2FFIA

Crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
273
structure length
273
Chain Sequence
LHLTAIDSHAHVFSRGLNLASQRRYAPNYDAPLGDYLGQLRAHGFSHGVLVQPSFLGTDNRYLLSALQTVPGQLRGVVMLERDVEQATLAEMARLGVRGVRLNLMGQDMPDLTGAQWRPLLERIGEQGWHVELHRQVADIPVLVRALQPYGLDIVIDHFGRPDARRGLGQPGFAELLTLSGRGKVWVKVSGIYRLQGSPEENLAFARQALCALEAHYGAERLMWGSDWPHTQHESEVSFGSAVEQFEALGCSAQLRQALLLDTARALFGFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase from Pseudomonas putida, Northeast Structural Genomics Target PpR23.
rcsb
source organism Pseudomonas putida
molecule tags Structural genomics, unknown function
molecule keywords 2-pyrone-4,6-dicarboxylic acid hydrolase, putative
total genus 78
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2ffiA00
1EJVC 3UR2A 4DI9A 4L6DA 1XRFA 2P53A 4QTGA 1BF6A 2HBVA 4F0RA 2WM1A 3CAKA 2DVTA 4H9XA 2Y1HA 4IFRA 4EPBC 3DCPA 1ONWA 1UBPC 2Z4GA 4GX8A 2WJFA 2R1NA 3LGDA 4IGMA 1PO9A 1GKPA 2Q01A 2R1LA 1FWBC 4C6IA 4I6KA 4WGXA 5FSDC 3ID7A 4PCNA 2OGJA 4ERAA 2YXOA 3C86A 4KQNA 2GZXA 4NG3A 4C6CA 3UBPC 1ITQA 4IGNA 3R0DA 3RHGA 1FWCC 3TNBA 1NDWA 4KEUA 1S3TC 1XWYA 1RJPA 3SFWA 4C6KA 2P50A 1EJXC 3TN4A 1FWGC 4LAMA 2UZ9A 1UIOA 1I0BA 1V51A 3EWCA 1A5KC 4QROA 1RA5A 3O7UA 4F0SA 3F2CA 3EGJA 1K6WA 3UR5A 2PUZA 3GU1A 4GY0A 2YB4A 1PSCA 1K1DA 4HJWA 3FEQA 4H01A 4RDVA 2FVMA 1P6CA 4H9YA 3KM8A 4CQBA 1IE7C 2ADAA 1EYWA 4GY7A 2VC5A 4HK5A 3AU2A 2E1WA 1QXLA 3UPMA 2GWNA 4EPEC 4GK8A 2Q09A 4R85A 1M7JA 3MVIA 3A3WA 4XD4A 3T81A 1RJRA 4KIRA 2UBPC 3S2NA 3OVGA 3EWDA 3ITCA 4YIWA 2GSEA 2O4MA 1V77A 3IRSA 3B0XA 4RDYA 3PBMA 1NDVA 4DNMA 1FWDC 3E3HA 2Z27A 1I0DA 2R1KA 1E9ZB 1EJTC 4EPKA 2QS8A 3RCMA 1XRTA 3HPAA 2I5GA 1YBQA 2DVUA 2GOKA 1POJA 4HK7A 4M51A 4C6JA 1V4YA 3K5XA 3LU2A 3GG7A 3GTXA 4LCRA 3LS9A 3GIPA 3IGHX 4NP7A 3HM7A 4ERIA 2D2GA 1NDZA 1FWIC 3F4CA 4LEFA 3LSCA 4XAZA 4H9ZA 3T1GA 2VC7A 4GOAA 1YNYA 3S2JA 4EPDC 1A4LA 3NEHA 4LH8A 4GC3A 4MUPA 2FTYA 4QS5A 4IFOA 3URQA 4C5ZA 2HBXA 4RDZA 3A4JA 4H9TA 3ICJA 2RAGA 2ZC1A 3MKVA 1R9ZA 2O4QA 3GTHA 4ZSTA 3LY0A 3E74A 3LGGA 3JZEA 3MJMA 2R1PA 3IJ6A 3PNUA 3S2LA 1FWEC 1ADDA 4CEUC 1A5OC 1A4MA 2EG6A 3TN3A 3T8LA 4LAKA 3V7PA 3MTWA 1FWAC 1W1IE 4QS6A 1FWFC 3OOQA 1NFGA 4UBPC 4IFKB 4IF2A 3F2BA 1EF2A 2YZ5A 1V79A 3FDKA 2Z25A 4GYFA 4BY3A 4IG2A 4E3TA 4PBFA 4C6LA 2VR2A 3DC8A 3QGKC 1VFLA 1J5SA 3GUWA 1ZZMA 4EP8C 2AMXA 4HK6A 1WXYA 1FKWA 5LXXA 2PGRA 4HA0A 4RE0A 1FWHC 4XD6A 4P5UA 5HMDA 4IG2B 4OFCA 4AQLA 4AC7C 4B90A 4B3ZA 2WJDA 4LCSA 2Z24A 1O12A 3OU8A 1ONXA 3GIQA 3K2GA 3OJGA 3QY7A 4DZHA 3GTFA 1A5LC 4IFKA 2YB1A 2R1MA 2Z29A 3GU2A 4XD5A 2XIOA 5A6TC 3B40A 3AU6A 2I9UA 2W9MA 1KRCC 2E25A 4LFYA 2D2HA 2WJEA 1HZYA 4C6BA 3TN5A 3QY8A 1RK5A 3WYZA 4B91A 4H9VA 4BJHA 4CEXC 2CZVA 1J6OA 3PNZA 4TQTA 3NQBA 4XAYA 4LALA 2Z7GA 4R88A 2OB3A 5FSEC 4J35A 4IH3A 2Z28A 1A5MC 3QY6A 5CH9A 4XAFA 2EG7A 2G3FA 4I6VA 4PE8A 2QT3A 2PGFA 2HNHA 4C6EA 2EG8A 4H9MA 4C6OA 2Z00A 1O5RA 3DUGA 2ANUA 3G77A 2FTWA 3O0FA 4JOMA 3SO7A 5AKQA 1XGEA 4GX9A 4ERGA 4GXWA 1POKA 3WZ0E 4C6NA 4RZBA 4V1XA 1QW7A 2HPMA 4C60A 2IMRA 4XD3A 1EJSC 2FVKA 3E0FA 4KEVA 3LSBA 2BGNE 1UMLA 4WVXA 2VHLA 1FWJC 3ORWA 4GZ7A 4GY1A 1DPMA 4DYKA 3E2VA 1RJQA 3HTWA 4C6DA 1UIPA 3E38A 4DLFA 4C6FA 2BB0A 4G7EB 4LAOA 4CNSA 3CS2A 3AUOA 1P6BA 1M65A 2HQAA 2OOFA 4CQCA 4J2MA 3TN6A 3IPWA 2QVNA 1J6PA 3ISIX 4UB9A 5HMFA 1YMYA 4KERA 2F6KA 5E5CA 3URAA 4NI8A 3RN6A 3QGAC 2GWGA 3MDWA 3S4TA 2FFIA 3URBA 3URNA 1WXZA 4DZIA 3GTIA 1J79A 2OQLA 2OODA 1GKQA 2VM8A 3K4WA 1K70A 4C65A 4C6PA 1R9XA 1YRRA 1FKXA 3NURA 3GU9A 1KCXA 2DVXA 4DI8A 2PLMA 2KAUC 4QRNA 3RYSA 3OODA 3S2MA 1YIXA 4LANA 3FDGA 1EZ2A 3N2CA 4RDWA 4DIAA 4R7WA 5G4HC 4KETA 4B92A 4KF1A 4LCQA 4GBDA 2Z2BA 4IQJA 3IACA 4ZSUA 3MPGA 3D6NA 4J5NA 2A3LA 1KRMA 2Z2AA 5HMEA 1M68A 2PAJA 2ICSA 2Z26A 4G7EA 1A5NC 4XAGA 4QSFA 2HPIA 4C6MA 1JGMA 3GRIA 2QPXA 1RK6A 3F4DA 2D2JA 3IARA 4F0LA 1V7AA 3MDUA 4H9UA 4G2DA 4DLMA 3CJPA 4L9XA 1R9YA 2VUNA 3LA4A 3OQEA 1PB0A 4PBEA 3IV8A 3E0LA 1EJUC 4WHBA 1EJRC 4CNUA 4PCPA 3UF9A 1PTAA 1RAKA 3F2DA 4DO7A 1E9YB 3MSRA 4ICMA 3WMLA 1RA0A 2AQVA 4BKNA 4C5YA 4CQDA 4D8LA 4V1YA 4Z42C 1ITUA 1GKRA 3A3XA 1EJWC 3MVTA 1P1MA 4CNTA 3PAOA 2AQOA 1NDYA 1YBQB 4INFA 4C6QA 1KRBC 4H00A 3LNPA 3PANA 1KRAC 3B0YA 3BE7A 4KESA 4KEZA
chains in the Genus database with same CATH superfamily
2IPGA 1NEYA 3UR2A 7CGTA 3O2LA 1AZ1A 1S3HA 2ALDA 1PIGA 3ABOA 4FX7A 1LF1A 3MKCA 1NF7A 1UA3A 3SJ3A 4HNOA 4C6IA 4U2YA 4FO4A 5ABHA 3I4KA 4NIRA 3USZA 2OGJA 2WSYA 1U1HA 5U4NA 2G96A 4YWIA 4UQ9A 5JH1A 5CZSA 1XSIA 1CWYA 3NGFA 3VIFA 3GW3A 3UZZA 4R34A 1P0KA 1MUCA 1LUCA 1JCXA 4Q4KA 1XWYA 2WHMA 2XVLA 1EJXC 4F48A 1SO6A 1CLXA 1UIOA 1ISVA 2DPEA 4O11A 4NZ3A 1K6WA 4GIAA 1XYBA 4OBSA 2A7RA 4AWTA 3GO2A 4W7UA 4ZQCA 3WFAA 3H6OA 1MZHA 3FGCA 4KWVA 3M46A 1UYQA 4ZFMA 2IQ0A 3WLRA 4AC1X 1MUWA 3VUPA 1BKHA 2VJXA 3MVIA 1RALA 3JRKA 4L65A 3GHUA 4CNNA 4ROPA 1ZJAA 1TPWA 3ITCA 1UKPA 4U5IA 5HINA 4ZENA 3SCSA 1KXHA 1VIZA 4KS0A 1DV7A 1ISZA 3PBWA 4DBUA 1XPGA 3N15A 4N6FA 3DEQA 3VKBA 3UWUA 1RUSA 1LRNA 4K8EA 3LPFA 1PAMA 1KR0A 4HP5A 1UQYA 4ERIA 3KL0A 3DX5A 3TYUA 4QJ4B 1FWIC 3W7MA 3RO6A 1SMAA 4H9ZA 3W83A 1YW1A 2D0HA 3GG8A 3RCYA 1NWSA 