2FFIA

Crystal structure of putative 2-pyrone-4,6-dicarboxylic acid hydrolase from pseudomonas putida, northeast structural genomics target ppr23.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
273
structure length
273
Chain Sequence
LHLTAIDSHAHVFSRGLNLASQRRYAPNYDAPLGDYLGQLRAHGFSHGVLVQPSFLGTDNRYLLSALQTVPGQLRGVVMLERDVEQATLAEMARLGVRGVRLNLMGQDMPDLTGAQWRPLLERIGEQGWHVELHRQVADIPVLVRALQPYGLDIVIDHFGRPDARRGLGQPGFAELLTLSGRGKVWVKVSGIYRLQGSPEENLAFARQALCALEAHYGAERLMWGSDWPHTQHESEVSFGSAVEQFEALGCSAQLRQALLLDTARALFGFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 2-pyrone-4,6-dicarboxylic acid hydrolase, putative
publication title Crystal Structure of Putative 2-Pyrone-4,6-Dicarboxylic Acid Hydrolase from Pseudomonas putida, Northeast Structural Genomics Target PpR23.
rcsb
source organism Pseudomonas putida
total genus 78
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 2ffiA00
2R1LA 2DVTA 1UIOA 4MUPA 3K2GA 4RDYA 2EG6A 1K1DA 1YRRA 2YB1A 3TNBA 1EJSC 3N2CA 4WVXA 3O7UA 4XD5A 2O4QA 3DCPA 4C6EA 1EJXC 1RJRA 2A3LA 2GWGA 3A3XA 1KCXA 4HA0A 3UPMA 1GKRA 3K4WA 3CJPA 4LAKA 4BJHA 3GTIA 1YIXA 4IG2B 1YBQA 1GKQA 4QSFA 2BGNE 4HK5A 1XRTA 5FSEC 3URNA 3F2BA 2ZC1A 4CEUC 1RA0A 3GIPA 3F2DA 3G77A 4C65A 1FWFC 3KM8A 1M65A 2Z2AA 3E0LA 4NP7A 4RE0A 3MSRA 3E2VA 1DPMA 2Z29A 2GWNA 2YXOA 5HMFA 5LXXA 3ORWA 3UR5A 1FKWA 5E5CA 1A4LA 3TN4A 1RK5A 3EWCA 4RDWA 3AUOA 2EG8A 1ITQA 3GU2A 4LAMA 3O0FA 4AQLA 4KQNA 1EJRC 1RAKA 4KEZA 4UBPC 1EJUC 2P50A 3HPAA 4C6BA 1JGMA 3GIQA 3GU9A 3NQBA 4XD3A 1V7AA 4GZ7A 3PNUA 1UMLA 4F0LA 4GOAA 3AU2A 4H9ZA 1M7JA 1HZYA 3EGJA 4M51A 4H9VA 3TN6A 1ONWA 2Z2BA 4IH3A 4C6PA 2Z25A 3B0XA 4LCRA 4IFKB 1YMYA 2D2HA 1M68A 3GG7A 1NFGA 4KEUA 1J6OA 3RYSA 1FWJC 2FVKA 4IFOA 1A5NC 1ONXA 3BE7A 4GBDA 1KRCC 3IRSA 3RHGA 3T81A 1BF6A 1POKA 4GY7A 1FWGC 4QRNA 4KIRA 1NDWA 2OGJA 3PAOA 1R9YA 1UBPC 4CNTA 3ITCA 1EF2A 5FSDC 4F0RA 2YZ5A 1FWDC 2F6KA 4CNUA 2P53A 4ERIA 3MJMA 3RN6A 4ICMA 1V77A 1J5SA 4H9TA 3CAKA 2O4MA 4IF2A 4B3ZA 1J79A 4C6JA 2VC7A 4C6CA 4EPKA 4G7EA 3B40A 3D6NA 1S3TC 1P6BA 1YNYA 4LCQA 2HQAA 3DC8A 4HK6A 3URBA 3MDUA 5HMDA 3A3WA 1POJA 1R9ZA 2R1KA 4I6KA 2R1PA 3IARA 2AQOA 4LCSA 2VUNA 3NEHA 4XD6A 1P1MA 2YB4A 1NDYA 4C6KA 3QY7A 4H9UA 1I0BA 4WGXA 4IQJA 2E25A 3C86A 4LANA 4C6IA 2HNHA 4NG3A 3IPWA 1A5KC 1W1IE 1I0DA 2AMXA 3F2CA 3E74A 4L9XA 2OQLA 3OJGA 2HBXA 2OB3A 1K6WA 4KETA 4EP8C 3R0DA 4GC3A 4GK8A 4ZSUA 2PGFA 2HBVA 4QTGA 4INFA 4RZBA 4QS5A 3OVGA 3LU2A 4LFYA 1PTAA 4DLFA 2Z24A 3OU8A 2QT3A 3WMLA 4DI8A 2Z4GA 1RK6A 2VR2A 3QGKC 3ISIX 1V4YA 1EJVC 1FWCC 3MVIA 4NI8A 1EJTC 4PE8A 1YBQB 4J35A 3MVTA 4DLMA 4Z42C 4PCNA 3LY0A 4IFRA 1ZZMA 2UZ9A 1E9YB 3LA4A 1KRAC 2OODA 4GY1A 1A5OC 3SFWA 2Y1HA 4LEFA 3GRIA 1UIPA 2Z7GA 1EZ2A 4QS6A 3CS2A 3PNZA 4XAFA 1EYWA 3PBMA 4H01A 3S2NA 3OOQA 4GY0A 4C6DA 1A5MC 4F0SA 4RDVA 3ICJA 4XAZA 4GXWA 4I6VA 3E38A 4V1YA 4DNMA 2XIOA 1FKXA 4IG2A 4IGNA 3UF9A 4KEVA 2EG7A 4DO7A 1RJPA 3TN3A 3FEQA 3UR2A 3UBPC 3RCMA 1ADDA 3MPGA 3LGDA 1GKPA 3MKVA 4TQTA 2D2JA 1QXLA 1NDZA 2DVXA 3JZEA 1RJQA 1PSCA 3GUWA 4IGMA 1QW7A 4ERAA 2Z26A 2WM1A 1P6CA 2FVMA 4C6FA 2GOKA 4PBEA 2HPIA 2QS8A 4CQCA 4CQDA 1FWEC 1FWAC 4LAOA 4H9YA 4B91A 2KAUC 1J6PA 1K70A 1ITUA 1O12A 3OQEA 3OODA 4CQBA 3K5XA 2QPXA 3NURA 3FDKA 4E3TA 4DI9A 2PUZA 1A4MA 2HPMA 1XWYA 2CZVA 3LNPA 3LS9A 2D2GA 3ID7A 2Q09A 4XAYA 4JOMA 2FTYA 4H9XA 1EJWC 3LSBA 4YIWA 4QROA 2Z00A 1V51A 3GTXA 4DZIA 1XGEA 2PLMA 2GZXA 2I5GA 4HK7A 4R88A 1PO9A 3TN5A 3IV8A 4XAGA 1R9XA 4GX9A 1XRFA 3GTFA 1VFLA 3E3HA 2PGRA 3T8LA 4KF1A 4DYKA 4C6LA 4IFKA 2WJFA 3A4JA 4EPEC 4BKNA 3E0FA 4C60A 1WXYA 2WJDA 4CEXC 4J5NA 4G7EB 4RDZA 3V7PA 2E1WA 2Z27A 3IACA 1WXZA 3LGGA 4B90A 4WHBA 2I9UA 1KRMA 3IGHX 4CNSA 2BB0A 3S2MA 3GU1A 4C6MA 4C6OA 4D8LA 2AQVA 1NDVA 1FWHC 3LSCA 2FTWA 2VHLA 4ZSTA 4H00A 3URQA 4P5UA 4LH8A 1IE7C 4EPBC 2ICSA 3DUGA 4UB9A 4B92A 4C5YA 1E9ZB 3F4DA 4LALA 2IMRA 5A6TC 3URAA 4H9MA 4J2MA 2UBPC 2GSEA 4L6DA 4PCPA 3B0YA 4HJWA 3WZ0E 1FWIC 2G3FA 3T1GA 3HTWA 4PBFA 1KRBC 4XD4A 2OOFA 3MTWA 2W9MA 1A5LC 5AKQA 3FDGA 4KERA 5CH9A 2WJEA 2FFIA 4G2DA 1O5RA 2QVNA 3HM7A 3MDWA 4V1XA 3AU6A 3QY8A 3SO7A 1FWBC 4BY3A 2DVUA 1V79A 4AC7C 3S2JA 2VM8A 4GX8A 5G4HC 3S4TA 5HMEA 2VC5A 4DZHA 2Q01A 4ERGA 4OFCA 3IJ6A 3PANA 3WYZA 3F4CA 3QY6A 4C5ZA 2ANUA 1PB0A 2R1NA 4EPDC 4R85A 3EWDA 2ADAA 4C6NA 4DIAA 3QGAC 4C6QA 2Z28A 4KESA 3GTHA 1RA5A 2R1MA 4GYFA 3S2LA 4R7WA 2RAGA 2PAJA
chains in the Genus database with same CATH superfamily
