4Y8FA

Crystal structure of triosephosphate isomerase from clostridium perfringens
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
251
Chain Sequence
GSHMRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAADFAQIVNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate Isomerase
publication title Reversibility and two state behaviour in the thermal unfolding of oligomeric TIM barrel proteins.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Isomerase
total genus 86
structure length 251
sequence length 251
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4y8fA00
1W3NA 2NV2A 2YW4A 3FS2A 1N8FA 4C1KA 3G0UA 1TV8A 4JS3A 4OU1A 1SFJA 4QSHA 2ZZ1A 3E49A 5DXYA 1EX5A 4KFPA 1EUNA 1D3HA 3C2VA 5IBXC 4AMAA 4JGDA 4K7YA 1VHCA 4AEOA 5BW6A 4HNVA 2O7QA 2TSYA 4FNSA 3WJZA 3IIOA 4JYEA 4Z1DA 1TTPA 1PE1A 2PE4A 3TFCA 3C3NA 3PF3A 3HGJA 4CQ8A 1W54A 2QAPA 2Y7FA 2DORA 4GUHA 2J6XA 2WKJA 4GUJA 3GXTA 1OFRA 4IGHA 3O05A 3OIXA 2PRLA 3A24A 4HPXA 1LROA 4CQ9A 1YADA 1JCLA 1R46A 3BG3A 1XDMA 1JRBA 3OVQA 2HS6A 3BLFA 1TSIA 3BW4A 3M16A 4LVDA 3LX9A 3F4NA 3KVMA 1OYBA 2PC4A 3QM3A 5H91A 3W86A 1C29A 5I3KA 3GXPA 2ATMA 5D2YA 4ADSA 4CLMA 1SO4A 1X7FA 3GKAA 2A6LA 3W7QA 2Y63A 3CEUA 4EF8A 3NQCA 2RDWA 4X2RA 2P10A 5KTLA 2HMCA 3SGZA 1FUYA 4O17A 1OK6A 4DEFA 5EMUA 3P5YA 3S6DA 1GYLA 4WZHA 2DZTA 1ZAJA 1LTDA 3EXRA 3Q37A 4YWIA 2YFNA 4MZ8A 1OYCA 1S5TA 4KWVA 3ZWSA 4UTIA 4RZ5A 2DJLA 1O4UA 4FNPA 4YMZA 1OVDA 1H60A 1EA0A 3LCIA 2Y7EA 2CLIA 3LBMA 2QCFA 3O63A 1NEYA 3WJXA 3G1XA 4WJEA 3T40A 2E09A 2CLEA 4NXSA 1BWKA 4MIMA 4OWGA 2QF7A 5I3GA 4TMBA 1TMHA 2CW6A 2C16A 5AHIA 1TV5A 3G1DA 3NR0A 2RKXA 2VENA 3V1PA 4X3ZA 1BTMA 1Q6QA 3CHVA 5GVJA 4LVBA 3S5ZA 3GZ3A 4CNNA 2VEMA 3SZ8A 3W2NA 4PC8A 1SZNA 3CQ0A 3C4UA 5SWUA 1BKSA 3C6CA 4NJGA 5K7JA 1HFBA 1H7NA 1XUZA 1X6UA 3B03A 4LW7A 3O8AA 2ZZ2A 3M7WA 3NEVA 2YFOA 1F6KA 3N2XA 4TR9A 1SFLA 1Z42A 3QC3A 4AHPA 2P1FA 2QCNA 4H6KA 1VPXA 1SQ7A 4QQ3A 5C2XA 2A7NA 3BG9A 2QDGA 1HTIA 2J9XA 1GVQA 1LDCA 4UFHA 3GNNA 1NVMA 2RDUA 3FEMA 4ICNA 5KZEA 4LV4A 2ZYFA 4QAIA 4MPQA 4MJMA 4ONVA 1YYAA 5AC6A 3W75A 1W8SA 4JTJA 1VYRA 1W5QA 4JX5A 4O8RA 4WY0F 1W0MA 2FJKA 1G4PA 5EKYA 3M41A 1MO0A 3TR2A 1DQWA 2ZRXA 3G3MA 4R53A 3WK3A 3S0CA 4RJEA 5KITA 2TYSA 3P5ZA 3IIZA 1GQNA 3B04A 5D38A 5LZLA 5I3JA 1ME8A 4UTMA 3LI1A 3CT7A 5FEWA 1IXQA 3VKJA 5CZSA 3W1UA 3PG8A 4UTTA 3PS7A 3VCRA 3BG5A 3PM6A 2Y7DA 4O10A 1FQ0A 1EB3A 3EWZA 4NJKA 4N6FA 3SW6A 4MZ1A 2JKPA 3VFLA 1PHQA 1M6JA 4HIBA 2I9EA 4PTNA 4N6EA 2WNNA 1TJRA 2XN2A 3GX9A 3NQ8A 4MY9A 2CFFA 1G4TA 4BI7A 1JCMP 2I14A 3QPYA 4RK8A 3F1QA 2Y88A 3S1WA 3KHJA 4OBTA 3BLEA 4DO6A 2E6YA 1XFBA 3DKJA 3GKFA 1KA9F 2XN1A 1TPWA 2TPSA 4XKYA 3W2MA 4JX4A 2JGYA 1QO5A 5EPDA 2VFGA 1W3TA 2EGZA 3ZR4A 1WXJA 2ZBTA 1OFEA 3DI1A 3HB9A 2V0TA 4CNPA 1LP6A 4DF0A 1PCWA 2ZZ3A 3G1FA 4ZMGA 4EF9A 4POCA 3NQMA 3IGXA 5D2VA 3LTSA 4Y9AA 1T99A 2VEKA 3EKZA 3O15A 4JXCA 4XKYB 4IPJA 3C56A 3B0PA 3G24A 4IQLA 4C1LA 4OE7A 5A5WA 3WFAA 3CIXA 4LS2A 4K37A 1AK5A 4NNAA 4WXYA 1H7PA 3LTPA 1H7XA 3M5XA 5AHLA 2J9ZA 2QUUA 3DENA 5D03A 2W79A 1HL2A 3L5AA 1UCWA 2DZWA 1KM6A 1O5XA 2ZRYA 3W7PA 4NZFA 1KM1A 3W7CA 1XI3A 4AWSA 4DPPA 2C19A 2C14A 1GYNA 2ZZ5A 3UZ5A 2BX7A 2E68A 4Z1BA 1PIIA 4XBSA 1FWTA 1YPIA 2Q8LA 1PS9A 1PL9A 2QCDA 2VFFA 3L9CA 4UFIA 4BWLA 3HG5A 1FWRA 1ICSA 1S5VA 4Z0JA 4LRSA 1FWWA 3LLFA 3LI0A 1I4NA 3TC6A 1FXPA 3QRHA 3CTLA 1JJKA 5HMSA 5CZJA 4KFNA 3NL2A 1VH7A 3QSRA 1CX9A 3NQDA 2H3BA 1A5BA 2ATSA 1G4EA 1EP2A 1TTIA 1GVOA 1F76A 3T7VA 5AFDA 2CZEA 2GJNA 1ZFJA 4AF0A 2VFIA 1VS1A 2OT0A 1K8YA 3LHVA 1I45A 2E1DA 5DY3A 2Z1BA 3TAOA 5F4WA 3GB6A 3RF9A 3MYOA 1I2NA 2VEIA 3STEA 2NZLA 2G5WA 2XN0A 3AJXA 3UWYA 3STCA 1ZHAA 3NPWA 1MSSA 4GC4A 2FIQA 4CNOA 2JK2A 3OG3A 3PWAA 2HSAA 4Q33A 1OYAA 2BWGA 2C1HA 1ME9A 4BK9A 3C2EA 1H5YA 3SR7A 4HN4A 3LRKA 4UXDA 4K7VA 1ONRA 1H7WA 1GT8A 3BK0A 2DZSA 3G1YA 1IXNA 4Z0SA 3H53A 4XTIA 1GVSA 3W2JA 1DBTA 4GXMA 3M1ZA 3TSMA 3FKRA 2A4AA 1IIHA 1TYGA 3W88A 2WNQA 4MKNA 5C5YA 3GNDA 5LNVA 1WOBA 1IIGA 5CSSA 3HQ1A 2R91A 3CWOX 4RX0A 1OHLA 4UTHA 4FNRA 3LCFA 2Q8ZA 3GYEA 2YYTA 4IUOA 2YGYA 2EPHA 2WSYA 4G1KA 2OX1A 3ZWTA 2GVJA 4ZQNA 5DXXA 3TV8A 2B4GA 2GUUA 1KM4A 4JICA 2J88A 3UZJA 2A7RA 4LVFA 3NNTA 3FLUA 4DO4A 4P2VA 3R13A 3SECA 3ATYA 3W1QA 1KTCA 5LSMA 1GTHA 4O0ZA 1OJXA 3NDOA 5F4XA 5G4EA 4YCPA 2NUWA 3R12A 5FESA 1R2SA 1VZWA 3G8RA 4WQ6A 1Q3NA 2ZRZA 3TXZA 3W7HA 1H50A 3DU0A 2QJGA 3GXNA 4ADUA 3G1SA 5F1UA 5AHEA 5I3IA 2CLLA 3SSJA 1EP1A 1GOXA 3EWXA 1DQXA 3OHIA 4M6PA 1QMLA 1K8XA 4FO4A 1WOAA 4FEZA 3TNOA 4JTEA 3PG9A 1H61A 3VE7A 2ABAA 5F1VA 3G1AA 4E0CA 3L5MA 4RV8A 1A5CA 3DHDA 4JDYA 4FHAA 3C0JA 1E51A 1KLZA 4NU7A 5AC8A 3GDKA 2O7SA 3IVTA 4MVAA 5G1YA 4MLJA 2B0MA 4S2BA 4TIMA 4Y6GA 1XBVA 2G95A 3EX6A 3NZ1A 4O28A 1TCDA 3HIJA 1JVNA 2WJZA 1H7OA 1XXXA 3Q58A 4JY8A 5LHEA 4UFJA 3PUDA 3STFA 3QEZA 2G96A 3C52A 3L65A 4LC8A 3L21A 1LOLA 4FF7A 1ME7A 2CLKA 2TMDA 5CG7A 1F6PA 3W7RA 1BEUA 4N4PA 3TA6A 4AHQA 3TE9A 1AL7A 3TMQA 3AO0A 3IGUA 3LOTA 5KZDA 5EYWA 3LGEA 4FNQA 2OZ0A 1CI1A 3T44A 5DBTA 2G97A 5HNRA 1WX0A 5FEPA 3H55A 3WJSA 1FCUA 4HKPA 1FDZA 4PA8A 1QPRA 3S9YA 4FXRA 3QW4B 1NSJA 4X22A 2BLEA 