3S83A

Eal domain of phosphodiesterase pdea
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
256
Chain Sequence
LALEADLRGAIGRGEITPYFQPIVRLSTGALSGFEALARWIHPRRGMLPPDEFLPLIEEMGLMSELGAHMMHAAAQQLSTWRAAHPAMGNLTVSVNLSTGEIDRPGLVADVAETLRVNRLPRGALKLEVTESDIMRDPERAAVILKTLRDAGAGLALDDFFSSLSYLTRLPFDTLKIDRYFVRTMGNNAGSAKIVRSVVKLGQDLDLEVVAEGVENAEMAHALQSLGCDYGQGFGYAPALSPQEAEVYLNEAYVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GGDEF family protein
publication title Crystal structure of EAL domain from Caulobacter crescentus CB15
rcsb
source organism Caulobacter crescentus
molecule tags Signaling protein
total genus 87
structure length 256
sequence length 259
ec nomenclature
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3s83A00
3TLQA 4HU3A 4LYKA 5M1TA 4F48A 3GFZA 2BASA 3PJXA 4F3HA 4AFYA 3GFYA 3SY8A 4KIEA 3N3TA 4LJ3A 5MKGA 4J40A 4RNIA 3PJTA 4Q6JA 4RNHA 4FOUA 4FOJA 4Y9OA 4HJFA 3GG0A 3GG1A 4RNFA 3PJWA 3S83A 2R6OA 4Y9MA 4Y8EA 4AG0A 3HV9A 3U2EA 3GFXA 3PJUA 2W27A 4Y9NA 4ES4A 4RNJA 3KZPA 3HV8A 3PFMA 5MKGB 4HU4A 4FOKA 4Y9PA 5MF5A
chains in the Genus database with same CATH superfamily
1S1RA 5D33A 5M1TA 2BDQA 1QI0A 3ITGA 1I0DA 2GVYA 1OG6A 1NF7A 1C9WA 1FKXA 4JFUA 3H2EA 3UBPC 3B0VC 3KL5A 4H8UA 2E68A 5D9OA 4W9TA 1OFEA 3RLGA 1R86A 3UG4A 2J7CA 2YL6A 1HKJA 4NXKA 2A5HA 3WNPA 1T40A 1ITXA 1WPCA 3I3BA 4CD5A 1TKKA 1Q6RA 3RMEA 2GVEA 4E4FA 2BMBA 1IXNA 2WHMA 2R1KA 4ENLA 4Q32A 2TPSA 3BG9A 3UZYA 4JICA 1EJ7L 2DQXA 3CWHA 2V5JA 4CD6A 2X7VA 2W61A 3ITLA 5CC7A 1UWAA 1RJPA 1HX0A 4O0QA 1V79A 3ZJKA 3RRXA 5IHSA 1AJ0A 1XKYA 3NZRA 2YZRA 2G3MA 3H4GA 1RJRA 3WFZA 3WCZA 3LCFA 1G94A 4PMJA 2Y63A 3OTRA 1O5KA 3S46A 5BMWA 3FGCB 4AMCA 3F03K 4M7SA 1ISYA 4XAYA 4GQ0A 2OSWA 3H6OA 4MWAA 7CGTA 1R3YA 1OBAA 3TJXA 2WZEA 5FJOA 3T9PA 4C6QA 4UIOA 4OUIA 4C6JA 5JVLA 4QNEA 1XCWA 2OXNA 4DO5A 3UA3A 1DBTA 3R1ZA 2PPGA 4GX9A 3BW3A 3LNMA 3PAOA 2E6FA 3PY2A 1H62A 4FIRA 4M29A 3K8KA 2XVNA 5LNSA 3ARWA 3SFWA 2QHAA 2D3NA 2FHCA 3PBUA 1NVMA 1UKTA 4WQ6A 2NXIA 5D2VA 3P2VA 1XIIA 2VUNA 2VHLA 1ISVA 2O7SA 3SO7A 5HMEA 1L2QA 3VI2A 3EXRA 1H1YA 3OGRA 4YWSA 3W7NA 3KRUA 4W93A 4UTUA 2XN1A 1RCQA 3SSJA 1K8CA 1F4HA 4OHQA 5HOSA 4H9VA 3M41A 1NQ6A 4REQB 4M6VA 3CTTA 3QTGA 2DVXA 1JJKA 1GVFA 2PDUA 2NQJA 3SGGA 2OQHA 4Q7BA 2PRLA 3GHRA 4FNTA 3THQA 2XFFA 1VKFA 1PE1A 4C1NB 3LD5A 3VNKA 2VFIA 3CUZA 3NQ8A 1Z42A 2BGNE 1A49A 3BPWA 3ONCA 4GBDA 4GH1A 5FL0A 4GNVA 3NM3A 2ZZ3A 4NZCA 4GNKB 3V0TA 1HJQA 4UOZA 5G1TA 3TX9A 2XN2A 2XG9A 1D3GA 4WJ8A 1EIBA 2Q8ZA 3WQ4A 3KZPA 1MNZA 5C2XA 3T55A 3T0DA 1GGOA 3AXHA 4DLFA 2IS7A 1A4LA 3SQSA 3OG2A 2C71A 3GWQA 3BO9A 1KBIA 1U5HA 4FI4A 1IR2A 3F4DA 2FZNA 1GJWA 2JIWA 1ISZA 2WNWA 4HGXA 4AB4A 1EF2A 1X7FA 4G6CA 1LT7A 2ZZ1A 3LRLA 1WKYA 2DJXA 3EKLA 3E02A 1B31A 3LXBA 2FH8A 5PTDA 2BP1A 4RKAA 1Q6GA 4NAFA 3WDPP 4O17A 3B03A 4YVXA 3UZXA 4ZQRA 3N9SA 1GQKA 1F6PA 4XWUA 2X1TA 3WK1A 3RF9A 4RXGA 1OINA 3GNDA 3S5ZA 1FDJA 1D9EA 3M7WA 1W9PA 1C91A 4NG3A 5TF0A 1QNOA 4YN5A 3RCNA 5C5YA 4MHBA 4MKSA 1JVNA 2EAWA 3CIWA 4HOXA 3BQ6A 4I7UA 3Q2DA 3ABXA 2VUYA 3PZOA 1TPVA 