4F9DA 1DJZA 1IXNA 2AGKA 2BVDA 3N2CA 4WUIA 4PODA 1WKEA 5U7SA 5BCAA 2OZ8A 1LLWA 3VX1A 3H2AA 1QI0A 2W5FA 1S2WA 1XRTA 5FSEC 3NSXA 4JNYA 3L4YA 4C1NB 2VEIA 1BF2A 4FK9A 3W4RA 4LBSA 1L6FA 4MZYA 1IR2A 1FWFC 2WC3A 1FTXA 4OBSA 2Z2AA 1UD4A 4WJ8A 4MSSA 4LYRA 4NSBA 5T9BG 3ZJKA 4RXGA 3CUFA 4MJMA 3PTQA 1O4UA 2NWRA 1GZGA 2GUUA 2JGYA 3RRXA 2DZTA 3MHUA 3WQVA 3GBDA 1G6CA 2A2IA 4GO9A 4JY8A 5C8BB 2R82A 4GYKA 4FR6A 5EBAA 2P3EA 4I3GA 3BLDA 5D8ZA 2QJHA 3ONBA 4XD3A 1XYBA 1NH6A 5I02A 4FNRA 4X2PA 2DQWA 4H9VA 3N1AA 1FOBA 2QCHA 1W5OA 1XR2A 2ZX5A 4GVGA 1V0LA 2QCGA 4AIBA 3WQFA 1RUSA 4WLCA 2FVKA 1K9TA 1QK0A 1H50A 1Z42A 4GXPA 3EWYA 3O6YX 1M7PA 5TBOA 4JIIX 3KDNA 3VOCA 3L21A 2Y7EA 4BF9A 4Z1AA 1W3LA 5EL1A 1C7SA 4LVAA 2XIIA 4JEQA 1OSEA 5FEXA 3T0TA 3K8KA 1R3QA 1F6KA 2XN1A 3IUHA 3LN3A 3I3DA 3W86A 1S3TC 4GUFA 3E2SA 4O50A 3K13A 1QO2A 1B3ZA 3C61A 3OLDA 1TG7A 4FO4A 1AD4A 4B15A 1TWIA 1J5TA 1ZAJA 4L1GA 1RCQA 1NTHA 3QY7A 5GJNA 4XB3A 3WO8A 2CLLA 3IIOA 4IIFA 4RE3A 5B7YA 1V3IA 3EX3A 2HNHA 3B05A 3M7WA 1U5JA 4D6DA 2HEJA 2H3DA 3NXLA 3TK7A 4PMRA 1QR7A 3CHDA 4UUIA 1L8NA 1R38A 3QPZA 3GC5A 4OJYA 3NQDA 5I3HA 2HROA 3G18A 1PYFA 5CG0A 2OXNA 3G22A 1VEMA 2I1OA 1K8CA 3KWXA 1OCBA 2Z4GA 3MW7A 1GT8A 3DI1A 3VUPA 1S3HA 1AQFA 2FZ9A 3R8RA 1SJDA 3HG3A 4LQ1A 6TAAA 4F0MA 1FDJA 3SCQA 1V3KA 2VP8A 3TEVA 3TSBA 1QO5A 4LEFA 3GHTA 1XKJA 2WCGA 3MP3A 3SUVA 1V03A 3O6CA 1JZ2A 5MF5A 1W8SA 1YNPA 4JTJA 1GOXA 1RQEA 2ZE3A 1EHAA 4IGNA 1KFKA 1VCGA 3VNJA 4IX0A 1DQXA 4AYSA 4DELA 1V0NA 3CU2A 3LGDA 5REQB 3G6LA 4JNMA 1RR2A 3C0QA 2XM2A 4ERAA 4KRUA 3K8LA 3B9NA 3XISA 1EJ7L 9XIMA 2VEMA 2ZXAA 2G95A 2YW3A 2WO5A 1K70A 1QI3A 3RLHA 3PJWA 3RO6A 5CC6A 1K03A 2PCQA 1ECEA 4JX6A 4WIWA 8A3HA 4JCMA 4U28A 1V02E 4D6FA 2ZZ4A 1LRQA 1G4PA 3W82A 3QF0A 3N6HA 1EJWC 4JTDA 3GTXA 3CZEA 2FPYA 5A5WA 3HBLA 5AHEA 4US6A 4WKAA 3IIZA 3QVQA 1KXQA 3GTFA 4O16A 3PZUA 3EA3A 3E3HA 3T8LA 3VE7A 1V6UA 3DX5A 1YYAA 3OZPA 2CHRA 3TXVA 5HWJA 4DN1A 4C60A 4IISA 5HWMA 4RPQA 1UUMA 3U4FA 1HW6A 4PUJA 1DWIM 2J75A 2WCSA 4K8EA 1OYBA 2VDHA 3AIUA 1UKPA 5K7JA 3MV11 2PBGA 2VEGA 1XD0A 2BDQA 2EXOA 2EEXA 2YCIX 1OX4A 2VCCA 4EPBC 3V1HA 4LALA 1LOLA 2IMRA 3UYIA 3URAA 1O5QA 6XIMA 4W8AA 3IJ8A 3MO7A 2IXVA 5J04A 2XVGA 3ECQA 4NL1A 3VD3A 3M5VA 4JPGA 1G94A 1L2QA 2QDGA 5E93A 1AQ0A 3VZYA 4GQ0A 3LCFA 1L6GA 1RY0A 4J7RA 3AU6A 1GHRA 3WJXA 3QY8A 1DIKA 4K2SA 5ECUA 4JN8A 3M0JA 1CGXA 3BVJA 4LVGA 4GPNA 3ARPA 1V79A 3WD4A 2E09A 1DXEA 1B1YA 5HNRA 1XLGA 1AG1O 1J0KA 4DJDC 1IWBA 2ONEA 4A2SA 2Q01A 3GNPA 1CXKA 1KM5A 1FHDA 3SCTA 3CUIA 1RA5A 1DQUA 3W9ZA 3S2LA 2R1LA 3H2NA 4NAFA 3RLUA 2J7BA 2VO5A 2VQTA 3QR1A 3KVLA 4P61A 3LK6A 1WDWA 3SCNA 2PLKA 4JTAA 3UA4A 3MI6A 3CJPA 1KKRA 4R9XA 1T8QA 1XLAA 3T44A 1VENA 1AZ1A 1UH3A 1E6NA 4QSFA 3V1PA 3LHWA 5CZTA 3EXSA 3CASA 3F2BA 4F2BA 4NILA 4P8UA 1OC5A 1Q6RA 1V3MA 3EKZA 3F2DA 1U5VA 3MCMA 2CCRA 1L6SA 2DW6A 5FESA 4AVOA 4FXFA 3LHTA 2PDYA 3QOMA 2GWNA 5GQBA 3WMSA 2BSLA 3WK3A 1P0NA 4RDWA 1P0EA 3EMCA 1JVNA 2V2DA 4JTUA 4BFAA 4O1EA 4DJFC 3EBVA 1PL9A 1I8JA 2WC4A 3AOFA 1BD0A 5H8PA 3WJZA 3N18A 3E5BA 3ABRA 3M6YA 3LMZA 1GZ1A 2VEKA 3QW3A 4H9ZA 1W1VA 4WF7A 4J2PA 1TPH1 4UR7A 6ALDA 1ESWA 3HFTA 2VFDA 1WPCA 2VJXA 4AEEA 4HHLA 4ROPA 1ELSA 3FA5A 4K3ZA 3C2OA 1XLKA 1LQ0A 3GR8A 1N55A 5DT5A 4WOZA 1D8WA 2X0YA 3N9KA 4ZQOA 5FL1A 5LGXA 3LRLA 4HMCA 4JZ5A 2J7CA 3UJRA 2ZRWA 3WLSA 4DPQA 1UBPC 3SCUA 1U22A 4S38A 2WC7A 1X38A 3SUTA 3NOEA 1E71M 4TIMA 3DBPA 4GFIA 4D6JA 2EKCA 2J66A 1OX4B 4OUEA 3CNYA 4EX4A 2J27A 4KFOA 1P6WA 3MCOA 3M43A 4FEZA 1EOKA 3IJLA 5B7ZA 1XYLA 3B40A 2Y88A 4A29A 1HKKA 3D6NA 3MI2A 3MBFA 4GO8A 4TX8A 3FYYA 3WBEA 2V63A 3L66A 1E5NA 1D3CA 1XG4A 2IKIA 3UEQA 3WQ6A 1FCQA 2NVDA 5ABEA 2P10A 4Z1BA 2Z6JA 2ABAA 4H9UA 2VOMA 1NVMA 3C86A 4ML4A 3PC0A 4G5DA 4IJCA 5FF0A 3KOWA 2FGBA 3HJEA 3B8WA 2OQLA 3WLQA 4EIVA 2EF9A 2FJUB 4QG6A 3GDRA 2YDAA 2CXEA 3SY8A 1W17A 1WQ5A 1KTBA 4QTGA 3PJXA 3TLLA 4HPGA 4E4FA 2C3ZA 3QMTA 3JRKA 1LLOA 3QMRA 5XIMA 2WMKA 3ZO9A 2QJNA 1OFPA 1U1JA 2NSOA 3UG3A 3W73A 3RAOA 4W7VA 2PTXA 3B4YA 1QI4A 4RJEA 3KTSA 1NAL1 3OEXA 2BV9A 4N4QA 2X41A 1VYSX 4Z42C 1OINA 2J74A 2UZ9A 2BBFA 2NQJA 3UXAA 1Q6OA 2RDWA 3GRIA 4MKVA 4Q22A 5SWUA 3PTDA 4H01A 1AW1A 4GY0A 3LRMA 3WF4A 1FCBA 1NEYA 4CUCA 2RFGA 4N02A 3ABXA 1JR1A 1GVIA 4Q8VA 5HA7A 4AF0B 1TA3A 3VGDA 3XIMA 1OG6A 1BYDA 2ISVA 3UWVA 3CZ8A 1JF5A 2I14A 4Q7BA 3BV7A 2CERA 1JFHA 3GHRA 1L2UA 2QS8A 1K8YA 3FHQA 3TONA 4LW7A 1WZMA 1RP8A 3P82A 2RJGA 5LHFA 1HF6A 3K5XA 2Z7KA 2HE8A 4O11A 4J4KA 4LVDA 3MHGA 4V28A 2Y70A 5LA1A 2JF7A 3MKCA 3KVMA 4TX9A 4IMGA 3PBWA 4Z2KA 3MJYA 5M17A 4XZBA 3UJSA 2CW6A 3FAWA 2DT1A 3BANA 1XGEA 1SM9A 2PRMA 3LPFA 3SCRA 4TVCA 4HNOA 4GX9A 1R3WA 1VEPA 4AAJA 4IMAA 5FKYA 3T4WA 5I2UA 4UWMA 1J0ZA 2PZ0A 3PP7A 1NWTA 1M7OA 1BYCA 1QOXA 4LBRA 4XQ6A 3WLLA 1FP9A 1K3UA 4HNCA 2ISWA 1LZOA 2VRJA 4CD7A 5F4SA 1TV7A 6A3HA 3E96A 2VL4A 2I9UA 4BZYA 2BB0A 2DSUA 2FZ8A 1UKSA 2Z1VA 1ZY9A 3USZA 1DWGM 1RZMA 3WLOA 4LH8A 4JTLA 4OECA 1VJZA 1C29A 4X9YA 3GWQA 2J9XA 5I09A 3KP1A 3MSYA 3GR4A 3RNDA 2ZDSA 1S5MA 4B16A 1WP6A 3BW4A 3PZ9A 1XIFA 1FH8A 1CEOA 4G2DA 3BLFA 1G67A 4YNGA 1JCNA 4H41A 5CJMA 1M3UA 4E3VA 3R5EA 3R25A 3BAKA 2TYSA 3NQMA 1V02A 2XIJA 4IMCA 4IPIA 1KFJA 4POCA 2VM8A 1TJ0A 4YHGA 1LL7A 2DORA 4Y9MA 4FA3A 2FMNA 3ATYA 3AJ7A 4OFCA 4LJ3A 3IV3A 1MW0A 4W93A 4GJIA 1HIZA 4XBSA 3EWDA 1NOWA 1PX3A 2FFCA 1OYCA 4M1RA 3WY1A 1KCLA 2ZZ2A 1KW1A 1KGUA 4AW7A 4MFDA 1OEPA 2V3FA 4G6CA 4RE2A 3EA1A 1HL2A 1YBQA 2A3AA 2Q8LA 3THAA 1WUFA 4M56A 4UMAA 4CVWA 4S3EA 4X60A 1TA3B 5GPRA 2V67A 4K38A 4MADA 1WX0A 3VD9A 2XGBA 2YL6A 4TR9A 3HMJG 3W00A 3LTYA 3HOJA 5CZKA 3CB3A 3LHVA 1AMYA 4WRHA 3E0WA 4OBTA 2PWEA 2QHAA 2E67A 2ACSA 2OEMA 3GDKA 2WHMA 2ZZ6A 4KQNA 1T8XA 3L4ZA 3NO3A 4E38A 3OTRA 3W22A 5D04C 3EX6A 1T5AA 4ZB0A 5H8MA 2W63A 1A5SA 1KQYA 3EOOA 3GY1A 4M0XA 1LBFA 2QPUA 4JDYA 2QPSA 1ZHAA 4G7FA 4JIPA 1O5KA 1M68A 2DGAA 2PDJA 1DE6A 3TJ4A 4GQGA 3WK1A 