3PBYA 3ABQA 3INPA 2WNZA 5D33A 1LYXA 3USBA 2C0AA 3EX3A 3QPZA 1G7UA 4DQWA 4A3UA 4IXXA 1QO2A 3BLIA 5G2HA 4E2DA 1P4CA 2VXNA 3DXIA 4GUIA 3BW2A 2FB3A 2B7NA 5AHNA 4UTLA 3PSVA 4HT3A 1VCFA 1QFEA 4JYFA 3B05A 2YW3A 4O1BA 3UWWA 3Q94A 3NG3A 4TX9A 3LTYA 2BSLA 4B5NA 3W1NA 2Z0IA 1L2UA 1GTEA 3JRKA 5AB3A 1XBXA 2Y85A 2ZDRA 2B7QA 3B06A 3W07A 2CZFA 3PULA 2RH9A 3C2OA 1Q45A 3EX2A 5ABTA 3DFNA 4M6QA 3TK7A 1YLVA 3EKLA 1BWLA 1HG3A 2WSQA 5K4XA 1LRNA 3GR7A 4N9EA 5D2TA 4JTSA 1U83A 2V2HA 2WO5A 2E77A 5BOOA 2KZHA 4D2JA 1H1YA 2DZUA 3ABSA 1NF7A 4EIVA 2D73A 3R2GA 4KWWA 3S5OA 4O19A 3L68A 3O16A 2QCLA 4O0KA 4XBKA 2CLMA 1XL9A 3LXBA 1FX6A 5F2MA 3TKFA 4MFEA 3PB2A 1TPH1 1EWEA 3L67A 4BWLC 5TQLA 2QCMA 3W76A 5BMXA 4A21A 3LV5A 3HG4A 4XUGA 5H2ZA 4R34A 1OX4A 3U6WA 1ZNNA 2ISVA 4K8HA 3SI9A 1F74A 4GWEA 3NQEA 1UASA 1SSDA 2YZRA 1J2WA 4RKAA 5EBUA 4QM1A 4DO5A 2FTPA 5AOUA 1DORA 3MP5A 1I8JA 4O54A 3W74A 1KM5A 4OT7A 5K9XA 3DFTA 1OX4B 3M6YA 2X2GA 5FF4A 3HGOA 3RLVA 4NX0A 2F7FA 1B3OA 4IMDA 1ZAHA 2NLIA 3HO8A 3DGRA 3NL3A 1YDVA 4FX6M 3UWZA 5HR6A 4BI6A 4N9BA 3C8FA 2QUTA 3NQ2A 1W3IA 1TPDA 2XFWA 4X9SA 5J5RA 2QDHA 1AW1A 1RQEA 3HGRA 3O1NA 4JY9A 3W1AA 5D05A 2NX3A 4IMGA 3IIVA 1H51A 1WBJA 3FYPA 2PRHA 4LUIA 4UCGA 4DF2A 3W84A 4O57A 1N7KA 3K30A 3P80A 2V2DA 3KXQA 3L2IA 5E93A 1AG1O 5DLCA 1A53A 2VFEA 2ABBA 1LRTA 2C15A 1TQJA 2CZDA 3JR2A 4Y90A 1YTEA 4RLIA 3TMLA 5J5DA 5FF0A 3QMRA 4O52A 4RXFA 3LRMA 3HG3A 3PUEA 4DF1A 3QF0A 3MI3A 4L4LA 3LM7A 4K6AA 3HMJG 2DP3A 1PCKA 2EHHA 4O50A 4NJJA 3NQ6A 1VYSX 2E5BA 4QIUA 2Z6IA 3TU9A 5K9CA 2OJPA 3OVPA 5LNRA 1EWDA 2UV8G 4JDBA 4JX6A 3FFSA 2HS8A 1TRIA 3EB2A 4MYXA 3ABOA 4A2RA 5DN1A 5K2ZA 4JTUA 1YDNA 4UC5A 1FWNA 2B7PA 4O1CA 4JIQA 3I6RA 4EWND 4WY0B 4RZ4A 3ATZA 2F84A 2EAWA 3MO7A 2VELA 1QNVA 3PY2A 4XWUA 4YCOA 5G5IA 4O4VA 3TC7A 1WA3A 4IOTA 1VLWA 3TROA 3WK1A 3G1VA 3GIYA 2NXHA 1F5ZA 1H63A 1U5JA 2E5CA 3P74A 4UR8A 4YLWA 2FPVA 2H3DA 3U2OA 4JNMA 1OX6A 3S5YA 1OFDA 1TB3A 4LS0A 5TBOA 2ZZ7A 1OK4A 1TV7A 4JN6A 4HNTA 3W7JA 4AWTA 1FDJA 1GPWA 2GVGA 2V30A 4N4QA 3C61A 1UUOA 5K3VA 2E6AA 3FJLA 1KTNA 4NZJA 3LHUA 1G67A 4N2YA 2WV8A 1ZALA 3E02A 2CLHA 1SW3A 1XBYA 4RCXA 5LGZA 1DL3A 5BMWA 1S3HA 4IWWA 3DBPA 3ZFHA 1SPQA 3G1HA 4UNLA 4CCCA 5CPLA 4ALDA 2ISWA 1KBJA 2NWRA 3HGSA 2Z2UA 3EX4A 3IIPA 5EA9A 2X1UA 3LLDA 4M7TA 4ZQOA 1ICPA 1W37A 3QMSA 4PODA 3BVJA 4QNWA 3MI2A 3NQVA 4XQ6A 1KW1A 3RNDA 4O11A 1K7EA 1O94A 3M9YA 4LU0A 1XBZA 2X30A 3RU6A 1EPXA 2NX9A 4PCFA 2BXVA 3G0XA 5D04C 5DELA 3T4CA 4JTLA 1LZOA 1PVNA 2GPTA 2Y89A 3H54A 4PL1A 2Y7GA 1YTKA 2AGKA 3DHFA 3GK0A 3CWNA 3QFEA 1LM1A 3THAA 3O07A 4JTKA 2EF9A 1MEWA 3TDFA 1H1ZA 2PCQA 4KKXA 1VCGA 2H90A 1KFLA 3NAVA 1AW2A 1ML1A 4NNCA 1SUXA 3KX6A 4UTWA 3VNDA 5LHFA 4OGZA 3QH2A 5U4NA 3Q2DA 3GDLA 1W5OA 3QYQA 1GJPA 4EVZA 3PUOA 1PV8A 3FIGA 4Y96A 1RR2A 3W1PA 4RXGA 3W22A 1DHPA 2DZXA 5G1TA 2NX1A 4AAJA 2HTMA 3A5FA 5KZMA 4ORMA 4PEKA 5AHFA 1SU5A 1W5PA 3LCLA 4UIOA 1B4KA 4DBDA 2RHGA 2CLFA 3TSBA 1ICQA 3W3OA 5D09A 5AC7A 3DFPA 1KM3A 5BNKA 2A21A 4M6VA 1DJQA 2QCGA 3MJYA 4WXZA 3KVLA 2X1SA 3KAOA 3B0UX 1SZEA 2GQAA 3MHFA 3W1MA 5AYXA 4I7UA 3PBUA 1OFQA 1O95A 5FI8A 1FWSA 3OVRA 4NT0A 2PURA 8TIMA 1KFBA 4IXHA 4UMBA 2H8ZA 3FKKA 3OA3A 2YR1A 1H62A 5F2LA 1SSGA 5CPOA 1IXOA 1A5AA 1IF2A 4FIRA 5E1QA 1SO5A 1Q6OA 4IX0A 3TJXA 4TMCA 3NOEA 2YYUA 3L0KA 2NUYA 4NJHA 3HOJA 4Z1AA 2FFCA 1FY6A 3W23A 3P67A 1OF8A 1VJIA 3OEXA 3TIMA 3ZS4A 3G22A 2E6DA 1GVRA 3UWUA 3P8JA 3PR2A 5AYYA 3V75A 4A22A 4ZZ9A 3IV3A 2RFGA 2JBMA 5L6UA 2NV1A 4N02A 1IXPA 2ZA2A 4LOCA 3ABRA 1X1ZA 2YDAA 3GDRA 1TO3A 4IPIA 3BGJA 3W2KA 3LCGA 3LDVA 1LLZA 3MBFA 1TRDA 1J4EA 3HPXA 3C2RA 1B9BA 4AXKA 4HSNA 1YPFA 4IX2A 3IVSA 3M47A 3KVJA 4MUZA 3MYPA 2VOMA 1OFPA 5E0KA 1OX5A 1ZY9A 3I65A 3PBVA 3SY5A 3MI6A 5HR7A 3R89A 3TUUA 1I2PA 5K4ZA 2A1YA 1OFAA 3LHWA 3ELFA 3EWYA 3LV6A 5HWJA 4Y8FA 4HSOA 2C3ZA 3UWQA 1KM2A 5CZ0A 1V7YA 2QAFA 4DBEA 1SW7A 4JTIA 1K7XA 4UMCA 4DELA 2YCEA 3WK0A 5FEXA 3TH6A 2QKFA 5MHBA 2GQ8A 3M44A 1GVFA 3DI0A 1FXQA 4E2BA 3P8IA 1T96A 2QCHA 3EXTA 3WJYA 3LERA 4RR4A 1KV5A 3D0CA 1P1XA 1VC4A 1VQTA 3G0SA 4TO8A 1OFBA 4QJ1A 3TSDA 1SO3A 1JQXA 1YXYA 1LORA 2YXGA 3M43A 4LVGA 3C2FA 4IJBA 4WUIA 1DVJA 1QAPA 3A9IA 4DPQA 3W6YA 2FLIA 3W7NA 4O53A 4UNKA 1HO4A 3NM3A 4NJIA 3EEGA 1X8FA 4PFMA 4RZ6A 3EXSA 1RPXA 4ADTA 3TQKA 1KFJA 1B4EA 4K8EA 5D30A 2GVLA 5CPNA 1XM3A 3HPZA 2VFHA 3UPBA 3UD6A 3THQA 4BFAA 4NUWA 2YX0A 3BARA 1W56A 4JTTA 1EEPA 1SO6A 3S8HA 1WDWA 3KOFA 1FCQA 2V2CA 3W7GA 1F2JA 3LXCA 3A21A 3DFSA 1Q6RA 4FXSA 5D32A 1W5NA 4YL2A 3KVKA 5HWMA 1HUVA 1X1OA 1NFBA 3UQNA 3PSWA 1TPUA 3IGSA 1I2RA 2BTMA 1QDSA 3TW7A 4LWWA 3STGA 4M7SA 1M7PA 4UMAA 4ZVJA 3EWWA 5C55A 5HULA 1KLYA 2FPYA 1KV8A 5CPMA 1EP3A 5AYZA 3S1XA 1W5MA 4K39A 3P84A 4AHOA 3RK8A 4GJ1A 4WOQA 1T0OA 3EWBX 3KFTA 4AVFA 2QCEA 3W7IA 1G4SA 3MUXA 3W83A 2BZNA 4IMFA 2V5BA 3MWAA 1WAUA 4O13A 4CQAA 1WQ5A 3BW3A 1WV2A 2Z6JA 3DZ1A 3O6CA 4HNUA 5LNUA 3NPXA 3W70A 1F05A 5HUOA 5G2IA 3HBLA 1S5WA 3NL6A 1SW0A 2OCZA 3R8RA 1KFEA 1YXDA 2CWNA 4UTKA 1Q6LA 5U7SA 2QJIA 1JCYA 2NUXA 4O18A 2E6FA 1TPVA 2V5LA 4MZYA 4NVTA 1A50A 5KINA 1Z44A 1YTDA 1F7BA 3RLUA 4I7VA 1Z41A 2C13A 2W6RA 4WX2A 2AAMA 3HJZA 