2PBOA

E27q mutant of exo-b-(1,3)-glucanase from candida albicans at 1.85 a
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
394
structure length
394
Chain Sequence
AWDYDNNVIRGVNLGGWFVLQPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEAQLDAFEYTGGWVFWSWKTENAPEWSFQTLTYNGLFPQPVTDRQFPNQCGFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein XOG1
publication title Structural and Functional Analysis of Protein:Carbohydrate Interactions at Three Distinct Sites in Candida albicans Exo-beta-1,3-glucanase
rcsb
source organism Candida albicans
molecule tags Hydrolase
total genus 151
structure length 394
sequence length 394
ec nomenclature ec 3.2.1.58: Glucan 1,3-beta-glucosidase.
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2pboA00
1UD6A 4YN5A 4PSRA 1JD9A 1OGGA 1OINA 3SCSA 2YOCA 3PTKA 4GO9A 1WE5A 1MQQA 1BGGA 4AEFA 2CHOA 4IISA 2Y24A 2OSYA 1RP8A 1LL4A 3L2MA 1GOOA 3B9DA 3WH5A 2GJPA 5A1AA 2DIEA 2BHZA 4MPKA 1UZ1A 3WD3A 4AD2A 4WF7A 4PUDA 1JG9A 3N15A 1KR1A 3WUEA 2ZUWA 4PMRA 4OJYA 3VPLA 4AYSA 3BAWA 2XJ7A 5EMYA 1C92A 1QI4A 5FL0A 3WF1A 1Y7VA 1MYRA 2MANA 3MANA 2YA0A 2ZXBA 5D8ZA 1WAWA 4D71A 3PZIA 1NWTA 1E40A 1UWIA 1CTNA 2EPMX 3ARQA 2EPOA 1XSKA 1H41A 1KGXA 1LWHA 3U7BA 1WDRA 1XSIA 1V3KA 1J0ZA 1UQYA 3WENA 4ATLA 3PZTA 3WF2A 2W67A 3VGBA 3K8KA 4JL1A 1KBKA 3KL5A 3NYDA 4M56A 1CZ1A 4UZSA 4C7GA 3DHPA 3SUSA 2VNCA 3W0KA 3W81A 2E8YA 3CPUA 4XX6A 1UKSA 4CVWA 3EDFA 5A2BA 4M29A 1TE1A 3AZSA 4AD1A 3MO4A 3N04A 4HA4A 5A3HA 3SUWA 1BYDA 1H3GA 4W8AA 3CO4A 3RO8A 4W86A 4QCEA 3VD7A 5HNNA 4D6HA 1AMYA 1ISVA 1V6VA 4CD4A 1C3FA 2XVKA 5CSUA 1GOKA 2X2YA 4PTVA 1KWGA 2BNJA 4JIEA 2J7HA 2W91A 1O7AA 2ZXDA 1UG6A 1M7XA 1GNXA 3ZM8A 5M3WA 1BVNP 2V5CA 1EDQA 3WDRA 1QNOA 3VILA 2BHYA 3AZTA 3O9NA 1K9TA 1ODUA 2OYMA 3ZR5A 3W27A 3WNMA 1JAEA 1WZMA 1MW0A 1PZ3A 2G3IA 3PHAA 4EANA 4WLCA 1CLVA 4CD7A 2JIEA 4D6GA 4PSPA 4N0RA 2C7FA 4AW7A 4ATWA 2W61A 1H5VA 4NF7A 2CBVA 3ARTA 4D6JA 2QV4A 5GNZA 1PIGA 1WZAA 2G3NA 1VEPA 1AQ0A 1XD0A 1R85A 4FMVA 5D9MA 3SEPA 3MV01 4M81A 2J47A 1OT1A 1CXEA 1TA3B 2YDQA 3ZSSA 3DC0A 1Q6GA 2VX5A 3MMUA 4MB5A 4XB3A 5HBFA 1XCXA 1ZBVA 4AD4A 1ZBCA 1NARA 5BXRA 3WL1A 2NT1A 4PCTA 3AIVA 4MDOA 3W4RA 1LJYA 5D4YA 2A3AA 1J11A 2VCBA 4CU6A 1V6XA 3OGRA 3GBEA 4KWUA 3ALFA 4UQEA 4D6IA 4PN2A 4ZXLA 2EPKX 2JFEX 3BCDA 3OBAA 3GNOA 4JKMA 2NSXA 1JI1A 3CTTA 1BTCA 4QLKA 2DPEA 3G6LA 1GHSA 2BXYA 3WUBA 1GOQA 3TOPA 5HOSA 3WUFA 4JKKA 4OBRA 3VNZA 1HL9A 4AXNA 1J0YA 1OIMA 3NJ3A 4PTMA 5E70A 1JNEA 1ISXA 3UCQA 3WBEA 1HVQA 5F7UA 2RGLA 1NOFA 4NSBA 1JF5A 3U57A 3D5HA 4MJ4A 4CUCA 1WNOA 2J7GA 5C70A 2WSKA 3N11A 2JEPA 3CBWA 1IZJA 3CHEA 3KL3A 5ABHA 1VEOA 1J0JA 3AISA 2AAAA 5HXMA 1E4LA 1SMDA 2G3JA 2VTFA 5GNYA 1JZ7A 2XPKA 3UETA 3AXXA 2Y2WA 3TP4A 4TXEA 3K4AA 5A6JA 1E0XA 3LPGA 5E6YA 2A3BA 4OBSA 4X9YA 3BLPX 1A47A 1LWJA 1W9BM 3BSGA 3NCOA 1US3A 2WMIB 4PMOA 2VRQA 1BYCA 1ZL1A 1KFWA 2JF6A 4PUEA 3VDCA 1AVAA 3KE0A 2QPUA 5JIWA 1BLIA 4MADA 3AMLA 5I78A 1ZS2A 2OYLA 4GZEA 1QHPA 3ARPA 4QCFA 2OSXA 4JFUA 5I2UA 3O2LA 5IHRA 3W29A 3AXHA 3WSUA 1HJQA 1WPCA 1TMQA 4ZENA 4DUVA 1C8XA 3PN8A 5CJ5A 1DWGM 3WH8A 2GDVA 1RD6A 4QAWA 3GXMA 1BFNA 1BQCA 1K9FA 1TR1A 1PZ2A 3WNLA 6A3HA 1DHKA 2DT1A 3F5LA 3QHMA 1PEZA 1CGXA 1FH9A 3GDBA 4ZXOA 5A8PA 3CMJA 3VD5A 1J01A 2BHUA 3OLIA 3ARRA 1B3VA 2EPNA 2VZUA 4CVUA 1WO2A 5ABFA 1M04A 3ZJ6A 1CGWA 3VTRA 1DWFM 2WYSA 4FF5A 2BY2A 3CHCA 4KRUA 3GBDA 1QNSA 1HKMA 2Y4SA 3CH9A 3MUAA 4PMYA 2DGAA 3CUIA 3NDYA 4TVDA 3W38A 4NRRA 1JXKA 3AMKA 3WDPP 3AHYA 3AHTA 3CUGA 2GUYA 2YIHA 2Z1SA 4Z2KA 4F66A 3FY1A 2O92A 4HMCA 1PIFA 3BAJA 4GXPA 2ZUVA 5FD0A 1W32A 1VEMA 4URIA 2XM2A 5ABEA 1JZ6A 3W24A 4AZ5A 4CN6A 1IV8A 1W2VA 4UTFA 5A6KA 1ODZA 2WZHA 1HIZA 4AZHA 4MJ2A 2WZEA 1GQLA 1KGWA 2JALA 1GORA 1OD8A 1XGZA 3PTQA 3E1F1 3GZAA 1SFSA 1MFUA 2QF8A 1C8QA 3WNPA 1SYTA 5LA2A 1UD2A 4HA3A 2O9TA 5D8WA 4J3XA 4HMDA 3WD0A 2GK1A 2BY1A 3PZNA 2XGBA 2DH3A 3WF0A 2CITA 2J7BA 3L4TA 4D6DA 1NWSA 4S3KA 3VX1A 3T2QA 2V3EA 5DT7A 3NSMA 3GNPA 1TG7A 1G9HA 2VX6A 1U2YA 1D2KA 4P8XA 2NW0A 1EO5A 3MUIA 1LL6A 1HKIA 1MVYA 1HP4A 2XG9A 5BXSA 1DP0A 1UA7A 1WKYA 4LGXA 2BVTA 2QLYA 2ZX8A 1I1XA 4QLJA 3TTQA 3PZGA 2WCGA 2WPGA 4TTGA 1BAGA 4V28A 3EDEA 4U3CA 3WH6A 4CCDA 1Q4NX 3RDKA 1JNDA 1B2YA 4TVCA 3OLEA 3VM5A 5A6SA 3BAIA 4LYPA 1QBAA 3ARVA 1CENA 2WCAA 3W82A 3CZLA 2ZX9A 3PZVA 3SUTA 1V0KA 2DH2A 3EMCA 4X0VA 1H0GA 2WANA 3RCNA 8CGTA 4GIAA 4FK9A 1CGTA 2O9PA 3K1DA 1BYAA 3BAXA 2Y8KA 1MW3A 4A3YA 1MW1A 1ISYA 1TVPA 4Q7NA 3WQWA 5HPOA 2VRKA 1JDAA 1G94A 3D3AA 3IAQA 1OT2A 2EJ1A 4L4OA 4H8VA 4WKFA 3RILA 4CKQA 2WHMA 1JZ4A 1XH2A 2F8QA 2ZUSA 2DQXA 2XTKA 1W3JA 3WH9A 1CGUA 2FHBA 2VZTA 4PBGA 3N13A 3SCRA 3WFZA 3GXFA 1I75A 2VR4A 3I3DA 4H8UA 1FP9A 4V27A 4ZFMA 3THDA 3W28A 1PX8A 1QI5A 1GQKA 3EDDA 1VFMA 1JI2A 4LXFA 1NWUA 2BVYA 2GVYA 5E0CA 2WLZA 1VAHA 3L2LA 4ZE4A 1HJUA 3I3BA 3HN3A 2WC4A 2WMIA 2JE8A 1NH6A 4TX6A 3RIKA 1K9EA 3DYMA 4Y7EA 5BXPA 1QNPA 3ZJ8A 4AZIA 4CN1A 2J8FA 4OOZA 4P7LA 2YL9A 3VGGA 4HPGA 1QI0A 3EBVA 7CGTA 4JFVA 2UY4A 3VIIA 1E3ZA 1Q6DA 2W63A 1KWKA 1HJSA 5CPSA 4PMQA 3VMOA 4LQ1A 3AMGA 4DWSB 1H2JA 1U33A 1R87A 5A6AA 1ZBKA 1KCLA 2GJRA 4JL2A 3BXWA 4CN4A 3T0BA 