4Y8FA

Crystal structure of triosephosphate isomerase from clostridium perfringens
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
251
Chain Sequence
GSHMRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIVNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Isomerase
molecule keywords Triosephosphate Isomerase
total genus 86
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y8fA00
2YPIA 1GZGA 1PIIA 5K4ZA 1W54A 4TX9A 3S9YA 2Y89A 2VFFA 4WOZA 3LRLA 1KM5A 3WJZA 1U5JA 3EWWA 4FX6M 1F05A 4JIPA 4X2RA 3TW7A 4RKAA 2FB3A 2TYSA 2ZRWA 1QR7A 1VQTA 3L65A 5D30A 1L2UA 5U4NA 4GJ1A 4UFHA 3QSRA 3QSTA 4KFNA 3PB0A 2DJXA 1GT8A 1M7PA 3KX6A 3N14A 2B7QA 5KZEA 3W1AA 4A21A 2R8WA 1XDLA 2YX0A 4LUJA 1AL8A 5DBTA 3O16A 4CCDA 4O15A 1OFEA 5CPNA 1KFCA 4N2YA 1OFQA 4WJEA 4MY9A 4FNTA 3OA3A 2WJZA 2ZA3A 1X6UA 3W7IA 5AC8A 3RLUA 3LLDA 4M7SA 3NZ1A 4POCA 5EL1A 3QM3A 4K6AA 1PHQA 3BG9A 4UTMA 2FPTA 4BFAA 1VHNA 2JBMA 5LHFA 3QZEA 5HQEA 5J5RA 4LS0A 2WSYA 1H7XA 4ADUA 3Q2DA 3BW2A 3LCIA 1KM4A 1D3HA 3C52A 1LP6A 3NQ7A 2ZRZA 3HQ1A 1JULA 4QNWA 1SO6A 4Z1CA 3W84A 4PODA 5HJLA 2GJNA 3UPWA 2I14A 3PM6A 4PEKA 1NF7A 1QPNA 2Y61A 3PBYA 3UPBA 4DBEA 1FWSA 3W2KA 1ML1A 2V2HA 2V81A 5D09A 4OT7A 1O5XA 1QFEA 3STFA 3IGUA 3L2IA 3W7QA 3WK3A 3G22A 4G1KA 4UFMA 5AYXA 2FFCA 2Y88A 4I9AA 1W5QA 3IIVA 3MUXA 3BG5A 3R12A 1BTMA 2G95A 4HNVA 1WYIA 2VEIA 4YLWA 4ADTA 3LRMA 1TPDA 4IJBA 3STEA 3L5LA 1XBXA 5BMWA 5C54A 3G3MA 4AAJA 3TR2A 4DO6A 1XC4A 2YFOA 3GX9A 1AW2A 3VE7A 3DGRA 1FQ0A 1VCVA 2QCDA 1HL2A 2ATMA 2J24A 2W6RA 2C0AA 1I45A 1ICPA 3LB0A 4DPQA 3DZ1A 4UTUA 1FCQA 4OU1A 1VYRA 3ZWTA 3EWYA 1TPH1 3IVSA 4DF2A 1T96A 2YGYA 3GXPA 4YXGA 3IIPA 1TPVA 4LV9A 2VXNA 1YYAA 1DV7A 1I2NA 3W1PA 2O7QA 1H1YA 4NJKA 5BW6A 1RQBA 5I3KA 1TRDA 3Q37A 1P0NA 1ZALA 3QPZA 5D2TA 3QFEA 1TV7A 3E49A 3WFAA 2PRHA 3P8IA 3I68A 4I7VA 1I2PA 3LHUA 3QQ0A 2WO5A 1IXPA 3HO8A 3S5OA 3UY8A 1IIGA 2CLHA 3LDVA 3RMJA 5LHEA 2ZA2A 2VFEA 3NQCA 3ZFHA 3TA6A 1XXXA 1DQWA 2BWGA 3BVJA 3GNNA 3FJ6A 4GRSA 3HGJA 3W72A 4UR7A 3GDKA 4UFLA 1N8FA 1OYAA 1WBHA 2BZNA 2ZZ1A 1LM1A 1J5TA 3LLFA 2VKZG 1IXOA 5ABTA 1KTCA 3C8FA 2ALDA 5EBUA 2VEPA 4U28A 3SZ8A 3U6WA 2R14A 3W75A 1PE1A 1JCYA 3CWNA 3F1QA 3SW6A 4QJ1A 2VOMA 1GQNA 3NQMA 1GWJA 3T78A 1O94A 2P1FA 1TV5A 1F76A 2X1TA 1L6YA 3G1SA 2A0NA 3LM7A 4GWEA 5D33A 1KM0A 3C6CA 4XWUA 1OX4B 2A7RA 3CC1A 2C18A 5C55A 3B0UX 4GE8A 3W73A 1H62A 3PUEA 2QCLA 4LUIA 2ISSA 1S5WA 1W31A 1RQHA 2GPTA 2YYUA 3L66A 4AHQA 1UUOA 4LS1A 3TX9A 5F4XA 4P61A 1Z44A 3LCFA 2VFHA 3PB2A 3A5FA 1A50A 5HWMA 1UCWA 1SZEA 4JTKA 3L21A 1MZHA 2YFNA 4IMFA 4NQ1A 4MJZA 2NUYA 4M19A 3IVTA 3WK0A 4ADSA 4MOZA 5D2YA 1QNVA 1ZFJA 4UIOA 3QMSA 1GVOA 4NJHA 2CLKA 3OEXA 1DBTA 4WX2A 3P5ZA 1UASA 1LBLA 1XKYA 1F5ZA 3VE9A 4OGZA 4JTEA 4MLJA 1K7XA 4AEOA 3R8RA 1ZY9A 3SFKA 1R46A 3HG4A 1OF6A 3TQKA 4CQ9A 1GVQA 1LTDA 1LRTA 5GVJA 2AAMA 2PRLA 1KFJA 4JTUA 3F03K 4C1LA 3TDFA 4XZ9A 1P0KA 4MFDA 2TRSA 3W74A 3TXZA 4FEZA 5K9DA 4YMZA 2OT1A 3VI2A 3T44A 1R2RA 5AHNA 5I3FA 1VS1A 8TIMA 3RK8A 5LNSA 2OZ0A 4A3UA 2GQ8A 5TQLA 5KZDA 1LLZA 3NPWA 5HINA 3EX1A 3UNDA 2EPHA 4ORMA 3EWUA 4UFJA 4NJJA 4CNPA 1I2RA 5LNUA 5H91A 2FJKA 1D9EA 1SW7A 3GDLA 1QO2A 1Q6QA 3WJWA 4FNPA 5U7SA 2RH9A 3QQ1A 4O1AA 3MBDA 4PC8A 3CIWA 4EWND 1W8SA 3G1HA 3EX3A 4GUIA 4LW7A 4N02A 3E12A 3DHFA 3MP4A 4E38A 2WOQA 3HJZA 1Q6LA 3LXCA 3H54A 4JICA 4YL2A 5CG7A 4DO5A 1ZCOA 3ATYA 5AC6A 1ONRA 2FLIA 2H3DA 5CZTA 3LXBA 4NZJA 4O53A 2BXVA 1R2SA 4JTFA 5DCBA 1EPXA 1F6KA 2E6FA 4MJMA 5CSRA 4H6KA 2QCHA 5FESA 2RHGA 3C56A 3QMTA 1FUYA 1SSDA 4WOQA 1RV8A 2NUWA 3BW4A 1M6JA 3W2UA 5D02A 1G69A 4MIMA 2ZRVA 3NM1A 5J5DA 3LTSA 2DZTA 3R5EA 3RU6A 3W23A 5DCDA 3C4UA 3TNOA 4BR1A 5LGXA 5L6UA 4HIBA 1OYCA 4LRSA 1LLWA 2QCNA 3GIYA 4Z1DA 3LX9A 3W7OA 1QPQA 4O1BA 3QC3A 4QNEA 1BKSA 3STGA 1XBZA 2DZSA 4R34A 5EKYA 3M47A 4Y96A 2FTPA 3W1NA 5CKSA 5DY3A 3NYZA 3N2XA 1SW3A 1FY6A 2A7NA 3JS3A 4O11A 3DXIA 4A22A 3EKZA 4LU0A 3NNTA 4Z0SA 3G1AA 2ZQ0A 3LGEA 1G7VA 5LNVA 1G4EA 4HN4A 2Q8ZA 3S1XA 1DVJA 3IGSA 1JCNA 1GYNA 4HNUA 2ZZ2A 1SQ7A 2WQPA 1PCKA 1TPC1 4PH6A 3CQ0A 2QCFA 5D04C 1G67A 3EXTA 2J9XA 5G4EA 3LTPA 5DBUA 3QF0A 1VC4A 5DLCA 2F84A 3NQ6A 1YXCA 2CLFA 5T26A 3OVQA 2E6YA 3Q58A 4UUIA 3PG9A 1SZNA 1J4EA 3KRZA 1SPQA 3N9RA 3MI2A 3GKAA 1ZENA 1WDWA 3NDOA 3W70A 3H55A 3ZWSA 2JKAA 4AWUA 1H1ZA 3EXRA 1KM3A 1WV2A 2NLIA 1DORA 3THQA 5FF0A 1TJRA 4TO8A 1FDZA 1VR6A 4ML9A 1IIHA 1Q6OA 3LERA 3TROA 3NGJA 4WY0A 4S2BA 3UD6A 5FF4A 4IMDA 1ADOA 3PF3A 5IM51 4OQVA 3UZJA 1ZJIA 2V2CA 5F2MA 2VEKA 2JGYA 4JTTA 3CIXA 3M44A 2C14A 4W9TA 2A5HA 1OJXA 1AW1A 3P61A 2QR6A 5F1UA 2F7FA 1YXDA 3LBMA 2X1SA 2WNQA 3TH6A 4HNTA 3AO0A 1ZAIA 5F1VA 4NXSA 1KM2A 3RF9A 4DPPA 1VGAA 2RFGA 2ZZ7A 4HT3A 2CFFA 3INPA 3C0JA 5FF3A 3TFXA 3VKJA 2RKXA 2B7OA 3B0PA 2HMCA 3QH2A 2E68A 3IIXA 4N6EA 1OFDA 4CNOA 4JGDA 1SO3A 3W1TA 3LXAA 4UMAA 3I7QA 4K8HA 4N9EA 3FLUA 2VELA 1HTIA 3GDMA 4M6VA 3K30A 4N4QA 1BWKA 4HHPA 2NX9A 3L5MA 3DAQA 1KA9F 2DZUA 4WD0A 1JQVA 3W7DA 3O05A 5HUPA 5DXXA 5BRBA 5SWUA 2C16A 3G24A 4A2SA 3QPYA 5CZJA 3W2JA 1ICSA 5G2WA 1Q3NA 3P62A 1B4KA 4LTSA 2DZVA 2A1YA 2GQ9A 3GXNA 4WZHA 1W5PA 2J9ZA 3BO9A 