4Y8FA

Crystal structure of triosephosphate isomerase from clostridium perfringens
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
251
Chain Sequence
b'GSHMRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIVNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate Isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Isomerase
total genus 86
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y8fA00
2B7OA 3W2UA 1VGAA 1VLWA 1UCWA 3VKJA 2J9XA 5LZLA 4UTTC 5DCDA 4BFAA 1CX9A 3CEPA 1AW2A 2WQPA 3G1XA 4ALDA 2CZDA 4UFMA 4RZ4A 3HIJA 4BWLA 4DO6A 3W1PA 3LOTA 2CLIA 4DO4A 2RH9A 4CCCA 1RR2A 2NWSA 5G2WA 1DQXA 2FB3A 2B0MA 3M7WA 1A5BA 3M41A 4UFJA 1S5WA 2Y7FA 2FPYA 1JUEA 3P7YA 4UTIA 2WV8A 1Q6LA 1VZWA 4RXGA 4GUJA 1VRDA 4FXSA 4NX0A 3PUOA 4MFDA 3G22A 4O50A 4XTDA 3RLVA 1L2UA 3W6YA 3G3MA 4O10A 5AHMA 3I6RA 3OHIA 3PWAA 1MZHA 5HWMA 1QFEA 2A1YA 3NPVA 3NL5A 1PCWA 1OF6A 3C2EA 3RU6A 1TSIA 1K7XA 1GYLA 2Z0IA 3BG3A 1DJNA 3NEVA 1TPUA 2Q3OA 5BRBA 2EGZA 4E0CA 3KXQA 3KVKA 1ZENA 4YWIA 3UXDA 5FF2A 2PC4A 5E1QA 3PM6A 4IX0A 5J5RA 1AL7A 2BLEA 4PC8A 3DFOA 1Q6QA 2DORA 2CU0A 3FA5A 2C6QA 4HPXA 3S1XA 1JQXA 3G24A 3U2OA 2QKFA 4NVTA 4LOCA 1BWKA 3O05A 1PHQA 1DHPA 3TFCA 3PC0A 3YPIA 4NXKA 3A23A 1MEIA 1DBTA 2CZ5A 4GUFA 3WJWA 2X1RA 1OYBA 3NQGA 3TDFA 1FQ0A 1PL9A 3TQKA 1G7UA 1RD5A 3DU0A 4FXRA 1LRTA 2A85A 4UTHA 3SR7A 5CSRA 4FNUA 2P10A 2OX1A 3PSWA 1JJKA 3BGGA 4YMZA 4FO4A 2YDAA 4WJEA 4O12A 5DY3A 3KVMA 1RQHA 3T40A 3LGEA 5L6UA 3HO8A 4POCA 3DHDA 1V5XA 2HS8A 3GNNA 4OHQA 3O15A 1LRNA 2OT0A 1GJPA 4WOQA 4GBUA 3TXZA 1H7WA 3PSVA 4LUIA 1IF2A 2ZRWA 3VFLA 1N7KA 2QJHA 4O16A 4GUHA 1LM1A 1JQVA 1VLIA 2FIQA 3NQAA 1EUAA 1K03A 3NQEA 3HOJA 2QUTA 1SSGA 1CI1A 4A21A 3A21A 1F76A 3KX6A 4GNJA 5TIMA 1OYAA 3PAJA 4ZQPA 2J88A 4RR4A 4MY1A 5LKYA 4N9BA 1K02A 5E0KA 5EMUA 2H8XA 5F4XA 3PBUA 4UR7A 4IUOA 4FNSA 2D73A 1MEWA 3GIYA 3NQ8A 1C9DA 3CM4A 1Z44A 1LORA 3S0CA 4OU1A 5L9FA 1JCNA 3TC7A 2Z6JA 3P8IA 4JTLA 3W86A 4O4VA 3TA6A 3B05A 2I14A 4NJGA 1SZNA 5AYXA 2CFFA 1WOBA 2ABAA 3CWOX 5I3IA 4TO8A 1EP1A 3BG5A 3MI3A 5F4WA 3CIWA 4CQ9A 3W7LA 2ZA1A 2VEIA 2YZRA 4JY9A 4TIMA 3FKRA 3W2JA 1FXPA 1GTEA 1UUOA 4RLIA 3W72A 4EF9A 1EA0A 2ISVA 3LV6A 4ZQMA 1DQWA 3G8RA 3CLMA 2QCDB 1TYGA 3W9ZA 5BMXA 1XC4A 3GKFA 3Q37A 3E96A 2V5LA 2B4GA 1F6PA 3LCFA 3TE9A 2QCMA 1SZGA 1ADOA 1JCYA 1EB3A 5BOOA 4JYFA 2ZZ3A 4O0ZA 1Q3NA 2OCZA 4MOZA 1KA9F 1TREA 1KM4A 1NEYA 3KVJA 4WY0B 1FXQA 1T0OA 3LHWA 4A3UA 5C5YA 1D9EA 3QSRA 1L6YA 4CQAA 3LDVA 4I9AA 3NA8A 4O1CA 1O4UA 3IVUA 4FHAA 3TMLA 3SZ8A 4PL2A 2E68A 3IRDA 4KWWA 2DZWA 5K9CA 3W7RA 3W07A 2C3ZA 3CC1A 5G4EA 3HPSA 3NYZA 1ICSA 2ZRVA 3P74A 1VYRA 3HGOA 1FCUA 3TSDA 4RJEA 5AYYA 3O07A 3G1YA 3GDKA 1YXDA 4K7VA 1HO1A 3E49A 4NUWA 3S5OA 2FPTA 5KTLA 1H51A 5F2IA 4UNLA 2VFHA 1TB3A 4O57A 1TRDA 3NPWA 4MLRA 5K3VA 3IIVA 1OFQA 2YFNA 2ZCGA 3RMJA 3S1WA 2QJGA 5IM51 3W23A 4LV4A 4DPQA 1LROA 2JKPA 3G1HA 3HPXA 5DCBA 1G4SA 2YXGA 4HN4A 4RZ6A 3PULA 5AHIA 3TIMA 4DBEA 4FB7A 3SIZA 4WXZA 4JTGA 4KKXA 4E38A 2PURA 5F1VA 3MW7A 3NZ1A 1GZGA 5GVJA 3W7HA 1I2NA 2FJKA 1S5VA 4IMGA 1DJQA 1RZMA 3UD6A 5AB3A 5F1UA 4LWWA 1LLZA 5HNRA 5H2ZA 1OK4A 3RK8A 5I3JA 3CHVA 4GFSA 3W1QA 2QCDA 2CLEA 1TTJA 1J4EA 4ONVA 1WX0A 1FCVA 2DZVA 3TJLA 2DU2A 3HGJA 1O5XA 2X30A 2NWRA 3M1ZA 2VEPA 4QM1A 2A4AA 1BEUA 3DAQA 3UWYA 2CWNA 1A5SA 4WY0A 2RFGA 1F6KA 5HULA 7TIMA 4A22A 4KWVA 1X1ZA 1SUXA 1W5QA 3BK0A 2VENA 3CB8A 2EKCA 1W5MA 2Z1BA 3QF0A 3TU9A 4HKPA 2GUUA 3N19B 1ML1A 2GJLA 1ZFJA 2A21A 3GR8A 3NVTA 1ME8A 3WK1A 1JULA 4AH7A 4WOZA 2AQWA 4WD0A 2Y85A 3EX6A 4CQ8A 4UTUA 5T26A 2NUYA 1PS9A 4FNRA 5A8GA 2VFFA 3TKFA 1SZEA 1G67A 4ADUA 1X7FA 3F4NA 3VE7A 1T96A 3W88A 1HL2A 2HS6A 1KFKA 2DJXA 3DFQA 4O11A 1XUUA 4S2BA 1TJRA 3LXCA 1A5CA 2B7NA 1UJPA 2QCCA 1G69A 4K39A 4UTMA 2YGYA 1R2RA 4MPQA 1I8JA 1GVRA 4FEZA 3T4CA 4UFHA 1V7YA 1LBFA 4Z0SA 1W8SA 3GR7A 4BF9A 4C1KA 5U4NA 2NUWA 1H61A 2TRSA 4JDBA 4FX6M 1I2OA 3A5VA 2VEKA 3STFA 2QCLA 3UNDA 1J5TA 3IGSA 1ZCOA 1RV8A 1W54A 1AMKA 1FX6A 2FB2A 3LLFA 2I1OA 3W7QA 1GVOA 5FEPA 4O53A 5K9XA 3O6CA 5D02A 3DXIA 4ADSA 2BWGA 2A5HA 2C15A 3NM1A 1DKWA 2ISWA 1YDOA 3I7QA 4Q33A 2Q8LA 5KMYA 4K36A 3V75A 5EA9A 1F7BA 1TCDA 1YPFA 3A9IA 3B06A 3HPZA 5IBXA 3TXVA 2DZXA 4FNQA 1SQ7A 2E1DA 3DENA 1KTBA 1F05A 2CLHA 5FEWA 3NDOA 4LS2A 1K7EA 3I7RA 4DBDA 3O6DA 5C6MA 2A7RA 2GQAA 2ZQ0A 2O7QA 3STCA 2ZZ4A 1ZJIA 3A5FA 2Y88A 5K4ZA 4RKAA 5E93A 5BNKA 4UTJA 5D2TA 2EF9A 5DY2A 4BI6A 2C1HA 1YADA 1P4CA 3B0PA 2J9YA 3LCXA 1I4NA 4JYEA 4XBKA 1TPEA 4LTSA 4PEKA 3LLDA 4NZFA 1W3IA 4M19A 3CT7A 3O06A 4UTWC 4JTUA 4AXKA 3ZWSA 3PUEA 1ZAJA 1PHWA 4M6QA 3R12A 3S5ZA 4EOUA 2GQ9A 3NL3A 4MFEA 4O1AA 4AVFA 4PH6A 1QR7A 1OF8A 3W71A 3NQMA 1WDWA 1QPNA 4PFMA 2G97A 3NAVA 1VC4A 2GPTA 1YXCA 3MO7A 3B03A 3SSJA 3GDMA 4PA8A 2VFGA 4JS3A 1XDMA 4NZJA 3KVLA 1OFEA 4ZZ9A 1XUZA 3A24A 1AW5A 2BXVA 4RZ5A 3TSMA 3UWWA 4ICNA 1OVDA 5KZMA 3AO0A 4TR9A 5LNWA 1YDNA 2QUUA 2B7QA 4LW7A 4ADTA 3BW3A 2R91A 3L21A 3MHUA 4LV9A 1TO3A 1Z41A 2EAWA 3NQ6A 5DXXA 5FF3A 1NF0A 5AHLA 2X2GA 1IXPA 1JR1A 2Y62A 3R13A 4JY8A 3W7OA 4TU1A 2X1UA 1KM2A 3OG3A 3LERA 3QYQA 1SO5A 3QH2A 3L2IA 1TTPA 4HHPA 