2PBOA

E27q mutant of exo-b-(1,3)-glucanase from candida albicans at 1.85 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLQPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Hypothetical protein XOG1
publication title Structural and Functional Analysis of Protein:Carbohydrate Interactions at Three Distinct Sites in Candida albicans Exo-beta-1,3-glucanase
rcsb
source organism Candida albicans
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pboA00
1R86A 5IDIA 3WNPA 3CHEA 1WPCA 2PI6A 1GOMA 5M3WA 2OYKA 5CGMA 1J12A 1PBGA 3AYSA 1WZMA 2CBIA 1WE5A 4C7FA 5AYIA 5I23A 4GI8A 3W81A 3LPFA 1ZBVA 3OGVA 4KGLA 1HJWA 1RH9A 4H8HA 5AY7A 1KB3A 2J74A 1I75A 1EQPA 4GPNA 4XB3A 1MWOA 2NW0A 1JAKA 3GH4A 1UH4A 3CHDA 3CUHA 1Q6FA 2XFRA 3WBAA 1W9VA 2EPKX 3ARYA 1CXKA 5A6SA 2XJ7A 3ARPA 5KZ6A 4YN5A 3ZJKA 1VEMA 4J3UA 3HMCA 4UQ9A 2OYLA 3BH4A 3AS0A 1HXJA 1VIWA 2J47A 4PSRA 4U3CA 1E0VA 1N82A 1CGYA 3VDCA 1FH7A 3NJ3A 5E6YA 3M46A 2WLZA 5ABHA 5JBFA 3AQUA 4MDOA 4DWSB 4FF5A 5C70A 4UZSA 1NH6A 2C0HA 1W1YA 2D0HA 1R7OA 2OYMA 5DT5A 3GXDA 1OWQA 4QLLA 4XX6A 4IPLA 1OT1A 2CIPA 3AIQA 4KRTA 3JUGA 5HXMA 4A3HA 4ACYA 4OBSA 2JF6A 2WWCA 5CSYA 3BLPX 4UOQA 4AYSA 1H41A 5C71A 3QOKA 4BQ2A 3N17A 2CESA 3OG2A 1JD9A 3CMJA 2YL9A 2J75A 3OB8A 3VMNA 1HKMA 1ISZA 1B30A 1UR0A 3ARQA 4AZIA 3AIRA 3PBGA 4UZUA 2GJXA 5A2BA 5A94A 4CD7A 1QI3A 1OGBA 1FHDA 2WMFA 4GQQA 5HDRA 3WD3A 1UR8A 1GOQA 3K4AA 3SCSA 1ODZA 1QHPA 1RPKA 1US3A 3UG3A 4JFTA 1BYDA 1GHSA 2UY4A 1K9FA 1ISWA 2D20A 2VCAA 3VO0A 1WZLA 2XM2A 4H8VA 4HZ6A 1HX0A 2NT0A 3QGVA 4DWSD 3CUJA 2D3NA 2J4GA 5ABFA 5ABEA 2FHBA 1OINA 3ARRA 2X2YA 3MUZ1 3WH5A 1E15A 4C7GA 1H49A 3UR8A 3VD7A 5CG0A 1QI4A 2VX4A 3AIWA 4WKAA 1YHTA 4QDMA 1K9EA 3VD4A 4UCFA 4Y7EA 3CZLA 4UQEA 2YA1A 1H1NA 3AS1A 5I0DA 4UR9A 3T2OA 2EPNA 2XWDA 2UY2A 1HT6A 2J7HA 1KGXA 4M81A 3N9KA 4F9DA 1Q6GA 3L2LA 1CLVA 5A6JA 2BY0A 4QFUA 2BV9A 3PZGA 1AVAA 2GUYA 2E0PA 1E4MM 4TTUA 3WUEA 2VL4A 2J78A 4LYQA 2JF7A 3N1AA 2D3LA 5CZKA 1CPUA 1NWTA 2BHYA 3TTOA 2RGMA 2ZE0A 3K8LA 3AHZA 2DT0A 4JFSA 2A3HA 2WVTA 2PF0A 2ZX9A 1H09A 4D71A 1JNEA 3T09A 1JZ3A 4Z2LA 4M82A 4R27A 7CGTA 2J77A 3ZR5A 1MQRA 1J0IA 1J0ZA 4HA1A 3CH9A 3B9EA 3WH8A 2WW5A 2O92A 1GCYA 1CXEA 4M29A 4V27A 4MJ2A 2WMIB 5HPCA 4YPJA 4GXPA 6TAAA 1XRVA 3BSGA 2QF8A 3SUTA 5F7UA 4CKQA 5A6KA 1X6LA 2UWFA 2W66A 2V3FA 1LWHA 2X09A 1VENA 2XG9A 4XZWA 1UQYA 2E9BA 3TTYA 1WDRA 1UKSA 4JCLA 4P7NA 1BFNA 3ARTA 1W3KA 1GOWA 4BQ3A 2J8FA 4J3TA 4AEFA 2WBKA 2JIEA 4H04A 3WQ8A 4PMUA 3PZ9A 3VKKA 3CZ8A 1MVYA 4U31A 3VM7A 3WUBA 5DMYA 3EBVA 2FH6A 5E9AA 4TXEA 5FL1A 3N12A 4CU7A 1J0HA 1C90A 4ATWA 4E2OA 1OCQA 3AICA 4UQDA 4TVDA 3AS3A 2W63A 2YA0A 3F5KA 2J7BA 3QHOA 3VUPA 3ZJ6A 1GW1A 3OBAA 3OLIA 1K6AA 1HIZA 1V3MA 2XUCA 3KL0A 4L4OA 4A3YA 1QNSA 3WEZA 4HPHA 3GM8A 5BROA 2ZICA 3AHTA 1Q6CA 3AS2A 1QNOA 3ZQ9A 1D7FA 4AD3A 1OB0A 4X0NA 3SCRA 1C91A 1GQKA 6CGTA 2VMFA 1NARA 1CZ1A 1EH9A 3ALFA 4J3WA 3AYRA 4CD8A 2WB5A 5DT7A 4P8VA 4JIEA 1V6UA 3BCDA 5GNXA 2BS9A 4PTXA 3NSXA 4F9JA 2XGBA 3FAXA 1MYRA 2Y4SA 3WFZA 1CNVA 4P7OA 1CTNA 1ISXA 2ZWYA 1V02E 2E3ZA 4P8XA 3ZO9A 1E56A 4AZ7A 1XYFA 2OSWA 1QW8A 2VZSA 2VTFA 3K4DA 4HOZA 4AMCA 1JDAA 2DSVA 4MNKA 1JF6A 2ZWZA 3VVGA 4AZCB 2XSBA 1US2A 1LL4A 2FGZA 3WIJA 6A3HA 1LLOA 2O9OA 1E73M 2OSXA 1W1VA 4MJ4A 1GQLA 5BRQA 3VILA 4HPGA 5EFDA 5CPQA 2V5DA 4B3KA 5CGTA 3ZMRA 2E4TA 3W28A 3TA9A 1CXFA 1V02A 5I2UA 4NI3A 2VVNA 5D4YA 4XZBA 3EMZA 4PUEA 5FL0A 2WC4A 3FY1A 4AIEA 2PBOA 4C7DA 4AWEA 5IFPA 3AMKA 3RJXA 3VD3A 3DYOA 1W9BM 1JYVA 2HISA 2WKLA 2VT0A 2WPGA 3DHUA 4CN4A 2FDMA 2VCBA 2CYGA 2D1ZA 3PTQA 5EBAA 3CZJA 1OD8A 2WCAA 3W25A 4UOJA 3FNDA 1WCGA 2VQUA 4H2CA 4MAZA 4HP5A 1V6WA 3BLKA 3UR7A 2QV4A 4N0RA 4AIOA 3W29A 2OWWA 3WH6A 5I3DA 4QCEA 4HU0A 3SCTA 3AHYA 1E4NA 1R87A 3ARZA 3EDFA 1BPLB 5IHSA 2CKSA 4D6HA 3U5YA 4UNIA 3ZSSA 3WEOA 1OIFA 4ZE5A 1XHGA 1QNRA 4W8BA 3MV01 1G9HA 2Y8KA 3AHXA 3TOPA 3VDHA 3K8KA 3MMWA 3VIOA 2CHOA 2DIJA 3RM9A 1GNXA 1J0KA 3VIMA 3CO4A 1G0CA 4V28A 3RO8A 5D9MA 1BG9A 1U33A 1LG2A 5JBDA 4PMZA 1K9DA 3WELA 2J7GA 4AZ6A 1K9TA 3M07A 4PMDA 5A1AA 1E9LA 1DWGM 1JZ6A 1KCLA 1ISYA 2ZXAA 8A3HA 2WSPA 3DC0A 3AHVA 2VZUA 1XD1A 4UFJA 1KXHA 4PUDA 1PX4A 2CBUA 1LG1A 1JDDA 1C8XA 4JKMA 2D2OA 4D6IA 1CWYA 2ZXDA 1M04A 1UG6A 3S2CA 3NCOA 3SCQA 4UFKA 1EGZA 2DT3A 2BXYA 2PWFA 2WVSA 3CHCA 2XM1A 1A47A 3BSHA 1M7XA 1TG7A 4WK9A 1V3LA 4MPKA 2WK2A 1KQZA 1ZU8A 4PTWA 5A2AA 5A69A 2WVVB 3WDPP 3HN3A 3QR3A 4UTFA 3IANA 4EANA 1HF6A 1BVZA 2J8GA 3N11A 4JL2A 2A3BA 1JI1A 1HVXA 1EA9C 5CLWA 1AQ0A 1E6RA 3WN6A 4RE3A 2G3MA 1XSIA 3WBEA 5A6MA 3KZSA 3K46A 1OIMA 2WHMA 1E6PA 2E8YA 1O6IA 4JKKA 1OGGA 2WZHA 4ACZB 3AZSA 2PWDA 1V0KA 2WVUA 1W9UA 4W88A 4Z2KA 7TAAA 2ZOXA 1E72M 5A8NA 4DWSA 3EDEA 3WF4A 5CSUA 1W9XA 4M1RA 4UQCA 3WH7A 3MSGA 2D23A 4M80A 1UA7A 1C7SA 4TVCA 1BYBA 1UR9A 1DP0A 4W7VA 2VZTA 5BWFA 1QI2A 1MW2A 2G3NA 5DFAA 5BRPA 4CU6A 5LA1A 4YHEA 2VURA 4GZIA 3APGA 3VIIA 1B3YA 2W67A 1NOFA 4TX6A 2BNJA 3NSMA 3NDYA 5IHRA 5GNYA 3NDZA 1IV8A 2QLYA 1BSIA 2CNCA 2IXUA 3EDDA 1UA3A 3DYMA 4MB3A 1BQCA 1W32A 5HNNA 4MADA 3THCA 1EOKA 1PX3A 4MTVA 2YBUA 3KL5A 1CGTA 1S46A 1G1YA 1GHRA 1VAHA 