3G1VA 4IIGA 2ZRWA 3RM8A 3IJLA 1V5XA 2J24A 1FWGC 3UA3A 3MV11 1OK6A 2OSXA 1WYIA 3IACA 4ZMGA 3C0LA 3P74A 2B7OA 3CWOX 3R8RA 3W2UA 1N8IA 4F66A 3GDMA 3P61A 1VFMA 3UNDA 3I6TA 4NY2A 4IJBA 4QS5A 1W3LA 3SURA 4JKMA 2HCVA 2WHKA 3OGRA 3LI1A 4QNEA 3NXLA 1JUBA 1KBKA 3UR2A 1FWJC 1X7FA 3EDFA 3SAZA 1J93A 4KPLA 1FWFC 2YGYA 4J40A 1EPVA 4JZ5A 2IXVA 4PMOA 4IHCA 2VRQA 1NFPA 4DBEA 4GJ1A 5I23A 3QH2A 4Y8FA 1FWTA 1MZHA 4UQCA 5A94A 2XM1A 2G3JA 4E4PA 1UP0A 1W56A 4RV8A 4I8DA 2ZA2A 1CTNA 3GR7A 4M82A 2OSWA 3WEMA 5HNTA 3W1XA 4FZIA 4C6NA 1BG9A 2WO5A 2R91A 3RR4A 4LUSA 1M65A 5C70A 1ZUAX 3SUTA 2VR4A 4IH3A 1QUMA 2PDQA 3GTXA 1QU4A 2XISA 3EMCA 3IV3A 3PUOA 1LT7A 5GVJA 1EJUC 4UZUA 3KS6A 1KLZA 1XV8A 3RU8X 1TV5A 1R3VA 4FF5A 2NVAA 4J3SA 4DZIA 3MA8A 4D6FA 4NP7A 3PAJA 2ZE3A 3ES7A 4UTWC 4LUTB 3BCDA 1EYEA 3M0YA 2YCEA 4ADTA 2WNQA 1KD0A 1E0UA 2CPUA 4PMRA 4NNCA 1BWLA 2VC5A 1RHCA 4V15A 5D9PA 1PZ0A 2D0GA 5CPNA 1JEZA 2E5BA 4FMVA 3USZA 3ENLA 4XBSA 2GSJA 4LQ1A 3SM0A 1XRVA 2RJGA 5FF3A 2OEJA 4AYGA 5IFTA 5K7JA 3BOFA 1OINA 3TQPA 5TAOA 2CLHA 3B4YA 4IMCA 3OGSA 4IMEA 2Z2AA 4WQ6A 2Y8UA 3WNLA 4FIQA 3GDRA 1ZJHA 1W8GA 4WDUA 4PMYA 3WBAA 4D6HA 1HW6A 2AAMA 3LRKA 3KOFA 3TNOA 1UYQA 3W73A 2BB0A 3ZR4A 1V6TA 4RNHA 2KZHA 3W3OA 1JZ5A 2WMIA 2OT1A 4Q8WA 2VDHA 1CXLA 1W2PA 3DKJA 1EL3A 2JE8A 3NDYA 5C9RA 2FDMA 3PBYA 4HVXA 3W7CA 2OTDA 4OTKA 2F9RA 3LCLA 2BVDA 4IICA 3EPMA 1ZJAA 1VRXA 3BDKA 5XINA 2V3EA 4OT7A 3QC3A 4KWVA 1QPRA 1TQJA 2HNHA 1P43A 4IX0A 1AD1A 2EQDA 4L6DA 4DF1A 2P10A 5FJUA 3DFSA 4HMNA 5G4WA 2VFDA 2OVLA 3TQKA 3W7IA 3UXLA 4BF9A 5A6SA 2PLJA 3WK1A 3NQ7A 1QPNA 4X0NA 1QTWA 1QASA 1MEWA 1G1YA 4LS2A 1KV5A 1LQAA 4XG1A 2YBTA 1BEUA 3PANA 4DM2A 5AECA 4XAPA 1G4SA 1DPMA 3EKLA 4DQWA 1G6CA 1XLAA 2QCMA 3PZOA 5BMWA 1GJPA 2DGAA 4M19A 3GZAA 3V5CA 3QFEA 1TA3B 4K39A 3QYQA 3WH5A 1PKMA 2YL9A 4HKPA 4WDWA 2PI6A 2JIWA 