1P4CA 4RL3A 3I6RA 4IJCA 3W22A 4OE7A 1L8PA 3FAWA 1UH4A 1V3LA 3FN9A 5M03A 4GFSA 3W24A 2R94A 1P6CA 4AC7C 4TV6A 5FI8A 4PMDA 5DMYA 3SY1A 2J27A 2PI6A 2F2HA 1XC4A 4P7LA 2GQ8A 2QJMA 7ODCA 3ANUA 1EX1A 3BICA 1NJJA 1TELA 5GVJA 8CGTA 5FA5A 4GUGA 1C29A 5AHNA 1KM6A 2I5GA 5C9RA 4K7YA 2ISVA 3THDA 4A22A 1W5PA 3PUOA 4ZFMA 2POZA 4AWUA 4R88A 1FWJC 1QNPA 1YADA 3DZ1A 1NDYA 5M17A 1ZTVA 4XAPA 3U5YA 3AI0A 4S39A 3WQEA 4UTWA 5CPQA 2EGZA 4JYDA 2BY0A 1NDWA 2PURA 2WHLA 4HMCA 1IEQA 2NLIA 4YWIA 2P1FA 3PZMA 2B7NA 1KO0A 3CL6A 3QHNA 3OYZA 3JZUA 1A5AA 1LWHA 3H54A 1Y65A 1J0KA 1WZKA 1XYBA 1UJPA 3EEGA 2HSAA 1JCNA 1RA0A 3P5YA 1SJBA 1VFMA 2VQUA 1C9DA 5DY3A 3DG3A 4J3ZA 1CB7B 4CNOA 4L7ZA 4NUWA 3U2ZA 4B90A 4GIEA 4O4VA 3N14A 1ZGDA 3PJUA 4ZENA 3WMSA 1LRNA 3K2GA 3PVFA 3R0DA 3VUPA 1FUYA 3COTA 2AKZA 3GHSA 3MUIA 3AC0A 1S2TA 3NQBA 1UD5A 4Q7IA 3RCYA 2A0NA 3LCLA 1LLWA 4MAVA 3UGVA 1OCQA 1GVYA 4KEVA 4FP1A 3W6YA 1EA9C 1TYGA 3UZZA 1EJWC 1H1ZA 5AHFA 3TKFA 2HJPA 3G3MA 1TPC1 2ZC1A 1VLWA 1R7OA 4IMCA 1UBPC 2V0TA 4E4PA 4S3FA 2WSKA 3TN6A 4AAJA 4U5KA 1RPXA 3A23A 2IQ0A 3SRKA 1N8WA 3UT0A 1V02A 4PB4A 1W1TA 3CK5A 4NQ1A 1J2BA 3U2EA 3CJPA 5LA0A 4IJRA 2YDRA 4DZ5A 2Z4GA 3MY9A 4AD3A 4F0SA 3GW0A 3GW3A 3PSWA 3OVRA 3CHVA 5E6YA 3GUWA 2NVAA 3A12A 4G2DA 2D2OA 3BV4A 1XLKA 1XSKA 2CLOA 3DC0A 3LN3A 4MF4A 1E4LA 3CUIA 1XRSA 3TDFA 1FCQA 2BWGA 3W4RA 3PZTA 2OGYA 3LNPA 5A6BA 5C54A 2EG6A 4FEZA 4WGXA 1UOZA 3OVGA 4IXXA 4IICA 4K68A 4IQLA 3GG1A 3OZMA 3BL3A 3WG6A 1R2TA 3GB6A 4I9MA 2XFRA 1S5MA 3CM4A 2B0MA 2Z1WA 4UTHA 1P7TA 3VMPA 1QDSA 2VC6A 3WN6A 2O7QA 1IQ8A 2YB4A 1JULA 5CAHA 2DZPA 2DT2A 1G69A 3CH0A 1L6YA 1CEOA 4C6CA 3GDKA 1E70M 4MJMA 3S6OA 2EJAA 3M0YA 5FCZA 4LS1A 1MEIA 3IUIA 4TVDA 3QGVA 1ZFJA 3LK6A 1W56A 4H41A 2I57A 3BLFA 2OYMA 1QK0A 4L61A 1AQ0A 4ZOBA 1XYLA 1S2UA 3C8FA 5CZJA 4QROA 3TMQA 3QQ1A 5HK4A 5I09A 3P93A 3RPMA 3BZJA 2VYOA 1O5RA 3BAWA 3FHQA 1H61A 1P0BA 2CLKA 1S5TA 5JIWA 1ITCA 4O0ZA 3PPGA 3C52A 5JXQA 1Y5XA 5I3GA 4NAFB 2IKIA 4UC5A 3W2KA 3MI3A 3WD4A 1F4AA 2QUTA 1AD1A 1XH1A 3VNYA 3OZYA 4YHEA 3VC6A 2VMFA 2JFEX 2J79A 4IG2A 5AC4A 2WNNA 4HPHA 1S2WA 4BI5A 4D6EA 2QIIA 3ARZA 3PWIA 1VLIA 3TFXA 4ZR8A 3UR5A 1NM9A 1E3ZA 4M19A 4IQJA 2ZUWA 4O19A 2MNRA 3CQKA 5FSEC 1IZKA 2PU1A 4JX4A 4ECLA 3WH9A 2P76A 3V5FA 1VP5A 1MI3A 1JUBA 5AYIA 1T7LA 3HM7A 1VQTA 2WHKA 4AX6A 3GY1A 3W29A 3LHYA 4WHBA 4IWWA 3CBWA 2NWRA 3ZQ9A 1OVDA 2OZ3A 4O0KA 3PG9A 1Z32X 2QDGA 1Y8BA 3FJ4A 3IJLA 4G5DA 4NASA 4NAEA 4U2ZA 1AG1O 3A47A 4O1FA 1R38A 3Q37A 4Z2KA 2IKJA 1VC4A 1SO6A 3CPRA 3EWYA 1NWSA 2VFEA 1WNOA 4PMVA 3W26A 2OYLA 1A50A 3HQ1A 3A3WA 1W1PA 1TPUA 3WNOA 3MHGA 2VR4A 4HYWA 4HN4A 4IGNA 1QFEA 2G3JA 5BU9A 1KCXA 3QLDA 4LYPA 1EOMA 2E09A 4N9CA 2DH2A 2PEVA 5E9AA 5F1VA 5F7UA 4L6HA 3HPFA 4AZHA 4S3KA 4DJEA 4ICMA 2B31A 1X39A 4PN2A 1ODUA 4GZJA 3L0NA 3AHVA 4I6VA 4AEFA 2BSLA 3QOKA 3W83A 4KCWA 3R8GA 3TJLA 2GGEA 3NXFA 4I7WA 4AMAA 3NGFA 4EPEC 4ZSTA 3ARSA 2C3ZA 1Q4NX 2Y4SA 4A05A 4ICCX 3N19B 1HVXA 3FNDA 3QH2A 2ZWYA 4DI9A 4DZHA 1QAPA 1V7YA 1Z69A 3UY8A 5LYRA 5HDRA 1KFKA 1R2RA 3SR7A 4J3WA 1QR7A 3AIRA 3B4UA 3H23A 1DTNA 2TRSA 