2C6QA 3QM3A 4KBXA 4AD1A 2J6XA 3P84A 2Y8UA 3UXLA 3NVTA 2VTFA 4KIRA 1IXOA 3HGRA 9XIAA 3GD6A 2XINA 2VGIA 4HMEA 1RQHA 4M24A 5D33A 4RX0A 1US0A 4ZFCA 1UR3M 3PM6A 3PJUA 4FZIA 1DWFM 5CPTA 4FNPA 3WBAA 5BU9A 4MIMA 1NOFA 1GONA 3RG6A 4J3SA 3RM9A 3WLPA 4U31A 4EPKA 4FLSA 1HKMA 1XGZA 4GQRA 4MDOA 2VZOA 2QF7A 3PN8A 1VFTA 4E6MA 3KZSA 4NNBA 2QJJA 3THQA 4Q8TA 5GNZA 5IDZA 2D24A 1TREA 3OHIA 1P1MA 1E6RA 2VVNA 1HNYA 3AHTA 4RUBA 3WDPP 4WGXA 1GQLA 3HG5A 3AMKA 3FN9A 4Y9AA 4EOUA 3CAVA 2OX4A 5E0CA 4D72A 5GJPA 2WSKA 4UTIA 1W1IE 2QR6A 3F2CA 1F3TA 3A23A 2GSJA 4ZOEA 1MRAA 4MG4A 3SIZA 2WNZA 3FNDA 5AYXA 3LENA 4DUOA 1QWKA 1XYFA 1MWOA 3LZ5A 4JQ4A 5EBUA 4DBUA 5ABHA 5HANA 3OVGA 3GLCA 3OBKA 2IKJA 2NUWA 4NX5A 2DFAA 3MWAA 2W27A 4XZWA 3UZYA 3VU2A 4NJKA 2QUVA 1XCFA 4PRRA 3NSNA 3KS5A 4Q8MA 2Q8ZA 4P8XA 2XHYA 4N9CA 3Q58A 2J7GA 2MNRA 4I8DA 2YZRA 1YBQB 3BMVA 1TMLA 1DXFA 1WE5A 1OZMA 2PDBA 1VBRA 4ZB2A 3ZT5A 4PB5A 5DX7A 4PFMA 3SFWA 2XH2A 2V69A 2YSWA 4GZJA 2ZX9A 3C6CA 1M01A 3QJAA 1XIEA 4UNKA 4JKMA 4QNWA 4NNCA 2DIJA 1IIHA 4H7ZA 3VKJA 1VFSA 2FPTA 1EX5A 1TE1A 4IG2A 1GOIA 3I65A 3TOPA 2OO0A 3W7RA 1KTCA 4HZMA 3UY8A 4MF4A 2ZUWA 1PSCA 1ZP4A 2WQPA 2IQTA 2ATMA 3I3EA 4J1OA 3MO4A 3U7BA 1V3LA 2FZMA 4UC5A 4IQDA 4LAOA 4B91A 3OZMA 4PMJA 3USBA 1E0VA 5D9OA 4O12A 3WH9A 2CIPA 4DWSB 3EXTA 1OQFA 5HWNA 2BODX 2QULA 1N8WA 3LEPA 5HPOA 1A0DA 2FHBA 4XZ9A 2LLEA 2O9OA 1AQMA 1BKSA 1JAEA 1OY0A 1R9XA 3B8TA 2UY3A 3UJEA 5C9RA 4GFSA 3ZVIA 2PGRA 3G8EA 5CLTA 3IJ9A 3QEZA 2QGYA 3T0DA 3BAXA 1WKYA 1MQPA 4J5NA 2VRKA 4FALA 2O55A 2PURA 1B4KA 3AUJA 3IACA 3LXBA 3WCZA 4WHBA 4JS3A 4F66A 3WQ8A 3DEQA 2BY0A 3BWWA 3LSCA 4ZSTA 4H00A 1YNQA 1XBZA 3CTLA 4WZHA 1IE7C 2FZNA 1K9EA 3SCVA 4UB9A 1ZBVA 3F4DA 1GGOA 7TAAA 1CXLA 2ZWYA 2WMIA 4B3KA 1EEPA 3KVKA 3IJDA 2WWDA 2NZLA 3BLEA 3TP4A 3AXHA 4KH2A 3IRDA 3BCJA 4OE7A 3KXQA 5HBFA 4GQQA 3MTWA 1UP2A 1PVNA 5I3GA 4LYQA 3C2VA 4AZHA 3TTYA 3RUBL 1H51A 3ARTA 2XFFA 2KZHA 3VGBA 4YVVA 4YL2A 3O0KA 4FAMA 3GXTA 4LNCA 5MHBA 2G4FA 3LCIA 3UZWA 3VGEA 3STEA 2O92A 3RX3A 5DRIA 3W7CA 3GM8A 1IXPA 2WHLA 2ASHA 5HQMA 4JYEA 2E5BA 4ERGA 2HWGA 8XIMA 3RFAA 4GNVA 1K8XA 2IS7A 1I2PA 3N04A 3XINA 2XVLA 3BK0A 2CLOA 3ANVA 5KINA 2DZXA 2FHFA 1TPDA 4OVXA 1TV8A 1A47A 4O53A 4O0QA 1UC5A 1QATA 2INFA 4LVBA 3PZQA 2GWGA 2XIQA 3BJTA 4YTTA 3MY9A 1ISYA 5AOUA 3HZ3A 1S2UA 1I6NA 2OG9A 3EDDA 4LUTA 4IG2B 1W1ZA 1XV8A 1GKQA 1VR6A 2TMDA 4JGDA 2WQDA 3URNA 3ABSA 5I6SA 3EPNA 4YXGA 3DC0A 1QHZA 4IL2A 3RPDA 3W1UA 5M3WA 1BGAA 5F4XA 4OU1A 3E0LA 3NQGA 1Z6KA 4E2VA 3ZR5A 1PYMA 1JNEA 5HMFA 4M80A 5DLCA 3SCWA 1NJJA 1UD8A 4FX6M 1EJRC 4LC8A 3W0KA 2P50A 3PPFA 2WMGA 4GKTA 4KCWA 3MMUA 4Q33A 3NQVA 1M7JA 1H3GA 3EKLA 4QJ3B 1UOZA 4LNYA 3N29A 4AD4A 3N4FA 5K2ZA 3GG7A 2P88A 4Q8QA 3CV2A 3UERA 4IFOA 1KQZA 3TYEA 3HA1A 4O15A 2EHHA 3JZUA 4NRRA 3M0YA 4FNTA 4AWSA 2PWGA 7ENLA 3WD0A 1XC6A 1A3XA 4BQ3A 5FSDC 4AHQA 3RM4A 1LQ2A 2WNWA 3RN6A 3TZNA 2Q71A 5CJNA 3W1RA 4UTUA 3WH8A 5EU9A 4Q7IA 3WUEA 4DZAA 2WMIB 3MZ2A 5M1TA 1NIUA 1Z41A 1SZEA 2OYLA 1SW0A 3W25A 1PX4A 1W2VA 2GGHA 1IEXA 1TPC1 2KX9A 3WD2A 4OOZA 8CGTA 2HQAA 4Y9OA 1KWKA 4QDPA 3W7PA 3VM7A 3KLLA 3FOKA 3L7RA 3BMXA 3EA2A 5JIWA 1AFSA 3E0VA 1RCOB 3UG4A 4A8NA 3TYBA 2EPKX 5TNVA 2VUNA 6XIAA 2IPFA 3PAJA 1A53A 1CNVA 2PC8A 4E2OA 1OIMA 1Q6DA 1WA3A 1FFRA 1HL8A 4EF8A 2Y8KA 3K8MA 2QV5A 1B0IA 4ZMGA 5DANA 3FKRA 3IAPA 4XUGA 4EP8C 2XISA 1SW7A 1K4GA 4GK8A 4ZB5A 4ZSUA 1GVYA 3DHUA 3N9RA 3QTGA 3ZXWA 1P48A 4PCFA 2YBTA 5D03A 2NXGA 3E49A 1JPIA 1QTWA 1FWWA 4U5IA 1YPXA 5FJTA 3GQYA 2CZFA 1VLIA 4H8HA 5AC7A 3QGKC 3U2EA 3EWXA 2XH4A 3A4WA 4H19A 4R27A 1BWKA 4XX6A 2NQZA 1GEQA 4LUTB 1X8FA 1IEVA 1EO7A 1G7UA 1KGXA 3ITOA 4EXQA 4HN8A 4NAEA 4HU0A 2R24A 3N2OA 1P43A 3ITYA 4JYFA 2R91A 4EKJA 4W87A 2BXYA 3P7YA 5KITA 3PFMA 3GNRA 4QS6A 1U2YA 3CXOA 4QE1A 3LI1A 4Q6XA 3WDRA 1WDSA 5E70A 5IHRA 4D6EA 1XIBA 4FXSA 1B90A 1IZKA 1FHLA 4GXWA 4DNMA 1M1BA 3N2BA 1FKXA 4N2YA 2YKKA 1UR2A 3UZXA 1GOOA 4YCPA 3RK8A 2G4JA 3M6DA 5BZAA 2P0OA 5DFAA 4DWSC 4TMCA 1UD2A 1JCYA 4W4QA 4GUHA 1ZAIA 2Y7FA 4Y7EA 3DENA 4IGMA 5CZ0A 2WKLA 3TR9A 4PBEA 3UJ2A 1KCKA 2VVSA 3SJNA 3N2XA 4K6AA 4EWND 1VYPX 4C1KA 2GVGA 1CZ1A 4JOMA 2O9PA 4CU6A 3Q94A 1HX0A 3AMLA 3WNKA 3KRBA 3GFZA 2D73A 1YE6A 4DUXA 3ZZ1A 1Q7QA 1V6VA 2GYIA 2FPVA 3CLMA 4MHBA 4P7LA 4AZ5A 3W72A 3GHUA 4JX4A 4IFKA 3VKCA 4DUVA 2FB3A 5D2VA 1FCVA 3F4VA 2NX1A 4CEXC 4O14A 4V27A 1PWMA 1M7XA 3GIYA 1BQCA 3TYDA 2PCEA 1NFBA 1AW2A 3OBEA 1RALA 3E2RA 1HUVA 5FAGA 4UOJA 4AWTA 2VHLA 2ZUMA 2CETA 1A5AA 3DBNA 3N73A 1J18A 2ICSA 3NAVA 3M9YA 2QVHA 1GTHA 3P60A 1OK6A 4AZCA 4HOZA 1UR1A 3KBMA 3VA8A 4K36A 3C2YA 2UY2A 1WZLA 2YCJA 2WZMA 1W5NA 1W1YA 5AKQA 2R8WA 4CNNA 2J8GA 3C0JA 5CPLA 4IT1A 2BWGA 1A0EA 1I60A 4RNFA 3KHDA 3OLGA 3HV8A 1GQNA 1IEWA 5D4YA 3SQLA 1H7OA 1E6XM 4I9TA 3NCOA 4MYXA 2OYMA 1KGWA 1VC4A 2B31A 3S4TA 4PCSA 3U8GA 1ZQ5A 2Z1SA 1JZ8A 3BJSA 1D2KA 4EPDC 2WNNA 1J0JA 4MGGA 2OSWA 4NAEB 4ZBCA 1AH0A 5GVJA 1TPUA 3V0UA 4GWEA 1LDCA 3GFYA 1UIOA 1K1DA 1BEUA 3W2JA 3TNBA 4FOUA 3EWUA 3LD5A 3TTQA 1EJXC 1RPKA 1FDYA 2A3LA 2WMHA 3WQWA 3VIIA 2W92A 4U33A 2B7OA 1JXJA 2WW5A 2QGHA 3VKBA 5EB8A 2BGNE 1YEYA 2AL1A 4CQ9A 4TOQA 3UZ5A 1W8GA 3CUGA 3W23A 5AY7A 3Q4DA 4PL1A 