3W75A 3QFEA 4E2DA 3BGJA 3BLIA 3FLUA 3M16A 3TX9A 3QJAA 3W22A 4EIVA 1QDSA 4BI7A 1I2PA 1TV5A 5HUOA 1HTIA 1KM0A 3KFTA 3W7DA 3BW4A 3PBYA 3PUDA 2UV8G 1KV5A 1LCOA 1GYNA 1LOSA 3DFNA 4R33A 5HQEA 2YX0A 3LCWA 4ZVJA 1KFBA 4QIUA 4CCEA 4B5NA 3L66A 1H1YA 3FOKA 3EX1A 2BTMA 3WK0A 1W31A 1L6WA 1EIXA 3W1XA 3R5EA 1NAL1 3GB6A 3BVJA 3ABOA 2ATSA 1JUKA 4LT9A 2WNNA 3W7EA 1WAUA 4FNPA 1THFD 4HPJA 3O16A 5D03A 1FWNA 3LHVA 1R2SA 3MWAA 3HMJG 2QCEA 3CIXA 3N34A 3M5VA 1VYSX 4PTNA 3EKLA 4JICA 2PRLA 4O15A 5C2XA 1FDYA 3MBDA 1OFDA 3C3NA 2A0NA 4IMCA 5DLCA 5HUPA 3P82A 3DI1A 4Q4KA 3CEUA 3W7PA 4O13A 2GQ8A 2B7PA 1GVSA 1SO3A 3THAA 2VXNA 1RPXA 3GXTA 5G1TA 3SFKA 1KLYA 4EWND 5BW6A 4JX4A 3B0UX 1AW1A 4PCFA 3LCHA 3W87A 2G95A 5LNRA 1KFJA 3NO5A 3L0KA 1RVGA 1VR6A 1P0NA 5FEZA 2OMAA 1H50A 3I68A 3TW6A 4IQLA 5AC8A 5D04C 5G1YA 5HMSA 4HNTA 3ZR4A 4BR1A 1W37A 1WOAA 3GZ3A 2QDHA 1H7OA 3CU2A 4I7UA 1KM5A 3C61A 4U4MA 1KFEA 2JKAA 4M7SA 1PE1A 3H54A 4LU0A 2WSRA 1FWWA 5EPDA 4JYDA 1EP3A 4GJ1A 5LNVA 3BPWA 3TR2A 4LUJA 2YSWA 3S1UA 2NXIA 1OYCA 3GXNA 4X22A 3L67A 3FFSA 3TUUA 3UXAA 3I65A 1AK5A 4H3DA 1MXSA 1YPIA 4S1FA 3P8JA 1VPXA 1S3HA 1MEHA 4K37A 1R46A 2C0AA 4RV8A 1KM3A 2WSQA 1ONRA 4LVAA 3M5XA 4OE7A 3QMTA 3WJXA 4JTSA 4H4IA 1OFOA 1B4EA 2YW3A 4W9TA 4M5PA 4IOTA 1X8FA 2NX3A 2ZA2A 2FQIA 4JN6A 3IIPA 5LNSA 4QQ3A 3TV8A 5FF4A 3GDLA 3W3OA 1LP6A 1G4EA 3NL2A 2RDTA 3EB2A 4JTJA 3ABRA 5AHEA 4FIQA 2HSAA 3PF3A 4K8EA 2WPBA 3FEMA 1T8XA 1DL3A 2E6AA 3NGJA 3HG5A 3LM7A 3SW6A 3NQCA 4TMBA 5DBUA 3FYOA 2WNQA 4YL2A 3GAYA 2A7NA 1K8YA 1YXYA 4OBTA 4OV4A 3P81A 4Z08A 5HJLA 5HR6A 4XWUA 1SPQA 2V2CA 4H6KA 5AFDA 3QRHA 1JVNA 4IX2A 1W3NA 4A2RA 4IJBA 2Y6ZA 3LRLA 3NG3A 2EHHA 4NNAA 5I3HA 2WO5A 3GLCA 3MYPA 5K9DA 4N02A 2A7PA 5AC6A 3M47A 2DZTA 4K8HA 3DI0A 5CSSA 3S9YA 4N9EA 5HR7A 3PG8A 3P61A 3N73A 3SY5A 1H60A 2E77A 2HMCA 3KRSA 1FDZA 4GE8A 3M43A 1K8ZA 2CZEA 4BWLC 4LRTA 1GEQA 3DBPA 2C14A 2JBMA 3P5ZA 3FIGA 1OHLA 3CWNA 3N2XA 3FS2A 3Q2DA 3THQA 3L0GA 2V30A 2E09A 2ISSA 1G4TA 4GUGA 1VCVA 3USBA 2H6RA 1TTIA 4UTWA 4Y6GA 3N2MA 1G6CA 4I7VA 3NPXA 3SJ3A 3P60A 4LVBA 1TV7A 3JR2A 3T7VA 2Q3RA 3HG4A 3JS3A 3MYOA 2H90A 2V2DA 2QDGA 1JRBA 2NX1A 4IXXA 3INPA 1DORA 1TPDA 1B4KA 3BLEA 2E6DA 2YPIA 4HT3A 3P67A 2E5BA 2ALDA 1TQXA 2ZTJA 4NU7A 1AL8A 1OFAA 5TBOA 3MP5A 4GUIA 1KFCA 1M7OA 3MJYA 4J9JA 3C4UA 4NX5A 3QEZA 2GVLA 5FESA 3UQNA 1WYIA 3CTLA 4TX9A 2V81A 3HQ1A 3Q58A 3OVPA 1W5OA 2JK2A 1MO0A 3MHFA 4Q32A 3VCRA 5I3KA 1QPOA 4O14A 5K2ZA 4JX6A 4AF0B 2NZLA 4P2VA 1KM1A 3D0CA 4AHOA 5CZJA 4WZHA 3LB0A 3L68A 2QR6A 1NSJA 3V1PA 4XTIA 5D2YA 2YFOA 2KZHA 4UR8A 1L6SA 4UTTA 4MZ8A 3UPBA 3RLUA 4UMCA 1TPC1 3LI0A 4JTHA 3G1VA 2TYSA 2ZYFA 5D2XA 2WSYA 3KHJA 3NM3A 4LC6A 3QMSA 5DCEA 1OFPA 2J24A 4ZQOA 4O28A 1IXQA 4M7TA 3GXPA 3P84A 4Z1DA 3EX2A 2AGKA 1ZY9A 3QM3A 1PCKA 2G5WA 2Q8ZA 2FFCA 3MUXA 3HGRA 3W7CA 1A53A 4DELA 4HNNA 2XN1A 3IIZA 1XBVA 3E9AA 1OX6A 1ALDA 2A2IA 4IMEA 3WK2A 1K3UA 2CLKA 4S2CA 1F74A 3C52A 5FF0A 1FY6A 2Y61A 3M5YA 2Y70A 4Y90A 5CZTA 1K8XA 2H3BA 3FJLA 5HINA 1IXOA 5CZSA 4RCXA 2E6YA 3L5LA 4HSOA 1SR9A 5H91A 1YYAA 3UZJA 4KFOA 2QF7A 2QCNA 5EYWA 2OJPA 3B8DA 1TPB1 1XCFA 2LLEA 2J6XA 5F2MA 5D30A 2XN0A 5I3GA 4R34A 4JXCA 3EXRA 1M7PA 3W2NA 1TJPA 2WJZA 5K7JA 1FWTA 1G4PA 3IGXA 4X9SA 3W1NA 3S8HA 2DP3A 3F03K 3LHUA 1TMHA 1O94A 2GVJA 3PBWA 2ZRYA 3QW3A 2QAPA 3LCIA 4ORIA 4NT0A 2PRHA 1E51A 4DXVA 3W7MA 5LGXA 1DVJA 3B04A 3EX4A 4Y96A 1N8FA 1B57A 1LDCA 1WXJA 1X1OA 2GOUA 4LVDA 4AF0A 4BI5A 3W2LA 2YCEA 4M6PA 1GWJA 3RNDA 4LY8A 1GOXA 1OJXA 3BW2A 1XM3A 1F5ZA 3TSBA 3MI6A 3UY7A 3QPYA 1XBYA 1L9WA 1R2TA 3QQ0A 3NOEA 3IEBA 3W7KA 4L4MA 1TRIA 4RX0A 3W76A 1H7PA 1VS1A 2ZZ5A 3HBLA 3STGA 5HWNA 5G5IA 3O8AA 4N4PA 1XKYA 4QISA 3L0NA 2GVGA 4NJKA 2NV1A 1SW7A 1H7XA 4U28A 4CNNA 1DV7A 1TTQA 1OK6A 5U7SA 1NFBA 3O1NA 2Y7GA 3W1MA 1VCGA 2VKZG 3QZEA 1KV8A 2ZRUA 1OX4B 2VEMA 3C2RA 1EX5A 2Y7EA 1RQEA 3G0UA 3NQVA 3EXSA 1KFLA 3S5YA 2ZBTA 2TPSA 5CPNA 3MHGA 4Z1AA 5CPLA 1WV2A 4O1DA 1P0KA 5SWUA 4IWWA 4LRSA 3STEA 1ME9A 2ZA3A 4WQ6A 4LNYA 3FJ6A 4JNMA 1O60A 2BZNA 1QWGA 4Y9AA 3C8FA 3CQ0A 4ZL1A 1U5JA 1GG0A 6TIMA 4LS0A 3C2OA 1QNVA 1QO2A 1M5WA 2R8WA 2P0OA 3G1SA 2C19A 2Y63A 4MJZA 5J5DA 3W1TA 1LBLA 4XUGA 1Z48A 3TAOA 6ALDA 3S5NA 1GPWA 5D32A 3ANYA 5C54A 2WNZA 3G1DA 1LRQA 3EEGA 3TW7A 1GT8A 2A6NA 5D2VA 2Z6IA 3EXTA 1W3TA 4Z0JA 5AN7A 4DO5A 5TQLA 3T44A 1BWLA 4GWEA 1H62A 5D33A 1HG3A 2NXGA 3W1RA 5D09A 2EPHA 5FF7A 2A6LA 2CLFA 2V5BA 3UWUA 3LXBA 1W56A 5AC7A 4A29A 2V82A 3L9CA 3Q94A 5G2IA 1Z42A 4FX7A 2JKEA 2YYTA 3W2KA 4BK9A 4UTKA 4YCPA 3IIXA 3M9YA 1GG1A 3N3MA 2BX7A 2XN2A 3DFSA 1QAPA 4KFNA 3IV3A 1OABA 3W7JA 3WFAA 2ZTKA 3MMTA 4IPJA 2FDSA 3QQ1A 4X3ZA 1YDVA 4WX2A 3MBFA 1W0MA 3GDRA 1OFRA 3G1FA 1P1XA 1LYXA 4MZ1A 5D2WA 3ELFA 3SECA 2Z2UA 5BMWA 3RFAA 3W1UA 1IIHA 1VH7A 1W1ZA 4X2RA 3ATYA 2W0UA 1UB3A 1XI3A 5LSMA 3HGSA 1OX4A 3LBMA 1YTDA 3PB0A 1IXNA 2QAFA 3L5AA 3BO9A 3E02A 4GXMA 1GTHA 4CLMA 2J27A 1W5NA 4OGZA 3W74A 5K4XA 3B0VC 3WJZA 2NX9A 1H1ZA 1JCLA 4O19A 3DHFA 4QNEA 4HNVA 1BTMA 4JEQA 2NXHA 4UMBA 3LV5A 3NQ7A 2W6RA 1HUVA 4Z1BA 1UASA 1KW1A 5DELA 1QOQA 3GAKA 4Y8FA 3C2FA 4PL1A 1JUBA 1FWSA 3QPZA 1OX5A 