1EDTA 2DGAA 3GNOA 1CGVA 1C3FA 1C8QA 1QNPA 2WZIA 1JXKA 1UR4A 3CUGA 3K8MA 2MANA 4F79A 1CBGA 3W24A 1JZ8A 3RCNA 1C7TA 1EO7A 2AOSA 1TFVA 3IK2A 1UKTA 1UD6A 2X1IA 4PMNA 3IAPA 4MAVA 1PEZA 1BG4A 3F5JA 2EO7A 1B0IA 3MS8A 2JE8A 2CERA 4UQAA 3I3BA 1E4LA 3VX1A 3ZT6A 3II1A 4JHOA 4HMCA 1RD6A 1AQHA 1EIBA 3OZPA 1QBAA 1V0MA 3CHFA 4ATDA 4UQBA 2WHKA 1UUQA 1G5AA 3AZTA 4P7QA 3WUFA 4D6EA 4GKLA 1W3HA 1BGAA 3FHQA 2VVSA 3CZEA 2XSAA 1WO2A 2IUZA 5ABGA 3PZOA 3VIJA 3RJYA 4W87A 3FXYA 3N04A 3RDKA 2W61A 2WHLA 4W7WA 3CMGA 4DUXA 3ALGA 4JKLA 3DHPA 3WL0A 2EQDA 2EBNA 1QVBA 2VI0A 3VGBA 1HKIA 4DUVA 3B9DA 1JYXA 5I24A 2VUYA 5TD4A 3RM4A 3VGHA 4FLQA 3KL3A 2D0FA 1M53A 1CXHA 3ARWA 4U5KA 1MXGA 1MW1A 1KXVA 2PBGA 1FH9A 3BMVA 2XVKA 3KE0A 2WBGA 2BHUA 4U2YA 5HOSA 2VRQA 5IXEA 1E43A 1B1YA 3WNNA 4CD4A 3ZJ7A 1GOIA 1R85A 4BQ5A 2O9TA 3VNZA 5I77A 3ARSA 4UFLA 1KCKA 3IJ8A 4E4PA 1MQPA 1C92A 2ZUMA 1U30A 1VFMA 4HZ8A 1B3WA 4PCSA 3AXXA 2WMIA 1E1FA 1V03A 4GO9A 3MANA 3AROA 4QCFA 2DIEA 1LL7A 5A8MA 3LPOA 4GO8A 4OKDA 3RM8A 1AMYA 1NP0A 1CGUA 1VB9A 3NIYA 1VBRA 2PWEA 1KR0A 3VGDA 3VOCA 2VR5A 4LYRA 2BVDA 5E0CA 3SCPA 4JHZA 2WM0A 1E3XA 2CETA 5AC5A 1H3GA 3WENA 2QHAA 3I3EA 1E5JA 1ZBCA 4LXFA 2OSYA 1DWIM 4HZ7A 2XVPA 2EPOA 2VO5A 2BY3A 2GFTA 1Q6DA 5AYBA 1X1NA 4ZEPA 4GIAA 1E6QM 1GVIA 4LQ1A 1QW9A 1V3KA 2VR4A 2VZOA 3OA5A 2YDRA 4F66A 3ARXA 1RP8A 2Y2WA 4D6CA 1XH1A 3VDBA 4Z2IA 2CKRA 3ECQA 3VD5A 3BCFA 4P7RA 1JZ4A 4W8AA 1MQQA 4P8WA 2CXGA 1WAWA 3AFBA 1MXDA 1UZ1A 4IM4A 2WZEA 1W9PA 2YDQA 4DM2A 1XYZA 1E4IA 4IUGA 2V3EA 1TZ7A 2ZX7A 4AZBA 1UD2A 4H7VA 3TP4A 1E5NA 1ESWA 1V3IA 4EAMA 1H5VA 2BFGA 2BY1A 4OJYA 2J7EA 1HKKA 1XGZA 3AOFA 4X0VA 2DSWA 3UERA 3PZTA 3RILA 5C8BB 3LMYA 3ZSTA 4J27A 2CBJA 3MV11 4W8LA 1UZ4A 4RE2A 4H41A 3E1F1 2JEPA 3SCNA 3T2PA 4GZJA 5I6SA 4R5EA 2J25A 2ZUSA 4AZCA 1SMDA 1V6VA 2YL5A 1FP9A 1V6XA 2B31A 4TX8A 3WDJA 1NWSA 1B9ZA 1UWIA 3ZR6A 1TVPA 4EK7A 1KGWA 2OWXA 3W26A 2BY2A 4N42A 1PJ9A 4GZEA 4CUCA 4CCCA 4AD0A 1P6WA 3CGTA 2F8QA 4AW7A 1ITCA 1WNOA 2WNWA 1PZ3A 5D9OA 1E0XA 4B15A 5EFFA 1VEPA 1EQCA 1PPIA 2VQTA 2E8ZA 4B9ZA 2DDXA 3W4RA 5E09A 3PHAA 2VZVA 3NYDA 3AMDA 3IAQA 1E6XM 1UD5A 4D1IA 5BYWA 1TUXA 5FCZA 1LL6A 1D3CA 3VX0A 2WMJA 1VEOA 3WQVA 1XH2A 3AXHA 3N18A 3BAJA 3O9NA 3VIFA 1XD0A 3EYPA 4BS0A 1CYGA 2DT2A 2FHCA 1OSEA 1XC6A 5EB8A 1ZJAA 5CLTA 5CPSA 1B31A 2WMKA 3QHNA 4WKHA 3SCOA 4ZXLA 3PZNA 4KWUA 4D72A 1KBBA 2Y24A 4W85A 3ZIZA 2CEQA 1V3JA 4ZFMA 3WY1A 2XPKA 4BQ4A 2GK1B 1E1EA 5A6AA 2VNCA 4QLJA 2E40A 1FFRA 2ZUUA 4RE4A 1R8LA 3UEQA 2WWDA 4BF7A 1UWQA 1E71M 3M7SA 1WZAA 5D8ZA 2IXVA 1BLIA 3OLDA 1HJSA 4U5IA 3SIMA 1G94A 1JYWA 1QOXA 2YLAA 3GBEA 4PTVA 4DWSC 3WH9A 1SR0A 2W62A 1DWHM 4TVUA 3FAWA 4Z2JA 1QNQA 2DPEA 3B9AA 3AJ7A 5JIPA 5M03A 2XFYA 5JBEA 3VU2A 1J0JA 4ML4A 2QPSA 1W9DM 4AXNA 3K1DA 3UETA 3MMUA 5HBFA 1E3ZA 1DTUA 2V5CA 3GDBA 5GNZA 3IJ7A 3QOMA 3EMCA 4OOUA 3OZOA 1UD3A 1CIUA 2UY3A 4W5UA 3VGGA 3AISA 1CECA 2WVVA 4ATLA 1ZB5A 1GVYA 4NSBA 2XWEA 2CBVA 2CCRA 5CJ5A 3CZKA 1B3VA 1LJYA 4PEEA 4HTYA 4K68A 3CTTA 4MNMA 1VFOA 1VF8A 1FOBA 2DSKA 2YOCA 1UOKA 4CVUA 4WF7A 3S6TA 2DSUA 5IFTA 3T2QA 1WDPA 3VNYA 4ACZA 2A3AA 5KEZA 1PX8A 2WYSA 1OM0A 5A2CA 2G3IA 4D1JA 3VMOA 3OLEA 1H0IA 3SURA 5A8PA 5I5RA 3L4YA 4CN6A 4PMQA 3J7HA 4OZOA 1V0LA 3WMCA 3PZIA 1GJWA 2NSXA 1KWKA 3PZQA 3WD1A 1JZ7A 3A4WA 4CD5A 1PAMA 4PYSA 1LWJA 3A3HA 1BTCA 3GNPA 3TONA 2G3JA 3FHAA 1E55A 1HL8A 1ODUA 1HJUA 3GZAA 3L4UA 2JIWA 1GQIA 3MMDA 2FH8A 4Z2HA 1CGXA 1UWUA 2J7DA 4AEEA 1QHZA 1JZ2A 1Q6EA 3WF2A 1D2KA 1LF1A 3MUAA 1XCWA 1CENA 2XVGA 3THDA 1W91A 3WMSA 2YJQA 1YQ2A 3BMWA 1NQ6A 1B3XA 1SMAA 1J18A 2TAAA 2ZUWA 2GSJA 4NRSA 4PMOA 1JAEA 4AZ5A 5EMYA 3CUIA 3T0DA 1QHOA 2YL8A 2YIHA 1TA3B 3BC9A 4E8DA 2ZUNA 1BYCA 1RP9A 1E0WA 4MNLA 4EKJA 4CCDA 1XH0A 3L4TA 4AD2A 4L4PA 4JAWA 4OUEA 3AMGA 4OBRA 4URIA 3OGSA 4X9YA 3SUWA 2YLLA 2VJXA 3TTQA 4J28A 1UHVA 3WUGA 2V3DA 1TMQA 1Q4NX 5M17A 3N15A 4TOQA 1V0NA 2EJ1A 2WCSA 3BAIA 1H0GA 3WNLA 3KEHA 4IPNB 3PZMA 4QAWA 5LA2A 4MB1A 3A4AA 2BHZA 3RMEA 4P8UA 3A47A 1DWJM 1J11A 1JL8A 3CBWA 1JDCA 1CGWA 1B3ZA 3ZT5A 1XCXA 5E70A 3MO4A 5A3HA 3ARVA 2WMHA 2CHNA 4UFIA 3GXFA 3POCA 4W89A 3BAXA 4HA3A 1HNYA 4Z2GA 4PMVA 3SUVA 3UG5A 1A3HA 3GXMA 4D6FA 2D22A 2OWCA 5I78A 1BF2A 3VTRA 1MW0A 1BYAA 1UH3A 3W38A 4TUFA 1B90A 1VBUA 1WP6A 2Q8XA 5BXPA 2JFEX 2DEPA 3HJEA 5CQ1A 3PZVA 4JFWA 3VIGA 1EO5A 4WSJA 5AC4A 1KGUA 4GINA 4AC1X 1UWRA 1CXIA 3GYCA 1HJQA 2XGIA 3FN9A 3PTMA 5JUVA 4AISA 2WMGA 1FP8A 3BGAA 3T0AA 1OBAA 3MSDA 1W2VA 4YHGA 3WF1A 2UY5A 5FOOA 1GUVA 3CZGA 2GDVA 5FKYA 3L2MA 1JZ5A 1V3HA 1IZKA 2ZX6A 1WB0A 1W3LA 3AIVA 4AD5A 2PWHA 4J7RA 3AI0A 1LQ0A 4FMVA 3AIEA 2EXOA 3L4ZA 3BAWA 3VIPA 4CU8A 5D8WA 5E0FA 2XHYA 4W7UA 1BVNP 4MB4A 4W84A 2QPUA 4M24A 1CLXA 4LPCA 3OGRA 4U33A 4WLCA 3RPMA 1W2PA 2E9MA 5JIWA 5I79A 1PIGA 4JCMA 4QLKA 2ZX8A 1EDQA 1OT2A 3F4VA 4MDPA 5CPTA 1DEDA 4BCEA 2BVTA 2EEXA 2OLHA 3POHA 3BXWA 4ZXOA 1UR2A 2NT1A 3BAKA 2YL6A 5FIPA 2VRKA 3AMLA 1G01A 1V08A 2ZUTA 4XUYA 4HMDA 4GI6A 4Q22A 2GDUA 3D5HA 1I1WA 3L4VA 4LX4A 1FHLA 1Y7VA 1TR1A 4KRUA 3A4XA 3VIKA 1TE1A 1I1XA 1VJSA 1VJZA 3GH5A 1XSKA 1FA2A 5D9PA 5E6ZA 5BXTA 1E6ZA 1QI5A 4FLOA 3DYPA 