1R0MA 2SFPA 3NIYA 1DJGA 1X1NA 3VOJA 1JJKA 2C15A 4M19A 2NV2A 2VDGA 1QAPA 2JFEX 3BQ6A 2AL2A 3E2VA 1XH2A 2Z29A 1HN1A 1E43A 1TRIA 2JGQA 4KCVA 3UR5A 1JAKA 4HMDA 2PF8A 2DZSA 5T91A 3STPA 3U9IA 2E5DA 2PD5A 4KMQA 1EGVA 2ZUTA 1GVRA 3P67A 5BW6A 2E77A 3ALGA 1EJUC 1WZAA 3R79A 1FXQA 3HF3A 2UWFA 4IQEA 3F4WA 3NQBA 4PTVA 2CITA 1Z8AA 4X3ZA 1XYZA 1XDMA 2DH2A 5IDIA 4HNNA 3CPRA 3GS6A 2YA0A 3AU2A 1VS1A 2ZZ7A 3AS1A 1O66A 4BI5A 1JCTA 3BW3A 1UWAA 4JQ1A 2BGSA 3WNMA 4TUFA 4IFKB 1YMYA 5AHMA 1RCXB 3CK5A 3MSDA 2Q3RA 2XN2A 4OBRA 1GCYA 2Y63A 3BE7A 4Q4SA 3F5LA 4UZSA 2NT1A 2A3BA 3EWZA 1MEIA 1OM0A 1F3EA 3LOTA 2GUYA 1U83A 2AGTA 3PAOA 1R9YA 1KR0A 4QITA 2I57A 3ONCA 3P0XA 4S2CA 5C2GA 3ABQA 1GK8A 4HPNA 4KRTA 4H7CA 2F6KA 2E40A 4DAIA 4P8VA 3PB2A 1JI1A 1V77A 5CXPA 1TJ1A 1XSIA 4B3ZA 3NZQA 3STGA 1J01A 4AZCB 4G1NA 1GNXA 1TFVA 4JTRA 3B04A 3WH7A 3I3BA 1FWNA 4BK9A 4AIOA 2WZTA 4HA4A 4L4MA 3IWPA 5FAJA 3AXIA 3R12A 4ASTA 2R1KA 4JIHA 3UY7A 4ZO7A 2OTDA 4Q4OA 3UJFA 3R94A 3MS8A 1JZ5A 2Q3OA 1T99A 3W2KA 1W1B1 2ZRYA 4EWJA 3LPPA 3TQ0A 1QMLA 5EMYA 3A64A 6TIMA 3STFA 1YPIA 3H2CA 3CIVA 4NKCA 3T05A 2QKFA 1B30A 4RK8A 1XQKA 3RO8A 3KL3A 2F9RA 2PGFA 2VWSA 5FF2A 2X09A 1SR0A 4WGHA 4MY8A 3EDKA 4Q8NA 5HR6A 3DGBA 1P0KA 1ZBWA 4LTSA 3Q67A 4CN1A 4RLIA 1I9CB 3NL2A 4UFMA 3QSTA 4W88A 4WXYA 2GL5A 3DIPA 3AYRA 5G2WA 2RH9A 5D02A 4AIUA 3VKAA 1E1CA 1WXJA 1E15A 1BGGA 5D2XA 1HT6A 4GA8A 1WKFA 3LBOA 2BHUA 4DLMA 2BNJA 3KOZA 3VIOA 1P1XA 1HO4A 4AHPA 4XWUA 4K8HA 3OA3A 1EZ2A 2D3NA 4US5A 2WLZA 5JH1A 4WKHA 2W4XA 3TU9A 2JE8A 2ZX7A 1YXCA 2XPKA 1QBBA 3WG6A 1H0IA 4XV0A 4N9BA 2C16A 5DCEA 1H11A 3ARYA 4J3XA 3U5YA 2XIOA 3NL3A 3GO2A 3TTOA 1ADSA 4LX4A 3UR2A 4V2XA 3W7MA 1JD7A 4JN7A 3HFYA 4Z0SA 3LHUA 4TQTA 2INZA 3M44A 3JZEA 3ES7A 3KRSA 1UMYA 3FVMA 3OGVA 3REQA 2QDEA 2GK1A 2WM1A 2FVMA 1GVFA 5A6BA 3H7RA 3IAQA 5LNVA 3A4AA 3MWCA 3VIFA 3UWEA 3CEUA 2J4GA 3WJSA 2PSNA 2GVLA 1D7FA 3S1WA 8RUCA 4YS1A 1VFUA 2R14A 1TELA 4LSBA 2CZVA 4LU0A 4W5ZA 3AIEA 3LNPA 4GIYA 2OELA 4O1DA 4AD2A 2WM0A 1VPXA 4PR4A 1O1ZA 1ZNNA 3I4EA 2BOFX 4MWAC 2YA2A 2PLMA 4PMYA 3VM5A 1FBAA 3CM4A 1H2JA 3TN5A 5E0FA 4MAVA 3VABA 4IUOA 1UJPA 3DFOA 1H7PA 2VYOA 2DUXA 4MMWA 3DFQA 3A5FA 3IANA 1VZWA 5G2IA 3N34A 4EPEC 4GISA 4IICA 4ZA0A 4WDXA 1RBAA 5LIWX 3OO2A 3M0KA 3GH4A 3L4VA 2PPGA 4ML9A 1XRSA 1MQRA 1AJZA 5DXYA 3FLUA 2V3DA 3ZVHB 4UMCA 3M0XA 2GLKA 1FWHC 3FGCA 3KOYA 3P93A 5JBEA 3AAMA 3T09A 1RLCL 3GTNA 4EAYA 2QQ6A 4CCCA 1W3NA 2VNCA 5AC8A 3HG4A 4O13A 1E9IA 5DMLA 3SECA 4LT9A 1XBVA 4PUDA 3LCHA 4HPHA 4LAZA 3ZMRA 2G3FA 2OOGA 4IP7A 3WL1A 2A3EA 3HTWA 3N6QA 4XD4A 2OOFA 2ZZ1A 2PTYA 5G5IA 4UXDA 3FDGA 4REQA 3DH7A 3R10A 2WJEA 2VX6A 1YDVA 2GGIA 1I45A 5LA0A 3D0CA 3V0TA 2C0AA 2O7SA 2QVNA 3PZNA 3C0LA 2NX9A 4V1XA 4L6OA 4PMVA 5EA9A 1PZ0A 3OP2A 3TWAA 2X0SA 2V2CA 4JX5A 1W9UA 1S2AA 2VD8A 1W3HA 2WKJA 4GVHA 4J3ZA 2OQHA 2D3LA 5LKYA 4QFUA 3S2JA 3Q2DA 3AIQA 3CMFA 4GX8A 1BQGA 1I2OA 1YX1A 4JFTA 1E1CB 3RCNA 4HVXA 2CLFA 3T42A 4OGZA 2YCLA 3W1XA 3AIRA 3CTTA 3QKEA 3QY6A 1OX5A 3U6WA 3NTYA 4MAZA 2J62A 3N25A 4XISA 4LC6A 3B06A 4HZ8A 2G96A 1RSCA 2G3MA 2PDHA 3CMJA 4MUPA 3W7HA 1WKDA 1IT0A 4UFLA 3B9AA 4H6EA 4R33A 3V5CA 1CPUA 1MRQA 1O6IA 2EPNA 2V9DA 3GBEA 4IUGA 4LAUA 4K68A 6REQA 1OFRA 2WSQA 3CL7A 3AQUA 3WLNA 4ALDA 3VDAA 4UTTA 2PDNA 4HU3A 3RIKA 1OFQA 1UP0A 4WY0A 3RPTA 4W9TA 5KZEA 2E7FA 3ITXA 1HJSA 4Z1YA 4NP7A 2R6OA 3W6LA 3KOFA 3RX4A 1GYLA 4QLJA 3TFXA 3BAWA 1EX1A 2Y89A 3S6DA 5LIXX 5TQLA 4W7WA 5I03A 4GI8A 5HMSA 4LF2A 3S9YA 1HFBA 2RJHA 3CQ0A 2ZRVA 5C7VA 5FA5A 3PNUA 1O60A 2E9BA 3I68A 4XKMA 4Z0JA 1K02A 1CENA 3L5AA 4HZ7A 2XZ9A 3W53A 2Z25A 3B0XA 4HPXA 1W9PA 5JXQA 2PDIA 3PTMA 4FI4A 4QQ3A 1J6OA 3RYSA 2VZTA 3H4WA 3G2GA 3G1FA 1RY8A 1M03A 1R85A 4AY1A 3PBUA 5J8LA 4PRTA 3N4EA 4BA0A 1A5UA 1K7FA 5IRPA 3CH0A 3WENA 1NWRA 1J0HA 3FGCB 1UQYA 1XQLA 3RU8X 3MJMA 1VF8A 3M5ZA 1BXNA 4NYYA 4ACYA 4FXJA 4QCFA 4DBDA 4AZ7A 4WOQA 4E8CA 1HG3A 4AEOA 4X63A 4BEQA 3U0HA 2J24A 3H55A 3C0SA 3GDBA 2PDXA 2PE4A 5FJPA 1G9HA 1PPIA 2WZHA 1E5JA 5HK4A 4REQB 4FLQA 4HIBA 2ZUUA 1EGMA 2HDJA 1NDYA 3HQNA 5DBUA 4BWLC 4TMBA 4MJ2A 1RP9A 3D3AA 1CECA 3W1TA 4RZ4A 3KCLA 3TYZA 5CBJA 5LNRA 4NG3A 4HHHA 5I3FA 4L9XA 3GZ3A 1IZCA 3H23A 5BOOA 5FIPA 1K6WA 2YCLB 1H7RA 1H61A 3EX1A 3N4AA 2PWUA 1Q85A 4GZIA 4LFYA 4LUSA 1JYNA 1JRBA 3KTCA 5KZMA 1HL9A 1AH4A 3SFKA 3W6MA 2R94A 1CXIA 2B7QA 3ISIX 1V4YA 1EIXA 1TUXA 1CGUA 1Q8JA 3RGTA 1SO5A 1DTUA 3VOHA 6REQB 1W1PA 3U57A 2W79A 3PF3A 1A5OC 2HE5A 2NQLA 3IEBA 4WY0B 3H4XA 4F79A 2YXGA 2WHKA 2CHNA 4FX8A 1SPQA 5T26A 3S2NA 2VQUA 1CWYA 2AAAA 3W1MA 3VE9A 2D69A 2EGZA 3E38A 1Y5VA 4V1YA 4IJRA 1QOPA 2PB1A 5AYIA 1TV2A 4NY2A 3MPGA 3VGHA 2NQHA 1EDQA 3QBUA 1XXXA 3MKVA 1GW9A 3UPBA 4L56A 3GUWA 3V75A 2YFOA 1P6CA 2DQXA 4CCZA 1TPVA 1X7IA 3KBNA 2OYKA 2DSZA 1JZ6A 1Z44A 3Q45A 4BEUA 3B8IA 5HXMA 2J6VA 5D9PA 2EBNA 2HPMA 1XWYA 2E6DA 1PCWA 1Q6QA 4CCEA 3NUKA 2Q09A 3S5YA 4CNOA 4ZTXA 2Q8XA 3W76A 1XS2A 2XVNA 2OX1A 2EPOA 4B5WA 2GZXA 3JU2A 1AJ0A 4NZ1A 4KCUA 1YTEA 3UR7A 1G4SA 2Q6ZA 2A21A 4DYKA 3PZIA 2PGEA 1VGAA 2WJFA 3EMQA 3KWSA 5CSUA 2WVSA 3ZT6A 1IYXA 1U1UA 3QV7A 4FR1A 3UPWA 3FX4A 1UH2A 4Q4QA 1BWVA 4OOUA 4E0CA 4IIDA 4AVNA 1WXZA 3TC7A 2ZUNA 1XLBA 3SRKA 4KWWA 