1W9DM 2ISFA 1QW8A 3JU2A 4FR6A 1ZUAX 4LVFA 2FTYA 2OSXA 2V5KA 1CGTA 4G56A 2RGMA 1R8LA 2FPVA 5K9CA 3LPPA 1QPRA 3DAQA 4R3UA 3LY0A 4ZXLA 4D1JA 1PZ1A 3AUJA 4IX2A 4GQQA 3C61A 4DZ5A 2NQ5A 3DFQA 3WMSA 2VR4A 3JVAA 5HPCA 2YR1A 1Q7ZA 3LHWA 4XX6A 4LVBA 1A0CA 2V5DA 5AYXA 1FP8A 3WX7A 1V5XA 1BGGA 1XDJA 1UA7A 3N29A 1XGZA 2X1SA 1X97A 5D2YA 1G6CA 2WNWA 2CC0A 3LXCA 3VCNA 4TV5A 3VDHA 1EC7A 4GD0A 4AXKA 5BU6A 2TAAA 1HW6A 4FAMA 4O0KA 3WLQA 1Z6KA 2E09A 4AC7C 3QRHA 4NAFB 3IIOA 4IXHA 1JAEA 5EBAA 3UU0A 2YB1A 2E8ZA 3PPFA 3GUGA 2UV8G 2D22A 2Z1VA 3CTLA 4I9TA 3B40A 2DT3A 1PS9A 4I7VA 1P0EA 1BXBA 2ALRA 3DHDA 1H1ZA 3EWYA 4YTTA 4MNJA 3B8TA 4X2PA 3U4FA 5IM51 2D2OA 1KM0A 1XH2A 3TJLA 1TVNA 3MP4A 4NL1A 4ZODA 2Q3RA 1V0MA 3BJFA 3UCQA 3CH0A 1QTWA 2CPUA 3QEZA 3MC5A 4WJXA 5JU6A 4O1DA 3NQVA 1ZP4A 3QJAA 2XH7A 3PY2A 4BF5A 2FTWA 3SO7A 3N04A 4O18A 3AJ7A 5I2UA 3OZYA 5D2TA 5T91A 2F7FA 3UYCA 4C6NA 4JYDA 2V0TA 3TZFA 4UNKA 3EB3A 1MWOA 3WQ6A 1HJUA 1UMLA 2VHLA 7ODCA 3ORWA 1SGJA 1WUFA 2PTYA 3QOKA 3GVQA 5C7VA 3PF3A 1LOLA 4MZ8A 3GVVA 5AC6A 3AIQA 2OOFA 4O4VA 3SN0A 1EZWA 3WEZA 5IBXA 3VE7A 1DJXA 4GH1A 4QBXA 1MW2A 4YN5A 3URAA 4AVNA 4MMWA 2OZTA 3G3MA 3CQIA 3E02A 3H8AA 4IIHA 3URBA 1W9UA 4JN6A 4UC5A 2D24A 2QCCA 4L1GA 1WBHA 4S1FA 3MZNA 4RW5A 4F4RA 4I90A 4YU1A 2VGBA 2JALA 4RNIA 5AC4A 6TIMA 1OVDA 4GA8A 2R94A 2B7OA 1QT1A 4I7WA 3WJYA 4JFTA 4LANA 1XG4A 1EJ7L 3L7RA 4UR7A 3TXVA 4ZVJA 3ZVHA 1JZ7A 2QDEA 3AS3A 4N9CA 3CV2A 1GVQA 4REQA 3KVMA 2AL2B 3WQWA 1VCFA 3ES7A 2ACRA 2Z26A 4G7EA 2WZHA 3VX1A 1N2VA 1NY1A 3TOYA 5CSRA 3I6EA 4DLMA 1M5WA 3HGRA 3CJPA 3LCFA 1XDMA 1I2OA 3AYSA 4MVAA 1EX1A 3KBMA 3FOKA 3RPMA 2EXOA 1XDLA 3FVMA 1OD0A 3T6CA 3MBDA 4S3KA 1A47A 1IXQA 4AVFA 3HURA 1V3KA 3GZ3A 3IIVA 1FXPA 4S2CA 4MM1A 1ITUA 2F6UA 4AEFA 3OO2A 2ZXQA 2HDJA 2OZ0A 8XIMA 2A3HA 3N73A 4Z1CA 4L6DA 2ZZ4A 2WVVB 1ZP3A 1TELA 1V6UA 2P3EA 2OX1A 2YXGA 7ENLA 4Q8OA 4KCUA 4PTXA 3KL3A 3PWIA 1TYGA 4L7ZA 4TX6A 3V16A 3T09A 1VB9A 5FSDC 1H11A 3TR9A 3OA5A 3P61A 2OSYA 2DUZA 2Q8XA 3P6LA 4LV9A 3UJFA 3DECA 3IANA 1L2QA 3NM1A 1WX0A 4N02A 2BASA 4DQWA 1HKMA 4N9BA 2BOEX 3CWNA 2HEJA 1S3TC 4PYSA 1FWTA 4A8IA 1VFTA 3R13A 2MUCA 1DTUA 4B4HA 3NCOA 4OWGA 4CQ8A 2YBTA 5AFDA 3G22A 1QOQA 2CW6A 3P0WA 4MZYA 4CLMA 4E38A 1XLGA 2EPLX 3R89A 1B31A 3T78A 4LUSA 4LUYA 3EWWA 1IWPA 1ESWA 2GSJA 2QUUA 2YIHA 3GNDA 1H49A 4DM1A 1KKOA 5AYBA 4MB5A 4QG6A 3MBFA 2PDYA 2DQWA 3V36A 4NYUA 5CPNA 3AAMA 1KM4A 3BCJA 1PDZA 4ZQOA 1XIDA 1UROA 5C9WA 1FWRA 3IUDA 4XZNX 1ECEA 7TIMA 3WLJA 4NU7A 3PP7A 3G1VA 4I5XA 4HK7A 5BYWA 1V4YA 1KFLA 5J04A 4FX6M 3IGUA 4JIHA 4XIAA 3PUEA 2VDIA 3W7NA 3UCDA 4HNTA 2VC7A 3DFHA 4PMDA 1YNYA 1Q6OA 2NLYA 5J5RA 2Q3OA 1JUEA 4K68A 3W82A 2J8GA 4IMAA 2ZC1A 2GVJA 1X6LA 2NX1A 4GUFA 2V2DA 2AQWA 4NX0A 1ADDA 4JN8A 2HE8A 2YCEA 4HJFA 2PRHA 4L4PA 2C91A 3W1UA 4LB4A 3MMTA 3AMCA 3NDYA 2ZUTA 3W27A 2Z1SA 4QIUA 1LOQA 4RZ4A 4FOKA 4QQUA 4E3TA 3ELFA 1K7XA 1YTDA 4C6LA 2ZTJA 3IAQA 4CKQA 3NL5A 2WLYA 4Q8QA 3MYPA 4S39A 3QPYA 3S8HA 1J5SA 4UQDA 1ONEA 4ATDA 3M5ZA 3WUBA 3TR2A 1WYIA 3M6YA 5CAHA 4KEMA 3A6OA 4ZOAA 3S1UA 3PPHA 3A12A 1W9VA 1A5LC 1R2TA 1W2VA 3S6TA 4V2XA 4JQ4A 4HNLA 3THUA 2RHGA 3VIKA 1KM3A 1EFZA 3DOPA 4GNVA 2WJEA 4LXFA 6XIAA 5AHEA 1H60A 1B3XA 1VYPX 2BY2A 1AD4A 1TB3A 4LUJA 1KCZA 4NNBA 3ABSA 2Z6IA 1TO3A 1QNRA 1TTJA 2IPWA 3CV7A 3P67A 2HS6A 4F66A 1H09A 1JPMA 2PCQA 3WDIA 3NQMA 3WNPA 1B5TA 4BQ2A 3VGHA 1W5QA 5JXQA 4C6OA 5D4YA 3SI9A 4B5VA 1CW2A 2VWTA 3CIXA 1CXHA 3TVAA 4NILA 4MY1A 1RBLA 3H7UA 3KOZA 1TV2A 5T8GA 1I60A 4H4IA 5CC6A 3ZT5A 2BP1A 4NZFA 2QEZA 4GYPC 2BGNE 4HOWA 2BWGA 4KWSA 2C0AA 1DIOA 2WCSA 4IMDA 2PF8A 4XTIA 4HMNA 5GJNA 5DBUA 1AK5A 1JI2A 1KR1A 4Z17A 4ZR8A 3K4DA 3C0SA 1J6PA 3ZO9A 5H2ZA 3NWRA 2QZRA 2I7GA 2QMKA 1SZFA 2F6KA 3GBDA 3HU7A 4S2BA 4M81A 3BLFA 3UGVA 3TQVA 1F3EA 1E72M 2XU2A 3TSDA 3NQCA 3MDWA 1WE5A 1VHCA 3G6MA 1XSJA 4R7OA 5FESA 1MZRA 2Y5EA 3LXAA 5AVNA 1NM9A 4JY9A 1NAL1 3DHFA 3LLFA 5CZ0A 1C8VA 4FA3A 3GX9A 4E4FA 3B8WA 2HZGA 1F74A 3WG6A 2AKMA 2J9YA 3BSHA 3TONA 3IVUA 1LCOA 1CXEA 3T44A 3TEVA 3IJ9A 2VX4A 3N2CA 3S47A 4J3XA 3PTMA 1JQVA 2QUMA 3H24A 4KF1A 3AHVA 1BQGA 2XH0A 4EWJA 3ITGA 4F0HA 1PWMA 1Q8JA 4A3HA 3E49A 4U3CA 3T4CA 3LHVA 4DJFC 3HQOA 3DGBA 3ITVA 1JGMA 4F0LA 5ABFB 3N4EA 3MUZ1 4E2DA 1XIJA 1JZ5A 3P82A 4G9PA 2X1RA 5REQB 1HGWA 3N9KA 4HMEA 3AWOA 1FHLA 1FCQA 1VAHA 1KCKA 4NKCA 5EL1A 1MEWA 3DI0A 2J7CA 3FW6A 1GKRA 5H8PA 4AX7A 5D32A 4TR9A 2DQXA 1YBQB 5DCEA 3DFYA 2GDUA 3GLCA 4BR1A 2NX9A 3C2FA 4B5TA 3VOGA 2HV5A 4EPBC 1WDPA 2Z4GA 3EX4A 2Q01A 3JUGA 3M47A 1GZ1A 3M0VA 4KH2A 1CGWA 3DKLA 2V6AA 3V5OA 4MDOA 4J9JA 3RM4A 3SIZA 1MI3A 3P81A 3MO4A 4XKYB 2BGQA 3VK5A 3GHSA 2FHCA 4JYEA 2HK0A 3C86A 1KBLA 4KQNA 2E6DA 1T41A 4C6CA 3FYPA 3OHMB 4X9SA 3BLDA 3U2CA 3SCTA 4YTRA 3KTCA 3UD6A 5F7UA 1NWTA 1V0NA 1H50A 1GZGA 2PCEA 3MSGA 2EJ1A 2UZ9A 5C2GA 3FAXA 1R3RA 5C6MA 4W5UA 4PCSA 1LROA 4ZGYA 4L80A 3UR5A 3P2VA 1UZDA 1RPKA 1K1DA 1KLZA 4AZ5A 4XUYA 1PIFA 4S23A 5D04C 4B4FA 2E77A 2UWFA 4F0KA 4RUBA 2ADAA 2FDMA 3ZWSA 1XICA 1QXLA 3W7QA 3MU7A 1NQKA 1F8MA 3R2GA 4GK8A 2Q09A 4ZOCA 1LRTA 1M7JA 1TUXA 3BLKA 3RNDA 1GVYA 2GUBA 5BU9A 1DVJA 1IHIA 3B05A 3WD4A 3E2QA 3OGSA 3KFTA 4Z2GA 