3R2GA 2DZPA 3W7GA 4WUIA 4NJIA 2CLMA 3O63A 3S42A 4IMDA 4JGDA 3MP4A 5EKYA 2DJLA 1KTCA 1OFBA 1ZAHA 4EF8A 5EBUA 5CKSA 4N9CA 4JTKA 4O17A 1QO5A 4MYAA 1J2WA 4WY0F 2NLIA 3ABQA 4O0KA 4AMAA 1XBZA 4ORMA 1B9BA 5LGZA 4NQ1A 8TIMA 4AWUA 3NQFA 4AAJA 1ICQA 5F2GA 2NUXA 3DKLA 2O7SA 2F7FA 3CPRA 3DFTA 4JTEA 4HIBA 3G3DA 3LTSA 1M6JA 3P62A 3QSTA 4DPPA 5FEXA 2X16A 4RXFA 4CCDA 4NXSA 2TSYA 3W85A 5IBXC 2ZZ7A 4JIQA 2CLOA 3EX3A 4GC4A 4I7WA 4DF0A 3C6CA 2ZRXA 1H63A 4N4QA 2RKXA 2DZUA 1Q45A 2ABBA 1NF7A 3OBKA 4AHQA 1IIGA 5AOUA 3HG2A 2QCFA 4NJJA 3WK3A 1SW3A 3PVFA 4K7YA 3NL6A 3U8GA 3LX9A 3TC6A 1WQ5A 4MUZA 3LCGA 2WOQA 3GX9A 2JGYA 4P61A 1SSDA 3OEXA 4UNKA 3TQVA 3LRKA 4MIMA 4O4WA 5D37A 3NZRA 3NQ2A 4UUIA 3TK7A 2CW6A 1Q6RA 5CPOA 3UWVA 1FDJA 2P1FA 4O54A 2VFIA 4EVZA 3C56A 2G96A 3F4WA 4K38A 4FX8A 5G2HA 3P5YA 2QCGA 3R89A 4FF7A 2C13A 3L5MA 2TMDA 3L65A 5I3FA 3IVTA 1A50A 1BKSA 2DZSA 5AHFA 3H55A 3OA3A 5AHNA 2BSLA 3IIOA 1XBXA 2YYUA 2NV2A 4AWTA 3TH6A 3AJXA 1ME7A 1LBMA 1HO4A 4MY8A 3G8EA 2PE4A 3G1AA 5CGQA 3O6YX 5LHEA 4O18A 2F84A 3T78A 3M5ZA 4R53A 1EP2A 2V9DA 4YLWA 2AAMA 1EWDA 3PS7A 1IGSA 3P80A 4M6VA 4JD4A 1I2RA 3GK0A 1VHNA 4OWGA 5C55A 2FTPA 2R94A 4MY9A 3DH7A 2CLLA 2PCQA 4DQWA 1WA3A 3GNDA 3VNDA 4AB4A 1KBJA 1EEPA 4QSHA 3W73A 3K30A 4JIPA 1FBAA 1X6UA 4L4LA 4TMCA 3UWZA 1C29A 4FNTA 1LOLA 1EUNA 1QMLA 1LOQA 3W7NA 1ICPA 1JCJA 5F2LA 3KRZA 2R14A 4MJMA 5A5WA 4LS1A 3MI2A 1U83A 3NPUA 2H8ZA 4UFIA 1KBIA 1T99A 2VOMA 2VELA 2RHGA 4JTIA 2H3DA 1VHCA 4HSNA 5LNUA 3VE9A 3FKKA 2YW4A 3BG9A 2IQTA 5G4WA 3I7SA 3UPWA 2FLIA 3OIXA 4O1BA 4R7JA 3OVRA 5KSWA 2CZFA 2GJNA 1KTNA 3QMRA 2ATMA 1ZAIA 3ZWTA 1YTEA 4XZ9A 3LHYA 4ML9A 3TCEA 1FWRA 1ZNNA 3BARA 3KAOA 1Q6OA 1TV8A 2V2HA 3ATZA 3EWXA 4AEOA 5AYZA 1XL9A 3M0ZA 1I2QA 3TNOA 5KZEA 1F73A 3LBCA 4JDYA 4PODA 3W7IA 3EWUA 5EL1A 4XBSA 3W2MA 4DF1A 4A2SA 2ZZ6A 2QUVA 3C0JA 5LHFA 2C18A 4QAIA 4C1LA 4AWSA 1SO4A 1SFJA 3GDTA 1AG1O 4G1KA 2XFWA 3PB2A 1LTDA 1VJIA 1D3HA 3UZ5A 1H7RA 1LLWA 1HFBA 3QW4B 2J9ZA 1TIMA 4UCGA 1NVMA 1VQTA 1MSSA 4UFKA 3VI2A 4K6AA 3SGZA 1N55A 2V8ZA 3HJZA 5D38A 1UUMA 4DEFA 3ABSA 2ZFAA 4CNOA 4NJHA 3UWQA 3C2VA 4JTTA 4D2JA 1FCBA 5MHBA 4O8RA 4UIOA 3SI9A 3RF9A 1VYPX 1A5AA 3BV4A 4ZMGA 4AHPA 1R30A 2ZZ2A 4UMAA 2I9EA 1JCXA 3LTYA 4OT7A 4O52A 5DBTA 1H5YA 4HNUA 1TQJA 5DXYA 3M44A 4XQ6A 1F2JA 1OG0A 2C16A 2ZRZA 2ZZ1A 3M6YA 4QJ1A 4JX5A 4MVAA 1RQBA 1ZHAA 1D3GA 5CG7A 1TPH1 2X1TA 4KFPA 3MP3A 3ZFHA 3N9SA 2X1SA 3LXAA 4N9DA 3KOFA 3NR0A 5KZDA 1O5KA 4LVFA 3R8RA 3E12A 3UY8A 4UFLA 1LZOA 1JCMP 4IMFA 4MZYA 4N6FA 1YTKA 1SO6A 1ZALA 2Y89A 3FYPA 4UC5A 4ZQRA 1XFBA 5F4SA 1QPQA 3EKZA 2OZ0A 3BLFA 4YCOA 4E2BA 3LHTA 3W1AA 1EWEA 4CNPA 4YXGA 4NNCA 3EWWA 1S5TA 2PRMA 2Y7DA 1VCFA 3SGUA 3NNTA 1KM6A 2QJIA 4ZQNA 1DOSA 5FI8A 4DF2A 4XKYB 3F1QA 3TFXA 3W1LA 3LCLA 2VFDA 3HB9A 1GQNA 3PBVA 2QCHA 2VC6A 3T55A 3IVSA 2VFEA 5ABTA 3HG3A 3W70A 3TQ0A 3DKJA 1SZFA 1QPRA 3PY2A 3GKAA 2HTMA 5D05A 4NNBA 1PV8A 3TMQA 4IPIA 5KINA 1PIIA 3JRKA 1FCQA 3PG9A 4JR5A 3TROA 1XXXA 1JRCA 2E5DA 4Z1CA 5CPMA 1FUYA 1YLVA 1CW2A 3GYEA 1TPWA 4OV9A 4RK8A 3LTPA 3PR2A 1P5BA 3S1VA 3W83A 4ZQCA 2QEZA 1H7NA 3UYCA 3DFPA 1TPVA 4N6EA 3G0SA 5DN1A 1UBSA 3IGUA 1EPXA 3G0XA 3N14A 4QITA 4MYXA 4UXDA 4OQVA 3NQDA 3B4UA 3TAKA 4WXYA 3DGRA 3EWBX 2JGQA 4JTFA 1XDLA 4N2YA 2ZDRA 5CZ0A 4IXHA 3NXFA 1PVNA 1R47A 3G18A 3DZ1A 3GVGA 1SW0A 1GVFA 1B3OA 3LRMA 3EWZA 5EY5A 5HWJA 4LC8A 3LI1A 3E0IA 2OT1A 3OVQA 2YR1A 3HF3A 4MLJA 2E5CA 1W5PA 4IGHA 1KLZA 1GVQA 4UTLA 1I45A 3H53A 4FIRA 3N9RA 3WJSA 2W79A 3ZS4A 3QC3A 1K7FA 2V0TA 1C8VA 3A22A 4LVGA 1Y0EA 1WBJA 2RDUA 1SFLA 3EWYA 2E6FA 3TJXA 3KRUA 3W84A 4GRSA 4QNWA 4XKYA 1SU5A 3LHZA 3S6DA 2WKJA 5KITA 1QCWA 3WJYA 1O95A 2FPVA 1G7VA 3U6WA 1QOPA 1TPFA 4MKNA 1WBHA 2RDWA
chains in the Genus database with same CATH superfamily
4DJDD 4Y7EA 2FZMA 4UTTC 5DEZA 4BFAA 4EACA 1AW2A 2WQPA 2D2JA 2CZDA 4RZ4A 3W1PA 4GVIA 3BAYA 3VIHA 5G2WA 2FB3A 4KGLA 2DT1A 4BQ3A 1XH0A 4UFJA 4W5ZA 2PGFA 1REQA 1JFHA 3AHXA 3MVTA 4GUJA 1XH2A 3N11A 3PUOA 1DIDA 1H5VA 2PCEA 4XTDA 3C0QA 3N25A 1ADDA 3W6YA 5AHMA 4GPNA 3UVIA 3PWAA 1PSCA 2XIIA 1BGAA 4RDWA 2Z0IA 2SFPA 3NEVA 3ZLHA 3PZQA 1TPUA 3AU6A 3CHDA 3A47A 3IUDA 1ZENA 3HPFA 1V93A 5HXMA 1QW9A 1YX1A 2PC4A 4KRTA 5E1QA 1EEXA 4JIHA 1UD2A 4HK5A 3DFOA 3Q4DA 3V5FA 1XG3A 3VPLA 1FH7A 2C6QA 1GORA 1GQIA 1JD7A 4Z17A 4WK9A 4K68A 1K4GA 3OW1A 1BWKA 3MTWA 3NXLA 5CG0A 4MKSA 3PC0A 3YPIA 1MEIA 1V7AA 2PF8A 2CZ5A 2X1RA 4K3ZA 3N1AA 2QDDA 3TDFA 4GZEA 4W7UA 1IEQA 1VD6A 5CH9A 4QJ3B 1BG4A 4FXRA 1FHDA 3SR7A 4Y9NA 4MPKA 2Z2AA 3E74A 2OX1A 3EOOA 1JJKA 2OPJA 3GG7A 1UW9A 3LUTA 3GTNA 5L6UA 4P7OA 2CHRA 3GNNA 2YB4A 4OHQA 1GJPA 1QK2A 5HDRA 4GBUA 4JTAA 2GOKA 1RJPA 3O6AA 2IKJA 3WQCA 3IJDA 3CH9A 4ZODA 4QBXA 1N7KA 2QJHA 3RHGA 4GUHA 2F2HA 2ZVRA 3F5LA 2YCIX 3FJNA 3HOJA 4UOJA 3RRAA 3BLOA 1Y65A 2VCAA 3A21A 4GNJA 2VGGA 3PAJA 3CUHA 4QCEA 1J9YA 4MY1A 1K02A 3HV9A 4GIRA 4H9UA 5E0KA 5EMUA 2A79A 2D73A 1MEWA 4WGHA 5AC4A 4JTCA 1C9DA 4CN1A 1UIOA 2IPGA 1ENUA 4NYUA 3TC7A 1NP0A 3TYCA 3BZGA 3W86A 4O4VA 3V7PA 1QNOA 4F4RA 3W81A 3T2QA 2HXUA 5AYXA 5XIMA 4NF7A 1O68A 1EP1A 3BG5A 2VTFA 3W7LA 3S9ZA 2ZA1A 