4YYFA 5U4NA 2OMAA 1NQ6A 1UWIA 5CZJA 1FCUA 1J11A 2CU0A 3GYEA 3PSWA 1J8VA 3P5ZA 3DHFA 4UTKA 1EL3A 1PZ3A 1E9ZB 4TXEA 2W0UA 3NR0A 4MKSA 3FJNA 1US2A 3LERA 3WQDA 2O9RA 1VEOA 4D9PA 3QH2A 5BXSA 1UD6A 4ATLA 5CH9A 2A5HA 1KBKA 2FFIA 3O06A 1QNPA 1UZ1A 5BRPA 1O5RA 4LUSB 4RNHA 1TV4A 5G1MA 2QDHA 3U3HA 1TV3A 2Y8VA 5F7UA 1QNRA 4JFSA 2ZYFA 3AHZA 4A3HA 4MNMA 3DFSA 1JDDA 4MY1A 2QZRA 3OYZA 2J7HA 1AVAA 4O28A 3ZLFA 5G4HC 5D8WA 1DEDA 4D1IA 4OZOA 4K37A 3H2MA 4DO4A 3GHSA 3E0IA 1PB0A 4JTSA 3M5XA 3S5NA 4AB4A 2BHYA 1OD0A 2IPGA 3N11A 5HQEA 2Y24A 1FRBA 2OT0A 4RDYA 3TA9A 3BO9A 1P0BA 1XP3A 1HP5A 3T78A 4KRZA 4HA0A 3UPMA 4CU8A 1V7YA 3KVJA 4HU8A 4J3WA 1ODZA 1ZJAA 4KWVA 1DV7A 4JTTA 1KTNA 3WN6A 1FVPA 5IM51 4W84A 3KW3A 5D2TA 4QQUA 2O56A 3WDHA 2GJXA 4QIUA 2QCDA 1QPQA 1K7EA 1IGSA 1QW9A 3V18A 1GPFA 1YLVA 1VJSA 2OWCA 5JVLA 1V6XA 4IL0A 4KPLA 1CLVA 2ISDA 1OC7A 3RCYA 2NLIA 4R3UA 3O0FA 2CC0A 1BPLB 1XLIA 2VFGA 1M41A 3QZ6A 2YL5A 4ZO9A 1GVEA 2GJRA 4C6BA 4LPCA 2GQAA 1JULA 1E0WA 3BLLA 5KSWA 4AHOA 2BMBA 5DY2A 5C71A 2HRWA 3EGJA 1Q7MA 3LG3A 5EYWA 3TSDA 3NQAA 3JUGA 2YYTA 1UWRA 2NXIA 2QDDA 4CNPA 2HK1A 4KEUA 1UQZA 2D1ZA 3SCPA 2PS2A 3NFUA 1QRQA 1A50A 1XICA 3OLEA 2X7WA 1TPEA 4L5ZA 3E5PA 4NXSA 2OGJA 4O18A 1TRDA 4RCXA 4KGLA 2HMCA 1FQ0A 3R1ZA 2YZ5A 3ARRA 2V8ZA 4CNUA 4LRSA 3WLHA 5EMKA 4HSHA 1HKIA 4MOZA 2BS9A 1ODUA 1TIWA 1QI2A 2D22A 3SIMA 1KXTA 1J79A 1QPKA 3AS0A 5CGMA 1EB3A 5FF4A 1BVZA 1YTKA 3ZJ6A 4JXCA 5ABFA 4AFYA 3PULA 4PMXA 1PKLA 3ZWTA 4I9AA 1UKQA 3BAYA 3URBA 2WOQA 4NYUA 1XLDA 3V3WA 3IARA 4KS0A 3WLKX 5KZDA 5IXEA 4DM1A 3C52A 1EOMA 2POTA 1MXDA 1S39A 1I0BA 2WNQA 3WDJA 3P5YA 1ZL1A 4C6IA 2OZTA 4AXNA 3DECA 4NZ5A 4MJZA 5JIPA 3W37A 4FF5A 3N14A 3P2VA 1EUNA 2B0MA 5HNTA 1V6YA 2VENA 2BFGA 3IUIA 3VZXA 3NQ8A 3RRAA 5BRBA 3DGRA 3WDQA 1X96A 3W7GA 1OF6A 4O1CA 2J8TA 2D0HA 3RITA 1OB0A 3W02A 4RZ5A 4X61A 3W71A 1LT8A 1ME9A 3POHA 1FWCC 4NI8A 1LWIA 1FUYA 1NP0A 3MB9A 3NEVA 5EFDA 1BSLA 4ZOBA 2ZBTA 4TV6A 4CQ8A 2GJXB 3ZIZA 2XU2A 2V2HA 1BVWA 1K6AA 5L6UA 1C7TA 1V0KA 3MZNA 4KFNA 4CVUA 3CHEA 4NI3A 4IIGA 5FJJA 3TR2A 2H8ZA 3AS2A 1DHPA 4N7QA 1GORA 2INEA 3RXZA 1TJRA 4IIHA 4W85A 4KEVA 2QEZA 3FEQA 1FWSA 3KL0A 2HISA 1L6WA 4MNKA 1TMHA 2Z1BA 1WNOA 4D8AA 1WYIA 2PTDA 3T55A 1VAHA 2NV1A 1VCFA 4JTQA 2YR1A 1N8FA 4AIEA 4JQ3A 3TC3A 3ZSSA 3M0LA 5K9CA 3NURA 1SZNA 4E3TA 1CW2A 4TVUA 1Z7AA 2WYSA 3VMOA 4R5EA 3FAXA 3CO4A 1E73M 2VFHA 1JUBA 1OT1A 3WX7A 4HYWA 1H60A 5H8UA 3KRUA 4IPPA 3LLFA 3BAIA 4HHMA 3H6OA 3KDOA 3IGSA 3A3HA 1QPNA 4JY9A 3A4JA 2C1GA 5CJ5A 3B8SA 1MQQA 4GUGA 1JCJA 2CBIA 1HJVA 1AK5A 3A9BA 3LUTA 1CXHA 1DIOA 5ABFB 3T08A 1G69A 1H7XA 4Q4RA 3EYPA 1Y7VA 4FNSA 1PIFA 4D8LA 4PMZA 4UMBA 1UPMB 2ZDRA 4S3CA 3S83A 3VIJA 1E6SM 2V68A 4CGTA 2H3BA 1NU5A 1XIGA 4FNQA 2C14A 1W5PA 4QP0A 3W85A 2NWSA 1R7AA 3WKZA 5CC5A 4GIAA 2P8CA 3NZPA 3WZ0E 2WXDM 3WBXA 1XBYA 4PBFA 3W2LA 5A6KA 1QOQA 4RZ6A 2J9YA 5A6SA 1KFBA 4F8XA 2VZUA 2YL9A 1R3SA 3RLGA 1TQXA 3VFCA 1CYGA 3C4UA 4DO5A 1JG9A 4BY3A 4GVIA 2ZFAA 5C9UA 4O8AA 2GJPA 3CQJA 3N15A 5AC6A 1ZJBA 1LJYA 2FDSA 3VC5A 4A6GA 4DY1A 4MNJA 3F4CA 3AZTA 1HJWA 5BOFA 3TROA 3W7KA 2IXUA 4C5ZA 1CBGA 3ITLA 1B4EA 4GYFA 2RAGA 3WQCA 3HGSA 3V35A 4NQ1A 3ARXA 2VX7A 1YXDA 4C6EA 2DT0A 3MQTA 1EHNA 1QWGA 3PUDA 1R2TA 5CAKA 4Q7NA 3I10A 1EBGA 3VAVA 3HN3A 3IVTA 1B3WA 2FTPA 1H49A 3U4AA 3CYVA 3G1RA 4XTIA 3ARSA 2GFTA 5BWAA 4Z2GA 5EFFA 4DF1A 3LV5A 2ZQ0A 3EOUA 2GGJA 1HGYA 4WX2A 3TLQA 3QTPA 4AZBA 3NDOA 3DFPA 3DERA 4CQAA 2ZRXA 2CLEA 1XYMA 2X1UA 3NQFA 1GOQA 2J7EA 2ZE0A 2JIEA 2FKPA 3LQLA 2AKMA 3RR1A 3TCEA 4AQLA 2PDUA 1RAKA 1GVQA 3ANYA 3NM1A 3FJLA 4S3JA 4GD0A 1ITXA 5LGZA 1V7AA 1OABA 2V3EA 1HXJA 1EYEA 1LTDA 2ZVRA 3TN6A 1VRXA 1XINA 3RILA 3S46A 3TA6A 1B2YA 3R89A 3UYCA 4S3AA 5K4ZA 3LTSA 3MV01 1KRCC 2CKSA 3R58A 3A13A 4ADUA 1XLHA 3B8DA 1EEXA 5K9DA 3NQ7A 4JTKA 3ZSTA 3S5OA 4CNTA 1UC4A 4HQVA 5CLWA 1EF2A 3QHMA 4FP1A 1KBIA 1SJAA 3P0WA 3L2LA 2J7DA 3FKKA 3MUAA 1IHIA 3WF3A 4AISA 2DZVA 1E4IA 2QMKA 2ESCA 1EXPA 3AS3A 1H5VA 3LCLA 1NM9A 4GACA 1UBSA 5D30A 4YHEA 3EEGA 3SN4A 2I17A 4IPJA 4GBUA 5KEZA 4HBKA 2QCLA 3EDJA 4H8NA 3SQSA 4PGLA 3F1QA 5E9AA 4Y8FA 3L0GA 1O94A 5C0QA 2YB4A 2J77A 5HATA 2B4GA 3ZJ8A 1E51A 3QHNA 2Y7DA 2J78A 3UVAA 4NJGA 1UD3A 1S5VA 4YWSA 1BHGA 3WK0A 3AC0A 3TFCA 4JICA 4PB3A 3DN5A 2Z1WA 1DORA 3BC9A 3GDLA 1UH4A 5LSMA 4X22A 3VIPA 2QJMA 4ZXLA 4PYSA 1XIMA 4INFA 1PZ2A 1E72M 3BW2A 1QBAA 2POZA 1W31A 3WDIA 2BY2A 4IXHA 3TQPA 5AC4A 1RV8A 1C9DA 1E55A 1REQA 3FY1A 2QT3A 3CQIA 3IK2A 4H6RA 1XYAA 3A22A 4O10A 3DHPA 2CLMA 2NX3A 1XHGA 4YPJA 2XFWA 2PTZA 5A8PA 1GQKA 3LY0A 4QLLA 3TNOA 2XIMA 3RM8A 1RQBA 4X0NA 3DFHA 1AQHA 1XG3A 1W3JA 4XSMA 3VTRA 1ISWA 3CQKA 4I8YA 2REQA 3PBMA 1EDGA 1TTQA 4FOJA 2AAMA 2Y2WA 1A5MC 3KZPA 2I56A 3ICJA 1OX6A 1R8LA 4HCHA 3CUXA 1SO4A 4FX7A 3EMZA 3PFRA 4JQ2A 1JI2A 4ZTYA 5DMMA 4Q8PA 4YTUA 1MFUA 2PDQA 3TUUA 3FA4A 2OWWA 3GSMA 3MP5A 4QCEA 3GB6A 5F4WA 4PMUA 4L7ZA 1Y8BA 4L64A 1B3OA 3GVRA 1C8XA 3G0UA 1LRTA 1MXGA 4EK7A 1ME8A 4CQDA 1EA9C 1ZRQA 1HKJA 3AROA 1IT7A 3C8FA 1J6PA 1ITUA 4PUEA 3OQ8A 5K9XA 4CQBA 2CESA 4GH3A 4IPLA 1KBBA 3EPOA 3LV6A 3TZFA 1DJXA 4PTNA 1H1YA 1PTDA 4QAWA 2Z00A 3HPZA 1KM1A 3PBGA 1FHVA 4AVFA 3EX4A 2NSXA 3AIBA 