3B8SA 4H8UA 1NP2A 2JEQA 3FW6A 3SEPA 2FGLA 3WSUA 4ZENA 1HKJA 1WZKA 1MW3A 1WKYA 3MUY1 3UESA 1VFUA 4CGTA 3WNOA 1GPFA 3T0BA 1JG9A 2RGLA 4LYPA 1EHNA 2VX5A 4WJXA 4PMXA 4AY1A 2XVLA 3VMPA 2DQXA 4WKFA 2AMGA 2WHJA 2DT1A 4FLSA 4KMQA 1FFQA 2WCGA 1UWTA 1UKOA 2W4XA 1KBKA 4V2XA 2WLYA 1W3JA 2G4FA 5FD0A 4FK9A 4IISA 3CIVA 1H2JA 8CGTA 4UFMA 3W37A 3NUKA 2VX7A 4RL3A 2ZIDA 2VX6A 3LPGA 1AQMA 2D0GA 2GJXB 2X8RA 3SUUA 3VGEA 2VOTA 1CDGA 4P7LA 1JNDA 3I3DA 3VIHA 2XVNA 2DH3A 9CGTA 2EPMX 4NRRA 1ZJBA 3UCQA 1O7AA 2YA2A 3WQ5A 4A4AA 4HU8A 4KGJA 1JF5A 3L4WA 3O6AA 3AMCA 1PZ2A 2QMKA 2XYLA 3PZUA 1ITXA 5ABFB 4J3VA 5A8QA 1WDQA 1L0PA 1L8NA 5DO8A 1JI2A 4JFUA 1E6NA 1UH2A 2O9RA 3KWXA 3AXIA 3W53A 1H4PA 2JALA 4AZGA 5M5DA 3WQ4A 1H11A 4F8XA 2GK1A 2J62A 3VD9A 2GJPA 1KWGA 1BGGA 4HMEA 4PSPA 2WXDM 4BZYA 3WQWA 3G6MA 4PBGA 5BXSA 4W5ZA 2V38A 5BCAA 3WMBA 4U2ZA 3TTSA 1ISVA 2Y5EA 1QI0A 3NSNA 5A95A 1GQJA 1NM9A 2CITA 2YDSA 2W92A 1J01A 5D9NA 1XV8A 3VM5A 4OOZA 3MUIA 2A3EA 5DF0A 4XV0A 2BXZA 4M56A 1C93A 1QPKA 1UYQA 4M8UA 3MU7A 3SCWA 1IZJA 3CLWA 3O2LA 1HL9A 2CPUA 1E70M 3WDQA 3SCUA 4OIFA 2ZUVA 4BA0A 2J79A 3GH7A 1JYNA 3VPLA 4B16A 1JFHA 3PN8A 3W82A 1ZBWA 3HU7A 4MB5A 1R7AA 1W1PA 3L4XA 1WDSA 3AIUA 3QHMA 1E40A 1EHAA 1UR1A 1GJUA 1BHGA 4EE9A 1PIFA 1IT0A 1BAGA 1NOUA 1X6NA 4PMYA 1HJXA 1JXJA 1UKQA 3AIBA 2QMJA 2YBTA 4WSKA 4GI9A 1ZL1A 4HA4A 4UFHA 2ZXBA 4UOZA 3PTKA 3U7BA 2AAAA 1GZJA 2PB1A 1FH8A 1M03A 4J3SA 1UD4A 3WDHA 1VFFA 2F2HA 3W6LA 2VCCA 2PWGA 3WQ6A 2WAGA 2WC7A 1XSJA 3WD4A 1EOMA 3GTNA 4LGXA 3N13A 5A6BA 1J0YA 1HP4A 1B2YA 5A8OA 3A6OA 1U2YA 3OLGA 2GVYA 1C8YA 1HN1A 1W1TA 5LYRA 2A3CA 4PRWA 4B9YA 3EDJA 3SUSA 1F4HA 3EMQA 3U5UA 1NWUA 2XIIA 3GNRA 3WL1A 1Z32X 4NZCA 2WC3A 4J3XA 3ZOAA 3WEMA 1KFWA 2V3GA 4Q7NA 2XTKA 3MKKA 7A3HA 1KR1A 2DSZA 3VDAA 1JGIA 4HOWA 2W5FA 4JZ5A 1TCMA 3W6MA 2FHFA 3T08A 1GOOA 5ECUA 3VGFA 1MFUA 1HP5A 2D24A 1DWAM 3U57A 3WNMA 1GOKA 1TA3A 4CN1A 2Z1SA 1JIBA 4ZE4A 3SCVA 1HVQA 5HPOA 2ESCA 1E6SM 1NWRA 1V6YA 3CUFA 4D6GA 1KQYA 4S3KA 1DHKA 5GQBA 1UD8A 3WFLA 1KXQA 1SYTA 2G41A 1ZS2A 2WSKA 4NF7A 3AZRA 3VINA 2G8ZA 2BVYA 4W93A 1UWSA 3WD0A 3F5LA 5BXRA 4MNJA 4DM1A 4AD4A 4AD1A 4S3JA 3WKZA 3WF0A 4WIWA 3W27A 2VRJA 4CVWA 3UG4A 1J10A 2X05A 1JD7A 1ZBKA 2W91A 2O9PA 5LA0A 3M6DA 4KH2A 4D6DA 4DUWA 3CPUA 5CXPA 2ZX5A 4JFVA 4JL1A 1UKPA 3GXIA 3DECA 4PCTA 4AIUA 4QP0A 2C8NA 1CEOA 4PN2A 1F4AA 3ARUA 3WD2A 3WF3A 2ZXQA 1CXLA 1GONA 1OD0A 2HVMA 4B3LA 5DEZA 3GBDA 4W86A 1MFVA 2X0HA 1EXPA 2PC8A 2Y8VA 1QBBA 2J7FA 4CCEA 3W0KA 4CD6A 3RIKA 3G6LA 4D6JA 3OIHA 2GJRA 5A6LA 1J9YA 2E9LA 4GQRA 1ECEA 1GORA 3BAYA 4U3AA 2YKKA 4TTGA 1SFSA 1TVNA 2EPLX 1DWFM 1M01A 5A6BD 5GPRA 4FLRA 1NOWA 1OGSA 2XFFA 3EDKA 1HJVA 3ZJ8A 2J7CA 3WDRA 2XIBA 3D3AA 2WANA 4AZHA 1UQZA 1JFXA 1VRXA 2Z1KA 3WNKA 2X0YA 3U7VA 4PTMA 4HOXA 2F61A 3IJ9A 2C7FA 3LPPA 3ZT7A 4PMRA 2DH2A 1KXTA 1EDGA 2WKGA 3ZM8A 3WDIA 2VC9A 4E8CA
chains in the Genus database with same CATH superfamily
2HCVA 4OU1A 4GC3A 2DORA 3HF3A 4NUWA 2AKMA 4GYPA 3DFHA 2OYKA 4DPPA 1Q5MA 4IP5A 3AYSA 2CBIA 3V75A 4C7FA 1LBLA 3O6YX 2Y7FA 3OVRA 3W7PA 3OGVA 3W85A 1HJWA 4X63A 4NL1A 3IUIA 2ABAA 1KB3A 2HK0A 4MWAE 1I75A 1EQPA 2CWXA 2XN1A 1MWOA 4DWDA 3H2FA 4Z08A 2NW0A 2OMAA 2POZA 3GH4A 3CUHA 4O8RA 3WBAA 4QJ3B 3LV6A 1W9VA 1P0EA 2EPKX 3ARPA 3KRZA 3TN4A 4FX7A 4J3UA 3T6CA 4UQ9A 2OYLA 3AS0A 4NXSA 3TK7A 4GLEA 2W6RA 1E0VA 1G4SA 3CC1A 3WLOA 1CGYA 2PU0A 3VOFA 3M46A 4GXMA 2XZ9A 3A64A 1JCTA 4MDOA 5C70A 3CM4A 1NH6A 1R7OA 5DT5A 1FWNA 1XBYA 2GVJA 4IMFA 1ZTVA 1H7RA 4H4IA 3AIQA 4JQAA 2HBVA 4ACYA 4FR1A 2WWCA 2ZA3A 1H41A 3RPTA 4BQ2A 3UXAA 3UNDA 1UJPA 3L0GA 1VYPX 5XIMA 1JD9A 3CMJA 2VC5A 4IFRA 3LXAA 3VMNA 4OV9A 4Z1YA 4ORMA 3VC6A 1GVOA 1Z7AA 5A94A 1NJJA 1FHDA 1XYLA 3HFTA 4GJIA 3WD3A 3W02A 1GOQA 3SCSA 1RPKA 4DJDA 2OG9A 3CV1A 3SY1A 1GHSA 2UY4A 4GIEA 4G1KA 3P7YA 4H9ZA 3UZYA 3WJSA 9RUBA 1VPXA 2GUBA 2CXEA 4HHPA 2HVNA 3B4YA 3QGVA 2NQ9A 3CUJA 2J4GA 5G5IA 4Y2WA 3FA3A 1OINA 3O05A 3WH5A 4C7GA 3GFYA 2FZBA 3E2SA 2E6FA 1PCWA 3W2MA 4A29A 3TDFA 4UR7A 1YHTA 4JNYA 1RJPA 4QDMA 1Q65A 2W79A 3GIPA 4GISA 4UCGA 3V3WA 5RUBA 2YA1A 3EWDA 3MWAA 4QE5A 4J40A 1HT6A 4ZVJA 2J7HA 1AK5A 4BY3A 1KGXA 4M81A 2BBFA 5A6JA 2BV9A 3R43A 1Z42A 3PZGA 2GUYA 3N29A 1R30A 4E2VA 4CEUC 3GK0A 3F4CA 1DIKA 4O57A 2J78A 5HANA 2JF7A 3N1AA 2D3LA 5CZSA 2VFDA 5EKYA 4NHVA 3TTOA 1LOQA 1W1ZA 3A5FA 4DO4A 3K8LA 3SB0A 1RCOB 2WVTA 1H09A 4Q4SA 4JOMA 4D8ZA 3QY6A 3WLRA 3I6TA 1J0IA 1J0ZA 3TCSA 2CLEA 2NXHA 1VD6A 1OZMA 4YPJA 3BCJA 4X2RA 3NWRA 2P53A 1ONXA 3BSGA 3C6CA 2UWFA 3GY1A 2PDQA 4GQ0A 3F2CA 1TQXA 1UKSA 3TNBA 2PLJA 3BQ6A 1W3KA 1S2TA 4RZBA 4BQ3A 3DGBA 3HTWA 1H7PA 3PZ9A 3TMQA 1AUSL 3CZ8A 1MVYA 1NIUA 3EBVA 2RDTA 4TXEA 4QBXA 3N12A 4MKSA 1OCBA 4YLWA 5D09A 4LS0A 3DDMA 4AIBA 1MEHA 1XYAA 5I3KA 3LA4A 5H6HA 3GKAA 3K4WA 4RDZA 1X7FA 3VUPA 2GQ9A 3OBAA 3WQGA 3URNA 1HIZA 1QNSA 3GM8A 4NZ1A 5BROA 1ZGDA 2C14A 1KW1A 3MHGA 4AY7A 3LTSA 1F5ZA 3NEVA 2VMFA 2WSYA 4XVEA 1CZ1A 4ZQCA 4KFOA 2WB5A 4H2HA 4WGHA 1AODA 4UTMA 3TC3A 3DU0A 4PTXA 4M5PA 4F9JA 1TTPA 1O1ZA 4IOTA 3L5LA 1FWFC 1ISXA 2ZWYA 1V02E 4ML9A 3AAMA 1QW8A 2R1LA 2VTFA 3S9YA 1QAPA 3K4DA 