4XIMA 4HHLA 3G2GA 2I5GA 2QUVA 4IPIA 4HU4A 1GW1A 5H8UA 4DBSA 3OVPA 4GUHA 4WZHA 2BXZA 4C7GA 4A2RA 5K2ZA 2IQDA 1X96A 3WQ4A 2PDJA 3F4WA 1Q8AA 4I9MA 3T2OA 2WHLA 1DIDA 5PTDA 1O1ZA 4JEQA 4YHGA 1DWFM 4NRSA 2NQ9A 4AZHA 1JPHA 1CB2A 3EXRA 1J2WA 3JZUA 5DCDA 3GTHA 4A2SA 3NDZA 1VLIA 1XG3A 1FHUA 4L56A 3C0QA 2B4GA 5M5DA 3PNUA 1J9YA 3PSWA 4CEUC 4GO8A 1OC5A 4HPGA 2GVEA 3TN3A 1VJIA 1B0IA 1QNVA 3OBKA 4LV4A 3DFOA 2X09A 3KCJA 4IQDA 2H9AA 1X6NA 4ZOEA 3W71A 5T26A 3W1RA 2WWDA 1JCNA 2D3LA 1TPVA 4UOZA 2BHUA 2E5BA 5FEZA 3GVWA 3AIEA 1X39A 4Q22A 2Z7KA 1F4HA 2WZEA 2INEA 4IG2B 2AOSA 3SUSA 2VVSA 2A7PA 3Q58A 3YPIA 3NZRA 3W1PA 5G1MA 1CNVA 3BCFA 3ZR6A 4HB7A 3CUIA 2XIQA 4UFLA 2ACQA 2VX7A 3TSMA 2Y0FA 1FOBA 3WJWA 3VDGA 4H3DA 1SR0A 1E0UA 2ZRZA 3G1HA 2VZOA 1O94A 3GH5A 1UKOA 3LBCA 4XAYA 4KWUA 1MO0A 3GXMA 5FSEC 3L2MA 3V5FA 5LA1A 3TMLA 1OFOA 3QY6A 1E4NA 1YPXA 3PFRA 3E5PA 3LX9A 3POHA 4AG0A 1O5RA 5F2IA 1Q3NA 4LAZA 4QITA 2VXNA 3M0KA 3W2MA 2RDUA 2VEIA 3H4GA 3S5YA 1LL4A 1QW7A 3R94A 1U33A 2HROA 3TU9A 2Z1WA 4XD3A 3VZYA 4DJED 3NZQA 3LB0A 2YFNA 2JF6A 3OVRA 1OG6A 3TXZA 1Q7MA 4FSAA 3W1XA 1BXNA 1HO1A 3E2VA 3KX6A 4E2OA 3A4WA 3WF1A 3QVQA 3IGXA 3S5OA 4DLFA 2MNRA 2DT2A 3ANVA 1UZ4A 5MKGB 1GJUA 1IWAA 2CXEA 3APYA 3ISIX 4BF9A 5CEWA 1RCQA 2WNNA 3RJXA 3L65A 3CHCA 1KQZA 3GIYA 3RN6A 4A3YA 2PTXA 3W01A 3WH9A 4F3HA 3W7HA 2B7NA 2I9EA 2HSAA 2OODA 1DE5A 3CZLA 3FA3A 2FZDA 4LYKA 3VKAA 3O63A 1YRRA 3NURA 3GU9A 1LOSA 2X1UA 3PPGA 4OVXA 1OYCA 1LP6A 4CD6A 2NWSA 2WKGA 1W3KA 1OD8A 3M41A 3ALFA 4RNJA 1GTEA 4R7WA 1R87A 1OK6A 2ICSA 8CGTA 4C6MA 4MNLA 1S2AA 2ZFAA 4Q7IA 3M1ZA 2DSVA 3P7YA 2NLIA 1TCMA 2YCLB 2E9BA 3H7VA 1BYCA 3R8HA 2FH8A 3T7VA 2BHZA 5CBJA 1Y5WA 2YA2A 1XRVA 4IIFA 2IPJA 5CPOA 1E15A 1E6QM 2NVCA 2B0MA 3AHTA 5I78A 3W28A 3VM7A 5BOOA 4HPJA 1UUQA 3AICA 3UJ2A 5F4WA 5AHIA 4NYYA 1E4LA 1T5AA 1VBGA 4AY1A 3QV9A 5G2WA 4JTLA 4V15A 5I6SA 2E6AA 5CGQA 3ARSA 4KEZA 3SY1A 4WOZA 4FZIA 1UH3A 1QNQA 4FOUA 4F0RA 3A21A 4HHPA 3F7JA 1WZLA 1DJNA 3WF3A 1WCGA 2DIKA 1QHOA 2DUAA 3LGDA 1KGXA 2WPGA 3TJIA 1JPKA 1Y65A 2YL8A 3ZM8A 2PLCA 1FWCC 4XB3A 3GZAA 3N9RA 3ITYA 3O6DA 2OFJA 5BNKA 3CMFA 3SFWA 2P8CA 3TE9A 1XIMA 3F5LA 3WBWA 3B9OA 1I0BA 2OYKA 1O60A 4QM1A 3L23A 3EA1A 3SBFA 3W7EA 2Q6ZA 5C5YA 1XYZA 1M9HA 3L21A 1K77A 3NQ6A 3FEQA 4IISA 3TAOA 1LG1A 3KM8A 3SUVA 4IHCA 4JTSA 5I0DA 1HGYA 3C2OA 2OKOA 2YW3A 3TC7A 4GPNA 2O9PA 4B5WA 1OWQA 1DQWA 1DIKA 2R24A 5G2HA 1MXGA 3RUBL 3GYEA 1ZL1A 4K39A 3GFYA 2XN0A 3RR1A 1A49A 1BVWA 4O1CA 2O9OA 2G97A 4HYRA 3WQGA 3NXLA 3VIHA 3WDPP 2ABBA 2OR2A 1G4SA 3I7QA 3GK0A 3SQMA 2GOKA 1EWEA 4M51A 3SCQA 4H7VA 4C6JA 3K5XA 3WNMA 2DSZA 1R3WA 4IJBA 2UY5A 2XZ7A 4JIRA 1D3CA 3NM3A 4AMAA 3U2ZA 2A5HA 4XAZA 3T1GA 2YL9A 1PX3A 5A8QA 3S2CA 3UW6A 5I00A 4RE3A 1F07A 5D9MA 3URQA 1H1YA 1W37A 2C6QA 2OYLA 4FP1A 2O4QA 3LPGA 1CIUA 3APGA 4PC8A 1HXJA 1KV8A 5B7YA 2JIWA 1S38A 1CZ1A 2V3FA 3IJ6A 1FWEC 2CERA 4NSBA 3S5NA 3B04A 3VNKA 1P7TA 1IEWA 4IPLA 4AZGA 4S3EA 4IFKB 4UBPC 3QFEA 4IF2A 5EFDA 3ARPA 3LDVA 4JDYA 2VENA 1OADA 2JGQA 3W7PA 3KS5A 4WKHA 3CL6A 1L2UA 3U6WA 1O5XA 2WCGA 1W9XA 5AC7A 1EBHA 4EP8C 1CXIA 4O16A 5JIPA 3TA9A 1SR9A 1TKKA 1J10A 1FKWA 4TO8A 3I3EA 3WENA 2VQUA 1PHQA 2ZZ2A 3QXBA 1JYNA 1KQYA 4GUJA 3UPBA 2VI0A 1AJZA 4LNCA 1TMLA 5G1TA 1HG3A 4H19A 1BFNA 1WO2A 3QY7A 2R1MA 5FIPA 3BPWA 2XIOA 4QSHA 2IKIA 1WNOA 2IXVA 3WEOA 3L2IA 1OSEA 4XQ6A 2D2HA 2PWEA 4N2YA 1RK5A 3NSNA 2ZBTA 5J5DA 1V7YA 1SFSA 2IQTA 4BZYA 4K2SA 2PDFA 2R6OA 4G7FA 3P14A 2XN2A 5E1QA 1HVXA 3SW6A 3R11A 3E9AA 3V0SA 1XIEA 4ZFCA 3ZSSA 1H61A 1L6GA 1EDTA 3SCWA 1X7IA 3G1AA 2BVWA 3ENLA 3PVFA 3DUGA 3UJEA 5BXTA 1J0ZA 3LG3A 1E71M 2OG9A 4MIMA 2HVOA 2IKHA 4C60A 5DXXA 2Y7DA 1AD1A 3BOFA 1GVIA 3SRDA 1ADOA 1VBRA 2R82A 2VZVA 4DVOA 3LSBA 2GVGA 3RF9A 1W0MA 2P88A 5ECUA 1CLKA 1Y5VA 1MXDA 3AZRA 2DU2A 2V5BA 3A64A 1LT8A 1QBBA 1TJRA 2NXHA 2J7FA 3AUOA 1DJGA 1HJVA 4CQCA 4Q8UA 1R38A 2YGYA 3LRKA 1QO5A 2PE4A 1EQCA 4JIEA 2NZLA 1TZ7A 3ABQA 4UR9A 4H6QA 3CXOA 2VGIA 3BW4A 4XZ9A 1L6WA 4LBRA 4MNKA 3AMDA 5D05A 4Y7EA 2C15A 3TROA 3K4WA 4HVXA 1PBGA 4O17A 1JAKA 4MB1A 3D0CA 2VQTA 1W3LA 3QHNA 4G1KA 4M56A 4J2PA 1TR1A 3LXBA 5M17A 1Z41A 1ZCOA 4BQ3A 4DWSC 2ABAA 1K4GA 3RLGA 3G5EA 3S2MA 3OBEA 1OFEA 3MI2A 4FPSA 3FDGA 4LW7A 1DL3A 1FWSA 3KRSA 4LCQA 2DP3A 1HUVA 4AWEA 4XBKA 3L0GA 2NX3A 2X0HA 3BGJA 3QR3A 5BWAA 4E6MA 4HTBA 4I8DA 4A3QA 3N4AA 3P0XA 1EPXA 3MYOA 2CHNA 4H9UA 3KW3A 3EA3A 4S3AA 1PV8A 1WA3A 3OQEA 2OELA 1WDSA 3EB4A 4E8CA 1EJUC 4KCTA 4RKAA 1LLWA 1KLYA 2ZUNA 2C71A 3MW7A 2HCVA 3ZMRA 2PS2A 1SSGA 1RZMA 1TJ2A 3M0YA 4DWSD 4WRHA 1GG0A 4DO7A 2X42A 3TSBA 4CQDA 4Z42C 2DEPA 4FNPA 3N2XA 1B3ZA 1FH8A 3H70A 3W53A 3VC6A 5CSSA 1G69A 3KE0A 1F2JA 1T8XA 3S5SA 2P53A 4NJIA 2HBVA 4DWSA 2DVTA 1TV8A 4OOZA 3VIIA 2ACSA 3DCPA 2E28A 4Q4SA 1Z3NA 2P3ZA 2BVYA 2P1FA 1FWBC 1BF2A 3HFYA 3IEBA 4LWWA 3NSMA 3ID7A 1LORA 4PCNA 4M24A 2JQXA 4ZO8A 1SO5A 2D23A 4HNVA 3BQ6A 3W1TA 5AHNA 1U22A 3RU8X 2OKTA 2B81A 5FF3A 2A7NA 2ZRVA 1G0CA 4IICA 1NDWA 3M0JA 1UHVA 1QPKA 1TRIA 2WZMA 5H91A 1PHWA 2GUYA 2W6RA 1LLZA 1PJ9A 1EB3A 1DXIA 9XIAA 2IKJA 1FXQA 3V0UA 1FUYA 3CQJA 1VFFA 1C93A 5AHFA 2G4FA 3EXSA 1VBJA 3UPMA 2QCHA 2VDGA 3DFPA 2QCLA 3KAOA 