5D8WA

Structrue of a lucidum protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
324
structure length
324
Chain Sequence
b'LQFAGVNIAGFDFGCGSDGTCNASGAWPPLTQYYGADGAGQMKHFVDDDGFNVFRLPVGWQFITDGVAGGDIDEDNWAEYDALVQACLDAGASCIVDVHNYARFNGEIIGQGGPTNQDFAALWSSIAAKYADNDKIIFGVMNEPHDVPDINLWADSVQAAVTAIRQAGATSQIILLPGNNWTSAETFVSNGSADALKKVTNPDGSVTNLIFDVHKYLDSDNSGTHEECTTNNIDNAWAPLAEWLRCNGRQAFNTETGGGNVASCETFMCQQVAYQNANSDVFLGYVGWAAGNFYQGYVLGEVPTDTNGVWTDTALVSACLAPNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoglucanase
molecule tags Hydrolase
source organism Ganoderma lucidum
publication title Functional and structural analyses of a 1,4-beta-endoglucanase from Ganoderma lucidum.
pubmed doi rcsb
total genus 112
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5d8wA00
3UEQA 2PC8A 3DYOA 1B3ZA 4W85A 2Z1KA 2W67A 4B9YA 4W7WA 4AY1A 4H8UA 1OIFA 3OLDA 2BHUA 1E3XA 3EMZA 1W91A 3PZTA 2JEPA 3BLPX 4B9ZA 3AMGA 2YLAA 5A8QA 5LYRA 1XV8A 3ARVA 1WZKA 2PF0A 1BQCA 5HXMA 2VVNA 1JD9A 1W1VA 5CSYA 1QVBA 2C0HA 3MMUA 1O7AA 2CHOA 1KXQA 4OBRA 1JIBA 1G94A 3WL1A 3VGGA 3TONA 3MU7A 2ZX6A 4JFUA 4D6CA 3VD4A 1JZ8A 5CSUA 2ZX9A 1BSIA 1JI1A 3WD3A 2GDVA 3MMWA 3WELA 1KXTA 1K9TA 5A6AA 3F5LA 3AHYA 2GJXB 1BVNP 1WZMA 4FF5A 5BRQA 1JD7A 5DMYA 3NSMA 1QI4A 2VRKA 4UQDA 1H1NA 1UKOA 5AC5A 2UY5A 4PN2A 5JUVA 3T0BA 6TAAA 1GPFA 2G3IA 4LQ1A 3DYPA 5DT5A 3WF1A 2WNWA 1ODZA 3WUFA 2BVYA 4TVUA 1UKQA 3VNYA 4LX4A 1QW9A 3WL0A 1UKPA 3VIGA 4AISA 1Z32X 1UOKA 2YL5A 1DWIM 4KMQA 1MW0A 3GM8A 4PTMA 3A3HA 1GZJA 5CXPA 2A3AA 2X1IA 4EE9A 2EXOA 3ARUA 4MJ2A 3BXWA 3W24A 1V02E 2J25A 2YL9A 3CZGA 3LPPA 1J0ZA 2PWHA 1V0MA 1U33A 2GJPA 2ZX8A 1J9YA 1E1FA 2WVSA 1EQCA 1E6PA 3I3BA 3GYCA 3N9KA 1KGXA 3ALGA 1BVZA 1FHDA 5FIPA 4AZCB 3ZJ8A 3OB8A 1D3CA 4EK7A 1OSEA 2AOSA 2DT2A 2QV4A 3HJEA 3VIFA 4ZXOA 1C91A 5E6ZA 4TX6A 1GVIA 5A8OA 3IAPA 4JZ5A 2D3LA 2WLYA 8A3HA 4ZE5A 2ZUTA 3BSGA 3APGA 2YDRA 1LWJA 1JDCA 1E72M 3O9NA 3RM8A 3N13A 4F9DA 3RM9A 2DSZA 3B8SA 3BCFA 4J27A 1ECEA 2CITA 5M17A 1RP8A 2XVPA 1I1XA 2D22A 1MW3A 2WBKA 2JF7A 3WNPA 4U5IA 1DWGM 4AW7A 2X09A 3MV11 2WSKA 2XHYA 2QMKA 1GNXA 1KR1A 2NW0A 4MNJA 1HKIA 4P7OA 1GQIA 3SCQA 2WAGA 3POHA 4WIWA 3ZR6A 2WVUA 5EB8A 1O6IA 1CYGA 2W4XA 4JFWA 1UR8A 1B3YA 1UH2A 1JFXA 2VX5A 4MB5A 3A4XA 1M53A 1JZ3A 3VM5A 4CU6A 4AEEA 4TXEA 3ZSTA 3T0AA 2DIEA 2MANA 2IXVA 7A3HA 1KGWA 1C90A 3S2CA 3AYRA 1BPLB 1EO5A 1ZL1A 1ISYA 1NOWA 2E3ZA 3ZJKA 4CCCA 3AMLA 5BCAA 2J7DA 2WVVA 5ABEA 1M01A 1V6YA 1GQJA 3CZKA 3ARXA 1QNSA 1M03A 4UQBA 2CIPA 4MNKA 2GJRA 3AROA 1KWGA 3VIKA 4M81A 2XSBA 3PTMA 1J0IA 2XVKA 4BF7A 4UQCA 1I1WA 3WUGA 2J4GA 1ZBKA 1QPKA 4J3VA 1KXHA 1XCWA 1FP8A 3K8LA 2YOCA 1WAWA 5GQBA 1UYQA 5A2AA 4IUGA 2VR4A 3L4WA 2DSWA 1DP0A 1GOOA 3WMBA 1H11A 3VMOA 4U2YA 1PX3A 1UR0A 3K46A 3WH6A 2WCSA 3IAQA 4Q22A 2IXUA 4UFHA 2DT3A 2DSUA 3VIJA 1E43A 4MTVA 5EBAA 2VT0A 4ZE4A 2D2OA 4PTVA 4E2OA 3TTOA 1E5NA 1JZ2A 4CCDA 1FFQA 3CMGA 1GJWA 1WNOA 3PZNA 3ZT7A 4HZ6A 3VKKA 3A4AA 2WZHA 1L8NA 1QBBA 4BQ3A 1WKYA 3RMEA 4AMCA 1R8LA 4N42A 3AFBA 5I79A 1UD3A 1UZ1A 3BAJA 3PZOA 3ZT5A 2BS9A 3W4RA 1VEOA 4QCEA 3ARQA 2XG9A 5I78A 3CUFA 4AD4A 4F79A 2WHMA 1E4MM 3BAYA 4W87A 4EANA 3OGSA 3VD3A 2D24A 1X1NA 3ZIZA 2CETA 4AEFA 1B9ZA 4LYPA 2AMGA 3UG3A 1E56A 4DWSD 1V3MA 3VTRA 5GNZA 5CPTA 1YQ2A 4D6IA 1V3HA 4ATWA 3PZGA 3F5JA 1J01A 4H8VA 5DFAA 4F9JA 2ZXAA 4OZOA 2PWDA 1FHLA 3WEOA 3PZIA 5JIWA 2WVTA 3W28A 4W5UA 2HVMA 3ECQA 1K9DA 3T09A 4YPJA 1BG9A 2OSXA 3ZO9A 4GI8A 1WO2A 4UFKA 4UQAA 3L2LA 5JBDA 2A3HA 1CGTA 1H0IA 1OWQA 5FKYA 5BROA 1XHGA 3ARPA 1UR4A 3W29A 4QAWA 2ZUMA 3M46A 4CU7A 4AD2A 1CGYA 1EHAA 1XRVA 3RPMA 3GBEA 3RJYA 3I3DA 2QPUA 1E15A 1JXKA 2D3NA 2DPEA 1V3IA 1V0NA 1KWKA 3MKKA 3AIWA 3OBAA 4V27A 4ACYA 4NF7A 2YA1A 3OLGA 1B1YA 5A8MA 3WF2A 2A3EA 4LGXA 2CBJA 2JEQA 1CPUA 1FH9A 2EPKX 2QF8A 5E6YA 5EMYA 4JHZA 4DM2A 4XX6A 2J7FA 1UG6A 3RILA 5KZ6A 4H8HA 1FH8A 1TCMA 1WCGA 3GH7A 3VDAA 1YHTA 6CGTA 1PBGA 3PN8A 1WDPA 4JKKA 1OCQA 4DUWA 4L4OA 1B31A 3CZJA 2J7BA 3TTYA 3WDRA 1NWRA 1VFFA 1UR1A 3GBDA 3I3EA 5CQ1A 4W89A 2CERA 3KL3A 1R86A 1VFUA 2E8ZA 3OZPA 4AZIA 3SCNA 4PEEA 3CHCA 3L2MA 2VCCA 2RGLA 3SUWA 2BY3A 1B30A 1MWOA 1CWYA 2BV9A 3PTKA 1W32A 2OLHA 2W66A 3AYSA 2WC4A 4WKAA 3F4VA 4Y7EA 2O9PA 4UZUA 3AI0A 5BYWA 5DT7A 1PX4A 4J28A 2O9TA 4PMRA 3VO0A 1OIMA 1LG1A 2DH2A 3KZSA 3SEPA 1A47A 3CTTA 1A3HA 2EEXA 3M6DA 2EO7A 4W86A 1HN1A 4PMNA 3WEMA 1QNQA 1V08A 2XM2A 4TX8A 2PWEA 5I3DA 4PMDA 3AHVA 2ZE0A 3G6MA 1QW8A 3RM4A 3W82A 1H5VA 1UWQA 2G3JA 1C8QA 2PBOA 3B9EA 4PUDA 1Q6FA 1OM0A 4MB1A 1BLIA 3U57A 4MDOA 1VFMA 2VUYA 4ML4A 4NRRA 3AHXA 2V3EA 4OJYA 4CVUA 4D6DA 3SUTA 1XCXA 1JYNA 5EFDA 1JZ5A 1XD1A 1BYCA 5IDIA 2CESA 2YL6A 3U5UA 5A6BD 2OYMA 3LMYA 2WMKA 2A3BA 2JIEA 1XGZA 3UG4A 3AS1A 4UFJA 4AYSA 1HXJA 1V3LA 1E9LA 3CGTA 4RE3A 1IV8A 2ZOXA 5C70A 4IISA 1VENA 4J3WA 2VQUA 3W25A 2BY1A 3SUVA 2VVSA 4OUEA 1JG9A 2XM1A 3GNRA 4WSKA 4AXNA 4R5EA 2VX7A 1KBKA 1IT0A 1B90A 3CIVA 3WDHA 3CHFA 1BGAA 1EO7A 2FGZA 1JDDA 1UQYA 2IUZA 1LL4A 2CBVA 1JFHA 3S6TA 2YBTA 3T08A 2DSKA 1ZBCA 3LPGA 4HMCA 2WKGA 4M80A 1XH1A 3QR3A 2UY4A 1GVYA 1H0GA 3NSXA 3MUIA 4GZEA 4WLCA 1ZS2A 1B3XA 5A95A 3VIMA 3VMNA 2X05A 5GNXA 2J7GA 