2R94A 3QMTA 1QOPA 1LOQA 1O5KA 3IRDA 3LB0A 4Z1CA 5LNWA 3SJ3A 1LOSA 3N14A 4OV9A 4HHPA 3RMJA 3TCEA 2DZVA 1VHNA 1FBAA 1KFCA 1WYIA 1RVGA 3TFXA 4GNJA 3IIXA 1J5TA 4PL2A 3W7DA 1T8XA 3A23A 4LUJA 5TIMA 1DOSA 3KRSA 3LHTA 3NPUA 1JULA 5D2XA 4UTUA 1ALDA 4H3DA 1EIXA 4O16A 4S1FA 4XZ9A 2X16A 4N9CA 3PB0A 3IEBA 1L6YA 3NXFA 4BF9A 1JRCA 3S1UA 2JKAA 2B7OA 5KMYA 4WD0A 3PC0A 4J9JA 4I7WA 1TTJA 3MBDA 4UTWC 7TIMA 3W2UA 3QZEA 1JR1A 3KRZA 3W9ZA 2P0OA 3I68A 1JCNA 3N3MA 4NNBA 1I2OA 3T55A 4MY8A 1LBMA 3GAYA 3NGJA 2CU0A 2X1RA 5FEZA 4MLRA 1UBSA 3W1LA 2V81A 3CB8A 3LXAA 2J24A 2EKCA 2A7PA 3S5NA 1M7OA 3NM1A 5F4SA 1TREA 2DZPA 5HJLA 1H7RA 3PVFA 1FCBA 1EUAA 3W2LA 5AN7A 2YSWA 2TRSA 1QCWA 4GBUA 1DKWA 4LY8A 2I1OA 3UY7A 2Q3RA 1TQXA 1YXCA 2H8XA 3TQ0A 1AW5A 2JKEA 1ZJIA 4GE8A 1HO1A 4JTFA 3MHGA 1I2QA 3TXVA 1XCFA 1G7VA 4Q4KA 4FB7A 4OV4A 4NX5A 4WY0A 4U4MA 1GG0A 4U28A 2DJXA 3UPWA 3MW7A 5DY2A 2H6RA 1LBLA 2VC6A 1QPNA 3DH7A 3QSTA 1LCOA 4N9DA 4JYDA 3L0NA 3N19B 1VYPX 3FOKA 3LBCA 3JS3A 4FIQA 1R2RA 3QJAA 3LCWA 3T78A 1V5XA 1XDLA 1P5BA 4EOUA 2YPIA 3M0ZA 3PAJA 4O1AA 4I9AA 1KTBA 5T26A 1UB3A 4UUIA 3WJWA 1SZGA 3CEPA 1K02A 1JCJA 1MXSA 1L9WA 1JUBA 3UYCA 5IBXA 1LBFA 3GR8A 5CKSA 3P60A 3W1RA 4LNYA 5K9DA 4PH6A 4P61A 4QNEA 4R7JA 1OF6A 3LHYA 5EL1A 5HQEA 3FJ6A 1XKYA 3A5VA 1QR7A 4R33A 3I7QA 5FF7A 4UTJA 5DCBA 3O06A 5C6MA 5FF3A 4UFMA 1ZAIA 1RQHA 2LLEA 4AB4A 2ZTJA 3DFQA 2WSRA 3U8GA 4E38A 1B57A 3NQ7A 3QQ1A 2J27A 1DV7A 3P61A 3SGUA 3BO9A 1QPOA 1JCXA 3HG2A 1TPEA 2QJHA 3TJLA 2J9YA 3TAKA 2QR6A 1SZFA 3NVTA 2GOUA 4ORIA 2X1TA 1L6SA 2C18A 4H4IA 1K8ZA 4YXGA 3G8EA 3W7MA 2E5DA 2Q3OA 3GAKA 1TPFA 5L9FA 2A5HA 2R8WA 1MEIA 1VR6A 2Y70A 5DBUA 4O4WA 1MZHA 5C54A 3W72A 3W85A 1VRDA 4S2CA 5G4WA 4FNTA 1NAL1 5BRBA 3CPRA 3QQ0A 2VFDA 3UWVA 4GUFA 3MHUA 3VI2A 3IVUA 4LVAA 4MYAA 2GJLA 2QEZA 2IQTA 4JD4A 3TX9A 2Y61A 2ZFAA 3CC1A 2V82A 5LGXA 1O60A 2FDSA 1P0KA 3EWUA 4OHQA 3YPIA 2FPTA 2NXGA 2FB2A 1K03A 1D9EA 3B8DA 4TU1A 3W87A 4LV9A 3EX1A 4JTGA 3GLCA 4IMEA 4LC6A 3GDMA 1ADOA 4K38A 5LNSA 3OBKA 4MY1A 4O1DA 4Q32A 3VE9A 2VKZG 4MFDA 3G18A 1KBIA 4O12A 3MP4A 2QUVA 2W0UA 3N2MA 1YDOA 3P81A 2FQIA 1TPC1 4GUGA 3B4UA 5I3HA 1WBHA 4OQVA 1FCVA 1VLIA 2QCDB 3E12A 5DCDA 4ZQPA 1K7FA 3LCHA 3F4WA 3W73A 5CZTA 4M5PA 4MJZA 4IMCA 1N55A 3BPWA 3PBWA 4HPJA 5LKYA 5DCEA 3CU2A 3GDTA 3HF3A 4LTSA 2OMAA 5HWNA 3N34A 1JQVA 4BI5A 2C6QA 4MOZA 1L6WA 1UUMA 4LRTA 1RZMA 3P82A 4UFKA 3NYZA 2NXIA 3HPSA 3NL5A 2WOQA 2DU2A 3RFAA 4AF0B 6ALDA 1TJPA 3UNDA 3NO5A 1JUKA 1THFD 1LRQA 2AQWA 2ISSA 4AH7A 3MP3A 4A2SA 2NWSA 3KRUA 4XTDA 2OT1A 3SFKA 5HUPA 1VCVA 3F03K 1XC4A 4FX7A 2ZRUA 4CCDA 2RDTA 2ALDA 1R30A 3P7YA 2GQ9A 4K36A 2A85A 3L5LA 1A5SA 3LCXA 3W1XA 3S42A 1K3UA 3FA5A 1MEHA 5G2WA 4FX8A 5IM51 1SR9A 3CM4A 3BGGA 3MMTA 1AMKA 1TTQA 1OABA 4O14A 5FF2A 5CGQA 1R2TA 1G69A 5D2WA 3DKLA 1ZCOA 1AL8A 3NQFA 3N9RA 3CIWA 4LS1A 3GVGA 1GEQA 3P62A 1GG1A 4LT9A 3G3DA 5KSWA 4ZQMA 5I3FA 4A29A 4ML9A 1RD5A 2V8ZA 3W7LA 1KM0A 3NQAA 4ZQCA 1XUUA 4JTHA 1RQBA 3UXDA 3E96A 5D02A 3WK2A 1P0NA 4O15A 4M19A 2ZTKA 2ZZ4A 1R47A 3W7OA 5A8GA 3ANYA 1TPB1 4JEQA 1CW2A 1DJNA 5D37A 1GZGA 2ZQ0A 3E9AA 1GWJA 3CLMA 1W31A 4GRSA 1KFKA 2ZA3A 4CCEA 1RV8A 1G6CA 2A2IA 3W1TA 3NA8A 2CLOA 1QPQA 1Y0EA 2ZA1A 3B0VC 4HNNA 4AWUA 5EY5A 2WPBA 4UR7A 3DAQA 3N73A 1IGSA 4NQ1A 1ZENA 3I7RA 4GFSA 3UXAA 1OFOA 1UJPA 2ZRVA 5F2IA 4ZQRA 1QWGA 4DXVA 2QCCA 2A0NA 3E0IA 3FYOA 3M5YA 4UFLA 1QOQA 1OG0A 2ZZ6A 4L4MA 1TIMA 2ZRWA 5AHMA 2WQPA 3R5EA 4QITA 5HINA 4FNUA 2R14A 3O6DA 2CZ5A 2VEPA 3W71A 3UY8A 3LHZA 4Z08A 3A22A 3SIZA 4KFOA 2PRMA 3NPVA 3BV4A 4JIPA 3W7KA 4WOZA 1NF0A 3L66A 1C9DA 1JUEA 1Z48A 3LRLA 3NZRA 2ZCGA 3TW6A 3W7EA 1VGAA 2V9DA 2Y62A 5F2GA 3N9SA 3I7SA 1C8VA 4NXKA 4BR1A 6TIMA 3O6YX 3TQVA 3M5ZA 4UTTC 3S1VA 1W1ZA 3L0GA 5CSRA 1F73A 3NQGA 3DFOA 3QW3A 2A6NA 2JGQA 1M5WA 4ZL1A 2Y6ZA 3M5VA 4JR5A 4QISA 1PHWA 1LLWA 1FDYA 4W9TA 1D3GA
chains in the Genus database with same CATH superfamily
3FS2A 3MANA 1N8FA 1TV8A 4JS3A 2BVTA 3H2NA 4HHLA 1FTXA 3LYEA 3WNNA 1M1BA 4QSHA 2OWWA 3E49A 3ZLFA 6XIMA 5FSDC 1EUNA 3C2VA 3JUGA 4ZTYA 1GK8A 3UP8A 4K7YA 4BF7A 3AJ7A 5BW6A 2O7QA 2TSYA 3WLHA 4DJDC 2WANA 4QP0A 4Z1DA 4D8ZA 1PE1A 2IPFA 3HGJA 4F0SA 2DORA 2J6XA 2VT0A 1OFRA 2R24A 4TX8A 5A8QA 3A24A 2YCIX 2C0HA 4HA0A 4W85A 4UZSA 1O7AA 4W88A 1TWSA 2DH3A 2OKOA 4EKJA 4KPLA 2VRKA 5H91A 1J01A 1C29A 1RPKA 2J79A 3FYYA 3GXPA 4ZB2A 3VDHA 2NT1A 2A6LA 2WVSA 2Y63A 1LWIA 4X2RA 2P10A 3WKZA 5M3WA 5LA2A 1AUSL 1WKYA 3UR7A 5EMUA 4DWSD 5C9UA 2DZTA 2INZA 3Q37A 2XGBA 2YFNA 4EANA 1S5TA 2E7FA 2GWGA 4KWVA 4RZ5A 3H7UA 4JZ5A 1H60A 2Y7EA 1E6XM 4PRTA 3AIBA 2GYIA 3MJMA 3ZVHB 1HIZA 1GVIA 4QJ3B 2GGHA 2PBOA 4MIMA 2QF7A 3N4EA 2CW6A 2VR5A 3G1DA 3KOYA 4HHHA 2RKXA 4X3ZA 1L6GA 5GVJA 3AIWA 4CNNA 3W2NA 2WM1A 1BKSA 4NJGA 1PZ2A 2P0IA 2ZZ2A 3M7WA 4H7CA 3N2XA 1SFLA 1Q6DA 4AHPA 4JKLA 1SQ7A 3S9ZA 3K1DA 2OGJA 4EX4A 3IARA 3GBEA 3GNNA 1NVMA 3CAQA 3C0SA 1RCXB 2ZYFA 2ALRA 4QAIA 4HOWA 1YYAA 1TZ7A 4IT1A 1VYRA 4KBXA 2BP1A 1W0MA 1P0DA 1RLDA 2CETA 1M65A 5E9AA 5HQLA 1QBAA 5EKYA 6CGTA 3G3MA 3S0CA 4RJEA 5KITA 1PDZA 5T9CE 4HGXA 1ONWA 1XPGA 4MB4A 4BA0A 5HXMA 3MO4A 3KEHA 3PS7A 3VCRA 3BG5A 2GZXA 