4IIBA 4X0NA 3UBPC 3NTYA 2QT3A 3FKRA 1TUFA 3S2LA 3VM7A 3EDKA 2HXTA 1UUOA 3LV6A 3D6NA 4LXFA 1TCMA 5BYWA 4QLJA 3BURA 5C7HA 2QCDB 3OGRA 3GKFA 4YHEA 3KOXA 1F6PA 3LCFA 4HZ8A 1JCYA 4JYFA 1Q3NA 2OCZA 3BSMA 4GQRA 1KM4A 5FSDC 5BRQA 4TQTA 1CNVA 1FXQA 1RBAA 3B8SA 3LHWA 3S2NA 2OEJA 4S3AA 1D9EA 1S2VA 3LDVA 4QDWA 4I9AA 1UP2A 1HP4A 1O4UA 3IVUA 3KTSA 5I3DA 3UP8A 4ZCWA 5G4EA 1VYRA 2HK0A 4AIBA 1ITQA 3TSDA 3M64A 4MHBA 4LYRA 4NYYA 4B9ZA 1EBGA 5ECVA 1HO1A 3E49A 3NDYA 1IEWA 4NUWA 4PTWA 3UZXA 3S5OA 3MUZ1 5KTLA 3QN3A 3KLLA 2VFHA 1TB3A 3B4YA 3WX7A 3IPWA 1J5SA 3TJ4A 1GVEA 4MLRA 1OFQA 4MB5A 3RMJA 2GGGA 2HWGA 4DPQA 4DRSA 2HZGA 5KEZA 5A2AA 1VBRA 3AXIA 4DUXA 5ABFB 3HFTA 1HKVA 1G4SA 3T1GA 3AOFA 5AHIA 3TIMA 4WXZA 4WEVX 8A3HA 2Y5JA 3ICJA 3NWRA 4KKXA 4K2SA 3VGFA 3MW7A 1FP8A 4Y8EA 3BJTA 5GVJA 1QK0A 5C9RA 1S5VA 3B8VA 3R7MA 1XLJA 4PCPA 3UD6A 4Q4MA 1QXLA 2PGRA 5F1UA 4QJ5B 3RK8A 2D2GA 2VCCA 2QCDA 2CLEA 1DWFM 3I6EA 1DEDA 1QW8A 3S47A 2DZVA 3EGJA 3L4WA 1V6TA 2DU2A 3HGJA 4HOWA 2VEPA 1A5SA 2RFGA 5HULA 7TIMA 1D8CA 3I4KA 5HMDA 4GO9A 4KGJA 1UKPA 4KWVA 2PUZA 5AZ0A 2VENA 4C6EA 2FZDA 1W5MA 5EMKA 3N19B 5FAJA 1ZFJA 1BLIA 1DIOA 4R9XA 1I60A 1JULA 3M46A 4WD0A 2Y85A 4V27A 2NUYA 1PS9A 5A8GA 3VZXA 2DT0A 2VFFA 3UA3A 1X7FA 3W88A 2VZSA 1KFKA 3DFQA 1IWAA 4KCUA 4B9YA 4F79A 4XSLA 2B7NA 5I24A 2QCCA 3UG8A 4TV6A 5DMYA 2YGYA 4LCRA 3II1A 1BXNA 1GVRA 1M3UA 4UQDA 1OCNA 3GBDA 1W8SA 3H22A 1K9FA 4ICMA 2PDGA 2NUWA 1H61A 2TRSA 1I2OA 3ZXWA 2VEKA 3STFA 2QCLA 3DFYA 2XG9A 1XPGA 3VM5A 1J5TA 3IGSA 3CGTA 1JPMA 4LBRA 1W54A 2P76A 2FB2A 1GVOA 2VVSA 3VC6A 3DXIA 3K1GA 4YU1A 3V16A 2A5HA 4CD6A 3NM1A 1PZ0A 4E2OA 3KE0A 1YDOA 4H00A 4JQ2A 2ZXQA 4C6NA 2V68A 4FLOA 1YPFA 3A9IA 5IBXA 3TP4A 3K8MA 3WBYA 5CPTA 1SQ7A 4HHHA 2CHOA 2A7RA 2XJ7A 3D3AA 5G4HC 2ZZ4A 4ATLA 3A5FA 5K4ZA 4AIOA 1TVNA 3H6OA 3IUIA 3CXOA 4IGNA 3NUKA 1T6MA 2Y5SA 4FLQA 2NQJA 1R3TA 2A3HA 1W8GA 5JBEA 2XZ9A 4XBKA 1TPEA 3LLDA 4NZFA 1S2WA 4JTUA 4AXKA 1XLMA 3C86A 2PLCA 4RUBA 1ZAJA 2HK1A 4M6QA 4IIFA 1GZ1A 3R12A 3S5ZA 4EOUA 3NL3A 4PH6A 1X1NA 5I79A 3RJYA 3NQMA 2G97A 3NAVA 4AFYA 1WDSA 4UNIA 5JQ9A 5LXXA 1MFVA 4JS3A 4ZOCA 3UR7A 1KC7A 3P0WA 4FS9A 3R79A 4ZZ9A 1AW5A 4MUPA 4DZHA 1WXYA 2BXVA 1UJQA 3C0LA 1ITCA 4RZ5A 1HKKA 3NEHA 3IJ7A 1OVDA 1FTXA 2P50A 3AO0A 4TR9A 3W02A 2Q71A 1ZS2A 3L4UA 1EGMA 3MHUA 4LV9A 1TO3A 1XCWA 3VCCA 4XBJA 4DBSA 3PZNA 1IXPA 4DYKA 4KWUA 2NSOA 2F38A 3R13A 2VURA 3FA4A 3OG3A 3RU8X 3OLIA 3TTYA 2VYOA 3IJ9A 1Z89A 3ONBA 3VGDA 2OLAA 4C90A 1CT5A 3VDBA 3OPSA 4NI3A 2J7HA 3BGJA 3S9IA 1EA9C 3QJAA 4W5UA 1GUVA 1QDSA 1KRCC 5HUOA 4IP5A 3W7DA 2EJAA 4DJED 3PUDA 2J78A 5MF5A 3VX1A 3WBAA 1KWGA 2UV8G 1KV5A 1LCOA 1WO2A 2AGTA 1GYNA 2OU4A 4R33A 3GS6A 4DNHA 4H7CA 3WD3A 3F2BA 4CCEA 4MMWA 3EX1A 1UR9A 3LBOA 1KXHA 9XIMA 1L6WA 4GINA 1DJGA 5A6JA 4ILSA 1NAL1 3U9IA 4G5DA 2GJXB 1JUKA 3RX3A 4L1GA 1CXLA 4FNPA 1THFD 3ERPA 2X05A 4J3XA 4HPJA 5D03A 1C91A 4QSFA 4IG2B 3LHVA 3QOMA 3CIXA 3M5VA 1VYSX 1CXHA 3EKLA 1ISYA 3AS1A 4NSBA 1FDYA 3MBDA 3C3NA 2A0NA 5HUPA 3VZZA 1JYXA 3P82A 2VRQA 3XISA 2YA0A 1SO3A 4FI4A 1T8QA 2VXNA 4IIGA 3GXTA 3FW6A 1W17A 1X98A 2BOFX 3WNLA 1AW1A 3LCHA 3OZMA 3VOCA 3L0KA 3EDEA 1VR6A 4XKMA 2ON3A 4ZB5A 2GYIA 3WDRA 3SUSA 3I68A 1EYWA 5D04C 2Z7KA 4BR1A 3N6QA 3CU2A 4H7VA 2IW0A 2ZX8A 3G77A 4Q4RA 2GSHA 4HMNA 2WSRA 3NURA 4B5XA 3FVMA 3KTXA 4DUOA 3I6TA 4MJ2A 5M1TA 4DLMA 1AZ1A 3L67A 2PU0A 3FFSA 1E70M 3ANVA 3I65A 4ZFCA 4GCXA 1YPIA 1MEHA 5CGTA 1NJJA 3M5XA 1XYMA 1FWIC 3PPFA 1B54A 4D6DA 3AIQA 5E9AA 2YIHA 5CJMA 2GJXA 3I4EA 4PGLA 4GX9A 4GXWA 3V5CA 4RNFA 3HPAA 4F0SA 3TTQA 3IIPA 2B31A 4QQ3A 3TV8A 3GDLA 3W3OA 4WDXA 3NL2A 2WSPA 3EB2A 1JIBA 3ABRA 1V03A 1M53A 4YVPA 1V02E 3FEMA 3VKBA 1VBHA 2E6AA 3K4WA 3MZ2A 1WZAA 3SW6A 2EPKX 5DRCA 4H9YA 3UZWA 4TMBA 5DBUA 3A3WA 4PRTA 3FYOA 2WNQA 2PBGA 2A7NA 2GFTA 1GHRA 1K8YA 4CGTA 3B8WA 3T4WA 4Z08A 5HPCA 3L4YA 4XWUA 1SPQA 2V2CA 4IX2A 3EPNA 1XRSA 4UQ9A 4H04A 4A2RA 2ZOXA 4PMOA 3UERA 1XPYA 4KEZA 4C5ZA 4NAEB 4H01A 1A49A 2EHHA 3F5JA 4ZR8A 3HURA 1UR4A 4CD7A 4MWAE 3MYPA 5AC6A 2FTYA 3D47A 1EGZA 3DI0A 5LIXX 3PG8A 1R9ZA 1MW2A 4GIYA 4IUGA 3N73A 2DV0A 2E77A 3PZ9A 3KRSA 3N3TA 4QLLA 3M43A 1K8ZA 2CZEA 4DXKA 4LRTA 4IHCA 1OHLA 4F9DA 3CWNA 3N2XA 3Q2DA 4MNMA 4ACZB 5JH2A 1BG9A 2ISSA 1G4TA 4GUGA 1VCVA 3LZ3A 3RRXA 3NOYA 4Y6GA 4JFSA 3ZR6A 4I7VA 1G6CA 4XZLX 1CLXA 2F8QA 1ZBWA 3ARQA 4LVBA 3T7VA 2Q3RA 1JZ8A 4YTQA 3MYOA 2J75A 1TPDA 2E9BA 1B4KA 4A6GA 3GHSA 2XIMA 1MRAA 3P67A 1TQXA 2ZIDA 1E4MM 3VCNA 4S3GA 2BY2A 1NQKA 4IH3A 2GUYA 1KFCA 3WNKA 3R25A 3GO2A 3W27A 3GTHA 4V33A 1EFZA 3UQNA 1WYIA 3WEOA 1J18A 1MW1A 2CZVA 1MO0A 2VWSA 3SN1A 1IE7C 2ZX9A 1J0IA 4O14A 3WF0A 3VIIA 2OZTA 3PZUA 1EF2A 1KM1A 4HU4A 2XPKA 3LB0A 3V1PA 5D2YA 4WDWA 3APYA 4HOXA 3B8UA 2O9RA 1XIJA 5B7ZA 2ZYFA 2F6UA 5D2XA 4V1YA 3T2OA 3TWBA 4HJFA 1FWCC 3VGEA 5H1WA 4Z2IA 2CESA 3AI0A 3QMSA 4O28A 2BGNE 4AC1X 1TFVA 4M7TA 3GXPA 3P84A 1EH9A 3PHAA 4XAGA 3WBWA 2FFCA 3Q45A 3HGRA 3A3XA 2R1PA 2G3FA 2XN1A 3IIZA 3E9AA 4Q8VA 2PAJA 4F0RA 3DBNA 3WQOA 2HNHA 1O12A 3OGSA 4FZIA 4Y90A 5CZTA 3WMSA 4ACZA 3BXWA 2XISA 4JPGA 3SIMA 4M29A 3MSDA 3AJ7A 3UW6A 1RVKA 5CZSA 