2J75A 4NI3A 3TTYA 2VURA 4UFKA 2PWDA 2YLLA 3WD1A 4J3WA 4MNKA 3IJ8A 4MAVA 4W5ZA 3RPMA 1VENA 1GW1A 2XWEA 3THCA 1JZ2A 3M46A 4UFJA 1V0LA 5BROA 1QNQA 1KQZA 1ISZA 2WMJA 2QHAA 3FNDA 2J4GA 2XHYA 2VZSA 2DEPA 1V6YA 3KL0A 3AS2A 5E6ZA 2PWGA 2TAAA 1R7AA 4HZ6A 1UD8A 4JHOA 1VBUA 3ARZA 1HN1A 1ITXA 1DWJM 2CBUA 2WSPA 3L4WA 4ACYA 1A3HA 4HPHA 1F4HA 3WIJA 3AIBA 3AFBA 1Q6FA 3K46A 3MUZ1 3GM8A 2IXUA 4JFWA 2WK2A 4PTXA 3AOFA 1E56A 4UFIA 1V02A 3WBAA 2XVNA 2X1IA 3PBGA 3K8LA 1M01A 2CCRA 2VMFA 1BG9A 5A6MA 1TZ7A 3UESA 2VZOA 3AIRA 4BA0A 4W7UA 3W37A 3LPPA 1JZ8A 3CGTA 2DSZA 4UFLA 2W62A 1B0IA 3HMCA 4EAMA 1OIFA 3GYCA 3NSXA 3WH7A 4XZBA 2CETA 2YL6A 1EH9A 2WWCA 1QW9A 1UR2A 3FW6A 4AY1A 4YPJA 1WZKA 1K9DA 3SCOA 5KEZA 3BMVA 1FA2A 1R8LA 1ZU8A 2YKKA 5CZKA 2YLAA 4TUFA 4AD3A 5JBEA 3UG5A 2D20A 2GJXB 3BMWA 3CHDA 2VCAA 4W89A 2WZIA 1KXQA 2D0FA 2J79A 1FHDA 2XM1A 3I3EA 3CZJA 5JBFA 4AEEA 3F5KA 4R27A 2J77A 3WMBA 2PWFA 1C91A 2WVVB 1JYXA 1J10A 1GONA 4IPLA 3N18A 2E0PA 2BV9A 2QMKA 3AS1A 3EDKA 3SCWA 5FIPA 3M7SA 3GTNA 2Z1KA 1CNVA 1G0CA 4D6FA 4L4PA 4LX4A 2IXVA 1V6WA 4NRSA 3A3HA 3WMSA 4BS0A 3ARYA 4C7FA 2XFFA 1E6NA 2FGLA 4UNIA 4K68A 4GPNA 1EQPA 3KEHA 4MDPA 4XZWA 4AIUA 1X6LA 1QHZA 4KH2A 2OWWA 3BSHA 1OM0A 4HZ7A 1ZJAA 4BQ5A 4U5KA 1UH3A 4JFSA 2G41A 3BH4A 4FLSA 5E0FA 1OB0A 1E4IA 3ECQA 3EDJA 2VVNA 3PZMA 4LYRA 2V3FA 4PMDA 2CIPA 4E8CA 3GXDA 4EE9A 4XV0A 2C0HA 4UQDA 3SCTA 1W1VA 2XGIA 3OZPA 1CDGA 4YHGA 1CBGA 1UWQA 5CGTA 1UWTA 1CEOA 1XHGA 4J3VA 3AIQA 2AMGA 3BCFA 2YBTA 1MFVA 4OUEA 4TOQA 4F8XA 1UR4A 6TAAA 2ZX5A 4UOQA 1V3JA 3VIGA 3OB8A 1UR8A 1U30A 3AICA 1B3YA 1SR0A 3VD9A 1DWAM 3UR7A 1CECA 4HA1A 1GOIA 1H11A 4X0NA 3WDHA 2A3CA 3QOKA 3WDJA 3W6LA 1US2A 1BVZA 1W91A 3W53A 3UERA 3ZQ9A 3SCPA 3ALGA 2W4XA 1V3MA 1JIBA 3CMGA 4JCMA 1H0IA 4JZ5A 2UY2A 2E9BA 1BYBA 2VZVA 3SCQA 2E40A 1V3LA 2BXZA 2IUZA 7TAAA 4AD0A 4DWSA 4J3SA 1JDDA 3L4YA 5IFTA 1UKPA 4JFTA 3K4DA 3VX0A 4P8VA 3L4UA 2CESA 4RE2A 1KR0A 1DWHM 4JAWA 1VJZA 4HP5A 3N9KA 3ZR6A 1VB9A 3WQVA 2W66A 1MXGA 3PTMA 4EKJA 2YL8A 5GQBA 4MB1A 1JYNA 2ZE0A 3KZSA 1JFHA 1PX3A 2VO5A 6CGTA 3AJ7A 5A6LA 1HL8A 1OBAA 1NQ6A 2VJXA 1UKOA 1NWRA 3GNRA 5A2CA 1H09A 2E4TA 2CPUA 1PPIA 3T09A 1UR9A 1MWOA 2CBIA 2EXOA 3VDAA 3BAKA 3VD4A 1WZLA 2DIJA 1CGVA 3WDIA 1HX0A 1W1PA 1WDQA 4UFHA 3CZKA 1TVNA 1EOKA 1L8NA 1JL8A 1QI2A 2J74A 2UY5A 1E72M 3HU7A 4TVUA 5DEZA 1GVYA 4GI8A 5E9AA 2WNWA 3BAYA 1N82A 2D0GA 4W8BA 3GH4A 3PZOA 4S3JA 4ZE5A 1WDPA 4KMQA 1UZ4A 2JIWA 3GH5A 4KGLA 4Z2HA 1W9PA 4F79A 1RH9A 3WD2A 2XIBA 3N1AA 3OGVA 3M6DA 1ZB5A 3SUUA 2Y5EA 4ML4A 4FLOA 5IDIA 2FH6A 2EQDA 1JDCA 3NSNA 4KGJA 1GUVA 2A3HA 3ARUA 3T0AA 4PMVA 3VIJA 1XH0A 4H7VA 3NDZA 2FHFA 1XSJA 5KZ6A 2YL5A 2V3DA 1X1NA 4U3AA 3AIWA 2FHCA 3UG3A 5A94A 8A3HA 4V2XA 4UQAA 3TTSA 1JXJA 1VIWA 3T2PA 1OGBA 4AZ6A 1CIUA 2GJXA 1PX4A 2J7FA 3BC9A 4QLLA 4HU0A 1E4NA 4AISA 2Q8XA 5IXEA 1MQPA 3QR3A 4R5EA 3VVGA 1G5AA 1V03A 1MW2A 5DO8A 5A8QA 4DM1A 5GNXA 5A2AA 4QFUA 4HOWA 2V5DA 1UWRA 3RMEA 5AYIA 1QPKA 3LPOA 4JKLA 3WEMA 1E55A 1BHGA 2VQTA 3NIYA 3UR8A 4F9JA 3AZRA 3B9EA 1UD3A 5FKYA 2DSVA 1HJVA 3AYSA 3AI0A 3MMDA 3JUGA 1C7TA 2WC3A 3ZO9A 1VFOA 1TCMA 3WELA 1TA3A 2ZIDA 5EBAA 3RM8A 1JAKA 5HDRA 2O9OA 3WF4A 4U31A 1CXKA 4UQBA 4P7QA 1QOXA 3S2CA 1UKTA 4B16A 3GXIA 5CPQA 3T08A 1XCWA 2E9LA 4PMUA 1UQZA 4AZ7A 5I79A 3NUKA 1C93A 3CZEA 2WCSA 1L0PA 4LPCA 4OIFA 2YDRA 2X09A 1BPLB 1OWQA 1ECEA 1UR1A 4GQQA 3F5JA 1H4PA 1OD0A 1YQ2A 3OIHA 1KQYA 4PMNA 3VU2A 2F61A 1M03A 2EPLX 1XV8A 3WDQA 2PBGA 5CLWA 1I1WA 2HISA 2FDMA 3DYPA 4E2OA 5TD4A 2F2HA 1OGSA 1HP5A 2XIIA 3T2OA 1VRXA 3CUFA 2ZWZA 1S46A 3IJ9A 2D1ZA 1EIBA 2CKSA 4BZYA 4AWEA 1B3WA 2WKGA 2WW5A 1NP0A 5LA0A 2XFRA 3VGDA 1NOUA 5EFFA 4H2CA 1QI3A 4B3KA 4A4AA 1LL7A 4PCSA 3CHFA 3CZ8A 5A6BD 2VI0A 4B9ZA 1CXHA 1XH1A 2DT0A 1VFUA 3WEOA 1G1YA 4ACZB 2WBGA 2J8GA 2XSBA 2WBKA 2WB5A 2ZOXA 2QPSA 4W88A 4HZ8A 2OWCA 1FH8A 1W9DM 4HTYA 1ZJBA 4AZBA 2YA1A 4HMEA 4RE4A 1FOBA 1W2PA 3RM4A 4P8UA 4UZUA 3IJ7A 1KXTA 1HJWA 3MKKA 7A3HA 3FAWA 1RP9A 2ZXAA 4J3TA 1B1YA 2PB1A 4B9YA 3TONA 2J78A 1HNYA 1AQMA 1E6QM 4OKDA 3J7HA 3MUY1 5D9OA 1OCQA 2PWHA 3FHQA 4RL3A 1B31A 1ZBWA 3IK2A 3RM9A 2UWFA 2BFGA 3A4AA 4QDMA 1V0MA 1ITCA 3WF3A 1J12A 3DECA 3B9AA 3O6AA 3EMZA 1UH4A 3FHAA 3WD4A 5CLTA 4FLQA 5C8BB 1PBGA 1JFXA 5CPTA 2PWEA 4M82A 1WCGA 1EA9C 1XD1A 2XVGA 1E0WA 5DFAA 2XYLA 4J28A 4DUXA 1E73M 3AROA 3ARXA 1CYGA 4GZJA 3AHZA 3WFLA 3U5UA 5IFPA 2X8RA 4CD6A 3UEQA 3VIFA 1GZJA 3L4XA 1QNRA 4GINA 1E1FA 2D2OA 3W6MA 3OLGA 2VOTA 2E9MA 2BY0A 2OWXA 3A6OA 3ZT5A 3OGSA 4UCFA 2XVPA 2QMJA 3II1A 3N17A 1UD4A 4W7WA 3VDHA 3WMCA 5ABFB 5I6SA 3L4VA 4AC1X 5M03A 1QW8A 2WXDM 4RE3A 1W9VA 3CUHA 3CIVA 2OSWA 3WNNA 2PBOA 2WAGA 2WVSA 4DWSD 3VIMA 3ZMRA 2WMKA 1HJXA 4IM4A 1GPFA 1KBBA 3HJEA 1CGYA 3MU7A 1J18A 1UWSA 3IANA 1PJ9A 4UOJA 3VNYA 4WSKA 1V6UA 3VKKA 3A47A 3ARSA 5I23A 3OG2A 4Q22A 4J3UA 2DSUA 1WDSA 1GQJA 5A6BA 1JYVA 4KRTA 3VGFA 2VCCA 4CGTA 3OZOA 2ZX6A 2W5FA 1VFFA 1CPUA 1EDTA 3ZJ7A 4AIEA 1E6RA 5DT5A 2ZXQA 1ISWA 3PZQA 5A8OA 3MMWA 1KGUA 1ESWA 2E8ZA 2PC8A 3VO0A 1XYZA 5JUVA 1O6IA 1KXHA 5M5DA 5A8MA 4WKAA 2CXGA 2A3EA 1TUXA 3MV11 3WQ5A 1JGIA 4UQCA 1BGAA 1EGZA 1M53A 2GK1B 4AZGA 4U5IA 9CGTA 3N12A 4M8UA 