1EJVC 4ROQA 4JQAA 4XZHA 1JZ6A 4TTGA 3TYZA 4KS0A 4P8XA 4IOTA 3KVLA 3C56A 3PZNA 1UWIA 1XWYA 1IZCA 2VWTA 4AX7A 3MYPA 1M03A 1MW2A 1UZ4A 3MVTA 1GQIA 1NAL1 1BF2A 3T0TA 5CC6A 3CASA 5FEPA 1BSIA 3WL0A 1GG1A 1TR1A 1UWUA 3PTDA 4PUUA 4O13A 3E38A 5T9CE 1JYWA 1SZFA 3QRHA 2FKPA 2FLIA 2FMNA 1JPDX 5JH1A 1U22A 4JAWA 2QUUA 2CXEA 3QEZA 1X6LA 1YRRA 3GK0A 2C1IA 4JDBA 4JGDA 4QQ3A 5D09A 1YNQA 3VDCA 1KRAC 4E4UA 3ZT7A 3W76A 1ADDA 4M81A 3KCJA 2BHYA 2PTDA 2DUXA 3VCRA 3TTOA 1VBHA 1XC6A 2ZA2A 1YDNA 1DQXA 2ZZ2A 3B9AA 1MSSA 2OWCA 4E2BA 4PMQA 1LBLA 1ADSA 2CBJA 4JNYA 3WLLA 3QHMA 2R8WA 4Q8UA 4J4KA 4NZ4A 4B5XA 4HNCA 4GVHA 1PCKA 1XLMA 3NQ6A 3BCDA 3MV01 4NZ1A 4ACYA 1KTCA 4RNHA 1DKWA 2WWCA 1XINA 3N11A 1DWJM 1Q45A 3PUGA 3ZWSA 2J13A 4QM1A 3MUAA 3OVPA 3WO8A 4O18A 4PMYA 3GIPA 3B0XA 2G95A 4RXFA 4YTSA 2VNCA 2PD5A 3W7HA 4Z2IA 1U83A 3C2YA 1H49A 3KXQA 3KM8A 1FWSA 4FR1A 1P7TB 1CGUA 1GJUA 5AYZA 4BCEA 1DE6A 3F5KA 2PRMA 4PMRA 4AY7A 1U2YA 1GOMA 1QOXA 2HEJA 1EBGA 2WAGA 4M1BA 1A5CA 1UR1A 4RZ6A 4O11A 2G37A 4KCTA 4OUEA 2PSNA 2Y85A 5CZSA 3A4AA 3BSHA 3DECA 2B81A 3CU2A 3NOYA 1CX9A 2C1GA 4RNJA 1SZGA 4JTTA 1RQHA 3R8HA 5KINA 3NO5A 4LBSA 4KBXA 4PTVA 2VURA 3QF0A 4IFKA 1XISA 2PWUA 1E40A 5REQB 3V3WA 3C0QA 5LIUX 2ISFA 3GC5A 2Z1VA 3BZGA 2ZUVA 3EOOA 3IAPA 5ABEA 2GJXB 1F61A 4HIBA 3IARA 3V5CA 4ZQNA 4CUCA 3RU6A 2ODOA 1R3RA 3P6LA 3B05A 3W7RA 1GWJA 3GXFA 1R6WA 1J8VA 1TPEA 3UG5A 2FB2A 3DFPA 3I4EA 4YU1A 1QPNA 4JTEA 3S0CA 4QEHA 4QAIA 1M7XA 2W63A 1ZU8A 4DBUA 2GUYA 4IG2B 3RK8A 4G7FA 4PR4A 3B9EA 4IPLA 2HZGA 1F3XA 2J77A 3N25A 5LA2A 4A2SA 5A95A 3W88A 1TX0A 3JZEA 4H9MA 1J12A 1JGIA 4Y7EA 4N6EA 5FIPA 4W86A 5JQ9A 4ZEPA 4PMXA 4GACA 4D72A 2Q3RA 1US0A 4TIMA 1R87A 4RLIA 4RZ4A 1JR1A 3B8UA 1J01A 1EGZA 5A8GA 1WAWA 5B7ZA 3QN3A 1SZNA 1A4MA 1N2VA 1P6WA 4Z17A 1YTEA 4PSRA 2QGHA 4AC1X 4FXSA 1WX0A 1JDCA 3HZ3A 4HHMA 4RPPA 3F2CA 3RLHA 1J5TA 4PA8A 1KFJA 1TUXA 1XI3A 2OLHA 1XYFA 1XIBA 1T99A 1PB0A 2X1SA 3OA3A 4ZQPA 3VNZA 1JIBA 5DRIA 4ZMGA 3CEUA 4FNRA 2QCGA 1E5NA 1UMLA 3M7SA 1T96A 3MMUA 4NZ3A 1DQUA 4JX5A 3OA5A 3EB2A 1KKRA 4WDTA 2XHYA 4L9YA 4P61A 3QQWA 1E1FA 4C6IA 1C93A 1XUUA 3W7IA 2ZDSA 4CCCA 2VOMA 3N4FA 3N17A 3NXLA 4XSMA 2I5IA 3RR4A 3LMYA 1Z3NA 2VEPA 4AQLA 3G2GA 3ZR6A 4G7EA 1WUEA 3AMKA 3W87A 4F66A 5FEWA 3SQMA 1CTNA 1KBBA 1WOBA 3EWDA 4FX6M 1TA3A 3WBWA 1X96A 4EXBA 3DGBA 5FEZA 1VBJA 4FNUA 2BFGA 3NQMA 3KOYA 3AYSA 4FOUA 1OFOA 4L1XA 4HHPA 1LUCB 4IQEA 1RQEA 3VMOA 5A6MA 2P8CA 2VCCA 1UUMA 3WK0A 3CUFA 4ATDA 4FMVA 1GOXA 1TX2A 2VOTA 4B5SA 3KBNA 2PD9A 1PYMA 4WZHA 1WDPA 3DC8A 5DO8A 1MXDA 2QPXA 3TZFA 3JR2A 4ZVJA 2VC9A 2JKAA 1QHZA 4QQUA 2X1UA 4DVOA 2O0TA 1KM0A 1JD7A 4GYFA 4H8NA 5H6HA 2OSXA 3FVDA 3HB9A 5G2WA 1HO4A 5FJJA 3O63A 3QFEA 3W27A 5FKYA 2J6XA 2EKGA 1ZJAA 4LAUA 4YYCA 2JKPA 3HGJA 3PZQA 3PM6A 1ZJIA 3ATZA 3PB2A 5BZAA 2DFAA 2ZUTA 4OQVA 2WZIA 1H0IA 3R11A 4MUPA 2D0GA 1GONA 3UCDA 3HOJA 3G0SA 2A1YA 1O1HA 2BVYA 3O6AA 1DWAM 5K9XA 1J79A 3IRSA 4K38A 4UNLA 4GI6A 4MTVA 4QGCA 2DIKA 2H3DA 2NLYA 3S2MA 2R6OA 1XSJA 4HMDA 1AH3A 3RG6A 3IK2A 4F9DA 3U3HA 3GFZA 2PCEA 4NIRA 1DJXA 2WSRA 4U5IA 