4RCXA 3L5LA 1FKXA 4HZ7A 3MSRA 4IT1A 2ACUA 1ONEA 5IDIA 1E0VA 5IOBA 3WQPA 4DWSB 5AVNA 2DSVA 1E0UA 1TPB1 1XCFA 2J6XA 4HD5A 2XN0A 3K46A 1J0KA 1GKRA 3WUBA 3GDBA 2AQVA 3EYPA 3A4WA 2ZXBA 4TUFA 3PBWA 1Y7VA 4B3KA 1A4MA 1H3GA 3V36A 4AEFA 3KOWA 1YDYA 3B04A 3EX4A 1OADA 1N8FA 1X1OA 1WXJA 3W2LA 2YCEA 3KL0A 4JTRA 2POTA 3TSBA 2PC8A 4HPGA 1PX8A 1IR1A 2J4GA 2HRWA 1UC4A 2PDWA 2A3AA 2XM1A 1TRIA 2VD8A 3N29A 1VS1A 3STGA 3WQWA 3USZA 3O8AA 4QISA 4W84A 1E71M 1G5AA 1A3HA 1UD3A 4HNCA 1DWAM 4GX8A 4U28A 3L23A 3GU1A 4CNNA 1DV7A 4IL0A 3BJSA 4RDVA 2Y7GA 2DFAA 4QFUA 3QZEA 4C7GA 2GK1A 1EX5A 1RQEA 4XAFA 4D8LA 1JZ4A 4RDYA 1WV2A 1FVPA 1XX1A 2BHUA 3STEA 1ME9A 2ZA3A 2WHLA 4WKAA 4LNYA 4WQ6A 4JNMA 2PDKA 4XG1A 1E0WA 2DH2A 2J7EA 4DWSA 1JZ6A 1U5HA 4P7NA 2CIPA 4DZAA 2Y63A 4RL3A 1LBLA 4XUGA 1Z48A 3ARUA 1F8MA 3S5NA 3ANYA 1XISA 3EOUA 1B3VA 3UXLA 4D1JA 1VFSA 1LRQA 1XF0A 3WQ8A 3EEGA 4HA3A 3AQUA 4P8XA 4DO5A 2PMQA 3T44A 3COTA 3LSBA 4GWEA 1HF6A 1H62A 4F2TA 4WSHA 1HG3A 1LQAA 1GHSA 4AZHA 3WENA 2Z1VA 3WF3A 2A6LA 4RPPA 3PNZA 2V5BA 4L9XA 3RR4A 1SZRA 1ONWA 3Q94A 1Z42A 5T8GA 2Y1HA 2PTXA 3IIXA 1F4AA 4NG3A 3ITLA 1OBAA 2VEGA 1QAPA 4KFNA 1OABA 2ZTKA 1LT8A 2X41A 3QQ1A 4X3ZA 4WX2A 4WJXA 3MBFA 3RLHA 4QG6A 1VBJA 2PDFA 1HJSA 1OFRA 3ELFA 1D3CA 1UD4A 1XSJA 1V0MA 3LPFA 4CVWA 3RFAA 3UJ2A 1W1ZA 1QBAA 4X2RA 5CC7A 1A5UA 3PN8A 3PB0A 4QCFA 3L5AA 4HB7A 4E4PA 3VNYA 1ZRQA 3WYZA 4C7DA 1W5NA 4PCSA 2D24A 4AWEA 3B0VC 3VX0A 1QI4A 1JCLA 4O19A 3GW3A 4AMCA 3CHEA 3WQFA 4A4AA 4PR4A 1EJWC 2W27A 3LV5A 4CEXC 3M6DA 9RUBA 1FHUA 3CIVA 4Z1BA 1UASA 1J0HA 3S4TA 3GAKA 4CQCA 1AD1A 1ISVA 1UZ4A 2DZPA 4F9JA 1VFOA 1R3WA 3W7GA 4NJIA 3O63A 3S42A 4JGDA 3MP4A 5EKYA 1K9TA 2DJLA 3LM3A 1DYSA 1KTCA 1KCXA 2E67A 1ZAHA 3SEPA 1D7FA 5A95A 1VENA 5EBUA 2UY5A 3DYPA 5JUVA 4WY0F 4LALA 4O0KA 4AMAA 2PEVA 1B9BA 3TNBA 3O0FA 4AWUA 1ICQA 3DKLA 3IARA 1GOKA 4ZENA 3PPGA 3IS4A 4DAIA 3OTRA 1V8EA 4WGXA 3QSTA 1X6NA 3E2RA 1X38A 4NXSA 1T41A 2ZZ7A 3DYMA 4HPHA 1A0DA 4DY1A 1H63A 1NF7A 5AOUA 1Q13A 3LQGA 3HG2A 2W91A 3WK3A 3N4AA 3CWHA 3NZGA 4ZTXA 4H8HA 3UZYA 4K7YA 3U8GA 1WZLA 3LG3A 1R3VA 2Y5EA 4GI9A 2FHCA 3LCGA 4JHMA 4TTUA 2WOQA 4P61A 1SSDA 3KP0A 3AUJA 3URAA 4WRHA 3CQHA 3NZRA 4GYFA 4UUIA 1XYZA 3TK7A 3UZZA 2Z24A 5CPOA 2P1FA 1ZP4A 4O54A 3SN0A 4EVZA 3C56A 1N8WA 3KWSA 4K38A 2WQDA 4LCSA 1NIUA 2C13A 3OJGA 3GTXA 2OB3A 3QV9A 1XLHA 4HCDA 3AALA 1XLCA 4KWSA 4PB5A 1XBXA 2GJRA 2YYUA 3C2YA 1MNZA 1R3SA 1ME7A 3CQIA 1DJXA 1FWDC 4MY8A 2CITA 3G8EA 3M5ZA 1S38A 1EP2A 4X0VA 4IICA 4C6KA 1VPYA 5BXPA 4M6VA 4MNJA 3H4GA 1VHNA 1EYEA 1GW9A 5HBFA 2R94A 3DH7A 3VNLA 5BU6A 1WA3A 3GNDA 3LA4A 4Y9OA 1OIMA 2PDHA 4C7FA 3K30A 4JIPA 2NQLA 1LOLA 3KHDA 1QMLA 3UNTA 1ICPA 1O5QA 3MMWA 1KBLA 4MJMA 3MI2A 1RK6A 3VIPA 2VOMA 1T99A 2X8RA 1FFRA 2H3DA 3PTMA 3CV6A 2PLKA 3QR0A 3A3HA 2YW4A 1CGVA 1EJXC 3RGTA 4O1BA 4GFIA 3MZNA 2CZFA 4AZ6A 1Z3NA 1RCXB 1ZAIA 3G6LA 3ITVA 2D23A 4Q8OA 1W1PA 1YTEA 4ML9A 3TCEA 3B0YA 3NO1A 3WLTA 1UBPC 3TNOA 4UZUA 5KZEA 1ITUA 3T08A 4JDYA 2XWDA 3EWUA 5EL1A 2OZ8A 1ELSA 4XBSA 3PUGA 3WUGA 1WZKA 4NZ5A 1VKFA 1AG1O 4P7RA 4XZBA 1VJIA 2HPIA 1E40A 3QW4B 1TIMA 1BPLB 1W9VA 4UCGA 4HU8A 3DC0A 1VQTA 4H8VA 2EG7A 2BS9A 2FZ8A 3LQLA 4W87A 3SCRA 4DEFA 1VJSA 1XYAA 4ZBCA 4NJHA 4D2JA 1TUXA 2Y8KA 3E2VA 5MHBA 1VYPX 2VVNA 2YCKX 1QHOA 2VHLA 3H2OA 5BOFA 1LL4A 2WZEA 1H5YA 4HNUA 1XIIA 1OG0A 4ZO6A 2ZRZA 3M6YA 4CNUA 4JX5A 2BXZA 2PLJA 2DUAA 2G4JA 1HJQA 5CG7A 5DMMA 1TPH1 1R5YA 4MB4A 4KFPA 1W6TA 3QTPA 3UU0A 4DUVA 3KOFA 3NR0A 5KZDA 1BYDA 4H6EA 5CBIA 4J3ZA 2G8ZA 3AYSA 1LZOA 4H9MA 1YTKA 1SO6A 4ZTYA 2Y89A 4AX7A 5F4SA 4QHRA 2JIEA 2DH3A 2VZOA 4YCOA 3LNPA 1A3XA 3W1AA 4GXPA 1ADSA 4YVXA 1B1YA 3FNDA 2I5GA 1VCFA 3R0KA 3HQPA 3NNTA 1VFUA 3L4TA 2R1KA 2WHJA 1KM6A 5FI8A 3H23A 3K5XA 4CQBA 1YPXA 3RCMA 4IQDA 3GH4A 3VNMA 1K6AA 1UH4A 3PY2A 4DN1A 4TOQA 4PE8A 1FP9A 3F4DA 1PIIA 1OD0A 1Q4WA 2Y8VA 4IFOA 3PJUA 3WBEA 4PUMA 5D8WA 4Z1CA 3C8NA 4OV9A 4I5RA 2QEZA 3UYCA 3BH4A 3LENA 3IGUA 3N14A 1TJ2A 1FWEC 4F0HA 3UYIA 4WXYA 1SFSA 1CGYA 1V0KA 1UWIA 4EE9A 4REQB 3VMNA 1GKPA 4BJHA 2WBKA 4IXHA 1NY1A 2I5QA 3NXFA 3KWXA 4P8VA 5DT7A 3HN3A 4PBFA 3WCZA 5C9XA 4LC8A 4I9MA 1A5NC 2YR1A 3RDKA 3VYLA 1U1JA 2YXOA 4UQCA 3E38A 3B8TA 1GVQA 1I45A 4FIRA 5D9MA 3OODA 2RJGA 2CBUA 4LVGA 1Y0EA 2EKGA 1R3YA 3KBNA 3TJXA 3W84A 2XVNA 4GRSA 3H7VA 3S6DA 2VR2A 1QCWA 3WJYA 1AVAA 1O95A 1MXGA 2DSZA 2QIWA 1PTGA 2B7OA 4NY2A 3W2UA 4RE0A 1XCXA 3B97A 3VKJA 1V02A 3MO4A 4UOZA 2C71A 4NZCA 4DO6A 1SYTA 4BWLA 3WH6A 4XK2A 1GOWA 4DO4A 1Y5XA 3E6EA 2RH9A 4CCCA 3GNRA 1RR2A 2NWSA 4PMQA 2L5HA 2AAAA 3M41A 3RPTA 2FPYA 3WMLA 4UTIA 4UTFA 1VZWA 3VIFA 4WLCA 2XVGA 4MFDA 3G22A 1EDGA 4C6QA 4O50A 3RLVA 4O10A 1AH0A 3M07A 1Z8AA 3WNMA 1AH3A 1HJUA 2VC9A 1PCWA 4REQA 1K7XA 3NGFA 4HZ6A 3BG3A 1DJNA 1M41A 4JFUA 1RBLA 1XGZA 2OX4A 3R6IA 1M01A 3QYSA 3UXDA 5FF2A 2BHZA 3PM6A 2XTKA 4IX0A 2YJQA 1Q7ZA 1P6BA 4B5VA 1Q6QA 2OYLA 1DJHA 4MG4A 1AH4A 3PZIA 2XH4A 5GNZA 4NVTA 4LOCA 4CU6A 5CBBA 1KXVA 4DI8A 3CZ8A 3O05A 1DHPA 1MDLA 2VR4A 4NXKA 3WJWA 7REQB 2YDSA 3NQGA 1FQ0A 1UMYA 1G7UA 1RD5A 1ZPTA 3DU0A 4UTHA 2A85A 5CSRA 4Q4SA 4FNUA 3PSWA 1PTDA 1WNOA 3H2NA 