4QAIA 1AZ2A 3QKEA 1KA9F 3MWCA 1VBHA 2OO0A 3KWXA 1K03A 4CU7A 1LWJA 1E0WA 4FLSA 4WXYA 1REQA 1R3SA 3BAXA 3CC1A 2FJUB 2WJZA 4M6PA 1J12A 4ONVA 3PG8A 4HYWA 4DNMA 2UY4A 1I0DA 2V68A 1E6ZA 3TDFA 3P5ZA 4DY1A 2NT0A 4GJIA 4Q6JA 2X30A 1POJA 2BG5A 4DNHA 3GTXA 5KTLA 4NT0A 1M3UA 2PP1A 3NSXA 3DIPA 1B3VA 5K9DA 4MWAA 1VPXA 3VOFA 1W3JA 3B0UX 2PTDA 1WKEA 4HCDA 2HMCA 5C8BB 2YSWA 3EMZA 4PODA 2I14A 2YCLA 3MKVA 2ZX6A 3BTNA 3H2OA 2G37A 2AGTA 1JCLA 4Q3MA 3JZEA 1QO2A 1GOMA 3S2LA 4O1AA 1BSIA 4NI3A 1DHKA 5JH2A 3IJ8A 2QNEA 4UZUA 4WJ8A 1HN1A 2V38A 4E0CA 2L5HA 3NEVA 3S9YA 5T9BG 3FHQA 3RM8A 5IHSA 1TQJA 2A4AA 2WMJA 1OYBA 4KT2A 1Z42A 2BODX 1SFTA 1XYLA 4LGXA 2DT1A 3N2OA 5FEWA 1VFLA 3MSYA 3LCHA 3WMCA 5IFTA 5CJMA 5LXXA 3CUXA 1TPUA 1PYMA 3AHXA 3ZT6A 4CQAA 1OCBA 3CUFA 3PBVA 4U31A 4B90A 4JCMA 5HOSA 2RJHA 3DFNA 4C1KA 3NOEA 4JPGA 3QYSA 3B4UA 1WAUA 4R27A 4L1WA 1MMFA 3GU2A 4XD5A 4DAFA 1XJBA 2VNCA 1K9EA 2W3ZA 5MKGA 1ZBKA 3GR7A 1JDFA 1JGIA 3LHTA 2D69A 3K30A 3KRBA 3VO0A 1J6OA 4LSBA 3BMXA 1XQLA 4JFUA 4QP0A 3D46A 2DIJA 5DLCA 3GNOA 2E8YA 1QFEA 1VPQA 3SAZA 3VOIA 3CT7A 4IUGA 3BK0A 1FP9A 1B9ZA 4PMYA 4KCVA 4JHOA 1M7OA 1VHNA 1OT2A 4JOMA 2FVLA 1L6SA 3ITOA 1CBGA 3HOJA 1VS1A 4MWAB 1HVQA 3W7OA 2IMRA 4FEZA 2FMOA 4CN6A 5LA0A 3GBEA 3TTOA 2BMBA 1E5JA 2ZXBA 3KUMA 4K7YA 2CBIA 2ZRWA 4LU0A 5BXRA 1EA0A 3LM3A 3NGJA 2ZX7A 2B31A 1DEDA 2VFFA 2HRWA 3GH4A 3ZJKA 4JX6A 3TLQA 3LCIA 4IQLA 4X9YA 3BZGA 2GLKA 1ME8A 4UQCA 1IZJA 4MDPA 3R0KA 1YMYA 1YE6A 3HPSA 3VNJA 1AMKA 2WVUA 2PLJA 1R30A 1QNPA 2W63A 1TFVA 5C71A 3HG4A 2FFIA 3W2NA 3NYDA 3ZZ1A 5CAKA 4BF7A 1A3WA 1GKQA 4WY0F 4D6HA 4NXKA 4UFMA 2PZ0A 1CPUA 5IOBA 1ZHAA 1OB0A 3QN3A 4WDTA 4DO5A 3PHAA 2DSKA 3UCCA 3NQAA 1BTCA 5CJ5A 3BG9A 2G41A 2CLFA 1ZAHA 1VRXA 4O15A 2FTPA 1V08A 2PTZA 1B9BA 4L64A 4RDWA 4EAMA 1N8WA 4HZ7A 3QC3A 3F03K 3MPGA 2WKJA 3EDDA 5BW6A 1RY0A 4ZQPA 2EPMX 3MP5A 1QPNA 3F4DA 2D2JA 1V7AA 2GVLA 4Q33A 3PB2A 3M0XA 4IL0A 1W1VA 3G8EA 2OO6A 3ABZA 1C7TA 5HPOA 3W3OA 3E0LA 3JW7A 5AOUA 4MGGA 4JIPA 5JMUA 4WSJA 3ME3A 2FYMA 5TAOA 4PTNA 1S5TA 3NZ1A 3B06A 2P5NA 1AODA 1S2TA 1XM3A 3MSRA 4A8RA 3EEZA 3MKKA 1EOMA 4V1YA 1D8CA 3MVTA 3KBJA 5T9CE 3LBOA 2WSKA 3QV8A 2PWFA 3VMOA 3SGUA 1QUMA 2H6RA 5ABFA 4ZO9A 4IM4A 2BGSA 1UR0A 1XIGA 4QTGA 5GVJA 3WQEA 3KVLA 3MUCA 4QX4A 2HXTA 2R1NA 4KRZA 3UWZA 2EGZA 1TG7A 1L9WA 3TWAA 4I6KA 4IPPA 3QF0A 4GVFA 4WGXA 3W6LA 3NL2A 3VFCA 1TTPA 4J3ZA 1Y0EA 4NG3A 5I06A 3HN3A 3IJLA 1C8QA 1JCMP 1BLIA 1ALDA 4ZOBA 7REQA 5G5IA 3VZZA 3VILA 2WPBA 2FQIA 1H7OA 4KEUA 3UWYA 3CH9A 2DW6A 2QUTA 4UXDA 3LMZA 3T07A 2VX6A 3ZIZA 4QJ1A 1TA3A 2XFWA 3DGRA 1O7AA 3KXQA 1PL9A 3TTSA 4WUIA 4RX0A 1SZEA 4L6HA 4PUJA 3U2EA 5FJUA 4AXNA 4CQBA 1NU5A 2VFIA 4PB4A 5A5WA 1U1JA 4D71A 2E1WA 1EUAA 2C1HA 4M1RA 2V3GA 2D73A 3UNDA 2REQB 3MB9A 3FVDA 2DZVA 1XLJA 1TVPA 1QI0A 1PX8A 1EP1A 4XD4A 1QR7A 5ABTA 1RV8A 2DZTA 3A23A 1UR3M 3OVGA 3W7CA 1JD7A 4YIWA 1EHAA 3M43A 1RLDA 1EF3A 4RDYA 4AHPA 2V81A 3PBMA 1E1FA 3UVAA 1BWKA 1GQJA 4O57A 1JZ2A 1FWDC 3WQCA 3PFMA 4AEOA 1CGXA 2BHYA 3G8RA 4EPKA 2WYSA 8A3HA 5C55A 4JTRA 3EPMA 4JFWA 4ACZA 3EXTA 1JZ3A 2J25A 3ZLHA 1XFCA 1AL7A 1FWWA 2YW4A 4DF0A 1JR1A 3CLWA 4P7OA 3IAPA 1A4LA 3ATYA 3FN9A 1R0MA 3F5KA 4IFOA 4E8GA 1LQ2A 4GINA 3H12A 2VGFA 4ZB5A 3DC0A 1JZ8A 5TIMA 2ZKMX 3VXGA 1OCJA 1Q6LA 1TCDA 3PR2A 1TTIA 4HPHA 5I3KA 1N8IA 3UYIA 3TFXA 3W86A 4HU3A 1XFBA 2EG6A 4JD4A 3VIJA 1W1IE 1FWFC 3OOQA 1YDVA 1P6WA 2HE5A 1BYBA 3MV11 4X22A 1YEYA 3F2BA 4BFAA 2ZTKA 4AD5A 4Y9MA 1XCFA 4KIEA 1FFRA 3SRKA 4LC6A 1AW2A 3IVTA 1X7FA 1KXTA 3IIXA 2Y63A 2QF7A 4LYRA 5HULA 3VD7A 3UWQA 3G18A 2PTWA 2BVDA 3K46A 2BBFA 2O56A 1W2PA 4NJGA 5C2CA 4JBRA 2VR5A 3OU8A 5D33A 2OWWA 1XYFA 3PS7A 3E2RA 2DH2A 5JBEA 1Q6DA 2R9RA 5FJJA 5A6TC 1KTCA 1M01A 1OX6A 5A6BD 1FY6A 2OVLA 4MWAC 3B8UA 4XKYA 2ZRYA 1GUVA 3O15A 4A3RA 2E3ZA 2O7SA 4AIEA 4GKTA 4K7VA 2O0TA 4AMCA 4PULA 4PMXA 3GSMA 3USBA 3WH8A 5GNZA 3POCA 4HCLA 4REQB 2G5WA 4XZWA 1PTGA 4WSKA 1Q6FA 2WBGA 4NAFA 3V1HA 3KDNA 4NZCA 5CQ1A 3EX3A 4AZCB 1TMQA 1LZOA 1XGEA 2CLHA 2XSAA 1GG1A 4EIVA 4DJEC 4TMBA 1MXSA 1ZB5A 1ZRQA 3NQ2A 2V9DA 1KV5A 3B97A 1Y8BA 4PMZA 1JDDA 2ZICA 1GEHA 3GC4A 2GDVA 2WC7A 1FTXA 1X8CA 2VURA 4NJJA 5KETA 4OBTA 3STPA 1QHZA 1AW1A 3OYXA 4WQ6A 1QU4A 5KEZA 3AALA 1ZCCA 1DIEA 4MPKA 4C6FA 4KRUA 1HL9A 2J79A 1M65A 1U30A 3L5LA 1W3TA 3E0VA 4UB9A 3THCA 3WD2A 1AJ2A 1M6JA 9XIMA 3S5ZA 4GIYA 4LUSB 4WD0A 3STGA 3MUXA 3QLLA 2GJLA 2HK1A 5AC5A 1Q6CA 1L8NA 2GWGA 1Q45A 1EC9A 3EWBX 2OEKA 1J79A 3L68A 3LTPA 4PR4A 2VM8A 2X05A 1I2RA 2YYUA 3EWXA 3NYZA 3HPXA 3DHUA 1R46A 5D2WA 2OMAA 1CCWB 1SFLA 1KC7A 1ZLPA 3IVSA 4DJDD 3QM3A 3C8NA 5E09A 1A5SA 2J8TA 1PIIA 3ZOAA 1GYLA 6ENLA 3R25A 3WBYA 2ZZ6A 1W3NA 2PD5A 3NUKA 3U7BA 4A05A 5G4HC 1KD0A 2X16A 1F9CA 2CU0A 1M53A 3IWPA 3WSUA 1A5AA 1EDQA 1M68A 1A5NC 5BROA 4Y9PA 5EMKA 1RK6A 1UD5A 1ZBCA 2ZX5A 4G2DA 4WIWA 4R7JA 1N55A 4M29A 5LNVA 2HVMA 3HJZA 3KCLA 1OG0A 4WCJA 1KBKA 3L0KA 3NNTA 5DF0A 3H2FA 4NX5A 4HNCA 3VIGA 1H7PA 2JK2A 3WLKX 3G3DA 4MKVA 2GVYA 4CU8A 2C3ZA 1NARA 3A5VA 3IJDA 4U2ZA 5IHRA 3WQFA 2RDWA 3STFA 2ISDA 1NDYA 3W2JA 4XVDA 3LNPA 3XINA 4JTAA 4D6CA 6REQB 3HGJA 3W24A 5RUBA 1DORA 1X1ZA 1VF8A 1I1WA 1ONWA 5FI8A 