2YYTA 1SZFA 3GK0A 1R30A 1ZHAA 4HKPA 1W1ZA 3A5VA 3S5YA 3TAKA 3FEMA 3STCA 2BX7A 1DKWA 5D37A 5HR7A 1I2QA 1H7OA 3L68A 4N9BA 3PC0A 2J88A 4K39A 3W7GA 2V2DA 4BWLC 4N9CA 1FWNA 2Y7DA 1TTJA 1ZAHA 3DFQA 3S5ZA 4TU1A 1GTHA 4CQ8A 4E0CA 3P67A 4EVZA 4IMCA 1HG3A 2ZTKA 2QJIA 4XTDA 1TSIA 5AYZA 5KITA 5L9FA 1SFJA 4NU7A 2QAPA 3BLEA 1EX5A 4PL1A 1L6WA 3N73A 1SO4A 1FDYA 3KVJA 3U2OA 3MJYA 1KM6A 2ABBA 3LHVA 1B3OA 1TPEA 3H53A 3UWUA 3KAOA 1JR1A 2H8ZA 3NL3A 2ABAA 1GG1A 1XM3A 3NA8A 1MEHA 1YDVA 2QAFA 3DKLA 2XN1A 4PA8A 5BNKA 2E5DA 1KV5A 2E09A 3T4CA 4NXKA 1XL9A 4IGHA 1YTEA 4YCOA 1JUKA 3MI3A 3I65A 4HSOA 1PVNA 3A24A 2YW3A 5D2XA 3W9ZA 1EEPA 1OK4A 2QUTA 4ZQOA 4IWWA 2Y7FA 3SSJA 2Y6ZA 1TREA 2YCEA 2QCMA 2ZDRA 1OVDA 5C5YA 1W37A 3W7RA 2D73A 3NEVA 2Q3RA 3VCRA 1GVSA 2ZZ3A 3FA5A 1PV8A 4OE7A 3UWWA 2Y70A 5D32A 4KFPA 3GLCA 2ZZ4A 3KHJA 2O7SA 3KXQA 3O15A 3PBUA 3GAKA 4JDYA 3KFTA 5TIMA 4JXCA 5K7JA 1MEWA 1E51A 1OYBA 2A6NA 1MO0A 2H6RA 3GAYA 2Z6IA 3THAA 3PS7A 4K7YA 2Z1BA 3C2VA 3G1YA 3A22A 3G18A 3HG2A 4NNBA 3C2EA 1FCBA 5AN7A 3OBKA 4OHQA 4EF9A 4MPQA 3W7HA 4FHAA 2DP3A 5EY5A 3LBCA 4DELA 4E2DA 4Z1AA 1N55A 2FIQA 3P5YA 3P60A 2E5CA 3NOEA 2V82A 3WJXA 3S1WA 3LCGA 1O60A 3ATZA 3GXTA 2V5LA 4MZ1A 1QCWA 4BI7A 4WXZA 1ZNNA 3DH7A 1TB3A 4QISA 1A5SA 3NG3A 3OG3A 1SUXA 4MYXA 3CU2A 5AB3A 4JTLA 3QRHA 2X16A 1EUAA 1K3UA 2I1OA 2NZLA 4O12A 2EF9A 5CPOA 4ZQPA 1THFD 1MXSA 1TV8A 1GYLA 2CLEA 3LHWA 3PUDA 2UV8G 2IQTA 3HPZA 3LCLA 1DJQA 1W3NA 1XBYA 5F4WA 1JVNA 1T8XA 1SO5A 2ZZ5A 4BI6A 1QPRA 5E1QA 2CZ5A 3G0XA 4L4LA 4UTTA 2ZZ6A 3M9YA 3NAVA 1SU5A 3QJAA 1CI1A 4RX0A 3DFTA 1XDMA 2JGQA 4RXGA 1YTDA 4AF0A 4B5NA 1QPOA 2A6LA 2QUVA 2B4GA 5LSMA 2EKCA 4AXKA 4GUHA 2ZCGA 1FXPA 3HIJA 3ANYA 5C2XA 4GBUA 3G3DA 1GOXA 2CLOA 4JX5A 4QITA 2V8ZA 2ZBTA 3R89A 1Q6RA 1KFLA 1DL3A 3S42A 1U83A 2WKJA 4NX0A 1X1OA 2NXHA 4RXFA 3W1MA 3W7KA 1B57A 1TCDA 3W7EA 1UUMA 4Z08A 1J2WA 2HSAA 3L67A 3HPSA 3OVRA 5LNWA 4AMAA 3QW3A 3W6YA 1JCXA 3N9SA 1F73A 4GUJA 5G4WA 3M5VA 3ABSA 2QF7A 4XBKA 4QIUA 5DXYA 3NQDA 1LZOA 3W7PA 2JKEA 3UQNA 1JQXA 2C13A 4FIRA 3O6DA 5KINA 5AHMA 3TE9A 2Y62A 1BEUA 2C3ZA 1FWWA 3PSWA 2CW6A 3W2LA 1HO1A 3DFSA 4GXMA 3C2RA 4K38A 5MHBA 3LTYA 3MW7A 2TSYA 2G97A 4RJEA 3PR2A 5D03A 4O16A 4PTNA 1W5MA 3SY5A 3M43A 2CZFA 3EWXA 3O07A 3PULA 2CLMA 3MHUA 2C1HA 1EUNA 2VENA 3GR7A 5F4SA 1X8FA 3SI9A 5D2WA 1QMLA 4XBSA 4O0ZA 1ALDA 3BK0A 1F2JA 1F7BA 4O4WA 1G6CA 3TJLA 1SFLA 3E96A 4ZQMA 4LV4A 5I3HA 4DF0A 6ALDA 1RQEA 5FEXA 4XKYB 3P81A 2NX1A 2VFDA 1XBVA 3B8DA 5EA9A 3G8EA 3E0IA 4FF7A 4LC6A 2ZRXA 1VH7A 3TMQA 3F4NA 3BW3A 3R2GA 3MWAA 2QCEA 3GDTA 1GPWA 4R53A 4ZL1A 1NF0A 2A2IA 3KVMA 4O57A 3I7RA 5DELA 5LGZA 3O63A 3M41A 3S1UA 4FO4A 4X9SA 1KTBA 1RPXA 3ABOA 4UTHA 3CLMA 1LBFA 1QAPA 3FFSA 3MP5A 4UTJA 4XUGA 4DF1A 3EWZA 1H5YA 4IX2A 2R91A 1X1ZA 3P8JA 4QAIA 4EOUA 3KRSA 1OFRA 1LOQA 5E0KA 3NR0A 5E93A 2C6QA 3GDRA 2YSWA 2NV1A 2J27A 4R33A 3UZ5A 1K7EA 4WXYA 3HG3A 3TKFA 4FIQA 5EYWA 1H63A 3W76A 4LRTA 2QDGA 1JRCA 2ZA1A 3MI6A 4UXDA 2JK2A 3B03A 4HNNA 2ZRUA 1VCGA 4O1DA 5LNRA 3TSMA 1I8JA 1GTEA 3D0CA 4UTKA 2DJLA 4MLRA 3TIMA 4LWWA 1LYXA 2PE4A 4NJIA 2QKFA 3W83A 4E2BA 4O28A 3NL5A 3NQEA 4H3DA 3IIOA 5HWJA 4IMEA 5K3VA 2B0MA 2OCZA 4FNUA 1QOPA 4MVAA 2BLEA 4O4VA 1UB3A 4RZ5A 2KZHA 3PG8A 1GEQA 1A5CA 3DI1A 3NZRA 3TK7A 3TMLA 2Y7GA 4FX8A 3EX6A 3W22A 5DY2A 4JN6A 4L4MA 4AHPA 5DN1A 1NVMA 1JUEA 4ONVA 3T40A 4CNNA 1JUBA 1B4EA 1H50A 4O19A 1QWGA 1WOBA 1VHCA 2QJHA 4IMGA 3HMJG 3PY2A 1KBJA 3NVTA 3S5NA 5HMSA 1C29A 1LORA 1O4UA 4NJGA 2TPSA 4Y90A 5I3IA 2CWNA 4UFKA 1H7WA 3PAJA 1MEIA 4JTIA 2HS6A 4WY0F 3KRUA 4ZZ9A 1WXJA 2GVJA 4HPJA 2WSRA 3W85A 1F74A 3W1QA 4UTTC 3IVUA 1WBJA 1BWLA 1CX9A 3WJSA 3TU9A 1K03A 4UTWA 1Y0EA 2GJLA 4OBTA 4RCXA 5CSSA 2V9DA 1OHLA 1KTNA 1C9DA 1H7PA 2E1DA 1QO5A 4GUGA 2OX1A 4TIMA 1H51A 3DFNA 4MUZA 3DKJA 1SR9A 2E6AA 3N34A 1FCUA 1WX0A 5AC7A 5AHIA 4TMCA 4NUWA 3BGJA 3B4UA 3T55A 2NX3A 4JDBA 2PURA 1KFBA 4UTLA 1PCWA 4Y9AA 2Y85A 3M1ZA 3R13A 4N6FA 1LCOA 3FIGA 4X3ZA 1G4SA 3LHTA 1WA3A 1Q45A 1JJKA 5AOUA 2BSLA 3A21A 3HBLA 3EXSA 1EP1A 1UBSA 2AGKA 3NPUA 4NNCA 2PRMA 1IF2A 1VCFA 2B7PA 3SGUA 2DZWA 4WQ6A 4O1CA 1H7NA 5EMUA 2JKPA 1AG1O 2FDSA 4H4IA 4NVTA 4JX4A 4O13A 1KLYA 4GC4A 4MKNA 2ZTJA 1YPIA 4JYDA 2HS8A 4U4MA 4ZMGA 4JD4A 4JR5A 3TC6A 4UCGA 3KVKA 1A5AA 1T0OA 1R2TA 3HPXA 1QOQA 3W1RA 1TTQA 2NXIA 5CZ0A 1KM1A 3OIXA 4JYEA 2QJGA 3L0NA 4LNYA 4YCPA 5FEPA 4K37A 2QCCA 1C8VA 5EPDA 3RLVA 4A2RA 3WJYA 4LVGA 3UXAA 1LBMA 1FWTA 3M5XA 3ABRA 1OX5A 1Z42A 5FEWA 3MO7A 1A5BA 3AJXA 4JEQA 4LS2A 3FYOA 1P4CA 4BWLA 1W5OA 3USBA 3CWOX 5DCEA 4KWWA 2FQIA 3LOTA 2WPBA 2PC4A 4DBDA 3W2MA 5H2ZA 4M5PA 4IUOA 4OWGA 3LCXA 4JY9A 3IGXA 1OX6A 3W7MA 3SECA 5KTLA 2Y63A 2ZFAA 2DORA 5FI8A 5HNRA 5K4XA 1HFBA 2J9YA 3IV3A 1V5XA 3L0KA 1F6PA 4JIQA 1K02A 4YWIA 1FWRA 2TMDA 1GJPA 4M6QA 3EWBX 3NQGA 3HGRA 4UC5A 4I7WA 3TFCA 3TV8A 4CCEA 4FNRA 4BI5A 4TMBA 2ATSA 1RVGA 4NT0A 1LDCA 3L9CA 2GVLA 1S5VA 5C6MA 1L9WA 4JTSA 1YDNA 1VPXA 3E02A 4PCFA 3HB9A 3MHFA 4IPJA 1K7FA 3UWYA 3GB6A 3HG5A 4DO4A 3LV5A 3B0VC 1VLWA 4QM1A 4AH7A 2ISWA 1YLVA 3E9AA 1NSJA 5F2LA 1G7UA 3BV4A 4NNAA 1AMKA 1R47A 5AFDA 2C15A 3GVGA 