1HKMA 1X6NA 1Q6OA 2EPOA 4YHEA 1UKPA 3G6MA 4Q4OA 3WLIA 4MNMA 2UZ9A 4GC4A 5LA0A 1ML1A 3WFLA 2YCLA 3ZJKA 3W4RA 3SUWA 2YL8A 1UQZA 3NOEA 4NUWA 1EF3A 4AIOA 3ARUA 1FHUA 2ZDRA 3G1SA 2CBIA 1FWIC 2FZNA 3OP2A 3AIRA 4Q4PA 4U28A 3FW6A 3L0KA 2QMJA 5DBTA 3MUIA 4J27A 1GOOA 1VJSA 2ZKMX 1YYAA 4W88A 2D2HA 3QW3A 2J9XA 2PODA 4U5KA 6ENLA 5F2GA 4Z1DA 3WBEA 4UTIA 2FJUB 1EUNA 2VR5A 1GZJA 1T99A 2IKIA 4HTYA 3VNZA 4K7YA 1T8XA 3P14A 4MAVA 4O0QA 5FCZA 4DBSA 1Q45A 3OIHA 4G2DA 3SEPA 1ESWA 3UGVA 5A8OA 3PUGA 3UJRA 1IXNA 1EF2A 3KWSA 1ITUA 3UPWA 1RQHA 2O56A 3PS7A 3TQVA 4WXYA 2QXWA 3WMLA 1R47A 4EX4A 2A6NA 3MUZ1 3IJQA 1FH8A 3G1HA 3GO2A 4EVZA 1Z8AA 2ZVRA 3BV7A 1TV3A 4JIHA 1JDCA 1J12A 4CCZA 4I9JA 4GQRA 2XN1A 3ZIZA 3SR7A 4PEEA 3KRUA 1OF8A 3Q37A 1N2VA 1AQFA 2BDQA 3T4WA 5C0QA 1E0VA 2QV5A 2UY5A 1A5UA 1HL9A 3U7VA 3PZQA 4QS6A 2X42A 2Y7EA 3M47A 4N9DA 4B2DD 4O15A 1S1RA 3CH9A 1AH0A 2YBVA 2WJDA 2XFWA 4KGLA 5REQA 5DMNA 3WBWA 2E67A 4Z2HA 3GIPA 1NOFA 3RJYA 3G22A 1TPDA 2RDWA 1Q6DA 1YQ2A 2NVCA 2E3ZA 3GM8A 4K8EA 4MKSA 2O0TA 2CITA 2P8CA 2NSOA 5D33A 3TJIA 1W17A 1LDCA 5D04C 1DVJA 1YE4A 4HOWA 1EDTA 3ZLHA 1EGMA 1MDLA 4S3FA 2QCEA 3H24A 4H9YA 2BBFA 1CGWA 4JQ1A 3IV8A 5K3VA 2YZ5A 3FKKA 1DOSA 1KR1A 1KWGA 4AMAA 4JOMA 1JJKA 2VWTA 4KMQA 6TIMA 1CNVA 2NV2A 5CQ1A 5DO8A 1R3QA 1V08A 4FNQA 1CGYA 4Z1YA 2F6KA 4FSAA 2E9LA 3MV01 3RF9A 2CBJA 3GVWA 1W5NA 2E1WA 4CN6A 1U30A 4PRTA 5JMUA 2V3DA 1I2OA 1P0KA 4UWMA 3QV8A 1LORA 1FY6A 4MNKA 4LVBA 3N9KA 1R85A 4Y2WA 3O9NA 2E7FA 1DJHA 2BY0A 2HWGA 1JZ6A 1OCJA 1XLBA 4C91A 4ZOBA 1IZKA 1E73M 4AB4A 2PC8A 1NEYA 2YL6A 3ZM8A 2VDIA 3G3MA 4AYSA 1KCLA 2WC4A 4LUYA 1PCWA 4BR1A 4GZEA 3MKCA 2V2DA 4J5NA 3NGFA 1I4NA 2XGZA 4YVPA 2OKOA 3WJXA 2HE8A 4OKDA 2FZBA 1J11A 2HE5A 1A5MC 2VC6A 4QEHA 3MPGA 1Y8BA 2WCSA 2A0NA 2BTMA 1S2UA 3N4EA 4BF5A 3UW6A 3URBA 4UTHA 4LS0A 1XIHA 1RD6A 