4GQGA 2YCIX 1XIFA 1Q7QA 1ODZA 3EKGA 1XINA 4Q8PA 3LQLA 4W8LA 3WH5A 3QC0A 1JDCA 5TD4A 4YTQA 3WELA 1P7TB 1D2KA 1IYXA 2QR6A 4IT1A 3AIRA 3W0KA 3PZVA 1CTNA 3R0DA 3S46A 3DG7A 4S3GA 2YDAA 2YLLA 5H8MA 4HMDA 2YZRA 4I9JA 1D9EA 3RX2A 2DZWA 4MY8A 1QVBA 2QW5A 4GGHA 4R9XA 3MV01 3UZYA 1DJHA 5DMLA 1J01A 2VEFA 3GG0A 4PA8A 2YYTA 3P93A 3DXIA 1FDJA 1XBYA 2VL4A 4ICCX 5DANA 4OJYA 4GY0A 4M1BA 1UW9A 1RQEA 3VKDA 3AIUA 4H9YA 4DO4A 1S2VA 2VELA 3NOYA 5LIYX 4P7LA 3WNLA 3NQDA 1GONA 4F0MA 3AI0A 1DWJM 4EPEC 2WXDM 1VYSX 1FBAA 2F84A 4EACA 4S3CA 3T0CA 1RJRA 1PPIA 4QDPA 4RR4A 1BWLA 4JYFA 1LBMA 5EA9A 1YNQA 2F9RA 3OYZA 3F4NA 4L1XA 1LBLA 4EWND 1WQ5A 2NXGA 4HZ8A 3MHGA 3KLKA 3HPAA 4O8RA 2IPFA 2I56A 2DVUA 1WKFA 3IGSA 3F5JA 4MFEA 3RX4A 1E9LA 1EGMA 2BS9A 2PDGA 2TPSA 5HJLA 3GNPA 5A69A 2J24A 2V5JA 4BI7A 1ICSA 4PMQA 4D6DA 3S2JA 1AH0A 1IGWA 2GGJA 3GC5A 2QV5A 3MWAA 4MUPA 1JEZA 4UNLA 4IMCA 4AF0A 4P61A 2X0YA 1X38A 1LUCB 5G4EA 1R9ZA 1YE4A 1Q6RA 4C1LA 4HKPA 3C3UA 1GVSA 5KZMA 3VIMA 2I1OA 1ZALA 3E2SA 4GI6A 2P8BA 4F2BA 1GQKA 3KWSA 3BL3A 1V3HA 2YZ5A 4JTEA 1D7KA 3B4YA 1Q6EA 3NDOA 1W8GA 3DI1A 1TE1A 2TYSA 4PN2A 1XLIA 4OV4A 3QGKC 3CAWA 3SN4A 2VCBA 1CECA 1OQFA 2DH3A 4GUGA 2A3BA 2J7HA 2ZUWA 1LT7A 4JNMA 3DBPA 4KFNA 1ZZMA 2AMXA 4Q8WA 1S46A 3VNLA 4HA0A 5BXPA 3Q65A 4LY4A 1ONXA 3FS2A 3K2GA 1LQ0A 4O0ZA 3UG3A 6PTDA 3GTFA 1J2BA 1VCGA 2C0HA 1M1BA 3MI3A 3LN3A 1VJZA 1OYAA 2GQ9A 5FJPA 3AU6A 3KBVA 5HNTA 3W7KA 1V02E 5HWNA 3GKAA 1J18A 1W31A 1UWIA 3ES8A 4LY8A 1C9WA 1V0KA 2XZ9A 4YWSA 3WDJA 1H7WA 4PH6A 4FLOA 1EQPA 4AHQA 1QNSA 4I5RA 2QF8A 4DRSA 5I3HA 4I6VA 5D2XA 1BKSA 2VEMA 3TZNA 3CEUA 1GOWA 3NIYA 3R6IA 3KRUA 1E51A 4ERGA 1XS2A 4GXWA 2Z1XA 2FPTA 3AJXA 3CQKA 2WM0A 3S42A 3S1XA 1TWDA 3PTQA 4KEVA 1XLKA 1E3ZA 2CKSA 2F6XA 4I3GA 1RJQA 3FXGA 3TA6A 2QJIA 3DZ1A 2WZTA 4YJ5A 1P6BA 2XVPA 3IPWA 2X1TA 5CPQA 3TKFA 3O0KA 2TMDA 3OW1A 1QI5A 4KERA 1LYXA 3KBWA 4KCWA 3GFXA 3UG8A 4GI9A 3NPUA 4OBRA 3O6CA 3ZLFA 1VRDA 2XVNA 3NQEA 4HU8A 2NUWA 3QMTA 3WFLA 4W8BA 3ECQA 4EE9A 4GCAA 5DRIA 4K1WA 4DXXA 3UXKA 3WDRA 1K70A 3U0HA 4Y6GA 3B8IA 4UUIA 1GNXA 4C65A 5JBDA 4RE4A 4LVAA 3WUFA 2JKPA 3MSDA 2GYIA 1IEVA 2X41A 4DI8A 1QWGA 2NWRA 1FDYA 3ANUA 5HK4A 1GCYA 1JCJA 2BOFX 2PU0A 1R3QA 2INFA 4J27A 4CQ9A 3L67A 3AYTA 3TIMA 2YDSA 1MEIA 1JXKA 4B92A 4LTSA 1JUKA 4QCEA 4GKLA 1FCBA 4KKXA 3L4XA 2FZMA 2TRSA 1PZ3A 3AYVA 4HD5A 4J3TA 2W79A 2BY1A 4GNKB 2CWNA 3BW3A 4D1IA 3H54A 3WLSA 4WSHA 1MYRA 1V0LA 2FKPA 4AHOA 3P62A 3RO8A 2AAAA 4ATWA 3AIWA 3AS2A 4GCXA 3VMPA 1LBFA 2ZZ7A 1XUUA 1PYFA 1UD6A 4L9ZA 5K7JA 3BURA 3N9SA 1BTMA 3GXTA 2WB5A 3GHRA 2AQVA 1H1NA 4V33A 1K6AA 1KCLA 5A8GA 1P1MA 1LRQA 4W87A 2VOTA 4C6QA 5IDZA 4BQ5A 2YOCA 2VC9A 2EO7A 1WPCA 3D47A 3AQUA 1GOXA 4IFRA 4JX4A 2DIEA 2NQLA 5KZDA 5LIXX 1UCWA 2NV2A 1IXOA 1JCYA 5AY7A 4N4QA 3VKKA 3HV9A 3CWHA 3RLVA 4G1NA 4MG4A 5EMMA 2YXOA 3IRDA 3KCOA 4DJDA 3FV9A 5FEXA 1GJWA 1KM1A 4PSPA 1CX9A 1ITQA 3CB8A 4M80A 3SCOA 3L4VA 2F2HA 5A94A 2QYGA 1EIBA 1GORA 4J3WA 4KPLA 1BSLA 2DT0A 4C6KA 1TR9A 1X6UA 5D03A 3RLHA 1RY8A 5IBXC 3HGSA 3CMGA 3KRZA 5E9AA 3JR2A 3IV3A 3CASA 4GZEA 5A1AA 5I02A 3SB0A 3NQ8A 4E8DA 5U7SA 4RXFA 3M4HA 3VC5A 2YBVA 3LZ5A 1ZS2A 4BEUA 3EDFA 1B90A 1P6CA 3MCMA 3OLDA 2ON3A 1IR2A 3AU2A 1UR2A 4UFIA 1XLAA 3GDBA 3M0LA 1UH2A 4JY8A 1UBSA 3U4AA 4A35A 2RDTA 1EIXA 4B5XA 3SRHA 4PBGA 2PDCA 1RR2A 4RPPA 4H2CA 1VYRA 3EB2A 3UR8A 3U9IA 1BVNP 2G50A 3CZKA 4ZE5A 2BTMA 3TWBA 3A5FA 1M03A 2G3IA 1HT6A 5M03A 3WUEA 1W56A 3B9NA 3I3DA 4GNJA 1PKLA 3KBNA 3GIPA 4JCLA 3UWVA 4NP7A 1H0GA 5GPRA 5CLTA 2QCFA 3LSCA 2EPHA 4E4UA 2XINA 3QPZA 3BANA 5I09A 5EU9A 1P1XA 5CC3A 2PI6A 4RCXA 1ME9A 1WBJA 4AZ6A 1XRSA 4J40A 2D20A 1JULA 3BG5A 5HATA 3H21A 3QR0A 2ZZ3A 2RH9A 1VQTA 1G4TA 4ADTA 4UFJA 2W66A 5F1VA 2QJNA 1CXFA 3QLDA 1UD8A 3B8VA 1Z48A 4B3KA 1FWAC 2NUXA 3AMGA 1DJZA 4D6GA 2DZSA 2RDXA 4RLIA 3VCRA 4PCTA 1QK2A 3BW2A 2OYMA 4BY3A 3FGCB 4UOJA 3OHIA 2WNQA 3T9PA 3DC8A 4OIFA 6REQA 8XIAA 3AOFA 1GQIA 3G0XA 4JL1A 2CCRA 3G6LA 5E93A 2QLYA 1JL8A 3UY7A 2OGYA 2VDHA 5MF5A 1FWHC 3LHYA 4ICNA 2BLEA 4X2RA 1NQ6A 3OJGA 3QYQA 3QQWA 3DYOA 2RFGA 3WQOA 2Z29A 1YHTA 4PUMA 3IS4A 2WQDA 1T99A 1DJQA 1R5YA 5TBOA 3L4UA 4A8NA 3WBEA 4UMAA 1WUEA 3RPDA 1W1TA 4B91A 3W1QA 3MO7A 2CFFA 1EYEA 3UWWA 3W72A 4CEXC 4DUWA 3PNZA 5EMUA 5C9ZA 1ISXA 1VP5A 5M2FX 4PFMA 2OB3A 5HDRA 3CL7A 4J35A 3C56A 1DQUA 2OOGA 3T8QA 4KGJA 1WZAA 1BG4A 5CH9A 1GWJA 2HJPA 1DJYA 2G3FA 4GABA 4PTVA 4MJZA 3VGGA 2DZXA 2EG8A 3KS6A 4LOCA 5I79A 2RGLA 4YVVA 3QBUA 4M19A 5ECVA 3H22A 5DT5A 4F2UA 1XI3A 4DJFA 3PJXA 5AKQA 1YXDA 4RNFA 4IP7A 2I57A 1ZY9A 3HV8A 2VZUA 3VM5A 2VX5A 3W84A 1XC4A 4HA4A 1BRLB 1C92A 4JTQA 3KP1A 1XLDA 4WY0A 4LBUA 4JN7A 3UZWA 1JRCA 4DPPA 4RZ5A 1K9FA 1RBOB 1WDWA 4LT9A 3CYJA 1MFVA 1GVRA 1TJPA 4TVCA 2Y85A 3VYLA 4EXQA 3EDEA 2ZWZA 4Y8EA 3QOMA 5D8ZA 2BVTA 2QVNA 3WLNA 1P48A 3NAVA 4MHBA 1T8QA 1YTKA 5DRCA 2HISA 3MUY1 4UTIA 4IIGA 5C54A 3II1A 3T0AA 3PUDA 3OB8A 3C3NA 3M0MA 5HQMA 3MA8A 1DE6A 4EK7A 4MADA 1S5NA 2GQAA 3GR8A 1EEXA 4P2VA 2H3BA 7XIMA 4GLEA 3H2AA 1P0BA 4XKMA 2IUZA 3T4WA 3C8FA 1XP3A 1G7UA 4JQ2A 3PPCA 5A6BA 3PULA 1GPFA 2ZVIA 4NZJA 3WQDA 2WVTA 2CYGA 2Y5SA 4AFYA 1HJXA 2AGKA 4R53A 2O9TA 