1JZ3A 2GGGA 4L9XA 2B81A 4N6FA 4Q7NA 3SW6A 4MZ1A 3GTNA 3ONBA 4F2TA 3CBWA 4N6EA 1O12A 2ZX7A 1TJRA 3BCJA 2F8QA 2PC8A 3QPYA 4RK8A 1VJSA 4DO6A 2E6YA 3AHZA 3CV7A 3DKJA 3GKFA 2XN1A 1DP0A 4ERAA 4QGCA 1X1NA 4XKYA 3VNKA 5DT7A 2VVSA 1RK5A 2DT2A 4MKVA 2ADAA 4IG2A 3HB9A 1CXLA 4B5SA 8A3HA 3CUGA 1OCQA 3GFZA 1MI3A 3LPOA 1W1A1 3EKZA 1VFUA 2O56A 4IPJA 5BU9A 2GJPA 1D7KA 4KGJA 4HOXA 5ECUA 3I3BA 1AK5A 1GVEA 3SRHA 4WXYA 1F07A 1E1FA 2GJRA 1XJBA 2UWFA 1GOQA 4A4AA 3R25A 2W79A 3VCCA 3U7BA 3R0UA 1KM6A 5I02A 1DTNA 5BRQA 1OB0A 2BS9A 3H2EA 3W7CA 1XI3A 5HA7A 2BFGA 4JQ4A 4AWSA 3AXXA 3BH4A 3LPGA 1B0IA 3UZ5A 2D24A 3PTMA 4Z1BA 1PIIA 1Q2SA 5I23A 1DXIA 1PL9A 2OSXA 1IEWA 2C71A 1XW8A 2PP0A 4HPGA 1XLCA 1ZL1A 1I4NA 1V3HA 4W8BA 2XZ7A 4GKTA 5HMSA 1XLAA 3WLSA 5CZJA 2GK1A 4PTMA 3NURA 1VH7A 1W9DM 3QSRA 2H3BA 4D1JA 1KO0A 3EPNA 4TV5A 5MKGB 2WMIB 2VFIA 1VS1A 2OT0A 3VNZA 2F9RA 5I24A 5DY3A 2Z1BA 1J0KA 2VC5A 4ACYA 4MNKA 1CXFA 2VEIA 3STEA 3AMDA 3EYPA 4WDWA 3UWYA 3STCA 1VENA 1MSSA 5FCZA 1TE6A 4PTXA 1V0KA 4INFA 2HSAA 1POJA 1OYAA 2BWGA 4OTKA 3VD3A 1K77A 1TR9A 3POCA 2YJQA 3H26A 3B9OA 4HN4A 3R6IA 1Y7VA 1ONRA 1H7WA 1GT8A 5B7YA 2DEPA 2WBKA 3B9EA 2DIJA 3G1YA 3M0HA 2OWCA 3H53A 4XTIA 1X6LA 3ZR5A 3N4FA 5GNZA 4UZUA 4C91A 1BXBA 2X42A 1IIHA 1TYGA 3E0LA 4R9OA 2CEQA 3QV7A 2XIBA 2V5KA 2G41A 3CUZA 3WD4A 1IIGA 1KBKA 4JKKA 1R85A 2R91A 4RX0A 4QS5A 3SSZA 7REQB 4OECA 3U4AA 1XIMA 3CUFA 1FWGC 2WSYA 4G1KA 3T0DA 1YDYA 3ZWTA 2HISA 4OKDA 5DXXA 2GUUA 1KM4A 3UZJA 4QCFA 3H7VA 1UMYA 2F6KA 1KXVA 2DFAA 2QPXA 3SECA 5LSMA 3N2BA 4O0ZA 3BV7A 3NDOA 5F4XA 5G4EA 1A5LC 3G6MA 3WX7A 5LXEA 3SFWA 3VIKA 2NUWA 5IHRA 3G8RA 3K4DA 4R85A 5JIWA 2QJGA 2HWGA 1D3CA 3GXNA 3FVDA 5IDIA 7XIMA 5F1UA 3N15A 2CITA 2CLLA 1KQZA 1EP1A 1GOXA 4U5KA 1HX0A 2X1IA 3VGDA 4M6PA 5D9PA 1AQ0A 3C8NA 1EQPA 3VKDA 2WKLA 4MWAB 3CQIA 3P2VA 2ABAA 3OZMA 4ILSA 1TV4A 4QJ4B 3G1AA 2WCSA 3CTTA 4H1ZA 5I6SA 3K5XA 1WDDA 3GVQA 4ZXOA 3N2TA 1E51A 5AC8A 4MLJA 2B0MA 1EJXC 3AS2A 4Y6GA 2VYOA 3S47A 1XXXA 3VMPA 3S2LA 4AWEA 4AZHA 3STFA 5G4HC 4YYFA 3L65A 4LYPA 1M04A 1F6PA 6REQB 4EE9A 3AO0A 5KZDA 5AC5A 5EYWA 3FY1A 3LGEA 2E40A 2G97A 3H55A 1QOXA 2Y8KA 4HKPA 3QVQA 4S3BA 3M0KA 3GG1A 1TV2A 1MQPA 2W92A 3R11A 4FXRA 2G3JA 2ZX9A 4X22A 2BLEA 2BVYA 3PBYA 4LAUA 2XISA 4KF1A 1G7UA 4A3UA 2YCLA 3BLIA 4HOZA 2PD9A 4GQGA 5LIWX 5ABGA 5IXEA 2FZBA 4DO7A 3B05A 2PDJA 2C1IA 5ENLA 3LGDA 3RM9A 4B5VA 1YBQA 4LCQA 1PWMA 1JPKA 3WNOA 1VBHA 4Q7BA 3RX3A 5CZKA 1GTEA 3JRKA 4JCMA 4MPKA 3LY0A 4RNHA 2ZDRA 3W07A 2CZFA 3PULA 5C7HA 4LB4A 3T8QA 2VCBA 2PDYA 1FHLA 4M6QA 3GRIA 3EKLA 3HFTA 3L4XA 4JTSA 2J77A 2WO5A 1AH3A 5CC7A 4IQEA 3TZFA 4A35A 1NF7A 3B8IA 2D73A 2DIEA 4KWWA 1NM9A 1OY0A 1S2VA 2YBUA 3TKFA 8RUCA 1J6OA 1EWEA 4BWLC 3W76A 1IT8A 4XUGA 3N04A 4GVHA 1F3WA 1OX4A 2DW6A 1PKMA 2WVVA 3U6WA 3FA4A 2ISVA 4K8HA 3P0XA 1F74A 3V5CA 3AI0A 1UASA 1RSCA 4WIWA 1K4GA 4YHEA 4ZO9A 5AOUA 4DI8A 4K1GA 1DORA 1KR0A 3W74A 4PMJA 1YNPA 3DFTA 4ATLA 4J4KA 2Y0FA 3M6YA 1XYAA 3UVAA 4GA8A 2F7FA 4LSBA 4IMDA 1ZAHA 2NLIA 4R7WA 4HU4A 4RUBA 1E4MM 2QGHA 3R0DA 3WG6A 4BI6A 2QUTA 4ENLA 4J2MA 1W3IA 1TPDA 3NZQA 5HNTA 2BY3A 2XFWA 2QDHA 3O1NA 1EH9A 4KERA 5HJXA 2XFRA 2DH2A 4HZMA 2PRHA 3DUGA 2O9OA 3VX0A 3K30A 3VKBA 3KXQA 3ZJ6A 1I0DA 3B8SA 3COTA 4QDPA 1ITUA 4LBUA 3BWWA 3BLDA 5I7GA 3E2VA 2C15A 4FZIA 2BOEX 2IPJA 3IJ9A 2SFPA 4O52A 3DG3A 4C7DA 1LUCB 3QF0A 2DP3A 4NI3A 3ITYA 2TAAA 1VYSX 2WLYA 3PPHA 2OJPA 2VM8A 5DMMA 3VGFA 1UMLA 3TYDA 4Y9OA 1NIUA 3G1RA 5AVNA 3LK6A 2HS8A 1OCNA 2NVCA 4KWSA 1VAHA 4JEJA 3ABOA 5AZ1A 2P88A 1YDNA 3WLLA 3AZSA 1QWKA 4O1CA 2NQJA 1JDEA 4KETA 4RZ4A 3MO7A 2VELA 4F9JA 3N11A 4UR9A 4P8XA 3TC7A 2QF8A 2XUCA 3MV01 3L2MA 3TROA 3WK1A 2NT0A 5I78A 1H63A 1KRMA 4FXFA 5PTDA 3WL1A 3LEPA 5REQA 1OFDA 1FWJC 3BMVA 1AQMA 4I9MA 4EPBC 2ZZ7A 1OK4A 5ABFA 1RD6A 4MJ2A 4AWTA 2RAGA 6PTDA 3SO7A 3ALFA 1EDGA 7ODCA 3LHUA 1G67A 2QNEA 4N2YA 2WV8A 1H3GA 2XYLA 1XBYA 5DO8A 1IZCA 3OQ8A 4IQDA 2QUMA 1S3HA 1CZ1A 1U1JA 1W9VA 4LCSA 3ZFHA 1SPQA 3VIIA 4CCCA 1XG3A 2ISWA 4XUYA 1V51A 3IIPA 4YVVA 2X1UA 3LLDA 4M7TA 1YW1A 4ERIA 4H83A 1UJQA 1KKRA 3QMSA 3BVJA 4QNWA 3MI2A 4A3QA 2WHKA 8XIMA 1HVXA 3H7RA 1K7EA 4HJFA 1O94A 2I16A 4BZYA 1CGYA 4QE1A 2X30A 4CU6A 3MC5A 4HYVA 2RGMA 4DJDD 2FHBA 5DELA 2OLSA 2O9RA 2Y89A 4DNHA 1YTKA 2AGKA 4DIAA 1POKA 3CWNA 2WPGA 4DZHA 1LM1A 4JTKA 3HQOA 1MEWA 3WD2A 3TDFA 1JDCA 3CMGA 1OBAA 2REQB 4KKXA 2H90A 2CXEA 3NAVA 3PPGA 1AW2A 3NIYA 3KX6A 1D8WA 1TKKA 4AVNA 5EB8A 4H6RA 1W5OA 3WBWA 3FIGA 1R8LA 4Y96A 4I5UA 3EA2A 1RR2A 3DX5A 3A64A 4RXGA 4G7EB 4AAJA 2P3ZA 2HTMA 2D2GA 2V67A 4GY7A 5KZMA 4ORMA 5AHFA 4AIOA 4UIOA 1QI0A 2WZEA 1ICQA 5D09A 3ZXWA 2A21A 4HHMA 4Y9NA 4U2ZA 1HL9A 1X8CA 3LMYA 3NSMA 5C0QA 3WYZA 2GQAA 5AYXA 3CH0A 1O95A 1S2CA 4KRUA 5C9WA 4AZ5A 5CCZA 3OVRA 2V3GA 4F0KA 3M0LA 5E9XA 3KS6A 3OA3A 4WSHA 1SSGA 5CPOA 1A5AA 1SO5A 1EFZA 2XSXA 3KS5A 4IX0A 4TMCA 2OKTA 4AD5A 1EDQA 2XM2A 2FFCA 1OF8A 1RK6A 1VJIA 3TIMA 4MDPA 4LUSB 1PXGA 1GVRA 3UWUA 3P8JA 3V75A 4ZZ9A 5L6UA 1ZRQA 4N02A 4MAZA 2MNRA 4ZTXA 2ZA2A 1X1ZA 4G1NA 1W6TA 1TO3A 2EKGA 1EF2A 3BGJA 4V1XA 1Q4NX 1DXFA 2W66A 1BQCA 2V3EA 2ACUA 2OGYA 1J4EA 4U2YA 3M0MA 4HSNA 