3PZUA 5I5RA 5BYWA 2X05A 1B90A 1NM9A 2D22A 1MQRA 3WEZA 4JHZA 1QBBA 5D9NA 1EHNA 4UOZA 1WP6A 2PF0A 1CLXA 4W87A 1V08A 2AOSA 1LLOA 3WNOA 4MTVA 1HKJA 1CXIA 1LQ0A 4P7NA 3RJYA 4OOUA 4WIWA 2ESCA 3S6TA 2D23A 4D6EA 5BXTA 3WQ4A 2CBJA 1B9ZA 4AZCB 3GH7A 5EB8A 3TA9A 2WHKA 1J0KA 1FH7A 1NOWA 1F4AA 1FP8A 3M07A 5I3DA 2NT0A 1BG4A 1Q6EA 1D7FA 4C7DA 2DT2A 2G8ZA 2VUYA 1Z32X 1UR0A 2OYKA 4D1IA 1BSIA 1E1EA 4P7RA 5E09A 1EOMA 1W3HA 1GOWA 2BS9A 1IT0A 2EEXA 4Z2IA 4D1JA 1W1TA 3QGVA 2CNCA 2VVSA 1H49A 5BRQA 1W1YA 4J27A 1C8YA 4MNLA 4ACZA 1E3XA 4CCEA 1JZ3A 1TFVA 1QHOA 2GDUA 4ZEPA 3VD3A 2ZUNA 4PTWA 5GPRA 1B30A 3OLDA 5CQ1A 5FL1A 3QHNA 3CUJA 1H1NA 5EFDA 1J0IA 3VM7A 1BF2A 1E6XM 2DSWA 1P6WA 1UHVA 3APGA 4FLRA 5FOOA 1HVXA 1OSEA 4MNMA 1EQCA 4B3LA 1GJWA 2XFYA 3ZT6A 3OA5A 3WL0A 3ZIZA 2DDXA 5I24A 5HPCA 2C8NA 5A8NA 2J62A 3DHUA 2J25A 1KXVA 3W25A 1W9UA 3VIKA 3CLWA 1C90A 3VMPA 1DTUA 1E71M 3VINA 1LF1A 3MSDA 4HOZA 2YA2A 3VMNA 3VIPA 1E15A 1PAMA 4H8HA 1NP2A 5AC4A 4B15A 1EO7A 4MNJA 1XC6A 4Z2GA 4IPNB 1VBRA 5FCZA 5AC5A 1J0HA 2WKLA 4GI6A 4TTUA 5AYBA 4OZOA 1UH2A 3L4ZA 3AIEA 4WJXA 4P8WA 1CXLA 4MAZA 1DWIM 3CZGA 3AXIA 3FXYA 1V3HA 4U33A 4CU8A 1UOKA 2V3GA 2WVUA 5I0DA 3VDBA 4BF7A 1KB3A 3A4XA 3SURA 3IAPA 2G3MA 3K8MA 2WWDA 1FFRA 3U5YA 3DYOA 3VIHA 3VGEA 2WLYA 1X6NA 4WKHA 3RJXA 4CU7A 4AIOA 4DUWA 2CHNA 1R7OA 3QOMA 4W85A 5AY7A 1DEDA 2VC9A 4Z2JA 3WKZA 5BRPA 4E4PA 3FAXA 4H04A 1EXPA 2FGZA 3SCVA 3TTOA 1HXJA 1GHRA 3LPFA 1GCYA 1B3XA 3SCUA 4NZCA 1UUQA 4PMZA 4HU8A 4W5UA 3WQ8A 2Y8VA 4U2ZA 2XUCA 3AMDA 1JZ5A 4GO8A 3G6MA 3MSGA 4YHEA 4UQ9A 1C7SA 2X0HA 2VQUA 3QHOA 5CG0A 1V02E 1SMAA 2G4FA 3WUGA 5LYRA 1QVBA 4PMXA 3PZ9A 1E5JA 1GOMA 4D6CA 3FN9A 2CKRA 1IZKA 1J9YA 2CEQA 2WHJA 1E6SM 3WNKA 4EK7A 5I77A 3LMYA 3WY1A 2YDSA 3AS3A 1JYWA 3AS0A 2VT0A 4N42A 4LYQA 1G01A 2WVVA 1AQHA 5BCAA 2BY3A 4CCCA 1VF8A 4W93A 1GQIA 3AHVA 2RGMA 2OLHA 1CWYA 4HOXA 4J7RA 2HVMA 2EO7A 2XWDA 3U7VA 5LA1A 1EHAA 3VIOA 4D72A 3AIUA 4JCLA 3ZT7A 3UG4A 1V0NA 4BQ2A 1D3CA 4MB4A 1HT6A 4GZIA 2V38A 5DF0A 1E5NA 1MXDA 1UWUA 2WHLA 1UA3A 2WM0A 4MB3A 2WMGA 4UR9A 1W3LA 3POCA 1JD7A 3BGAA 4W84A 2DT3A 4GKLA 5M17A 1E6PA 4QP0A 1R86A 1E4MM 3AHXA 3AYRA 2JEQA 1RPKA 4F9DA 5CGMA 2VX7A 4AZCA 2WMHA 5D9PA 3AQUA 1HKKA 3EMQA 2CERA 2PI6A 1B3ZA 2VRJA 2GSJA 4E8DA 3VOCA 3SUVA 2UY3A 3W26A 2ZWYA 3SIMA 2D3LA 1E43A 2ZUMA 1W9XA 3WQ6A 5A69A 2XVLA 4W8LA 4A3HA 2X0YA 3ZSTA 2ZUUA 4UFMA 4AMCA 1K6AA 1VJSA 1UKQA 2XSAA 4XUYA 4M1RA 2E3ZA 1WB0A 4IUGA 3ZJKA 5JIPA 2D24A 2ZICA 1Q6CA 2J7CA 4PRWA 1JF6A 4U2YA 3SCNA 4P7OA 2ZUTA 4BCEA 2B31A 5BWFA 3KWXA 2YBUA 3B8SA 2WMFA 1YHTA 3POHA 3VUPA 3A4WA 1LG2A 5ABGA 2J7EA 4ATDA 1E0VA 4WSJA 4CD5A 4W7VA 5CXPA 1HF6A 2VL4A 2D3NA 4CD8A 2VR5A 4PYSA 2JF7A 4Z2LA 1EDGA 2W92A 2WVTA 2BVDA 1V3IA 1W3KA 2ZX7A 1UD5A 2J7DA 5A95A 5ECUA 3F4VA 4M24A 4AD5A 1E9LA 2WC7A 3AMCA 4H41A 1FFQA 4TX8A 1UYQA 1LG1A 1GVIA 5C71A 2YJQA 3ARWA 5DMYA 4DM2A 1FHLA 4WK9A 4DWSC 1E70M 4BQ3A 1E6ZA 5IHSA 1XYFA 4GI9A 1GJUA 4GQRA 4M80A 3T0DA 2EBNA 2D0HA 2CYGA 2GFTA 5CSYA 3BLKA 2FH8A 2DSKA 2O9RA 3EYPA 1KCKA 3MS8A 3WN6A 3VGHA 4BQ4A 5JBDA 1XRVA 1CXFA 4PEEA 2VX4A 3ZOAA
chains in the Genus database with same CATH superfamily
2XZ7A 5CSSA 1V93A 1OINA 2YOCA 4AUBA 3T55A 4N9EA 3D6NA 5CAKA 1IXPA 4X63A 1GOOA 3B9DA 3EOSA 1RLDA 1TIWA 5A1AA 2HDJA 4MPKA 3S4TA 4AD2A 4PUDA 1JG9A 3N15A 4OJYA 3QM3A 3BAWA 3F1QA 4GE8A 3FJ4A 1MYRA 2MANA 2ABAA 3LGEA 3UGVA 3EOOA 4D71A 1MXSA 2EPOA 5LIYX 2NQ5A 4ZO9A 3VDGA 1KGXA 4JTEA 1WDRA 1XGEA 1V3KA 3WENA 5EMUA 4XD6A 3L5MA 3WF2A 1TWDA 3MCNA 1G4PA 1CZ1A 2INFA 3TA6A 2Z2UA 3KTCA 1KFJA 3ENLA 4LCSA 3W81A 1AL8A 3EDFA 2Z6IA 1XBXA 1ZCCA 3LUTA 4HHMA 5A3HA 1V51A 1EC8A 2Z00A 4EPDC 3ANVA 4W8AA 3NFUA 1IEQA 2VEKA 3FLUA 5HNNA 2FPYA 2CLLA 1FWCC 2VR2A 1F3WA 5AC8A 2X2YA 4PTVA 3H22A 4O57A 7ENLA 1KWGA 2NQ9A 1A3WA 1T40A 1FXQA 4G8TA 4DNMA 5M3WA 2D2GA 1JRCA 3B03A 4JPGA 2V5CA 3S83A 3VILA 2Q71A 3O9NA 4I6KA 4XTDA 1PZ3A 3HPXA 3PHAA 5FJTA 3SQSA 3UFYA 1QFEA 1WKEA 2JIEA 4N0RA 2C7FA 3N34A 4G9PA 1H5VA 3LU2A 4GH1A 3W76A 3ARTA 3LTYA 1W5QA 3HQOA 5I3JA 4C6EA 2HTMA 1DXIA 3LHWA 5D9MA 3ZXWA 4M81A 2E1WA 3ME3A 1K8ZA 1FWFC 4C90A 4GMEA 1H61A 3NQ8A 1TA3B 4JIIX 3ZSSA 3DC0A 4M7SA 1TTPA 3SFKA 3KBSA 3PPFA 4XB3A 3UW6A 2XH0A 1XCXA 5BXRA 4FNSA 3WL1A 2NT1A 4PCTA 4MDOA 5JQ9A 1LJYA 2VCBA 4CU6A 2Q09A 2FVKA 4UQEA 3GTFA 1MNSA 2OJPA 2RAGA 3P84A 3ZLHA 2JFEX 3LBCA 4GA8A 5G2IA 1MSSA 3DFQA 5CBJA 3GNOA 4JKMA 3W22A 4H83A 1JI1A 3CTTA 4YXGA 2DPEA 1OK6A 2V5LA 2BXYA 4P2VA 3SSJA 1D7KA 4ES4A 3FV9A 2R9RA 2NQZA 1J0YA 1OIMA 5J5RA 1JNEA 5EKYA 2H8ZA 3HQPA 5F7UA 4FR6A 1OK4A 5GJMA 4TX9A 4NX0A 3U57A 4MJ4A 2QAFA 4PUMA 4YCOA 2WSKA 4CEXC 1IZJA 3KL3A 1SW0A 4XZHA 2W3ZA 2VTFA 2XPKA 4BY3A 3BK0A 3AXXA 1LLZA 2VD9A 4TXEA 3V5FA 2IS7A 3WLOA 3K13A 5K2ZA 3N6JA 4OFCA 3H26A 3BLPX 3APYA 3O3RA 4B90A 1WUEA 3BSGA 2VFIA 4YTUA 4PB5A 3TR2A 3MDWA 2YW3A 4PMOA 2VRQA 1BYCA 7REQB 1OZMA 2QPUA 3MQTA 1DJGA 1JCTA 3GK0A 1W31A 3WQDA 1M68A 1XBYA 2X0SA 3S47A 3CT2A 1FWHC 1HJQA 2OB3A 2E67A 2ABBA 4RXGA 4PFMA 3HG4A 3R0DA 3E2VA 5IRPA 1EIXA 4ZOBA 4XQ6A 2OZTA 3F03K 4IGMA 1FWBC 3LB0A 3GDBA 3LDVA 4L4MA 1H60A 3S6OA 3LZ5A 2BHUA 2NXHA 3ZJ6A 1O5QA 1DWFM 4FF5A 