3UETA 5I5RA 1E71M 2E40A 4EAMA 1NH6A 1NOFA 1JZ6A 5I77A 1J0HA 1GOMA 4GO8A 3AIBA 1G0CA 3ARZA 3IANA 2DIJA 4LPCA 2FH8A 4H7VA 1EXPA 1ISZA 3AS0A 5A8NA 4EKJA 2OYLA 4HMDA 3VGEA 1JYVA 1SMDA 4IM4A 1CIUA 2WCGA 3DECA 1M7XA 4TTGA 4LXFA 2DDXA 2YKKA 3SCPA 3RO8A 1WB0A 6A3HA 5CZKA 1HJWA 2CKRA 3MS8A 1W2PA 2PWFA 3D5HA 4JKLA 2W5FA 4AZGA 5ABFA 4AD1A 2VZTA 4BQ4A 1QNOA 3TA9A 3ALFA 1B0IA 1HKKA 1K9FA 3LPFA 3WQVA 4W7VA 5A69A 1J0KA 1WDSA 1JYXA 2D1ZA 3WNNA 1FP9A 4AZ7A 2WMFA 4E8CA 3MUAA 1GHSA 2WMGA 1EDTA 1DWFM 3W81A 3PZQA 3B9AA 4AZBA 3ZT6A 3VGDA 4Q7NA 3VGHA 4HOZA 1HJQA 4AIUA 1D7FA 2CEQA 5JIPA 3QHMA 1EOKA 5LA0A 5AY7A 3ZJ6A 3VD5A 1W3LA 1GQKA 1WZLA 4CD4A 1G9HA 1H2JA 3RJXA 3BMVA 3N1AA 2VZUA 1VAHA 4H41A 3VVGA 5M3WA 1HVXA 1HNYA 2VCBA 2JALA 3ARYA 1VF8A 4P8XA 3TTSA 3NSNA 4GI6A 1E0WA 5D4YA 2WHKA 4A4AA 1CTNA 2D0FA 1FFRA 1QHOA 1E0XA 2E9LA 2ZIDA 4AZ6A 2D23A 3QHNA 1EGZA 1LQ0A 2VZOA 4E8DA 4UTFA 3VDBA 1CXHA 4JKMA 2YA0A 2QHAA 3AMCA 1JZ7A 4FLSA 5IXEA 1QHPA 4B3KA 1W1TA 1VJZA 1TFVA 1E73M 1V03A 2GFTA 4X9YA 3UCQA 4YN5A 4D6HA 4PSRA 2VR5A 2GUYA 3WH7A 3LPOA 1HL9A 3BC9A 1OBAA 3ZSSA 1CBGA 2VZSA 1Q6DA 2WMHA 4MJ4A 4MB3A 1EOMA 3WUBA 1V6XA 5A6KA 3OA5A 4CN1A 3JUGA 1ISVA 3OLIA 1AQ0A 3MUZ1 3CO4A 1HJXA 5HDRA 1W2VA 2G4FA 2ZWZA 3BCDA 1E40A 2EPOA 1CDGA 1UWIA 3WF4A 2Y4SA 4CN6A 3SCRA 5ECUA 4H04A 1WE5A 1VB9A 4CKQA 5M5DA 5GNYA 4TUFA 1W9BM 2WYSA 1H3GA 2DT1A 5E09A 1ITCA 1MQRA 2BY0A 2FH6A 1TG7A 5D9OA 5A1AA 1CXKA 1R7AA 1UWSA 5I0DA 4MADA 2PBGA 1XYFA 2UWFA 1NWSA 1N82A 4CUCA 3AZTA 4XZWA 4AD5A 5C8BB 3AIVA 4K68A 1DHKA 4JFVA 3AHTA 3CHEA 3W6MA 5EFFA 2XVLA 2VO5A 1HJSA 5IFTA 4CD7A 2V38A 1JXJA 2J7CA 1C92A 3MUY1 1GW1A 2EBNA 1OGGA 3BAWA 5A94A 3MMDA 4PBGA 3CHDA 4PCSA 1RPKA 3EDFA 2D0HA 4ACZA 4PSPA 4D6FA 5AYBA 1ODUA 4M24A 1UWTA 2F2HA 2DH3A 1HP4A 1PIFA 4AIOA 3WFZA 1H41A 3ARRA 4TVDA 1BF2A 5HPCA 1C7TA 1PIGA 3KEHA 3VIHA 1PPIA 5AC4A 5E9AA 1X6NA 3VIOA 3AZSA 2PWGA 2WZIA 4UQEA 4PMVA 3D3AA 3EDJA 3FN9A 4CN4A 1J0YA 4KGLA 2ZXQA 5A2CA 4JL1A 2DEPA 1ZBWA 2VRQA 3AICA 3CPUA 1NP2A 1QNPA 4PTXA 1CXIA 3W53A 1V6UA 2CCRA 1C3FA 4M8UA 1DTUA 4D1JA 3WSUA 5IFPA 1QI5A 1UWUA 2WWCA 1MW1A 4JHOA 3OGRA 1I75A 2BY2A 3AIQA 5DO8A 4P7LA 1E6SM 1Y7VA 4U2ZA 1RD6A 2AAAA 2BVTA 4WKHA 5A6LA 2WC7A 3WDQA 4P7NA 5JBFA 1E6XM 1VIWA 2WM0A 2WXDM 1Q4NX 4PUEA 3HU7A 3L4YA 2Y2WA 1V0KA 3WF0A 4OKDA 2VC9A 4AZCA 1KFWA 2BHZA 4JAWA 4WF7A 2J8GA 1PAMA 1L0PA 2VNCA 4HA1A 1LL7A 3VU2A 1GHRA 4Z2JA 2JIWA 2QLYA 2TAAA 2FHCA 2GJXA 1BG4A 2F8QA 1GUVA 4U3AA 5HNNA 4D71A 3FW6A 5LA2A 1VBRA 4P7RA 2WKLA 4C7FA 1K9EA 5AYIA 1VBUA 3AOFA 1IZKA 4H2CA 3RCNA 1AMYA 2ZUNA 4NSBA 3KL5A 4QFUA 2J74A 7TAAA 1QI0A 1UD8A 1MFVA 1HF6A 3VNZA 3WQ8A 2XFFA 4PMOA 2VJXA 3SIMA 1E4LA 3FNDA 1AQHA 4W8LA 2XIIA 4Z2LA 2JFEX 5C71A 2ZUVA 2DQXA 5FOOA 4HP5A 1TA3B 2BXZA 2A3CA 3WUEA 2O9OA 4WKFA 4W88A 3WD2A 3AIUA 2O9RA 3K1DA 4GZIA 4UOQA 4GZJA 3VDHA 2G3NA 4HZ8A 3QOKA 1W9UA 1X6LA 3TP4A 1V3JA 1TA3A 1W9DM 1NARA 2WBGA 1B3VA 5BXPA 1JNDA 2J8FA 3DHPA 3MV01 3WFLA 1NOUA 1QNRA 4A3HA 1GORA 3WDJA 4HU0A 3WMCA 1MFUA 1KCKA 3ZM8A 1HKMA 3AZRA 3WF3A 3CLWA 1C7SA 3CBWA 4W93A 5CGTA 1LF1A 2GK1B 4BQ2A 1HP5A 2W91A 4RE4A 4URIA 5A6SA 3WBEA 1W3HA 1M04A 3K4AA 5D9MA 2QPSA 3WDIA 2OWXA 5BXTA 3M07A 1XSJA 1BAGA 1HIZA 3GTNA 2ZXDA 4AWEA 1E6QM 2VI0A 3CH9A 3HN3A 1BYDA 1OD0A 4PMQA 3TOPA 2OWWA 4FLQA 3EMCA 3WH5A 3VOCA 1CECA 1E4NA 1UD2A 3BLKA 4R27A 4UFLA 1KR0A 4HA3A 2UY2A 1ESWA 3AJ7A 2G3MA 2YLLA 4TVCA 1ZJBA 4NI3A 1ISXA 3L4ZA 5LA1A 2RGMA 5IHSA 1CNVA 1GOIA 1NWUA 2E9MA 4UCFA 2W63A 3WMSA 4KRTA 2Q8XA 3SCSA 2ZUWA 3OZOA 2FHBA 4IPLA 5FD0A 3VDCA 3VD9A 1W1YA 2WWDA 1XD0A 3N11A 4PRWA 5D8WA 2BNJA 5F7UA 3GNPA 2CHNA 3L4UA 1UD6A 4JCLA 2W61A 1BFNA 4GQRA 2V3DA 3FY1A 4GIAA 2E8YA 1P6WA 1CGXA 1UR9A 1UKSA 5BWFA 3NIYA 1H4PA 3BGAA 3FHQA 1AVAA 2G8ZA 4ATDA 4BQ5A 1UUQA 1WDRA 3CZLA 2WVVB 5TD4A 2GSJA 4F66A 3SURA 3WD0A 3WIJA 2XGIA 3OLEA 4OOUA 1FH7A 2XWEA 1E4IA 5CLWA 3VX1A 3F5KA 1OINA 3EDKA 4P7QA 1JZ4A 3ZOAA 1CLXA 1XSKA 2XYLA 4M56A 3O6AA 3BAXA 4JL2A 1WDQA 3WH9A 4ZFMA 2J79A 4NRSA 3DC0A 2PB1A 4V28A 3W0KA 3EDDA 4CGTA 2XFRA 5M03A 4TOQA 4QP0A 2XFYA 2VZVA 4ACZB 2V3GA 2CKSA 2JE8A 4HU8A 3BH4A 1C93A 1XH0A 2XVNA 2XIBA 1TVPA 2PI6A 2WW5A 2J62A 3POCA 2ZICA 2NSXA 1LL6A 1E0VA 1G5AA 2V5CA 4WJXA 1WP6A 1UR2A 3GXDA 4MNLA 2GK1A 1D2KA 3N17A 1EDGA 4BZYA 4TTUA 1KGUA 1Q6CA 2W92A 2WCAA 3CZ8A 2NT0A 1TR1A 3WNKA 4CCEA 2Y5EA 5FCZA 4PMZA 1PEZA 4FMVA 1JF5A 4ATLA 4WK9A 4S3JA 3UR7A 3GH5A 1NM9A 3VGBA 2YL8A 1F4HA 4DM1A 2CNCA 3NJ3A 2D20A 1KBBA 2WC3A 3AISA 3W6LA 3MSDA 2FGLA 4ZEPA 3AXXA 1HJVA 4QCFA 4UR9A 4UOZA 3AIRA 1GONA 3WY1A 2WMJA 3PTQA 3GNOA 4AC1X 3A6OA 1KXVA 2YDQA 3MO4A 5CGMA 4HPHA 3K8KA 2GDUA 4U5KA 1W9XA 1MQPA 3AMDA 4MDPA 1PJ9A 1BHGA 4AD0A 3EBVA 2BHYA 3FAXA 4MB4A 2OSYA 1BYAA 4GKLA 2WMIA 2J7EA 2YJQA 4QLLA 4IPNB 3GXMA 1GOQA 1H49A 4FLOA 2WB5A 4CD8A 5HBFA 1CENA 2F61A 4GI9A 2VMFA 1E70M 3WKZA 1CZ1A 4OBSA 2J75A 2O92A 5D9PA 4MAVA 3WBAA 3II1A 4KRUA 4XZBA 3PZ9A 3T2OA 1OGBA 4B15A 4UNIA 3N18A 1GJUA 3DYMA 5E0FA 2ZX5A 2DGAA 3U5YA 1QOXA 4D72A 1V0LA 4UQ9A 1EQPA 3EMQA 2NT1A 5CJ5A 3M7SA 3UESA 1R85A 3A4WA 4V2XA 3CUHA 4U3CA 2J78A 5CLTA 5DEZA 1OT1A 4X0VA 2WHLA 3AXHA 1OD8A 3FHAA 3L4VA 3ZQ9A 