1J6PA 2J9XA 5MKGA 4IG2B 3TEVA 1LL4A 2PODA 4GUFA 4H3DA 6A3HA 2HJPA 1D3GA 2OSXA 1W1VA 4MJ4A 2A4AA 2YCKX 5CPQA 3EPOA 4B3KA 3ZMRA 4LV4A 4IFKA 5C7VA 3G24A 4MJZA 1B3OA 1JGMA 5FL0A 5I07A 5IFPA 2GL5A 3W01A 3O7UA 1BWKA 3LLDA 4XD6A 2WKLA 2I5GA 3DHUA 4WJ8A 2CYGA 2OZ8A 3W1LA 3NR0A 5EBAA 2QJJA 3W25A 1UPPA 2IPJA 4UOJA 2ZVRA 4MAZA 3O1NA 3BLKA 3G8EA 2QV4A 3MSYA 2BOFX 2OWWA 4JTIA 2XIOA 4R34A 5EYWA 1M7JA 1E4NA 3HMJG 4X22A 3MYPA 1K4HA 3CO8A 3ZSSA 2CLIA 4N4QA 4ROPA 4TMBA 1VHCA 4ZE5A 1XHGA 1ICSA 1UC5A 3QTPA 3LV5A 3AHXA 3EPMA 5T9BG 3TOPA 3VDHA 3FJNA 3K8KA 2CLFA 4AWTA 3EB4A 2CHOA 2DIJA 3FJLA 1YBQB 4S3CA 1J0KA 3VIMA 3OEXA 3CO4A 4R9XA 3IVSA 5EMJA 4EOUA 1K9DA 5K4ZA 1FY6A 4AZ6A 3M07A 3UZWA 4PMDA 1E9LA 1DWGM 4XKYB 1VYRA 4LUJA 1RXOB 1JPHA 5HR7A 1QTWA 4C5YA 4UFJA 2CBUA 3B8IA 2J88A 3N3MA 2PWUA 1CWYA 3GSMA 1YTEA 1M04A 1UG6A 4LAUA 3NCOA 3PBMA 2C18A 2IS7A 3U8GA 2CZ5A 4UFKA 4UXDA 2PWFA 4CNUA 3M5XA 5KSWA 3EEGA 1EFZA 2XM1A 1TV7A 4DX3A 3BSHA 3THAA 4ZMGA 1C9DA 1TMLA 1NAL1 1ZU8A 3W2UA 4L1GA 4CQBA 2KX9A 3WDPP 3HN3A 3IANA 1GEHA 1BVZA 2YB4A 3RPDA 1JI1A 2RH9A 1AQ0A 4ICCX 1E6RA 4O28A 1HO4A 4J35A 5A6MA 3NQGA 3KZSA 3RAOA 4PCPA 2WHMA 1E6PA 3GR4A 4IP4A 2E8YA 3F4DA 4JS3A 3BOXA 1OGGA 4ACZB 1S2CA 3VOIA 2HMCA 4Y8FA 3H6OA 4Z2KA 3HPXA 5A8NA 2REQA 3WF4A 3VZZA 4M1RA 5DMMA 4UTIA 3CB3A 1XM3A 4DVOA 1C7SA 4YXGA 1BYBA 1UR9A 4W7VA 1WDWA 3T7VA 3VKBA 1E51A 2G3NA 1K7FA 3S2NA 1OYBA 2BNJA 3NSMA 4ZCWA 5HINA 4YCOA 3NDZA 2DZTA 1IV8A 4HKPA 3WLNA 5EMLA 2R82A 2YPIA 3ITXA 3KXQA 3S83A 5HNUA 4Q33A 4QE1A 2PP1A 1PX3A 3QQ1A 4DO6A 1FWAC 3L66A 4O19A 1TX2A 1ONWA 3GNOA 2ANUA 3UZ5A 1QNPA 2WZIA 3O0KA 1JXKA 4WY0A 1V77A 3CUGA 2B4GA 3K8MA 5FF2A 2MANA 2EG7A 4RNIA 4F79A 1A80A 1CBGA 3GDRA 4DBSA 1JZ8A 3E6EA 3IAPA 4MAVA 1BG4A 3B4UA 4NVTA 1B0IA 4UQAA 3VX1A 3EA2A 3II1A 4JHOA 1EJRC 1RD6A 2F6UA 3SADA 4DI8A 1EIBA 2OXNA 3ZR4A 5BMXA 1BKSA 3CHFA 4RV8A 4O8AA 3P0WA 4D6EA 1BGAA 1KFCA 1W6TA 3GHRA 2VVSA 3T8LA 2HK1A 1XLHA 3CZEA 1WO2A 4EP8C 1KTBA 1IXPA 4W87A 4L9ZA 3TFXA 3RDKA 3PBYA 4RCXA 3NQFA 3IJ6A 2HTMA 3WL0A 1UP3A 2EBNA 2O0TA 1QVBA 2OT0A 4ENLA 2R1KA 4HBKA 3T81A 2B7PA 5H1WA 1POKA 2VUYA 5LGXA 2D0FA 2RJHA 4EVZA 1T8XA 2DUXA 5C0QA 1ECQA 1EJSC 6XIAA 1ZHAA 3BMVA 3KE0A 3SQMA 4OTKA 4HTBA 4CD4A 5I02A 3ZJ7A 4KW2A 3WLJA 1U22A 4JNZA 4BWLC 3O0FA 1R85A 2J27A 3VNZA 4IQEA 4BF5A 3BGGA 4UFLA 1UPMB 3UA4A 4AHQA 1MQPA 1TWSA 2GYIA 2ZUMA 3LNMA 4IPIA 3OP2A 1U5JA 2Y5SA 3UZZA 2WMIA 3MANA 1YE6A 3AROA 3QPYA 3QTGA 1J5TA 2QGHA 4C90A 1AMYA 3A9IA 1O5QA 3NIYA 3W7OA 2GUUA 4PUWA 2GGGA 3W07A 3VABA 3PJTA 3W1UA 3HGRA 1TR9A 2BG5A 3NTYA 1XKYA 3U4FA 3RXZA 1YXDA 1E3XA 2ZRWA 1E5JA 3LXBA 2EPOA 4ICNA 2BY3A 3TLLA 2GFTA 5AYBA 1X1NA 3W86A 4HN4A 2HQAA 2YDRA 3H2AA 1DJIA 4XUGA 4ZO6A 1XH1A 3N4FA 5CSRA 4Z2IA 2CKRA 4MKVA 2RHGA 2RDUA 1LLZA 3CV2A 3TXZA 4XD4A 4P8WA 2CXGA 2GOUA 3DI0A 3I7SA 3EWCA 3LHUA 3V5OA 1P43A 5CC3A 2WZEA 2YDQA 1KKOA 1XYZA 3AC0A 1P0DA 1SZFA 2V3EA 3Q4DA 3PFRA 1A5OC 1H5VA 4Z42C 3DESA 4TR9A 2BY1A 3BANA 3DHFA 4K3ZA 3W6YA 3E2VA 2RAGA 2AQWA 1HKKA 1XGZA 3AOFA 2DSWA 3DERA 5C8BB 3LMYA 3N4AA 2XH2A 4JR5A 3N6JA 2IQDA 4QQ3A 4W8LA 1FWTA 1U1UA 1W56A 1SZRA 4H41A 5KZEA 1N55A 5CZJA 3T2PA 5TF0A 4R5EA 2I17A 1MI3A 2BODX 3UGRA 4IJRA 1V6XA 4F2UA 2VWTA 2QUMA 4H9TA 1V4YA 4HNTA 3W26A 2BY2A 1A5UA 1PJ9A 3IIZA 4GZEA 4CCCA 4CUCA 3FLUA 4AD0A 3UJ2A 3C52A 4QSHA 3UG8A 3R8GA 2WNWA 1VEPA 1X97A 4B9ZA 3W4RA 4A3UA 2XH7A 3ZLHA 3MWCA 3T0CA 1XLEA 3GDLA 2JGYA 5F4WA 3PHAA 4S2CA 3NYDA 1TYGA 3CUZA 5JXQA 2VEFA 4I5XA 3NM1A 1BRLB 1TUXA 3W2LA 2DUAA 1BWLA 2NWRA 4QXIA 3K5XA 1VEOA 4RV3A 1E9YB 3BAJA 2HEJA 3ZZ1A 1YIXA 3L0NA 4RNHA 3HGSA 3PWAA 1L6WA 5CPSA 1B31A 4K6AA 3A9BA 2R8WA 1FWWA 5FACA 4LALA 4ZXLA 4D72A 3M5VA 1P1MA 1V6TA 3WY1A 1OX4A 2XPKA 2GK1B 4S3EA 4OWGA 1E1EA 1O5XA 1R9XA 1FFRA 4H9YA 3ITYA 4WXZA 2WWDA 4EX4A 3GUWA 3DOPA 4BF7A 1E71M 1WZAA 4WD0A 1EGVA 1YTKA 1RLCL 1HJSA 2AL2B 2CU0A 3HQ1A 1G94A 3B03A 4GJJA 3UR2A 1QOXA 3ZVHA 3WH9A 4GXWA 3EOEA 2C16A 3DH7A 3MZNA 4P2VA 3VZYA 1KKRA 2ZQ0A 2NX1A 3B9AA 1MNZA 5JIPA 4GYPC 3NQAA 3RR4A 3BSMA 3SQSA 3CB8A 3VU2A 1J0JA 2I9EA 3K1DA 5BW6A 4X3ZA 3MMUA 4UBPC 1ENUA 1RHCA 4F2BA 2PWVA 3OZOA 4XSMA 4E2DA 1DIOA 2CBVA 2BXVA 3GVRA 4MUZA 1LJYA 1F8MA 4PEEA 4HTYA 4K68A 4XQ6A 1I4NA 1VFOA 4PTDA 4RUBA 1FOBA 3LS9A 1VC4A 4DXKA 4AWSA 4WF7A 2FVKA 1WDPA 5KEZA 3BG3A 3VMOA 1F3TA 2XN0A 5A8PA 2CZEA 3C5QA 1BEUA 3NPWA 4G7EA 2B0MA 1V0LA 1TPFA 5CJNA 3LENA 3PZIA 1Z89A 4FR6A 2NSXA 4NXKA 4CD5A 3A3HA 2NUWA 2FB3A 2XDFA 3GNPA 1IE7C 2Q3OA 4R3UA 2QYGA 4LUYA 3PUEA 2RKXA 1UWUA 2Z00A 2J7DA 4EPKA 2POTA 1LF1A 1YXYA 1AJ2A 1XCWA 3SRKA 4FEZA 3OO2A 3GFZA 3STFA 1PZ1A 1ELSA 1RSCA 1YQ2A 1JUBA 1NFPA 4ZQPA 1KTNA 1QOPA 1GQNA 2AL1A 2TAAA 2OR2A 4JIQA 3I7RA 5G1TA 5G4WA 4AZ5A 5DY3A 2FJUB 2WQDA 4AX6A 4AVOA 4PRTA 3DFPA 2C1GA 2A6NA 4L4LA 4EKJA 2BVWA 3L4TA 3GDTA 1IEIA 1I2OA 1TTJA 3T4WA 4OUEA 3U2ZA 2OKOA 4URIA 4AH7A 1A5MC 3OGSA 4TX9A 1J5SA 2V3DA 1TMQA 4JY8A 2ADAA 2FMOA 3B8UA 3KOZA 2VFHA 4GG9A 2FZ8A 1U5VA 3KEHA 4IPNB 3VE7A 5FSDC 3KOXA 4IJBA 5LA2A 3A4AA 4RDWA 1NELA 2BHZA 3BZJA 1UCWA 3A47A 3CBWA 3QMRA 4HK5A 4YIWA 1JDCA 3GS6A 2GJLA 5E70A 2PTZA 3S5SA 