2BY2A 3S6DA 4AWSA 4KRUA 1FWNA 3R8HA 4PMYA 3FEQA 4NRRA 4CNSA 1KKRA 3QTPA 1Z41A 3PBWA 3CUGA 4QS6A 1Z42A 3V1PA 1ZP3A 2YIHA 3RRXA 5KETA 3QY8A 1YNYA 2ZZ3A 3GAYA 4HMCA 3L68A 1W32A 1XYBA 4YNGA 4HNTA 1W5MA 3W24A 3UZWA 1W2VA 3T05A 4JNZA 4AZHA 4MJ2A 1GQLA 4O0ZA 1KGWA 2E77A 1OD8A 3SY8A 3QSTA 3GZAA 3WLKX 2AKZA 3FDGA 1C8QA 3KM8A 2O56A 3SECA 2PA6A 1W1A1 5LA2A 1I60A 3LM3A 3IARA 1A5UA 1QR7A 1OFAA 5M1TA 2OQYA 1GTHA 3WD0A 3M5XA 3PZNA 4H7CA 2XGBA 1PTGA 5F2LA 2CITA 2FYMA 2FB3A 3HZ3A 5AHEA 1K70A 5C9RA 3EB4A 4HZMA 3T2QA 5MKGB 2QCLA 3WQFA 4Z0JA 2OKOA 4H9ZA 3MUIA 1HKIA 4C6QA 3VOHA 3H23A 3PK7A 1DP0A 1UA7A 3JR2A 1DJYA 2QLYA 3TTQA 3PZGA 4CQ9A 1VQTA 3PPCA 4TTGA 4B5NA 4B91A 2X1RA 3WH6A 1Z9AA 5LZLA 3G1DA 1RV8A 4AXKA 4HCLA 2VDHA 5HJYA 4C1KA 4FOKA 2H9AA 4XIMA 4OGZA 3BAIA 4E2DA 4LYPA 2E68A 3KBNA 1CENA 3U2EA 2RDXA 3N29A 3HGRA 2BSLA 2DH2A 4O13A 4FK9A 3WLMA 4A3YA 2KX9A 1SM9A 5G1TA 1QPNA 3H2NA 2J9ZA 1TJ1A 2G97A 5U4NA 1U1HA 2J6XA 1G94A 1XIDA 2R6OA 3IAQA 5FEXA 1Q2SA 2R1KA 4H8VA 4X60A 4CKQA 5C7VA 1MZRA 3QZ6A 6REQB 3BDKA 4C5ZA 3T44A 2HK0A 2WJFA 1W3JA 3AJXA 3WH9A 1TSIA 4Z17A 2PDHA 3UZJA 4PBGA 3N13A 3WFZA 3GXFA 1I75A 2VR4A 2QNEA 5DLCA 2W6RA 4Y9AA 3UF9A 2WSYA 3EDDA 2PLMA 4ZQCA 3MA8A 3H55A 1NWUA 4IGSA 2CU0A 5E0CA 4IX2A 1VAHA 3L2LA 3I3BA 2Q01A 2R8WA 2WMIA 4C1NB 3DYMA 4JTQA 3TZNA 3OVRA 4ZOAA 1I8JA 4BI5A 3Q67A 1MZHA 4CN1A 4ZZ9A 3KCLA 3BJTA 3FYOA 1GYMA 1DXFA 2HEJA 1Q6DA 1HJSA 1ITQA 4LQ1A 3BV4A 1H2JA 1R87A 1ZBKA 3S2MA 1FCUA 1KCLA 5T8GA 4CN4A 3T0BA 2J75A 4RDZA 3NO1A 1EX5A 3TTYA 4H6QA 1GVOA 3JW7A 2GYIA 4J3WA 4Q6XA 3IJ8A 2EG8A 3RPMA 3W7LA 2QCDB 2Z26A 3THCA 1JZ2A 4UFJA 2EPHA 1ISZA 4F40A 3FNDA 2J4GA 4OU1A 3BLIA 1QU4A 3KRBA 1Q3NA 2PAJA 3HPZA 1TQJA 1POJA 2PWGA 4DJDC 4JHOA 3ARZA 1DWJM 3CB3A 3RX2A 2Q3OA 1A3HA 3LX9A 2ACSA 4CNOA 4ML9A 4JDBA 1F4HA 1TMLA 5AVHA 3AFBA 1Q6FA 3DFPA 4JFWA 4GFIA 2WK2A 1E56A 4UFIA 3SQMA 3WBAA 2Y89A 2XIJA 2XVNA 4XBKA 1SO4A 2OCZA 3KDOA 1EZWA 3UESA 2P1FA 1A5BA 3AIRA 1R3YA 3K30A 2I1OA 3LPPA 4GD0A 3JRKA 2GZXA 4UFLA 2QJGA 1K02A 5IDZA 2IKIA 3ABOA 4HNNA 2BBFA 2VEFA 3BZJA 2CLFA 4LVDA 1SSDA 2WWCA 3G1SA 3H2MA 3FW6A 3S5SA 5A5WA 4AY1A 1WZKA 5TQLA 4AD3A 2NSOA 1MO0A 3CHDA 3SO7A 2VCAA 1WA3A 4A35A 2D0FA 3WMLA 5JBFA 4R27A 3A12A 1JPKA 1GONA 1OQFA 4S39A 3VKAA 1DJXA 1S38A 4PB4A 1AJ0A 4JYFA 3IS4A 3EDKA 1MEHA 3WO8A 4J3ZA 1F3XA 3GTNA 1G0CA 1SVDA 2BTMA 3B0UX 4U4MA 1KNWA 3E74A 3R8RA 3MYOA 5C2CA 3LTPA 3BMXA 1HFBA 4L1GA 5HJLA 4MZ1A 1R3VA 2VGBA 4LBRA 4XZWA 1DJIA 4AIUA 1QHZA 2VFGA 4KH2A 4IMDA 2FDSA 2KAUC 4HZ7A 1ZJAA 1R6WA 4U5KA 1DJQA 1UH3A 2G41A 3BH4A 3SZ8A 3G8EA 3RITA 3TYDA 1T5AA 4WXZA 4PCFA 2PDKA 3KBVA 3PZMA 4LYRA 2V3FA 1UIPA 3KFTA 2CIPA 4WXYA 1LUCA 5CC3A 1U83A 3GXDA 3TWBA 4XV0A 3ITCA 2DZAA 4UQDA 5BOFA 1ONRA 1W1VA 2XGIA 4XD5A 5B80A 1CBGA 5CGTA 1UWTA 3G22A 2AMGA 3QZEA 1EJTC 2DW6A 2FGBA 4OUEA 2AGTA 1XLHA 2ZX5A 1IT7A 3OB8A 1UR8A 4AF0A 1SR0A 3VD9A 4HA1A 3NAVA 4X0NA 4DAFA 3IJIA 2QCHA 1BVZA 1XR2A 2R24A 2OLSA 1NEYA 3QPEA 4LS2A 2W4XA 5HQEA 4HU4A 1ENUA 1IYXA 4AX7A 1GOXA 2Y7FA 3KBWA 4O28A 3ES7A 5G4WA 2E9BA 4S38A 2VZVA 5T9CE 3SCQA 1V3LA 3B8UA 1KD0A 2OELA 2Z29A 3AO0A 3ANYA 4DWSA 4J3SA 1O4UA 2O55A 3R25A 4OV9A 5DCEA 4RE2A 4KW2A 2QQ6A 1C8VA 3DKLA 4G7EB 3G1YA 3N9KA 2P50A 2W66A 1PCWA 4Z42C 1UPPA 2ZZ2A 4GVIA 2VJXA 1UKOA 3PG9A 4ZBCA 1NWRA 3GNRA 3WJSA 4TMBA 3MYPA 3T0TA 1UR9A 5AZ0A 2I5QA 3VD4A 2RDUA 1EGMA 3VK5A 4O10A 3L67A 3QSRA 1EJRC 3DBNA 2RH9A 1QMLA 1HKWA 4HPNA 1KW1A 4WSHA 2E6FA 1GT8A 3A9IA 3HU7A 2PD9A 1GVYA 2YCIX 1N2VA 3W23A 4H9UA 2WNWA 1N82A 3PZOA 1KBLA 4ZE5A 1WDPA 1E1CB 4KMQA 1UZ4A 4LEFA 4Z2HA 1W9PA 3WD2A 1HZYA 4DJEA 4LB3A 2XIBA 3OGVA 2HBXA 3VE7A 4REQB 1FCVA 4FLOA 2FH6A 3I10A 5M2FX 1KBIA 1BD0A 2A3HA 3MUXA 1KKOA 3OBEA 3RU8X 4LVAA 2FHFA 1R30A 5KZ6A 1EEXA 3MI6A 2WNNA 2V3DA 1X1NA 4N4QA 4U3AA 1BXNA 2AL2A 3AIWA 5EMMA 3T78A 1EPXA 1FWJC 2P10A 5A94A 2Z6JA 4V2XA 4UQAA 3TTSA 3GG7A 1WAUA 1OGBA 3UPBA 3W87A 2J7FA 1A4LA 5T91A 4FR1A 4NNBA 4BI6A 4QJ5B 3GZ3A 4QQUA 5DO8A 1SFTA 4ZB2A 5A8QA 3E2SA 1D8WA 2V2DA 1Z69A 1SZRA 3HG5A 4QFUA 4AY7A 4HOWA 1XXXA 2H6RA 1UBPC 3SSZA 4ENLA 1UWRA 5HMFA 3PM6A 1EYEA 1J5SA 5CH9A 5AYIA 2VQTA 1ZTVA 3AZRA 4O8RA 1IE7C 5FKYA 1LROA 3BANA 2XISA 3W00A 3AI0A 3MMDA 3AXKA 3CAWA 2WC3A 2QVNA 1VFOA 4QDWA 4RDWA 3PUDA 1JAKA 5LHEA 3S8HA 4UQBA 4P7QA 3REQB 1UKTA 4CQCA 1FDZA 4WOZA 2E9LA 1NY1A 4ZOCA 1R47A 1C93A 3EOEA 3QEZA 3N2BA 1NDWA 1P7TB 3RK8A 2ISVA 1S5TA 3QYSA 4IQJA 3VNMA 1XPGA 3FA3A 1UR1A 5LNSA 3OIHA 4GJJA 3VU2A 5BMWA 4ADUA 4XK2A 3RPTA 3IRDA 1TTIA 5AVNA 2HISA 4PEKA 1P6BA 5TD4A 2F2HA 1OGSA 3EKLA 5CSRA 3KRZA 1A80A 2CKSA 4BZYA 3SRDA 4PMJA 4AWEA 3H2AA 3VOJA 2WKGA 3U3HA 2FTPA 2YFNA 3CZ8A 3NM3A 3TJLA 3FJ6A 3TC3A 1XH1A 3WEOA 1K8YA 2I57A 4JTKA 4YTTA 4CNTA 1FX6A 2WBKA 4O1FA 4N9CA 5KZDA 2PP3A 1FH8A 2C1IA 2WZMA 3HPFA 5FJRA 4E5TA 3MBDA 1W2PA 7A3HA 3FAWA 4J3TA 1QATA 3AC0A 2FJUB 3N4FA 2J78A 1RBOB 1E6QM 3J7HA 4LH8A 3M43A 2GQ3A 1ZPTA 1A3XA 4GYPA 3FHQA 4RL3A 1ZBWA 3RM9A 1REQB 2PU0A 1YMYA 2BFGA 3GVVA 4QDMA 3H2OA 1XDMA 2ATMA 1X1ZA 3SM0A 1UH4A 3FHAA 3WD4A 1GVSA 1J6PA 1O60A 1FWTA 3VCNA 4GOAA 4Y8FA 2V82A 4DELA 1JFXA 2ZC1A 4GNKB 4A3RA 4C91A 1WCGA 5CG7A 1XD1A 