4MZ8A 1W5NA 2WV8A 3FKKA 3W7LA 4AVFA 2H90A 1VLIA 3JR2A 4Q32A 2QDHA 5I3GA 3MYOA 5D05A 3KOFA 1S3HA 3NO5A 1WOAA 3PUOA 3W86A 3VNDA 3G1VA 4JX6A 3I6RA 1ME8A 1KFEA 3W7NA 1RD5A 1YXYA 3T7VA 2GOUA 4LC8A 3O6YX 1I2OA 3GKFA 2H8XA 2CU0A 3BPWA 5D2VA 2G96A 1DJNA 4EF8A 1EWDA 3HOJA 3A9IA 3UXDA 5A5WA 1RZMA 1TO3A 3L5AA 5HR6A 4RZ4A 1DHPA 1AW5A 3IEBA 4OV4A 3GYEA 4KWVA 3TSDA 3W1LA 3V75A 1GVFA 1VRDA 1ME7A 2GQAA 2RDTA 5CPMA 3UWZA 3MMTA 1RR2A 4J9JA 4JTGA 3CM4A 1JRBA 4O52A 2DZXA 2YDAA 3G0UA 3NL2A 4XTIA 1VYPX 3G1FA 4MFEA 1OG0A 4LVFA 1GVRA 3NPVA 4LVBA 4K7VA 3G0SA 1XCFA 3HGSA 4Z1BA 5D38A 3W1XA 1D3GA 2YR1A 3EKLA 2WNZA 4DXVA 4O8RA 1W3IA 4N4PA 3FS2A 2E6DA 5CPLA 2YXGA 1W56A 3B06A 3P7YA 3EB2A 3W07A 5BOOA 3DFPA 2FPVA 1T99A 3TUUA 5F2GA 1Z48A 1TTIA 1FCVA 2X2GA 4PL2A 5FF2A 3TQ0A 4LVAA 5FF7A 2CZDA 4FB7A 4KKXA 4UTWC 3P74A 2Q8LA 3TXVA 1JCLA 4JTJA 7TIMA 5G1TA 3N2MA 4UTIA 4BF9A 5IBXC 3W88A 3QEZA 3UWVA 3DHDA 2Z6JA 4M6PA 3S6DA 3W1UA 3EEGA 4Z0JA 1H60A 4Q4KA 3TSBA 3LCWA 3G1DA 4AB4A 5K9XA 4UMCA 2H3BA 2DZPA 3DI0A 4D2JA 3TAOA 1TPFA 2CLIA 4HPXA 3IRDA 4P2VA 2XN2A 3M7WA 1LRQA 5I3JA 4KFOA 1L6SA 3TC7A 1WAUA 4QSHA 4LVDA 1EIXA 3C2FA 3VFLA 1G4TA 1DQXA 4UNKA 5HUOA 3W3OA 1NFBA 2RDUA 3CPRA 1KW1A 1H7RA 1VZWA 3P82A 4O17A 4ZQRA 2VFGA 1VJIA 4S1FA 4I7UA 3L0GA 1HO4A 1GG0A 1YTKA 4LT9A 4FX7A 1TPUA 2XFWA 1FDJA 3S0CA 1TJPA 3QW4B 3WK1A 1YPFA 2V5BA 3PWAA 4RLIA 1LOLA 1XUUA 2QCGA 3LV6A 2FB2A 3CB8A 4LY8A 4RK8A 1XUZA 4XKYA 2P0OA 2CLLA 3BLFA 1OFAA 1O5KA 4WY0B 1OFBA 3BARA 1K8XA 4UR8A 1TTPA 2WNNA 1W3TA 4K8EA 2NV2A 3M5ZA 1HUVA 2J6XA 3GR8A 2X1RA 2YW4A 1DOSA 1TYGA 3UWQA 4DQWA 3DU0A 2A7PA 3W71A 4HSNA 3OHIA 5CGQA 4BK9A 2NWSA 3FOKA 1TPB1 3GZ3A 1EWEA 1MSSA 2QUUA 3DENA 1VYSX 2A4AA 3LI1A 3YPIA 1P5BA 3MP3A 5AYYA 3PBWA 4Y8FA 4IX0A 2Y7EA 3M0ZA 3B04A 1G4PA 3FYPA 2B7NA 4ZVJA 2OJPA 3ZS4A 5G2IA 5G1YA 1QDSA 1LOSA 3F4WA 3ZR4A 4EIVA 2PCQA 3ELFA 2ZRYA 1EP3A 2GUUA 1AK5A 5G5IA 3U8GA 2VFIA 4QQ3A 1NAL1 1ZAJA 2E5BA 2ZYFA 3TJXA 5KSWA 1V7YA 2E77A 5KZMA 4WUIA 3TW6A 1I4NA 1OX4A 3G8RA 1SSGA 1WQ5A 3S1VA 1SW0A 4CQAA 4OV9A 1CW2A 3O8AA 4FXRA 1OK6A 1ICQA 3O6CA 1K8YA 4RR4A 4ZQCA 1JCMP 4K36A 3EX2A 1AL7A 2AQWA 5HULA 3W87A 4MY8A 5K9CA 5CZSA 2FPYA 2V30A 4JS3A 2X1UA 3Q94A 1Z41A 3NL6A 5HWNA 3MHGA 4C1KA 1KBIA 3M5YA 4FXSA 3C61A 3N19B 4PFMA 2A85A 2CZEA 3LRKA 2W0UA 2RDWA 1W0MA 3P80A 5KMYA 3BG3A 3HGOA 3RNDA 2NWRA 1XFBA 3CEPA 2XN0A 4O54A 5F2IA 3NQVA 5A8GA 3W7JA 4LOCA 1FXQA 3RFAA 1IXNA 3N3MA 4Q33A 5IBXA 2GVGA 4IQLA 2BTMA 2NUXA 4GUFA 2HTMA 2OMAA 3FKRA 4AHOA 4UNLA 2EAWA 1TQXA 5G2HA 3KVLA 3SGZA 2OT0A 2QCDB 3CT7A 1X7FA 3C3NA 2WSQA 4NZFA 2EGZA 1NEYA 2YZRA 3PSVA 2VC6A 1KFKA 5LKYA 3NQ2A 5TBOA 2X30A 2V0TA 4XQ6A 3OVPA 4ZQNA 3I7SA 2Z2UA 4AWSA 3GNDA 1ME9A 3TCEA 5BMXA 3FJLA 5AHEA 1FX6A 4IPIA 4X22A 4FNSA 3QYQA 1P1XA 1OFOA 3BLIA 3C2OA 4R7JA 2C19A 4ICNA 4MZYA 4ORIA 1YADA 4TR9A 3DBPA 1XI3A 3NQ8A 4JNMA 4UMBA 2W79A 1OFPA 1IGSA 3MYPA 1TIMA 2I9EA 2Z0IA 5AHLA 1OF8A 3SIZA 1K8ZA 4O0KA 4GNJA 4RZ6A 3A23A 3UY7A 3CHVA 3ABQA 3LHZA 4UFIA 3TQVA 3PBVA 3NXFA 3LHYA 4S2CA 1LRNA 3W2NA 3NPXA 4IXXA 1TQJA 4JTHA 1TRIA 6TIMA 4N9DA 2EHHA 3G1XA 1YDOA 3SR7A 1B9BA 4JYFA 3B05A 4RV8A 1TMHA 3PVFA 1KV8A 4NX5A 1OABA 3M16A 3M6YA 3DFOA 3CTLA 4MYAA 4Y6GA 1M5WA 3W7CA 2Q3OA 2LLEA 3S8HA 4FNQA 3UYCA 3QMRA 4ALDA 2VEMA 4O14A 3NQAA 3O06A 1IXQA 1KLZA 1PL9A 5AHFA 1TPWA 4A29A 2ISVA 1EA0A 1PS9A 2NXGA 1O95A 4IXHA 3BGGA 1S5TA 1JCJA 3LCHA 1UJPA 2A21A 3JRKA 3EX4A 5LZLA 4O50A 1FBAA 3SJ3A 2G5WA 3NM3A 2P10A 4O10A 2QEZA 4IOTA 4CLMA 3LI0A 2DU2A 1A53A 3HF3A 4MY1A 1PHWA 1EB3A 3CEUA 4JY8A 4GFSA 1LROA 1N7KA 3IIZA 5FEZA 3P84A 1H61A 3MBFA 3V1PA 4AWTA 1EP2A 3NQFA 4O18A 4CCCA 4DEFA 5K2ZA 1SZGA 1M7OA 3WK2A 2R94A 3O1NA 4AF0B 4M7TA
chains in the Genus database with same CATH superfamily
2YPIA 4LYRA 1F8IA 1DJXA 1QW8A 5EMKA 2XG9A 5A8QA 2RGLA 4A8NA 2Y89A 1CT5A 4WOZA 2WYSA 1AQ0A 1KM5A 2IPJA 2BGSA 4X2RA 1XIMA 1VRXA 4HCHA 5C9UA 1PYFA 3ZT5A 2O9RA 1JGIA 3CUGA 3AXMA 3QSRA 3GH5A 3VABA 4DJFA 3QLLA 3PB0A 1GT8A 1E6ZA 3CWHA 2F2HA 3CZKA 2ZXDA 2R8WA 3KCJA 2XUCA 4LUJA 2XIJA 3M4HA 1SFSA 2D2GA 3O16A 4IFKB 1OY0A 1OFEA 2G50A 4NZCA 3M0LA 3R6IA 4WJEA 1JPMA 4MY9A 4J2PA 2JALA 2ZA3A 3NXLA 4DAFA 5XIMA 5LYRA 3RLUA 5EL1A 4MG4A 4AZIA 4Q8UA 2PF0A 3AHXA 1UOZA 4QQUA 4L4PA 3I6TA 4BFAA 1VHNA 4HD5A 1QRQA 4IISA 1RJRA 4LS0A 3VU2A 2PBGA 4ADUA 2ODOA 3LCIA 1D3HA 1LP6A 1B3WA 2ZRZA 4Z1CA 1G9HA 3W84A 5A6BD 3WDHA 4AD5A 1W17A 3KUMA 1PWLA 1M04A 4Y9PA 1NF7A 2V5DA 4WGHA 3NVDA 4GXWA 3A12A 2VT0A 2OSYA 3IV8A 3N3TA 4Q8PA 3IGUA 1U1HA 1VP5A 1LQ0A 3AHTA 1UQYA 4ZOCA 4PMJA 3V4BA 2G95A 2VEIA 3VGFA 4A6GA 3STEA 1P0BA 2NV9A 3B0YA 4MDPA 4DO6A 1REQB 3GX9A 3V5CA 4AD2A 1DXFA 3BQ5A 4H9YA 1W2VA 3DGRA 1HL2A 1EA9C 3WD1A 1LQ2A 3MDUA 2GDQA 4NAEA 2CCRA 3V7PA 4UTUA 3O7UA 4RZBA 1C9WA 1X8CA 3EWYA 3CIVA 2CHNA 1GHSA 1TG7A 4YXGA 5A2AA 2E3ZA 1DV7A 3W53A 4QEHA 1UKTA 2CHRA 3GDBA 3TTEA 2OU4A 3VGEA 4EKJA 1N82A 1P0NA 3ITXA 4AX7A 2ALRA 2UY3A 2WM1A 4IPNB 4KESA 3WFAA 4ACYA 3VINA 3CPUA 1R5YA 1IIGA 1BXCA 3AMDA 5LHEA 2ZUNA 1TWDA 1UH3A 4PBFA 1XXXA 1Z8AA 3QC0A 3WEMA 3WX7A 1RK6A 1KB3A 4P8VA 3GNNA 1L6FA 5FL1A 