1E5JA 2XUCA 2CYGA 1ZB5A 2J7HA 5KEZA 4HMEA 3T2QA 4D6GA 1U2YA 4LYRA 4J3XA 1NWTA 2XGBA 3GZAA 1G1YA 1BGGA 3VX0A 2WPGA 2YA2A 3K8MA 3NDYA 1UA7A 3NCOA 4U33A 1HL8A 1IZJA 2VRJA 2YBUA 1EIBA 4GPNA 3THDA 3VUPA 4JFSA 3WD4A 2WSPA 1VFOA 3NYDA 1UH3A 3ZMRA 1R7OA 1NP0A 4L4PA 3VD7A 1ITXA 3CMJA 3WN6A 2Y8VA 3B9DA 3FXYA 3K4DA 4J3TA 1Q6EA 1E55A 3AMKA 4CVWA 4BCEA 4Z2KA 7CGTA 4HA4A 2X8RA 4PMYA 2XVGA 1MXDA 1E6ZA 3AS2A 3IK2A 3NUKA 4ZXLA 1VEPA 4J3UA 1C8XA 4PYSA 5CG0A 1J12A 5ABHA 4CD5A 3U7VA 5IHRA 2OYKA 4B3LA 4W5ZA 5HOSA 2BXYA 2V5DA 1EHNA 4P8UA 4MPKA 3SCWA 3WEZA 2FHFA 1ZJAA 4KWUA 3MSGA 3HMCA 4Z2HA 2G41A 4U31A 3WNOA 1K6AA 4B16A 2YDSA 1Q6GA 5GPRA 1BTCA 3WD1A 1F4AA 3PZVA 1MVYA 4NZCA 2Y8KA 4C7DA 4XV0A 2J77A 3IJ7A 1B3WA 3RDKA 5CPSA 1UA3A 3QHOA 2XPKA 2W62A 1W3JA 4W84A 3GXFA 3SCOA 3VPLA 2WHJA 1DEDA 1JYWA 3L4TA 4DWSB 4PTWA 3IJ9A 2EQDA 3CUGA 1XSIA 4OOZA 3AQUA 2OSWA 4KGJA 4W8BA 1MXGA 4UZSA 1KQYA 1CEOA 1JNEA 2XSAA 2ZX7A 3QOMA 5A3HA 4AD3A 1G01A 4QDMA 1GOWA 3AS3A 1US3A 3SCVA 1DWAM 3GXIA 4C7GA 3AIEA 2XWDA 1SR0A 3W27A 4FK9A 4Z2IA 2Z1SA 5A2BA 5BXRA 1UWRA 4CD6A 3WQ4A 1OGSA 1E6RA 3SCUA 1UD4A 1B2YA 3PHAA 3OGVA 1GOKA 5DF0A 1U30A 1XYZA 2HISA 3W26A 2E0PA 1TE1A 1LJYA 3KE0A 2X0HA 1AQMA 2YIHA 1KB3A 4HTYA 3N15A 5A6BA 5I23A 1JDAA 5I24A 2ZWYA 3A47A 2CBIA 3FAWA 1JGIA 1US2A 3ARTA 4GINA 1WPCA 5ABFB 2X2YA 1JAEA 2J47A 4J3SA 5BRPA 3ARWA 2JF6A 3ZJ7A 4XUYA 1V6VA 2D0GA 1KQZA 3L4XA 3T0DA 1J10A 3EYPA 3EDEA 1V02A 1JI2A 3U7BA 3WNLA 4J7RA 1W9PA 2VX6A 2E9BA 3UG5A 2GVYA 3QGVA 2BFGA 5D9NA 1ISWA 1OB0A 3TTQA 5A6JA 1J11A 2XTKA 3IJ8A 4PMUA 4D6EA 2EPNA 1JL8A 3CZEA 2WZEA 3BAIA 4P8WA 4RL3A 2FDMA 1UQZA 4AIEA 1C8YA 1SYTA 1ZU8A 3ARSA 3BMWA 1HVQA 4W7UA 3WQ5A 4HPGA 4KH2A 3G6LA 4QLJA 3UR8A 1UZ4A 2V3FA 2C8NA 4OIFA 1TMQA 1EDQA 1QHZA 5JBEA 1CLVA 4X0NA 3E1F1 1FOBA 4ZENA 1W1PA 4JCMA 1MYRA 1RH9A 2CBUA 1TVNA 1LG2A 3AHZA 4MAZA 3WQWA 1RP9A 5CPQA 3J7HA 1HKJA 1QI3A 4P8VA 3N12A 3BAKA 4GO9A 1VRXA 1HX0A 4D6JA 8CGTA 4A3YA 3CUIA 2CXGA 3KL0A 4XB3A 1W9VA 4FLRA 4WSJA 3W38A 5BXSA 3OIHA 2DSVA 5FL1A 1MQQA 4QLKA 1SFSA 4BS0A 3AXIA 1GQLA 1PZ3A 1LWHA 3KWXA 1R87A 1SMAA 1XH2A 3OG2A 4M82A 1CXEA 1V6WA 1TUXA 3RIKA 2QMJA 2VQTA 4UOJA 1UH4A 4LYQA 2VOTA 1CXLA 1NQ6A 1TZ7A 4N0RA 1H09A 4Z2GA 3CUJA 1KCLA 1E1EA 3BSHA 4S3KA 3VINA 1EH9A 1LLOA 3VILA 3VM7A 2ZXBA 2Y24A 1WZAA 4HZ7A 2XJ7A 3VMPA 4HOWA 3THCA 4RE2A 4UFIA 4DUXA 2WLZA 1VJSA 2ZUUA 4F8XA 5HPOA 3WDPP 1J18A 2ZUSA 4UFMA 4W8AA 5ABGA 1QBAA 1CGUA 5A6MA 1UHVA 1E6NA 1W3KA 3NDZA 3PZUA 3W37A 1GCYA 1JF6A 2EPLX 3UERA 1CGWA 1J0JA 1MW2A 2WANA 2OWCA 4AZHA 1BYBA 2EPMX 2CPUA 3VIIA 3WQ6A 3VIPA 1PX8A 1E3ZA 4MNMA 3PZMA 1EA9C 4DUVA 1QI2A 2VL4A 1DWJM 1VEMA 4E4PA 1HJUA 1FA2A 4BA0A 1ZBVA 4PCTA 4HOXA 4AZ5A 2UY3A 2VURA 1PZ2A 4JFTA 1DWHM 1XC6A 3ZR5A 2DT0A 4DWSA 3PBGA 3WH8A 5E0CA 4PMXA 5A8PA 4M1RA 4YHGA 2VX4A 5I2UA 3T2PA 3GH4A 3GDBA 1HT6A 2EJ1A 4D1IA 4M29A 2X0YA 4GXPA 5FL0A 2E4TA 4DWSC 9CGTA 1S46A 2WMIB 5E70A 2WK2A 3VGFA 2B31A 1V3KA 2ESCA 2VCAA 3WENA 1UKTA 3SCTA 1JAKA 1OT2A 3SUSA 2VTFA 4CU8A 1CGVA 2C7FA 2BVDA 3N04A 4YHEA 4JIEA 3SUUA 3WNMA 5D8ZA 5I6SA 1CXFA 3O2LA 1UD5A 4GQQA 3MANA 3DHUA
chains in the Genus database with same CATH superfamily
4J5NA 3MP5A 1P4CA 2Z1KA 2CZFA 3C8NA 1LRNA 4XAPA 3OLDA 5IDZA 4QRNA 4GLEA 3EMZA 3PZTA 1ZP4A 2JEPA 1SUXA 1TTQA 2YLAA 2F2KA 2P0IA 3LRMA 1XV8A 2GGGA 3ARVA 2IPGA 3V0SA 2PF0A 3E5PA 4TV5A 1FWTA 4LCRA 3LQLA 1CT5A 2C0HA 1XFBA 2QYGA 1O7AA 2CHOA 3WL1A 3IRSA 2OX1A 2VUNA 4FXJA 3TONA 3C2EA 2ZX6A 1C29A 1O5KA 3LBOA 4OWGA 3BUVA 5CSUA 2VEFA 5T26A 3LCGA 3BANA 3OU8A 4DJED 1BSIA 1UCWA 1FBAA 1IXQA 5BOEA 3WD3A 2GDVA 3WELA 1KXTA 1K9TA 4UTWC 5DQPA 2OELA 3LNPA 3EX4A 1BVNP 3FSTA 2HCVA 3M1ZA 1JD7A 5DMYA 5LIUX 1QI4A 4MFDA 4UQDA 4EP8C 4NAFB 3T0BA 6TAAA 1RK5A 2G3IA 3DYPA 3WF1A 3WUFA 4PBFA 3PG9A 1TQJA 4XBKA 4PH6A 3VNYA 4LX4A 1QW9A 4H9ZA 3WO8A 2A7RA 5C9WA 3GDKA 2FYMA 3I68A 1UOKA 2YL5A 2C3ZA 4HJWA 1MW0A 4RNJA 1OFAA 3RF9A 1YDYA 5CXPA 4IL2A 3ES7A 2PS2A 2X1IA 2Z7GA 2EXOA 3OQEA 1FCQA 3I6TA 1F8MA 3W24A 1FKXA 3T4CA 1EQCA 1BKSA 1VFTA 3CWHA 3UWQA 1BVZA 4AZCB 3ZJ8A 1D3CA 3ID7A 4ZXOA 3O3RA 3TXVA 2OQLA 1H60A 1WKFA 1GVIA 4JZ5A 1F3XA 3W72A 4TU1A 3BSGA 3UZZA 1QO2A 5EU9A 2YDRA 1JDCA 5I00A 3RM9A 4J27A 4GY0A 2CITA 3L67A 4GX8A 1LORA 1EJXC 3A5FA 4XAZA 3WK2A 3WNPA 3PVFA 4U5IA 3RRXA 2WSKA 2XHYA 4UR8A 3USZA 1R47A 1I6NA 1GQIA 1KRAC 3DAQA 4LEQA 2WAGA 3S8HA 4WIWA 4QEHA 2A7PA 3DFNA 4ONVA 2HV5A 4HCDA 4UTLA 1GWJA 2WO5A 3UZXA 5HMEA 3GY1A 1MRQA 3RLVA 4DBWA 4CU6A 3QPZA 2DW7A 5H8UA 2DIEA 4JTIA 5FJJA 1T99A 1XKYA 2J8TA 2IXVA 1EGMA 1WAUA 3RG6A 2EG8A 4GYJA 1ZENA 1EO5A 3DI0A 1SVDA 2VKZG 5CC5A 1PCKA 3UZJA 1RLDA 3ZJKA 2HVOA 3T05A 2C6QA 1R3RA 2FGBA 1OX6A 1W1B1 5ENLA 3CZKA 1MXSA 3SZ8A 2GJRA 1UIOA 1R30A 4EIVA 3H21A 1ZHAA 1ONEA 2Z2AA 4DJDA 3VIKA 2XSBA 3W7GA 5DMMA 4CEUC 3PTMA 1J0IA 3HV8A 1GKQA 4HJFA 2PU1A 2J4GA 1QPKA 1FP8A 3K8LA 3ZWTA 4IICA 1QPNA 1VFSA 5A2AA 3AXMA 1WBHA 3M43A 3LB0A 4ENLA 3SI9A 1GOOA 1XGEA 1LLWA 3VMOA 4U2YA 1PX3A 4IMDA 3WH6A 2WCSA 3IAQA 1Q6QA 1QJWA 1LM1A 1JCXA 2IXUA 1F5ZA 1TMHA 2DT3A 3MT1A 3KW3A 1HGWA 4PTDA 3T07A 2C79A 3T44A 2VT0A 2WZMA 2D2OA 3W7MA 4PTVA 3B8TA 1FFQA 3L5AA 3T0TA 1W8GA 