4F0HA 3M47A 3KVJA 2VOMA 1F4HA 3N17A 1ZY9A 1PWLA 3O7UA 3SY5A 3KCOA 1Q63A 3CV6A 5C9XA 3PZOA 3DYOA 3HZ3A 1DWAM 1TELA 5K4ZA 1R9YA 4HSOA 1R7AA 3GW3A 3V1HA 5AZ0A 5BROA 2QAFA 4DXXA 1A0DA 2G3FA 2HV5A 2YCEA 1QHOA 5FJTA 2CESA 5MHBA 3CO8A 1GVFA 2D2OA 1KCZA 1XP3A 3V5FA 1T96A 4R7OA 4Q8UA 1PIFA 3HA1A 4RR4A 1BF2A 1KV5A 4UOJA 3G5EA 3N6QA 2FKPA 5C9RA 4H6EA 1FWHC 4PUNA 3VIPA 1OD8A 2YXGA 4WUIA 1QAPA 2FVKA 1RHCA 4W5ZA 4Z2JA 3GH7A 1VRXA 5LYRA 3BSMA 5CXPA 3WLOA 4IHCA 4RZ6A 4EP8C 1RPXA 1TUXA 2D2JA 3WLTA 2VFHA 4QTGA 3T81A 3UD6A 4YTQA 1W56A 4XVDA 4HMDA 5C71A 1EEPA 3S8HA 3KOFA 1E1CA 3A21A 1Q6RA 2IKGA 1F8IA 1W5NA 1YMYA 1YNQA 2AL2A 3U9IA 3PAOA 1NFBA 3IGSA 3DHPA 5C55A 2P53A 4C6FA 3IK4A 4WVXA 1UUQA 4G2DA 5AYZA 3S1XA 4HU3A 3VZZA 4G5DA 2O9TA 3SCQA 2QCEA 4O1FA 1G4SA 4LF2A 3T0CA 1WAUA 4O13A 3S1GA 3WQWA 3REQB 5LNUA 3NPXA 1QW7A 3W70A 5HUOA 4FLSA 4DYKA 5CEWA 4XZNX 4JBRA 2XIJA 3JZEA 5U7SA 1W1PA 2NUXA 4O18A 3VNLA 4R27A 4CU8A 1AH4A 2E6FA 3FSUA 3ECQA 3W53A 1Z44A 1YTDA 2C13A 2W6RA 1VIZA 2R94A 1O5KA 3LB0A 4PYSA 3N14A 2PGEA 2Z24A 2DZVA 3VD7A 5A2CA 5FJIA 1NARA 1KFCA 3LENA 3KZSA 3I3EA 3E74A 1AQFA 1LLOA 2HE8A 4PL2A 4D6DA 1T8XA 3N3TA 5TIMA 4ZE5A 1RLCL 1W3JA 3KRSA 4K8GA 1QK0A 4S1FA 3VABA 3SUWA 2IPWA 4KQNA 2VZOA 3S1UA 1V6WA 1C91A 4JHZA 2J7DA 3TOYA 3MBDA 1FVPA 2V6AA 5M03A 4QG8A 4PBEA 3W2UA 1T7LA 1JR1A 3B3DA 3KRZA 3N6JA 5IRPA 1EJVC 3N3MA 3T55A 1I2OA 3KBJA 1LBMA 2CU0A 3A47A 1OGSA 3E0FA 3EZ4A 1XGZA 3VIOA 4A8NA 4CVWA 1EXPA 3RO8A 4RE0A 3NM1A 2NSXA 1E71M 1TREA 2DZPA 5HJLA 1A4LA 3IUIA 3WN6A 4EXBA 1EUAA 1AFSA 5AN7A 2TRSA 1QCWA 3AS0A 1BHGA 1LL4A 4MG4A 2I1OA 1TQXA 1JDAA 2JKEA 3ZIZA 2FH8A 4GE8A 1XR2A 4PTDA 4HMCA 1ODUA 1PTAA 3ZZ1A 4B2DD 1H0IA 3UERA 2ZX6A 2R1KA 2J25A 4J5NA 4ZO7A 3V36A 5FACA 4NX5A 1PKYA 4FMVA 1W2VA 1GG0A 4DUOA 5GJNA 2Y2WA 1XIEA 4F9DA 1W8GA 2BG5A 3NTYA 4N9DA 1Y5WA 4JYDA 3FOKA 2FMNA 4MWAC 3P14A 1PAMA 4EXAA 2YPIA 4JFSA 1KTBA 3DG7A 4GG9A 3UESA 3BSHA 4DUWA 5E0CA 2D2HA 1E9ZB 2QZRA 3GR8A 5CKSA 4QNEA 3GHSA 1OF6A 3LHYA 5EL1A 4I3GA 1XKYA 4R33A 3BICA 3QGVA 1KQYA 2VEFA 5C6MA 1VJZA 3DFQA 1RBLA 1B57A 1X98A 1DV7A 2PDPA 1QPOA 2QJHA 3BE7A 3TAKA 2GOUA 1TE1A 4ORIA 2BV9A 3SIMA 3ANUA 2C18A 3W7MA 3W24A 2V3DA 1UC4A 1O5RA 4XX6A 1MEIA 5DBUA 3GFYA 4ZOAA 1L6FA 2NQZA 4FNTA 1IT0A 2VFDA 3POHA 5H8UA 2OZTA 4O1EA 4RPPA 3IVUA 3ZSTA 2GJLA 2QEZA 3EWCA 1XICA 1HGYA 4L6DA 3QYSA 3ZQ9A 3CV1A 1DTUA 4AZBA 3BJFA 3EWUA 2OEKA 4HZ8A 5M5DA 5JXQA 2FB2A 3B8DA 3LQGA 1O66A 2XTKA 1F4AA 4JTGA 3OLEA 4HA4A 2I5QA 3D3FA 4CUCA 1Q13A 1XSJA 4K38A 1ZZMA 5C2CA 4Q32A 3ONCA 4QJ5B 1R6WA 2FQIA 4J3ZA 4L4OA 5I3HA 4OQVA 5HDRA 1NOUA 3E12A 1JZ4A 1NOFA 4ECLA 4ZQPA 2E28A 4GC3A 2ONEA 3LCHA 2D20A 1ADSA 3RJYA 2GVEA 4LAZA 4ACZA 3PBWA 2XSAA 3R0KA 4WHBA 2A3HA 3AQUA 5A6JA 3N34A 1J96A 2OZ8A 1JQVA 4BI5A 2VTFA 2Z27A 3FK4A 1L6WA 1XLDA 3KWSA 1JL8A 2NXIA 3E0WA 1B90A 5CPSA 1SZRA 4FPSA 3KBVA 1J93A 1THFD 2XG9A 2ISSA 3H4WA 4ZO8A 3UZXA 5CGMA 1AQHA 2ZUNA 2VGFA 3KRBA 2RDTA 2POTA 2A85A 5XIMA 4O8AA 2PGFA 2J7FA 1K3UA 3FA5A 3FX4A 1TTQA 4O14A 3QOKA 1G69A 5CSYA 2OTDA 3N9RA 2XVPA 3GVGA 4LALA 3WMCA 4LT9A 3WY1A 4ZQMA 4ML9A 2V8ZA 2YDSA 2ZE0A 1KM0A 1XUUA 1RQBA 4CD8A 4AZCA 3GW0A 3R4IA 1V6TA 2JQXA 1HNYA 5I5RA 4C6EA 1E15A 3VIFA 1FP8A 3KE0A 1XHGA 3QZ6A 4S3GA 3EA3A 2NVAA 1UWUA 4AZGA 4PUJA 5TF0A 2D3NA 4GXPA 1EJWC 3OOQA 3RIKA 3VUPA 2CLOA 3B0VC 4HNNA 5EY5A 4Y2WA 2WPBA 1J0ZA 2FDMA 1OFOA 4DB7A 4PBFA 1IR1A 3WQ6A 1XYFA 1O1HA 5FAGA 1QWGA 4DXVA 1BTCA 2QCCA 1P6WA 1GQKA 2B31A 3M5YA 4JQ1A 4PR4A 2GDVA 1QOQA 4L4MA 1TIMA 2OB3A 5AHMA 1GVYA 4ATDA 4MM1A 3R5EA 4QITA 1TMQA 1SJDA 4IP4A 2P76A 4E3VA 2CNCA 2WJFA 2ZC8A 1VBRA 3A22A 3E1F1 1VBJA 1GQLA 5T9BG 4JKMA 4W8AA 5DX7A 1AH0A 2Z2AA 3II1A 4LAMA 1NF0A 3L66A 3RPTA 1G0CA 3TW6A 1DJWA 4ML4A 3N9SA 3A4WA 4JTAA 2VWSA 3TQVA 1LJYA 1LT8A 1FH8A 3M5ZA 1L2QA 4PE8A 1QBBA 3BQ6A 5CSRA 4GD0A 3DC8A 1F73A 2E1WA 1EOMA 3NQGA 3QW3A 4E2OA 1VFHA 2WMHA 1M5WA 1Z8AA 4JR5A 5HMEA 4W9TA 4M3PA 4NZ1A 1D3GA 5JVLA 1W3NA 2NV2A 1QATA 5A6BA 4C1KA 4S38A 1MUMA 1V6UA 4H9YA 4JIRA 4OU1A 2PWHA 1SJCA 3QY8A 5BZAA 3MDUA 5DXYA 1KCKA 1M7JA 2Y8VA 4ZSUA 1MZRA 4JGDA 1VHCA 3C2YA 5DRCA 4FNSA 4C6OA 4J1OA 3IIOA 2FHCA 4TTUA 3AXKA 3C3NA 3PF3A 1W54A 9CGTA 3VIMA 1UZ4A 4AYSA 3GU9A 4GX9A 3OIXA 4HPXA 1LROA 2Z7GA 4H8UA 3UZZA 2J8FA 4AW7A 1JCLA 4EPDC 4IFKB 1R46A 3BG3A 1Q7QA 2EEXA 4ZEPA 3S9IA 1DPMA 4XBJA 1XDJA 1Z32X 4QSFA 2YA2A 5D2YA 3BJTA 4ADSA 2VVNA 2ICSA 1SO4A 3GKAA 3DFHA 2G8ZA 3CEUA 4EF8A 3S2JA 3T07A 1XIJA 1T8QA 2YDRA 1H1NA 5KTLA 1AD4A 3PHAA 4ZGYA 2HMCA 3T05A 2HRWA 3SGZA 1FUYA 3AXIA 1WDSA 1N2VA 1A80A 2OQYA 4S3KA 1OK6A 4DEFA 1E43A 3S83A 3S6DA 1IHIA 4WZHA 4PMDA 1LTDA 4YWIA 4PSRA 3WH9A 2VX4A 1OYCA 4Q6JA 4UTIA 3ZLHA 5HBFA 2DJLA 1O4UA 4YMZA 1OVDA 4ZO6A 2CLIA 3F5KA 2QCFA 1NEYA 3VPLA 3WJXA 4WJEA 4C5YA 2OX4A 3S46A 3T40A 2RUSA 3UZWA 1YPXA 3L4ZA 1S3TC 1ITXA 5I3GA 1F3XA 4TMBA 1KXTA 4OJYA 1TV5A 5HPOA 3FJNA 4MKSA 3ZT6A 1BTMA 1Q6QA 2ZXAA 3CHVA 3S5ZA 3R79A 2HNHA 4B3LA 4A05A 4PC8A 3C4UA 2Y5JA 5K7JA 3B03A 3ARXA 3CZGA 1KR1A 3OTRA 1V3KA 3BZGA 3QC3A 2P1FA 4PRWA 4H6KA 1VPXA 2J78A 3BMWA 3AHYA 4B16A 3MUCA 2BBFA 1HTIA 2J9XA 4GI8A 1GVQA 4NL1A 4GHRA 