3HGJA 4LUTB 3WQ4A 1HVQA 4WIWA 3FXYA 2VHLA 2VQTA 1N8FA 1LM1A 4LUSB 1GOOA 3U3HA 3QHMA 4JTRA 2ALDA 4JKKA 3REQA 5EBUA 4XISA 3W75A 2ZOXA 3SW6A 4QJ1A 3DESA 4PSRA 3POCA 1KGXA 4U5IA 1GOIA 1GWJA 1PZ0A 4CVUA 1O94A 2X1TA 1UPPA 5D33A 4HMCA 4S23A 4XWUA 2W67A 3JUGA 2INZA 2DQWA 1KBBA 4IH3A 3UVIA 4GABA 3H4WA 2WJFA 3B0UX 1CECA 1H62A 3C5QA 1P6BA 4B91A 3IUIA 4R88A 1W31A 2GPTA 1IR2A 2GZXA 2J7HA 2PWVA 3GHTA 2R1MA 5A2CA 4P7LA 3L66A 5HJYA 5ECUA 2PI6A 5HANA 1MDLA 3DG7A 3TX9A 1VIWA 5F4XA 1V02A 2FHFA 4KGJA 1DWIM 4ZCWA 1A50A 1V3HA 1ZTVA 3XISA 5HWMA 1SZEA 4JTKA 3L21A 6REQA 1HKKA 2YFNA 4XG1A 2XIMA 1VFMA 2D2OA 4ADSA 4QXIA 1R9YA 3QMSA 1P6WA 2XGIA 1TVNA 4ROPA 1A80A 4MF4A 4OGZA 4JTEA 1V51A 3OLEA 4AYSA 1OIFA 3SEPA 3KRBA 4YU1A 3E0FA 1XIIA 2O0TA 1B90A 2EG7A 4CQ9A 3CZEA 3CAVA 1GVQA 2VQUA 2HPMA 2PGRA 2ZUVA 1XGEA 3WF1A 1KFJA 4JTUA 4C1LA 2TRSA 3TXZA 4HGXA 3UR7A 3WQVA 4FEZA 3TYBA 3ZR6A 4EACA 4YMZA 5K9DA 5IDZA 4TTUA 4ZOEA 2REQB 5C9ZA 2OO0A 4J27A 3RK8A 4O1FA 1LLZA 3NPWA 2OWCA 4F0MA 4Z2KA 1DIOA 3EWUA 4NJJA 1M68A 4MDOA 4CNPA 3CT2A 4GACA 3WF0A 3GDLA 3GH4A 1QO2A 1T7LA 5U7SA 3QQ1A 2QT3A 2SFPA 1B3ZA 3NYDA 4GYPA 4YHGA 3E0WA 2BHYA 2G41A 4V1YA 3FV9A 2NQLA 3D46A 3MP4A 1E0XA 3HJZA 4CD5A 4JICA 5CG7A 3PTQA 5HQLA 3SCPA 3VZZA 3LG3A 4H6RA 2XYLA 3ARXA 3LXBA 4O53A 3CL7A 4GBDA 3SUTA 2BXVA 3MTWA 4PMUA 3TQPA 1KKRA 1F6KA 2E6FA 5CSRA 1E9IA 4H6KA 1VFFA 3SUWA 2CERA 4CU6A 1A49A 4H8HA 2RHGA 1SSDA 4WGXA 3AMGA 4HA0A 3URBA 4MWAB 2HE5A 2QVNA 3NFUA 5D9MA 4MIMA 2NVCA 2DZTA 1AMYA 1XLLA 5LGXA 4JL2A 4AD0A 1JZ4A 4KCWA 2QCNA 3LX9A 4O1BA 4LF1A 2QLYA 4LY4A 1JNEA 1S39A 1UBPC 1CB7B 3M47A 1UW9A 2XIIA 4IFOA 4Y96A 3A4AA 1US3A 1DHKA 3NYZA 1OGBA 1ONEA 2IXVA 1LL7A 1F4HA 5J04A 3JS3A 1H2JA 2P3EA 2UZ9A 4MHBA 4A22A 2UY2A 4JTQA 2FYMA 2Y8VA 2CESA 3V0SA 1VAHA 2Q8ZA 2WC4A 3S1XA 2VGBA 3WMLA 2I5GA 3SBFA 4HNUA 2ZZ2A 2VC7A 1TPC1 2EPMX 1FKWA 2QCFA 5D04C 1V6VA 5DRCA 3GYCA 3BLPX 3MUCA 5IDIA 3AXHA 5DLCA 4ZSTA 2F84A 3IAPA 3WH5A 4C6NA 4UUIA 1SPQA 1OCQA 3QV6A 1ZENA 2IPWA 3NDOA 1I0DA 1NWUA 1H1ZA 3GU9A 5H8UA 3UP8A 4TO8A 2VCCA 4H7VA 1GOMA 4XZNX 3L4VA 3UESA 4ML9A 1IIHA 1X98A 1VFUA 3ANUA 4FXFA 3NGJA 4S2BA 1PZ2A 3PF3A 5A6BA 3UZJA 2BDQA 3LN3A 3EA1A 3M44A 5I23A 2A5HA 1VENA 3P61A 2F7FA 1YXDA 3RPMA 4HA4A 4D71A 2UY5A 2WNQA 3AO0A 4NXSA 2RJHA 1A5LC 3SQLA 2ZZ7A 3VKCA 2AOSA 4HT3A 5FF3A 4XBJA 2RKXA 4CD8A 3WLMA 4GK8A 1NIUA 4AZHA 4CN4A 1GGOA 3W1TA 3AIEA 3PZGA 5DFAA 3K30A 2BVYA 2R82A 1CLKA 2F2KA 3OU8A 4N4QA 1BWKA 3WLRA 3L5MA 4IQEA 3DAQA 1KA9F 4WD0A 4YVXA 3O05A 3SUVA 3VAVA 3WLLA 4A2SA 2GSHA 3GVQA 1ICSA 3CLWA 5G2WA 3EOSA 3EAUA 4H8VA 2DDXA 9RUBA 1W5PA 2WLZA 2J9ZA 4KT2A 2X7VA 2YYTA 4ZO7A 1ZHAA 2VM8A 3ANVA 2VX4A 5D37A 5MF5A 1CYGA 5I02A 1CWYA 3GNXA 4UQCA 4N9BA 3PC0A 5C2CA 3DG3A 4JFVA 5C9XA 5I09A 1J79A 1FWNA 2Y7DA 1XKJA 2PDHA 2BY2A 1TFVA 4HSHA 4RNHA 2Z2BA 1Y65A 1HG3A 2ZTKA 3U2ZA 4XTDA 1XH0A 3CUZA 1EDTA 5AYZA 2X41A 1FDYA 2DIEA 2XH4A 4GISA 4Q8MA 4YVPA 3KAOA 2H8ZA 3AFBA 1NJJA 4MAVA 3UJFA 1XM3A 3NA8A 1MEHA 3V1HA 5AC5A 4G7FA 5BNKA 1XL9A 5GJNA 1QJWA 4QAWA 4D6HA 2J78A 4F8XA 3V36A 1HGWA 1FWFC 3O6AA 3A24A 2YW3A 5D2XA 3PZMA 4ZQOA 5E9AA 3IK4A 2QCMA 5I78A 3NSXA 1NM9A 2CBVA 3PJWA 3VOCA 2Z1WA 2DIKA 4IL0A 2Y70A 1V03A 4FPSA 3C0LA 5GNZA 3PZIA 3LPGA 3GAKA 5CLWA 4XKMA 1W1VA 4PUEA 5K7JA 1MEWA 1OYBA 4G2DA 1R85A 2H6RA 4J3UA 2F38A 3C2VA 4AZ5A 4GY7A 4OHQA 3VX1A 4LUTA 3TYZA 4EF9A 3W7HA 1AH4A 5EY5A 4CEXC 3T8QA 3R25A 4DWSC 2V82A 5M5DA 3LCGA 1V3LA 1O60A 2GJXA 3ATZA 4BI7A 3BOLA 4YPJA 2ZC8A 4QISA 3ICJA 1L8NA 1SUXA 2WVSA 4MYXA 1MNZA 5AB3A 4JTLA 2X16A 4M6UA 2I1OA 2PGWA 4O12A 1JGMA 4L7ZA 2BGQA 4HK5A 4QCFA 2CLEA 1IEVA 4G8TA 3LHWA 2CBUA 4GIEA 1XG3A 1QWKA 4HPGA 4LXFA 3FHQA 3OODA 2FGBA 3HPZA 1EOMA 1EJSC 1T8XA 4QG9A 4BI6A 3G0XA 4MNKA 3W02A 4KCUA 3QJAA 1F4AA 1OIMA 3ZVHA 1S2CA 2TAAA 2BXZA 2QUVA 1FWIC 1IGWA 2Y2WA 2B4GA 1RAKA 1O12A 3TYCA 1EC7A 1MRAA 3WD2A 2OYLA 3HIJA 3WELA 3ANYA 3W01A 4LBSA 4GBUA 3BOXA 4G56A 1NH6A 3G3DA 2CLOA 3PWIA 4QITA 2ZBTA 3R89A 1KFLA 4EP8C 2WKJA 1X1OA 3WFZA 3W7KA 1B57A 1UD8A 4NYYA 2WLYA 3GFXA 4Z08A 2HSAA 5CH9A 1OT2A 1JCXA 5AECA 5G4WA 2VC9A 2QF7A 4GNKB 1BKHA 2JKEA 1UP0A 3UQNA 4R3UA 4AVNA 1D2KA 2NT1A 2XWEA 3URQA 1MQPA 2HXUA 4XUYA 2Y62A 3PPGA 4H9ZA 5CJNA 2Q01A 3AUOA 1HO1A 3TTOA 4OOUA 4HPHA 1T8QA 1ODZA 4K38A 1AUSL 2V5JA 1EEXA 4PTNA 3QN3A 3JVAA 3EWXA 3O07A 3PULA 4DJDC 3MSRA 4IZGA 2VENA 5F4SA 1QASA 1X8FA 3WD4A 3S2LA 4XBSA 3LEPA 3D5HA 2FKPA 3WH6A 1SFLA 1ADSA 3E96A 4ZQMA 4LV4A 5I3HA 4DF0A 4XKYB 3G8EA 1DJHA 3E0IA 1R3VA 4FF7A 4LYQA 3TNBA 1SYTA 2ZRXA 4B5WA 4S3DA 3TMQA 1TWSA 3KS6A 1W2PA 2QCEA 4R53A 1TWWA 1NF0A 3OBEA 1FWGC 3I7RA 1E55A 3S1UA 4DI8A 4UTHA 1KTBA 3R8GA 3CLMA 3OOQA 4XUGA 4NAFB 3EWZA 2CPUA 5HXMA 2R91A 1TE6A 4HK6A 2O4MA 4DWSB 4P8XA 4HOWA 4A35A 1TJ0A 2ESCA 4B9YA 1OFRA 4Z42C 1PDYA 5E0KA 4MB1A 1UWTA 2C6QA 2J27A 1R8LA 4C6QA 2CHOA 1H63A 3GVWA 4LRTA 1AQFA 1JRCA 3MI6A 4UXDA 5DT7A 5I0DA 2V67A 1Y5XA 2CETA 1VCGA 2ZRUA 4HU4A 4RDVA 4O1DA 4HNCA 3CMFA 1UD2A 3NIYA 4IQDA 1ITQA 4UTKA 3WNMA 2R24A 3ZVIA 4B3ZA 3W27A 4PUDA 3W83A 4CN6A 2QKFA 2G0WA 2VRKA 3WBEA 4H3DA 1H11A 5HWJA 2OELA 4IMEA 