3TC7A 2FZMA 2XYLA 4YVXA 4KWOA 1E73M 1EJWC 3CM4A 4GZJA 2PDLA 3SJNA 3CXOA 4XWUA 2HE5A 4CD6A 2V0TA 4UNLA 5CC5A 3HG3A 3PUOA 4ZO8A 4OQVA 2VOTA 1AFSA 3UWQA 4JIQA 4M6UA 2Z1XA 5REQA 1UD4A 1IEWA 1OX4B 3WMCA 5ABFB 2BDQA 3MI2A 3UNTA 4DJEC 1V79A 4S23A 5M03A 4RE3A 2O7QA 2FVLA 3FYPA 4WDXA 5AHLA 3TYZA 4IT1A 2J13A 4R88A 3UZ5A 3WLJA 3NGFA 3I65A 2IQTA 2WVSA 4DWSD 2VM8A 3NQFA 4O8AA 1GPFA 3KOFA 2P0IA 3IANA 1V6UA 3A47A 3OG2A 4EPBC 4J3UA 2DSUA 3VXGA 1NU5A 1JYVA 4HSHA 4KIEA 3VGFA 2ZX6A 1VFFA 1EDTA 4CNUA 4AIEA 1E6RA 3OYZA 3MMWA 1KGUA 2PC8A 1B3OA 1K7FA 4DXKA 4FPSA 1XIIA 2PRLA 3W1RA 1JR1A 1VJIA 1TUXA 3MV11 3WQ5A 1M53A 2GK1B 2EGZA 9CGTA 1GEHA 5AHMA 1Q6RA 3DG7A 1LBFA 2A1YA 4JXCA 4C6LA 2ZE3A 2D22A 4MLJA 3MP5A 2QJMA 1QBBA 3RU6A 3STFA 1DJWA 1V08A 2AOSA 3GFZA 4MTVA 3A13A 4NT0A 4P7NA 2ESCA 1JUBA 2D23A 4LUIA 4WX2A 3M41A 3TU9A 3UG8A 1DQWA 3GH7A 4O50A 5EB8A 1J0KA 1NOWA 1FP8A 5DY2A 1BG4A 2J9YA 1TKKA 3DH7A 2QT3A 4C7DA 2PCEA 1GG0A 1XYMA 1S5NA 3EB2A 1UZDA 1GJPA 4XVEA 3TCSA 2AAMA 3S1UA 3TVAA 4Z2IA 1YLVA 2X2GA 4IMEA 3E12A 3DERA 3ITVA 5C5YA 2P3EA 1PDZA 4IJRA 2VVSA 5BRQA 2PDNA 2BG5A 3NL5A 3T0CA 4NIRA 1JZ3A 3ABRA 1OYBA 1RJQA 1QASA 2GDUA 5GVJA 3VD3A 2ZUNA 3CU2A 4I9MA 3OLDA 5CQ1A 3W70A 3S5OA 3W7DA 3TV8A 3QHNA 3CYVA 4NQ1A 3QXBA 1H1NA 5EFDA 1H51A 1P6WA 1UHVA 2X7VA 3APGA 4MM1A 2DP3A 4H2HA 3THUA 1TJRA 2EKCA 3PB0A 4HHLA 1OSEA 3TLLA 3MSRA 5DXYA 3OA5A 3ZIZA 3QKEA 4HN4A 3FKRA 2J62A 1RQBA 3QMTA 1PL9A 4NY2A 2R91A 1YTDA 2B4GA 1UC5A 4DPQA 3Q4DA 3CC1A 1KM4A 1XJBA 1YTEA 2V5JA 3KHJA 4H8HA 2G0WA 1NP2A 5I3IA 1CT5A 4GYPC 1PKLA 3TX9A 4IIGA 5AC5A 2QCGA 4TTUA 2A7RA 3C6CA 3L4ZA 1XIFA 4MAZA 1DWIM 4PFHA 3BZGA 4H9VA 3ZVIA 4U33A 2CLKA 4BF7A 3GHRA 1K77A 3VNIA 3A4XA 2PODA 3IAPA 2G3MA 3P93A 3ZYZA 5AFDA 1G67A 3WLQA 3VIHA 4GQGA 4XO7A 1Q5MA 4CU7A 4AIOA 2I5IA 3GXNA 2CHNA 4BEQA 1TJPA 2UZ9A 1LLWA 1QPOA 4W85A 4GY7A 4HK6A 2PF8A 3Q65A 2X40A 1R2RA 4E4PA 1ADSA 4LAUA 2PPGA 4M51A 1LQ2A 4IXXA 4NZCA 4PMZA 2QAPA 1TPC1 2W0UA 3M0YA 4U2ZA 2XUCA 1JZ5A 3TSDA 3R10A 3G6MA 3MSGA 3M5YA 5CG0A 5DX7A 3LG3A 4PTNA 1V02E 1SMAA 4PMXA 1EX1A 3FN9A 1IZKA 4G7FA 3NQMA 4UTWA 2A4AA 4S3AA 1JPHA 1EL3A 4YTSA 3GTXA 4FXRA 2FKPA 4LJ3A 3WG6A 3AS3A 3NGJA 3MO7A 4WY0F 1NIUA 2VT0A 4LYQA 3Q45A 3PPHA 3PPGA 5BCAA 2BY3A 3LY0A 3NQVA 4W93A 2PDXA 1GQIA 1XLCA 1WOAA 2BLEA 5EMLA 3R8GA 4IIFA 4MVAA 2FB2A 2XWDA 1S3HA 3PBMA 5LA1A 1JCNA 2CZEA 3CWNA 4D72A 1QTWA 2H8XA 3UG4A 1A5MC 1V0NA 3NVDA 5DRIA 1HT6A 4S3DA 2V38A 1HTIA 1E5NA 5HWNA 1MDLA 1YXDA 4PBEA 3E6EA 4BI7A 3E5PA 4CNNA 4LALA 4W84A 3HTWA 3ATYA 4YVVA 4QP0A 1J79A 2JEQA 5CGMA 1I45A 1BKSA 1QRQA 4GJ1A 4AZCA 1XLFA 5D9PA 3UPWA 1G6CA 1HKKA 3VNKA 2GSJA 4Z0SA 1ONWA 1XW8A 1OZQA 4RW5A 1ADOA 1DQXA 2ZRWA 4HYRA 3MUCA 4MWAE 3VCRA 4DRSA 1P1MA 2POZA 2ZWYA 3R43A 2XVLA 4W8LA 1FBAA 5FF0A 4UFMA 4WOQA 3W7QA 2CLHA 4NXSA 3GUGA 1NDZA 3LV6A 3W83A 4RDYA 1VLIA 2E3ZA 3ZJKA 3GDLA 3M16A 2XDFA 5IM51 4GJIA 4XG1A 1LBMA 4U2YA 2ZUTA 2C14A 5BWFA 3UJFA 3KWXA 4JN8A 4AEOA 5K9CA 1XM3A 4RW3A 2QF7A 1WOBA 3GNXA 1T7LA 2J7EA 4ATDA 1UJQA 4CD5A 4GFSA 3R0UA 1H7NA 4KQNA 5H6HA 4X3ZA 2DVXA 5DMLA 4Z2LA 3KCOA 1RD5A 3TH6A 1ICQA 3TW7A 1EDGA 3KHDA 2A79A 3KLLA 1XIHA 2ICSA 3GVRA 1V3IA 3H2FA 2ZX7A 1EBHA 2J7DA 1E9LA 1ECQA 4H41A 1FFQA 4XZNX 5K9DA 5C71A 1GVIA 4FXSA 4DM2A 3KVMA 4B92A 1OY0A 2DUXA 5DANA 1IF2A 1OFPA 4ZL1A 1UCWA 5IHSA 1WKFA 3XINA 1OC7A 1GJUA 2I9EA 4M80A 3T0DA 2GUUA 3DI0A 2D0HA 3ITLA 1VHNA 5D2WA 1OFQA 3C2FA 4KFPA 3QJAA 2DSKA 3EYPA 3RF9A 3MS8A 2OLAA 3UXAA 3VGHA 1XRVA 4V1YA 1NFBA 2XN1A 2VX4A 4YN5A 3PULA 4GIRA 4PSRA 4B4HA 1JD9A 2ACUA 3SCSA 4F2TA 1MUCA 1Q6QA 1B54A 4HBKA 1H7WA 1RP8A 3WH5A 3R6IA 1Y0EA 2GJPA 1UPMB 4I5XA 2BHZA 1SW7A 1UZ1A 3WD3A 2Q8ZA 5XIMA 1KR1A 2BWGA 2ZKMX 4JY8A 4R9OA 3T8LA 3UWYA 4FZIA 4ZTXA 4FNPA 3NPUA 1QI4A 1XUUA 2YBVA 2W27A 2YA0A 3IJQA 1CX9A 3QV8A 3FA4A 2ZVIA 3AXMA 2X1UA 1AW1A 5D8ZA 4RNJA 1GEQA 4KCWA 1IGWA 3D47A 3PZIA 1RXOB 1E40A 1W3TA 3CQJA 1KV8A 3WK2A 1W54A 1XSKA 1FWWA 5B7ZA 3S5YA 3T81A 1XSIA 4H9XA 1HW6A 3GE7A 5HK4A 3UQNA 2Z4GA 2W67A 4R7JA 3K8KA 1KBKA 3KL5A 4C7GA 5EYWA 1LRTA 3SUSA 4HNLA 5K7JA 2YCKX 1QDSA 4IICA 3CPUA 4PL2A 4RE0A 3H24A 5A2BA 3AZSA 3N04A 2OO0A 2OEKA 1BYDA 3GW3A 3B05A 2E5CA 1AMYA 1V6VA 3W07A 1C3FA 3TIMA 5CSUA 2BNJA 2J7HA 2W91A 2ZXDA 3ZVHB 1UG6A 1GNXA 1BVNP 4A8LA 3B3DA 2VC7A 4M1BA 1K9TA 1ODUA 2OVLA 1WZMA 1MW0A 3FX4A 1XG4A 4EANA 1CLVA 3H4XA 2P8CA 4MYXA 4CD7A 4PSPA 3VZYA 4O19A 4LT9A 4HNVA 4AW7A 5C55A 1O66A 2OOFA 4NF7A 2CBVA 4UBPC 5MHBA 2QV4A 3C56A 3GTHA 4X2PA 3SY1A 1VEPA 2YCLA 1AQ0A 1XD0A 4CQAA 2HV5A 1Y65A 1R85A 5CCZA 3MV01 4DLMA 4AB4A 1CXEA 5E5CA 2WPBA 1LCOA 1B9BA 1Q6GA 2VX5A 5F4XA 5CBBA 5HBFA 4FSAA 4AD4A 1ZBCA 2H9AB 2ISFA 3IIPA 4RPPA 1TPB1 4DF1A 2VKZG 3W4RA 5D4YA 1J11A 1W56A 3DESA 4KWUA 4NYYA 1MNZA 4WDUA 4PN2A 4ZXLA 4CNPA 4L1XA 3W7EA 4LY4A 2EPKX 3BCDA 3OBAA 9XIAA 2DIKA 5AC6A 1BTCA 3T40A 1S5VA 3E5BA 4UCGA 4ZO7A 1GOQA 2ANUA 3IVSA 3GDRA 4DN1A 3A5VA 1PZ1A 3VNZA 4LBSA 4AXNA 4KETA 4PTMA 4NU7A 2RGLA 1NOFA 3NXFA 4NSBA 3V3WA 2A3LA 3MCOA 1JF5A 4IG2B 3D5HA 3C61A 3UJ2A 4W4QA 1WNOA 3OG3A 4CUCA 2JQXA 3TOYA 3N11A 3VKJA 1ZHAA 3CHEA 1SPQA 1J0JA 3AISA 5GNYA 2F6UA 4ROQA 4OVXA 3TP4A 3EGJA 