1VCVA 1TTPA 1ZCOA 3N14A 1A5SA 2OEMA 3KTCA 3MI6A 4IL0A 1JPMA 4I9JA 3W7RA 4JNMA 4NJHA 1DQXA 3QW3A 3PUDA 1LOSA 1UD3A 1UZ1A 2QDHA 5BW6A 2NV9A 5AZ0A 3OHMB 2HNHA 2QDGA 3RCMA 3ZT5A 1RA0A 3ARQA 4B2DD 2YFNA 4GKTA 4ERIA 3QBUA 3TOYA 3N9RA 3ZVHA 4F79A 3TZFA 1QU4A 4GBUA 1HFBA 3B9OA 5CBIA 4UTMA 2AMGA 3LY0A 5K9XA 3C0SA 3PP7A 2NVDA 4DO6A 3BG3A 5CPTA 1FWHC 3KLLA 1P1MA 3IVSA 3PZGA 3UPBA 5DFAA 5CBBA 1FHLA 4WY0B 3PZIA 2WVTA 1XG3A 2HJPA 1P0NA 4DY1A 3NEVA 1OCBA 1LUCB 4AF0B 1EZ2A 1QTWA 4GI8A 2A5HA 2Y63A 4PGLA 2P88A 1A3XA 4GWEA 4CNPA 5FKYA 5BROA 5LIWX 1XHGA 3SW6A 1P0BA 4QAWA 3M46A 3EX6A 1CGYA 3TVAA 1LTDA 4LRSA 3GBEA 3GYEA 2QGHA 3I3DA 3OVPA 3N6QA 1KC7A 2NV2A 1E15A 1FCUA 4K8HA 1P0DA 3LA4A 5H91A 4O1FA 1NFGA 1V0NA 3MKCA 3TLLA 3W7PA 4V27A 3ZS4A 4NF7A 2YA1A 3QGAC 2A3EA 1YE4A 3MZNA 3B8DA 2CBJA 2JEQA 4JN8A 4JHZA 4DM2A 4XZMX 4Q8QA 3SFKA 1RY0A 5C9UA 3IJLA 1TCMA 1WCGA 3VDAA 1YHTA 1WDPA 3OPSA 1OCQA 1XYCA 4P61A 4H6RA 1AJ2A 2J7BA 2R8WA 3W7HA 2BODX 3SJNA 4OV4A 4WDWA 5CQ1A 5C0QA 1S2AA 4TV6A 1AUSL 2RAGA 2OXNA 4UTJA 1Q6LA 1EX5A 2RGLA 2Q3OA 2A79A 3A12A 3JZEA 3SUWA 1QUMA 3BICA 3I4KA 3N29A 4F4RA 4DAFA 1K8YA 4H9TA 4Y2WA 1OFDA 1K3UA 3N2TA 4LCSA 4Y7EA 1Q13A 3WFAA 4R88A 4LVFA 2J24A 4UZUA 1R9ZA 5CPNA 1PX4A 4J28A 4HNLA 1G67A 2ZC8A 2DH2A 2E7FA 2TODA 2O7SA 3TR9A 3M6DA 4GG9A 3CV1A 1UJQA 2P8CA 3DBPA 1XBVA 4LS1A 3TU9A 1NU5A 2QCFA 2XM2A 4TX8A 2PWEA 8TIMA 3TCEA 4HYRA 1TVLA 3HG5A 4JEQA 5CGQA 3VXGA 3FGCB 2JK2A 1WDDA 4NZ4A 3U57A 3V75A 3V16A 1VFMA 2VUYA 5BMWA 3GAYA 4TO8A 2QJIA 2V3EA 3NQMA 1A53A 3M0ZA 2J9XA 2C18A 4YVVA 4LAOA 5U4NA 2OYMA 2C16A 2CXEA 3LMYA 4M0XA 1RVKA 2WMKA 5T8GA 4D2JA 2JIEA 3UG4A 5I09A 1HXJA 2BLEA 2ZOXA 2UBPC 1VENA 5IBXA 5FI8A 1RA5A 3NQGA 2VVSA 3QFEA 4XD5A 4OUEA 1JG9A 2XM1A 1AW2A 4AXNA 3L7RA 3MO7A 1AH0A 3ITCA 1B90A 2Y5JA 1PYMA 3PY2A 1BGAA 4JQ3A 2FGZA 1UPPA 2IUZA 4MG4A 1JFHA 3S6TA 2YBTA 2E09A 4E0CA 1SZRA 3KVMA 3LHTA 2QCMA 3VNKA 4M80A 5HWMA 3QR3A 1MUMA 2WKJA 1H0GA 5FSEC 3URNA 3K4WA 4ZQCA 4I6KA 1XLCA 5CSRA 1E71M 4BKNA 4BWLC 2QQ6A 2E40A 3DGRA 1JZ6A 1P43A 3WLPA 3PK7A 4GO8A 4ZTXA 5SWUA 1G0CA 4IQEA 3ARZA 3KUMA 3KFTA 1IYXA 1CI1A 3CMFA 2DIJA 3U0HA 9XIMA 1WKDA 3GHTA 1EXPA 3AS0A 4UTWA 4MMWA 3LUTA 2YCKX 1UJPA 1SMDA 4XKMA 1PKMA 2Q6ZA 2WCGA 1GGOA 3DECA 2FTYA 5HMFA 4TTGA 2R1NA 3SGGA 1ICPA 3S1GA 3HG3A 1UP3A 1W2PA 2W5FA 5ABFA 1I45A 3TMQA 2VZTA 4AD1A 4BQ4A 5ABTA 2ACSA 1GYLA 3A21A 4AXKA 3BW4A 3ALFA 1B0IA 1HKKA 4HNUA 1WDSA 2D1ZA 3HGJA 1FP9A 3MUAA 2VC5A 3H54A 3C3NA 2ZZ6A 4F0KA 2QVNA 1GW9A 1OFOA 3GFXA 3VE7A 4L64A 4X63A 4HOZA 4AIUA 5JIPA 3TW9A 5LA0A 3VD5A 1GQKA 3RJXA 3N1AA 2VZUA 3NQAA 1QOPA 5REQA 5HMSA 2RFGA 4W9TA 2VWSA 1D9EA 4DJDD 4AX7A 3ARYA 4KCWA 2OGJA 1LYXA 1TIWA 1UOZA 1GKRA 3TTSA 1F6KA 3NSNA 2FFCA 2O4MA 1E0WA 1KV8A 3D3FA 3W7KA 3MCMA 3ANUA 5HATA 1CW2A 3KVLA 4G7FA 1CTNA 1PIIA 5FJPA 2D23A 5HNUA 2VZOA 1PZ1A 4UTFA 3O05A 4LAUA 3O63A 2QCDB 3AMCA 4NZJA 3DG3A 3GC2A 2QR6A 3TE9A 4IFOA 4B3KA 1VJZA 2YZ5A 1RUSA 2GVLA 1E73M 2GFTA 4X9YA 4YN5A 3TMLA 1XDMA 2EKCA 2X40A 4BY3A 2ZA3A 3BMXA 1HL9A 3BC9A 1CBGA 1I0DA 2DVXA 2VZSA 3CYJA 1AL7A 4UIOA 2WMHA 4MJ4A 5FF0A 1FRBA 2BDQA 3S1VA 4FNTA 2PDJA 1V6XA 3OA5A 1GZGA 4LV9A 1SW7A 4QE1A 3OLIA 3QV8A 1JCNA 1LBMA 1W56A 3V5CA 2EPOA 3WF4A 3W7OA 3G1DA 4CN6A 3EWUA 4B5NA 3SCRA 3GD6A 5ECUA 1OZMA 1WE5A 4ZB2A 3T8QA 4CKQA 5U7SA 1O1HA 4I7UA 5E09A 3EB2A 4S1FA 1TG7A 5D9OA 5K2ZA 4O19A 3GVQA 3CT2A 1NWSA 3ZLHA 4AD5A 3BLFA 5C8BB 3BO9A 3A13A 3BOLA 8RUCA 5G5IA 2ALDA 3W6MA 5EFFA 4I9MA 5CZ0A 3VOJA 5IFTA 3STCA 3GU2A 5CPMA 2V38A 1EJUC 4KS0A 2J7CA 5KINA 3WJWA 7REQB 4JTLA 4ACZA 4MY1A 4O14A 4H00A 4ZQPA 1LZOA 2F2HA 2PAJA 3WFZA 1H41A 1Z42A 4JGDA 5HPCA 4IX0A 3VIHA 4MWAA 1AJZA 3S2NA 2OKOA 2PWGA 3QGKC 2XIMA 1ICSA 4D8ZA 3EDJA 3FN9A 1OYCA 4Q4MA 1NIUA 4AB4A 2NUWA 5A2CA 2ZE3A 5KMYA 2INFA 1CXIA 1V6UA 1C3FA 1DTUA 2PDPA 3RAOA 3RX2A 3SADA 1FUYA 5I02A 4KEUA 3C5QA 4H8NA 4INFA 1XR2A 4PEKA 3WQDA 4N7QA 1Y7VA 3LG3A 2AAAA 3V5OA 3C56A 2BVTA 2IKGA 4WKHA 2VEMA 5A6LA 3A3WA 3WDQA 2FVKA 1TV8A 3GVVA 2PDGA 4PUEA 2XN1A 3CC1A 3L4YA 4AZCA 1EC7A 1TJ1A 2BHZA 1SPQA 4WF7A 3E02A 1LL7A 3VU2A 4Z2JA 1KCXA 2QLYA 5FACA 4XD6A 2TAAA 2FHCA 3M44A 3NQCA 1GUVA 1W3TA 5HNNA 2A7NA 3FW6A 2VFDA 1VBRA 4C7FA 2WKLA 3SDOA 2NZLA 1VBUA 5HNTA 1IZKA 4H2CA 4DO7A 3RCNA 2ZUNA 4MM1A 1B4KA 7TAAA 2WJEA 3THQA 3AWOA 3VNZA 4CNUA 2VJXA 3SIMA 3RR1A 2FJKA 1AQHA 5C71A 5K3VA 2ZUVA 2DQXA 1ZGDA 2OMAA 1TA3B 3TCSA 3B4YA 2A3CA 2E1DA 3LCHA 3N34A 1M7PA 2O9RA 3K1DA 4GZIA 4GZJA 3QOKA 1X6LA 3VC6A 1NAL1 1W9DM 1B3VA 3ICJA 2J8FA 3DHPA 3MV01 1N55A 3ISIX 3VKJA 4A3HA 1D3HA 1GORA 3TKFA 1YW1A 3WMCA 1KCKA 3ZM8A 1VS1A 4QG9A 3S5OA 4J2MA 3AZRA 3RITA 3CLWA 1R38A 3PUEA 4QGCA 3TR2A 5CGTA 5D2YA 1V79A 3W7EA 2GK1B 1HP5A 4RE4A 4URIA 5A6SA 1IT8A 1W3HA 3NWRA 1F73A 1C8VA 3RK8A 1TPC1 4IFKB 3TOPA 1IGSA 1FTXA 3BOXA 1P6CA 2VFGA 1CECA 1UD2A 1JUKA 3FVDA 4R27A 1MEHA 2OG9A 1OX4B 2G3MA 3PG8A 4TVCA 3TFCA 3C2OA 3TYZA 5LA1A 1O60A 1GOIA 2E9MA 2I5GA 3GW3A 4E8GA 4PCFA 3S9IA 1EWDA 3MBFA 4IPLA 3H26A 3UR5A 1TSIA 4A3UA 4XZLX 3UJSA 4BR1A 3COTA 5D8WA 3GNPA 3L4UA 1ZJIA 5FEZA 2XISA 2VD8A 4GQRA 3FY1A 2E8YA 1NFPA 1UKSA 3E9AA 1AVAA 2G8ZA 1ADDA 1WDRA 2OX4A 3CZLA 