5K3VA 5C8BB 4GVHA 4MVAA 1UB3A 3R0UA 3PG8A 1GEQA 4ZO9A 1XS2A 3QZ6A 3WUEA 4MSSA 1EGZA 4Y9NA 1XLIA 4L4MA 4AHPA 2ZWYA 3T40A 2P3ZA 4CNNA 2J7CA 2GGGA 4S3AA 5I6SA 1ZS2A 3GD6A 2HK0A 3VNJA 3MMWA 2WANA 3V3WA 1K9FA 4JQ1A 3AIQA 2VP8A 4JNYA 4H8NA 4WSKA 4I9TA 4B5XA 4GH1A 2GVJA 7PTDA 1XIHA 2WSRA 6ENLA 4LEFA 1E0TA 1S2TA 4A8LA 3S47A 3WSUA 1A47A 1WBJA 1BWLA 1CX9A 1VBHA 1Y0EA 4OBTA 1PTDA 1OHLA 1C9DA 1H7PA 2E1DA 1QO5A 4GUGA 5A2BA 2OX1A 1XIFA 1DYSA 1DXEA 4Z2JA 4QDPA 1SR9A 3TOPA 1VBJA 1Q8JA 3LQLA 2EO7A 1JF5A 1ITCA 2NX3A 1KFBA 5HPOA 5EU9A 4WVXA 1WKDA 2Y85A 3M1ZA 5JMUA 3FIGA 4U2YA 1HKVA 3T81A 5AOUA 4AEEA 1I9CB 2VZOA 2PDPA 3S1GA 2OQYA 2PRMA 1IF2A 2B7PA 2CYGA 3HA1A 3SGUA 3SM0A 1HL8A 1R6WA 4WJXA 4WQ6A 2CC0A 3PBMA 1YX1A 2JKPA 3SCTA 1KXVA 4NVTA 4O13A 1KLYA 2OKTA 1LL6A 3WQEA 4HPNA 1RD6A 1M7JA 1G1YA 4F40A 3IK2A 2GDVA 3FGCA 3EDKA 3RPTA 4ZXOA 4UCGA 4LBUA 3U5UA 3F7JA 1T0OA 1R2TA 3HPXA 2CIPA 2QDEA 4Q8OA 2WMIA 2NXIA 5CZ0A 4JYEA 3DHUA 2QJGA 3AIRA 4PMRA 5FEPA 4W4QA 4E2OA 4BQ3A 3H4GA 3QY7A 1C8VA 3RLVA 4V28A 4A2RA 1J2BA 4QSFA 2HVNA 3E2VA 3M5XA 5FEWA 3VNMA 4X2PA 2EPLX 4JEQA 4PTVA 4C6BA 4LS2A 2MANA 4L65A 4GINA 1J11A 3USBA 3HM7A 1ZPTA 1J6PA 1MW1A 3B9OA 3ARSA 3W2MA 1OB0A 5AYBA 2E25A 3M0IA 5KTLA 2Y63A 3KHDA 2PDYA 1FWDC 3G6MA 3RYSA 1R7OA 3CHFA 2W5FA 4JQ2A 1RBOB 3L0KA 5DEZA 3MUAA 5LXXA 1K02A 1A5KC 2I56A 2J47A 1DIEA 4GI8A 1PX4A 2WBGA 2VVNA 3TV8A 3G77A 4H9MA 4CCEA 4FNRA 4JN7A 1FFQA 2I57A 3UZXA 1LDCA 1XYBA 3WMSA 4R7OA 3VKKA 3GZAA 5FSEC 3GB6A 3HG5A 4TX6A 2G4FA 2ISWA 1YLVA 2VMFA 3E9AA 1UOKA 1B31A 1G7UA 4NNAA 2BS9A 5AFDA 4C6PA 3MU7A 3KTXA 3ARTA 3GUGA 4DI9A 4F48A 2QS8A 2DH3A 3W7LA 3AYSA 2QV5A 2NQHA 2INFA 1JDFA 3VC5A 1QHPA 2Y5JA 5D05A 2WZMA 4S3GA 2OSXA 4WF7A 1XD1A 4F4RA 2Q02A 3PUOA 4QX4A 3W86A 4JX6A 2VL4A 3T7VA 2VEFA 3GKFA 2WAGA 2YCJA 1DJNA 3S46A 3FSTA 1EWDA 3A9IA 1TE1A 3UXDA 4F0LA 1RZMA 3W4RA 1EH9A 4AG0A 2QVHA 3THDA 1TO3A 3L5AA 1HXJA 1DHPA 3PJTA 1KWKA 1AW5A 3TSDA 4DLFA 2RDTA 3BCJA 3UWZA 3MMTA 1RR2A 4NI3A 2GGIA 3SCVA 4L61A 3W82A 5D9OA 1OSEA 2DZXA 2YDAA 3NL2A 4LVFA 3OQEA 1BRLA 3VM7A 4LVBA 1E6XM 3G0SA 1O6IA 3TZNA 1XCFA 3VIKA 3VVGA 3GTHA 2WNZA 4BEUA 1BG9A 1C93A 3ITCA 2GLKA 3B06A 3IPWA 3EB2A 1BHGA 4KGLA 3H7VA 1KCXA 1Z3NA 1MUWA 2V5KA 1UIOA 2PDUA 4IICA 2WW5A 1IZKA 4FB7A 4UTWC 1MWOA 3P74A 4Q8TA 3TXVA 3GBDA 1JCLA 5BZAA 3SY8A 2ZE3A 1Y8BA 4DUVA 3TYAA 1B5TA 2PCEA 4BF9A 1NDZA 2Z6JA 4HTYA 3S6DA 1A3WA 1O5RA 1EXPA 2DSZA 4PR4A 1OC6A 3DI0A 2DZPA 2PWGA 3IRDA 4DWSD 2Z27A 4MGGA 4DHGA 4P2VA 4ERGA 3N1AA 1O1HA 3H23A 3IARA 4Z2HA 1EC8A 3QYSA 5DRIA 3K8LA 4LVDA 2XSAA 3VFLA 1G4TA 3R1ZA 5HUOA 3WF4A 2RDUA 2PWEA 2WCSA 3V5FA 3MMUA 1YDYA 4PCPA 3GTIA 1H7RA 2WMIB 4V15A 1AH3A 2Z29A 3P82A 4US5A 4ZQRA 4NKCA 3CQIA 4I7UA 1J5SA 1YTKA 2DUXA 4AZ6A 3MB9A 1UPMB 4M56A 1TJPA 4XVDA 1LOLA 2OOGA 4GMEA 3CB8A 1S2AA 4RK8A 2P0OA 4UQAA 1CPUA 3HU7A 2D0GA 4DXXA 3PK7A 3ITVA 2WNNA 1W3TA 4K8EA 2NV2A 1HUVA 2PDFA 3B0XA 2WM0A 1OZMA 2ZUWA 3W71A 3IANA 3OHIA 4L80A 1B3YA 4BK9A 3BAYA 3AIVA 2QUUA 3DENA 1C7SA 1W9DM 3YPIA 1CNVA 3MP3A 5AYYA 3PBWA 4Y8FA 2XM2A 1GVIA 3CV7A 3VM5A 2BV9A 1M41A 2XH0A 4GQQA 3FYPA 3L12A 4ZR8A 4ZVJA 2OJPA 5G2IA 2XWDA 1LOSA 3F4WA 4WK9A 3CQKA 2Q6ZA 3VX0A 2ZRYA 3ARUA 3Q4DA 3VIMA 5JBDA 4RE3A 2WJEA 1NAL1 5T9CE 3S83A 2ZYFA 3D6NA 1W3JA 4LPCA 3EPMA 4GI9A 4WUIA 1I4NA 1OX4A 3G8RA 3S1VA 1SW0A 1RLDA 2J25A 3AI0A 1ICQA 1XLGA 3O6CA 4W8LA 3AOFA 3OZYA 4RR4A 2NSXA 1ZGDA 4K36A 3U2EA 3GUWA 3QR3A 5CZSA 4OECA 4LCQA 1HIZA 2VX6A 3Q94A 3E74A 3MHGA 4C1KA 1UIPA 3HQNA 4FXSA 2BASA 3LBOA 4KBXA 4TXEA 4EE9A 4X9YA 4HOZA 4DJFD 2D1ZA 2W0UA 4H19A 4KRTA 3FDGA 2W66A 1IWAA 5FJUA 4IUGA 1XFBA 1CGVA 3AQUA 5XIAA 4D6EA 3U0HA 4Y9MA 4DIAA 2YIHA 4C5YA 3WQOA 4GUFA 4HZ7A 2OO6A 2QGYA 3DBNA 1R3TA 3KVLA 2QCDB 2G3NA 2DT1A 1X7FA 2WSKA 2P88A 1RA0A 1NEYA 5A1AA 3PSVA 2VC6A 5TBOA 2X30A 2V0TA 4L64A 4EXQA 3OVPA 4ZQNA 4GVGA 3N2OA 4AWSA 1ME9A 1VFHA 3FJLA 2QUNA 4W87A 3V0TA 4Z17A 2RGMA 4LSBA 2V3DA 4BF7A 4C6IA 2EEXA 1OC5A 1AZ1A 2O4QA 1IGSA 3GC2A 3VMNA 4DNMA 1OF8A 3E0LA 1K8ZA 4O0KA 1LUCA 3PBVA 1J0IA 3LHYA 4XV0A 4D8AA 4IXXA 1JD7A 5CJ5A 4JTHA 3TN6A 1TRIA 1XSKA 3P93A 3ID7A 3UJRA 1Z7AA 4RDYA 1YDOA 2ISDA 1B9BA 3PJXA 3GC5A 3VNYA 4ILSA 1KV8A 1OABA 3WQ6A 5JBFA 2FH8A 1M5WA 2BBFA 2Q3OA 2OODA 1P6CA 4FNQA 1US0A 4IG2B 1Z89A 2VEMA 4O14A 3S6OA 4I5XA 4RE2A 5AHFA 2PP1A 4UZUA 1EA0A 2D69A 2NXGA 2E40A 4XAYA 5I3DA 3BGGA 4K3ZA 4QBXA 1UJPA 3EX4A 3SJ3A 2P10A 2PTDA 2EQDA 4CLMA 3HF3A 3AU6A 1KCLA 1IT8A 1RA5A 1DP0A 1EJVC 1H61A 3V1PA 3NQFA 7REQA 2X0HA 4P7NA 4DEFA 1SZGA 4Q7IA 3KWXA 3O1NA 3MSYA 3WBWA 4TX9A 3S9YA 1VJSA 1WUFA 1NWRA 2VFFA 2BMBA 3LRLA 2XGBA 3WJZA 2YKKA 4M1BA 2HVMA 2XDFA 4RKAA 2NT0A 2I17A 4Q8NA 2ZRWA 1VQTA 4DUWA 1FP8A 3TLLA 5D30A 5U4NA 4ES4A 3OLIA 4GJ1A 1ITXA 4QS6A 4DM1A 2J6VA 3ES8A 3RO6A 4KFNA 3T1GA 2DJXA 2FTYA 3KX6A 5HK4A 3EDFA 5KZEA 1PDZA 3W1AA 5I77A 5C71A 4HHHA 2YX0A 2RUSA 5DBTA 4CCDA 3PZTA 4O15A 5CPNA 2VCBA 1E6PA 1JZ5A 2DT3A 1GOKA 2VYOA 3U48A 3W7IA 5AC8A 2PWUA 2Z2AA 1B3VA 1NU5A 3ZM8A 3CV6A 3WN6A 1KRAC 3QM3A 4GYPC 4IHCA 4K6AA 1PHQA 3BG9A 4FLSA 2FPTA 4XD4A 1FA2A 3TTYA 1BPLB 3Q2DA 2HVOA 3C52A 1HN1A 