4LV4A 1QNQA 1NFGA 1PX8A 4AX7A 4MPQA 4MJMA 4HVXA 3GQYA 4MJ4A 4B4HA 1W5QA 4JX5A 2FJKA 4JIHA 4CNSA 4OOUA 5B80A 3M41A 3TR2A 3NZPA 1DQWA 2ZRXA 3WK3A 2C7FA 1DWHM 3P5ZA 4R3UA 3B04A 5D38A 4Z1YA 3AISA 3BAIA 5LZLA 3O0KA 3WQVA 4GQ0A 2OYMA 3BOLA 2R9RA 4RNIA 3CT7A 4FLRA 1CECA 3KBNA 3PG8A 2NQHA 1CNVA 3ARZA 4P7LA 1IT7A 1JF6A 3PM6A 2Y7DA 4O10A 1EB3A 3EWZA 5LIUX 2JKPA 3RCYA 1M6JA 3WF0A 3GVRA 1H5VA 5I03A 5J8LA 4AFYA 3VYLA 3H2AA 3WUFA 3WF1A 2XN2A 5HAOA 1PSCA 3PPFA 3SCOA 4FR6A 3AMGA 1G4TA 1NDWA 2WW5A 3H22A 1J18A 3BLEA 1CPUA 3CT2A 3UR8A 1PKNA 4CD4A 3ZR6A 1TPWA 1UIOA 2JGYA 2VI0A 1HJVA 3MWCA 1Y8BA 2VFGA 3WZ0E 3ZR4A 2VUYA 1OFEA 2V0TA 4U33A 3MMDA 3VNJA 4CNPA 1WUFA 2NW0A 4DF0A 1PCWA 2ZZ3A 3FEQA 3G1FA 1GW9A 3NQMA 1S5MA 4NILA 4B15A 1XYBA 3TJIA 1EL3A 3SCSA 3CASA 3NGFA 1OCJA 4XKYB 1BPLB 1ZB5A 3B0PA 1ZBWA 4IQLA 4C1LA 5A5WA 5M1TA 1R3VA 4LS2A 2VCAA 5CAKA 1JDDA 4NG3A 4LYRA 2POZA 1H7XA 1VFLA 2J9ZA 5D03A 3L5AA 3UGVA 5E5CA 2XINA 4NZFA 3LS9A 1KM1A 3A3HA 3PBMA 5EMMA 4YTUA 4XSLA 4DPPA 5M2FX 1KWKA 3UETA 2C19A 2VX7A 2YBTA 1GYNA 5DMLA 5T91A 3GH5A 2VJXA 5CJMA 1PS9A 3TN6A 4L9ZA 2QCDA 3L9CA 4DBUA 4BWLA 2ZWYA 3HG5A 1FWRA 2ZADA 4Z0JA 1FWWA 3GXIA 2EPMX 3TC6A 2VZVA 3GU1A 3QRHA 4JTRA 3VGEA 3MKVA 4RE3A 2OZ3A 4AEEA 1LQAA 1B3VA 1CX9A 1IEQA 1G4EA 5DQPA 1TTIA 3AXMA 3WBAA 2CZEA 3EOLA 2PLKA 4AF0A 3UF9A 4CQDA 2BASA 4KWOA 1S5NA 2E1DA 3VDBA 3QOMA 3GB6A 5F4WA 2NV9A 4YS1A 1X6NA 3VOJA 3V0UA 2G5WA 4AZ6A 3AJXA 2HNEA 3QR3A 3NPWA 3VU2A 4GC4A 4KMQA 3GG0A 2FIQA 2JK2A 3PWAA 4K1WA 3DG6A 1QI2A 1MDLA 2HE5A 1ME9A 4E8GA 3MUAA 3SR7A 4ZXLA 3LRKA 4K7VA 2WWDA 4MWAE 1TR1A 3S2CA 3W2JA 1RUSA 1TA3A 2YKKA 4LYQA 3ENLA 2OG9A 3QBUA 1GZ1A 3ITLA 1WOBA 4X0NA 2OLAA 3THDA 1MNZA 5CSSA 3I10A 1OHLA 1IYXA 4FNRA 2YYTA 4HPHA 4PMYA 4IUOA 4A3YA 2GVJA 2I56A 1RY0A 3BLKA 2A3EA 1TWZA 1V0LA 2PBGA 4LVFA 3NNTA 4Q8VA 1SM9A 3N9KA 4GO9A 3R13A 2RDXA 1KTCA 4GBDA 1J2BA 4YCPA 5H8PA 1R2SA 5FOOA 1IWPA 4WQ6A 1NDVA 1Q3NA 3W7HA 1BYBA 1MUWA 1J0IA 3M4HA 4A6GA 1TUFA 3I4EA 3Q4DA 3PZQA 1E56A 3SSJA 3EWXA 1FWDC 3VA8A 4AYGA 1QMLA 2G3IA 3VMNA 2QDEA 4GCAA 4FEZA 3TNOA 3PG9A 2XH2A 1H61A 1XCXA 5F1VA 1U22A 4E0CA 3WLPA 4KS0A 1B3WA 5CSUA 3M46A 4MVAA 3KLLA 4NRSA 3EX6A 4C6PA 4O28A 1TCDA 3HIJA 2WJZA 7TAAA 1ESWA 1VEMA 3Q58A 4JY8A 2CBUA 4OUIA 4ZFMA 5LHEA 4UFJA 3VNMA 4XIAA 3IS4A 3W26A 1A3XA 1A5UA 3L21A 4ZB0A 2OEJA 2R82A 2BGNE 2J62A 1BEUA 1JDFA 3TE9A 3IGUA 4UNIA 1SJAA 3CV2A 4S3JA 4FNQA 1EJUC 3UZYA 3VK5A 2DDXA 5HNRA 3GZAA 1EX1A 1WX0A 1VD6A 1V3IA 3WJSA 1FCUA 1HN1A 2WZIA 2OO0A 3RDKA 4NZ3A 1WZLA 3NO1A 1QPRA 4QDMA 1UPPA 1NSJA 4XZWA 4GIRA 1FH9A 3WH6A 3E6EA 4LNCA 1PTDA 3T2OA 5D33A 1W9UA 3EX3A 2HBXA 3QPZA 4IXXA 4S3EA 1QO2A 1V4YA 4E2DA 1W1B1 1YKWA 4N42A 2VXNA 3DXIA 1TX2A 1KNWA 4V28A 3SRKA 1EBHA 1VCFA 1QFEA 3T2QA 4JYFA 4DWSB 3UWWA 4TX9A 2VP8A 1I1XA 1XRTA 3QHMA 2PF0A 3AC0A 1ADDA 3RJXA 4HZ6A 3BDKA 2CLPA 3T0AA 2B7QA 2FTYA 3B06A 1Z69A 3UJEA 1UA3A 2HEJA 5BU6A 1UD5A 4F0RA 1A4MA 5ABTA 4LAKA 1KWGA 3G77A 3UXKA 1XIDA 4XB3A 1W1YA 1FWCC 1HG3A 5K4XA 4P5UA 3GR7A 4N9EA 1CLXA 3EDJA 4LY4A 3HTWA 4W84A 1J6PA 2UY5A 4LH8A 3N29A 1ODZA 3RR4A 2KZHA 1BF6A 3ABSA 3DGBA 3PZTA 4JNZA 3R2GA 3ZVHA 3AS1A 4O19A 1ITCA 3L68A 1QVBA 2QCLA 3E2RA 3UBPC 4HA3A 1FX6A 3PK7A 1NWUA 1US0A 4MFEA 1TPH1 1ZJHA 2QVNA 2QCMA 4YVPA 3LN3A 2CKSA 3HG4A 3LV5A 3WF3A 2X05A 1VFFA 4S3AA 5H2ZA 1UWSA 2PU1A 4R34A 1CIUA 4M56A 5I2UA 5FJUA 2Z1VA 2BMBA 4DLMA 3FSTA 4GWEA 3NQEA 1WUEA 1SSDA 2YZRA 1J2WA 5EBUA 4J35A 4NZ4A 4RDWA 3U2CA 4DJFA 1EC7A 1MVYA 1S2WA 1CWYA 3BXWA 1AA1B 1UKSA 1KGXA 4O54A 2DSZA 3TYEA 1U5HA 1OX4B 3OBEA 5FF4A 3RLVA 2PD5A 6A3HA 1B3OA 2CERA 3GDBA 3DGRA 3UWZA 2DIKA 4N9BA 1UKOA 2R1LA 3C8FA 1EBGA 5FD0A 2PWVA 1GOOA 5CPQA 3VX1A 1AW1A 4JY9A 3HGRA 3W1AA 4XO7A 4IPLA 4G6CA 4LUIA 4UCGA 2ZX8A 3ZM8A 4DF2A 1MRAA 1N7KA 1E0VA 1R5YA 2Z2BA 3P80A 4BY3A 3SCVA 3L2IA 5IFTA 4P8WA 5DLCA 4A3HA 2V68A 3VDAA 3NXLA 1A53A 4AD2A 1H49A 4HMNA 1TQJA 4CU7A 3MSDA 3TMLA 3H12A 2PSNA 1HP4A 3D46A 3HG3A 3PUEA 3NVDA 4RNJA 1F3TA 2HBVA 4DF1A 3LM7A 2VRJA 2XH0A 4L1WA 1R3WA 1E3XA 1LG1A 2Z6IA 4IFRA 1X96A 5LNRA 1EWDA 2UV8G 2WZHA 4JDBA 1GGOA 5FAJA 3BLOA 4ZOCA 5DN1A 5K2ZA 4JTUA 2Z1WA 1SVDA 2B7PA 3C3UA 4NI8A 3XISA 3QGKC 2VZUA 3E0VA 4JTDA 3GXFA 3T0TA 1N8IA 5LIYX 2VQUA 2EPNA 3ATZA 2VDGA 2PA6A 1A49A 3PY2A 4H9UA 3RM4A 4Q8OA 1U33A 4XWUA 3S6TA 4IOTA 1VLWA 4C6BA 3G1VA 3GIYA 1QTWA 2NXHA 4QQUA 4HTYA 2E5CA 3P74A 4YLWA 4LB3A 2H3DA 4UOZA 4C6NA 1V0MA 2VD9A 1UKQA 4NAEB 3SCWA 1S2AA 1TB3A 4LS0A 2IXUA 1TV7A 9RUBA 2AMXA 3TYZA 4HNTA 1NWRA 3O3RA 1W17A 4N4QA 4GH3A 2VX6A 2PP3A 5K3VA 2E6AA 4F66A 5E70A 1UH3A 3UG5A 3WMLA 3BAWA 5REQB 3UG4A 3R7MA 1OT1A 2PDHA 5ABFB 2VHLA 3DEQA 5CPLA 3CAVA 4ALDA 3HGSA 4J7RA 3EX4A 4OFCA 4X63A 3AYSA 4GH1A 5LIKX 2XWEA 5IOBA 4ZQOA 4PODA 2JIEA 2JIWA 2PLCA 3GG7A 3LSBA 3NQVA 1BLIA 5DF0A 2BHUA 3RNDA 1LQ2A 3VC5A 5MKGA 2FGZA 2WMIA 4X0VA 3NWRA 1E55A 4CN1A 5D04C 3WLNA 4NYUA 3MY9A 1PVNA 3PJXA 4PL1A 4Q6XA 2Y7GA 7A3HA 2J4GA 1JZ8A 2WVUA 4TV6A 3O07A 3WDPP 1OM0A 5I3DA 1H1ZA 1BVNP 4MMWA 1JI2A 4XSMA 3ZLGA 2V5CA 3PZGA 2NQ5A 4AD3A 1SUXA 3VNDA 5LHFA 4M6UA 2PWDA 3R8GA 4OGZA 4UQEA 3WCZA 1V8EA 3CMJA 5EBAA 3V16A 