1ISWA 4QSFA 3RFAA 4CD5A 2JBMA 3LV5A 3R8GA 1M7XA 2WKLA 3TQKA 2REQA 4XBSA 3TLLA 3KOXA 1UWTA 1FA2A 1PB0A 3CPRA 3BH4A 1VEMA 3IV8A 1JIBA 2XWDA 4FLQA 3KP0A 1EJRC 4HT3A 4CNUA 3FKKA 4QEEA 5CPTA 3F2DA 1H63A 4Y96A 4V28A 3RRAA 5FJOA 1PTDA 4QEHA 3AZSA 3K8KA 3ZWTA 1P43A 4JL2A 2KX9A 4AZBA 1V6VA 4F40A 4N4PA 2Y4SA 4INFA 3NZGA 5F2GA 4H00A 2WVSA 4KESA 1EJVC 1M7PA 1W3IA 3DKJA 2ACUA 1MRAA 3GB6A 1J4EA 1Q4NX 1TPEA 2WM1A 4JKMA 3V75A 2XGIA 1L0PA 3Q2DA 4GX8A 1Q66A 3AMLA 1UUMA 5CJNA 4JNYA 1VJSA 3SSZA 4CNOA 3ARUA 2HVNA 5I3GA 1MVYA 1Z9AA 2V3DA 3RHGA 3FY1A 2PU1A 5EBUA 2J27A 1G01A 3WLMA 2PDKA 9RUBA 4G6CA 3V4BA 1RJPA 1LWHA 3PK7A 3TN4A 4ECLA 4WJEA 4NAEB 2CLIA 6TAAA 3KZSA 4MY9A 4CD7A 4WEVX 1PSCA 2PGEA 3SSJA 3RGTA 4ACZB 3SGGA 1HF6A 5K9XA 3UGRA 2XFYA 3UPWA 3ZVIA 3O3RA 2GWNA 1WZMA 5AN7A 4GJ1A 3I6RA 3NPVA 1PEZA 2Z1KA 3A3WA 5DY3A 1DYSA 4RNHA 4YMZA 3EWDA 5HA7A 3C2VA 2QULA 3VAVA 3BSMA 4AX6A 3IRSA 1ZAIA 2Y70A 4GMEA 4AIOA 3J7HA 2CLMA 3P74A 1TPFA 1XLFA 3RIKA 3EYPA 3W7JA 1GHRA 4RL3A 4A29A 2GJXB 3LU2A 3IIZA 4LCRA 2Q02A 3LS9A 2ZQ0A 3WLLA 1UMYA 2D0FA 5HQLA 2HXUA 4GACA 4P7QA 2WQPA 2YA1A 2OLAA 1M04A 4ZB0A 3NEHA 2ATSA 1NFPA 4QE1A 1R85A 4LPCA 4HYVA 1EBGA 1HJSA 4NZ4A 4O1FA 4RDZA 3K8LA 2CLEA 4Q4OA 3SDOA 3QPEA 2OLHA 1EOKA 4W85A 4POCA 3GKFA 1E70M 5K3VA 1IV8A 2R1PA 1R3TA 2ATMA 3W07A 3CB3A 1X1OA 4TVDA 1JF5A 3OTRA 1LL6A 4UOQA 9CGTA 5IFPA 4ZB2A 1S2UA 4N0RA 1Q85A 1V79A 2EAWA 4JTGA 5A2AA 3CMJA 2C79A 3VNMA 1DWAM 4GYFA 2EPOA 3WLOA 3M44A 3W2UA 4YTSA 3WQ5A 4MFDA 4HNUA 2A79A 2FH6A 1OX4B 3VIPA 3VOHA 4OUIA 1PE1A 1M41A 3T0DA 3LI1A 4MB3A 4XD6A 4H6EA 4OFCA 1RD5A 3TYEA 4GXPA 2QAPA 1GPWA 4DUOA 5CC7A 2ZUUA 1S1PA 1Z32X 1PZ2A 4CNPA 1NP2A 5KZ6A 1KXQA 4XG1A 2ODOA 4GVIA 2V63A 2C1IA 1OHLA 4XVEA 3CU2A 1E5NA 1HZYA 1E43A 1SZNA 1TREA 4DF1A 2V5CA 4L9YA 1SJAA 4NF7A 3QQ0A 2FPYA 1AQMA 2QJJA 3PBYA 5D8WA 2ZA2A 2J77A 2PZNA 3C6CA 3R79A 1XLCA 2ZA1A 4BEQA 3ZJ6A 1OFDA 3CUGA 3G0UA 5IRPA 3N1AA 4PEEA 3L4WA 3S6OA 2Z00A 2YKKA 1DQXA 2CBVA 1JI1A 3RJYA 1MW0A 2VRKA 2ONEA 1CI1A 2VT0A 5CGMA 4NHVA 5CZJA 3W70A 4V1XA 3WL1A 3STCA 4C91A 4JIQA 1UZ1A 5REQA 2D3NA 1QOXA 3NJ3A 3UG5A 1W5OA 4YPJA 2VRJA 1TQXA 2J62A 3AYRA 3Q67A 3TNOA 1ZU8A 4GZ7A 1DPMA 4PMNA 3WJSA 1W5NA 4UTLA 2Y62A 1D7FA 1XH0A 4US5A 1BPLB 4LYQA 3PAJA 4BI6A 4IZGA 3LM7A 5LKYA 4RV3A 3VOCA 3UY8A 5CGTA 4Q4RA 4ENLA 1A50A 3GNXA 8TIMA 4ZMGA 1NOWA 4JXCA 4WGHA 2CZFA 3B0PA 3C2YA 5XINA 3NFUA 4FNQA 4K6AA 2WWCA 2V2CA 4M82A 1FKXA 3EOLA 2NT1A 3I7RA 1XPYA 5K4ZA 4JQ1A 3VTRA 1JVNA 4DIAA 4DHGA 4PUKA 1HKIA 4O13A 2QV4A 4O52A 4GQRA 1A0EA 3RMJA 4GBDA 4OUEA 2XISA 1K7FA 3REQB 3W22A 4IQJA 2B7QA 5A8PA 4N7QA 2J13A 4NJKA 4AVOA 1EO7A 2A3LA 4ASTA 3CZGA 2XUCA 1QPQA 1I2QA 1YPIA 4MLRA 1TJ1A 4UQBA 1UWRA 1SPQA 1R7AA 1DKWA 1RBAA 1E56A 3L0NA 3RLUA 1AL8A 3W29A 1OFAA 1JNEA 1G1YA 3CHEA 1ITXA 5LIWX 2NSXA 4NVTA 1V93A 1PTAA 1O6IA 2OQYA 2EF9A 3LPOA 1PUDA 2C19A 3CK5A 4ICMA 2E1DA 1W1PA 4YVXA 4LS1A 5HNUA 1EJWC 3GFZA 4CNTA 1H3GA 5AHMA 4JICA 5BMXA 1Q6GA 1UPMB 3SCPA 2DW7A 5A8NA 2CETA 2TODA 4MUZA 4A4AA 2NQZA 3UG4A 3R7MA 3CAKA 3ONBA 4ZO6A 1EX5A 1H51A 5FF4A 5JVLA 4E5TA 4QG9A 1PZ0A 3BJSA 1K8CA 1GOOA 1MNSA 3L5MA 4CCCA 3BAIA 1H62A 1BXCA 2FDSA 1FWNA 2FZNA 4UQAA 3W7GA 1G67A 5GNXA 2PDIA 1I6NA 2GK1B 3O6AA 2YBUA 1SO3A 4JGDA 3R58A 4O12A 2ESCA 2ZZ5A 2DGAA 2PRMA 4N9EA 1S39A 2WMIB 4KMQA 4DF2A 1ENUA 4QROA 2Q8LA 1P0DA 1V6WA 3ABXA 2EEXA 2WSRA 3C0LA 3ARXA 2YB4A 2CEQA 1OGSA 5J8LA 4RDVA 2QJMA 3DESA 4EX4A 6ALDA 4Q4QA 3DBNA 3U5YA 4J28A 2J47A 3AHZA 4BCEA 2VZSA 1ZJIA 3D5HA 3MT1A 1HQTA 4IQEA 1VCVA 1XISA 2RUSA 3THDA 3QGVA 1D3HA 3SUTA 3KOWA 3FX4A 2UBPC 4RE2A 4AD4A 1HL8A 2GSEA 4W89A 5LGXA 3BZJA 3W1MA 3GTNA 1UASA 5DMYA 2R1KA 1OEPA 1L8PA 3P5YA 1E6SM 1C90A 3PZIA 1QK0A 1ZGDA 4E2BA 3CBWA 3BDKA 3UXDA 4KGLA 1NIUA 1TSIA 5LYRA 3GHTA 2PDHA 1TZ9A 1KFCA 4LUTB 3HQPA 2EKGA 1LL7A 1BGAA 5F4XA 1ZJBA 1SO4A 1KFEA 4FHAA 1ZFJA 2OT1A 2ZXAA 3N4FA 4QS5A 3V18A 1C8YA 2G95A 1WAWA 1GOIA 2HBXA 3N6QA 1NFBA 5CG7A 3O06A 3QMSA 1BWVA 2PP3A 4YVPA 4UWMA 4XSLA 4XZLX 2J75A 1UH4A 3GC2A 3HQNA 4YTUA 1RVGA 3EKLA 2JFEX 4M6UA 3WK3A 3CUZA 1OBAA 4LVDA 1IIHA 4FIQA 2POTA 4HPNA 3C0JA 2JKEA 4IPNB 5D09A 1EEPA 3SCUA 1WXJA 3MP3A 3CZ8A 1MRQA 5LZLA 4FNUA 4RXGA 5I07A 3AIBA 4DYJA 2E9LA 5DELA 3M5YA 3VDCA 3OZOA 2VO5A 2E9MA 3P84A 5HMDA 4GQBA 2Y2WA 1F7BA 3A4XA 3W2KA 1E9IA 1UP3A 2XFRA 1DWIM 3W02A 3A9IA 1AJ0A 4AB4A 1TV3A 4IJCA 1XLBA 3C4UA 4LS0A 2W9MA 3M5XA 4LFYA 3VD5A 3BOLA 4DJDC 3WYZA 3V5CA 5KZEA 2QGYA 2G0WA 3O6YX 4MTVA 2BZNA 2VD9A 4GO9A 1EXBA 1ISYA 4FF7A 4IH3A 4JTCA 2FFCA 2EPKX 1THFD 2V82A 1T96A 1XC6A 4XAFA 1RD6A 2PGFA 4MKSA 4Z2JA 4UTWA 4MPQA 5DCBA 3S83A 3LLXA 5BCAA 2TSYA 3N19B 3E0IA 2BY0A 3ALGA 1UKQA 2A3CA 1KW1A 4QNEA 3MY9A 2Y24A 4JTIA 2QQ6A 2E7FA 3O8AA 5XIMA 5FJTA 4S3DA 1AG1O 3ZSTA 1WKYA 3EMCA 1XF0A 1UUOA 2C14A 2E67A 5FCZA 4AD0A 1SM9A 1GQLA 3V3WA 4XO7A 3PUGA 5GQBA 1AFSA 2ZX9A 5A8OA 1CDGA 4C6DA 4DUXA 4GFSA 1KB3A 1XV8A 1XD0A 4OT7A 2HQAA 3SFKA 1F3TA 2YJQA 1VPYA 4H8HA 4GVGA 2A3EA 2FMNA 3KTXA 3CM4A 3C2RA 4FS9A 3LRMA 3S4TA 4GYKA 3PBUA 2VWSA 3BMVA 1VFSA 3SIMA 3PZMA 3G1YA 4NUWA 4TX9A 1V3MA 3IJQA 1HKWA 4H2HA 5AVHA 2OX4A 2E4TA 3U8GA 4LF1A 1EPVA 3OODA 