3GE7A 4QJ5B 4F3HA 3PTDA 3UPWA 2I14A 3PM6A 1RSCA 3DC0A 3BJFA 1T40A 2Y61A 1Q7ZA 3PBYA 2GJRA 1OM0A 1MW0A 1ONWA 3W2KA 2PZ0A 2V2HA 2V81A 3UZZA 1GQLA 4OT7A 1QFEA 3STFA 3AC0A 3W6MA 3L2IA 4LAZA 5AYXA 2FFCA 2Y88A 2R1PA 1W5QA 4IIHA 3BG5A 4HNVA 1K9TA 2GSJA 4YLWA 3F4CA 4U10A 4IJBA 1SJBA 5BRQA 3G3MA 2YFOA 1ZJBA 4I9JA 3VE7A 4CUCA 4F0SA 2J24A 5JQ9A 3LB0A 1QOXA 4PMYA 1J96A 1YRRA 1PYMA 1VYRA 4XZWA 4PUJA 5CAHA 2DW6A 1JPDX 3IIPA 1K6AA 3CAWA 1I2NA 1BVNP 3WQCA 4LAOA 4ZTYA 5I3KA 2ZUUA 3UR8A 4AIOA 3Q37A 1DQUA 1HX0A 1UQZA 5D2TA 3L2LA 2ACUA 4Z2LA 2PRHA 3D3AA 3FHAA 3P8IA 2Z1KA 3I68A 3F4VA 3VD4A 2R9RA 1PBGA 3UY8A 1R3RA 3C86A 5ABFA 5G4HC 1J8VA 3NQCA 1DQWA 4R5EA 3MA8A 2POTA 4YNGA 3GDKA 4UFLA 4MB3A 1WBHA 2BZNA 3OYXA 1S1RA 3LLXA 4LUSA 3LLFA 2VKZG 1IXOA 2ZX6A 2V3GA 5ABTA 1OCNA 1E4LA 4U28A 3U6WA 4J3TA 1PE1A 1JCYA 3CWNA 1GQNA 3NQMA 3T78A 1TV5A 4GQ0A 1L6YA 4MNMA 3G1SA 3LM7A 4GQGA 1QHOA 5ABGA 3C6CA 1UR8A 1A0DA 3WIJA 3ARWA 4LAMA 2CBJA 2C18A 4F2TA 5C55A 1HP4A 3W73A 2NVAA 1JDAA 2FHBA 4H00A 2QCLA 1XLKA 3BSGA 1EO5A 2YYUA 2C1IA 4J2MA 4OUIA 1OGSA 3LGDA 5IFPA 4P61A 3MCMA 1H41A 3LCFA 3CZJA 2VFHA 3GQYA 1OGGA 4TOQA 1BAGA 1I1WA 2Z1VA 4C6MA 2FZDA 2VD9A 4JIEA 5AVNA 1MZHA 2VX5A 1UWIA 4B9ZA 5ABHA 3WF2A 2NUYA 4M19A 2X42A 4M81A 1K70A 3SN4A 3AIWA 4ZB2A 2CLKA 2QJMA 1DBTA 3AIUA 1LBLA 2YXXA 3MV11 3VE9A 1HJUA 4MLJA 4AEOA 3R8RA 3QFWA 2XSBA 1R46A 3BOFA 2PODA 3NJ3A 1PTAA 5A69A 3U5YA 1F6YA 4BF5A 3UT0A 2B31A 3OVGA 3WQDA 5CC6A 3RPDA 2PRLA 4AZGA 3GXDA 4EX4A 2C1GA 3TDFA 2J4GA 4MFDA 5AYIA 4WEVX 1JZ6A 3MO4A 4QE1A 4DJFC 3T6CA 1NFPA 1Q65A 1VS1A 1J93A 1VBUA 4QJ3B 1EHAA 1WKYA 2OZ0A 2GQ8A 5TQLA 1GKPA 3N6HA 4CGTA 5FAJA 3V16A 4ORMA 1UMLA 4DLMA 4J7RA 4X0VA 1KR0A 3QVQA 3DDMA 5H91A 3M0XA 4GKLA 4FNPA 2RH9A 3GNOA 4PC8A 3BLLA 1PTGA 4AD4A 4EWND 1W8SA 1KKOA 3G1RA 4CU7A 4LW7A 3E12A 1XRTA 1VBRA 3LXCA 4MWAA 3F2BA 1W3HA 4DO5A 1JPHA 1ZCOA 3M6DA 5I06A 1ONRA 2PLCA 4NZJA 1AQHA 4TV5A 4YTTA 3L7RA 1EPXA 3G5EA 3GW3A 3C56A 3QMTA 4YJ5A 4H1ZA 1FUYA 3BCFA 4WOQA 1MDRA 1Q6EA 2NUWA 3BW4A 1EZ2A 3TTSA 3ZJ8A 2ZRVA 5MKGA 4QCEA 5DCDA 1W32A 4Q3MA 3TNOA 4ZE5A 4BR1A 1JD9A 1A3HA 2WNWA 1OYCA 1GNXA 1KR1A 4Q4RA 4LRSA 2YDSA 3CB3A 3RR4A 3GIYA 4NHVA 1L6GA 3TR9A 5A6MA 3SAZA 1E1FA 1E1CB 2J79A 4EPDC 4YTRA 2Z4GA 1J0JA 2OEKA 4HBKA 4R34A 5EKYA 4ZSUA 3CO8A 1NQKA 5DY3A 4DBWA 2BY0A 3B9NA 3ABZA 3N2XA 4Q8QA 3LK6A 4Q4SA 1FY6A 3M0HA 2PTZA 3EDJA 4O11A 2J77A 3DCPA 3EKZA 5FJOA 2Z24A 3BLKA 4OVXA 3LGEA 4OIFA 2VZVA 1G7VA 1Q63A 1GHRA 4LQ1A 3LU2A 2HPIA 3IGSA 1JCNA 4H7CA 6TAAA 2WQPA 2V3EA 1FHVA 1EJWC 3RU8X 3M64A 4QS5A 2Z00A 4HU3A 4GCXA 4GHRA 1DWAM 4PRRA 3OVQA 1SR0A 1V6TA 1CXEA 3WDQA 3VD7A 2DVUA 3N9RA 4WDWA 3GKAA 4P5UA 4TVDA 1U5HA 3H55A 1UKSA 4QP0A 1V6WA 5CZKA 3EXRA 1XX1A 3THQA 1YMYA 3P14A 3TROA 3LERA 3UD6A 4DBUA 3B97A 3SRKA 5IM51 3SRDA 1CGTA 1ZJIA 5F2MA 2VEKA 1XD0A 2JGYA 1E9LA 2PSNA 3UR2A 2WHMA 1OJXA 2Z7KA 2QR6A 5F1UA 1TVLA 3LBMA 3JW7A 4Z2IA 5F1VA 1KM2A 4J3SA 4IFRA 1VGAA 2DSVA 3RUBL 5CPTA 3INPA 1A4LA 1HJWA 5LIYX 3WY1A 1OFDA 3LXAA 4UMAA 3ZOAA 9CGTA 1UR1A 3LZ3A 2VELA 3BAWA 3UEQA 4M6VA 2DZBA 3GW0A 3PNZA 5EMJA 4HHPA 4JPGA 4GVFA 3W7DA 1PZ1A 5DXXA 5HUPA 4DZIA 3VXGA 2C16A 3G24A 2JIEA 5CZJA 4W7VA 4F2UA 1XRVA 1W6TA 3B8IA 3TN4A 1UD5A 3P62A 1B4KA 4GZEA 4LTSA 4CD4A 3WEOA 3N18A 1SZFA 5B80A 2WVVA 2PDGA 5IXEA 3CUJA 1QW7A 3TAKA 1DKWA 5KETA 2J88A 4K39A 3WDRA 3MCOA 2V2DA 1XICA 3Q45A 1TTJA 1ZAHA 4KMQA 1V0NA 2DIJA 4CQ8A 1J10A 2VC5A 1EYWA 1XPGA 1N8WA 3KLLA 1TSIA 5L9FA 5KITA 1SFJA 2QAPA 4BY3A 1P7TB 3WYZA 5M03A 1EX5A 1L6WA 1Q8AA 3ORWA 4Y2WA 1Q6CA 5AVHA 4ZB5A 2BVDA 4TVUA 1KM6A 4IL2A 2JFEX 1QI0A 3WNLA 1GG1A 3O0KA 5LIKX 4FR6A 1MXGA 4ZBCA 3E0VA 1YDVA 1KD0A 4AD1A 5B7ZA 2XN1A 2E09A 3RO8A 4NXKA 1WAWA 2PDWA 1JUKA 1F3XA 1H1NA 1PVNA 2J8GA 4IMAA 3W9ZA 4BQ2A 1OK4A 2Y7FA 2IKIA 2HBVA 2Y6ZA 3H2EA 4WRHA 1ELSA 4M82A 4EPBC 2ZDRA 5CEWA 4S3CA 3QXBA 4QE4A 5C5YA 3G2GA 4W5ZA 2D73A 3NEVA 2E0PA 2DSKA 4I6KA 1GVSA 4D6GA 3U9IA 1PO9A 9XIMA 1GQKA 1NOUA 1W91A 2J62A 2O7SA 3SN1A 4JFTA 3LSCA 3PBUA 4WSJA 3WQ5A 1E73M 4JDYA 3AS3A 4JXCA 2PP0A 4W89A 5H8PA 1V7AA 4C6CA 3THAA 3AMCA 2ISFA 3HG2A 5IRPA 4EPEC 5A8PA 1FCBA 3AIBA 1SZRA 2PGEA 2FIQA 3WNOA 3NOEA 4E4PA 3WMBA 1O66A 1UZ1A 1HP5A 1XGZA 4F2BA 4LUYA 2V5LA 4M3PA 2OLHA 1Z9AA 3NG3A 3OG3A 3CU2A 2OG9A 4B2DA 5JVLA 1QK2A 4WDXA 5CBJA 1NFGA 1MXSA 1TV8A 2NSOA 4IIFA 4GCAA 4QJ4B 1PSCA 3K1DA 1V3MA 3CUFA 4V1XA 1W3NA 1JVNA 3QQWA 2CLPA 2OB3A 3W26A 4M24A 2CZ5A 2OGYA 3VNIA 4MAZA 4ENLA 3M9YA 1SU5A 3OG2A 3DFTA 1XDMA 2JGQA 3I4EA 5ENLA 5BCAA 1DJZA 4B5NA 5HMDA 1W9BM 2OX4A 4EXBA 1JXKA 2HDJA 4J3XA 4DX3A 3A3XA 1HQTA 3GG7A 4GUHA 3UERA 4ICMA 1FXPA 5C2XA 1VFSA 5KEZA 3VIPA 3CUIA 4JX5A 2VVSA 4D1JA 2RDXA 4C90A 2D0FA 5E70A 1W3KA 2V8ZA 4UB9A 1IZJA 1DL3A 1R3SA 2XVLA 3RCNA 1XYLA 1B1YA 2E1WA 1U83A 2Y5EA 3BANA 4RXFA 3W1MA 1TCDA 3IJ9A 3PFRA 3R0KA 4GIAA 3RRAA 3OVRA 1OWQA 3QW3A 3KBSA 1TZZA 4BA0A 1YE4A 3M5VA 3ABSA 2NQZA 4QTGA 4XBKA 3LS9A 3MKCA 3ARVA 1OT1A 3GVRA 4GX9A 1GKRA 1JQXA 9XIAA 4PCTA 4X60A 4FIRA 3O6DA 5KINA 3M7SA 2GOKA 2EXOA 3W6LA 5AHMA 4PUUA 1AQMA 4PB4A 1JG9A 1UWAA 4GOAA 3VZYA 1MUCA 3NURA 1QI4A 