2WMHA 1A5BA 1K8XA 3R11A 6ALDA 4O1AA 3KRUA 1A0CA 4UR8A 3P8IA 1HNYA 3ATYA 4Z2GA 1KFJA 3EKZA 4BF9A 3G1VA 2PAJA 3VTRA 3NVTA 2Z1VA 4ZSUA 4TUFA 1V7YA 4N6EA 1VBUA 4ZODA 4Y6GA 1B4KA 2NVDA 4JTUA 2DEPA 3VCNA 2F6XA 2QCCA 3WG6A 3QPEA 3RFAA 2G95A 7REQA 1UWRA 1IT8A 1HJQA 3PTMA 3U9IA 2Z24A 1FP8A 3KZPA 3T0AA 3MSDA 3PB2A 4LRSA 1UIOA 2G3FA 4PC8A 5K4XA 2QDDA 3NGJA 3CZGA 5FKYA 3B97A 4F4RA 1VJIA 2ZX6A 1THFD 4HSNA 1QOQA 2FIQA 3KP1A 2FFCA 2RFGA 1RALA 4KEMA 1LQ0A 4FMVA 4O4WA 2I1OA 3BOFA 4G1NA 3KP0A 2XGZA 2REQB 1RV8A 1FHUA 3WBYA 3C0LA 1CLXA 2PZ0A 4U33A 3RPMA 5J04A 3UJFA 4E0CA 1K4GA 4XTDA 3F4VA 2QJNA 4NJIA 4PB4A 2OLHA 1H7XA 4NX5A 1UR2A 4C6KA 2YL6A 5FIPA 3AMLA 2W27A 5CH9A 4XUYA 4Q22A 3D5HA 1VCVA 2FZMA 3ZWSA 3E9AA 5D33A 3L4VA 4KRUA 4JD4A 1TR1A 3A4XA 1TE1A 1XIEA 2ISSA 4TV5A 4Q4PA 1AH4A 1VJSA 1HW6A 1VJZA 3FA4A 3O15A 3GH5A 8TIMA 2NUYA 3V18A 4FLOA 3Q94A 1PO9A 1C9WA 3U4AA 3PANA 2ZA1A 3UESA 1XIHA 1VFUA 2IQTA 4CGTA 3B06A 3E5BA 5TBOA 2QCLA 1EF2A 3R0KA 3UF9A 1AH3A 2QVHA 4GY1A 4HJFA 3PY2A 4QQUA 5DXYA 3AYVA 4AY1A 4GNKB 3VMPA 2AMGA 3H12A 4KMQA 1W54A 2Z6IA 5KTLA 4TV6A 4H7ZA 7ODCA 1YPIA 5HWMA 3U48A 1I2QA 1L6GA 2ZTJA 2X0SA 2G4FA 1NDZA 3MUXA 2C1HA 4FK9A 3CIVA 1H2JA 3E0WA 4UFMA 3W74A 5AFDA 4XWUA 3NUKA 2VX7A 4C65A 4RL3A 1K3UA 1Y5VA 4X9SA 1F07A 2J24A 1A3XA 2X2GA 2GJXB 1CDGA 3IJIA 3VIHA 1TPWA 4AVNA 4AX7A 2TYSA 4NRRA 5CPMA 1GK8A 2DZWA 2RJGA 4DELA 3W7GA 1XLLA 1JF5A 1CI1A 3L4WA 1Q3NA 4JQ2A 1O5RA 7ENLA 3O6AA 4ES4A 1YEYA 2XYLA 2Y63A 5A8QA 1JPKA 1P0KA 3RX3A 2QIIA 1L8NA 2QEZA 2BLEA 4JFUA 1LTDA 3MT1A 2JALA 2Z6JA 3G5EA 3DG6A 4HQVA 3NQDA 4PSPA 3HG2A 1XYMA 3G6MA 1Q7MA 5BCAA 3S0CA 3LRLA 4U2ZA 2PDCA 1ISVA 2HV5A 4GY7A 5H8UA 2CITA 4DAIA 4K7VA 1MZHA 4G7FA 2HWGA 4PEKA 2BXZA 4S3GA 4M8UA 1SQ7A 1KFBA 1XI3A 1SW0A 1X39A 1WKFA 3O2LA 2VGGA 4LB4A 3W7JA 4RNFA 1A4MA 4GX8A 1JYNA 4Y9PA 3VPLA 1ZBWA 3RN6A 3LSCA 5L9FA 3QHMA 1E40A 2DJXA 3FVDA 4EE9A 3BL3A 2O7QA 6XIMA 1PIFA 3GC5A 1BAGA 4PMYA 1HJXA 4CNOA 3R5EA 4OFCA 3CWHA 4KCTA 1VZWA 3TJ4A 3ITOA 3FK4A 5FAJA 2PFHA 1TZZA 3C2RA 2TPSA 4Q32A 4OV4A 4KWSA 3SI9A 4NZJA 3SJ3A 5BOFA 3QEZA 3AWOA 1IIHA 1SO6A 1UD4A 3VOHA 1CCWB 1VFFA 3UYCA 1VFHA 2F2HA 3W6LA 2V5JA 2PWGA 3DFYA 1EWEA 5EPDA 3GE7A 2WC7A 3CEPA 1XSJA 3WD4A 2PA6A 1DXEA 4DUOA 1XF0A 1J0YA 1HP4A 5T9CE 1B2YA 3A6OA 1C8YA 2A3CA 1XL9A 2HBXA 1F4HA 2QJMA 2WO5A 3NQVA 4MM1A 3SN1A 4DJFD 1NWUA 1DTNA 3GNRA 1DQUA 1TPC1 1Z32X 4NZCA 1O12A 4HZMA 1VPYA 4J3XA 3LQGA 2AKZA 4F0SA 1FCQA 2DSZA 3BPWA 2DIKA 2E28A 1TCMA 3T08A 3TOYA 4E38A 2XH0A 4FOJA 1HP5A 2D24A 1TA3A 1GOKA 1YYAA 3IJLA 4CN1A 3QY8A 2E7FA 5FJOA 5HPOA 2ESCA 1YX1A 3N2OA 5AYYA 1NWRA 3JW7A 3NG3A 4NILA 3V5CA 3OYXA 3NOYA 2OX4A 2R1NA 3LDVA 1XG4A 1DHKA 5GQBA 2ZCGA 1UD8A 5CSSA 4QR6A 1ZS2A 3FEQA 2WSKA 4Q4QA 3B9NA 4NF7A 4R7JA 1Y5WA 4IFOA 4KPLA 4QJ4B 3ZXWA 3T4CA 4DM1A 5E93A 3PFMA 3W27A 4H83A 4CVWA 3UG4A 4LH8A 1J10A 2O9PA 3M6DA 4PB3A 2V8ZA 1JCJA 4DUWA 1HZYA 4JFVA 1H62A 3CTLA 1R38A 3URBA 3INPA 1VP5A 3S1WA 3UQNA 3MJYA 4PN2A 3WF3A 3CMFA 3KRBA 4O17A 1ZY9A 4US5D 2QDGA 4B3LA 2H9AB 3GBDA 3W7NA 4AHPA 4QG6A 1EXPA 4EIVA 3UXDA 4GUJA 3S8HA 2PC8A 4CCEA 4CD6A 1QT1A 3OIHA 1QUMA 2E9LA 3H21A 5EL1A 4FXRA 4GNJA 4ONVA 5FF0A 5K9CA 1TVNA 4KETA 1UUOA 4D2JA 1DWFM 4AXKA 1QW7A 5GPRA 3BLOA 4R85A 4PL1A 1JCNA 4UMCA 1OGSA 2XFFA 4CCZA 1RLDA 3BG9A 1S2WA 1UQZA 2Z1KA 4H01A 3WNKA 4JNMA 3BICA 2X0YA 3APTA 1XLAA 2VD8A 4I9AA 4DBDA 4JTGA 3LPPA 4PMRA 2NX3A 3N2XA 4KCWA 4GOAA 1R3VA 2ISDA 4E8CA 5C6MA 1R86A 5IDIA 2GGEA 3RITA 1WPCA 2PI6A 4XG1A 4S2BA 4HNVA 5M3WA 3HPZA 3TR2A 5CGMA 1T96A 1J12A 4IHCA 4YTSA 3EB3A 1WE5A 3EWZA 4HJWA 3EKGA 1SJDA 3CEUA 3HPAA 3LLFA 1TPH1 3SO7A 4V33A 1RH9A 3SRFA 4H8HA 4Q8UA 4O14A 3TAOA 4LUSB 1XKJA 1L8PA 4OE7A 5B7ZA 4GPNA 4XB3A 2I5QA 3MSRA 1UH4A 3CHDA 4LRTA 5T8GA 4TMCA 2FVLA 1UWAA 3BW3A 1Q6FA 2NV9A 4IX2A 4BK9A 3REQA 1VEMA 2PTXA 4NX0A 3BH4A 3PJUA 1X1OA 4KEZA 4PSRA 4U3CA 5U7SA 3Q65A 2A1YA 2G37A 4MWAA 3UJSA 3VDCA 1FH7A 4NQ1A 5HNTA 1PUDA 1K6WA 4CQ9A 3LEPA 1YLVA 4GNVA 2C0HA 3G0SA 1YDOA 2D0HA 5AZ1A 1Q6QA 3SRDA 1RUSA 4XX6A 1OT1A 4QIUA 1Q2RA 3JUGA 4Q8WA 5HXMA 4A3HA 4OBSA 3F4WA 2JF6A 3F4NA 2D2JA 4H1ZA 2DV0A 2FVMA 4UOQA 3S2LA 4AYSA 5C71A 3QOKA 1TPEA 3G0XA 3MDWA 2J75A 1HKMA 4I7UA 3V0UA 1SU5A 1Q45A 3PBGA 1OGBA 5CBIA 2WMFA 3NFUA 5CAHA 2H3BA 1UR8A 1ODZA 1US3A 3CIWA 5HQMA 1JCLA 3UG3A 2CC0A 4E3TA 4QJ5B 1BF6A 1BYDA 1XDLA 2VCAA 2EJAA 5D02A 1WZLA 1TELA 4UTTC 3WLHA 5HUOA 4I6VA 4HZ6A 1IEWA 1Q8AA 5FEWA 5AYZA 4DWSD 5PTDA 2D3NA 4I5RA 4HB7A 4LVGA 1DBTA 2X2YA 3EWXA 3MUZ1 5AYXA 1H49A 3CU2A 4JIPA 3SZ8A 4WKAA 1NDWA 3E0LA 5CC5A 3T1GA 4A8LA 3VD4A 3CZLA 5L6UA 4ZB5A 1H1NA 4UR9A 4LJ3A 2EPNA 3RCYA 2XWDA 2G0WA 1AH0A 1YE4A 4GUHA 4F9DA 1CLVA 4MF4A 1O60A 2BY0A 4PUJA 2PGRA 1M7PA 2OU4A 5K3VA 3E3HA 4LYQA 4MWAD 5ABTA 1PCKA 4KQNA 1IR1A 3H24A 2VP8A 2PF0A 3MJMA 3S1UA 5D30A 3T09A 4M51A 2J77A 1QU4A 1MQRA 4UTWA 2ZZ2A 4HA1A 3ORWA 4H6KA 1DV7A 2QKFA 3S5OA 4M29A 4V27A 2I57A 4MJ2A 1GVRA 4Q6JA 3W7EA 3R8HA 3CQIA 6TAAA 2E6AA 3NQ8A 2E6DA 1X6LA 3KBNA 2ACUA 1LWHA 2YX0A 1VENA 2XG9A 4IH3A 4X2PA 3EEZA 2E9BA 4HK6A 3TTYA 1M41A 4JCLA 3S2MA 3ARTA 2OEKA 4ZBCA 1GOWA 2J8FA 