5BYWA 1KR0A 2YB1A 1MZRA 4AY1A 1WP6A 4ZZ9A 3C2FA 2ATMA 1E4MM 1NP0A 4JTCA 3E5PA 3IJQA 4JTJA 1K7XA 2QXWA 1E6NA 4NJGA 3L65A 1SJDA 1J9YA 3HPXA 3GUGA 3N15A 3S47A 3L12A 3W3OA 1ZCCA 2IQTA 4N7QA 4ZO7A 4BI6A 2H9AA 2W67A 1A3HA 2H90A 3P84A 4IFKB 5K9DA 1TPWA 1PTDA 4IMFA 4B9YA 4CU8A 3M6YA 1RCXB 1C90A 4XK2A 1R30A 1E56A 5HATA 1G5AA 2AMGA 2NZLA 2VGBA 3MP4A 4CNNA 3CUGA 1E6PA 3W7LA 4EK7A 5DCBA 1G4PA 1YEYA 1DOSA 4BEUA 1T0OA 2HK1A 4MB5A 2YA0A 1AD4A 4CQCA 3CT2A 5AFDA 1YXCA 3LHVA 4FNQA 1QPQA 3GAKA 3U7VA 4HA0A 5CAKA 1GOOA 3P8IA 1AL7A 2E8ZA 3G0UA 1XBVA 3K4AA 1PIFA 2R1PA 3GZ3A 1EJSC 5DEZA 5G5IA 5F2IA 2XFYA 4EPBC 4KETA 1OF8A 1Y7VA 4F2UA 1A80A 2YA2A 1ALDA 1XM3A 4LS0A 4EP8C 3UXDA 1IYXA 4F0KA 3QV6A 3PP7A 1JCMP 1F3WA 2BBFA 4MDOA 1EP3A 3STGA 2EF9A 3IJ8A 2FGBA 1XLCA 4AW7A 4ROPA 1W3LA 2V68A 4OZOA 3LS9A 3GXTA 1RCOB 4NI3A 4UMAA 5BWAA 1BVZA 4NJHA 3EB3A 3LLXA 1KCLA 3M0MA 4K2SA 3LCWA 4XISA 1W3IA 3QJAA 3WH5A 1LL4A 2J88A 1WQ5A 1CT5A 4L4OA 5EMUA 2FH6A 4DI8A 4JTHA 5A5WA 5HQMA 4JCMA 6A3HA 4LEQA 4BY3A 5XIMA 4AFYA 4GVIA 2ZZ4A 4OECA 4WSKA 4B4HA 2PBOA 3ZJ8A 1B0IA 3T0BA 3EKGA 4LF1A 1V6VA 3NM1A 3RYSA 4J3VA 2VELA 2J7GA 1Q63A 4MFEA 3UP8A 1F6YA 1DJQA 4U28A 4G7EB 4R7OA 5CC3A 3BW2A 4NF7A 1YX1A 4BR1A 3MSDA 1L6SA 3SJNA 5AY7A 4V1YA 4S3DA 4LUYA 3W7OA 4H6RA 2EJ1A 1DJIA 2PZ0A 1YQ2A 2FB3A 3WD0A 1SR9A 1J11A 4LXFA 1GK8A 4HMNA 1XYZA 3AXMA 1Q65A 3GU2A 3KCOA 3G1XA 3N6HA 4J3TA 5CCZA 1J0ZA 2WVTA 3IIXA 2C91A 5C7VA 2G4FA 4AYSA 3W23A 1ICPA 4NXSA 1F3TA 1E3XA 1O4UA 1GKRA 5XINA 3HQOA 4KWVA 3RM9A 4JS3A 4XVEA 4QG9A 2ZQ0A 2VO5A 1YIXA 3W72A 1A5SA 3IVTA 1E0VA 3VFLA 4GISA 1UIOA 3SCNA 3VABA 3SN0A 4O1DA 1JG9A 1SFTA 1VCFA 4HZMA 1XS2A 3WF2A 4P2VA 4WXYA 1TQJA 1S1PA 4PL1A 4AD4A 4DXKA 5A8QA 3WSUA 2XH2A 1VJIA 2RH9A 4FOKA 2Y0FA 3L66A 3PSVA 1NU5A 2VD9A 3SUVA 2H8ZA 1WAUA 3EDJA 1HL9A 4N2YA 4A8IA 4HYRA 3TN3A 3ZJ7A 1E6XM 3P61A 1ZB5A 3W2JA 1M04A 2QW5A 4B3LA 4GX8A 5AHLA 1Q8JA 2QZRA 3AIQA 5FJRA 1TV8A 4GNJA 1EB3A 3SGZA 1H51A 3A6OA 1JFHA 3CZGA 3VA8A 3W01A 1JUKA 2FIQA 1PJ9A 1B9BA 1PX4A 3T08A 5C9XA 3MV11 3MMDA 2YCEA 2V2HA 3URQA 4PTWA 1GKQA 4KQNA 3SI9A 2BG5A 5A3HA 5A2CA 3CLMA 4NRRA 2R1NA 3UWQA 1G9HA 1VFUA 1VH7A 3AJ7A 3IUDA 2BVWA 1XUZA 2F84A 1GOIA 3PPHA 3VO0A 1O95A 1YPIA 2VZOA 3EOLA 4JKKA 4GRSA 3MMWA 5LHFA 1P48A 4IX2A 2B7PA 2HXUA 3G0XA 4BF5A 1XYCA 4Z1DA 5IOBA 1Q6QA 1P5BA 4J28A 2Y5JA 5MKGA 4I7VA 3MDWA 3TFCA 1UKOA 4ZOCA 4GQGA 5G4HC 1DWGM 2UV8G 3QSRA 1XRVA 2EPOA 1B3WA 2NT1A 3TR2A 3AAMA 1HJSA 4KFOA 1HJXA 2XPKA 2Y8KA 3UCCA 3PANA 4ZOEA 3QW3A 1V77A 2TSYA 3M6DA 3O8AA 3NG3A 2A85A 1CIUA 1OCJA 4HA1A 4HOWA 5FF3A 3LCHA 3EAUA 3H22A 4RW3A 3IGHX 4UQDA 4WJEA 1S46A 3UEQA 1YPFA 4NVTA 1EJXC 5FD0A 2ZICA 4U2YA 1W5MA 3STPA 3AUOA 3QTPA 1Z8AA 2DZBA 3CC1A 5A6LA 3N73A 3FEMA 2A4AA 3WD3A 2ANUA 1ML1A 1K03A 2CEQA 3AU2A 3REQB 3FJNA 3CMJA 2BASA 4H6EA 3E12A 3NQEA 3HPAA 3R89A 1WYIA 4U3AA 3U4AA 4TVUA 4FXRA 5LSMA 4XZBA 3GR7A 4MUZA 4L1GA 2C6QA 3R94A 3MBDA 4NNAA 4B9ZA 3W6MA 1R46A 3N04A 3H2AA 3QMRA 3QZEA 2TMDA 1H5YA 3ALGA 4S2BA 2Q09A 4AHPA 1F74A 2WNZA 3EWWA 5FF0A 2CHNA 2YCKX 3GS6A 1JDAA 3BE7A 3TTYA 