4HA3A 4R7JA 3QC0A 2HS6A 1G4TA 2BVWA 4XG1A 1XFBA 1YADA 1EPVA 3DDMA 2YL8A 4YN5A 2VEFA 1UKOA 5IBXA 5TF0A 4LY4A 1GOKA 3L4UA 5DO8A 2E1WA 2CHOA 3VMNA 3L23A 4B2DA 2Y7GA 1BSIA 3LTPA 3FEMA 3WQ5A 3SAZA 3LPOA 2BOGX 2EPMX 1BXBA 3C3NA 3K30A 2BG5A 1Z69A 3S3GA 4D2JA 5I06A 3WF1A 3G1XA 1TWZA 3BCFA 2E8ZA 5EPDA 4PTDA 2PWHA 3VDGA 1SR9A 5RUBA 5TAOA 2X1RA 3BH4A 4AX7A 4PCPA 3W7LA 1WO2A 3ARWA 3VOGA 4HJFA 1J12A 3ZYZA 4ZVJA 3SY1A 2I7GA 4ZQPA 1TKKA 2FB2A 3C5QA 1OZQA 3QKZA 1A3HA 3W2UA 2ZICA 4XZMX 1AMKA 2FMOA 2XZ7A 2WSYA 3MDWA 1FDZA 2C18A 4NNAA 1JF6A 2X2YA 3CLWA 1REQB 1HTIA 3TAKA 1QPRA 3KCOA 3W7OA 2AQWA 3P80A 3T2PA 4X2RA 1ONEA 5HMEA 2DU2A 2VC5A 3RX2A 1R3RA 3IJ6A 2J88A 2G5WA 4JFVA 2ANUA 4PUMA 3SADA 3AXKA 4ZQCA 5HULA 2BOEX 1JDEA 2YX0A 5DBTA 3S6OA 1YRRA 2REQB 4XD5A 4QBXA 3DCPA 1OG0A 1R46A 4DXVA 4BJHA 5CPSA 5LHEA 2XWEA 4P2VA 4HP5A 3AHYA 1MUCA 1B57A 4Q8OA 1YDYA 4HNLA 3A47A 5AHFA 1GG1A 4D8ZA 5M03A 3LYEA 1E4LA 4IM4A 1QW8A 2P3ZA 4L4LA 1FH9A 2ZZ5A 3MYOA 4D6IA 1AD1A 3ZS4A 1UWUA 3ZFHA 3T0BA 3C56A 3LCXA 3ORWA 1QUMA 2XVKA 3CHFA 2V5JA 2XSBA 3OZYA 1E1EA 1KV5A 3UU0A 3D46A 4NAFB 4AH7A 3OZOA 4HU4A 1TVNA 1OADA 1EDTA 4L4PA 1OCJA 1X97A 3GG1A 4OKDA 3GU9A 3TE9A 3QPEA 1RVKA 2H9AA 5DELA 1SU5A 1ZBKA 2F2KA 4TO8A 1YDOA 2Z2BA 4DF2A 4L1XA 2TODA 3AMCA 3GAKA 4O0KA 4UQBA 2BX7A 1ONXA 3DFTA 4JHMA 1XDJA 1RXOB 3T81A 3TTSA 1BF6A 4O1BA 1HJUA 1XIDA 1JDFA 3PS7A 5AZ0A 4S2BA 3RDKA 1Q7ZA 2NLYA 4N42A 4I90A 2ON3A 3WUGA 4HCDA 4PUWA 3L5LA 2PA6A 4HSOA 2V5CA 3S1VA 2P53A 2MUCA 4Q4KA 2EAWA 1E6ZA 3BZJA 5BYWA 1IT8A 2C8NA 4JFWA 1CXEA 1KFWA 3U5UA 1DOSA 3GXNA 4A05A 3W75A 2V5DA 4HTYA 4MM1A 4PBGA 2RKXA 4EXAA 1P6BA 2OO6A 4LCQA 3B0PA 2GQ8A 3VNZA 3OPSA 4YU1A 3PBYA 2QAFA 5HMDA 5A6AA 5KMYA 1UJQA 1E3ZA 3TYUA 3UNDA 1LL4A 1JXKA 4QNEA 1HP4A 2XYLA 3EX2A 3VMPA 1LG2A 4S1FA 2ZTJA 5EMUA 1KXHA 3MT1A 5BXTA 5HNNA 5AHLA 4PRWA 3CGTA 5I07A 2DJXA 3IJIA 1V08A 4US5D 1YE4A 1MUWA 4NJIA 2JIWA 1SW3A 3ITVA 1DP0A 4DZ5A 5C2XA 4JTFA 4DYJA 4W7UA 4W8LA 4P7RA 1VQTA 4URIA 1JD9A 4B5TA 2Z24A 3AYTA 1RBOB 2CYGA 3PUEA 2C0HA 1F73A 3NYDA 5XINA 5A6BD 4LS2A 5ECVA 1Y0EA 4PCNA 2L5HA 3S5ZA 3LA4A 3RMEA 4JFUA 5XIAA 3NPUA 3LB0A 2HXTA 4PMQA 2Z7GA 3WEOA 5I79A 1S5TA 5CEWA 3W1AA 1EYWA 2IPJA 4NU7A 1F3WA 2FZDA 2ZRUA 3KLKA 1C91A 3DESA 4K1WA 5DQPA 1QASA 1T40A 1EC8A 1AJ2A 1VFFA 5KZ6A 3R8GA 4PULA 1WDRA 1XPGA 3TW7A 1IQ8A 6ENLA 4O8RA 1VLWA 1G01A 1UZHA 4XVEA 4UFKA 5IOBA 4K39A 5FACA 2BASA 1TCMA 1LBMA 5A95A 2DVXA 1G7VA 1WOBA 4GNKB 4V15A 3NQCA 3LPGA 2CZDA 2H9AB 1RH9A 2Z0IA 3GK0A 4OV9A 3VNLA 4ZFMA 3DYMA 3Q37A 3CZLA 1JZ7A 1XSKA 3SRFA 4PL2A 4BF5A 3TYAA 2DT2A 4HNTA 2VKZG 3QZEA 2XTKA 4H9XA 3I6EA 3UD6A 1J4EA 1QVBA 2ZUVA 3AYVA 1ZENA 2A85A 3WJWA 4RL3A 4HK7A 4W89A 1AL8A 2OLHA 4AX6A 4GYPA 1KM3A 5K4XA 4A3QA 3GXFA 5DXXA 3CQHA 3WH5A 5A2BA 3EPMA 4Z1DA 1PWLA 5BRQA 1VFOA 2GVEA 4XO7A 1QNOA 1QPOA 4ZOAA 1E4MM 5MKGA 3QR0A 2YYUA 5JUVA 4GI9A 3OW1A 3GAYA 4LV9A 4PTMA 3QMSA 3GW0A 1X98A 3JVAA 2D20A 2GJNA 3H2OA 3URQA 4P5UA 3SY5A 1CXFA 2XG9A 3A5VA 4HB7A 3CEPA 5DN1A 5ENLA 1GOWA 1DYSA 2ZC8A 3S1GA 3I6TA 2G3JA 2WANA 2XWDA 1KRBC 3NO1A 4NF7A 1V3JA 2NXHA 2OGYA 1GJUA 2GPTA 2ISFA 4DJDA 3K4AA 4FB7A 1JQXA 1XLFA 5JBFA 1YHTA 4QG9A 1Q6FA 4R34A 1KM0A 2OKTA 7ODCA 1MDRA 3O63A 1B54A 4YMZA 1VP5A 2CWNA 1EQPA 3EWBX 4GIRA 3ZLHA 2PP3A 2X0HA 2WV8A 5AYZA 2XUCA 3KS6A 3MMWA 3LCWA 4Q3MA 2JQXA 3W83A 3OBAA 1XISA 1W1TA 1Q5MA 2CLPA 3T4CA 3PTKA 1UWTA 2ZA2A 2R1NA 1BG9A 1CB7B 5H1WA 4QEHA 2BTMA 3CZKA 2Y5JA 4LUYA 1DBTA 4DNHA 1V93A 3TWBA 3K2GA 4KKXA 1FWRA 3QV6A 3A3XA 1KCXA 3SSZA 3K4WA 1B3XA 2E3ZA 4MLRA 2CKRA 1TZ7A 2YLAA 1YIXA 4LF1A 3H22A 7A3HA 3W24A 1HVQA 4TVDA 2HXUA 3NPXA 3FFSA 2J9ZA 3B0VC 1UUQA 3G24A 2G41A 2W91A 3G77A 3FSTA 4DJED 1FH7A 3B4UA 3KM8A 4ZODA 4XBKA 2G50A 3ES8A 3I6RA 3FXGA 3VK5A 5EMJA 2HJPA 2P5NA 4D6GA 1PAMA 1A0CA 1TJ2A 2YXOA 1I2QA 5AVHA 3KEHA 5DEZA 1N8IA 4UQAA 4JTIA 5A8NA 3AUOA 1JDAA 1EKOA 2A7PA 4CD6A 3DXIA 3PWIA 4WSKA 5IBXC 3M0ZA 4GXMA 4W5UA 4KCTA 5I00A 3LGEA 4GYJA 3GIQA 3VIHA 1E4NA 5I7GA 3AHVA 3VNYA 1RLDA 4YVPA 4IH3A 4AY7A 1MEWA 3QFWA 1J2BA 5T8GA 3PJTA 1FWJC 3O05A 1X1ZA 4P7NA 5MKGB 1LLZA 3ZWSA 2PWFA 4QRNA 3MUIA 4UQCA 1Q6CA 3NA8A 5G4WA 1J10A 3MBDA 4HHPA 2F61A 2X1IA 4XAPA 3CV7A 4GZEA 2J7FA 3B03A 4WDTA 1C8YA 1XX1A 2FVLA 3SUUA 3OYXA 1Z89A 2RDXA 2VC7A 4DEFA 1R2RA 3LM3A 1K4HA 3IUDA 1O5XA 3APTA 4DVOA 2RGMA 2HK0A 4WJEA 3VYLA 4HN4A 1TPB1 3R43A 2I5QA 3TDFA 4E8DA 2ZTKA 3QV8A 4MVAA 5FJIA 1S46A 2AQOA 1QDSA 1YPFA 4C6KA 4O1FA 3UXIA 4CD4A 2CPUA 1E6PA 3KUMA 4NRSA 3U2OA 1GG0A 3KFTA 4L1WA 3OIHA 4UNIA 1HKVA 4CN4A 2PRLA 1EFZA 1J0IA 3NO5A 1G0CA 2VR5A 4DWDA 2VGGA 3C8NA 2XJ7A 1PKYA 3CZGA 1OIFA 2YCKX 3UT0A 3WELA 4RXFA 4DBEA 1PTAA 1GQIA 1J2WA 3TAOA 3SGUA 3TJIA 1UKTA 3A21A 1KR1A 5REQA 3W81A 4B4HA 3BQ5A 5FEPA 1J93A 2VR2A 1RHCA 5LNSA 1MDLA 1EJTC 4RV8A 4PE8A 4J35A 2Y5SA 2BVYA 3TQKA 4XVDA 3PB0A 5A8QA 1KRAC 1LRNA 2OODA 3FJ6A 2Y1HA 3GYCA 4M29A 1UIPA 1MSSA 4GI6A 3UZJA 2C1HA 1EO5A 1CCWB 3I4KA 5A8OA 2PI6A 2HVNA 3OOQA 1D9EA 1TUFA 1NP2A 4AD5A 3R8HA 5HUPA 4RDVA 4I6VA 4QX4A 1H41A 4UQ9A 3UVIA 3M07A 3VO0A 3IJQA 4JYDA 2DT3A 1RJPA 1V6WA 1ZALA 4LVFA 2WBGA 5JU6A 4UQDA 3AJXA 2UY4A 1GVOA 1DJYA 1AL7A 5FJUA 1OK4A 2A3CA 