4NZ4A 4AEFA 4I90A 4YWSA 4XZNX 2JIEA 4H04A 3WLSA 1ONRA 3VNLA 1GYNA 5LNUA 4FS9A 3RLUA 3VM7A 3WUBA 5DMYA 2FH6A 3HA1A 4FHAA 1C90A 2HPIA 4ZB2A 4HIBA 5KETA 1TSIA 1OCQA 3GG1A 4TVDA 3S42A 2YA0A 1XDJA 4IXHA 1DHPA 2Y88A 4IT1A 5EBUA 4KWVA 1VH7A 1SFTA 3OLIA 4ZTXA 2J13A 4B91A 1K6AA 3H2OA 1V3MA 3KL0A 2XUCA 4L4OA 2W0UA 5D32A 3N73A 2PSNA 4DY1A 3DAQA 3SDOA 4L64A 3ZQ9A 3G2GA 2GGHA 1EEPA 4AD3A 4X0NA 3DFTA 2YCIX 1C91A 6CGTA 1EH9A 4DBUA 1ADDA 2HROA 4M6UA 4PODA 4JIEA 3G77A 3BCDA 4JBRA 4XD3A 3M1ZA 3NSXA 2XGBA 3WFZA 1PTDA 2Y4SA 1CNVA 5BU6A 4P8XA 4GFIA 2E5DA 2VZSA 2OPJA 4HOZA 4AMCA 3D46A 1YPFA 1JF6A 1US2A 1KD0A 1YMYA 3UCDA 1IXOA 1LLOA 2O9OA 1E73M 3WO8A 2PZNA 5B80A 3ZYZA 3GU1A 1JUKA 3H7UA 5EFDA 4A3QA 4B5UA 3EWWA 2QDEA 3HB9A 4GQBA 1V02A 3BLFA 3CAQA 1PIIA 3C86A 4XZBA 4TIMA 3FY1A 3MB9A 1TPVA 3PJWA 2QCHA 3RJXA 2R91A 3VD3A 3AALA 3B0YA 4LCSA 1W9BM 3KS6A 1JYVA 2WPGA 1YW1A 4MY8A 4CN4A 1UROA 3T0TA 4M6QA 1TJ1A 2WCAA 3RF9A 3PVFA 2VEPA 3SRHA 3FNDA 3KBJA 3GWQA 1RQHA 4H2CA 4M19A 1V6WA 1AD4A 4AIOA 4HU0A 1GEQA 1R87A 1ALDA 4FXFA 4D6HA 2PDWA 4B5NA 4HSOA 4RE0A 3IGSA 4QITA 3C56A 5F1UA 2ON3A 4ZQMA 4IWWA 4W8BA 1GG0A 1VBGA 2Y8KA 2Y1HA 4ZO9A 4EF8A 3Q67A 3WLPA 2ZDRA 2FFIA 1VKFA 5B7YA 3UWUA 3EOOA 4CNSA 4G8TA 1G0CA 4A8NA 3RO8A 3APYA 1F8IA 1U33A 5JBDA 4UNKA 4PMZA 3WJYA 2J7GA 4JQ4A 4Y9MA 4G9PA 1FTXA 1SZEA 2PCEA 4I9TA 3JZUA 8A3HA 3DC0A 3KM8A 2Q01A 1PX4A 4C6EA 2J6XA 1RR2A 3ZWTA 3WK3A 3M44A 2QF7A 4E5TA 2DT3A 5LNSA 3CHCA 1RY8A 4J2MA 2A7NA 1A47A 1BKHA 2ATSA 3MBFA 5A69A 4JEQA 1Z44A 3QR3A 3W1TA 4CQDA 3RRAA 1WQ5A 3I10A 5EMUA 2NVCA 3N11A 1EA9C 4ZFCA 2I56A 4RE3A 2G3MA 1XSIA 2XIQA 3TYUA 1ICPA 2QR6A 4O0QA 4JXCA 1GOXA 3FJ6A 2V9DA 3IACA 2WZHA 4BI6A 2GSHA 3OW1A 1IWBA 3E0VA 1E72M 2Z1BA 5CSUA 1W9XA 1Z69A 4UQCA 2Z1XA 3B8DA 3IEBA 3M0KA 4XBKA 1UA7A 4TVCA 1E0UA 2IW0A 1DP0A 3R0UA 5BWFA 4A6GA 1RAKA 5DFAA 1F61A 5BRPA 5I3HA 4W4QA 4CU6A 4I3GA 2VEIA 3VIIA 1ZNNA 1B3YA 3VXGA 3SGZA 5FJRA 4TX6A 1OFOA 5IHRA 5HUPA 3W2NA 2Z27A 3LCHA 3HQOA 2Y85A 3N14A 1EC9A 1YNQA 1PYFA 2IXUA 2WSQA 5KINA 4M3PA 1BQCA 4YWIA 1W32A 3THCA 2CLLA 4IQDA 1JEZA 3BTNA 1S46A 1C3FA 1MO0A 1ZZMA 1UR4A 3C2EA 3UWEA 2E1DA 1NEYA 4GK8A 4DJEA 3P6LA 3W24A 3P3BA 4L4MA 3RCNA 1PB0A 5CC7A 2RDXA 1KRCC 3H8AA 1EO7A 3IK2A 1UKTA 1UD6A 3KAOA 3BJTA 5LZLA 3R12A 1PEZA 4GGHA 2VC7A 3MHUA 3MBDA 3OZMA 1OY0A 3MPGA 4DF2A 1KM3A 1YTDA 3MI2A 3TNOA 1XR2A 5A5WA 3LTYA 3OZPA 1QBAA 1ZFJA 4ATDA 3URAA 2WHKA 1EC7A 5GJMA 3UJEA 3K30A 4B5XA 1N2VA 3AZTA 4NP7A 4DJFC 3P60A 2BASA 1VPQA 4M1BA 3SM0A 1GTHA 6TIMA 5LNVA 4HA0A 5EMKA 2XSAA 2IUZA 3VIJA 3RJYA 3GVVA 4Q8VA 4W7WA 5BWAA 3CMGA 5LXXA 2PP0A 4DUXA 3UY8A 4P5UA 5FJIA 3DHPA 3NOEA 1TVLA 1LOSA 4S3AA 3VGBA 1HKIA 2QNEA 2FB2A 3HQPA 4N7QA 5LNRA 1IEVA 5I24A 3RM4A 3VGHA 2Q6ZA 4ZQRA 4FLQA 1KRAC 3PUGA 4IMEA 3ZS4A 1XCFA 1Z6KA 5AHEA 3O06A 2V5LA 2X1UA 3TSMA 4DYEA 1QPOA 4U2YA 3KVLA 3PNZA 5AHNA 1E43A 5IXEA 3WNNA 3CLMA 3S3GA 3PG8A 2O9TA 4C6PA 2Z2AA 5I77A 1SVDA 3QN3A 7PTDA 2OGYA 3D3FA 3TYZA 1KCZA 2Q09A 1C92A 5G1YA 3HO8A 1NTHA 4HZ8A 3GVWA 4LS2A 4GO9A 3SR7A 4MIMA 2DIEA 5A8MA 1XIBA 1NP0A 1CGUA 1JDEA 4G6CA 3RLGA 3VGDA 4XZLX 1OCNA 3VOCA 3BARA 2DZXA 2BVDA 2HE8A 1G7VA 1V93A 2C0AA 3GTFA 1MNSA 3A12A 5G1MA 1ZAJA 2H90A 1DL3A 3SCPA 3CQHA 2P50A 1H3GA 2QHAA 1TTIA 3B8VA 3C8FA 1ZBCA 1K7EA 4LXFA 2VENA 1RPXA 1F6KA 4GIAA 3VKAA 3USBA 1V3KA 2E68A 2VR4A 2VZOA 4L6HA 4D9PA 2VUNA 2Y2WA 2R14A 2ABBA 4JTTA 3VD5A 3ITTA 1JZ4A 2ZC8A 1GYMA 2F84A 3TX9A 3CV6A 4RXFA 4Q8OA 1OCJA 2IMRA 2PRMA 5CPLA 3AFBA 2Z2UA 3E74A 5F2LA 1W9PA 1XUUA 3VCCA 4IUGA 2ZX7A 1EZ2A 2DZBA 4H7VA 4JTHA 5FF4A 2OELA 1E5NA 1ESWA 3I68A 5LHEA 2Z1WA 2R94A 1K7XA 4HNCA 1L2UA 4C6MA 4X0VA 1TJ0A 3N9SA 3PZTA 3YPIA 3ZSTA 4GH3A 1LDCA 3CYJA 4RE2A 3W00A 3EX1A 1WDDA 3SCNA 4LY4A 3VNIA 4GZJA 3B0VC 4MLJA 1KFKA 2NQZA 4ADTA 4IG2A 1SMDA 3H54A 3O16A 2P10A 1FP9A 1BQGA 4Y96A 3LI0A 3G1RA 2J9YA 4X61A 1YKWA 3T78A 3CNYA 3WDJA 1UWIA 1KGWA 3R8RA 4N42A 4MFDA 2ZFAA 2VKZG 1P6WA 2F8QA 1DE5A 2QUNA 1E0XA 2GVLA 5EFFA 2VQTA 4LBUA 3TN5A 5I3JA 3F2DA 1UMLA 2ZYFA 2XH4A 1BWVA 1OK6A 3LHZA 3E38A 2AQVA 1E6XM 4JHMA 1UD5A 4FX8A 3K13A 4QX4A 3B9OA 4Q3MA 1Y0EA 5D03A 1D3CA 3VX0A 3WZ0E 3U0HA 1EEXA 1ZP3A 3N18A 3LM3A 4O15A 1PVNA 1CYGA 3NZRA 1JUEA 3HPSA 1ZJAA 1FDZA 3TN3A 5TNVA 5H8MA 2CWNA 1KBBA 4W85A 2PDFA 2CEQA 3CWNA 4ZFMA 3GR7A 4UMAA 3SJNA 4LY8A 4QLJA 3R25A 1YBQA 1SFJA 5LNWA 5C9UA 2QULA 5I03A 3LLXA 1R8LA 2V2DA 3VNDA 3UEQA 3R7MA 3M7SA 2VD9A 2PTYA 3IGXA 2IXVA 1XISA 4ZTYA 4G2DA 3S6OA 4U5IA 9XIMA 4XKYA 4DWSC 3ANUA 1VCGA 3IIPA 1TO3A 2QJHA 1JULA 1YADA 4TVUA 1X8FA 4Z2JA 1QNQA 4LAZA 4QGCA 1HGWA 3AJ7A 2CZFA 4PA8A 3LHWA 1W9DM 4AXNA 3UETA 5LKYA 3PS7A 2V5CA 5GNZA 4GY0A 3FSTA 3IJ7A 3QOMA 3EMCA 5J8LA 2QUUA 3G1SA 1UD3A 1CIUA 4W5UA 3P81A 1CECA 4ATLA 3N3TA 2XWEA 3NDOA 3MDUA 4B2DA 2CCRA 1B3VA 1IXQA 1Z8AA 1DIDA 3CTTA 4MNMA 2ZBTA 3KS5A 1FXQA 2YOCA 3JRKA 3B40A 5CAKA 3QXBA 3UXKA 4HNNA 1F3EA 2DSUA 2ISVA 3S9ZA 3VNYA 4ACZA 2A3AA 2WYSA 2OQYA 2G3IA 4D1JA 1H0IA 3SURA 5I00A 3M64A 2ICSA 4BFAA 4K36A 4PMQA 3J7HA 4OZOA 4ADUA 4MWAC 1DIEA 5HWJA 3PZQA 4CQAA 3A4WA 3U2OA 1LWJA 3UYIA 3EZ4A 4REQB 3Q2DA 1NQKA 5I3GA 