4GLEA 2GSHA 1JEZA 4AU0A 1A47A 4GXWA 1AODA 1W9BM 2YXOA 3NCOA 1GZ1A 2RKXA 1QW7A 3BW4A 4ADSA 2WMIB 2JF6A 1ZL1A 2VENA 1P6CA 4FX7A 4S2BA 4YTRA 5JIWA 4MADA 5I78A 2C15A 1OYCA 1ZS2A 4QCFA 1QHPA 3P0XA 4IFKB 4JFUA 2EAWA 3WSUA 4DUVA 5D2VA 3PN8A 3WH8A 2GDVA 1EUNA 2HXTA 3GXMA 2FFCA 5CZ0A 1K9FA 2QGHA 3A64A 3WNLA 1PEZA 2QGYA 1FH9A 3GKFA 4ZXOA 1ONEA 2QJJA 3OLIA 1L9WA 3W9ZA 2VZUA 1WO2A 1M04A 4PCNA 1CGWA 5D32A 3VTRA 2PE4A 2WYSA 1IWBA 3CHCA 3ITYA 3GXTA 1QNSA 5JH1A 3PC0A 5CZTA 2Y4SA 3NDYA 4TVDA 3W38A 1JXKA 3AHTA 3DKJA 2DZPA 3G2GA 1XQLA 3QFWA 3MPGA 4FNTA 2O92A 5L9FA 1XLAA 1J96A 4GXPA 2V5BA 1D9EA 1LRQA 2BX7A 4LUYA 3GHUA 4FNUA 3D46A 2WZHA 3HBLA 4UMAA 1AZ2A 2WZEA 1N55A 2NXGA 1XGZA 1VFLA 3PTQA 5TAOA 3C52A 3LTSA 4GQ0A 3QF0A 3RFAA 4DYEA 2DVUA 1SYTA 3IIOA 3P8IA 4GC3A 2O9TA 4JQ3A 5DELA 3TQPA 2YX0A 1Y5WA 3BLDA 3WF0A 2VEPA 4D6DA 4DJFD 1TV5A 4LC6A 1BEUA 2V3EA 4E4UA 3NSMA 1G9HA 2VX6A 1D2KA 1ME9A 2PDMA 4QQ3A 1MVYA 1ZLPA 2PDWA 2BVTA 3U48A 2ZX8A 2WCGA 2WPGA 1BAGA 3PWGA 4U3CA 3GVWA 4BJHA 2VDGA 1H50A 1OHLA 3H7RA 3UWZA 4A3UA 2ATSA 1YADA 1NJJA 3LZ3A 2HBVA 2RDWA 4LOCA 5BRBA 5BOEA 1QBAA 3ARVA 2WCAA 1XGDA 1RSCA 4YYFA 3PZVA 5BOOA 2WANA 3EA2A 4GIAA 1CGTA 4LCRA 4NVTA 3RR4A 1BYAA 1XRTA 3FEMA 3L5AA 1IWPA 2VRKA 1JDAA 4B5XA 4K8HA 1NQKA 2QIIA 1OT2A 1EJVC 4L4OA 4WKFA 1L6YA 4LV9A 2ZRXA 4L6DA 3ABQA 1CGUA 2FHBA 2ZCGA 4MF4A 2YB1A 5BMXA 1F73A 3M4HA 2QR6A 4L65A 4Q8VA 4QE5A 3I3DA 4V27A 1K3UA 4R33A 3W28A 1PX8A 1GQKA 4MMWA 5DY3A 1VFMA 3LYEA 4MFEA 1ZJHA 2BVYA 3V0UA 1OCNA 3EXRA 3L12A 3R94A 1AK5A 3ICJA 4U10A 3HURA 4KCTA 4TX6A 4QBXA 2F6XA 4HYVA 3QVQA 4AWTA 3OQEA 1QNPA 3ZJ8A 4AZIA 4NZ5A 1XLLA 1EF3A 4MZYA 4P7LA 4Y9PA 2ZC8A 3APTA 4KFNA 4PMQA 1WXJA 1XC4A 4DWSB 4C6OA 1U33A 5A6AA 3DIPA 2GJRA 4HVXA 4MWAD 4JL2A 3BXWA 3ORWA 1KCXA 4NI3A 3WBXA 4UFKA 4CCZA 2PWDA 4XAYA 1BKHA 3WCZA 4GGBA 4AIBA 3WJXA 3VZXA 4LWWA 4JHMA 5C9UA 1W6TA 3CTLA 1V0LA 5BROA 1ZP4A 4NAFB 1MRAA 1W0MA 2C16A 2WMJA 2QHAA 3H4GA 3URBA 6ALDA 4OUIA 1U5VA 1Z7AA 1Q8JA 2PEVA 4MUPA 1HN1A 2WSPA 1Q7MA 5B7YA 2B7NA 4XKYB 1V4YA 2QIWA 3W6YA 1M7JA 4GZ7A 3EWXA 4HPHA 1IQ8A 2VFFA 2OZ3A 1XISA 3RG6A 5HMEA 3T4WA 3MUZ1 2Q02A 2EG6A 4J35A 3EWDA 3FIGA 4O12A 3CYJA 1XLEA 1W5OA 3K8LA 2CCRA 1Y5XA 2VMFA 4JNYA 1BG9A 1TZ7A 5AHIA 3L7RA 2VZOA 3L65A 2DQWA 3W37A 3CGTA 4JTAA 5DN1A 4ORIA 5EPDA 3VFLA 3AWOA 4DBEA 1OIFA 4XZBA 2Z0IA 3NNTA 5HMSA 2V8ZA 3LXBA 3W7NA 2C71A 3H8AA 4YPJA 1K9DA 2OODA 3BMVA 2J27A 1Q63A 1R8LA 2YLAA 7PTDA 4O0KA 1KFKA 1JQVA 4X61A 4Q8TA 3WQEA 2GVGA 2WJDA 5FSEC 1W17A 5FEWA 3B4YA 3ONBA 3QRHA 3W85A 3H6OA 1W1IE 2E0PA 4I9JA 3AS1A 1UOZA 3W1TA 1XLGA 3P5ZA 3M7SA 5DXXA 3N6QA 2VEGA 3KP1A 4D6FA 4CQDA 1ELSA 1RY0A 1V6WA 1MDRA 4NRSA 4ERIA 4BS0A 3FJLA 3ARYA 3UU0A 3ELFA 3R2GA 3W1LA 4UNIA 4Z1CA 4GPNA 5HULA 3KEHA 3C3UA 4IMCA 3BOLA 3TYAA 3PR2A 3B8VA 2OWWA 2ZA1A 6TIMA 3BSHA 2GVLA 4BQ5A 1YRRA 2NX9A 1E4IA 1BXCA 1NDYA 1MMFA 3UWUA 3R12A 3PG8A 3T9PA 4EE9A 3C2VA 2C0HA 2HXUA 4QG9A 3EEZA 2E1DA 1XHGA 4J3VA 3T07A 3BCFA 3K1GA 1PYMA 3O0KA 3TQKA 5FA5A 3B4UA 5EU9A 4UOQA 1V3JA 3BGJA 1E9ZB 4LNCA 3I68A 3UR7A 4EF8A 1CECA 3WDHA 1XYLA 4BKNA 3QOKA 3L21A 3W6LA 4LUSA 3PNUA 2VUNA 3UERA 3A9BA 3GU2A 4MKNA 2OZ8A 3CMGA 3SW6A 2HMCA 2CLEA 3LHYA 1BYBA 2DUAA 3GWQA 2E40A 7TAAA 3W1QA 4EACA 3TFXA 1UP0A 4AD0A 4DVOA 3C2EA 3L4YA 3N9RA 3VX0A 4JQAA 2X42A 3B06A 4P8VA 2RJHA 3N9SA 3BW2A 1DWHM 4JAWA 3CAKA 1VB9A 3ZR6A 2PDUA 3P0WA 2YFOA 1LOQA 3WQVA 5FF7A 1MXGA 3PTMA 4PODA 1ZRQA 5GQBA 4C6IA 3AJ7A 5LNVA 4IQDA 3M0IA 1NQ6A 1TWIA 1J8VA 2WO5A 3MJYA 2J9XA 1H09A 1PHQA 4E0CA 2E4TA 1PIIA 1PPIA 3GNDA 3T09A 1MWOA 4PRTA 3VDAA 1WZLA 1BQGA 1VIZA 4UMBA 2DU2A 3NQ7A 1EJ7L 3CQKA 3WJZA 3SGUA 3VA8A 1WUFA 3WDIA 2BOGX 1US0A 3ANUA 3NPVA 4S3CA 1TVNA 1UWAA 1JL8A 1XG3A 3S9ZA 3BAYA 2D0GA 1DE6A 5K9XA 1YXYA 1GG1A 3W7GA 4JEQA 4FS9A 1TPVA 4F79A 3QGKC 3BQ6A 5DQPA 4GCAA 2Y5EA 3C86A 4QISA 1GUVA 3ARUA 4PMVA 1XH0A 4H7VA 3LA4A 4RPQA 1H7RA 1K7EA 2PDIA 2WJEA 8XIAA 4HK7A 3A5FA 3UG3A 8A3HA 1KLZA 5AYXA 1JXJA 4Z1AA 4RKAA 3T2PA 3ZWSA 5TNVA 1CIUA 2GJXA 4EPEC 1X96A 2Y7DA 4QLLA 5H8PA 4HU0A 1E4NA 2Q8XA 5IXEA 1TPDA 3QR3A 4R5EA 4EAYA 3WLIA 1S2AA 3RHGA 3UJEA 1CW2A 4J2PA 4JTTA 2NVAA 4H6KA 3LMZA 2VGFA 3RLVA 4N6EA 5HR6A 1QPKA 4JKLA 5H8UA 3WEMA 1K4GA 3TXVA 2Y62A 3NIYA 2E6AA 4INFA 2AQWA 3DHDA 3PF3A 1UD3A 2E5DA 3GC4A 1SO5A 1TCMA 3O05A 3WELA 1TA3A 3RM8A 1WXYA 5BU6A 5F4SA 2DW7A 3QPZA 3WZ0E 2O9OA 3S2CA 4C6NA 4JTRA 5CPQA 2PDJA 3T4CA 2OT0A 1NELA 1XCWA 4PMUA 1UQZA 4AZ7A 1VPXA 2OOGA 3NUKA 5T9BG 4HJWA 4R85A 1SZEA 3CZEA 2WCSA 4LPCA 1JGMA 2BXVA 3OVPA 4Q4OA 1SFLA 2ISWA 2YDRA 3DX5A 3GLCA 4L6HA 1BPLB 1MUMA 4MZ8A 1T99A 4GQQA 1W5NA 2NXIA 1H4PA 5LGXA 3DFTA 2EPLX 1EYWA 3WDQA 1LORA 5KMYA 1I1WA 3LV5A 1VGAA 2FDMA 3DYPA 4HYWA 3H2EA 2Y1HA 2VEMA 4NJHA 2XIIA 2P5NA 2XINA 1S46A 4MOZA 3V5OA 3F2DA 3E49A 2FTYA 5JVLA 1DQUA 3CWHA 1V5XA 4WEVX 4D8LA 2XFRA 3NOYA 5HNRA 4H2CA 1QI3A 4UWMA 4A4AA 4UTKA 3STEA 3STGA 5A6BD 3NPWA 4K8EA 1CXHA 1VFUA 1G1YA 2R1LA 3C0SA 1MEWA 5AHFA 2Z25A 3CV6A 1LTDA 4HZ8A 4PL1A 2OWCA 2PGWA 2RFGA 4ZGYA 4HGXA 1GYLA 4AZBA 3EWBX 4UTLA 4HMEA 3VCCA 1A49A 5BU9A 4ZB0A 3NO3A 2NV9A 2Y0FA 1VYRA 4JTSA 2LLEA 1YDVA 3N73A 1RJPA 4GYJA 4JS3A 