3FYOA 4AYSA 1EZ2A 4W86A 4S38A 3RILA 2NXIA 3WF2A 4DWDA 4IL2A 2VTFA 2HTMA 2WMHA 4UCFA 1U5VA 4ORMA 4D8AA 4YLWA 5I3JA 4UTMA 3SY5A 3F1QA 4WKAA 2GDQA 1FHDA 4BWLA 3GRIA 1HP4A 2QPXA 4FMVA 1IR1A 1Z7AA 3P8JA 3U2OA 1IF2A 3NO1A 5A2BA 3OP2A 3N3MA 4FLRA 4AF0B 2FIQA 3UWEA 4ALDA 1EC8A 5CKSA 3KBSA 5EMJA 5I5RA 4LX4A 3TYCA 2QCEA 1VIWA 2I5IA 1MDLA 1J0JA 1GQNA 4NNCA 5DN1A 2VC6A 2A3AA 2WO5A 3L4TA 1A3HA 3G24A 2J9XA 3LQGA 2V3EA 4HPXA 2J6VA 1VC4A 2E6FA 2YXXA 3BE7A 3CL8A 4HA3A 3ZR5A 3LNMA 5C9RA 3BAKA 1GVFA 1F61A 3ONCA 2NW0A 3BO9A 4D8ZA 4MYAA 1K9DA 4FALA 1WZKA 1UBPC 1J0KA 3W81A 2BFGA 3AMKA 1ECQA 3MI6A 2OWXA 3R8RA 4ERAA 6CGTA 3W25A 3TYBA 3GAYA 2G3MA 3PC0A 4W7WA 4W93A 2CHOA 4XBJA 3LI0A 5JQ9A 3W7RA 1Y5XA 2YL6A 2W67A 1RVKA 4LAMA 3MUAA 1XKJA 2QCMA 1RA5A 3QTGA 3PJWA 5D30A 4B3LA 3FK4A 2FGBA 1AA1B 4HJWA 2GGGA 1UWSA 2PA6A 3U57A 2NVAA 1GOQA 2XSBA 3AC0A 4ZQRA 4URIA 1E6PA 1RCXB 2EQDA 1J96A 4PMUA 1NF0A 3GQYA 1Q6QA 2EHHA 3EBVA 1D8WA 4KIRA 5HWJA 2NQJA 4O50A 2PB1A 1W1ZA 4Z1AA 1QRQA 1UJPA 1UZHA 5BRPA 4UTWC 1OFPA 2X8RA 4QDWA 3B0XA 3W6YA 2NQHA 2GL5A 4HN4A 2W61A 1KFJA 2Z27A 3RM9A 4J3VA 1L6FA 3DERA 1XRTA 3XIMA 1OC6A 5TF0A 3BMWA 3BLEA 3GG7A 4FXRA 3DFTA 3CAVA 3HQ1A 3AHYA 3ZQ9A 2WSQA 2ZDSA 3IGHX 4GI8A 4M5PA 2G8ZA 3KVJA 5HR7A 2ZX8A 1JPDX 1FHVA 3RITA 1ELSA 4AY7A 5FF2A 3CIWA 1OC7A 2D1ZA 4AEEA 5E70A 1VFUA 4DEFA 3E0WA 2AAMA 4AZIA 5DT7A 4XISA 2CZ5A 2ZUVA 4WKFA 2PWHA 2X2GA 1OX5A 4X3ZA 5CSUA 2QCDA 1NOFA 3DU0A 3XISA 3CNYA 3E74A 3LGGA 4DJFD 1KBIA 4GQ0A 4HBKA 1A5OC 3GDRA 3VVGA 4QQ3A 2XJ7A 2YDQA 2WAGA 1G4PA 4UCGA 2VCCA 1NJJA 4TUFA 2EBNA 3FDKA 3AXXA 4K1GA 1A5BA 3TK7A 1TZZA 5KSWA 4D6JA 2J9ZA 5DY2A 3N11A 1O1HA 3PZTA 5BRQA 1KXVA 3IJIA 1QATA 1QOPA 5TQLA 4M3PA 4O54A 3WK2A 1JZ6A 3H23A 3ZJ7A 4QG8A 3LLDA 4M6QA 1NP0A 1HKKA 2GJXA 1US2A 2QAFA 3STEA 3TW6A 1TIMA 4B3ZA 2WJDA 4LCSA 2Z24A 5C7HA 1UD4A 3KZPA 2YCJA 3CPGA 4MJ2A 2QKFA 1AQFA 3OVQA 1KM6A 4XK2A 4XWUA 1KWKA 3O9NA 3TW7A 2ZA3A 3R0UA 4US6A 2H8ZA 2FHBA 1R3VA 1OIFA 3UJSA 3HF3A 5A6MA 2FLIA 2OEJA 4MWAE 1JXJA 2XGBA 1H2JA 3BV7A 2JGYA 5HXMA 3GE7A 3HB9A 3BSGA 4BJHA 2CZVA 1N7KA 4GVHA 3W1NA 1G9HA 1UWAA 3I65A 5HNNA 4PCFA 5MHBA 2JIEA 3W2LA 2Z28A 1BD0A 1HP5A 2QCDB 3UP8A 2HNHA 3LK6A 4O1BA 4PTWA 5DMMA 1AUSL 3OIHA 5F1UA 3IUHA 3WNNA 7A3HA 5G4WA 4MF4A 3TFCA 2W27A 4RZBA 2V67A 3U5UA 5EY5A 4UFKA 2HPMA 5I03A 1BG9A 1OM0A 1SVDA 1MQPA 1J0IA 3BUVA 3ARQA 2YCKX 1VH7A 3EX1A 3QKZA 2CZEA 4JX5A 3P3BA 3BLLA 3GYCA 3BXWA 2WMGA 2XIBA 4YCPA 3T0TA 1UB3A 4G7EB 1MNZA 1YADA 4B16A 1OFQA 3VGBA 4IOTA 3TN6A 1B57A 1EGZA 3VE9A 1A80A 4DWSB 2QMJA 4ML4A 3WF4A 5HBFA 2GJNA 3QZEA 4PRWA 2ZXDA 4CUCA 1TV7A 3AXHA 1U83A 1TA3B 1DWGM 1MW1A 4ZCWA 2PPGA 3RG6A 4UMBA 5FF0A 1E1CA 2G3NA 3ITLA 4N42A 4C6PA 3NVTA 2P0OA 3TCEA 4MYXA 4CD4A 1XYMA 3RYSA 1XBVA 3CTTA 4PUNA 3V0TA 5EYWA 1PVNA 3BG3A 3CHVA 5HANA 4X0VA 4UTHA 3GG1A 4BWLC 4KETA 1BAGA 4IJRA 1V03A 2F38A 3NQ7A 3LRLA 1SW3A 3Q45A 4GG9A 3B03A 3PBGA 1XHGA 3A13A 5FEPA 4FXJA 5L9FA 1A53A 3W87A 1PCWA 4FNTA 4XAGA 2YL5A 2PDNA 4G8TA 4A22A 1E1EA 2J7DA 4H7CA 5A3HA 1IT0A 1JUBA 2GPTA 4D6IA 4L9XA 3K1DA 3NTYA 3VMNA 1OINA 1C8XA 4O10A 4ZO7A 3T2PA 1HNYA 1BVZA 3M9YA 4IMEA 1TMHA 4ZL1A 3B8DA 1AH4A 4JKLA 4H04A 4GISA 2XPKA 4PUUA 1E9YB 4H1ZA 5L6UA 4W7VA 4D8LA 3HFTA 3EAUA 2CLLA 2W4XA 1RP8A 2AQOA 3L2LA 2CWXA 3LGEA 1HTIA 3KLLA 5EMYA 3TC6A 5C70A 1A0DA 3MHFA 3GD6A 3H2MA 5EFFA 4GGBA 3WDQA 4CVUA 1SU5A 4H9XA 1Q13A 4EF8A 1DXFA 2IS7A 4KFOA 1QPOA 3BGAA 4JHMA 2AL1A 2GJRA 5D9NA 1GEQA 4UFHA 2DJLA 1RLCL 4EKJA 4CN1A 4HSNA 1E40A 5HJXA 4DBEA 1LLOA 1K8ZA 5HMSA 2QDGA 3NPWA 2QPSA 1XCXA 1JZ4A 3U48A 2DUXA 1W91A 3G0SA 4AW7A 1E0TA 2EJAA 1E6RA 3CT2A 2P50A 4GYJA 4FNSA 3PZGA 1A5CA 1O66A 3GXDA 3A4AA 2YLAA 1B54A 2A85A 3WD3A 2PDXA 2QJGA 1V3JA 3NZPA 3NVDA 3W7LA 2PODA 1YLVA 3LUTA 3GXNA 5HQEA 4F9DA 5M1TA 3C2EA 1HKJA 3ZYZA 3TOPA 2XGZA 3N18A 4CCEA 2VYOA 4AZ7A 1K02A 3GW0A 3BOXA 2CLOA 3MCOA 2ZZ1A 3CYVA 3BCDA 1RQBA 2ZUSA 4MNMA 2V2HA 3GNNA 3SURA 4GIRA 2Y7EA 3S2NA 4AIUA 3I68A 4LRTA 1KBBA 2OPJA 1OF6A 5KMYA 3R43A 4DXVA 5CPSA 1V3LA 1E9ZB 4HIBA 3RCMA 2DZUA 1B1YA 4K36A 1ICQA 1XR2A 3TYZA 4UTTA 3EWUA 1K3UA 1NELA 4JTUA 4RK8A 2RKXA 2OXNA 4M8UA 4GIEA 1NOUA 1OK4A 4JR5A 2D2GA 3WD0A 1MSSA 4EXAA 4QJ5B 2XN1A 1WOAA 1JYVA 1QNOA 4P8UA 2DJXA 3BICA 3IK2A 2QDHA 2GQ8A 1GVEA 2J78A 2OJPA 3FEMA 4ADUA 1IIGA 3OPSA 3W00A 6A3HA 4UTTC 1LWIA 1PKNA 3N13A 2I5QA 1OJXA 3QHOA 4PMRA 1TV4A 1US3A 1TPH1 4LQ1A 4PGLA 2XFFA 1J11A 3GXFA 4LUIA 4PUDA 3TV8A 1EF2A 3CLMA 1FFQA 2YPIA 4E2VA 3EX6A 3WF0A 3CV1A 1NWUA 4PL1A 3NXFA 5FA5A 3WN6A 4D6EA 4ACYA 1J0YA 1IWBA 1DJWA 5CSYA 3KVKA 1I45A 1J5TA 2Z1BA 3L4ZA 3GVRA 3K1GA 5LNSA 2E6YA 4XTDA 2VCAA 4A8LA 2E68A 4YYCA 2J7EA 4FOJA 5D2VA 3R12A 1TE6A 3BJTA 3SN1A 1K7EA 3QFWA 3W74A 1ME7A 4PRTA 2LLEA 2PBOA 7TAAA 5FOOA 3KOYA 2Y8VA 1A5UA 1JD9A 4IXXA 3MUIA 3QZ6A 4BHYA 3TN5A 1XIBA 2EPNA 3I4EA 3VX0A 2GUUA 4H9VA 4ORIA 2HS8A 4TQTA 5JUVA 3VCCA 3BARA 2PURA 2Z7GA 3PJUA 2KZHA 4B5UA 3FJLA 2ZCGA 3P80A 3QV6A 2NUYA 3DH7A 4YYFA 4JFSA 4J4KA 3H53A 2EG7A 3AIVA 1MFUA 3WFZA 3EEGA 5F2MA 3FSUA 3NPXA 2UY2A 4Y90A 4GC4A 5KINA 2GOUA 2V8ZA 4EAYA 3S1GA 1PDYA 1Z89A 3O0FA 3QQ1A 3C5QA 3N14A 5XIAA 1H7NA 3S1WA 1XIHA 