2G3JA 4X60A 4HT3A 4GVHA 4O0ZA 1E55A 1W5PA 4M6VA 1HJUA 3XISA 4RKAA 3B0PA 4Z2HA 4IPPA 2CW6A 1PHWA 1S2VA 3OBKA 2JK2A 1Q6EA 2PURA 4IICA 1CENA 4KWWA 2DZUA 2NVAA 4F48A 1B3XA 1XIIA 4GE8A 1XGEA 5EMYA 4O50A 1QHOA 1W1B1 2YIHA 1O5KA 4E8DA 3HBLA 3T9PA 3FVMA 1RP9A 1E0WA 5A8GA 3LHYA 3TC6A 3PC0A 1DXFA 5D05A 4B5SA 4JAWA 3W7LA 4FA3A 1RZMA 2YLLA 4PUUA 4K7YA 4DLMA 1EWDA 4J28A 3ME3A 1UHVA 3Q45A 1WBHA 3BOLA 4NI8A 5M17A 2OOGA 3BLIA 2YCJA 1V0NA 1H0GA 1DJXA 2FDSA 3WNLA 4KKXA 4B5VA 3PZMA 5CBJA 1QATA 4MB1A 2V2CA 3RMEA 3K2GA 1DKWA 6REQB 4UFIA 4AAJA 2CLPA 4B2DD 3POCA 5FJPA 2WSRA 3BAXA 4HA3A 2DY3A 3SUVA 1REQB 3KOYA 1I60A 3WJXA 4LOCA 4B4HA 4NZFA 2OEMA 3GDMA 1UH3A 3W38A 2VXNA 1TKKA 1B90A 3N2CA 5DCEA 1ME9A 1ZRQA 3XINA 3ERPA 4YS1A 3TYBA 1ZENA 2JFEX 3VIGA 1W5OA 3VI2A 3DC8A 4WSJA 4AYGA 1KGUA 4GINA 1UZDA 3QGKC 1CXIA 4YVVA 4AISA 2WMGA 2GWNA 3BGAA 2C13A 3MVIA 4JTSA 2WZTA 4YHGA 1MUWA 4MY1A 1BD0A 1F6PA 1OQFA 4NYUA 1C29A 3GG0A 4JTEA 5REQB 1IZKA 1W3LA 3AIVA 4AD5A 3THQA 3KUMA 4KRZA 3AI0A 3PBWA 2X40A 1ZQ5A 3BAWA 3L4ZA 3VIPA 3UGVA 4MYAA 5E0FA 1QCWA 4M24A 3OGRA 2VELA 3DFOA 4WLCA 3C0QA 4JCMA 2W3ZA 3V1PA 1VIZA 1DQXA 1F2JA 2IQ0A 1DEDA 3MCMA 2V5KA 2EEXA 1KFEA 3P80A 2NT1A 1VQTA 4BEQA 1JRBA 3BAKA 3MP4A 3MKCA 4XAZA 4PCNA 1V08A 2ZUTA 1XG3A 3NGFA 4DYKA 1AW2A 3D0CA 1I1WA 1TTQA 3BGJA 4LX4A 3W1NA 1W3IA 3VIKA 1K1DA 2XINA 4ECLA 1FA2A 2NQJA 3OA3A 1US0A 4L9YA 3SQLA 4DB7A 3S5YA 1W0MA 4JDBA 3PR2A 2E09A 3W88A 3R94A 1WOAA 1MW3A 3FKRA 1PKYA 4FB7A 3MUY1 1Y65A 5G2HA 3S1VA 4ZL1A 3WNOA 3OQEA 3L23A 3T0BA 1JG9A 4DO5A 4L65A 2VX5A 1Y8BA 5T91A 3LRKA 4PMXA 4GFSA 1J8VA 3NQCA 1L6FA 3SSZA 3S5NA 2DQXA 4WKFA 1OX6A 2DT1A 1FFQA 1L6SA 4WZHA 1YDYA 5LIUX 4IUOA 3UBPC 4QNEA 1W3JA 2NQ5A 5HJLA 2B7NA 3W37A 2VX6A 2FTWA 3QW3A 5AZ0A 4DXVA 2X8RA 2G4JA 3SUUA 3UT0A 1Y5XA 3I3DA 2HNEA 4Q7BA 3TMLA 3H70A 1BRLA 4O1DA 4IIDA 1OFEA 1AFSA 5LIYX 5FEPA 1QK0A 4IIGA 4KGJA 1S3HA 4LB3A 3KVJA 3TJLA 5AVHA 4J9JA 3CAVA 4UUIA 4QNWA 1ITXA 3WQEA 5ABFB 4KBXA 4YTRA 3FDGA 1JI2A 1UH2A 1TE6A 1TWZA 1LZOA 1YNPA 1JRCA 1GG1A 2OO0A 1H4PA 4K8HA 3W53A 3LZ5A 3PUDA 5GVJA 1RBLA 5M5DA 3WQ4A 1H11A 2GK1A 3N2MA 3MUCA 1BGGA 2WM1A 4HMEA 4C6DA 4LAMA 4BZYA 3WQWA 5BXSA 4XISA 1EUNA 2DVXA 2EAWA 1LRNA 2PE4A 1GJPA 3RRXA 2BOGX 1W8SA 3GAKA 2Y5EA 2QDHA 5A95A 5HR6A 2YDSA 2W92A 1J01A 3FSUA 5D9NA 1R3RA 1XV8A 3GLCA 3TW6A 4DZHA 4QRNA 2AL2A 5DF0A 4DJDD 3WLQA 1UYQA 4LUTB 3MU7A 4MLRA 2GOKA 1U83A 4FIRA 3WDQA 2C1IA 4N6FA 2ZUVA 1P0NA 1JFHA 3F1QA 3PN8A 4MB5A 1ADSA 4GUIA 3W87A 1R3WA 1NU5A 2J66A 3L4XA 1I45A 1EHAA 1BHGA 2PRHA 1TQJA 1IT0A 4C1NB 3PPFA 1JXJA 1UKQA 3PTDA 1Q7QA 3IARA 3AJXA 1EUAA 2NQLA 2QMJA 1FWIC 3W2JA 5CC6A 3LCLA 3EX2A 3GFXA 1DE6A 1S5MA 2VGIA 3HGOA 3PTKA 5AOUA 1A5NC 1SSDA 1W1IE 3N6QA 2B81A 4O16A 2ONEA 2Z4GA 4OT7A 4JX4A 1R9YA 4U10A 1OFDA 3P14A 4RJEA 3TCEA 1EOMA 1PDYA 5A6BA 4B5TA 3HG5A 3FV9A 3LYEA 1O1HA 2OTDA 4RZ6A 5HK4A 1W1TA 3UR5A 3TAKA 4PRWA 3RYSA 3SUSA 4LW7A 1XIDA 1N8IA 3EMQA 3U5UA 3IUHA 1TPDA 1T40A 4ALDA 2GGJA 3U2CA 3ZOAA 5IBXC 4Q7NA 4L61A 3MKKA 4XBSA 1KR1A 4Q8NA 1V79A 5MF5A 2A79A 3COTA 2XSXA 4JPGA 1EJ7L 3WNMA 3RNDA 2Z1SA 3W1QA 1H63A 4PFMA 4DNHA 1U5HA 2WJZA 4A8IA 4PGLA 3ABZA 3WLIA 4WDXA 3QQ0A 3QJAA 5AHIA 4D6GA 1GKQA 1B57A 2PLCA 2G41A 5MHBA 2G8ZA 4W93A 5C55A 3FFSA 3O8AA 3LTPA 1QMLA 2PU1A 4MNJA 4EWJA 3GG8A 4AD4A 4AD1A 3DG3A 4S3JA 3IRSA 4S3BA 3H2EA 1O95A 2Q8ZA 1VYSX 1KTCA 2X05A 4JYEA 3NQ7A 4E6MA 2GQAA 4C6IA 4KH2A 4GGBA 4NAFB 2ZX5A 3H26A 3L0KA 3DECA 3DBPA 1XPGA 4QP0A 1CW2A 2C71A 4OGZA 4O52A 4BI7A 1EKOA 4QTGA 2G96A 3BWWA 2OO6A 2V68A 3W0KA 4OUIA 3G6LA 5I3IA 4LSBA 4LT9A 1ECEA 4B92A 1WXJA 2O55A 1SFSA 3QV9A 1LRQA 4JEJA 2R6OA 4PUMA 5A6BD 4FLRA 1NOWA 4NU7A 4AMAA 2XIBA 4ZOAA 2WANA 5H91A 4AZHA 1FKWA 3ANVA 4F0RA 4M7SA 3ZT7A 5ECVA 3I4EA 4KEUA 2DH2A 4UIOA 4DN1A 1TJRA 5F4XA 2P76A 5HQLA 4GC4A 3WK1A 3QY7A 1GOMA 3CV7A 3QQWA 3TVAA 3FS2A 4LS1A 2BGSA 1PBGA 4NIRA 1WZMA 3T05A 3LCFA 4H9VA 3H53A 5DLCA 2OLSA 5I23A 3W81A 2HS6A 4HNOA 4LTSA 3LPFA 3W1XA 4KGLA 1AJZA 4RR4A 3VNJA 4IPJA 1D9EA 3EXRA 3NXLA 1TV4A 3A23A 3JU2A 1P5BA 1JAKA 2QUTA 2XFRA 1Q8JA 4GCXA 5TQLA 4S23A 2XJ7A 3SAZA 1J4EA 5EY5A 1CB2A 5D2YA 3LN3A 3R79A 3O63A 3WJZA 2VGFA 4R88A 4J3ZA 4RX0A 1VIWA 4QDWA 1DJYA 2J47A 3EGJA 1XLFA 2Y7DA 3NQ6A 3WQPA 3LSBA 1SPQA 3H7VA 2TSYA 4AEOA 3QLDA 5JBFA 1EP1A 4IQJA 4Z17A 3LHVA 3BZGA 2R1MA 1H61A 4DWSB 3UA3A 4FF5A 3EWYA 3VE9A 4MHBA 3UWZA 2IPGA 3CPGA 2OYMA 2PDYA 1KV5A 1OWQA 1B4EA 4JQ1A 1O4UA 5CSYA 3IJQA 3BLPX 1RJQA 2QJGA 5HMDA 4QDPA 3O07A 2YL9A 5CG7A 1ISZA 3EX3A 4U28A 4AZIA 1W5NA 2GJXA 4FNTA 4CD7A 5HDRA 5D2WA 1P7TB 2PLMA 3K4AA 1R2SA 1QHPA 3EWUA 1ZJIA 4JFTA 3BDKA 1K9FA 1ISWA 1TJPA 1XLBA 2D20A 3VO0A 4H8VA 3IS4A 1FWSA 4R53A 3WK2A 1PL9A 2NT0A 4IF2A 1UASA 5FEZA 2F9RA 1E9IA 5AHLA 3FGCB 1E15A 2MNRA 3ABQA 4MFEA 5CG0A 1UBPC 3CAWA 3QV6A 3M0HA 4BHYA 1WKEA 3AIWA 4AB4A 4WDWA 4H6QA 3ES7A 1Q6RA 3BUVA 4XAPA 1K9EA 4DF1A 3V35A 4Q8QA 3C3UA 2CLKA 2P5NA 1DYSA 2VDHA 3STPA 3C61A 2VDGA 4O18A 4GYFA 5F1VA 2YGYA 2JBMA 1EX1A 3N9KA 1LT7A 1XFBA 3L2LA 1RBAA 5I3FA 4QFUA 3UVIA 1CB7B 4GMEA 3PPGA 1AVAA 1TZ9A 2E0PA 3R6IA 2BDQA 3M5YA 4Y9NA 3RU8X 