4UNKA 4HPJA 1ZY9A 4Q4QA 3I6EA 3TYUA 5AECA 5D9OA 3A23A 1J5TA 3V5CA 2PWHA 1GKRA 3SN0A 1VRDA 3E2QA 3M0ZA 3GDKA 1G4TA 1KTBA 4B5VA 3UCCA 3E0LA 1ITCA 1MRQA 2YCJA 3B9AA 3EMZA 3OVGA 3W7HA 4JTUA 2XSXA 4LUJA 3IIVA 4G1KA 1J4EA 5H91A 4AHPA 3BARA 1GTEA 5G2WA 3W2KA 4HNUA 1E0WA 3GHSA 5DFAA 4J28A 3S2LA 4DUXA 3R7MA 1FUYA 1CYGA 1XF0A 3AHZA 1Q6LA 3U5UA 2X8RA 3WBYA 3UEQA 1TVLA 4DYKA 4LAMA 1GZJA 1HG3A 1QNRA 3VAVA 2BY0A 2OTDA 2GDQA 3CNYA 3A6OA 3ZT5A 4UCFA 1IIHA 2QMJA 3N17A 2GQAA 2GUBA 5I6SA 3WK1A 4YU1A 4AC1X 4O53A 1SW3A 3N3TA 4O14A 2WXDM 4IQEA 4QTGA 3JZEA 5JMUA 1W9VA 2I7GA 1UZHA 4ZCWA 4XD3A 2WAGA 2PU1A 1TE6A 4WR3A 1UJPA 1HJXA 3S1XA 3HJEA 3ABZA 5FJUA 4S3FA 3R0KA 3WQCA 2TPSA 4UTIA 3SGGA 4Q22A 3W1XA 2F9RA 4QRNA 5MKGA 1GQJA 1YBQA 3OBKA 3A24A 3KDNA 4CGTA 5A8GA 2W5FA 2ON3A 4N9BA 4HU3A 4H6RA 2ZXQA 2I56A 4GABA 3AALA 1Q45A 5D33A 4EWJA 5A8MA 3Q2DA 4TU1A 3OA3A 1Z89A 4DQWA 1C29A 4K7VA 4A8IA 4WKAA 2CXGA 2J88A 3USZA 5JXQA 2QCEA 1JGIA 1W3IA 1BGAA 4AZGA 7XIMA 1FRBA 3N12A 1QUMA 4LAKA 2GVEA 1NDVA 1K8CA 1QO2A 1MQRA 1QJWA 2FPTA 3GS6A 3T1GA 4UOZA 4GVFA 3L0NA 3KZPA 2ACQA 4LRTA 3PJTA 4UTTC 4W87A 3MC5A 4HIBA 3RJYA 3S6TA 4IPPA 3LI1A 4I8DA 4D6EA 3ID7A 3WQ4A 3RO6A 1B9ZA 4AZCB 3A3WA 1FWEC 4XBJA 3V7PA 2NT0A 1Q6EA 1D7FA 2Z27A 4HKPA 2DT2A 2G8ZA 4DB7A 2OYKA 1SZGA 1E1EA 4P7RA 1TREA 1W3HA 2I5GA 1BRLB 5CKSA 2XFWA 1OF8A 1W1TA 1M3UA 4WCJA 1QWGA 4NKCA 4J27A 1C8YA 1F3TA 4UIOA 4R7OA 1DHPA 1QHOA 5GPRA 5FL1A 4C1NA 1YW1A 4LU0A 1QPRA 2FZBA 1EB3A 2GQ9A 4FLRA 1HVXA 1XLKA 4HNOA 4DXXA 1NFPA 4B3LA 2XFYA 1JCJA 5K3VA 4IH3A 5F2MA 5I24A 3CL7A 3W72A 2WNZA 1Y5VA 2C8NA 5FJPA 4AHOA 3DHUA 3W01A 1P43A 1KXVA 4LW7A 5BW6A 4IL0A 1C90A 3VMPA 1PO9A 4HT3A 1DTUA 1R5YA 1E71M 2Q3RA 3VINA 3VZZA 1LF1A 4DBUA 3MSDA 4HOZA 2QCDA 5AC7A 3FGCB 4ONVA 1C9WA 4UR7A 3VIPA 3HIJA 1E15A 3TYCA 2PSNA 1PAMA 3FOKA 4LCQA 3N3MA 1EO7A 4MNJA 3GD6A 4ZO6A 5FCZA 2E28A 4BEUA 1P0KA 3O6DA 4QITA 1UH2A 1E0UA 3AIEA 5EMJA 3EA3A 5FJJA 1P4CA 1I2NA 3FXYA 4C6MA 2V3GA 2YCEA 5KZMA 2P76A 1H7OA 4NYUA 1ZFJA 2PLKA 5CGQA 2OT1A 4TR9A 3DYOA 2WLYA 4ERGA 5D37A 3G3MA 3RJXA 4WKHA 4XZLX 4DJDA 4DUWA 1W1B1 3MP3A 3PVFA 2C18A 3QOMA 1LQAA 4B2DD 1AG1O 3EX6A 4Q32A 4LUTB 4EPKA 1PCKA 4N7QA 4H04A 3CUZA 1EXPA 2HZGA 3N14A 4YCPA 3W7PA 3TSBA 3GO2A 1HXJA 1GHRA 2E7FA 2IPWA 4Q6JA 1GCYA 3H4WA 3UA3A 3I7RA 4BK9A 4KFOA 2P8BA 4W5UA 3BG3A 1RUSA 5EA9A 4IL2A 5TF0A 2X0HA 1AQFA 2Y70A 4CQ8A 3WLHA 1TX2A 3KX6A 3PSVA 2G4FA 5LYRA 4IMGA 1Q66A 1E5JA 4D6CA 4PH6A 2CKRA 3NTYA 4BR1A 3WQPA 1PYFA 3W2UA 1RBLA 3SRKA 1E6SM 2WSQA 1UMLA 7TIMA 4IMAA 3WNKA 3VNLA 2YDSA 1W1ZA 3GDMA 4PR4A 1TJ2A 1HKVA 1VS1A 4IX0A 1O1ZA 1AQHA 2ZFAA 1O94A 1VF8A 3AHVA 4DY1A 2NZLA 2RGMA 4RK8A 4C6JA 3G24A 4J7RA 2HVMA 4RNFA 2OFJA 3S0CA 4PUNA 3IPWA 3VIOA 2ZDRA 1VFTA 1SFJA 1JQXA 2H90A 4KIRA 4BQ2A 3BLEA 1MXDA 3ABSA 3QY7A 4WVXA 1N7KA 3QKZA 1UA3A 4DZHA 1BWKA 2WMGA 3V16A 1JD7A 1I0BA 2P53A 3W88A 5C2GA 5M17A 1DIDA 1E6PA 4FX6M 1XLDA 1E4MM 3AHXA 1RPKA 1UASA 2OKTA 5D30A 4ZSTA 4CLMA 1S39A 1XIEA 5FSDC 4L9ZA 3AQUA 4HHPA 3PANA 3VOCA 1SO3A 4JNMA 3CASA 3O63A 4LB4A 3SUVA 5AB3A 3HQ1A 3DFSA 3HMJG 1XQKA 3OP2A 1WBJA 2REQB 3OTRA 2YCLB 2C0AA 2PP1A 1VJSA 4MWAB 4M1RA 4R7WA 2D24A 2ZICA 4I7WA 2MNRA 3SIZA 3GG8A 4P7OA 3LNPA 1HO1A 4F48A 2YBUA 1AH3A 3B8SA 2WMFA 3POHA 1VCFA 3P8JA 1LG2A 2BASA 2FLIA 2GOKA 1I0DA 1GKPA 3MSYA 1L8PA 1HF6A 4EP8C 2D3NA 4S3BA 1BTMA 1VYPX 2BOEX 2WV8A 4HA0A 4GVHA 2W92A 1THFD 2BVDA 1W3KA 1XRFA 3KOYA 1UD5A 4JTGA 4GUJA 3RCMA 5C2XA 2WJZA 5ECUA 4GI4A 5J04A 1UYQA 3NL3A 2A6LA 2YJQA 4XISA 1FHLA 2QDHA 1VBHA 3W7KA 3BE7A 2QCNA 1JJKA 1KFCA 2B7OA 2ALDA 1XYFA 5FACA 4V1XA 1IZCA 4KWWA 3C8FA 4G6CA 2QYGA 1F07A 1S2VA 3KW3A 2PTWA 5CSYA 3F4NA 2CZFA 3RAOA 1DXEA 3E38A 3IUIA 4JY9A 2BOFX 1CXFA 4EF9A 4PEEA 3ZOAA 3P81A 1UD6A 4PUWA 4EWND 5CC7A 3FK4A 1PVNA 1XL9A 2XH7A 3HV8A 1K1DA 1VP5A 4GO9A 3N2XA 3OZMA 3WQOA 1MQQA 2CHOA 4IISA 1X7FA 1E1CA 2GOUA 4H1ZA 2OSYA 3OQ8A 3HGJA 3MI3A 3L2MA 3CL6A 3PY2A 1UB3A 1OADA 4K3ZA 2DIEA 5G1MA 3BUVA 1JPDX 1OF6A 4WUIA 3VPLA 5EMYA 2XJ7A 5FI8A 2F6KA 3L2IA 4DO5A 4K37A 5FL0A 3WF1A 3JS3A 3JZUA 4POCA 3ZLGA 1PZ0A 1KA9F 3RYSA 4Q7BA 3SDOA 4QHRA 3ITTA 1L6WA 2Y88A 4YTQA 1H41A 3ES8A 3U7BA 3H54A 4HTBA 1J0ZA 3PZTA 3LGGA 4IP7A 4JICA 1AA1B 1XIGA 3OZYA 4JL1A 2CLIA 5CPNA 4GUFA 3A22A 4UZSA 2PC4A 2VNCA 1XIMA 1FWAC 3W0KA 3P67A 4CVWA 4XSLA 4M29A 4PZVA 3VKCA 1XIJA 4AD1A 4HA4A 4I6VA 4YS1A 1U1JA 3NQ6A 3CO4A 3V36A 4W86A 2RHGA 3HPAA 3FSTA 4CD4A 1RA5A 2XVKA 1GOKA 4H9TA 2O0TA 4JIEA 3NZGA 4AY8A 5HWMA 2ZA2A 3AUJA 3VYLA 1WXZA 3REQA 4Q8UA 5C54A 1M7XA 3ZM8A 4PULA 2BP1A 3CEUA 3GU1A 1EDQA 3NZ1A 3AZTA 4Z08A 3F4WA 4HN8A 2Z7KA 3ZR5A 3W27A 3WNMA 1JAEA 4R53A 2G3IA 3B8IA 3O6YX 4DJDD 4GBDA 4V33A 4ATWA 4MG4A 2W61A 1FWIC 3C0LA 4D8ZA 3M0HA 5GNZA 1PIGA 1WZAA 4B4FA 1S2CA 3NL6A 3WLNA 4C5YA 4FMVA 5GJNA 1E0TA 1OT1A 5H1WA 2PDCA 2YDQA 1JRBA 5XIAA 2QUMA 3G0SA 3H70A 5D05A 1DJHA 2ZZ1A 4MB5A 3LN3A 4CEUC 1V6TA 2JKEA 1EC7A 1ZBVA 1H7XA 4M7TA 4RZ5A 4LAOA 3OGRA 1K4HA 2NLIA 3RNDA 4NJIA 1FQ0A 3NZPA 4LNYA 1C9DA 1Q7QA 4D6IA 4ZMGA 3T8QA 4IGHA 1ZAHA 2QJIA 5U7SA 3W7MA 3D3FA 2NSXA 2JGYA 3G6LA 1GHSA 1WYIA 5HOSA 4JIPA 2WSRA 2NX1A 1OJXA 1RPXA 5FEZA 