3KVMA 1RQHA 4OKDA 3QV6A 3DHDA 2HE8A 3O15A 4D6CA 1LRNA 1J6PA 4WOQA 4C5YA 3I10A 3TXZA 1TJ0A 4DI9A 1TG7A 3W26A 3KRBA 4IQEA 3GG0A 3VFLA 4LUTB 5AC5A 3NQAA 1EUAA 1K03A 3BCFA 3VKDA 4PFHA 1SSGA 2PP1A 3ARVA 3L2LA 1CI1A 4A21A 1F76A 5TIMA 5HA7A 4ZQPA 1FWGC 1BYCA 1JI1A 4GZIA 5DQPA 3WELA 3DG7A 3OZPA 3PBUA 3CM4A 4OTKA 5IXEA 4OJYA 3AZTA 5L9FA 3RCYA 4LYPA 1JCNA 2WZIA 3DGBA 2EPNA 4NJGA 3CMGA 1JDDA 1SZNA 1QNSA 1WOBA 2ABAA 5I3IA 4FK9A 1PO9A 5C7VA 3WQVA 3CIWA 3VU2A 2VEIA 1XINA 2DPEA 1TR9A 8RUCA 3W2JA 4RLIA 2WMJA 3ZVHB 1JCTA 1ODZA 4ZO8A 3H2MA 3EOLA 1TYGA 5BMXA 3E96A 2V5LA 5A1AA 7REQA 1U33A 3TE9A 2QCMA 3ZJKA 5E9XA 1PWLA 3OHMB 4D6GA 3MS8A 4EP8C 4MOZA 3EWDA 4CEUC 4W8LA 3QGVA 3QFWA 1B9ZA 1NEYA 3TQPA 3KVJA 2XHYA 4WY0B 1L6YA 4G6CA 4CQAA 1EC9A 2VQTA 5REQB 3IRDA 2DZWA 4W93A 4I8DA 3W7RA 3W07A 3CC1A 2PA6A 3HPSA 3P74A 3RYSA 2W3ZA 1CGTA 4LUTA 5DMLA 3A64A 4PUUA 2NLYA 4PB4A 3V18A 2OFJA 3H4WA 5AYYA 3G1YA 4EPBC 2VX4A 3CO4A 3NVDA 4NP7A 3OYXA 5EGRA 4DJFC 4RNHA 1EHNA 1I6NA 1H51A 4KEMA 4O57A 4YS1A 3TYZA 3B0XA 2XVLA 4O1EA 1EX1A 5K3VA 1YNQA 2YFNA 3CV7A 3S1WA 3WBXA 4U2ZA 1EJUC 4JQ3A 4DZIA 4F48A 5A6TC 2YA2A 3HPXA 5DCBA 3VOJA 2YXGA 2BVTA 3PULA 4DBEA 4F0KA 4XB3A 4MB3A 1VFTA 1JDFA 3BLPX 1KD0A 3NZ1A 1Q6CA 4AUBA 1I2NA 4WSJA 4Z2HA 4IMGA 4D8ZA 3ZVHA 5BRPA 5HNRA 5H2ZA 1MUWA 1D8WA 3CHVA 4GFSA 2E3ZA 1XGEA 3SCVA 1J4EA 4ONVA 3EMZA 3LY0A 2ZX7A 3PZOA 4OOZA 5LIKX 2A3LA 2X30A 3B9EA 2NWRA 2HVNA 3L4XA 3M1ZA 1E0TA 4QS6A 3P0XA 2OVLA 3FXGA 1EHAA 2O56A 2D0GA 3FAWA 4GIAA 4WY0A 1F6KA 3VNZA 3B8IA 5CQ1A 5HAOA 1O1ZA 1SJAA 5REQA 1SUXA 3RX2A 4B2DA 3SUUA 2EKCA 2HEJA 3QF0A 4HKPA 4LNCA 1HT6A 3NVTA 2HVOA 3WK1A 3ABXA 1XLKA 4TVDA 2H9AB 2VGFA 5T26A 4PTMA 4FNRA 1DJYA 1UH3A 3FXYA 3VDAA 1G67A 4JFWA 1LL6A 2HS6A 3WNPA 2DJXA 4O11A 1XUUA 1TJRA 2BFGA 1UJPA 4K39A 3H21A 4S39A 1R2RA 4MPQA 4WDUA 1OY0A 3S2JA 1E9YB 2WCSA 3T4CA 4Z0SA 3ARTA 1E6RA 1EL3A 4BF9A 5U4NA 1XRVA 2XINA 3CHCA 2VT0A 3DEQA 2PODA 3UNDA 4GYKA 1A5LC 4NIRA 1RV8A 3LLFA 1AMKA 3W7QA 3GXFA 5FEPA 3E5PA 4GYPA 3VD9A 2A3CA 1XC6A 3PTDA 2Q8LA 4Q33A 3QV7A 1F61A 4K36A 5EA9A 3ITTA 3E0LA 1F7BA 3HPZA 3TXVA 3H7RA 2PTDA 1KTBA 4L64A 2BOEX 3BOXA 4LS2A 1FHLA 3QY6A 4M81A 4DBDA 2REQA 2RDXA 3O6DA 3M7SA 5CPSA 3TOPA 1IEXA 1WXZA 4PBGA 4RKAA 5E93A 5BNKA 1HKJA 1UZDA 2EF9A 3NQBA 1EPVA 2C1HA 3B0PA 3WLNA 3MC5A 4B3ZA 1UQYA 4JYEA 1Q85A 3EMCA 4H9XA 1XH1A 5MKGB 3O06A 4AXNA 3PUEA 3SQLA 4IZGA 3UR2A 1M68A 1PHWA 2DIKA 2H9AA 1W9XA 2J8GA 4F0LA 3EA1A 2GQ9A 3ISIX 3MCOA 4HTYA 5H8PA 3AHVA 3KW3A 3W71A 1WDWA 1QI5A 1QPNA 1G01A 3GUWA 3MO7A 2VCBA 3CTTA 2VFGA 2RJHA 4NZJA 1PDYA 1XUZA 3A24A 2IPJA 4XSMA 2QLYA 4ECLA 3R4IA 1ZZMA 4DX3A 4Q7IA 4ICNA 4PTVA 5JXQA 5KZMA 1JYNA 1W1A1 4LW7A 2VX5A 4E2VA 2VX6A 4C6LA 3NQ6A 5DXXA 1B5TA 5FF3A 5A8OA 1NF0A 3UR5A 3KOZA 5AY7A 4D6IA 2X1UA 1SMAA 1EXPA 4K1WA 3LERA 3GNPA 3VAVA 2P0IA 3APTA 3W75A 3WNNA 3R43A 3FLUA 4IL2A 3W22A 4EIVA 4BI7A 1TV5A 4D72A 2YL6A 1HTIA 4QEHA 3KFTA 1B0IA 2IPWA 3GHRA 1NFPA 3HU7A 2PDYA 1WKFA 4HSHA 3LCWA 3ECQA 1RLDA 4B5NA 3L66A 5CGMA 1H1YA 4Q8PA 1KCKA 4QTGA 1RP8A 5MKGA 3LK6A 2E25A 1AQMA 3EDJA 1IV8A 5CAHA 4I5XA 3ABOA 1Q5MA 4LT9A 4J35A 3VXGA 2V3FA 2PF0A 3WH7A 3UJEA 1E6NA 4DYEA 2PWUA 3NSXA 4GISA 5HJXA 1KCZA 2I56A 3OQ8A 4JICA 4AD3A 1R7OA 4WSKA 1OFDA 5DLCA 4F2BA 3DI1A 4O13A 3IACA 2B7PA 4HQVA 3SFKA 3BWWA 1QOXA 4EWND 4OECA 1UA3A 1K1DA 4KIRA 5LNRA 1C90A 1KFJA 3MKVA 5XIAA 3DOPA 1P0NA 3CUGA 5FEZA 1AJ0A 3UT0A 1XV8A 1E3XA 1E1CB 1HN1A 4AY1A 2IQ0A 3BICA 2FGBA 4I7UA 1CLKA 3FAXA 1KFEA 3R94A 1XFCA 2WHKA 3CUFA 4LU0A 1FWWA 3MJMA 4GA8A 3SRHA 3FK4A 3S1UA 3S3GA 2VZUA 2NXIA 4QE5A 1GONA 4YTRA 4DJDC 3KCJA 2MNRA 5FJIA 4H83A 4H3DA 3P8JA 2R1MA 1S3HA 1R46A 1V77A 4RV8A 4EKJA 1OGSA 1GW1A 4LVAA 2ICSA 3QMTA 3WJXA 1KFWA 3CYJA 4JTSA 4H4IA 2YL9A 4G1NA 3W0KA 2NX3A 2ZA2A 2ISFA 1HJWA 5CC3A 4JN6A 5LNSA 1ZQ5A 2VDGA 3DC8A 4DWSC 2OQYA 2FGLA 5GNYA 2RDTA 3V0SA 4JTJA 5D4YA 5GPRA 4K8EA 4DVOA 3KS6A 3LPOA 3HG5A 2XH2A 5EMYA 4HK6A 1W2VA 3VILA 4OBRA 3KBWA 2PDXA 4OBTA 4OV4A 2WZTA 5HJLA 1R38A 4GY0A 4H6KA 5AFDA 1UC5A 2DQWA 4TX6A 3QHNA 3HJEA 1UPPA 2BODX 1EDQA 3MPGA 3GFXA 5I3HA 2R1NA 6REQA 1E6PA 3WFLA 3M47A 3FV9A 3JZEA 5FJJA 5HR7A 1PAMA 4N9EA 4OBSA 3UR8A 1BWVA 4ZB2A 2HMCA 5A8PA 4GE8A 3ENLA 3WQEA 1XYFA 2Y8UA 3DBPA 3P5ZA 4H19A 4QG8A 2OG9A 9XIAA 3FIGA 3WH8A 3FS2A 3THQA 2P5NA 1UH2A 3TYUA 2Z1WA 2E09A 3GHUA 3MWCA 1MXDA 3N12A 3F5KA 4DUWA 3USBA 3M0KA 4UTWA 1Q2RA 3ITCA 1EOMA 3SJ3A 2JF7A 1TV7A 3JR2A 4IXXA 3INPA 3FHQA 4CU7A 3BLEA 3IANA 2E6DA 1YEYA 4QDMA 2E5BA 2ALDA 2ZTJA 3SUVA 5TBOA 1KBKA 4GQBA 4GUIA 3MJYA 1C7SA 4J9JA 4CD4A 5FESA 2FJUB 3HQ1A 4DXXA 2JK2A 3MHFA 3VCRA 2PWEA 5I3KA 4JX6A 3H24A 1BKHA 3LD5A 3AHYA 3VOHA 3TN3A 1MFUA 2RAGA 3D0CA 1B90A 1DIKA 4WZHA 4QG9A 4EAYA 3L68A 2QR6A 1L6SA 2KZHA 4UR8A 4UTTA 2X0SA 1TPC1 2PU1A 4XZIA 3SUWA 3Q65A 5KZ6A 4H2HA 2WSYA 4Z2KA 3NM3A 4LC6A 4M8UA 2XIJA 4TV5A 3S6OA 2YDQA 2YB1A 1S5NA 3EX2A 3VUSA 3QM3A 1ZY9A 1PCKA 1JDCA 2Q8ZA 1HW6A 4DIAA 1QVBA 4E8DA 1GVIA 4DELA 1UR3M 1OX6A 2A2IA 1DP0A 5CSUA 3NSMA 2CC0A 4S2CA 1F74A 3RM8A 3M5YA 1DE5A 2Y70A 1ZLPA 2PGEA 1K8XA 7TAAA 4L6OA 1JPHA 2J79A 1IXOA 