4EXAA 3W2KA 3SRHA 2ZCGA 4O15A 5TD4A 3WD0A 1YBQB 4L4LA 3WIJA 4Q8UA 3APTA 3RHGA 1H5YA 3M0KA 1ZFJA 3GTIA 3OLEA 2QUMA 1F05A 1E4IA 3DN5A 4X60A 1VPQA 4JTQA 1EPVA 3EDKA 2I9EA 1JZ4A 3M9YA 4LUSA 4MWAB 2XYLA 4GZ7A 3BAXA 2PTYA 3WH9A 4ZFMA 5HUOA 4HNOA 1JDEA 2GWGA 4WQ6A 3DKLA 2XFRA 3HZ3A 4ACZB 5E93A 2DVTA 2DZBA 1G6CA 4LUTA 1C93A 2XVNA 2HTMA 2O0TA 4R9OA 3DHFA 4B91A 2INEA 2PI6A 2WW5A 4IIHA 4Q6XA 1G5AA 4WJXA 1WDWA 3QV6A 4WGHA 1UR2A 3PULA 1F3WA 3RR4A 3NVTA 1J4EA 4OV9A 2Y5EA 1PEZA 3B0VC 1JF5A 1NM9A 4DM1A 2Y7EA 2CNCA 2V69A 2DW6A 4E2BA 3W6LA 3TC6A 2FGLA 4ZEPA 3HPFA 3AXXA 4N02A 1X97A 5MHBA 3VNLA 1F7BA 1KM5A 2HPIA 5D33A 3EOEA 3WY1A 4DI9A 2CHRA 1ITQA 4YCPA 2ZVIA 3TAKA 3WX7A 1KXVA 3MO4A 4HPHA 3K8KA 5DCDA 3SGUA 1MQPA 1TR9A 2WV8A 4XO6A 3EBVA 2NQLA 2BHYA 5I3IA 3FAXA 4MB4A 2OSYA 2R1PA 4GKLA 1YDNA 3GVGA 1EJ7L 4QLLA 3UGRA 3B0XA 4LB3A 1R3SA 1QNVA 3CLMA 4US5D 1EL3A 5I03A 1CENA 2E6DA 2GQ3A 1EC8A 4RNHA 5G4EA 1CZ1A 4JIRA 4OBSA 3LHVA 4X2RA 4WEVX 2J75A 2O92A 5DXXA 3WBAA 3FK4A 1L2QA 1Y65A 4XZBA 1DORA 4Z1AA 3B05A 3C2FA 2TSYA 3DYMA 3W1XA 1A0EA 1F8IA 1QK0A 2I5QA 4UQ9A 4D72A 1LCOA 3PPCA 2PDKA 3EMQA 1XQLA 5CKSA 4H19A 2Q09A 3M7SA 3UESA 1R85A 2MUCA 3CUHA 2J78A 3W7LA 1OT1A 4X0VA 2WHLA 3BK0A 3OVGA 3L4VA 2Z24A 3ZQ9A 1HZYA 3DOPA 1ZB5A 2NUXA 4MF4A 3T0CA 3T2QA 1QPQA 4LYRA 2Q71A 3I6EA 4J3XA 1NWTA 3GZAA 3M0HA 1G1YA 3F4DA 1BGGA 2YA2A 3BL3A 1UA7A 3MKVA 2DZXA 1VYRA 3QV7A 1LRTA 3BWWA 3UCCA 3RPDA 3THDA 1ME7A 3NYDA 3TN6A 3VD7A 4JTSA 1IXNA 3WJSA 3WN6A 3FXYA 1E55A 3AMKA 3UP8A 4CVWA 3KAOA 4JQ2A 3N3MA 4HA4A 4PMYA 1MXDA 3IGSA 4HHHA 3HGSA 4O12A 1E1CB 1ZSXA 3AS2A 3NUKA 4J3UA 3SBFA 3ITOA 3PC0A 4Q33A 3F1QA 4B3LA 4DVOA 2BXYA 2V5DA 3E49A 2PWUA 4MPKA 3SCWA 3NEHA 1ZJAA 2DFAA 3MSGA 4Z2HA 3E96A 2QULA 2G41A 4U31A 2B0MA 4B16A 2R1MA 4MOZA 1Q6GA 3PPGA 3UZYA 3WD1A 1F4AA 3CQHA 3OODA 4C7DA 3IJ7A 1B3WA 1RCXB 1FXQA 5CPSA 3QHOA 4DYKA 4GE8A 1R9YA 1LBLA 1DEDA 4KT2A 4C91A 3CUGA 3M5ZA 2RDWA 3PUGA 1XRSA 4J35A 4NG3A 4W8BA 4GNKB 3H2MA 3NQDA 4UZSA 2I16A 1CEOA 1JNEA 3BCJA 4LSBA 2ZX7A 1R3WA 5HWNA 1NF0A 3W70A 4IJBA 3W86A 1MEIA 4QDMA 3NL2A 3AS3A 3GLCA 5I07A 4H2HA 5JH1A 4XIAA 1SR0A 3W27A 4FK9A 4Z2IA 3E74A 3EWCA 1OGSA 1E6RA 4IWWA 1UD4A 1B2YA 3OGVA 1OFRA 3GS6A 2HBVA 4IP5A 4DRSA 1MZHA 2BG5A 1XYZA 2Y62A 4LVGA 3CASA 2YB1A 3V18A 3KE0A 2X0HA 1OZQA 1T8XA 2YIHA 5D2WA 3TJIA 5I23A 1JDAA 2PRMA 3A47A 3PWAA 4NNBA 2CLEA 3ARTA 4HYVA 3NYZA 1JAEA 2J47A 3ARWA 4NX5A 4PMJA 1G4TA 4XUYA 4R34A 3GDMA 3MYPA 3EYPA 3U7BA 4HT3A 3AU2A 3CM4A 4YYFA 1W9PA 1W5OA 3QGVA 3W87A 1PXGA 1XIIA 5D9NA 3QXBA 4O11A 3V35A 5FAGA 2WZEA 3LEPA 1W54A 1LOLA 4QEEA 1YBQA 4WVXA 1G69A 7ODCA 5HINA 4FF7A 3IJQA 1ICQA 2Z6JA 3WQFA 1OC6A 4HPGA 1DJGA 2ZFAA 3UR8A 4OIFA 3IIZA 3EKZA 4HBKA 1XYAA 3LBMA 1RY8A 4DYEA 1W1A1 2YCJA 4YYCA 1FVPA 3TJLA 1QK2A 2BZNA 1DQWA 5B80A 2CBUA 4LS2A 3J7HA 1Q2RA 4DBUA 4LNCA 1RQHA 3SGZA 3BAKA 1T6MA 3DGBA 3GR7A 5D2XA 1S38A 5KITA 5JQ9A 1W9VA 4GD0A 4ICCX 4L7ZA 4M3PA 2C1GA 4HK7A 1Q2SA 5FL1A 1MQQA 1OX4A 1SFSA 4BS0A 1PZ3A 1R87A 3MVIA 3B97A 3L23A 2Y7GA 1KFJA 1TUXA 2QMJA 4J3ZA 4QQUA 2NXIA 1YADA 4NAEA 4Z2GA 3LCIA 4B5WA 3BSHA 3H53A 4FS9A 2E67A 1ZTVA 3B03A 1EH9A 3R7MA 2ZXBA 1QATA 2FPYA 3NL6A 1FCBA 4HZ7A 4S39A 2AL2A 2XJ7A 4BEUA 3H2CA 4UFIA 1VJSA 1R2SA 3VCRA 4F8XA 4GK8A 4DXXA 4IX2A 1J18A 2ZUSA 4O52A 5C54A 3QC0A 4M7TA 1CGUA 1XRFA 3PPFA 4UTKA 3PZUA 3W37A 3LENA 1PV8A 1JF6A 3UERA 1XUUA 1MW2A 2GL5A 2HNEA 2OWCA 3VIIA 3VIPA 4MNMA 4KRZA 1JPHA 3PZMA 4ICMA 1XM3A 4DUVA 3BE7A 4BI6A 2UZ9A 3TZNA 4PCTA 1EUNA 4JTAA 1DWHM 1ZZMA 3C8FA 2X1SA 3NQ8A 1IE7C 3PBGA 3ZVHB 3EX2A 2F6XA 4O16A 3O1NA 4ZBCA 3T2PA 3QYQA 1KBLA 4LUYA 2X0YA 5FL0A 4C6NA 9CGTA 4DWSC 4NHVA 2B31A 3G1XA 4KESA 3UVIA 3B8UA 4GRSA 5HK4A 3NDOA 2ON3A 2OO6A 2BVDA 4Q8TA 1XQKA 2MNRA 1VBGA 3SR7A 4AIBA 1PHWA 3NQVA 5LNVA 2WZTA 4GVHA 3UY8A 3FJLA 3DHUA 3DYOA 4O54A 1F6PA 4W85A 1BWKA 4H8UA 2CWXA 4OBTA 1E3XA 3GXTA 3MSYA 4JTHA 1IR1A 4HCHA 4AHPA 3P14A 3OVQA 3AMGA 3CJPA 5A8QA 2B7NA 1IQ8A 5L6UA 3M0YA 1WZKA 4JIIX 4HPJA 4L61A 2VVNA 3WQGA 1F9CA 3S2JA 3MMUA 4DWDA 1ZJHA 3IGXA 3ZLGA 1T41A 4OBRA 2YCIX 3VGGA 3GG0A 4H3DA 3Q2DA 4I5UA 4D6CA 1XYMA 2BGQA 4LT9A 2ZX9A 1XLIA 1JI1A 5CEWA 3MMWA 4FALA 2Z2BA 3F5LA 3AHYA 4GUFA 1XPGA 3UXKA 2VRKA 1A4LA 1UKOA 5AC5A 1NSJA 4LBRA 3NM1A 4LQ1A 2BVYA 4TVUA 1MO0A 4JHMA 2AGTA 1W0MA 3P62A 4LAKA 3PSVA 3VIGA 4AISA 4RV8A 3O16A 3F7JA 3EOLA 1K6WA 3RPTA 3A3HA 4MWAD 1GZJA 2A3AA 4XBSA 3UNTA 4B3ZA 3MUCA 2VEPA 4MKNA 3ARUA 3WMLA 3UJRA 1YIXA 4GVFA 4MJ2A 1N8FA 1V02E 4L9YA 1MI3A 3CAWA 4LANA 2YW4A 1J0ZA 2QZRA 3P5ZA 2GJPA 4LALA 2PZNA 2WVSA 4H7CA 3NOYA 1IR2A 4GX9A 1FHDA 4MIMA 5FIPA 4I7VA 3FOKA 1XYLA 1EP2A 3Q67A 3HJEA 4PBEA 1C91A 5E6ZA 3N2MA 5L9FA 1XLFA 4TX6A 3IAPA 1JRBA 3ABSA 2PTDA 2WLYA 1P5BA 3LHWA 4C6JA 2HPMA 2V5KA 3G1YA 2ZUTA 1MDRA 1Y5VA 3KOYA 5CC3A 1U1JA 3N13A 1VLWA 3DX5A 4F9DA 2DSZA 1TMLA 2QIIA 3B8SA 4O0KA 3VZXA 1RP8A 3UWVA 2D22A 4J40A 1MW3A 2WBKA 2VFFA 4DUOA 2Y70A 4K37A 3BQ6A 4C6LA 4Q4QA 1VPXA 1GNXA 1KR1A 2NW0A 4FXFA 4MNJA 5G1TA 4L65A 4RNFA 3ZZ1A 3POHA 1DIEA 3FDKA 3QMSA 3W1QA 3JW7A 3MUXA 2FZ9A 1W3IA 1H62A 2VX5A 3KBNA 3A4XA 1I4NA 3RXZA 1JZ3A 3GHRA 1LDCA 5FAJA 4IMCA 1SM9A 4TXEA 3ZSTA 