5TAOA 3LNPA 4UWMA 2VL4A 1AMKA 3RLVA 4WUIA 2EGZA 1NWTA 3MCOA 2OLAA 2SFPA 1RY0A 1Z41A 2J9ZA 5HATA 2ZE0A 3AHZA 4L80A 2A3HA 2ZX9A 4RLIA 4D71A 3Q58A 4Z2LA 4M82A 2IPWA 3W71A 3M0MA 3CH9A 3WH8A 2A0NA 2O92A 3T40A 2TODA 2Y0FA 4LAOA 1R46A 2QF8A 3SUTA 3EPNA 5F7UA 4CKQA 5A6KA 4B3ZA 3DI1A 2ZTKA 2V3FA 1LRTA 2X09A 2YFNA 4XZWA 1AL8A 1J96A 1UQYA 3RHGA 2HDJA 4JICA 1A53A 4Y9OA 2OFJA 3WQOA 1TREA 4QEEA 5C2XA 3L7RA 4J3TA 4QG8A 7TIMA 3WQ8A 2B7OA 2YYUA 2DQWA 3H4XA 4HD5A 2OT1A 2GJNA 3SW6A 1UP0A 3CWOX 1FQ0A 4BWLA 1OF6A 4ATWA 1R2TA 1S5WA 2INEA 3AICA 2JKPA 3F5KA 1ONEA 2J7BA 2AGTA 3ZJ6A 1GW1A 2VFFA 3NVDA 1QASA 1ZAIA 1I2RA 3K1GA 1PE1A 3GNNA 4A3YA 4JY9A 3WEZA 4HPHA 4NJKA 2ZICA 2VC6A 2OJPA 3AS2A 1QNOA 4A22A 5K9XA 4HU4A 4BR1A 1GQKA 5D04C 2CLOA 1NARA 4JTDA 4M0XA 4J3WA 3AYRA 4CD8A 4P8VA 3KTSA 9XIAA 3KBSA 4JN8A 4W9TA 3SGGA 1MYRA 2D2GA 1IR2A 4P7OA 2E3ZA 3HGJA 4AZ7A 1XYFA 2H3DA 2OSWA 1OFBA 4DPQA 3AUOA 2DSVA 1OVDA 2ZWZA 4AZCB 3WIJA 3SIZA 1GQLA 2P3ZA 1RVKA 1XLGA 1Q63A 2FGBA 2V2HA 3IVUA 5CGTA 2E4TA 1FWJC 3TA9A 1CXFA 4DZAA 3B8WA 5I2UA 4NI3A 2VVNA 4JTFA 1DQWA 3EMZA 1G6CA 3N2BA 1EP2A 3QV8A 2VDIA 4Q7IA 4JN6A 4ZO8A 4JYDA 4AIEA 1NDYA 2PBOA 3OTRA 4MVAA 3L21A 2VFIA 3VA8A 4DO7A 2YSWA 2HISA 2VT0A 4WDUA 3FYYA 3RMJA 2FDMA 5BRBA 2O7SA 3PTQA 2DZSA 3FX4A 1MEIA 2X7WA 2H9AA 4G56A 3LM7A 2R9RA 1MRAA 2BWGA 2VQUA 1S5TA 4HP5A 4WRHA 2QIWA 3UR7A 3W29A 2KAUC 1TRIA 5I3DA 2FYMA 4L56A 3AHYA 4WDTA 3GU2A 2ISFA 3EDFA 3TQKA 5IHSA 2E25A 2CKSA 1EL3A 3LCWA 3U5YA 5FF7A 4UNIA 3DEQA 1OIFA 1YXCA 3OIXA 2DZVA 1QNRA 1KM0A 2ZVIA 1R9ZA 4WHBA 2J8TA 1SJBA 3ONBA 5HMEA 3GNXA 3W7QA 4H19A 3RM9A 1GNXA 2H8ZA 3RK8A 2ZZ3A 3W84A 2OVLA 1F9CA 2I7GA 1ZLPA 1PS9A 3BG5A 1VLWA 1K9TA 1I2NA 1LQAA 3ONCA 1JZ6A 3V36A 1ISYA 2ZXAA 2VZUA 4XO7A 1XD1A 4PUDA 1LG1A 4HCHA 4JKMA 2D2OA 4D6IA 1E1CB 2ZXDA 4CQCA 3T44A 4C1KA 2Y7GA 3TA6A 4LUSA 5G4EA 1QO2A 2OB3A 2WVSA 1M7XA 3M43A 4WK9A 1V3LA 4MPKA 2WK2A 1KQZA 1PKMA 1E9ZB 1XLMA 3P2VA 2WVVB 1GT8A 2FTPA 2XFWA 2J8GA 3LK6A 4JL2A 2AGKA 5CLWA 1XLIA 1F76A 3W73A 4UNLA 1ML1A 3WN6A 1HQTA 2FQIA 2QXWA 3WBEA 1IWAA 4DJDC 2PF8A 3CT7A 1BVWA 4JKKA 3TU9A 4JTLA 4WEVX 2ODOA 1IT7A 2PWDA 4E4FA 1EB3A 1EXBA 7TAAA 4F2TA 3EDEA 3ELFA 1WYIA 4GBUA 1JCXA 2GQ3A 3MQTA 3DKLA 4I9JA 3FYOA 1KO0A 2D23A 2C6QA 4M80A 3TZFA 4PUNA 1HL2A 3EOLA 3NNTA 3APGA 3MC5A 1J2WA 2GWGA 5GNYA 1QWKA 2VWSA 2QLYA 1BSIA 2CNCA 1UA3A 3DYMA 3E02A 3TROA 3TJIA 5HNNA 2YBUA 1G1YA 1GHRA 2DGAA 1C8QA 4YVXA 3LZ3A 4JN7A 3ABXA 3W72A 2QUVA 2TMDA 1U1HA 1C7TA 1FCVA 3A21A 2AOSA 1TFVA 3TW7A 4PMNA 4B5WA 1FHVA 1XX1A 3M41A 1X98A 1YRRA 2EO7A 1OG6A 3QMTA 3MS8A 3MP3A 1KC7A 3ZT6A 4ORIA 4HMCA 1KM1A 3OVGA 3L12A 3GAYA 1V0MA 4UQBA 1KBIA 2FPTA 2NV1A 1UUQA 2PRLA 2ZRUA 1G5AA 4P7QA 3WUFA 4GKLA 3LRMA 3IGHX 1JCYA 3OYZA 1MDLA 2PDPA 5ABGA 2CLMA 3PZOA 4AWUA 2OCZA 1XLKA 3N04A 2W61A 2WHLA 2F38A 3ALGA 4JKLA 5AHMA 4C60A 3W3OA 3M0ZA 4DUVA 3B9DA 4GKTA 4A35A 1JYXA 5M2FX 3W7CA 5H2ZA 3GDKA 4V1XA 4XSLA 2ZE3A 4U5KA 1MXGA 2NXIA 1OYAA 2PBGA 2B7QA 4YL2A 1FH9A 2WBGA 1S2AA 3U6WA 3VYLA 1ZP4A 3VCRA 1UR3M 4R9OA 5AECA 1GVFA 3C4UA 5AKQA 4O1CA 5DELA 2C15A 2G97A 2WPBA 1RD5A 2YZ5A 4HPXA 4BQ5A 3KTXA 3I4KA 3MYOA 3TIMA 4AF0B 4DNMA 3ARSA 1KCKA 1S5VA 4E4PA 2XIMA 4XZHA 1U30A 1VFMA 1PWLA 4PCSA 3AXXA 1E1FA 4KFNA 2PDGA 1F74A 1R2RA 3LPOA 4OKDA 3M0XA 3RM8A 3C3NA 3TWAA 1Q6OA 4QHRA 1VB9A 1Z48A 2PWEA 2YW4A 3GW0A 3DCPA 4PBFA 2F2KA 1VFTA 3M6YA 3GO2A 4B90A 1ITQA 3A4JA 3TV8A 5CPOA 4LEFA 2CETA 3WENA 3PB0A 3I3EA 4KESA 4YCPA 2PGEA 2OSYA 1DWIM 3NQEA 4HZ7A 2VO5A 3ENLA 1G4TA 3ZLGA 4HCLA 4LUIA 1G67A 2QCDB 1GVIA 5K7JA 1TV8A 3SN0A 3ARXA 1RP8A 2L5HA 4KT2A 4D6CA 3VDBA 3H22A 4GIYA 5DRCA 1X1ZA 3GTHA 4Q8MA 3ECQA 3BCFA 3EXTA 3I6RA 4MJMA 1Z3NA 4P7RA 1MQQA 2PDXA 2ISWA 2BSLA 1MMFA 5K2ZA 2V30A 1UZ1A 2UZ9A 4IM4A 1GTEA 1LM1A 5KZDA 6PTDA 1UD2A 3DFSA 4C6BA 4EAMA 4MUPA 4M6PA 4WVXA 2BFGA 4GYJA 3GIQA 4OJYA 1OFAA 1X8CA 4KF1A 4ZOCA 1V5XA 3HV9A 1PXGA 4QS5A 1NFGA 4J5NA 2H8XA 2ACSA 1Q85A 1VBHA 3CQ0A 4J27A 2IKHA 2CBJA 3UCCA 3MV11 2OZTA 5DY2A 2Y8UA 3E1F1 2JEPA 3ICJA 5DBTA 2BZNA 4RDYA 4DIAA 4K37A 1T8QA 4WGXA 2QQ6A 1V6VA 2YL5A 1TCDA 2B31A 4TX8A 3E12A 5E5CA 3UVAA 1NWSA 1SUXA 1I2PA 4AFYA 4K39A 1KRMA 3CPRA 2OWXA 2ZRVA 4BEUA 3KFTA 4C6NA 2WZMA 3V1HA 3CGTA 1OC7A 4ZR8A 3FKKA 5D9OA 3CH0A 3WQFA 1EQCA 1PPIA 2E8ZA 1FDYA 2DDXA 4O11A 2YBVA 5E09A 4LWWA 3B0UX 2VZVA 4QROA 3AMDA 4Z0SA 4O0KA 4Y90A 4D1IA 5BYWA 1EF3A 3BE7A 2D69A 2X1SA 3KRSA 3H4GA 3DBNA 2FPVA 4EXAA 3WQVA 1SZNA 2YCLB 3AXHA 3O9NA 3VIFA 1XD0A 4BS0A 4GA8A 2FHCA 1OSEA 1XC6A 5EB8A 4YJ5A 4CEXC 1V8EA 2WMKA 3QHNA 4WKHA 4FNRA 2Y62A 3OHIA 1OF8A 1VS1A 3FOKA 3HM7A 2Y24A 2NXGA 3N25A 1V3JA 5AVNA 3LY0A 3P84A 3NL2A 2YZRA 3PPHA 1ICQA 4HN8A 5A6AA 4PMJA 4RW3A 4KEVA 3KBMA 3PAOA 2ZUUA 4RE4A 3TYCA 2ZZ1A 1A5SA 2P3EA 5BOOA 2RUSA 3STEA 3RR1A 1T5AA 2QS8A 1UWQA 5D8ZA 4Z1DA 2YXXA 3DIPA 3OLDA 1GVSA 3SIMA 1JYWA 4C6JA 3GBEA 4PTVA 4MYXA 1SR0A 4RDVA 3UWWA 2W62A 3ES8A 1FWBC 3LX9A 2EKCA 3M47A 2Y7EA 2DPEA 5M03A 2GGIA 4XAFA 1DVJA 5JBEA 4ML4A 2QPSA 3CL8A 3KDNA 4IIBA 2PDMA 1H5YA 3P93A 3G1FA 2PDHA 3HFYA 3AISA 4QS6A 1ZB5A 3SGUA 4A8RA 3GU9A 2Z7KA 5CJ5A 4F0LA 3CZKA