2HK1A 3BWWA 4GXMA 3KZSA 2HXTA 4HU0A 3MZ2A 1UH4A 5D03A 4O16A 1PPIA 2OWWA 4NF7A 4NIRA 3SY5A 5FJRA 1V77A 3K2GA 1VEPA 2CLMA 1Q13A 2C1HA 2XFFA 1V8EA 1U5VA 1QU4A 4A3RA 4D6DA 2QGHA 1WKFA 2YXOA 1TA3A 4O0ZA 1ALDA 3BK0A 1TA3B 5I7GA 4O4WA 1G6CA 1Z32X 3L2MA 3SCRA 4K2SA 3BLOA 3MDWA 1CLXA 5FEXA 1JF6A 2VFDA 1XBVA 4ZEPA 1KBLA 1NWSA 1VH7A 3AYTA 1KXQA 3RM9A 4PMVA 3W38A 1ZJAA 2A2IA 4O57A 5DELA 2FVLA 3M41A 1LT8A 1POJA 1RPXA 1V4YA 2WJDA 3ABOA 4HZMA 3RX3A 1LBFA 4NAFA 2QHAA 3LNPA 3MP5A 1JYNA 2J7GA 4NRSA 1H5YA 4IX2A 3P8JA 3BJTA 4QAIA 3KRSA 1LOQA 3GDRA 1HJSA 3V0UA 4LGXA 4JCLA 1K7EA 2DVTA 4QFUA 3TKFA 3VPLA 4FIQA 5IHRA 1MW3A 3WQGA 4D6IA 1KQZA 2ZA1A 3WNNA 3HMCA 3L23A 4MJ4A 3W37A 4ACZB 1W1B1 1DE6A 2DJLA 3RLHA 3SO7A 4DJDD 2ONEA 2PE4A 4NJIA 1IQ8A 2EKGA 3EA3A 3IIOA 3MSDA 2OCZA 1QOPA 3M0KA 1P48A 2BLEA 5A6KA 2KZHA 5G1MA 3DI1A 3W22A 5CJMA 2XTKA 3A47A 4FSAA 5DY2A 3NCOA 2INEA 1NVMA 3UCDA 4JOMA 5J8LA 5CC5A 4C7DA 3PZQA 3H70A 3TWAA 1B4EA 1H50A 5BYWA 1O7AA 1WOBA 3R4IA 3VO0A 1MZRA 2QJHA 4IMGA 4RNIA 4CKQA 3I4KA 3ZMRA 1C29A 1LORA 3K1GA 3POHA 4Q4QA 1P0DA 4I90A 2DUZA 1BFNA 5M17A 1XYAA 4MJ2A 4UFKA 3P0XA 3PAJA 2X0YA 3K5XA 2HS6A 3R0DA 2BHZA 5I00A 1D8CA 1NP2A 1GVEA 1WXJA 5BROA 5I03A 1TR9A 1W1YA 2BOFX 3N6JA 1H0IA 1F74A 3W1QA 3ERPA 7ODCA 1K03A 1LL4A 5A8MA 1V0LA 3FAXA 4DZAA 1BXBA 1XDJA 1KTNA 4W88A 1Q4NX 5JUVA 3SURA 2XVGA 4QLLA 1X1NA 1H51A 4KEUA 2XJ7A 4BS0A 3DKJA 1R3QA 1CZ1A 2FGLA 5EMMA 3T55A 3B4UA 2UBPC 5CQ1A 3EMQA 2PURA 3QKEA 3FK4A 4Y9AA 4N6FA 3CZGA 1EBGA 1EHNA 1LCOA 3BZJA 3MPGA 3HQPA 4X3ZA 1G4SA 3DEQA 3N9KA 3R94A 1UBSA 1SMAA 5HNNA 5E0FA 3PTKA 2PP3A 5A8OA 1VCFA 4O1CA 1H7NA 4PTMA 2YJQA 1AG1O 2FDMA 4H4IA 4JX4A 3ITTA 3GC4A 2ZTJA 1YPIA 1XLJA 4Q22A 4IP5A 4JYDA 3WH9A 4LALA 4L1WA 4JD4A 2PC8A 2I7GA 1XFCA 3TC6A 8RUCA 3LZ5A 2A3CA 3AMKA 5JBEA 3P6LA 3W1RA 1KM1A 3OIXA 4KQNA 4YCPA 4K37A 5E5CA 1AFSA 3WJYA 3QV7A 3SRFA 1GCYA 3UXAA 4PMOA 1LBMA 2XSXA 4NYUA 3CK5A 2NQJA 3B40A 2BOGX 3ZO9A 3WLJA 3FYOA 1P4CA 3RJXA 3RITA 2GFTA 1H49A 1UHVA 4KWWA 2G3MA 1FOBA 3WQPA 4ERAA 2PC4A 4DBDA 1WDQA 4WLCA 2P8CA 4D6JA 1VFTA 5H2ZA 3AXIA 4ATLA 1OX6A 1UJQA 4JKLA 3W7MA 1WKEA 2DORA 4L9ZA 3VMOA 5HNRA 2YBUA 5K4XA 2J7DA 2PDCA 2J9YA 3IV3A 3FDKA 1V5XA 4JIQA 1EYEA 4YWIA 3R8HA 1FWRA 2TMDA 4KH2A 2JEQA 2WVTA 3OBAA 2JF7A 3W00A 1EKOA 4KEZA 3TFCA 2Y1HA 4C6DA 4BI5A 4TMBA 4NT0A 3L9CA 5C6MA 1YDNA 4PCFA 3HB9A 4GA8A 3NZQA 4DO4A 5KZ6A 4QM1A 3QTGA 4AH7A 3Q67A 3KBWA 4KRUA 3VD9A 1ISXA 1NSJA 2C7FA 2G3JA 3EPNA 3TC3A 1R47A 4XZHA 1BD0A 3GIPA 4FI4A 5C70A 1W5NA 4I5RA 3PNUA 3FKKA 2ON3A 3GXMA 2VGIA 1VLIA 4MKVA 5I3GA 3MYOA 3VKAA 2Y24A 1S3HA 2O9PA 1WOAA 3VNDA 4IFKA 1KFEA 3W7NA 4JZ5A 4LC8A 3O6YX 4QDMA 4PFHA 2VGGA 3HOJA 1I6NA 3FEQA 5A5WA 2WPGA 3A3WA 2BHUA 3BC9A 1UWUA 5HR6A 4RZ4A 5A6AA 1SJAA 2YL6A 4CNTA 3K4AA 1UZHA 3IEBA 3DUGA 2WHJA 4EPKA 1KRCC 1GVFA 1ME7A 4IM4A 2CXGA 1E6QM 4J9JA 4RPQA 1SVDA 4O52A 2JF6A 1V79A 1E0UA 1TJ1A 1VYPX 4MFEA 4CCZA 1KRMA 3NPVA 1WP6A 3BAKA 1IT7A 4K7VA 3V18A 2DW7A 3EKLA 3CASA 1Y7VA 1FTXA 3FS2A 4TX8A 2E6DA 4XAGA 1HL9A 3DFPA 1T99A 5F2GA 1Z48A 1WXYA 1UMYA 5BOEA 2D2HA 3KCLA 4PL2A 5CAKA 4DWDA 1FWHC 2WK2A 5FF7A 1JXJA 5G1TA 3MCNA 3GG0A 3W88A 3LM3A 3UWVA 4M6PA 1I1XA 3EEGA 4Z0JA 3H2OA 3LCWA 4AB4A 3KCOA 2PLJA 1UR2A 2FHCA 3TAOA 3URNA 2VUNA 3M7WA 5I3JA 1XP3A 2F6KA 1QNQA 4B5VA 1D8WA 2ZXQA 3C2FA 1DTNA 3H2FA 2O9OA 1DQXA 3W3OA 1NFBA 3LSBA 2OFJA 4RPPA 1KW1A 3HV9A 4MNJA 1VZWA 4O17A 5C7VA 1C8YA 5C2GA 2VFGA 3L0GA 1HO4A 3IJQA 2YZ5A 4LT9A 3AS1A 4FX7A 4PULA 1E3XA 1UZ4A 2XFWA 2IS7A 1ZUAX 1FDJA 1TX0A 3QW4B 3WK1A 2PDJA 3UETA 3WBXA 1XUUA 4AZCB 1XLDA 1W9PA 3TYDA 4LY8A 4D8LA 1RCQA 1BVWA 2CLLA 3BLFA 3T0DA 1O5KA 1K8XA 1XWYA 1U33A 4UZSA 3KL3A 1UC4A 1DJWA 4BJHA 2YW4A 1GKQA 1DOSA 1RP8A 1TYGA 3UWQA 2A7PA 3BSMA 4DJDA 2VTFA 3R7MA 4AY1A 1KQYA 4G5DA 1TPB1 3GZ3A 1MSSA 3UU0A 2A4AA 3LI1A 1QATA 3GRIA 3KP0A 1S5NA 2F8QA 1RH9A 3T2QA 1O5QA 4GQRA 1EJUC 5G1YA 3E2QA 3WUFA 1B2YA 2PCQA 1EP3A 4BZYA 4AD3A 4RDZA 2GUUA 1AK5A 3U8GA 1E71M 2VFIA 2WWDA 4DJEA 1S38A 2E8YA 5JH1A 1FKXA 1V7YA 4HNLA 3WL1A 1PX8A 3O8AA 2O56A 4B5UA 1OK6A 3CQJA 4LBRA 4DXKA 2OXNA 3ZLFA 1W1A1 1IEWA 1VPYA 4IJRA 1K8YA 4ZQCA 3OB8A 1NARA 1OQFA 2JEPA 3W87A 4GYJA 1PX3A 2FZNA 1QW9A 3KBMA 4S3BA 2AL2B 1PAMA 2RDWA 5KMYA 3BG3A 2RAGA 1WZAA 2GGJA 2XN0A 1BG4A 5F2IA 4LOCA 3GFYA 3RFAA 1IXNA 1EJRC 4Q33A 1W9UA 5IBXA 3T8LA 2GVGA 4IQLA 3IJ8A 2BTMA 5D8ZA 1BTCA 2NUXA 1EQPA 1JAEA 3ENLA 2Z1XA 2OMAA 3APGA 4UNLA 2EAWA 1XCXA 2HRWA 3I3EA 2OT0A 4HK7A 4B90A 4XZMX 3CT7A 3QHNA 3C3NA 1NP0A 3I10A 2GWNA 3T2PA 4M8UA 1QK0A 3ES7A 4XQ6A 3S5SA 2Z1SA 2Z2UA 3FXGA 4P7QA 1MFUA 3TCEA 2ZUTA 1FX6A 4X22A 2VDGA 1EBHA 3QYQA 1OFOA 4Q4MA 1YNYA 1MVYA 5I07A 3NQ8A 4DUXA 1OFPA 3T0BA 2D0HA 2I9EA 1V08A 4FALA 4PE8A 4GNJA 4RZ6A 3A23A 3CHVA 1XLFA 3LHZA 4UFIA 3TQVA 3UZWA 3HFYA 1LRNA 1PKMA 3NPXA 3UW6A 4US6A 2W91A 3C2YA 1ZBCA 4NRRA 1EPVA 1UP2A 3BV7A 5BWAA 4AMCA 4JYFA 3B05A 4RV8A 3PVFA 2VOTA 1H4PA 3N4AA 3M6YA 4Y6GA 3BDKA 5FAGA 3NSNA 3S8HA 3OHMB 3RX4A 4ALDA 3O06A 4PGLA 2ISVA 2E4TA 4AXNA 4CNSA 4CNUA 3LCHA 3TW9A 1ENUA 1Y5WA 2FMOA 5LZLA 1QPKA 5CGTA 2G5WA 3NM3A 4O10A 4PZVA 