4S23A 1K8YA 4ALDA 3W1AA 3IV3A 1CLVA 1ZBKA 1E5JA 1AA1B 5MF5A 2YYTA 4WKFA 2ZUSA 5D04C 3WENA 5I5RA 3WD1A 4C7DA 4PMUA 3BMVA 2C15A 4V1XA 3UESA 2INEA 1EZ2A 4NJIA 2QMKA 2Q01A 3EMQA 4TU1A 1AQFA 4WDUA 4AWTA 2NUXA 1KKOA 2DORA 3F5JA 1XFBA 3EB4A 5HR7A 3TONA 2Z27A 3HQPA 5G1YA 3GYEA 3KWXA 4PMOA 3KVJA 4BI7A 4MZ1A 3VKKA 1KRMA 5EMMA 2GQAA 2E1WA 2G97A 1UD4A 3D0CA 2W6RA 2PDHA 3U2CA 3K1DA 4AY8A 3DYOA 1VYPX 1MFVA 3W7GA 4GUIA 1BGGA 1HF6A 2V9DA 3E0FA 1OD8A 4X9SA 1REQA 3CT7A 2OEJA 1KFBA 5HANA 5D05A 3KAOA 2R1LA 4Y9MA 3T40A 4I8YA 2OGJA 2QJNA 2CZVA 4FAMA 2Z28A 1I2PA 3V7PA 4XD4A 2GVLA 3MWCA 1UWQA 3M43A 1Y5WA 2ZYFA 3D3FA 1GYNA 1FDYA 4MY8A 4R7JA 2BVTA 3DCPA 1UZHA 4ZB0A 5K4ZA 3ZLFA 1J0HA 4GY7A 2OLAA 3B0UX 2DSKA 4ZTYA 3AIUA 1JCJA 4W8LA 2Q8XA 3R7MA 2I5QA 1TV4A 2OX1A 3VIOA 1QOPA 1YXDA 5DT7A 3ZVHB 4AVFA 1J96A 6XIMA 3QMSA 4V27A 3V18A 1GEQA 4M80A 2E7FA 2FVMA 1BQGA 4BWLA 2WNQA 5HWJA 3GE7A 2UY4A 3FYOA 1OC7A 4GZEA 4LYKA 3S1GA 2I16A 2QCFA 4WOZA 2J9XA 4DNMA 5IM51 4CNTA 4PUJA 4C6FA 4HHLA 1VIWA 4O53A 4M1RA 3FXGA 3L4WA 2H6RA 1X38A 3AMDA 1N82A 2FVLA 4HU4A 1Z48A 3ID7A 5HQLA 3GM8A 1YNPA 2BVDA 2KX9A 2X09A 4JIPA 1JUEA 4Q6JA 3MHUA 1XDMA 4B3ZA 2ZFAA 3WF1A 1D7FA 2D20A 5AZ1A 5HMSA 3IANA 4B4FA 3O6CA 2YL8A 3TH6A 1HKMA 1KLYA 4JEQA 1HGYA 1VIZA 3GNXA 1XD0A 5BOEA 1CDGA 4HZ6A 4LW7A 1RBLA 1PKLA 3V36A 4BWLC 2OEMA 8TIMA 5HXMA 3L7RA 1UBSA 1VFSA 5MKGB 4DUOA 2FFIA 4UTJA 3T42A 3N29A 3W84A 3WKZA 3B3DA 1LL6A 3V75A 3SURA 4IHCA 1JCTA 4KFNA 4LV4A 4JL2A 4URIA 5BNKA 3VIIA 2E8YA 3KP0A 2WWDA 4GKTA 1MDRA 4LVFA 3MTWA 4C7FA 1OX4A 5CZ0A 3GBEA 3N1AA 1F07A 2ACUA 1EEPA 1S2CA 4O1EA 4AD1A 3VE7A 5E70A 3AS3A 3B97A 3UG3A 3R25A 1XBZA 3SQLA 2WLYA 3PHAA 4A21A 4LUJA 5DX7A 1PKYA 2J7HA 2QJJA 3GNPA 2EEXA 3S5NA 3TTQA 3WLNA 2XSAA 3BAKA 4HNVA 1XIMA 4FK9A 2J8GA 4C5ZA 3FJLA 4O10A 5BW6A 4NZ5A 3QGAC 4IPIA 3UY7A 4ZXLA 1OCNA 1BKHA 3ITTA 3M46A 1PIIA 5KMYA 2QCHA 1OD0A 1HKWA 1XLGA 3DN5A 4G8TA 2D2HA 3JUGA 2P0IA 2CLEA 3VKBA 3UG8A 4XZIA 3SY8A 9CGTA 2PGFA 2V3DA 3KOWA 4Z42C 1SFLA 2A3BA 3ISIX 3KWSA 3ARVA 3LHZA 3LV6A 3TZNA 1GVOA 2XWDA 1XGZA 2WKLA 3TWBA 4OJYA 1QPOA 1TCDA 4K39A 3WLRA 3ANYA 2NSOA 2OODA 1TV2A 5F4SA 1YTDA 4WDXA 1ZSXA 4XBSA 1LWIA 1M41A 2E5DA 1IEVA 3QM3A 2XIMA 1DPMA 2DY3A 3DHPA 2GVJA 1UUQA 3WELA 3IS4A 1SU5A 3G1HA 1TMHA 4L80A 1NQKA 3W7EA 1G1YA 1J6PA 3EPOA 3TC7A 3SW6A 4HCLA 2J47A 2CERA 2PP1A 1XYAA 5D38A 5H2ZA 1FKWA 3ME3A 1SR0A 1M53A 3DFSA 3SN4A 1ME8A 3LGGA 1E4IA 1RLCL 4HCDA 3AWNA 4Q8MA 3RM8A 1E9LA 2OG9A 1TO3A 3SUUA 1V3MA 2CLPA 1FWWA 3QV9A 4HA4A 3R0UA 1TPB1 2ZX6A 3VD3A 3TXZA 1HP4A 1RY0A 4AIUA 3O7UA 1XGDA 1B3XA 1UA3A 4L6OA 5EMYA 3H2FA 2E25A 4GXMA 2WOQA 3R79A 1KNWA 4O1AA 5CBIA 3CAWA 2IPFA 4RE2A 1N7KA 4KWOA 5J04A 3EWUA 4JIRA 2J6VA 4HJFA 1LM1A 3WJSA 2XZ9A 3JW7A 5HMDA 1V0NA 2HROA 3SECA 4Q8NA 4C91A 4LT9A 3MUCA 3WIJA 3V4BA 3IGXA 1YXYA 4RDZA 4B2DA 1CECA 4TMBA 1H63A 1IF2A 1E43A 1X6UA 4QDWA 2GZXA 2ZXBA 2PFHA 4AXKA 1OYBA 2PGEA 1WUFA 2NQ5A 5DCEA 2GJRA 1H11A 2QVNA 3W7QA 3OLGA 3N6JA 2ICSA 2OLSA 4ORIA 4JTFA 3QBUA 1TTPA 4XQ6A 3FXYA 4X3ZA 4J2MA 4IMDA 4XIMA 2W9MA 1QBAA 2D2JA 