1TWWA 2HSAA 5E70A 3UCQA 4G2DA 2PTDA 3RR1A 3WBEA 4MLRA 2QV5A 4N6FA 3CBWA 2NQJA 5ABHA 3CUXA 3EWUA 1VEOA 1SMDA 2G3JA 1JZ7A 1QOPA 2UV8G 3QV9A 2CHRA 3UETA 4K1GA 2Y2WA 3S2NA 3K4AA 1E0XA 1V77A 3LPGA 4X9YA 2J66A 1IEVA 4DZ5A 2VGIA 4EXBA 3NQ2A 4QAIA 4L9XA 3IGUA 1US3A 1T0OA 2G37A 3O15A 2B7PA 1VPQA 2GWNA 2BGQA 3NO5A 3VDCA 1AVAA 2FZ9A 3NEHA 1YX1A 1BLIA 4ZQNA 3IVUA 4GZEA 2D2JA 4JQ2A 1KO0A 3O2LA 4K8GA 3AXHA 3GU9A 4ZENA 3V35A 1C8XA 3BSMA 3GB6A 3RLHA 4IIEA 5CJ5A 1DWGM 1KRBC 3Q58A 2PDFA 3M7WA 1O68A 1RD6A 3EX3A 3HB9A 1VKFA 5F4WA 4QAWA 1KFLA 1LYXA 3KRUA 2NUWA 1TR1A 4JN7A 3EX2A 2DVTA 4PUUA 1DHKA 1Q4WA 2DT1A 3F5LA 1CGXA 4JX6A 3CMJA 4QDPA 3VD5A 3NQBA 4Q3MA 1J01A 3TSMA 1FWGC 2PDBA 4ZQOA 5ABFA 4N2YA 3GBDA 2I17A 2CW6A 3CH9A 4NJJA 4KESA 5CPLA 2DZVA 5HQLA 1TZ9A 4X22A 1Q65A 3AHYA 2AGKA 4XZMX 4K39A 2PLCA 2GUYA 5CC6A 3TNBA 3H2CA 5EGRA 2Z1SA 4F66A 2PRHA 4UTUA 3HM7A 3FY1A 5I3GA 2ZUVA 1GW9A 5FD0A 2ZZ4A 5LIXX 4URIA 2VFEA 2XM2A 1S5WA 5RUBA 1IV8A 1ODZA 3Q37A 3DFYA 5AHNA 2QS8A 1YEYA 1GORA 4WGXA 3DG3A 3W1MA 1A5SA 3PUGA 2ALRA 3DUGA 3THAA 4O18A 3WNPA 5AOUA 3SAZA 1KBJA 4JOMA 4HA3A 4J3XA 1KRMA 2FFIA 2GK1A 2DH3A 3RRAA 4FX8A 1JUEA 3EZ4A 2J7BA 3F4DA 1YXCA 3GDTA 3PSWA 4S3KA 1K8XA 4IJBA 5ENLA 4DAIA 3VX1A 5G4HC 1EP3A 5DT7A 3GNPA 5I02A 2CLPA 1EO5A 3EKGA 3AYTA 3STCA 3B0YA 1HP4A 5BXSA 4YMZA 2ACRA 2B0MA 5CPOA 1KC7A 1I1XA 1TV7A 4Q8QA 3N2TA 2CC0A 4V28A 3EDEA 4IMFA 4XKMA 4CCDA 1Q4NX 4Q8NA 1JNDA 3OLEA 5FAGA 3PB2A 1CB7B 3M0KA 2Z1WA 4M6PA 8RUCA 3MZNA 3GG1A 3W7IA 1D8CA 1QCWA 3DXIA 3GY1A 2CWXA 3W82A 2VC5A 1DTNA 4DXVA 1V0KA 3DOPA 3ONCA 1P0BA 4X0VA 1RAKA 5HNTA 2O9PA 3K1DA 3DC8A 2Y8KA 1MW1A 1ISYA 1TVPA 4WGHA 4JTCA 3WQWA 1VFHA 4JBRA 3TROA 2BVWA 4X9SA 3P61A 4I90A 4ALDA 3CIXA 1I2RA 1PTDA 5L6UA 4DEFA 3RILA 1J93A 3EWYA 2WHMA 1XH2A 3LCLA 2ZUSA 2DQXA 2XTKA 2VZTA 4QS5A 5D2XA 2Y5JA 3SCRA 2ZA3A 3W73A 2J8TA 1FP9A 3TZFA 4ZFMA 3THDA 1VD6A 1M1BA 5F1VA 1A5NC 4Y90A 1JI2A 3USBA 4IUOA 2WLZA 1EWEA 5K4XA 2PCQA 1XI3A 1R2SA 3CMFA 1AJ2A 3DDMA 3MJMA 4GY0A 3U8GA 3H7VA 4YYCA 3NQCA 1LT8A 1QT1A 2J8FA 1ZNNA 3VGGA 2YL9A 2VWTA 2INEA 7CGTA 2ZRYA 3E2RA 1E3ZA 2W63A 5CPSA 3YPIA 1P0DA 4M0XA 3VMOA 4MSSA 1S1RA 3AMGA 2OR2A 2Z24A 3WX7A 4JGDA 2G50A 4E8GA 1XLJA 3TDFA 2FZDA 1HGYA 2PTYA 5EY5A 3VC5A 2YLLA 3PAJA 3ZLFA 1VENA 2HROA 1I6NA 3THQA 3W71A 3NDOA 1QNQA 5CBIA 2XHYA 3OVQA 3GR8A 1V6YA 3KL0A 4FIRA 3AS2A 5E6ZA 5J8LA 3KTSA 2YW4A 1L6GA 4IFOA 4RV3A 4IIDA 1IT8A 2R14A 4LC8A 2TSYA 1ITXA 2OPJA 4ACYA 2POTA 3N19B 3LCFA 3TMLA 1Y8BA 3OHMB 1GPWA 4EXAA 1VH7A 3WIJA 3L66A 2ZDSA 3AIBA 1SJCA 3GM8A 2Q6ZA 3AOFA 3OIXA 1OVDA 5JU6A 2X1IA 4Y2WA 1M01A 4M5PA 4FALA 3W2NA 5K4ZA 4W7UA 3BWWA 2DSZA 1AUSL 1VLWA 3V1HA 3NQEA 3TEVA 2GGJA 4GXMA 3WH7A 3NSXA 2CETA 2YXGA 2YL6A 1LWIA 1QW9A 4KCUA 3ABXA 5KEZA 2GGGA 5C7HA 1FA2A 2YKKA 5CZKA 5JBEA 5D03A 3UG5A 2GJXB 3FFSA 4H3DA 2ISSA 2WZIA 1FVPA 4RUBA 2WOQA 4WHBA 2J79A 1L6FA 1FHDA 2XM1A 3DG6A 1R2TA 3B9OA 1J2BA 3F5KA 3GIQA 3WMBA 1C91A 1XKJA 3P62A 1PUDA 2WVVB 5I3HA 1A50A 4L4LA 1J10A 4IPLA 4P5UA 1JYXA 1DIEA 1O12A 2BV9A 3E0IA 3LHVA 2HE8A 5FIPA 4LFYA 3RMJA 4L4PA 3EPOA 3A3HA 2PURA 2OQLA 1VYSX 4C7FA 1E6NA 3BOXA 4QGCA 4K68A 1KM0A 3M44A 1XCFA 3BLFA 4XAGA 4YWIA 1OM0A 1RQEA 4Y8EA 3W1PA 1H5YA 3LM7A 3NQDA 1JULA 3DENA 4DJED 3EDJA 1XINA 2YZRA 3H12A 4PMDA 4K1WA 4DYJA 3LSCA 2W9MA 1W3NA 3GXPA 5A6TC 4KEMA 1M41A 3CK5A 3QPYA 3UZXA 1CDGA 3VKDA 1UWQA 2PDYA 4PE8A 3AIQA 5FAJA 4NP7A 3FSUA 4D8AA 2FMOA 1LDCA 1OCBA 2Z2BA 4TOQA 4F8XA 3UY7A 6TAAA 3W02A 2R1MA 3A21A 3MVIA 3VIGA 4ERAA 3LHUA 4LBUA 4F0RA 1TPWA 4R9XA 3IJLA 4DHGA 1DWAM 3TWAA 1M9HA 2A3CA 3GYEA 3QLDA 1ML1A 3LK6A 3W53A 3ZQ9A 3SCPA 1G4EA 6XIAA 4A05A 1POKA 4JCMA 1H0IA 4JZ5A 3UZZA 3BVJA 2CLOA 2XU2A 2GSEA 4UTMA 4IWWA 3DAQA 2IUZA 1F6YA 1Q7ZA 3R11A 3P2VA 1DPMA 4DI9A 5IFTA 3K4DA 2QCFA 3UP8A 1KR0A 2RUSA 1VJZA 3M6YA 9RUBA 1P5BA 4ICCX 2YL8A 1BWLA 2ZE0A 4PB3A 1QAPA 1JPMA 1PX3A 2VO5A 3GSMA 4F0SA 5A6LA 1HL8A 1OBAA 4I8YA 5A2CA 1GVEA 1OABA 1RALA 2EXOA 4FIQA 2NUYA 2HPIA 3UGRA 4AVNA 3I6RA 2DIJA 4DBSA 3IGXA 4BF9A 5CEWA 1HX0A 3SRHA 2TODA 3DFHA 2NVCA 1OG6A 3CZKA 1KRAC 3MHUA 1ZQ5A 4DX3A 1MUWA 2J74A 1OYAA 2DORA 4TVUA 4HK5A 5DEZA 4GHRA 1E9IA 1EXBA 4FI4A 1G7VA 2X30A 1EGVA 5E9AA 5HUOA 1V8EA 4LANA 3PTDA 1A0EA 2IQ0A 4S3JA 3CPGA 4XUGA 2X41A 4KGLA 5AYYA 3TCEA 3N1AA 2QDDA 4ML4A 4G5DA 4JIRA 4NASA 5CJMA 2EQDA 1JDCA 3NSNA 4RZ4A 1MI3A 5IBXA 2Y5SA 3R1ZA 4A8RA 4PBFA 4QX4A 3TAKA 2Q8LA 2FHCA 4XAZA 2RJGA 3MZ2A 1PKMA 4AZ6A 1X8FA 3TYEA 1XYCA 2G4JA 1PX4A 4C60A 3O07A 3R79A 2YGYA 3ZVHA 1XICA 1MQPA 2V30A 2R82A 3H53A 4A2SA 3VVGA 1KLYA 1G5AA 1XBZA 3FYYA 1XLMA 1MW2A 4K36A 4ASTA 5LNWA 1T8XA 4DM1A 4TIMA 5GNXA 5A2AA 4A21A 3P7YA 1YBQB 3VABA 4O1BA 2GGEA 3UJRA 1BHGA 4AG0A 3UR8A 4Q4RA 2DZXA 4DO4A 3B9EA 5I3FA 2ZRUA 3CLMA 3DGRA 2PFHA 4WD0A 1C7TA 4L6OA 3HG2A 5I09A 3I7SA 4GX9A 4XZIA 3TAOA 5EBAA 3Q94A 5HDRA 3QZAA 4U31A 2AMXA 2YPIA 3CEPA 3O7UA 4B16A 4L64A 2PUZA 3GXIA 3T08A 1YDOA 2OX1A 4DUOA 4K7YA 1FHVA 4ZR8A 3TW6A 3W7OA 4DPPA 2IPFA 4DWDA 3N4AA 1M7OA 3URNA 3EEGA 2PGRA 1RLCL 3GNNA 4PGLA 1UUMA 3EOUA 2X09A 1ECEA 3UD6A 4TMCA 3QC3A 4DNHA 3F5JA 1OD0A 1YQ2A 3TUUA 1KQYA 5D2TA 3OJGA 3DFOA 3KOZA 1M03A