2OEMA 2G41A 5JUVA 2ZADA 2D2GA 2NQ9A 3QSRA 1AA1B 4HNUA 3AALA 3CV1A 3TYAA 4KF1A 1E4LA 1GVRA 1J0YA 3ZSTA 1MW0A 3FEQA 2ZXDA 1Z3NA 1H7XA 2ZX6A 3GHRA 3WUFA 3AHXA 3A21A 4H9XA 3VKAA 3TVAA 4WLCA 1OX4B 3GNNA 4GVFA 3OB8A 1EOMA 1GG1A 4FNSA 4X3ZA 1W9DM 1EJTC 4GCAA 1KM3A 1GT8A 4WEVX 1O5RA 5A1AA 3G1FA 1XM3A 4GI6A 1KRAC 5FEXA 5BMXA 4O28A 4I5XA 4GHRA 3SCNA 1V77A 2CLKA 4JTJA 1GVFA 3EA3A 1V3IA 3M43A 4DLFA 3SIMA 3H23A 4QG9A 4KEVA 3OODA 1KFLA 1XPYA 4BF7A 3L9CA 4NYUA 3UFYA 3T9PA 3SSJA 1TPH1 4DELA 2OYKA 2ABAA 1GVYA 3WD3A 2D20A 3V0SA 1WE5A 2V5KA 3GAYA 4LUJA 1BTCA 1S5VA 4A8NA 3C2VA 3FDGA 3T2PA 4C6FA 2MUCA 3V4BA 2FGZA 4EP8C 1EJWC 3QGKC 1NDVA 3SFKA 5FEPA 4N6EA 1JD7A 3AFBA 2Z7KA 4X0VA 3QV6A 5HJLA 4XAYA 4YNGA 3W37A 2YDSA 3W1QA 3LHTA 2EG7A 3SI9A 1UD2A 4O52A 3WLHA 1ISXA 2C6QA 4IFRA 3MP5A 4C1NB 4AX7A 3ARSA 1PX4A 4FXRA 2Z1SA 4IGSA 4HOZA 1VRDA 1HQTA 3KHJA 1CXKA 4HPNA 2B7QA 1E0XA 4X9YA 4B4FA 4GA8A 1MVYA 1PYFA 3BLIA 5A3HA 4WDXA 2Q6ZA 2WV8A 4RV3A 1GORA 4B5WA 1W1ZA 2OXNA 3VCNA 1N7KA 1TSIA 4I9AA 4IG2B 3TROA 4GFIA 5IDZA 2Y1HA 1VD6A 2XUCA 3CT2A 1WB0A 3R5EA 4B5SA 2QHAA 4AIBA 4DPPA 2ALRA 4JTEA 5TD4A 3OJGA 4MWAA 1R30A 1JPMA 2WKLA 4AISA 1XQKA 3C2FA 3F5LA 3WH8A 2AKMA 1GG0A 1AZ2A 2PCEA 3EWYA 4O57A 1OC7A 2XVPA 4AF0A 3S8HA 2CLFA 3CAWA 4FI4A 1CWYA 4FP1A 2V3FA 8XIAA 1JG9A 3DG6A 4MAZA 2VT0A 3GTNA 2ONEA 3AI0A 2JIEA 3UJEA 4AZHA 1XF0A 3HQPA 4GIEA 4BEUA 4KIRA 3BMVA 2J88A 1THFD 2X0SA 1OHLA 4KS0A 5IOBA 1G0CA 1TUXA 1UOKA 4MLJA 2XZ7A 3GR4A 1XJBA 4F40A 4W84A 4M56A 2O55A 4LAUA 4Z2KA 1NVMA 3DESA 1GQJA 4PUNA 3W83A 1F2JA 4ZB2A 4PGLA 3WDIA 3VM7A 4JY8A 1FKXA 2XN2A 4F0MA 3M5YA 1BVWA 2RFGA 4S2CA 4PCSA 3TFXA 4U3AA 2J78A 2G3MA 2PRHA 2DVUA 3BXWA 1AODA 1AW1A 4DNHA 3UJFA 3AXKA 4JTHA 4BCEA 1XIGA 2HVOA 3VXGA 2Y6ZA 3OVGA 3S83A 3AMCA 3M1ZA 2FH8A 5D03A 1ZBKA 1GOIA 1MW1A 1SO5A 1QNOA 2VEPA 4A6GA