1WXYA 4HU8A 1PO9A 4EVZA 2WCGA 3KL5A 1ZTVA 5LXXA 3W22A 3QLDA 5G1TA 2NX1A 4L80A 2V3FA 4PB3A 1BG4A 2ESCA 5A6MA 3DBNA 3MKKA 1B4KA 3DFPA 2VCCA 4M6VA 1CT5A 1M41A 1PBGA 1J9YA 1DJQA 2X1SA 1EPVA 1JGMA 1SZEA 3MHFA 3PBUA 1OFQA 3F2BA 2ISDA 3UEQA 1VIWA 8TIMA 3OGRA 3KOXA 4EPEC 3AXHA 1XQLA 3FKKA 4L65A 4XAGA 3KL3A 1IXOA 1IF2A 2O0TA 3BMXA 1JF5A 1NFPA 1Q6OA 1XH2A 4GINA 3TJXA 3L4VA 3NOEA 2NUYA 3NZGA 2WZTA 5ABHA 4PTWA 1WZKA 1ZLPA 3U5YA 3B9DA 1FY6A 3W23A 1CBGA 4M1BA 3F7JA 2XDFA 2ZX5A 4XAZA 2E6DA 2BY2A 2XSBA 3PR2A 5AYYA 4A22A 3IV3A 1BGAA 4J3UA 1LL7A 2KAUC 4MWAA 3AMLA 4E2VA 3U4FA 1UWAA 2J8TA 4UTFA 4U3AA 3WEOA 1WXZA 3LLXA 1TRDA 4GPNA 1E5NA 1P6BA 4GOAA 1OX5A 3R58A 3P3BA 1FOBA 3I65A 4M1RA 4EXQA 5HR7A 6XIAA 4MUPA 2F38A 2A1YA 4B5TA 3AIQA 4HK7A 2CBJA 5CZ0A 1A3HA 1V7YA 4DBEA 2JE8A 2QULA 1TG7A 3WK0A 3SM0A 3DI0A 1FXQA 4GABA 1EA9C 2E3ZA 2ANUA 2OODA 2XVGA 3OO2A 3W6LA 4H9VA 1U1UA 1P1XA 4Q7IA 1VQTA 2YB1A 3G0SA 4TO8A 3KL0A 1JQXA 2DQWA 4IJBA 3SN0A 3T4WA 1KGUA 1TWDA 2FLIA 3OLGA 4LEFA 3WH7A 3SN4A 2KX9A 1HKMA 3IJIA 1GHSA 2BB0A 3SUVA 3LG3A 5CPNA 2O4MA 3HPZA 3KP0A 3UPBA 3CHDA 4BFAA 1F9CA 4FXJA 1FCQA 1WP6A 2V2CA 3GS6A 2DT3A 3NDYA 3VZYA 1HUVA 1EYEA 1X1OA 2EG6A 1JYXA 3UPMA 3PSWA 1KFWA 4WR3A 3EPOA 1CEOA 3STGA 1A5MC 3EWWA 2XIMA 2PGRA 1KLYA 2PPGA 3EOEA 4V33A 2FPYA 5HATA 3PTQA 4GVGA 4MAVA 4AHOA 1AJ2A 4I6KA 4RDVA 4WOQA 1EJ7L 2HK1A 2BZNA 3W83A 3MWAA 4IJRA 3WD3A 3BW3A 4NF7A 1ZSXA 1VEPA 3V18A 2BHZA 4MB1A 4B92A 4XKMA 1E6SM 3KM8A 3RCMA 1F05A 3DESA 3HFYA 2DUZA 3VOCA 1A0EA 4R5EA 1JIBA 1KFEA 3VUSA 2CWNA 4UTKA 1JCYA 5DMNA 3GVVA 2V5LA 5EMLA 4BQ5A 2PZNA 5LIXX 1E4LA 3HJZA 3C0LA 4HCDA 1QOPA 1LOQA 3L7RA 3IRDA 2RJGA 5HQMA 2QS8A 1XGDA 2FVMA 2PMQA 4HHPA 3RMJA 1UYQA 2WMGA 3AIRA 4B5XA 4IPNB 1FBAA 2WKGA 4RZBA 1AZ2A 3GTXA 4QBXA 3NPUA 1E0XA 1ALDA 1EIXA 5A8NA 3TVAA 2ODOA 4DYEA 1L6YA 1HKVA 3TYAA 4KH2A 5KMYA 3BURA 4J9JA 4WGXA 4F0LA 4L64A 2NLYA 1CDGA 3JVAA 4UTWC 1BGGA 2UY3A 3QZEA 4IP7A 5XINA 3SQMA 1R86A 2XFYA 4NNBA 4BQ2A 3GE7A 1A5NC 3GAYA 2X1RA 3NGJA 4PN2A 5FEZA 4J28A 3TTOA 3AALA 3L4YA 1E0UA 2YL6A 5HNNA 3LXAA 4J3XA 4P8UA 1M7OA 3TN5A 1LUCA 4XD6A 3VMOA 1YQ2A 1H7RA 1UHVA 5G1MA 1BSIA 1IEXA 1IV8A 3CXOA 5HK4A 2GUYA 3W2LA 1XIFA 4GY1A 3B0XA 4BQ4A 4LY8A 3BL3A 3T0BA 1AW5A 4V15A 3MHGA 4HYRA 1GKRA 3LGGA 3TXVA 4Q4KA 3WDHA 4CD7A 3UA4A 5ECVA 3RR1A 1U1HA 3CB3A 5C9ZA 4U4MA 4JN8A 2R1PA 3MW7A 2H6RA 1LBLA 1DWGM 3CL6A 1QPNA 4GZIA 3A13A 3QSTA 7PTDA 1LCOA 3QXBA 2DV0A 3L0NA 1QW9A 4MNJA 4S23A 3OB8A 1VYPX 1R2RA 3QJAA 2C1GA 2Y5SA 3ANVA 4EOUA 1EC8A 4JQ3A 3MUZ1 3WQDA 4UUIA 1SZGA 3CEPA 1K02A 2J66A 1L9WA 2QXWA 2EJ1A 3P60A 3W1RA 4PH6A 3XINA 4BF5A 1V93A 3FJ6A 1ONEA 3IJ6A 5FF7A 4UTJA 3PZMA 5DCBA 3U2ZA 2ZOXA 4O0QA 4DJEA 2LLEA 4AB4A 2ZTJA 1BD0A 3A4XA 3KOWA 4WRHA 4HNOA 1PZ3A 4AY8A 1VFSA 1JCXA 1XFCA 3HG2A 1E3ZA 1TPEA 3VKKA 3PANA 3TJLA 5FKYA 4FA3A 4IIGA 3NVTA 4MSSA 1DWJM 5IDZA 1L6SA 4H4IA 1OGGA 3AYRA 2YCJA 5CBBA 1VR6A 2WCAA 4TX6A 3WQCA 5KETA 1PX4A 1NY1A 1DXEA 3UCCA 1NQ6A 1XSIA 5G4WA 1NAL1 4GYFA 5BRBA 3E2SA 3J7HA 4GUFA 3MHUA 1VFTA 1QNRA 3BOFA 4MYAA 2IQTA 4HNLA 3TW9A 4M81A 5E6ZA 3AROA 3DYMA 3TX9A 4AY1A 3CC1A 2V82A 2WVTA 3MT1A 5LGXA 1ZJAA 3W27A 3N12A 2NQLA 2E4TA 4NHVA 3K1GA 1P0KA 2REQA 1SR0A 2XH7A 3HM7A 2DY3A 2R1MA 3YPIA 2FPTA 3WQ5A 2FZ8A 1WO2A 3W87A 4LV9A 2Z7KA 3EX1A 3T08A 1ZBCA 3FAWA 2BVWA 3OBKA 4O1DA 3VE9A 4BHYA 3IPWA 4N7QA 4G7EA 2WMKA 3MP4A 3N2MA 1YDOA 3P81A 2QIWA 1XS2A 3VM7A 2W5FA 1DE6A 4YJ5A 1VLIA 4IH3A 4L6HA 1DE5A 3A9BA 1UWRA 5CZTA 4LF1A 4WLCA 3OP2A 3IAQA 4M5PA 4L5ZA 5CG0A 4REQB 4MJZA 4H8VA 5CLWA 3BPWA 1VPYA 1KC7A 3GDTA 2HVMA 1HGWA 4LTSA 2OMAA 1UPMB 3NO3A 4LJ3A 4A8IA 4LRTA 3AS3A 1K9TA 3NYZA 3HPSA 3NL5A 2WOQA 3RFAA 4D6FA 2CBIA 3WBXA 4W86A 3QV8A 1QRQA 1TJPA 1XIBA 3UNDA 3OBAA 1LRQA 4AIBA 4AH7A 2XVLA 4A2SA 5HUPA 4WSKA 1VCVA 4P8VA 2ZRUA 4V27A 2ALDA 3L5LA 3LCXA 1IWAA 3S42A 5FL0A 1MEHA 4LUSA 1CXIA 4KCWA 2HCVA 4LUTB 4FX8A 5IM51 4WDTA 4HP5A 4HA1A 3BGGA 3MMTA 1DJYA 1C8XA 5C2GA 1OABA 3M0JA 4IGMA 1R2TA 4XZIA 1BYCA 2OEMA 4NIRA 1RXOB 1ZCOA 2IS7A 3NQFA 3ID7A 4MNLA 3SN1A 4C1NA 3CIWA 4WGHA 1GEQA 4DZIA 3WBYA 4A29A 1RD5A 3E5BA 3W7LA 1SJBA 3CHCA 1NWTA 3L4UA 1UR3M 1K9EA 2RJHA 1QASA 2GUBA 4IMAA 3GTIA 2ZZ4A 4ZB5A 1R47A 1Q5MA 3ANYA 1L8PA 1TPB1 5D37A 3T1GA 3SADA 1GZGA 4GO8A 3VNIA 4YTRA 3SCTA 3HV8A 3M0XA 4GRSA 4J3VA 3IJDA 4AZCB 1I60A 1G6CA 3W1TA 3NA8A 2GLKA 1QPQA 5D4YA 3RLGA 1Q8AA 4UR7A 3DAQA 1I1WA 2WMFA 3N73A 4GFSA 4Q8QA 4KEMA 1XH1A 2ZRVA 3W29A 3TONA 4UFLA 4S39A 1QW8A 5A8OA 2ZXQA 1BXNA 2FZMA 3QTPA 3AOFA 1GW1A 5HINA 3O6DA 2CZ5A 3W71A 1NTHA 4Z08A 3SIZA 1A5KC 2ACRA 3W7KA 3BV4A 4WOZA 4DAFA 4RDYA 3VVGA 3OZPA 3TTSA 3NZRA 3W7EA 1VGAA 2V9DA 1HXJA 5F2GA 3GNXA 3I7SA 3R10A 3UJFA 1C8VA 3O6YX 2QIIA 4CNUA 3KP1A 1W1ZA 4Z17A 1UD6A 3PP7A 3CAWA 2A6NA 3VILA 3MCNA 1KRBC 1FHVA 4NAFA 4U31A 1LLWA 1TCMA 3WEZA 4PUKA 3VGGA 4I8DA 4RPQA 3CS2A 2DGAA 3W82A 3QQWA 2ZZ1A 1NQKA 2VX5A 1HZYA 1MFUA 2J74A 2QJJA 1D3HA 3OGSA 5A6KA 3ES7A 1OT2A 4AEOA 4D72A 3WJZA 1E72M 4JYEA 3REQA 1TTPA 9XIMA 2QPUA 3MMWA 3TFCA 1M9HA 2FMOA 2E9LA 4CQ8A 2QAPA 2WKJA 2Q02A 4NKCA 2FJUB 2HPMA 1S1PA 3U7VA 1X97A 4PUMA 1MNSA 4QEEA 4L4PA 