1A53A 1PHWA 3CEUA 3F5LA 4GFSA 3EWDA 3IIZA 3EA2A 4GG9A 2HROA 7REQB 3NQBA 3WD3A 4B2DD 1TJ2A 1KNWA 4M7TA 3AXXA 1GZGA 1PIIA 3GU1A 5K4ZA 2ZDSA 2WMGA 3E6EA 3U2CA 4OOZA 2YCIX 2AL2A 3VOIA 2G3IA 1XYCA 1XGDA 4AFYA 3L4WA 1BGGA 1F05A 2QMJA 4ATWA 4MWAE 3TW7A 3EWCA 3DYPA 4B5TA 2FB3A 3KL5A 2TYSA 3G6LA 3O0FA 1E1EA 4A8RA 1QR7A 3L65A 3SCUA 6CGTA 1L2UA 5EFFA 1QXLA 4UFHA 3GXIA 3QSTA 1KCZA 4C1NA 4L56A 1M7PA 3RRXA 4U33A 3BMWA 2B7QA 2FZBA 2E8ZA 3AS2A 4A21A 3OYZA 1AL8A 2E9MA 5LA2A 1EF2A 5HDRA 2GJPA 1KFCA 2QW5A 6A3HA 4N2YA 1EXBA 2WWCA 2ACQA 3TLQA 4REQB 1X6UA 2X2YA 4A05A 4GGHA 2AQVA 4M7SA 3TZFA 4POCA 3N2BA 4C6JA 1Q7QA 4UTMA 1WXZA 4F79A 3T07A 4D9PA 5HQEA 2WSYA 1UKQA 4J28A 3NQ7A 4XAPA 3HQ1A 1JULA 2X09A 3VYLA 1BSIA 3QTPA 1ZBWA 2GJNA 3AZRA 4PEKA 1QPNA 3UPBA 1FWSA 1V6XA 4ZA0A 5D09A 2ZX9A 4JIRA 2NW0A 1O5XA 1F3EA 3W7QA 4C7GA 3G22A 4G1KA 1J12A 2IPFA 1A5MC 2AKMA 4UFMA 4HVXA 4I9AA 3R12A 3REQB 1S46A 1WYIA 2D20A 4ADTA 5BXTA 1DE5A 1TPDA 3L5LA 1XBXA 5BMWA 1Q5MA 3TR2A 1XC4A 4UQDA 3QOKA 4FP1A 1VCVA 2DSWA 2W6RA 3LNMA 2C0AA 1I45A 3S9IA 4WR3A 1ICPA 1H5VA 1RCOB 1TVPA 6XIAA 1FCQA 1TPH1 3IVSA 2YGYA 4BHYA 2DPEA 4LV9A 2VXNA 1YYAA 1BLIA 3KEHA 1RQBA 2GUBA 5AKQA 3PZOA 1TRDA 4PEEA 1F07A 1E9ZB 2BXYA 1WNOA 3QPZA 2WSPA 3QFEA 4E8CA 1TV7A 1I75A 3EKGA 3NO3A 2WMHA 3QQ0A 3QY6A 2WO5A 2J7EA 1IXPA 3N2CA 7TAAA 3UVAA 2ZA2A 2VFEA 5E6ZA 3ZFHA 1CGYA 2XPKA 3TA6A 1LJYA 2X05A 1MQQA 4IJCA 1XH1A 2BWGA 3BVJA 2PDBA 2OLSA 1EIBA 3W72A 4UR7A 2P0IA 1U2YA 1VKFA 1WZKA 4KF1A 4H2HA 1J5TA 1MW2A 5H1WA 5DANA 1KTCA 2VEPA 3SZ8A 4J40A 4W8BA 2EPNA 1OD8A 1VEMA 3F1QA 2VOMA 1UD3A 2XZ9A 3ALGA 2P1FA 1A4MA 3IS4A 3T0AA 1F76A 1CCWB 3VZXA 4GWEA 2EBNA 2GUYA 2ICSA 2KAUC 1KXHA 4QG8A 4GE8A 5H6HA 4LUIA 3ITGA 4PTXA 1UUOA 4UOJA 1UD4A 1V6YA 3PB2A 1Q2SA 3A5FA 1ZLPA 2P50A 1GYMA 2W62A 3B9DA 4IMFA 1YBQA 2QYGA 4NQ1A 4MJZA 3IVTA 1UYQA 5D2YA 1QNVA 2W92A 3DYMA 1GVOA 3WH8A 3OEXA 4U3CA 7XIMA 3P5ZA 4BKNA 1UASA 1XKYA 3BMXA 1HGYA 1K7XA 1PUDA 3SFKA 4XIMA 2ZIDA 1MRQA 3UCQA 3TQKA 1UR9A 2VURA 4MNLA 1LTDA 3L4UA 4JCMA 2YL8A 3ZLHA 5GVJA 2AAMA 4GO9A 3T08A 3ZJKA 1AVAA 1P0KA 1V6UA 1VBGA 4YHEA 3PPCA 3FY1A 4V2XA 2OT1A 3VI2A 3NOYA 1QUMA 4CEUC 1MI3A 1R2RA 4K8GA 3EOEA 1I0BA 3QPEA 5LNSA 3W25A 4A3UA 4ZFMA 5KZDA 2UY4A 5HINA 1XV8A 3UNDA 4MADA 2EPHA 4DBSA 2J8FA 1I2RA 5LNUA 1BWVA 1VEOA 2FJKA 1XIJA 1Q6QA 3WJWA 3MBDA 1KGUA 3PN8A 3CAQA 1BVZA 4XVEA 3EX3A 2E67A 4GUIA 3U7BA 1WZMA 3H8AA 4Q6JA 1IEXA 1QTWA 1QNRA 3H54A 4YL2A 3ATYA 4S39A 2H3DA 1XC6A 5E09A 4IT1A 4B3LA 1E0VA 3JZEA 1R2SA 1M3UA 5DCBA 4MJMA 2QCHA 4W86A 2XIBA 3GM8A 1WZLA 4HP5A 3JU2A 3RILA 5LA1A 1RV8A 3UG3A 1M6JA 1G69A 1PKYA 2PWFA 3LQGA 3DECA 4FOUA 3W23A 2Y5SA 3C4UA 3UG8A 3QY8A 3FYYA 5L6UA 1EFZA 2NQ9A 4AZ7A 4EXAA 1LLWA 2I5QA 3WUBA 4Z1DA 2W61A 3W7OA 4GLEA 1QPQA 1K1DA 4TUFA 4QNEA 1X7IA 5BU6A 2OEJA 1BKSA 3T9PA 3VNZA 3STGA 1XBZA 2PDKA 2DZSA 2D23A 3AU2A 2FTPA 3W1NA 5FL0A 5T9BG 3L4TA 5JIWA 3KE0A 1SW3A 2A7NA 1J01A 3DXIA 3APTA 3NNTA 1XINA 3WKZA 1E0WA 1P7TA 5LNVA 2J8TA 3BMVA 4OTKA 1EC9A 3VDCA 1DVJA 2EPKX 5DMYA 5HOSA 6PTDA 1SQ7A 3VD5A 3EXTA 5G4EA 3AAMA 4DO7A 1GORA 4PUMA 3LTPA 5FJPA 5DBUA 3QF0A 3OLDA 3E38A 1YXCA 2CLFA 5T26A 3Q58A 4K1WA 5HMFA 4QG6A 7A3HA 2DVXA 4F0RA 2QMKA 1J4EA 3KRZA 3MI2A 1BYDA 2PUZA 4MPKA 1WDWA 2WVVB 3UR5A 2ZUMA 3W70A 3ZWSA 3B4YA 4IIGA 2JKAA 4AWUA 3BUVA 4MMWA 2ZKMX 3MY9A 5FKYA 4H6QA 4IGSA 4PTWA 1FDZA 3SQSA 1Q6OA 2BGNE 5FF4A 2V69A 1UR3M 1W9VA 4K68A 3OPSA 1EQCA 4JTTA 3CIXA 4HJWA 3LGGA 1J0YA 1AW1A 3XINA 1VF8A 2NQ5A 1ZJHA 3EPOA 2X1SA 4HCDA 4HNTA 1ZAIA 3VUPA 3RF9A 2PD9A 2BY1A 1ZRQA 2RFGA 2IKJA 4DN1A 1LG1A 2VEGA 2FZ8A 2J7FA 2B7OA 2HMCA 3QH2A 1W1IE 2E68A 4N6EA 1SO3A 4K8HA 4N9EA 4QDWA 2POZA 2VWSA 4PBGA 4NP7A 1A5OC 1QI2A 1GZ1A 2NX9A 3QLDA 2DZUA 2ZICA 5SWUA 1Q6FA 4GYFA 2DFAA 1YIXA 1Q3NA 4S3EA 4EANA 2PAJA 3FA3A 4HZ8A 2GQ9A 3GXNA 2GGEA 3VMPA 3GK0A 1AJ2A 1NDVA 3WEZA 3A5VA 1MUMA 3FEMA 3S6TA 2DT0A 1FH8A 3CTTA 1H7OA 3L68A 1QBBA 3AALA 4N9CA 1MMFA 2IUZA 3DFQA 5HBFA 3BLDA 4E0CA 1GTHA 4XAZA 1T41A 4IMCA 2XM1A 4OBSA 2CNCA 4I8YA 1S3TC 2QJIA 2G4JA 1UKPA 4NU7A 3URAA 4DRSA 1XCWA 4L9XA 1V3IA 3BLEA 4OKDA 4PL1A 3RHGA 4HYVA 4NI8A 3KVJA 2QZRA 2ABBA 4MB5A 4JBRA 1DWJM 3LHVA 2R1KA 1B3OA 1TPEA 3H53A 3UWUA 5AC4A 3NDYA 1ZSXA 1E6NA 2ABAA 3EYPA 4JHOA 1XSJA 1KV5A 3T4CA 1E1CA 1JPKA 2CITA 1YTEA 1JI1A 4MM1A 2E9BA 1JCTA 3FW6A 1HKMA 1LT7A 4PRTA 3B8WA 3MI3A 4HSOA 4E5TA 1EEPA 4IWWA 3SSJA 3IRSA 1T6MA 2YCEA 1BF6A 3CHDA 1U1UA 5TAOA 3W7RA 4G9PA 1XRFA 4CU8A 3LYEA 1GOWA 2PWHA 1DWFM 3WF3A 1PV8A 1E72M 1AJZA 4ZB0A 3GLCA 2QIWA 2WC3A 3M46A 3KXQA 3O15A 4UWMA 3IWPA 2VR2A 1E51A 2A6NA 1MO0A 2HISA 2Z6IA 1TWIA 4K7YA 2Z1BA 3A22A 3G18A 2PDIA 3C2EA 5AN7A 1HKJA 3OBKA 3WQWA 4FHAA 2DP3A 3LBCA 3AWNA 4Z1AA 3P5YA 3P60A 2OLAA 3S1WA 3LPFA 3GXTA 5T8GA 2VR4A 1ZNNA 4AY8A 1X39A 3A9BA 3DH7A 1A5SA 2QNEA 2VRJA 2X0SA 2RJGA 5CC3A 2W63A 4KEVA 5C9RA 5C7HA 4AIUA 1EUAA 3GNPA 1K3UA 2NZLA 2D24A 5CPOA 1THFD 3W28A 3PUDA 2UV8G 2IQTA 1BSLA 4DYJA 1DJQA 3VIOA 1SO5A 3TVAA 3SRHA 1IYXA 3ZZ1A 4L4LA 4UTTA 2ZZ6A 1ITUA 1CI1A 4QHRA 4C6FA 5I24A 3T42A 4U2ZA 4RXGA 3SDOA 1QPOA 5A3HA 2A6LA 2PGFA 5JH2A