2C0HA 3VVGA 2XGBA 2Q3OA 1Z44A 1U5JA 1BVWA 3MI6A 2WC4A 3J7HA 3KZSA 3II1A 2Y1HA 4GUFA 4O8AA 2PDXA 1MW3A 1FWCC 2YL9A 1B3YA 3CB8A 3GTFA 2QDHA 3RFAA 2WMJA 1QW7A 4ADSA 4KWSA 3U0HA 2CW6A 4UFIA 1D7KA 4WK9A 1GORA 3K4DA 2YGYA 3A3XA 4A8LA 1ZJHA 2D2GA 4LAKA 3EX2A 4MYAA 4XZMX 2Y62A 1AQMA 4R34A 2CPUA 2ABBA 3S5SA 5IXEA 4PYSA 3AALA 1PXGA 3TXVA 4EWJA 1Q4WA 5I0DA 3K30A 3CGTA 1LG2A 4FALA 1R8LA 3GVGA 4AVNA 1PDZA 4I6KA 3L4XA 3G3DA 5ABGA 4OV9A 4GQQA 4LB3A 5CSUA 4JFSA 3I6TA 3OOQA 2FDMA 3HG4A 3VIMA 4WEVX 4N9DA 1A5MC 3FIGA 5EA9A 4ORMA 2FQIA 3OVQA 3HG2A 5I00A 2G50A 3LPOA 1HJUA 3NSXA 1PTAA 1OX4B 1K9EA 2CCRA 4D6GA 5HWMA 5LA1A 2WW5A 1HW6A 3VOIA 3I3EA 3WNNA 3VINA 2VGIA 1CCWB 3S1VA 1FH8A 3W6LA 5AHEA 5CPTA 2KZHA 2FTWA 3UPBA 2CBIA 4ZA0A 2CLHA 1FBAA 3RU8X 1EHNA 3TV8A 3BOLA 4EKJA 1P1XA 3TTEA 4FX7A 2YLLA 2IQDA 2HVOA 3W7KA 2O4QA 3UYCA 2IKHA 3W85A 1I2QA 3DXIA 4JY8A 2CYGA 2OZ8A 4C60A 3GKFA 3K5XA 1ZLPA 4GYPA 3G77A 1R3WA 1F76A 3ECQA 4TMCA 1YHTA 2F6KA 3VNJA 4GC3A 1LROA 3OIHA 2QDEA 1VRDA 3UZWA 3PPCA 4PEKA 4ES4A 3ES7A 4O4WA 1Q6OA 3R13A 2ZKMX 2DVTA 1UOKA 2NUWA 3T44A 3TCSA 1VCVA 1VENA 4A3YA 3CNYA 1E71M 4LNYA 2ZVRA 4JNZA 4OVXA 3F4CA 1BRLB 3TN5A 2DEPA 4WOQA 4B5TA 3EOUA 2Z2UA 3PF3A 2VD8A 4L6DA 3BVJA 4F48A 1TSIA 5C70A 1TRIA 3NTYA 4UTFA 2RGMA 3ARPA 3U9IA 4LS2A 1JXJA 2GLKA 1TB3A 4S1FA 1E0WA 3CMGA 4GYPC 4LUIA 3QKEA 4OIFA 4MWAD 4XVDA 1BQCA 4JTQA 1TWIA 2B4GA 3T05A 3BAYA 1KM2A 2V63A 5A2BA 3GAYA 1S39A 3TQPA 5BWFA 2ZE3A 4RCXA 1XPGA 4QE4A 1D3HA 2JBMA 1Q66A 2POTA 5ABFB 3PJWA 3VM7A 4NX5A 4BF9A 3GG8A 4E8CA 4CU6A 2CZDA 1JPMA 1YKWA 4J35A 5F4XA 1H7XA 1FWNA 2E9LA 2WMKA 4YS1A 4UTMA 4HNNA 5CQ1A 2QT3A 4JCLA 4FB7A 1JF5A 3EDFA 4HJWA 1EC8A 3W7DA 5EGRA 5T26A 2P88A 3ENLA 4DUVA 5ENLA 9XIAA 4MY9A 2V8ZA 1V03A 3EXSA 3LPFA 4GIYA 1S38A 3TNOA 1LZOA 3C2EA 3KOFA 1QXLA 3SM0A 2DZSA 1P43A 2VRKA 4EX4A 1UPMB 2VRJA 1BPLB 7REQA 1F9CA 3CYVA 4D1IA 2CETA 1X1NA 3P81A 1RALA 3CZ8A 4TVCA 4ZL1A 1FWBC 3VOGA 3FA5A 5KZDA 4J2PA 4WY0F 3H24A 3QKZA 2GQ9A 2REQB 3LOTA 4LX4A 4E8DA 3I4KA 7A3HA 1R0MA 3CYJA 4EANA 2C79A 2JE8A 4XD6A 4GVGA 2YXGA 4M3PA 5DF0A 4N42A 5AC8A 3IV8A 3DKJA 3T7VA 1VFTA 4GOAA 3VKAA 3SADA 1K4HA 1RP8A 2DT3A 5LNVA 3TSMA 1K7FA 1ICSA 4MM1A 3VIJA 3CL8A 2DT1A 4H9XA 1BG4A 3H55A 3TYUA 4BEQA 2AOSA 1HKIA 4LRSA 1SW0A 3OYXA 1UR4A 2PAJA 4ERGA 3FVMA 4FZIA 1E6ZA 3ITOA 3UR2A 4QCFA 3WMCA 1UKQA 4X0NA 4AZBA 1PZ3A 3UVAA 1EWDA 3W0KA 3SEPA 3ZXWA 2Y6ZA 1HKVA 1A0EA 5ECUA 1QMLA 3BOFA 4TO8A 1TE1A 1L6WA 1BAGA 4E6MA 1UD3A 4W85A 2A3LA 4QE1A 1H50A 5I3DA 3F2BA 4ZSUA 4M82A 4A29A 1JZ3A 3MDUA 4JY9A 4Q22A 3P62A 4LVAA 3QPZA 3NCOA 1E0UA 3PTKA 5IFTA 6XIAA 4DXXA 3MO4A 4DM2A 3WF4A 4IP5A 3ALFA 2EXOA 1JPKA 4O16A 1OB0A 3TQKA 3VCCA 1FHDA 2Q6ZA 2DGAA 4Y2WA 5DT5A 4JZ5A 5EPDA 4HCHA 4J9JA 3PBVA 4H8HA 1GEHA 2WC3A 4AZCA 2D73A 5GJPA 3EA3A 3AFBA 1DIOA 1AVAA 3AS1A 4B16A 4GGBA 1BHGA 5D8WA 4RR4A 1UR9A 2BS9A 2HVMA 3FDGA 3BSGA 4HPGA 3RX2A 1JGMA 3OJGA 4H04A 1DWIM 2EBNA 3T78A 2HISA 3EOEA 4PTMA 1XIDA 3IIVA 1OG0A 2YW4A 4IJBA 4KCVA 3BLPX 3NJ3A 3OLEA 1KA9F 3PZVA 1W3HA 4Z1CA 4WRHA 1HNYA 1FFQA 3A22A 2UBPC 3FK4A 