1TVLA 1MXGA 4CQ9A 1XDMA 1UR2A 1XINA 2HS6A 3VM5A 3BW4A 2CC0A 4D8LA 2PEVA 3LX9A 3F4NA 3KVMA 1E4IA 1OYBA 2IKHA 1EEXA 3WQPA 3W86A 2ACQA 2OFJA 2PS2A 3MVTA 4MGGA 3APYA 3CQJA 4H6QA 3W7QA 1UD2A 3NQCA 2RDWA 4AD4A 1IZKA 5CPTA 3FXGA 4LANA 4O17A 1AJZA 4I8YA 1ZAJA 4PEEA 4MZ8A 1UBPC 3H4XA 4G56A 4US5A 4EPKA 3WH5A 4WK9A 3GHUA 3TLLA 1EA0A 3LCIA 1BVWA 3O63A 1JPHA 4AC1X 3G1XA 1BVZA 2E09A 5HMFA 3M0IA 4NXSA 1BWKA 4OWGA 1TMHA 3RX2A 1H4PA 2H9AB 2VENA 1XIGA 3V1PA 3HQPA 2PGWA 3GZ3A 2D0FA 3EMZA 3C6CA 3UJ2A 5CQ1A 1HFBA 1XUZA 4LW7A 3O8AA 2FH6A 4KCUA 3NEVA 1TJ0A 1Z42A 3ZSSA 5A6TC 5C2XA 3U5UA 2AGTA 1TMLA 1P7TB 2PB1A 2DSKA 1S38A 4GCXA 1LDCA 4BS0A 4W7UA 3FW6A 3C0QA 3RAOA 3FEMA 4ICNA 5KZEA 3OZYA 2WZMA 1EJSC 1R3SA 4ONVA 5AC6A 1KXQA 3W75A 1W8SA 4JTJA 4O8RA 4WY0F 3BOXA 1G4PA 5BWFA 3ZJKA 1MO0A 1UWQA 4DLFA 3IIZA 3ERPA 1LL6A 3VO0A 1W9BM 3OYXA 3LI1A 5FEWA 1IXQA 1XH0A 1FQ0A 1Z3NA 1ITQA 4CEUC 4NJKA 1EF3A 3PZ9A 1PHQA 4HIBA 2I9EA 4GISA 4PTNA 1W9XA 1WZMA 1RH9A 3GX9A 3NQ8A 4MY9A 2QV5A 2F2HA 2CFFA 1GNXA 4DM1A 2ZE3A 1JCMP 2I14A 4BI7A 4DBSA 2Y88A 3GYCA 4OBTA 3S1WA 3TYBA 4E5TA 1XFBA 3KDNA 1KA9F 1IR2A 2TPSA 1XLIA 1H2JA 3WELA 4J3WA 3H24A 1JZ6A 2CZVA 1W3TA 2EGZA 2ZBTA 3DI1A 1T41A 1KB3A 1LP6A 2DPEA 3TZNA 1OC6A 4ZMGA 1CXHA 4POCA 2OU4A 2YZ5A 2X40A 3UW6A 2VGIA 3GU2A 3ARRA 2ZUSA 4Y9AA 4JXCA 2VC9A 3G24A 4OE7A 3WFAA 1ZBKA 1KCXA 4K37A 2UZ9A 4NNAA 3LTPA 3M5XA 4GYKA 4CKQA 5AHLA 2W61A 3NJ3A 2DSVA 3DENA 1C7TA 3C5QA 1HL2A 1UC5A 4PUUA 2ZRYA 3W7PA 2BGQA 2MANA 4BCEA 1E4NA 4PZVA 4UQCA 1Q4WA 2GVYA 1GCYA 1BRLA 2C14A 2HPIA 2BX7A 4FLQA 7CGTA 2E68A 2QJNA 3DIPA 2PDUA 2Q8LA 3F5LA 1GONA 2PDBA 3ALGA 3IJLA 1EGZA 4QROA 2VFFA 1U30A 3L4TA 3LZ5A 3NSNA 1UKPA 2WLZA 2IXVA 2J7BA 4TVCA 4Z2HA 1BKHA 3BZJA 4KFNA 3NL2A 2FFIA 5AC4A 4D1IA 3W37A 1A5BA 2ATSA 3FGCB 1EP2A 1C7SA 4FF5A 1GVOA 2ASHA 5AFDA 1KRAC 1ZFJA 3QR0A 4GI9A 5ABEA 5I00A 3BLPX 1K8YA 3ME3A 1HL8A 1YIXA 1CCWB 3RF9A 4XZMX 1W1VA 3WO8A 2NZLA 2EPLX 1N82A 4IPPA 3AMCA 1ZHAA 2G4JA 4CNOA 1Q6EA 3CZKA 4FI4A 2EG7A 4Q33A 2C1HA 4YVXA 3UR2A 4B9YA 2WXDM 1PYFA 3RPMA 2G4FA 3C2EA 3UJSA 4GLEA 3KOZA 3LMZA 4UXDA 1P0EA 2Q09A 4B90A 2YDQA 3D47A 1IXNA 2I5GA 2ZIDA 4Z0SA 1GVSA 1DBTA 4GXMA 3M1ZA 3TSMA 5GPRA 3FKRA 1XKJA 1GJUA 2PCEA 3CAKA 3W88A 1Y5VA 3EOSA 1WDQA 1UZHA 4MKNA 2D3LA 3GNDA 1CLVA 1M68A 4K3ZA 1MW0A 4E4UA 3V0TA 3HQ1A 3KUMA 3CWOX 1QI4A 3AHVA 3ZJ7A 2EPKX 1O5QA 5B7ZA 3GYEA 1E6PA 1TA3B 5JU6A 2YGYA 2EPHA 3OJGA 2G3MA 2EPOA 4ZQNA 2OR2A 2VR4A 2B4GA 3OU8A 4HNCA 2A7RA 2PUZA 2PDKA 4DJFC 4XISA 4UB9A 3FLUA 4P2VA 3ATYA 1TJ2A 2J7CA 3W1QA 1TWWA 1Z6KA 5FESA 1VZWA 1CLKA 3KTCA 4EACA 3TXZA 1H50A 3W01A 4ADUA 3G1SA 4J27A 5AHEA 4DY1A 3CZJA 3FV9A 5I3IA 3EBVA 4WF7A 5HNUA 1K8XA 1P43A 5EGRA 4RW3A 3OGVA 2E8YA 2G3NA 3VE7A 3WQEA 3NYDA 2A3BA 2D0GA 3TLQA 3KBMA 4JDYA 4FHAA 3EA1A 3C0JA 1XG4A 4NU7A 3GDKA 2O7SA 3IVTA 2R6OA 3DERA 4TIMA 4QLKA 2G95A 3NZ1A 4IM4A 1JVNA 3QPEA 3K13A 3PUDA 1W9PA 3MSRA 4LC8A 3MB9A 2GJXB 1LOLA 1YHTA 4H9TA 4H9MA 3RILA 1ME7A 1V03A 4Q4PA 3HMCA 4DXKA 5CG7A 2VR2A 4TOQA 3TA6A 4AHQA 3CYJA 4GZJA 3TMQA 3MKCA 3RGTA 4EWJA 4IUGA 3M7SA 2OZ0A 4DWDA 1CI1A 5DBTA 1W32A 2A3CA 1MW2A 3FVMA 1NJJA 4M0XA 5M17A 1HQTA 4XD3A 2CWXA 3UYIA 3IK2A 4NSBA 1FDZA 1XSKA 1CTNA 5FIPA 3S9YA 1FWFC 3GUWA 1CGWA 1NP2A 3E38A 3INPA 2WNZA 2C0AA 3T42A 3MV11 2PDWA 4DQWA 4IFKA 5G2HA 4UQDA 1O6IA 1P4CA 2FB3A 1EKOA 2B7NA 3RYSA 3PSVA 1CB2A 2W27A 3F2CA 4HT3A 4G7FA 3MUIA 3NG3A 3LTYA 2FZDA 4B5NA 3W1NA 2Z0IA 3XIMA 1JYWA 2WJDA 1XBXA 2HXTA 2Y85A 1GOWA 2RH9A 3A3WA 4ASTA 2XJ7A 1Q45A 3EX2A 3TQPA 4E8CA 3DFNA 3TK7A 1F3EA 4HMEA 1YLVA 3QY7A 2ZVRA 4H8HA 3AYTA 5D2TA 5A8MA 1RA0A 2V2HA 3DDMA 2E77A 5BOOA 4XAPA 4D2JA 1H1YA 2DZUA 2WHLA 4EIVA 2G0WA 3S5OA 5A6BD 2ON3A 4XBKA 3USZA 3M07A 2CLMA 1TV3A 1XL9A 4PMRA 3QTGA 1ZP3A 1JD7A 3L67A 1WDRA 3ARQA 4RE4A 4DUVA 3ZVIA 3QHNA 1AJ0A 2VRQA 2FYMA 4YWSA 2NSOA 1TIWA 4C6DA 3T8LA 1ZNNA 5H6HA 3SI9A 1XLFA 4RKAA 2QUNA 3F4VA 5EMKA 4DO5A 3VKAA 2FTPA 3BCDA 4QDWA 1KM5A 4OT7A 4H19A 1G01A 4ROPA 3L12A 4MB5A 4DNMA 3OPSA 3CL7A 2C79A 1E40A 4XD4A 4IIBA 4QCEA 3HO8A 2Q71A 2V69A 4FR1A 3BAXA 1KRCC 1XRVA 1ISXA 5A3HA 3NQ2A 4X9SA 5J5RA 3VFCA 2WMJA 4GACA 1H51A 3LPPA 1JGIA 3WFLA 4NY2A 3WF2A 3W84A 3CIVA 2V2DA 4WSJA 2PAJA 5E93A 1FWAC 1AG1O 1XQKA 3WLMA 3HJEA 2PP1A 3S2MA 1REQB 1LRTA 2GSHA 2CZDA 3JR2A 1UIPA 1YTEA 5J5DA 1G5AA 3B40A 2CHOA 4RXFA 4L4LA 1JI1A 4KEUA 3HMJG 1M53A 4NJJA 3NQ6A 4QIUA 2E5BA 2HJPA 3TU9A 1M03A 5K9CA 2I5IA 3OVPA 3HQNA 3S3GA 4Q4RA 4KW2A 4JX6A 1TRIA 3K8MA 1IEVA 2PF8A 1KBLA 4IIHA 3PJTA 1YRRA 1TVPA 4A2RA 4W87A 1FWNA 3H23A 4DUXA 3QZAA 1NELA 4JIQA 3I6RA 4WY0B 3CL8A 2PU0A 2EAWA 2QV4A 1QNVA 3VXGA 2DUAA 4ES4A 3WSUA 4CNTA 2UY2A 4ZFCA 4YCOA 4O4VA 1RP9A 1BWVA 1FP9A 2JFEX 3IAPA 1U5JA 1DQUA 4JOMA 4IZGA 4UR8A 1K9DA 2ZUVA 4RE2A 4DZAA 3MDWA 3Q65A 3U2OA 5A2BA 1KCLA 2O92A 1PKLA 5TBOA 4KESA 5GQBA 2PWFA 4W5UA 3W7JA 1FDJA 1EJTC 1GPWA 3GTHA 3AICA 2GVGA 3LNMA 2EO7A 3PN8A 2VZTA 5TNVA 4TUFA 2YA0A 3FJLA 3N1AA 1Q7MA 1UP3A 3E02A 2CLHA 1SW3A 5LGZA 4S3CA 4XIMA 3UT0A 5BMWA 1KXHA 4ZSTA 5FJOA 1DJGA 1QK2A 1VF8A 3G1HA 4UNLA 1E70M 4IL0A 1OGBA 4HYWA 1KBJA 2NWRA 3AUJA 1OINA 2Z2UA 7ENLA