4GJJA 3DYMA 1O95A 1XKYA 3TJXA 1EJSC 3OG2A 3E0FA 3Q37A 5DBTA 1ZSXA 3E96A 4Y9AA 1C9DA 1VD6A 4D6FA 1FWJC 5DQPA 1QW9A 1JNDA 1V02A 1UIPA 5AYIA 2BY3A 1SW0A 2CIPA 3CS2A 5CC5A 1SMDA 1YX1A 3D3FA 1NTHA 1J0HA 3IIPA 2VFGA 1DHPA 1SQ7A 1GW9A 1WDQA 3WQ8A 5B7ZA 5D37A 2DORA 3PZUA 3VD3A 5BXSA 2PDUA 4JZ5A 2FZBA 2FHFA 2H3DA 2QXWA 1F05A 2SFPA 1Y7VA 4RPQA 3EX2A 3N3TA 4HNNA 1W1B1 4U33A 4W88A 1UKSA 2VKZG 2VZTA 4GWEA 1K4HA 5CBBA 4Z2IA 3M07A 5SWUA 3QW4B 1X98A 3N2MA 1YIXA 4HCHA 2OT0A 3SZ8A 4GYPA 3UA4A 4Q4PA 2RJGA 4DAIA 4YHEA 1W8SA 2XG9A 2Z2BA 2Y5JA 1HKVA 4UTFA 3VNYA 3C52A 5BWFA 3GM8A 3T0BA 2P76A 2Z2AA 4HTYA 1RSCA 1V6TA 2PWGA 2CBUA 4MJMA 3IARA 3TQPA 2CXGA 1R3YA 3CQHA 2VEPA 1QBAA 2PSNA 1R9YA 3LA4A 4LC8A 3OGVA 1Q4WA 2WCAA 1B4EA 1QASA 3W23A 3N6JA 3OIXA 3V1PA 3TYDA 5F2LA 3QH2A 4K38A 4P7RA 4WOQA 1OGGA 1UC5A 1ITCA 3UXAA 2ZWYA 1XLMA 4ZE4A 1QI4A 1FH7A 1HO4A 2XSXA 3THQA 4WF7A 1U5JA 2BX7A 2UY3A 1AQHA 2OEMA 1QAPA 3PG9A 3PANA 1KRAC 3Q94A 1VBUA 3IUIA 1CT5A 3FKRA 3QSRA 4MLJA 2Y1HA 4E3VA 5C2XA 3ZJ8A 2WJFA 4F2TA 3NQFA 3SR7A 2R1LA 5E6ZA 4QCFA 5AHLA 5EB8A 4I7UA 2O92A 1KFKA 1AVAA 2J7BA 4U28A 4DUVA 4IIDA 1KWGA 4AAJA 1UR4A 3AS0A 1RH9A 3R1ZA 2DSUA 4U3AA 1W5PA 3FAWA 2CZDA 3QZAA 4MAZA 4HOZA 2A0NA 2JEQA 4G5DA 4A21A 3S3GA 3UA3A 2AMGA 4DPQA 1TJ0A 1UOZA 3PZNA 3B9DA 1LDCA 4Z0JA 2CBJA 1E1CB 3BQ5A 5A8MA 2I17A 1ONRA 1XCWA 1YXYA 4H41A 4JAWA 1RP9A 4US5D 4ZZ9A 1TPDA 1I9CB 4NZ1A 4PSRA 3UT0A 4OECA 2X0SA 1OZQA 3VUSA 1S1RA 5CXPA 1GK8A 1XL9A 4R85A 3WK1A 4ZA0A 2XVGA 4DX3A 3T81A 4OTKA 2E0PA 1SUXA 3LENA 2AL2A 4IP5A 3SQSA 4B2DD 1JFXA 1YNPA 3GVGA 3WY1A 3WUGA 3IJ7A 1S5MA 3WJXA 4S3FA 5IDIA 4XO6A 1CGUA 2WMKA 4NNAA 5AYZA 3B9AA 4HSOA 2W92A 4TIMA 3SCVA 4Q8TA 1S5WA 1Z8AA 2R14A 1OY0A 4QNWA 3N6HA 2PF0A 3T40A 3VKJA 2WSPA 4AD1A 5FAJA 4TU1A 4MKNA 3MANA 3UQNA 3VU2A 4NASA 3T08A 3UESA 1PWLA 1NDZA 1ZBWA 5HR6A 4ZBCA 3FYYA 3TTQA 4TV6A 4GOAA 1QCWA 3GR4A 4XZMX 5AZ0A 4GC3A 1F3WA 1NWRA 4Q8NA 4A3UA 3CPUA 2C8NA 3ICJA 1TWIA 2H9AB 3PWAA 1B30A 1UR8A 3BGGA 2XDFA 2WMFA 3RXZA 4Z2HA 3AFBA 2X2YA 4N9DA 3PZQA 4QLKA 3I3BA 2QDDA 1B3WA 5E0KA 4LAKA 2ZADA 4RZ6A 2ZDRA 2XIMA 5F4SA 4S3BA 1TVLA 4UTUA 4GUIA 4AH7A 2PDBA 4GZIA 4MJ4A 1KFBA 3O16A 1X1NA 4M7TA 3KTSA 4H7ZA 3WBAA 3VDBA 4XZBA 2Y7GA 1WXYA 1KBJA 4AUBA 3TH6A 3QSTA 3FJNA 1OX4A 1GOKA 2QUNA 2ZE0A 4DZAA 5C0QA 3GIQA 3T2QA 1GZJA 1F6PA 1OGBA 3MZ2A 2E5DA 4LVGA 3GH7A 3NO5A 3W26A 1A3XA 2I9UA 2E25A 1V6YA 3QR1A 4C6BA 4PMVA 4O0QA 1MQQA 1B4KA 3M0ZA 3EZ4A 2OU4A 4DN1A 1KTNA 4QLJA 1FQ0A 4R5EA 3VFLA 4GRSA 4O53A 8RUCA 3H4XA 1A5MC 1SZRA 1OZMA 3ZVHB 1W54A 3ZR4A 4OOUA 3W76A 4D72A 1MUMA 3AO0A 1OCNA 1KKRA 2PD9A 3TJ4A 5LNWA 3AROA 2ANUA 5CBIA 3LZ3A 1IXNA 3RAOA 4FIRA 4PUEA 1QHPA 3B8SA 5DFAA 5GJPA 2VEKA 2QPUA 3UJRA 2DZPA 1UWQA 3ERPA 5DX7A 3WO8A 7REQB 2GK1A 1VEOA 4PMJA 1SW7A 1BYAA 3VPLA 3LBMA 2BNJA 1HL2A 3NR0A 4HSHA 4MZ1A 4GY1A 1GJPA 3TP4A 2Q71A 1W5MA 2BB0A 1TIWA 1WV2A 4Q6XA 3H26A 3DN5A 3W7DA 4C1NA 4YCOA 2Y6ZA 4HQVA 5E5CA 4NI8A 1CB7B 1IGSA 5FJIA 3VI2A 1NVMA 3QHMA 3S0CA 5LIKX 1ADSA 1BRLA 1TPB1 3DHPA 5I3IA 3W75A 1WXZA 4DZIA 1SJDA 4KRTA 3KEHA 2A21A 5LIUX 4JTDA 3DDMA 3FJ4A 2YDRA 4ROQA 5FF7A 1EH9A 4TTUA 2J8FA 1R9XA 4OGZA 4P8WA 2VEGA 1QDSA 2Y89A 3CHDA 4R33A 4BQ4A 1HFBA 2GGEA 4L6OA 1YDOA 2KAUC 1Z44A 4C7FA 3FFSA 2A2IA 1B3YA 5A6LA 1JCTA 1TUFA 3MS8A 4CCZA 2V30A 3M7WA 4JTHA 4WK9A 1SFJA 1XQKA 3HBLA 2Z0IA 3FSTA 1DP0A 3G1DA 4LYPA 3D3AA 1W1A1 4K37A 5ENLA 2PAJA 3UR7A 2C18A 5EKYA 3EA2A 4QR6A 1TPC1 3ITTA 4JQAA 1IEIA 1P4CA 3EMQA 2VUNA 1IZCA 3OZPA 2J7GA 1Z69A 2IXUA 2O7QA 1JPIA 4MSSA 3UF9A 1EWDA 1VEPA 1EKOA 1RA0A 4UZSA 3K13A 3A3XA 1QI2A 4GBUA 1LQAA 2WNZA 3ZXWA 3MMDA 2VOMA 4M0XA 1W9BM 4UTKA 1BF6A 2W91A 3DYPA 3GS6A 5CG0A 1ZNNA 1RQHA 3BAJA 2B7PA 1GTHA 1PO9A 1GKPA 1TV5A 4GHRA 2XM1A 2A6LA 4AY8A 2PDWA 4GE8A 3W73A 1I8JA 2ISVA 1O68A 3W37A 3OA3A 4AD3A 3CEPA 3SEPA 1H4PA 2QCNA 4GI4A 3UEQA 2X7VA 3E12A 3NO3A 3LHZA 1ODUA 3LOTA 3P8IA 1F76A 5B80A 4HHHA 1FWGC 4J1OA 4D9PA 4FB7A 4U10A 4F8XA 3EOUA 5AZ1A 1V51A 1LTDA 2QCGA 5CPMA 2DDXA 4F0SA 1UWUA 3F2CA 1Q2RA 1IEXA 3VD4A 5A6AA 4NJHA 1UKTA 4IIEA 4H01A 2A6NA 3S1VA 3CO4A 1AW5A 2XM2A 2ZYFA 1XLHA 5LNRA 1XX1A 4Z1YA 1R6WA 2J66A 4UTJA 3G1RA 1EYWA 4GY7A 4HK5A 2E40A 2R91A 1VZWA 1VENA 1K8XA 3W4RA 2NSOA 2QIIA 1G94A 2WZIA 4LAUA 5C9XA 2G3JA 4QGCA 1EP2A 2AKZA 3OEXA 3SY8A 1E6NA 1R7OA 2PC8A 4JKKA 2WK2A 4I8YA 1NDVA 4BK9A 3E3HA 1DOSA 3VNZA 3PTKA 3A47A 2POZA 2DV0A 2QS8A 5AYYA 4IGSA 4Y8FA 3HG5A 3LCXA 1BEUA 3ZS4A 2C16A 2ZOXA 1JF6A 2XHYA 2ASHA 1UPPA 1OFBA 1VFMA 4O14A 2F61A 3F4CA 4LEFA 4MOZA 1AH3A 1C3FA 4Z2LA 1IZKA 1W17A 3CWOX 3S9ZA 1BQCA 1EL3A 1F6KA 2DZBA 3AXMA 2BV9A 3KL5A 4LH8A 1I2PA 2CHRA 4DBWA 1SJCA 1FX6A 1H5VA 4C5ZA 5KITA 4GXMA 2PRLA 4Q7BA 3SM0A 2Y88A 4ZSTA 2C13A 3GAKA 1Q65A 4X0NA 3SECA 4C1NB 1TTQA 5CCZA 1KGWA 4XV0A 1YDYA 3HGOA 3HG2A 5FD0A 2WHJA 1I75A 4EANA 4Y9NA 4U5KA 3BLPX 4ZTYA 3LTYA 3QTPA 3MMWA 3L4YA 5LHFA 2Z25A 3CHFA 2PDQA 1ZENA 2XWEA 4IG2A 4PBFA 4PB3A 2QGHA 2VUYA 2BSLA 3LCWA 1WDRA 4Z08A 2PDLA 3M64A 1B3OA 1W32A 4E4PA 1JQXA 3LV6A 1TWZA 3PWGA 5I77A 1VGAA 4P5UA 4YS1A 1SZGA 4AQLA 1JG9A 1TX0A 2Y8UA 1O12A 1HX0A 5HUOA 1ZTVA 4DZHA 3VGEA 3H55A 3OGRA 1T6MA