1PHWA 1DHKA 4J3TA 3G1SA 3ENLA 3WFAA 1NY1A 2HPIA 4AUBA 3BG5A 1LP6A 1UR4A 1VPYA 1KWGA 4PUUA 4YTQA 1MI3A 2KAUC 4NHVA 3OQEA 3FDKA 5I78A 1OJXA 2VCAA 4DI9A 1D7KA 1A4MA 1KM6A 3CAWA 3W7EA 5AZ1A 3LS9A 3Q65A 3ID7A 4MB4A 4XAYA 4ZGYA 5A2CA 1C92A 2Y0FA 2H90A 3LBMA 4QROA 2ZZ3A 4BI6A 3ABOA 4FLOA 3VILA 1XIIA 4OUIA 4RW5A 1EF3A 4R88A 4DXXA 1GUVA 1IF2A 3MI3A 3SQMA 3CB8A 1AUSL 3AZRA 3TKFA 5DRCA 4BKNA 1FXPA 2WLYA 1XRVA 4FLRA 3WNPA 3SRDA 2JALA 1LUCA 1XI3A 1ZBCA 4PTWA 1TVLA 4QGCA 3B3DA 4Q4MA 1XBXA 3V7PA 2Z27A 3LGGA 1NFPA 1Q13A 4CNSA 2WJZA 3KHJA 2ZXBA 4UR8A 3NL5A 2OSYA 4N9DA 1UYQA 5F1UA 4MWAD 1DQWA 3DYPA 4Y96A 3NGJA 2ZVIA 4S3BA 2QCFA 3T8QA 5A6TC 1DVJA 3NXFA 4RPPA 3L5MA 4RV3A 1CIUA 1JNDA 3S1UA 3T1GA 4S39A 2P76A 2P0IA 1KA9F 1P7TA 2CWXA 3NDYA 3CPUA 3O1NA 4UFJA 1OWQA 4YVXA 1WUEA 2VC9A 4O4VA 1KM2A 1IGWA 2XFRA 1FWBC 2QUUA 2F8QA 1Z32X 1SVDA 4WSJA 1Z9AA 2PDMA 1ZP3A 1E56A 3P74A 1F7BA 4BI7A 2PD9A 1YW1A 1G5AA 3CBWA 3B9OA 2BHZA 2C1IA 1GW1A 4MKNA 2GDQA 3TMLA 2ADAA 2DZUA 5C9WA 2ACQA 1ML1A 4Y6GA 1H62A 2E8YA 2QJIA 4GJJA 4XKYA 3GTIA 4A3YA 3I7QA 4L6HA 1JCXA 1JUEA 3NQ6A 3WLMA 3M4HA 2A0NA 3M5YA 3AI0A 1A80A 3VGGA 4S3DA 2NUXA 3GZAA 1VBGA 4UZUA 3KOXA 1UROA 2VFIA 4GYPC 1OFDA 4JL1A 3QW4B 5PTDA 4QJ5B 3GU2A 2PDKA 4JD4A 4IP4A 3KBVA 3UWZA 2D23A 3HPAA 1M53A 1TV5A 4MB1A 4MTVA 2VRQA 4Q8WA 4GZ7A 3E6EA 3TJLA 2PP0A 1V6TA 3ERPA 3QQWA 3LMYA 1HZYA 1XIJA 3MU7A 1D3HA 3EOLA 4C6PA 1ZSXA 5LIUX 4PZVA 1IZJA 3QV9A 1Q6LA 2E9LA 3L0KA 1XC4A 4GGBA 3IRSA 1LUCB 1W3TA 3P61A 3BDKA 3I7SA 3HG2A 3D5HA 2PU1A 1NDWA 1RVGA 1X6LA 2NQ5A 1KLZA 1PBGA 3PY2A 1RBLA 1F4AA 4JL2A 5CSYA 1PIIA 3H7VA 1FWDC 4EXBA 2HNEA 3NNTA 4PSPA 2IQ0A 2ACUA 1LWHA 1NWUA 2FDMA 2WHJA 1JPHA 1MNSA 2PRHA 3L4TA 4PCTA 3S0CA 1XH1A 1VHCA 4G7EA 3AO0A 4IIBA 3HGOA 1W6TA 3GDMA 3CIWA 3L2IA 4HK6A 4AC1X 4D6HA 3P8JA 4AWUA 3GXPA 2WBKA 4RE4A 1R9ZA 1P7TB 1BFNA 3EEZA 2O7QA 2Z1XA 4GVFA 5EKYA 3VNMA 3UCCA 1OCNA 2RDUA 1HVXA 1TMQA 5D9NA 2QV4A 4A8LA 4UFIA 3G1AA 4JDBA 1Q4WA 3WMBA 3ALFA 3TH6A 1A5KC 1TSIA 2CLHA 2WPBA 1X6NA 3I7RA 5D09A 1O95A 1CGWA 3VX0A 3OJGA 3IS4A 1VFMA 3PPGA 3THUA 2Z2UA 3R0DA 1O7AA 1F3XA 4XZLX 3W88A 1TB3A 5I5RA 1QCWA 5C6MA 2QCMA 4WQ6A 4XBJA 4AZ6A 2FGLA 4AF0A 1EA0A 1A5CA 5HINA 2PFHA 5BWFA 1VB9A 3C2RA 3S1XA 1TR1A 4XKYB 5I23A 4ZL1A 3CL8A 3WBYA 4KIEA 2ALDA 4ATDA 2VD9A 1VBHA 5JQ9A 4AD3A 4QEEA 1M04A 3CT7A 1EXBA 4RNJA 2B7PA 4L65A 4LB4A 2YOCA 1S5NA 3BUVA 1XLMA 1R5YA 1WDDA 4NJHA 5D38A 4X0VA 2G37A 1CTNA 4LYPA 4Z2LA 4GJ1A 4C6DA 2PEVA 3H12A 3W2MA 2OPJA 4AG0A 4J9JA 4B5XA 4HOXA 1CX9A 1MO0A 5GJMA 3NQ2A 2WPGA 4KEMA 3UF9A 3B8VA 3OB8A 4DO7A 3KX6A 3HO8A 4B9YA 2QNEA 2CBUA 1EGZA 2VELA 1OFBA 2XGZA 3QQ1A 5KETA 1JDCA 3SM0A 3UW6A 4DAFA 3LLDA 3FVDA 2QJGA 1FWEC 3QQ0A 4H9YA 4LEQA 4U3CA 3WNNA 2ALRA 1SFSA 2NW0A 2ZWZA 4HT3A 5LA2A 2VX4A 3KL5A 7TIMA 1YQ2A 1W3IA 1S1PA 2FH6A 2Y61A 1F61A 4GCAA 3TC6A 3LSBA 3INPA 3AIWA 1F6YA 2XVPA 1I2NA 3A24A 4M7TA 2P1FA 3LDVA 1VFLA 2W62A 3LNMA 3BMWA 4KF1A 4C7DA 3W1NA 4ES4A 5JBDA 2W3ZA 4UQEA 3EAUA 3G0XA 1IEQA 1R47A 4G7EB 7PTDA 3GE7A 2OEJA 5AYBA 1VYRA 4Q32A 3CWNA 1E9LA 4GE8A 3FYPA 4UTLA 1KRMA 3IGHX 1LG1A 1D8CA 2WB5A 3DAQA 4JQAA 1BYBA 5E6YA 3G1DA 2D2OA 3QHOA 4GINA 1KKOA 1XL9A 3H54A 1NOUA 3DUGA 2YGYA 1KD0A 3PZGA 2W61A 4MNLA 1ZLPA 2V5LA 1L6YA 2VZVA 3PWGA 3QLLA 1PHQA 4RR4A 1PDYA 2V81A 4FS9A 1WOAA 3V16A 1ICQA 3RLVA 3CHCA 1LQAA 1ZJIA 3SSJA 4OWGA 2VEPA 1VKFA 4ICNA 3W7JA 1OVDA 3UCDA 3UFYA 4HCLA 3WQ4A 5HJLA 4U2YA 3AXXA 5A1AA 5LNWA 5A8GA 4XUYA 2A79A 4P8WA 1UASA 1XF0A 2CBVA 2GVJA 4TTGA 3N2TA 4NZCA 3OVQA 1M5WA 5I77A 1SZFA 2X1SA 3MUZ1 4WKFA 2BP1A 2CEQA 4GRSA 3VFLA 4LUIA 4R7WA 2G3IA 4WJXA 1DE5A 1EIBA 3EWWA 1EJSC 2O0TA 3KRZA 4I5XA 1RJRA 2ZA1A 4QISA 3DFNA 2B7NA 3P3BA 3B97A 1SSDA 3UA3A 1W2PA 4J3UA 4R53A 3CZJA 2OEKA 2F84A 2VDIA 2WCAA 2PU0A 3PPCA 4ZXOA 1OYAA 2OVLA 1M65A 1W37A 3IK4A 4XZNX 2VXNA 3MSRA 3WD3A 3BPWA 5CCZA 1IIGA 2VC6A 4GUJA 1THFD 2PP1A 3BG9A 2E6AA 3HIJA 1FKWA 2PDGA 4KW2A 3FCPA 2FGZA 4UR9A 4AWEA 4LAMA 2JEQA 2X7VA 2QCCA 4FXRA 4GMEA 2GSHA 4XIAA 4YWIA 4IGHA 1CLKA 3AALA 3VNIA 4H3DA 1H5YA 4HD5A 4B5VA 1PV8A 1P0DA 5FL0A 1DIEA 3LXAA 4F0LA 4GOAA 3CH9A 1K9FA 1W54A 1C9WA 2VOTA 4LCRA 1VBJA 1ZAHA 1OGSA 3M41A 3DI0A 3YPIA 2G0WA 2E4TA 4Z08A 3NOYA 1POKA 4GY7A 1W91A 1FWGC 1SZRA 3R13A 3MUCA 4F40A 1C93A 1DJWA 2AL2B 3UWUA 2HV5A 1NSJA 2F7FA 2GGEA 3WUFA 3AIVA 3BGAA 3L4WA 2E68A 3BSHA 3B8UA 4K7VA 4LGXA 4LXFA 4C6CA 4MY9A 3N3MA 4A35A 1XLCA 3W74A 3UGVA 5FEWA 4PEEA 3PR2A 4X9SA 4JTGA 4QJ4B 3MDUA 4LUJA 2BXZA 3BL3A 4UFHA 1LYXA 2YIHA 4ZOCA 4A8RA 3G1HA 2GUBA 4IXXA 5EY5A 2A7NA 4W8BA 3R11A 4B4FA 4YCOA 2E25A 4MZ1A 1GYMA 2RHGA 4MWAE 3FYOA 2VGBA 2VI0A 3DKLA 3BJFA 1EBHA 1DTNA 3O15A 3TYCA 3O9NA 2HBXA 4BQ5A 1Y5XA 1ZB5A 3W1LA 7XIMA 5CC3A 4BHYA 5HPCA 1TPWA 2X2GA 2VURA 4QS5A 3LU2A 1MZHA 4DLFA 1SZGA 3OU8A 3WQEA 1SUXA 1Q6EA 3OHMB 1FX6A 3VOFA 6PTDA 2GQ3A 3DYOA 4LB3A 4MPKA 3MVIA 1Q63A 2Y85A 2YDRA 1UWSA 4HSNA 3TJXA 4U4MA 5E09A 4NASA 4JTHA 5C70A 1O1HA 2IPWA 4GI4A 1E0UA 1D3GA 5HQLA 5AN7A 1IWPA 2PC4A 4FIQA 1K77A 4DWSA 3P6LA 1XDLA 4M82A 2W6RA 3W7DA 5GNYA 1P4CA 1GJWA 3IJ7A 4FHAA 2X05A 4ENLA 3A9IA 5M2FX 3DG6A 5A69A 1E0TA 2GDVA 3QFEA 5CPQA 3WSUA 3ZLGA 1F9CA 4F9JA 1QHOA 