3UXKA 1RPKA 4EK7A 4HSOA 1DWGM 5A94A 1SR9A 1A47A 3HTWA 4KFOA 1VIWA 2QCNA 4M1BA 1QRQA 2XFRA 2OJPA 4HA4A 2E28A 3TW9A 5F2MA 5I3GA 1M7PA 4G56A 1JDEA 3W1NA 2BXYA 1W9UA 3F03K 2GVJA 3QW3A 4NT0A 2PRHA 1E51A 3KBVA 3AS2A 4V2XA 3W7MA 4MADA 3HFYA 1H0IA 1B57A 2PDNA 2GOUA 1L0PA 4LVDA 1RY8A 5EB8A 2VRJA 3WLOA 3RNDA 4LY8A 1NDYA 3BW2A 1XM3A 1UWUA 1XBYA 3WLJA 4NILA 3ITOA 1R2TA 2GLKA 1UHVA 3IEBA 4L4MA 2PSNA 3W76A 3CB3A 2ZZ5A 4L65A 4GI4A 4P7QA 5ABHA 3ALFA 3FCPA 3R8HA 1QBBA 4MDOA 1QWKA 2XZ7A 4NJKA 2EG8A 2NV1A 1SW7A 3DX5A 4FP1A 3TCSA 3THUA 4PRWA 1TTQA 1NFBA 3O1NA 1PKLA 3W1MA 1KV8A 4E8CA 1OX4B 3SCTA 3G0UA 4LAMA 3ARPA 4V1XA 4HMEA 2ZBTA 1P0EA 4IGSA 1Q4NX 2QF8A 5B7YA 2A3EA 5SWUA 1OZQA 6TAAA 2BZNA 5BROA 3CQ0A 4XAZA 1JAEA 4ZL1A 1U5JA 3KBSA 2CYGA 6TIMA 3C2OA 3ME3A 1M5WA 3T8QA 3G1SA 2WJEA 4IIDA 5A6MA 2DQXA 3TAOA 1ZBKA 6ALDA 2QUMA 5C54A 2YLLA 3M0MA 4C1NB 3NZPA 3UCCA 1N82A 2A6NA 5D2VA 3AWOA 5AN7A 5TQLA 4EPKA 4C91A 4FOJA 2W61A 5DANA 5D33A 3AC0A 2XVKA 4HZMA 2CLFA 1EZWA 1W56A 3UCQA 4R9OA 3L9CA 3TVAA 1HXJA 1ZTVA 3W2KA 4ERAA 3H2EA 2Z1SA 4UTKA 4BZYA 4YCPA 3IJLA 3KL3A 3N3MA 2XN2A 3TONA 3PZGA 3UVAA 3VC5A 4C6CA 3S6TA 4IPJA 2FDSA 4L4PA 1YDVA 2E8ZA 3K4DA 2E0PA 1QPKA 4KESA 1LYXA 1ECQA 4FXJA 3SECA 1OIFA 2ONEA 4PSRA 1UWSA 4DWSD 2Z2UA 5BMWA 2QVNA 3W1UA 1IIHA 1VH7A 1US2A 2HISA 3N17A 3GTFA 4RNIA 2W0UA 5LSMA 1OX4A 1YTDA 1IXNA 2QAFA 1HKWA 4FPSA 3BO9A 1J0YA 4KPLA 1QT1A 5A2CA 2J27A 5LXEA 1JZ5A 1PX4A 2NX9A 2Q8XA 1H1ZA 1XHGA 1KBBA 4GMEA 2X2YA 2X40A 3H2AA 1IQ8A 1BTMA 1E1EA 2PP0A 2QPSA 4JEQA 2NXHA 4U3CA 1X8CA 3NQ7A 3QC0A 2VNCA 4ERIA 1QOQA 1TMLA 8XIAA 4CCZA 3AYVA 4KS0A 3TOYA 3U4FA 5FL0A 4KRZA 2C0HA 3SY1A 4WUIA 2CLMA 2O9OA 4IMDA 3GC2A 1WZMA 2ANUA 3SDOA 2ZUSA 4C1NA 2HROA 4GK8A 4N9CA 1Q8AA 4JTKA 4O17A 2WJFA 1QO5A 3CAKA 4LYQA 2NLIA 3ABQA 5LGZA 1RHCA 1MZRA 8TIMA 1EO5A 2D2HA 3NQFA 4JKLA 5F2GA 3VMOA 3XIMA 1DWHM 1TIWA 4QRNA 2F7FA 3CPRA 1QASA 2XSAA 4ENLA 4G7EB 4CKQA 4X60A 4ZA0A 2E8YA 2Z25A 4CCDA 2D0FA 2TSYA 4OIFA 2XIOA 3W85A 1MUCA 3AXHA 2QPXA 3MU7A 3ZZ1A 4GBDA 4DF0A 1MNSA 3C6CA 1JL8A 4PSPA 3V1HA 1Q45A 4AHQA 1IIGA 3CPUA 6A3HA 2QCFA 1F3WA 3PVFA 2X7WA 2OWWA 3NL6A 3VOFA 1WQ5A 1EDTA 1QW7A 3O2LA 4EPDC 3GX9A 3IK4A 1QU4A 4H7ZA 1XSKA 3LRKA 5DX7A 3SRDA 4O4WA 4QLKA 1Q63A 1I0DA 2FZBA 2E1WA 1KR1A 3CH0A 4GHRA 1SJDA 3N04A 2PTWA 3UWVA 4JKMA 4LX4A 3SADA 2VFIA 3F4WA 3AMDA 2WXDM 3L5MA 2TMDA 5A69A 4IM4A 4NL1A 4AY8A 1A50A 1BKSA 2J7BA 4DJEC 3IIOA 3TH6A 3M0VA 1PIFA 5CGQA 5FKYA 1S46A 1E0XA 5LHEA 4H8UA 4J3UA 5M17A 3T78A 4KF1A 1EWDA 1OC7A 5CCZA 4JD4A 1Q66A 2W5FA 4MY9A 3LPPA 4XD4A 3H8AA 4DQWA 1EJTC 2ZUUA 1EOKA 2P3EA 3W73A 4TMCA 2BY3A 5LYRA 5GJNA 3VD3A 1LOQA 2WC4A 4G7EA 3PAOA 4DNMA 1V79A 1QJWA 2R14A 3TLQA 5DF0A 1UR8A 3CUXA 3FN9A 2DZBA 4CD8A 4JTIA 2DIEA 1U5VA 1FH8A 3VE9A 8XIMA 3W38A 1RCQA 3ORWA 1Q8JA 3URBA 3UGVA 4LGXA 3OVGA 4E5TA 3ANUA 3UPWA 1WP6A 4GVHA 3OIXA 7A3HA 3GD6A 5KSWA 2GJNA 4J2PA 1KTNA 1J10A 4D1IA 3ZWTA 3LHYA 3I3EA 1ZNNA 3EB4A 3BARA 3KAOA 1Q6OA 1CXIA 1J6OA 5CLWA 4R7WA 5A6AA 1TV8A 2V2HA 4AEOA 2EO7A 3OLDA 3M0ZA 4LEFA 4AD0A 2DUXA 4FF5A 4IQJA 2ZZ6A 3C0JA 3VKKA 4WR3A 4QAIA 4C1LA 4Q8MA 4AWSA 5DO8A 3WSUA 5EMLA 3UZ5A 1D3HA 2OOGA 3WDPP 3DIPA 1H2JA 4Q22A 3FHAA 1VEOA 1DXEA 4MAZA 1DWJM 4AZ7A 3SGZA 1K4HA 2BBFA 5D38A 4GNVA 4Q8WA 3SCUA 3ABSA 3MA8A 1JNDA 3UWQA 4JTTA 4URIA 4YNGA 2QW5A 1FCBA 2DEPA 1JPDX 2BP1A 3B3DA 1HGYA 4O8RA 4UIOA 2NVDA 1KNWA 3OYZA 3DECA 1UPMB 2J74A 4Q8TA 1R30A 2ZZ2A 1OINA 4UMAA 4EXQA 4KERA 1IYXA 2I9EA 2OSWA 4OT7A 4O52A 2W92A 2WWCA 5TAOA 3IJ6A 4HYWA 1D3GA 3BCJA 3TTSA 3ZFHA 3EA3A 3H2FA 3AICA 2BVYA 1XR2A 4N9DA 5FJTA 2FZNA 3E12A 1UA7A 5I5RA 4IMFA 3LSCA 3FX4A 1ZALA 4NAFB 4ZQRA 2ZC8A 4GABA 1QPQA 5FJOA 1TV3A 4FALA 1EWEA 3F7JA 4LBSA 4GH1A 3EA2A 1NARA 3ARYA 3SGUA 1L6GA 1VEPA 4ZQNA 1DOSA 4DF2A 4XKYB 1VEMA 3BL3A 3TFXA 3LCLA 2QCHA 1HQTA 5ABTA 3TQ0A 3DKJA 7ODCA 3OZOA 5LA2A 3MDWA 2HTMA 5D05A 4NNBA 4IPIA 1UWRA 2G37A 2D3LA 3AFBA 1W1TA 3JRKA 3DG6A 3TYBA 3WNOA 1XXXA 4RE4A 2Z1XA 3A9BA 1JRCA 1XQLA 4W8AA 3H2CA 4BQ4A 1YLVA 4RK8A 1ZL1A 3PR2A 3W83A 3BMXA 3JUGA 4N6EA 3G0SA 5DN1A 1EPXA 1JXJA 3B4UA 2CBIA 3TAKA 3NO3A 1XRFA 3TYAA 3EWBX 3BC9A 4OOUA 1ISWA 4IF2A 3QKZA 1P7TB 4HOZA 2YL8A 3MUY1 1LQ2A 3AS3A 4C6OA 1R47A 4YIWA 3DZ1A 3PFMA 1SW0A 1PYFA 1GVFA 4XZHA 2OT1A 1PZ3A 4MLJA 4ZB0A 4NAFA 2WNWA 3L12A 1W5PA 1UKQA 3U0HA 2PFHA 4V15A 2XU2A 1PX3A 3QR1A 3H53A 3N9RA 2NQ5A 3WJSA 4XIAA 2XGZA 1KXTA 3ZS4A 4J1OA 3QC3A 2V0TA 2J8TA 1C8VA 2OOFA 5C0QA 4EAMA 1XD1A 1DXFA 1EZ2A 4HMCA 1E6SM 2RDUA 2WKLA 3O9NA 4FR1A 4XKYA 5CC6A 5T9CE 5KITA 4LY4A 1Z32X 1NWTA 3BJFA 4J3TA 4FXFA 3ZT5A 4IMAA 2OQLA 1VGAA 3VTRA 1VLWA 4PN2A 1JGMA 3FSUA 5EFDA 3BANA 3CEPA 3G1XA 4ALDA 4JIIX 3VD7A 2QIIA 4UFMA 3HIJA 3ITYA 1HGWA 3T0AA 3U4AA 3LOTA 2CLIA 1DQXA 4QX4A 4BHYA 1S5WA 4F66A 1JUEA 3P7YA 4M56A 2WV8A 4M1RA 4PTDA 3CMJA 1VRDA 4NX0A 2CWXA 2EQDA 2J8FA 1L2UA 4XAPA 3OHIA 3O7UA 4FOUA 5BOEA 2G3NA 2V5DA 1MZHA 6CGTA 2A1YA 4F2UA 4DBWA 1OF6A 3C2EA 3RU6A 1PZ1A 3TZFA 2VL4A 1GYLA 3T8LA 4US5A 2FKPA 1P7TA 3LPGA 1BQCA 2Q3OA 3PTQA 2ZKMX 3KVKA 1XDJA 4ZEPA 1KKRA 3ARZA 1E5NA 1AL7A 2BLEA 4PC8A 4RE2A 