1HL2A 3WLJA 4B5UA 1VFOA 5F2LA 1W37A 1C7SA 4UCFA 4A3QA 1E1EA 1J10A 5LZLA 1K70A 5DCDA 1ZRQA 3S2NA 2WK2A 1J5SA 1X1ZA 2DIJA 2E4TA 1VEOA 1XLBA 3FLUA 3TYBA 5E0KA 3LZ3A 3URNA 3O6YX 3TNBA 2X7WA 1RV8A 4U10A 3RM4A 1DORA 2VM8A 2VQTA 3NL5A 1XDJA 2CC0A 2AGKA 2ZRXA 1WDRA 2OVLA 1KW1A 3M5YA 3S9ZA 1GVQA 1KTNA 1TMLA 2E28A 3WUEA 5U4NA 1SW3A 3GR4A 1JNEA 3WUBA 4DB7A 4JKLA 3KBSA 3WDJA 3AS2A 4Z2JA 2YKKA 4GYJA 3C2RA 1MXGA 1W5NA 3B0YA 3R10A 4WKHA 3LMZA 5LNUA 1RD5A 1JFXA 1UH2A 1KXVA 1NSJA 2VEIA 1SZEA 1EPXA 1T8XA 1JDEA 3OHMB 1W8GA 3I7RA 3MT1A 2FVKA 2OSYA 4BS0A 2VZUA 4IMGA 3QR3A 4A35A 1EZWA 4NILA 4L56A 4YVVA 5KZMA 4JQ1A 4LUTA 1GT8A 1QT1A 1E72M 1K7EA 4JTDA 2J9YA 4MSSA 1RD6A 3TSBA 1CGYA 3WJXA 1ZQ5A 1XRTA 4HTBA 1H2JA 2GJNA 3L0KA 4KW2A 1F05A 2FZ8A 1UIPA 4UNKA 4QJ5B 4Q33A 3S1UA 4IZGA 3TCEA 4AIOA 7REQB 5AYYA 3LHTA 3VKDA 4UQBA 3H2OA 3MZ2A 2AKMA 3E1F1 2EPHA 2UY2A 2V81A 2V30A 3SCRA 1NOWA 5EMJA 3MCMA 5HULA 2YW3A 4AUBA 4BQ5A 4GGHA 2ZVIA 2TODA 1E0TA 4KRZA 5HWNA 4QDMA 1EGMA 2HBVA 4KRTA 1P0DA 2NXHA 4C6EA 3QSTA 2HRWA 1IZJA 4YTUA 2CWNA 4PZVA 5E5CA 1FA2A 4PULA 4RX0A 2X0YA 3PFRA 2V5BA 3CPGA 4XAGA 1S5VA 2I7GA 2QMJA 3HV8A 3JU2A 3URAA 4QP0A 3LB0A 3UGRA 1EFZA 4EF8A 3G1DA 4D8LA 1XXXA 5A6JA 2IUZA 1HIZA 1KFCA 1L8NA 3BK0A 2CIPA 4YTQA 1R9XA 4GZ7A 3IPWA 2ASHA 2QDDA 1H7RA 2DSWA 2NV9A 4YL2A 3V1PA 4ML4A 1JZ4A 3USBA 1XP3A 3GTHA 2W91A 1B3ZA 3M0KA 2ZXDA 3SUSA 1LOSA 3QXBA 2ISSA 1XIEA 1IEIA 1X8FA 1XICA 5KSWA 1NELA 4B5WA 1H7OA 3AYVA 3NQCA 5IDIA 5I06A 4C6NA 3LSCA 3R5EA 5DLCA 4LBRA 4MB1A 2DVUA 3ITXA 4FLRA 5EFFA 3UWZA 3VX1A 1CPUA 4XO7A 5DBUA 1TJRA 5E6ZA 1XHGA 1IXPA 1OWQA 4NNBA 1W9VA 4MAZA 2AAAA 1W0MA 5AVNA 4NNCA 1W3JA 2CZFA 2PWGA 1QRQA 1OX6A 4Y8EA 1UASA 1I2NA 3VGBA 5C9ZA 1G67A 2C18A 1LP6A 3WUFA 2JIEA 1IXQA 1JXKA 3W1QA 3KLKA 3OG3A 1LOLA 1UUOA 2UZ9A 2DW6A 4XKYB 4MNKA 3SGUA 4LSBA 4LAZA 5CSSA 3LCGA 3LPGA 3WLIA 4BFAA 2BODX 1K77A 4W84A 2VEFA 5D8ZA 4CCZA 2RDUA 3FV9A 3LHUA 5IFPA 2WPGA 5JUVA 1QNRA 3DYPA 2X0HA 1KB3A 2R1MA 1U5VA 5A94A 1EYWA 3TIMA 1U1JA 2ZC8A 2OFJA 6ALDA 2ZX5A 4H7VA 5B80A 3LRMA 3TW9A 2PDQA 1UWSA 4DJED 2A3AA 2JGYA 4MWAC 4QJ1A 2BB0A 2YOCA 5I02A 3IVSA 4H00A 4BQ4A 4W7UA 1QO2A 2E3ZA 2DIEA 2B7OA 4S3CA 2PC4A 1QTWA 3Q65A 4RV3A 5CZKA 2WCGA 2OT1A 1X8CA 4E2DA 3L5LA 4RDWA 3ICJA 4UQAA 1GW9A 1FH9A 4YHGA 4GCAA 3VILA 4HVXA 2PB1A 1VYSX 3V16A 1CXFA 2ALRA 3PG8A 4CQ9A 4CCEA 1BF6A 2QCDA 1XBYA 4FLSA 2F6UA 3R4IA 1LQ2A 4XO6A 1EBHA 1OM0A 2YL5A 3NPXA 1UR2A 4F0RA 3ZSSA 3BARA 5LNWA 3LHWA 3H2MA 5GJMA 1XIFA 1TTQA 3P82A 2CFFA 4IP4A 3CV7A 4UB9A 4LUTB 1R3QA 3GRIA 5BCAA 3DYMA 5CJ5A 1FWGC 3LX9A 2PWHA 4HBKA 2ACSA 1VPYA 2ZCGA 1S5WA 1MMFA 1GHSA 1P1MA 2D0HA 3THAA 4HPXA 4WX2A 4C6KA 5HUPA 4NYYA 2YFOA 4M0XA 3NPVA 3DU0A 3UYIA 3GXDA 4C6PA 4QEEA 3M0IA 4TR9A 4RDVA 5CBBA 3CUJA 1DJGA 5F4WA 3NZGA 4L1WA 1IWBA 3VE9A 1Q6FA 4RZ5A 3V35A 1YBQA 3MP5A 3W53A 3BUVA 5J5RA 2AQWA 1BEUA 4BF7A 5JBEA 2E1DA 4NT0A 3B8SA 1T8QA 1BLIA 2DUZA 4UR7A 5BRQA 4BA0A 2VCBA 1DJZA 1W17A 4KPLA 1FX6A 2F8QA 1PAMA 1AH4A 3W2MA 4AU0A 4MZ8A 4F9JA 4KF1A 3AZSA 4ZXOA 1MUWA 1SM9A 1WZLA 3AS0A 1I2OA 1D3CA 