3NZ1A 2V9DA 3T0AA 4B5XA 2C15A 2MANA 4WY0F 5DRIA 4OVXA 4E4FA 3KM8A 4DJEA 1XDLA 1TREA 7A3HA 2QCGA 1C90A 1TUFA 4OECA 1BPLB 4OU1A 5KETA 1ZL1A 5BRBA 3BZJA 4X61A 4CCCA 4UNLA 4F0LA 4WRHA 3W1LA 1M01A 1GQJA 1WKEA 2GDQA 4A3RA 1GJPA 3DEQA 1QNSA 4UQBA 3AYVA 4MNKA 1KWGA 4PUKA 1KO0A 2CLPA 3U6WA 4M81A 1RSCA 1X6UA 1AQFA 2FTWA 3UY7A 1I1WA 3WUGA 1AL8A 1ZBKA 4KW2A 1V7AA 1Z6KA 3MI3A 4H9VA 3W71A 3XISA 4X9SA 2XIJA 4O1DA 4DJFD 3QMRA 2XN0A 4IUGA 4O17A 3L4WA 1DP0A 5AECA 1H50A 1K8ZA 2J6VA 3IPWA 1UR0A 1XPYA 4Q22A 4MTVA 1YTEA 4Z0JA 2GQ8A 2IPFA 4A3QA 4ZE4A 4KF1A 1JUEA 3W01A 3TTOA 1JZ2A 2VWTA 2BTMA 1AK5A 1GJWA 3ZT7A 3CXOA 4LEFA 4HZ6A 3PFMA 2WZHA 4R7WA 3IK4A 2DZSA 1DXEA 1WKYA 3NXLA 4DBDA 1XIFA 3HO8A 4N42A 4QG8A 1VKFA 4QS6A 2CLKA 1YE6A 5I79A 3GQYA 2QUTA 2XDFA 3F2DA 3UD6A 1DBTA 3LN3A 4PUUA 2BS9A 1YRRA 1VEOA 3QFWA 4QCEA 5I78A 2VXNA 2Z1XA 3CEUA 1ME8A 1UW9A 3W6YA 4UTIA 3OGSA 4IXXA 3GU1A 4XUGA 3TSDA 5EY5A 4LYPA 1RD5A 4HNCA 1TPEA 4G7EA 3OP2A 3NQ6A 3UG3A 1E56A 2Y61A 1NQKA 9XIAA 5GNZA 1YQ2A 3QM3A 4ECLA 4D6IA 1V3HA 3QTPA 3UWWA 3F5JA 4Z1BA 2V68A 3KHDA 4F9JA 1R2TA 3DIPA 4E38A 5JIWA 3W28A 3ECQA 2R82A 4N4QA 4YPJA 3H7RA 4O53A 4BFAA 3L2LA 2J27A 1CCWB 3ARPA 2DJXA 3SRKA 4G6CA 1OQFA 3MTWA 3D0CA 4DN1A 4CU7A 3GC5A 3RPMA 4NAEB 1OC7A 3L12A 3Q65A 1EKOA 1AMKA 1JXKA 2V8ZA 3WK3A 3LZ3A 3TLQA 3N2CA 1XS2A 3S46A 2OR2A 4DJDC 3MKKA 5C9ZA 1KFBA 4PRRA 4MKSA 4LJ3A 3OLGA 2Z0IA 2PLKA 4FNRA 4YNGA 3LU2A 1EGVA 3ERPA 3NZGA 2EF9A 1MMFA 3RILA 5KZ6A 4YTRA 5C7HA 2YW3A 3ITVA 3PN8A 3PWIA 4JKKA 1GOXA 3PTDA 3WQOA 1J6OA 2VC6A 3N6HA 5DBTA 3WDRA 4NZ1A 3LYEA 2PDIA 1NWRA 2C0AA 4GIEA 3I3EA 1IXOA 1EC9A 1R86A 2YB4A 2NX1A 3WQPA 4DYJA 3SCNA 4PEEA 3CHCA 3L2MA 2VCCA 2BY3A 3TWBA 1B30A 1EBHA 4XTIA 1PE1A 1W32A 4HYWA 4IPPA 1SFJA 3B8VA 5K9DA 2W66A 2PURA 2IPWA 5BYWA 3NGJA 5AKQA 1X96A 2IS7A 2PCQA 4DNHA 1LG1A 4NUWA 1PYFA 2FLIA 3KZSA 4JOMA 4OUIA 2RDXA 1FX6A 4E3TA 1I2PA 1RJPA 2OEKA 4S3EA 4PMNA 3WEMA 1WUEA 4WDUA 3RM4A 3B8WA 5C2GA 1H5VA 3I65A 1UWQA 1C8QA 1FQ0A 2PBOA 3NQ7A 3G77A 4PUDA 5DY2A 1Q6FA 1OM0A 4MB1A 2E5BA 3V1HA 4KKXA 4H6EA 3SUTA 1XCXA 3FXGA 5EFDA 1JZ5A 4E2DA 2PE4A 4FSAA 5FA5A 2A3BA 3AS1A 1E9LA 1Q4WA 3PBMA 1IV8A 4NY2A 1B9BA 1WUFA 2PTXA 3GUWA 2YBVA 1E1CA 3W7IA 5AHEA 3H23A 1NJJA 4Q8NA 1IF2A 3GWQA 3G3MA 1G4PA 3UBPC 1A0DA 4MJMA 1QWKA 3S83A 3NPXA 3WDHA 4I9TA 4EWJA 4FNPA 1QCWA 5FJUA 2FFIA 1UQYA 2CBVA 1Q8AA 2DSKA 2X7VA 5C9XA 3LPGA 4GXWA 4CQCA 4HMCA 2WKGA 3W85A 1XH1A 4HTBA 2UY4A 1GVYA 5HR7A 3MUIA 4GZEA 1OX5A 1WXYA 2ODOA 1KV5A 3MJYA 2J7GA 3UETA 2R6OA 3CV7A 1ADOA 4KCTA 4KEZA 4DI8A 4NI8A 3UWEA 3H8AA 4IGSA 2QAPA 3VCCA 4ZSUA 4LPCA 4PZVA 3G3DA 2FH8A 3CS2A 4L9XA 5A8NA 4NVTA 3SSZA 4EPBC 2OYLA 1PDYA 4S3CA 1EX1A 2PWVA 3IWPA 3VGEA 1JYVA 4KWWA 2RJGA 5B7ZA 4OFCA 1M7XA 3GX9A 2YKKA 4IGMA 4OE7A 6A3HA 2AGKA 1KFLA 3Q58A 2CKRA 3MS8A 3D5HA 3TIMA 2PSNA 3TA9A 4RE0A 3LPFA 3WQVA 4W7VA 1J0KA 1JYXA 3WNNA 3QN3A 3NAVA 2WMFA 2ABAA 1QW7A 3E0IA 3K5XA 3EKLA 3W81A 2X42A 3B9AA 2J13A 1EF2A 1KBJA 4GGHA 5LIKX 4AZBA 4GUGA 2I1OA 3PF3A 1GG1A 4O4VA 4ZSTA 2I9UA 3VGDA 2OVLA 3D47A 1DHPA 1BWVA 1HJQA 3QHMA 1EOKA 1UZDA 3WQCA 1G9HA 2ZZ2A 4JNYA 1EF3A 4I3GA 1TKKA 3HA1A 1EB3A 5M3WA 5TNVA 1HVXA 4M19A 3M5VA 3ZFHA 4CEXC 4P8XA 3SO7A 4ZB0A 1HKVA 3SN1A 5AZ1A 3KP1A 2OZ3A 4O13A 1QHOA 1XX1A 4YVXA 1KA9F 1EGZA 2I14A 1CXHA 4MYAA 1XC4A 1JZ7A 4C6PA 2Z1VA 5C2CA 3FSUA 4UTTC 4JN6A 4K36A 3UCQA 1QPOA 1T5AA 2PRLA 4IT1A 4PSRA 3S5SA 2PGWA 2GUYA 1JJKA 1PWMA 3STPA 2D69A 2OGYA 2IKHA 2G97A 4GJJA 4ADSA 3FGCA 2Z00A 3PFRA 3EZ4A 4MB3A 3STEA 5LKYA 1N7KA 3ZLFA 5CCZA 2JBMA 1EOMA 2PF8A 4HHLA 4XD3A 1XDJA 3GUGA 1H7OA 3KBVA 5HDRA 1JEZA 2G4FA 1E40A 1CDGA 4O28A 4B4HA 5AC6A 3QC3A 1R0MA 2VR2A 4QNWA 3W02A 2WNZA 1VB9A 1UMLA 1XIHA 3G1FA 5M5DA 5GNYA 4JTDA 2X41A 3MC5A 1W9BM 2WYSA 3GTXA 1ITCA 1G4SA 2BY0A 4AU0A 4C6OA 4XVDA 2ISFA 2ISVA 4XG1A 1CXKA 2RHGA 2GGHA 3B40A 5I0DA 2PBGA 1XYFA 2Q02A 4AFYA 3ITYA 2GUUA 3VOIA 4XZWA 2FQIA 2P5NA 1DE5A 4JFVA 1REQB 2B4GA 6PTDA 3UXIA 2XVLA 4ZZ9A 3HG2A 3CEPA 2R91A 1A5KC 4JQ4A 4N9BA 2VDIA 1SZNA 3DFPA 1JXJA 1DKWA 1O1ZA 1TPFA 1YXYA 3HG4A 1GW1A 2EBNA 5F2MA 4Z1YA 3BAWA 4GNVA 3PJTA 3M16A 3CHDA 4PCSA 1A5MC 1RPKA 2D0HA 4IMFA 4D6FA 1OFPA 1PTGA 1JPIA 4BF5A 1HL2A 3BJTA 1J93A 4N6EA 3U8GA 1QAPA 4TVDA 3ARRA 4DNMA 1HW6A 2HQAA 3E12A 2QIWA 4YTSA 1PIGA 3CV6A 4LUSB 4Q4OA 1PPIA 2QGYA 4AY8A 1RV8A 2H8XA 4A2RA 2J6XA 1XF0A 3G8EA 3GB6A 3UJFA 1B5TA 1UUMA 3D3AA 3FYYA 4F3HA 1R9XA 4KGLA 2D2HA 2ZXQA 4G56A 3CPUA 4GOAA 5FJTA 4PTXA 1IWAA 1X1OA 3WSUA 1D8CA 2GPTA 4IMEA 4O1AA 3TA6A 1UWUA 1UPMB 4YCOA 1LUCA 3QY7A 1K1DA 3TQ0A 3DFHA 3AIQA 5DO8A 4WY0A 1KCZA 1E6SM 3IIPA 4O0QA 4Q8OA 4U2ZA 1RD6A 1DJXA 4QISA 2XH7A 2WC7A 3UT0A 3OHIA 1VIWA 1Q4NX 1FWBC 2Y2WA 4OKDA 4AVOA 3NZPA 5LSMA 5FJIA 1POKA 2QJHA 1PAMA 3A9IA 5G1YA 3WLLA 5AC7A 2VNCA 1I60A 4NIRA 2ZQ0A 1Z3NA 2BP1A 3UZ5A 1BG4A 3U2OA 4GHRA 1I2QA 4P7RA 3UJ2A 1K9EA 2PDCA 5AHLA 3KTSA 4RLIA 1EZWA 4LC6A 1AMYA 3NTYA 3KL5A 4QFUA 3HOJA 1MFVA 3WQ8A 2XFFA 1DXIA 3DFSA 1E4LA 3O06A 5EMUA 4W8LA 1BEUA 2ZA2A 4DB7A 3OZYA 1XW8A 3W1NA 3ZR4A 4HP5A 3EWYA 1YMYA 4B2DA 1M1BA 3VDGA 3H4WA 3WD2A 3AIUA 3EA1A 3C6CA 3P67A 3TUUA 4N9EA 5M1TA 3W22A 3H2NA 4Z17A 