3WQ5A 4RPQA 4EXAA 2OTDA 5HPOA 4FMVA 4A3RA 4FA3A 1P48A 2PDPA 1IT7A 4LAKA 3S1XA 3M0HA 3S1GA 3U2OA 3WLLA 4PYSA 4ZXOA 3AZSA 1PHQA 3H7UA 3TFCA 1L8NA 5GNXA 5JIWA 3L4VA 3A23A 3LYEA 3E3HA 2G3IA 1PL9A 1CBGA 1YNYA 3TQKA 3WLMA 3GZAA 1J96A 4ZO7A 4LBUA 3AZRA 1OT2A 3VIGA 1TE6A 2P10A 3BGGA 1XSIA 5DY3A 5HQLA 3T40A 3LGEA 3HO8A 3ID7A 4YHGA 1V5XA 3LS9A 1XJBA 2OT0A 2XVPA 4A8RA 2G0WA 1A5MC 3ZSTA 4KIEA 1H7WA 5LIWX 2MUCA 4LUIA 3BV7A 4NRRA 1JQVA 1VLIA 2UY4A 1Z9AA 2FIQA 3CAWA 3APGA 4QR6A 4AW7A 2MANA 5HATA 3WEMA 3EDDA 3GC5A 3KX6A 1OYAA 2J88A 4NKCA 3MUCA 4AYGA 1WPCA 5LKYA 4N9BA 3DG3A 1W9PA 3GFZA 5F4XA 4CNTA 3BZJA 4UR7A 4FNSA 1E73M 3GIYA 4LEQA 3WLKX 1Z44A 1LORA 1NDVA 4NZ3A 1RBOB 2QJJA 4QXIA 4JTLA 3EDFA 5BXRA 3WO8A 2DY3A 5A6LA 4C6IA 3N2BA 2P88A 2R82A 2CFFA 1CXEA 2C1GA 3CWOX 2O55A 1FKWA 3UJRA 3MI3A 4J5NA 2NQHA 1U2YA 4JCLA 4CQ9A 2YZRA 1O5RA 1KRMA 2FZ9A 4JY9A 4TIMA 1VF8A 3WEZA 3FSTA 3A4XA 1BVWA 3W72A 1EA0A 4EF9A 1JPIA 4ZQMA 1DQWA 5BXSA 3CLMA 1LLOA 3Q37A 5EMMA 2B4GA 3AYTA 3GY1A 1TE1A 4GI8A 3K1DA 1EB3A 4I90A 4O0ZA 2ZZ3A 3EKGA 4A3QA 3OB8A 2V5JA 2Y24A 1OT1A 2I17A 4A3UA 5C5YA 3QSRA 3ONCA 4RDZA 3I3DA 3NA8A 4O1CA 4L6DA 2E68A 4KWWA 1D2KA 3UESA 2C3ZA 2AOSA 1VPQA 3NYZA 1ICSA 1UD5A 2ZRVA 2FVKA 3SQMA 3W4RA 2WJDA 3AHZA 2YLAA 1BD0A 4A35A 2WLZA 2YBVA 2I5IA 1I1WA 3EAUA 4HYVA 4W86A 2FPTA 4MJ4A 3KZPA 1VFLA 3KL5A 3GRIA 5F2IA 4UNLA 2Y0FA 3NPWA 1OG6A 7CGTA 3EPMA 3GE7A 3IIVA 2V5KA 1VBUA 3GVWA 3SUTA 3RO6A 4AY7A 1ZBVA 2ZXDA 1KQYA 3T09A 2V3EA 4O0QA 3SRKA 1PTAA 4FB7A 4UB9A 5D8ZA 3TR9A 4H41A 4KEVA 2PURA 5F1VA 4GQGA 4JEJA 1GZGA 1LWJA 1FWHC 3W7HA 2FJKA 3GR4A 1RZMA 1PB0A 2CEQA 5AB3A 4HHMA 4LWWA 3AMGA 1VBGA 5JU6A 1OZMA 3W1QA 1TTJA 1RJRA 4AISA 5JIPA 2J7GA 2XGBA 2JE8A 3D5HA 1WX0A 5A6KA 3TJLA 3OP2A 2AQOA 4H9ZA 3TN5A 3UF9A 4QM1A 2A4AA 3UWYA 3OGVA 2CWNA 3T07A 3ZMRA 4HN8A 9CGTA 4YPJA 2VGIA 1AZ2A 2WW5A 2XFFA 1B30A 1W5QA 3BK0A 3MY9A 1KGXA 5HNUA 2Z1BA 3TU9A 4A3YA 4IFRA 1DTUA 3IAPA 2GJLA 4M51A 2GK1B 2A21A 2WVVB 3GR8A 1E3ZA 4PUEA 4AH7A 2AQWA 4MGGA 4CQ8A 3EZ4A 4WIWA 3TKFA 3PJXA 1XW8A 1SZEA 4S3KA 4ADUA 1ZBCA 4DAFA 4AG0A 5HNTA 5D9PA 2ZUMA 2VUYA 1A5CA 3B9DA 3WUEA 5HNNA 4JKKA 4UTMA 3SAZA 1HJVA 4JBRA 1OM0A 1I8JA 1UWTA 3CQJA 2DSKA 3QQWA 4FEZA 4GACA 1V7YA 4UFHA 3SO7A 3GR7A 1SJCA 2DVTA 1KXQA 4UOQA 1MWOA 1LWHA 4TX8A 3CHFA 4JDBA 4FX6M 3A5VA 4OZOA 4BCEA 4BF7A 3B9AA 4NZ1A 2ZXAA 1ZCOA 4IIHA 1FX6A 3CL8A 3QV8A 3CZJA 4BEQA 4O53A 5K9XA 1JFXA 5D02A 4ADSA 2BWGA 3V35A 2C15A 4B2DD 1DKWA 1TX2A 3DCPA 2ISWA 3I7QA 2YBUA 2V38A 1F3XA 4H1ZA 1TCDA 3GVQA 4FNQA 2GGJA 2C91A 2E1DA 1KCLA 1POKA 3R58A 1F05A 2Y2WA 2CLHA 1K7EA 2ZUNA 3ITXA 2ODOA 3SSZA 3I7RA 3CMFA 1MDRA 4HNOA 2GQAA 2O7QA 4IIEA 3STCA 1GKQA 3AU2A 1LF1A 3N4EA 1WUEA 2FYMA 5D2TA 4LF1A 3VNJA 5DY2A 1W1B1 4FOKA 4BI6A 1YADA 1P4CA 4WKFA 2JALA 3LCXA 1QI2A 4C6PA 4J3WA 5M2FX 5EMJA 2WVVA 1W3IA 4M19A 4UTWC 1ONXA 4TVCA 1N8IA 4HVXA 1XWYA 3M4HA 2P8CA 4J3SA 3SCWA 4AC7C 4Q6XA 5D9OA 1JD9A 4MFEA 4O1AA 3BAKA 4AZGA 4AVFA 1UMLA 5TNVA 5JVLA 1QR7A 2PDIA 3FYYA 4PFMA 4JQ1A 1VC4A 4QEEA 3GDMA 1EBHA 1VB9A 3WF1A 3BOLA 5BCAA 1RH9A 1OFEA 4J2MA 3UETA 2WVUA 3PK7A 4XZMX 2CLPA 4GQ0A 1Y5VA 3TSMA 3UWWA 2GVYA 3CT2A 1OCJA 2GZXA 2QUUA 2B7QA 4ADTA 2R91A 3L21A 1DJIA 1Z41A 3U7VA 1JI2A 3GSMA 5I77A 1JYWA 2PLMA 1JR1A 2BGQA 1MUMA 3VA8A 5CEWA 4N42A 3W7OA 5BXTA 4TU1A 1L2QA 2PB1A 2FDMA 3QYQA 3ZYZA 3VGBA 3GG8A 1J2BA 1U30A 1YKWA 3BLIA 1GYMA 1I2PA 3OU8A 2WVSA 1BYBA 1IEVA 4HA0A 2ZE3A 3PBYA 1RK5A 4KEUA 3VGGA 2HJPA 3DFNA 2YX0A 1KFBA 3TJIA 1GOMA 4PMJA 1X97A 3RITA 3ZSSA 1C93A 3FOKA 4JFTA 2BTMA 3ZT7A 2CHNA 3WK0A 1W31A 1EIXA 4F8XA 3WDJA 2GUBA 2ZE0A 3R5EA 4AZCB 1E4LA 3BVJA 4W8BA 1DJZA 2WNNA 2WSKA 3W7EA 1WAUA 3O16A 5AZ1A 1BHGA 3W01A 3ARSA 3DYOA 3MWAA 2ZWYA 2QCEA 1OCQA 3WQ6A 1QHZA 5C2XA 4L1WA 4IMCA 5LIYX 3GC4A 4RNJA 1F3EA 3CEUA 3L4ZA 1V3HA 3THAA 1I1XA 1RPXA 5G1TA 1KLYA 4X63A 3UA4A 5BW6A 3B0UX 3W87A 2WMHA 3IRSA 3S46A 4R85A 2CCRA 1JEZA 3NO5A 1RVGA 2PGWA 3J7HA 3FDGA 2OO0A 1RA5A 1H50A 3TW6A 1BQGA 3CYVA 5HMSA 3ZR4A 1PZ2A 2GWGA 1W37A 1WOAA 3CZEA 5BU9A 1T7LA 2C1IA 2V67A 3C0SA 1KM5A 4XD3A 4R88A 2V63A 2CKSA 1XG4A 3H54A 5I2UA 2BASA 3HZ3A 4JYDA 1GQKA 1EP3A 5LNVA 4BF5A 2YSWA 3N2CA 4GVGA 3GH5A 1OYCA 1QNQA 4X22A 3VD5A 1AMYA 2DDXA 1POJA 1PXGA 3UXAA 3CZLA 4PUJA 1GJUA 1AK5A 1AJZA 2YXXA 4ZSUA 3KM8A 1VPXA 3MV01 2QDEA 4K37A 2C0AA 1KM3A 3IWPA 1HVXA 1ONRA 1OFOA 4QDPA 4W9TA 1QATA 3KBJA 6XIMA 4AZCA 2GQ3A 4IOTA 1X8FA 1LG1A 2VZVA 3BSGA 1CENA 4GZ7A 1V6XA 3AIRA 3A12A 2WM1A 4UZSA 5E0FA 4GIEA 1F3TA 1G4EA 4QGCA 5AHEA 1KRAC 1NDZA 2HSAA 4B91A 1MQQA 3LM7A 3T9PA 1H1NA 2CXEA 3NQCA 1ISZA 3P81A 1G94A 1JZ7A 3AXKA 1JVNA 1WE5A 2PD9A 3WD0A 2Z1KA 1VFMA 4LH8A 4DB7A 2Y6ZA 2NT1A 4N7QA 3LRLA 2QJNA 3F4VA 1ISXA 2INZA 3PPHA 3ZO9A 2A7PA 4K8HA 2DZTA 3CUZA 4G8TA 3S9YA 3P61A 4DM1A 1Y8BA 4FR6A 2JF6A 4XZNX 5C2CA 1WKEA 4E4FA 1Q65A 3SY5A 1XD0A 1H60A 1IGWA 3W25A 5RUBA 2Z4GA 1FDZA 2VC7A 1GEQA 2C14A 1E72M 2ACRA 3KBMA 3TYDA 1CB2A 1B31A 1DHKA 2GDUA 1N2VA 2H6RA 1UD8A 1XIHA 4GQQA 3SQSA 4B15A 3NPXA 2Z28A 3HG4A 3JS3A 1IZKA 2V2DA 2QDGA 1JRBA 2NX1A 5XINA 4ML4A 1SMDA 1DORA 4PMUA 5FJUA 2EEXA 3ZIZA