2QUTA 3TN3A 4D71A 1FA2A 3MKKA 5CAHA 4NZJA 3IVUA 4HKPA 1Q65A 1U33A 3KE0A 3WF0A 4C6FA 2GOKA 4AD0A 5DMYA 4CLMA 2VZSA 1L8PA 4HYVA 4CQCA 2CLIA 1MEHA 1LWJA 4TX6A 4E8GA 1UG6A 5D05A 1H7NA 4B2DD 3VD7A 4OIFA 3AMDA 3S47A 1E3XA 3BTNA 1R30A 3CWHA 4DO6A 1TPFA 4L4OA 1TZZA 1Q2RA 4DM2A 1SSGA 3WNOA 1UCWA 2FTYA 2IQDA 3PUGA 3HPSA 4DBSA 2W66A 1KBLA 4ILSA 3V4BA 2J79A 2YW4A 4F4RA 4PEKA 1PO9A 3A6OA 3IV8A 3S5SA 3TVAA 4CKQA 1DJHA 3ELFA 4JAWA 3WFZA 4H6KA 1QU4A 1QNQA 5TIMA 3REQB 4XK2A 3M0HA 1L9WA 2GK1B 5ABGA 2YXXA 1JPKA 3II1A 3W1PA 4Y9PA 4DRSA 1UA3A 1NDVA 3GH7A 3VNKA 3DU0A 2DY3A 2E5CA 1OGBA 2DZAA 4AEFA 2QF8A 3EXRA 2DZWA 3WFLA 3APGA 3THDA 3RPMA 1UP3A 3VPLA 3F7JA 3B9EA 4EANA 1CI1A 1BRLA 4E5TA 2GSEA 2QYGA 4R9OA 4L6DA 3B0YA 4HJWA 4I7VA 4WEVX 4YTSA 1B31A 2W9MA 3M46A 4KERA 3W38A 3LHYA 3LM7A 2GDUA 1N2VA 4P7QA 4DJEA 2WZEA 3SJ3A 4I5UA 3VUSA 5G1TA 3FXYA 3E9AA 3N17A 3H8AA 1F4HA 5C9XA 3FW6A 2X8RA 2YLLA 4AC7C 3TTEA 4NZFA 3BURA 1X39A 4GQBA 2CZ5A 1ZCOA 4DZHA 3THCA 2DPEA 3CHVA 1QNVA 3APYA 3MHFA 4BS0A 4R85A 4ZCWA 4H83A 2BY3A 5BMXA 3VCRA 3GNNA 4MDPA 3R0UA 2EG6A 3T9PA 3BGJA 2E1DA 3MCNA 1W3KA 2I5IA 2PDPA 1UZDA 1HO1A 5H91A 1B3VA 4M3PA 4S3GA 4BQ2A 2PDCA 3F03K 7REQA 5T9CE 3JS3A 5KTLA 1GPWA 1EWDA 3C3UA 1QFEA 2GOUA 4CEUC 3VC6A 4C65A 3NJ3A 3SR7A 5CKSA 4MUZA 3QR3A 4N0RA 3SEPA 4A8IA 3UGRA 3QZAA 5D32A 2I16A 1LM1A 1I75A 1MW2A 4A4AA 3GC4A 3FHAA 4J27A 1CGTA 4M6UA 1ITCA 1XIHA 2X40A 4R7OA 1UB3A 3ZR4A 3GNOA 4ATWA 3LCGA 5CBIA 4AMAA 4GC4A 2AMGA 2X1TA 1CB2A 4PUKA 1XH0A 1JGMA 2A3HA 1HKWA 5DT7A 1UMLA 4J3VA 4M51A 3W7IA 4O54A 5LIYX 1OD8A 3DG7A 4L80A 2DW7A 4QE4A 3N19B 2JEPA 2GGGA 3QOKA 1PIGA 4Q6JA 1A5NC 4GBDA 4M6VA 3UR8A 2QUNA 3LLXA 3L68A 5IFTA 4MPQA 3L67A 5CPOA 4F2TA 4E4UA 2BXVA 1DWAM 2OFJA 1F05A 4Z17A 4CN6A 4FF7A 1IEIA 4YJ5A 4F3HA 4MJ4A 1G4EA 1WAWA 5BROA 2Y5EA 3ZM8A 4ICMA 2DIEA 3W6YA 1Q45A 1X6UA 2O4MA 4LS1A 3QXBA 3W7NA 4C7GA 4JNZA 2ODOA 1BRLB 3L9CA 1R6WA 1YNYA 4ICCX 1SFTA 3DC8A 4XZHA 4NIRA 3LZ3A 5CG7A 3PG8A 3WF2A 3GFXA 3FA3A 5D37A 2YBVA 3WQOA 4RW3A 1BVNP 3BSMA 3GXIA 3NZ1A 1CDGA 5C54A 4IQJA 2OZ3A 3O8AA 4OT7A 3MA8A 4MB5A 2FIQA 2XH0A 5I3IA 3GR7A 4N6EA 3SCOA 2UY5A 3VKKA 1I0DA 4UTFA 1MXSA 4F0KA 1ZGDA 1S5WA 4QDWA 3QYSA 1X1OA 4N9EA 4GC3A 3LRKA 4LWWA 3WQPA 4JTCA 3V5FA 3EB2A 3LXCA 4O1AA 5JH2A 1UHVA 2FQIA 2FZBA 1W0MA 3GC2A 3MYPA 4H1ZA 1VJIA 2CZEA 5CSRA 3CIXA 3W29A 1J0YA 2QCNA 3COTA 3QSRA 3PG9A 3W26A 3GUGA 4NXKA 5HNUA 3WLTA 2DUAA 7REQB 4PN2A 4S3KA 4IFRA 5A6MA 4ORIA 1IXQA 1GOMA 2JKEA 3UG8A 3GNXA 3SURA 3ARVA 1E6QM 4RNIA 3M47A 3BCDA 7CGTA 4IMFA 2WZIA 3PNZA 4KGJA 2ZUSA 4ZE4A 3QGVA 3V5OA 2VUYA 3UXKA 4F0SA 2A6NA 2X42A 3HU7A 4XAZA 1W9DM 5HAOA 3SW6A 4DQWA 1VH7A 4ONVA 4QHRA 2QIWA 3RCMA 8TIMA 1T41A 1SGJA 1GKPA 2XM1A 1UR9A 1QXLA 1OC6A 3J7HA 2Z26A 4DPPA 3MMTA 4MWAA 4O52A 3G1VA 3UG5A 5LIKX 4C1LA 4NVTA 2PUZA 1K9DA 3WLIA 4QJ1A 1P5BA 3CT2A 1NARA 1NELA 2QMJA 1ONRA 1LF1A 1PXGA 4YIWA 3G0SA 2Y4SA 3CO8A 4UTJA 3O3RA 2I5GA 4KWUA 1TZ9A 3WIJA 4UCFA 1OF8A 3PWAA 3M0MA 1KO0A 4H2HA 1XRFA 3H21A 2YDSA 4AZGA 1Q8AA 4ACZA 4EF9A 5IFPA 3GVGA 3S9ZA 3QC3A 1WXYA 4A2RA 4WY0F 4DJDD 5F2GA 3M0VA 4EACA 3NVDA 1ECQA 2WMJA 3BGGA 3HMCA 1T96A 3GU1A 5BMWA 1OFEA 2FTWA 1OBAA 2ZKMX 5G4EA 3VDHA 2QCEA 4GUIA 5I24A 1E1FA 1XCXA 1L0PA 2VFEA 1BTCA 4RKAA 4S23A 1SJBA 3VD5A 4U3AA 3SUWA 2WAGA 4AY8A 1VIWA 1Y65A 4JBRA 4XZIA 2ZA3A 1H0GA 2ZIDA 2TAAA 3UZZA 4O0ZA 3RMJA 3HM7A 3UP8A 3R0KA 3TMQA 4TU1A 3FS2A 3SO7A 3AWNA 1JIBA 3H53A 4DBWA 2DVUA 2WVUA 1BG4A 1LOSA 4U2ZA 4PFHA 4DJFD 4P7OA 3BZGA 3ARZA 5A6JA 3OLIA 1G1YA 3PANA 1JQVA 2AKZA 3DFYA 2HTMA 1I4NA 2E6YA 3TW6A 4C7FA 2Z28A 3GTHA 4QLKA 3E12A 1F2JA 2DSWA 1PKMA 3GXMA 4KWOA 2O9TA 2YB1A 3R7MA 3O7UA 2QXWA 4M6QA 2OWXA 2IW0A 1UD5A 1B9ZA 2DEPA 3W7QA 2G97A 4TV5A 1HQTA 4E4PA 4JIQA 4JHOA 4Z2IA 1GEHA 2XN0A 4UTWA 5I3DA 4ZO8A 4JIRA 1OT2A 3GIPA 1VIZA 3AYSA 5A2AA 4KFPA 4GG9A 5AFDA 2Q02A 1S1RA 1WBHA 4MWAB 3ABZA 4F0HA 4I7UA 1ZFJA 4CU7A 1YXYA 4HNVA 3GVWA 5E5CA 1A4LA 1RK5A 3EWCA 3MUXA 4QXIA 2DDXA 3OG3A 1ITQA 4I9JA 4UTTC 5K3VA 3RF9A 4DUWA 4EAMA 3TCSA 3RJYA 2IKGA 3R2GA 4KEZA 3U2CA 4I5RA 1ZTVA 3NG3A 3NYZA 3GXDA 3VDBA 1R7OA 1BTMA 3ANUA 3OVPA 3HQ1A 4WCJA 2ABBA 1ISZA 3HV9A 1E0XA 5C2CA 1F74A 4G8TA 3GVVA 2D2HA 4ACZB 2QCDB 2DP3A 1H1ZA 1XM3A 3RHGA 1MYRA 3TV8A 1W5MA 2DSVA 1TX2A 3S8HA 2V5BA 3PPHA 1YKWA 4ADSA 3VVGA 1U5HA 1LCOA 2DH3A 4ERIA 3ARQA 3WJYA 5BOEA 4I9MA 4DJEC 3H26A 3IGXA 1XSJA 1MNZA 1CGVA 4IF2A 3G3MA 2FLIA 3W1QA 1WZKA 4BWLA 2AOSA 2FYMA 4FNUA 4UTMA 2OZ0A 1ENUA 2J8FA 4HMNA 1VBUA 5AECA 1M6JA 3VCNA 3A3WA 1POJA 4N6FA 4LCSA 2Z1KA 4NZ4A 3NEHA 4XD6A 1MVYA 3G1YA 3SRHA 5HOSA 3T07A 3ARUA 4ZQRA 5CGQA 4J28A 4UOZA 3N9SA 3BOXA 2OSXA 2HSAA 1Z3NA 2AMXA 2PWDA 3E74A 3S9IA 2CNCA 1Z48A 4KETA 4MZ8A 1F8MA 4OV4A 1M9HA 3UXDA 2VMFA 4JKLA 3LHZA 2E28A 2HBVA 1XLJA 4RZBA 4WSHA 2HVMA 5CGTA 2PDLA 2VGFA 5FJRA 3T0AA 3PZOA 2V5KA 5DMNA 5E1QA 2NV9A 3BLOA 5FEZA 1PCKA 3O16A 2JF6A 4Z2HA 1XJBA 2ZADA 4HA1A 1YTDA 2QUMA 1HJXA 2D0FA 3TSMA 3MVTA 4Y8EA 4B5SA 5E0KA 1ZZMA 1PZ1A 5AYYA 3GVQA 4LYKA 4GY1A 1RD5A 1UUOA 3LBCA 4WK9A 1Y5WA 4XAFA 3VI2A 3DKJA 3CMGA 2EKGA 3E02A 2MANA 1R3TA 3N3TA 3BARA 4XIMA 5G1YA 1JFXA 3VCCA 1GYNA 2DSKA 1W5QA 3SB0A 3GKFA