1V3JA 1TA3A 1IEIA 1NARA 1W31A 5BXPA 3BV4A 1NOUA 4HD5A 2YXGA 5KTLA 1TPUA 4MWAC 4H6KA 4I7WA 1O5QA 1S2WA 1HKMA 1PL9A 3EB3A 1MUCA 3WF3A 1C7SA 4F0SA 1XI3A 4QQ3A 4NP7A 4JDBA 1W5MA 3EB4A 1TRIA 4WJEA 2QDEA 1RLCL 3I6RA 4LWWA 1M04A 3GXPA 3WZ0E 4WDXA 5EA9A 4JTTA 2BBFA 2O4QA 3M07A 4AWEA 1GTHA 2PEVA 2VI0A 3HN3A 1X7IA 1BYDA 4FLQA 4KCVA 3UQNA 1E4NA 4UFLA 1KR0A 1U5HA 4WOZA 4ZOEA 1K7XA 4UCFA 1MDLA 2W63A 5F2IA 3P0WA 3WMSA 4KRTA 3SCSA 2ZUWA 1UWAA 1YKWA 1ECQA 2C1IA 2FHBA 3OZOA 6XIAA 2W3ZA 4GQ0A 2GJLA 4M5PA 3SRDA 4JQ1A 4XZIA 3MY9A 4H9YA 3LCFA 4NKCA 4K8EA 4Z0SA 3W1MA 4QDWA 3ME3A 4YXGA 5AHMA 2VYOA 1P6WA 1CGXA 1KKRA 4RDYA 5CJMA 1H4PA 4DAIA 1S5VA 2OTDA 3PSWA 4S3FA 3L68A 4IH3A 2PTZA 4F66A 5IOBA 3THAA 2W0UA 4C6KA 3P93A 2BGSA 1FH7A 4YTQA 2XWEA 3VX1A 5D09A 1HUVA 3M0JA 1M9HA 4KCUA 3ZOAA 1CLXA 3T42A 1G7VA 2OOGA 2R14A 2H3BA 3REQA 1TX2A 4NQ1A 3C52A 1DTNA 2Y1HA 3HQ1A 4JTEA 3NURA 3W0KA 4WDTA 7TIMA 5M03A 2P1FA 4TOQA 4QP0A 3VC5A 2DIKA 1JQXA 3ATYA 4S23A 2V3GA 1X38A 3P74A 4DHGA 5JMUA 1Q85A 1TVPA 5DLCA 1KLYA 2ZICA 5T91A 2NSXA 3UJEA 2KZHA 1WP6A 4FZIA 2R24A 2OT1A 3GXDA 1SW3A 4MJZA 3EXTA 1EDGA 5DN1A 4TTUA 4E5TA 1EYEA 2WCAA 4BHYA 1VHNA 1TR1A 2QJJA 3ES8A 4Y90A 3WNKA 4CCEA 4P2VA 2PP1A 5FCZA 3NO1A 4WK9A 4S3JA 3R13A 3GH5A 4IIEA 1SJAA 1X39A 3FEQA 1PSCA 1BXCA 3GTFA 1KBBA 3AISA 2OEJA 6REQA 4QCFA 1XP3A 1GONA 3GNOA 3GO2A 3DI1A 3P61A 4LUJA 5G1MA 4QE5A 9RUBA 5CGMA 4PUMA 1OEPA 4U5KA 1W9XA 3AMDA 4A8NA 1PJ9A 1SGJA 4ZQOA 4FB7A 3GDRA 1K8XA 1Z9AA 2VP8A 1I9CB 1LBFA 4IPNB 3O7UA 4JTRA 2V63A 3M4HA 1H49A 3NL5A 2IMRA 2F61A 4HPNA 1YPIA 3EXSA 4WJ8A 5EBUA 4JICA 4H7ZA 3FIGA 4MAVA 3UXAA 3II1A 4GBDA 1KNWA 3G2GA 1X8CA 3S5YA 3U3HA 4RPPA 2FVLA 5BOOA 1FXPA 5I7GA 5E0FA 3MVTA 2DGAA 3U5YA 3QTGA 3LDVA 2ASHA 2VEIA 4S3GA 2NT1A 4GQBA 3HV9A 1IEXA 4GUJA 4V2XA 4U3CA 3NA8A 5DEZA 2OZ8A 3V4BA 5J5RA 3LLXA 4LCQA 1OD8A 1FWSA 1E5JA 2CYGA 3EWXA 3CTLA 2YFOA 3S6DA 3CWNA 4A6GA 2WPGA 1SQ7A 3K8MA 3VOFA 2RDTA 3NCOA 4U33A 1HL8A 1IZJA 1X1ZA 5E9XA 5FF2A 4ERAA 4JFSA 2QW5A 1NFBA 1EBGA 3R89A 3ZMRA 5AYYA 1TV7A 4FEZA 4RV3A 2H9AB 4L4PA 2YCLB 4O57A 3UPMA 3CMJA 3R25A 3K4DA 4J3TA 3JR2A 5MKGB 3R10A 1KTCA 4OGZA 1E6ZA 4HQVA 2NQJA 3CQIA 2G96A 2BSLA 4ZXLA 3KBJA 1TQXA 3PB2A 3URAA 4IGHA 4PYSA 3EWBX 4LU0A 3NO5A 5ABHA 5IHRA 2OYKA 3G0XA 4K6AA 3HMCA 3SRFA 3STGA 3WNOA 3FEMA 1BTCA 3PZVA 1Q7ZA 1IIHA 4XV0A 2FZDA 3QQ1A 1PCWA 3RDKA 2XPKA 2HE8A 1VYPX 2V5LA 4W84A 3VPLA 2WHJA 4H6QA 3LI0A 4OOZA 1LT7A 2I56A 1XLLA 3C0JA 3HPXA 3SM0A 2PDUA 3TQPA 2XSAA 3QOMA 2R9RA 1G01A 4ASTA 1LLZA 4DEFA 4CQDA 1DWAM 1W37A 3IARA 3TJXA 4C7GA 3AIEA 1VRDA 1ZNNA 1FDJA 2E77A 2HZGA 2XWDA 1VCGA 4KQNA 3OQ8A 5A2BA 3TNBA 1OADA 1UWRA 4CD6A 1S5WA 2W27A 2XIQA 4K3ZA 3WQ4A 3KOWA 3TROA 1UP2A 3SCUA 3QVQA 3PHAA 5DY3A 1GOKA 5DF0A 4KIRA 3L0NA 5HQEA 2HISA 3ONBA 3CQJA 4HPXA 1AQMA 1KB3A 4HTYA 4FP1A 3VYLA 1VP5A 2CC0A 2PDHA 3RNDA 1BWLA 3FAWA 3LM3A 1C9WA 1JGIA 2BGNE 3GFYA 4K39A 4GINA 1WPCA 2ICSA 1TIMA 5EMJA 2X2YA 4IQDA 5BRPA 1BQGA 2JF6A 5DELA 1V6VA 2D0GA 2P10A 4G1KA 4HN8A 4N2YA 4QNEA 5G2WA 1RCQA 2HRWA 3W1PA 4AWUA 5G4HC 2INZA 3R0KA 2GVYA 2YCLA 1L6SA 3GKAA 4TQTA 4GCXA 4HZMA 2X30A 1ISWA 2QDDA 5A6JA 2EPNA 3CZEA 3BAIA 4P8WA 4RL3A 4CNTA 3R11A 3KTXA 1C8YA 1TWIA 1SYTA 1ZU8A 4W7UA 3PS7A 1P1XA 3WQ5A 4EF8A 3G6LA 5AYZA 1UZ4A 2V3FA 3JRKA 1QHZA 1CLVA 3KXQA 1V8EA 4JCMA 1MYRA 1S5NA 2FZNA 1RH9A 1TVNA 1LG2A 4MAZA 3R6IA 1QI3A 3SY8A 3CUIA 3KL0A 3M41A 3V7PA 4DBSA 4HN4A 5BXSA 3S0CA 1GVFA 1PS9A 2P53A 3LD5A 1Q3NA 1M7JA 1GQLA 1LWHA 5E5CA 2PDQA 2JQXA 2O55A 1CXEA 1JUBA 1V6WA 3RIKA 3R4IA 4FX7A 3VKCA 3V36A 2V2HA 1TELA 3B9NA 4HHMA 4S3KA 4RNIA 4DIAA 1UC5A 3PBUA 1LLOA 4J1OA 3FA5A 3UW6A 4P5UA 4HMNA 3HIJA 2ZRYA 4GGBA 4I9AA 1S2CA 5ABGA 3CK5A 2QCLA 3KLKA 1QBAA 5HWJA 5A6MA 1UHVA 3GG1A 3EOSA 5G4WA 3B0PA 1GCYA 5DXYA 3B0YA 3KRUA 5K4ZA 1B3OA 2EPMX 3WQ6A 1A5NC 3T55A 1EXBA 2DZUA 3E0FA 4GABA 4IMGA 2G4JA 4W4QA 2VL4A 3BURA 1HJUA 3WJYA 1VLIA 3NVDA 4AZ5A 4DLFA 3F4NA 2BVWA 2E28A 4Z08A 3CHVA 4N4PA 5A8PA 1HTIA 3N4FA 4YHGA 2VX4A 3BQ5A 2FZBA 3DERA 3VKAA 1TPH1 3GH4A 3CYVA 1GYMA 2YYUA 1HT6A 1BRLB 4L4MA 2VGBA 4GIRA 1FHUA 4M29A 3EA3A 3H4XA 4JXCA 1G7UA 4GXPA 2E4TA 4I8YA 5E70A 2WK2A 1V3KA 2ESCA 1IGWA 1UKTA 4KERA 3SUSA 3C86A 4OTKA 3VE9A 5FF7A 2EKGA 3OBEA 4CU8A 2C7FA 3UF9A 5KZEA 3KP0A 1XLEA 4JIEA 4YHEA 3WNMA 5D8ZA 4TR9A 5GJPA 3QQWA 3MPGA 3O2LA 1UD5A 4C6CA 3CO8A 4GQQA 5DMLA 4F2UA 4Q4SA 1VIZA 3N6JA 3QLDA 4W7WA 3MDWA 3M64A 3WJZA 4AY1A 3IJIA 1OIFA 3H7UA 1Q7MA 2BHUA 1P6BA 3ITGA 1ZPTA 2X1UA 3W74A 3BLPX 2PDMA 4B9ZA 3KWSA 4JX5A 5LYRA 5XINA 4J9JA 4S2BA 3DHDA 3LBCA 3VNJA 1BQCA 1O5XA 4AUBA 1JD9A 2ZDRA 5CSYA 1QVBA 3VKBA 5CZTA 3E3HA 1IEQA 1G94A 3R2GA 3MU7A 5HNRA 4JFUA 1FDYA 4U10A 2HXUA 2XH4A 2DJLA 3E6EA 4AY7A 4E2VA 3TSMA 2CZEA 4J2PA 1R3QA 1J79A 5A6AA 3VABA 3T6CA 1WQ5A 3C61A 1OC5A 2GJXB 2YCEA 1WZMA 4FF5A 3N9SA 4N9DA 5J5DA 1H1NA 3WLHA 2UY5A 4PN2A 3IEBA 3IIXA 4BK9A 5HJXA 1GPFA 2WNWA 1ODZA 1UKQA 1PDZA 2QT3A 3BDKA 3WL0A 4JTFA 1KM4A 1Z32X 4LOCA 1ZALA 1DWIM 1MUWA 4UUIA 3KOFA 2FB2A 3O6CA 4PTMA 3UWYA 4RDVA 2ZRZA 5AYXA 2EG7A 2GYIA 4EE9A 2C1HA 2VFEA 4PUNA 1BRLA 2NXHA 3BXWA 3ZVIA 2HXTA 1WA3A 4BI5A 2J25A 1QXLA 2YXXA 1XUZA 2PWHA 1U33A 1XGDA 3IS4A 1J9YA 2BMBA 1E6PA 3GYCA 3N9KA 1KGXA 4ZQRA 5J04A 3ALGA 3TN5A 3K2GA 4NAFA 4G8TA 2A6LA 1TV2A 2DT2A 1ZAJA 2NUYA 4A22A 3M5YA 4C5ZA 1UC4A 1IEWA 3E0VA 4JEJA 8A3HA 3XIMA 1F61A 1KM0A 4MLRA 1E72M 3C0QA 3RM8A 4EX4A 3TYEA 4CNSA 3W07A 5M17A 3CAVA 1RQEA 3SFWA 2XVPA 1I1XA 4RPQA 4IFKA 3HM7A 4L6HA 1XINA 2Z28A 5DCEA 4A21A 5TAOA 1CX9A 4AW7A 4C6IA 1SJDA 2GWNA 2PDWA 1HKIA 1X8FA 3DC8A 4P7OA 3LERA 4AX6A 4DF1A 3SCQA 3DFTA 3ZR6A 3UG8A 3R0DA 4DO4A 1O6IA 1CYGA 3S9YA 2W4XA 4JFWA 3LHUA 3A5VA 3FYPA 4C60A 1JFXA 2UV8G 4XK2A 4HCLA 3IVTA 3VM5A 3NGFA 1E9ZB 3O8AA 4AEEA 3LCXA 1K70A 3WK0A 2Y6ZA 4M6QA 2X1RA 3GW0A 5HANA 2BOFX 3WLKX 1KGWA 2YZRA 2PD5A 3S2CA 1I0BA 4C6EA 3SQSA 2O56A 2Z27A 3LGGA 1XXXA 1NOWA 4IJRA 4NNCA 5BCAA 3TEVA 2Y8UA 5ABEA 1V6YA 1DIOA 3EOOA 3ARXA 3P6LA 1UROA 1KRBC 3ZXWA 3WLOA 1DV7A 3AROA 1C9DA 3EGJA 4EPKA 2YGYA 1NTHA 2HS6A 4BF7A 1A80A 2HK1A 4WZHA 3ATZA 3I7SA 1KXHA 1XCWA 5HJLA 1O4UA 2YOCA 4XQ6A 1O12A 5GQBA 3VFLA 3F4CA 1UYQA 1RK6A 1MEWA 2VR4A 2DSWA 4GNJA 1H11A 1TJ0A 3KOZA 4QJ3B 4IF2A 2FTPA 3P0XA 3ZWSA 4L56A 2QXWA 3BGGA 1ADSA 3OEXA 3UYCA 1E5NA 1SFLA 3KBMA 2GZXA 2B7PA 3PZNA 4XSLA 3U2ZA 5A5WA 1LROA 4C1NB 3A4AA 1L8NA 1TV4A 4JNZA 1QBBA 4AAJA 4BQ3A 2BOGX 3TSBA 4AMCA 2Q8ZA 4ZOBA 3EA2A 4AEOA 1EJSC 1TJPA 4B5UA 3PBYA 2A4AA 3BOFA 4A8RA 3BAJA 1VBJA 4YLWA 3PB0A 3W7QA 4HNVA 2XG9A 2IQDA 2EG6A 2G3FA 3EOUA 3GRIA 3VD3A 4ZCWA 2CETA 1HO1A 1IEVA 4IHCA 4JTGA 1FWNA 4S3DA 2PGRA 4Q8PA 1V3MA 4DWSD 3AUJA 1NDZA 1OCNA 3GHSA 4D8LA 4YS1A 1S1PA 4MY8A 2WSRA 4ATWA 4O8RA 2WQDA 3N4AA 5H2ZA 1XRTA 4NZ5A 3DCPA 2NXGA 2ZXAA 4MLJA 2TYSA 3JZUA 1K9DA 4JD4A 1M65A 3T09A 2RH9A 1BG9A 3HGOA 2OSXA 3ZO9A 1KM3A 1WO2A 5JBDA 2A3HA 2W9MA 4HB7A 4Q4RA 1CGTA 1OWQA 1K03A 2ZRXA 2G95A 2OKTA 2ZUMA 1S3TC 1XRVA 4HNNA 4K7VA 4UBPC 2LLEA 4QG6A 2NVCA 4B5SA 2QPUA 4GYFA 1YX1A 4XISA 2DPEA 4FNUA 1V5XA 4ZQMA 1I2OA 1GTEA 4WR3A 3KOXA 5CJNA 3AIWA 1TPVA 3ONCA 4ACYA 3ABXA 4IIGA 4IG2A 2Z25A 3EKGA 3WF2A 2ZRWA 4FA3A 4GFSA 1YPXA 5BU6A 4LGXA 2QF8A 5E6YA 2ZRUA 5EMYA 5HA7A 4XX6A 4FIRA 1LRQA 1LQ2A 1EUAA 1QT1A 2AL1A 2J7FA 4H8HA 2Z1BA 1J6PA 3GH7A 2E5CA 1HKWA 6CGTA 1PBGA 3LTSA 1WV2A 2H9AA 2QV5A 5BNKA 3TTYA 2OLAA 1M41A 4FR6A 1VFFA 1UR1A 3G1HA 3GBDA 2ACRA 1R6WA 3ITXA 4W89A 2CERA 1J5TA 3KL3A 1FWFC 4NILA 2DU2A 3OZPA 4AZIA 5C55A 4JYEA 3R5EA 2OLHA 3AYSA 2WC4A 4WKAA 3F4VA 3NQ2A 3NQEA 3Q4DA 2TRSA 5CPOA 3AI0A 1EJTC 1V7YA 4NZFA 4PMRA 3OJGA 1SO3A 2ZZ5A 1POJA 4EPEC 1A47A 3CTTA 3EPNA 1A3HA 3ANVA 4US6A 4QM1A 4ZB5A 2EO7A 4W86A 1HN1A 4KFPA 5CSSA 1QNQA 3RO6A 5I3DA 1WXJA 2ZE0A 3GE7A 1QW8A 3OG3A 3W82A 3B9EA 2A1YA 1BLIA 3T78A 4CCZA 4MDOA 4ML4A 4NRRA 3AHXA 4A2SA 4OJYA 2JKAA 4D6DA 4EOUA 4UCGA 2P3ZA 3OTRA 1XD1A 3FA4A 4DZIA 1JCTA 5A6BD 1OF8A 3F2CA 5HULA 3R8HA 1XGZA 4GA8A 3P81A 1XIBA 4AYSA 1RHCA 3M0VA 1ZLPA 5I3HA 5C70A 3B06A 4JPGA 5F4XA 3W25A 1XIDA 1AG1O 2WJDA 3GNRA 2G0WA 7XIMA 2VX7A 4AH7A 1V51A 1IT0A 3CIVA 1NELA 1VCFA 2H90A 3T7VA 3CHFA 4O1EA 2B81A 1JDDA 3HQNA 1EPXA 4MGGA 2JGYA 2HS8A 4M1BA 1VYSX 2VFIA 3URBA 2P3EA 3UVAA 5BOFA 3LXBA 4WLCA 1ZS2A 1B3XA 1TZZA 3VIMA 2X05A 3RMJA 3UNDA 4LS0A 1Z8AA 1Z7AA 2QJNA 1NOFA 4F2TA 5I77A 1J0HA 1GVOA 2VFHA 1GOMA 3VAVA 3IANA 3SN4A 1RZMA 2BWGA 3NM3A 1AODA 2DZVA 2FZ8A 4H7VA 1OY0A 1TPB1 1XLMA 4EKJA 1EFZA 1P7TB 4DXVA 3N73A 1OG6A 2PA6A 4JR5A 1VD6A 1ZAIA 4QITA 5DBUA 3W84A 2YYTA 4AHOA 3HBLA 4FX8A 5EYWA 1VR6A 4LXFA 2DDXA 2QUNA 2ANUA 3RO8A 1WB0A 3GIPA 1HJWA 1SJBA 4AZGA 3QRHA 3S2LA 2ZTKA 3FX4A 1KM1A 3F4WA 1QNOA 3BLEA 3W2LA 3T1GA 4AZ7A 3NZQA 2FB3A 4Q8VA 4EAYA 4E8CA 4XAFA 1R5YA 2NX9A 3NPWA 3RX4A 1EDTA 3NG3A 4RX0A 2A21A 5CH9A 1DJIA 2OQHA 1FWRA 3KCJA 2ADAA 3GNDA 4Q7NA 3VGHA 3YPIA 1DIDA 1IWPA 1D7FA 4NYYA 3T8LA 3ZJ6A 4GMEA 1W3LA 1WZLA 3MHFA 3N2OA 1H2JA 4JDYA 4PCPA 1Q45A 3BMVA 4QIUA 1Z44A 1A4MA 1L6GA 4O8AA 1VAHA 4H41A 1OABA 4GJIA 4HHPA 4UMCA 1HNYA 2VCBA 3LCLA 4UNKA 1R3YA 3NQFA 4RXFA 4IIDA 1B54A 2BXVA 3QSTA 3PNUA 4A4AA 5FEWA 2FIQA 2E5DA 3KCOA 4AZ6A 2ZIDA 1AH3A 3URQA 3QHNA 1LQ0A 2CZDA 4H83A 3VDBA 2BASA 4FOKA 5TBOA 1N2VA 2JKPA 1W1TA 1XLKA 3TX9A 3OBKA 5CG7A 1TFVA 1VZWA 1V03A 2F6KA 1ZUAX 3W9ZA 2A3LA 2DQWA 2VR5A 2ZDSA 2HK0A 3LI1A 5E1QA 2ACUA 4O1CA 3LM7A 1KFKA 3NL3A 1OBAA 3S3GA 3FYOA 3VZZA 4Y9PA 5H1WA 1OK6A 1T96A 2GVGA 5A6KA 4N6FA 1ISVA 1B57A 2PU0A 3MUZ1 1HJXA 3IGUA 1W2VA 4Q4PA 2ZWZA 1UWIA 4IPJA 3CAKA 4NASA 4I8DA 3MI2A 4DX3A 1AFSA 1GG0A 3QKEA 1A50A 4TUFA 1H3GA 4Q32A 3S5NA 2X1TA 3I10A 1MQRA 3TC7A 3O0FA 3KBWA 5H8MA 1A5BA 4MVAA 4MADA 2ZKMX 4AQLA 5EMMA 2UWFA 3DG7A 4CUCA 2RJHA 3T9PA 5LHEA 4LVDA 4A05A 4K68A 4PTNA 3AHTA 4J4KA 3ABRA 2VO5A 4HU4A 2AQOA 1HJSA 4PCNA 1FWJC 3OYZA 1VJIA 3MUY1 3QEZA 3LLDA 5A94A 2NVAA 4ZGYA 1P0EA 3EDFA 4PSPA 1RR2A 3OW1A 1O95A 3S9ZA 1UWTA 2DH3A 3VUSA 4AIOA 3OVRA 4KPLA 1BF2A 3IV8A 3KEHA 5BWAA 2CWNA 3QY8A 2DZTA 5AC4A 1TWWA 3VIOA 4MZYA 4LNYA 3BJFA 4UQEA 1AZ2A 4PMVA 3GVRA 4XKYB 4CN4A 1J0YA 5D02A 1XLGA 3T4WA 4JL1A 2DEPA 3AJXA 2VRQA 3AICA 2C71A 1NP2A 4HU3A 1Q5MA 1XYBA 4XIMA 3LCWA 1KW1A 2YSWA 3PJWA 1HGYA 2Y88A 4PRTA 4IZGA 4GQGA 5IFPA 3DXIA 1QI5A 2WWCA 4MZ8A 4TMBA 4PB3A 1MW1A 4JHOA 5LNRA 3M5XA 3R0UA 1E0UA 1W5NA 1H7NA 4Y9NA 4LF2A 3W1UA 3SIZA 3E38A 1UUOA 3QH2A 3LQGA