3NAVA 3CQJA 4IGHA 2DJLA 3M47A 1F3EA 1PKMA 4GLEA 1AK5A 2WSQA 3NVDA 5DMNA 3NEVA 3S3GA 2YDSA 1EA0A 3RCMA 4GXWA 2X41A 3QYSA 2NT0A 4IFRA 3P8JA 5HJXA 4Y9AA 4JL1A 3V0UA 4JNMA 4PTNA 3L5MA 3R6IA 3CMFA 3EX6A 3NZ1A 4L65A 3ATYA 5DY2A 1GQNA 3TQ0A 4OKDA 1I9CB 1LWJA 3I65A 3WL1A 3SCPA 4IQDA 1U1HA 3U48A 3NQVA 4UR8A 2X2GA 4WLCA 2VTFA 3VNMA 1K9TA 4JQ3A 3XISA 8RUCA 1YDOA 4TTUA 2PDKA 3BJFA 1IT7A 4W7VA 3AJXA 3QPEA 1B90A 3ONBA 4HMEA 1PEZA 2ZXQA 2ACQA 3ZO9A 1JPHA 1EP2A 2ZX8A 4H7CA 1H09A 1OGGA 3PTMA 4J3UA 4ERIA 1A5KC 3WQ5A 3G6LA 4MWAB 2OQYA 4OU1A 2NXGA 3B0PA 1BTMA 1NTHA 1PZ2A 1B54A 1O94A 1XIJA 3ZWTA 3B40A 4GIRA 4UTWC 4FO4A 2XVLA 2NVCA 4IF2A 1W3NA 3MO7A 2WPBA 4Y90A 1ZL1A 2J24A 2NW0A 2YXOA 2HV5A 1WDWA 5GNZA 3MUY1 4KKXA 4HK5A 4CD7A 3DENA 2WYSA 3BMXA 4AZGA 4NZFA 5E09A 1PPIA 3FA4A 3LM7A 4NJKA 4QTGA 4KCUA 1D8WA 5MHBA 4PGLA 4LUSA 3TQVA 2OMAA 1H5VA 2ZUNA 3LTSA 4E3TA 2E6AA 1Q13A 1XGEA 3W1NA 5FF2A 3UETA 1ONEA 1PDYA 4QX4A 2NX1A 2VGFA 3LTPA 2OU4A 5CEWA 4TV5A 1C8QA 3E2RA 3PK7A 4XV0A 3T2QA 3WLHA 3IJ9A 4G1KA 4HZ7A 3UXKA 2QJGA 1TCMA 4A3HA 3MC5A 4R3UA 2XU2A 1G7VA 3T8LA 4UTIA 2ZUUA 1OSEA 1NFBA 1QW9A 4PUMA 1TJ0A 2D0FA 1C92A 3NQ7A 3N4EA 1UROA 3O16A 4JHOA 5HNNA 3HJZA 3TA6A 5B7YA 3NPUA 3PN8A 1RQBA 1QCWA 3S6TA 4DM1A 4GG9A 1A5LC 3GG7A 1AW1A 3KW3A 2FPTA 3B8DA 3S1WA 4LVBA 1TIWA 1TVLA 2CBVA 1I0BA 2DZTA 4Q4RA 4FS9A 1EXPA 3T07A 2OKTA 1NDVA 1EDGA 3V0SA 2QCDB 4LV9A 1S2AA 4S2CA 1TPFA 4D9PA 3C2OA 1LJYA 4HYVA 4ZE4A 3NYDA 3APYA 1IIHA 2OOFA 3OLIA 3BSMA 2PF8A 1B1YA 1OFDA 5G2IA 2AGTA 3O06A 3LTYA 2Z29A 2QVHA 1FWAC 2Z1KA 4DPQA 4JEJA 3H7RA 4QRNA 4MY1A 1H1NA 1UMYA 3V5OA 2QULA 3AU6A 1UPPA 4MNLA 3ZSTA 3CIVA 3SFKA 2HS8A 3TROA 4DF2A 4X61A 2GFTA 3VNLA 3PUDA 1M7PA 4M56A 1TZ9A 4QSFA 2XTKA 3C6CA 1PYFA 1BYCA 2AL2A 1XFCA 2V5KA 1UB3A 3EXTA 2ZWZA 3N2CA 1VBUA 1HTIA 1W5QA 1ONWA 4GO8A 3QQ0A 5HINA 3IAQA 1EO7A 3ZLHA 1KV5A 4MZYA 4JOMA 4NZJA 3UW6A 1HG3A 2R24A 3K8LA 5AN7A 1YBQB 3R43A 3GC4A 3L5AA 3DFOA 2ZTKA 3NQ2A 1QI2A 1VFHA 3ZR5A 2GOKA 3DI0A 4ILSA 3PTQA 4L4PA 2P0OA 3T0AA 4D71A 3S8HA 1ZCOA 1XH0A 4GYKA 4Q4MA 5CG0A 4MPQA 4H9UA 5K7JA 2O55A 1V3IA 3TYEA 1FRBA 2Z6JA 3OIXA 2ZRVA 1FWHC 4KGJA 1DXEA 2Z26A 5DANA 1O5XA 1I75A 5CH9A 5FJIA 2PWFA 3AHZA 4R9XA 2OT0A 3M4HA 1I6NA 2BLEA 5G2HA 4H83A 2ZZ7A 4F40A 1AUSL 1QATA 3DGRA 4J27A 5I3KA 2E67A 4PRRA 2WBGA 3G1VA 4KEMA 3DBNA 4MB4A 4Q4SA 4M6PA 1I1WA 4UFKA 5LIWX 3KCLA 1FXPA 4ASTA 1F6KA 2QAFA 3FX4A 4JQ4A 4H19A 1YE4A 4YNGA 4ZQOA 1HGWA 4K1WA 4GE8A 1OF6A 1C8XA 1DE5A 3C0LA 3T4WA 3B9NA 1W54A 4XAZA 3UQNA 2W0UA 1IWAA 3IGUA 2DZVA 3VXGA 1BXBA 3H4WA 1QPKA 1Z89A 2PMQA 3PWGA 4UXDA 1EC9A 3B06A 2HE5A 3N34A 2OZTA 4HK7A 3GH4A 4IIEA 4C65A 5C9WA 4DJEC 1F8IA 2E6DA 3VGHA 1TWSA 2BY1A 3JVAA 2Y24A 5AB3A 3L23A 1WOAA 7TIMA 1QO5A 4JIQA 2I14A 3DG6A 4NKCA 3WMLA 1KM4A 3GTIA 1P0KA 3IJ7A 4PBGA 3AIBA 4GZIA 3Q45A 3MANA 1L6FA 2DZUA 4JTAA 4NSBA 2GOUA 2NVDA 3W1LA 1Q3NA 1WDSA 1JEZA 1EQCA 1MDLA 1I2RA 4YTTA 2C8NA 4S3GA 2GGHA 1ONXA 3N2MA 4IT1A 4RPQA 4DJFD 3FJ6A 2WJDA 1UR8A 5A8NA 1V51A 3QY6A 1XH2A 5K4XA 1WCGA 2ZIDA 4DF1A 3LEPA 1ITUA 2YXXA 3ZMRA 1XLEA 1XW8A 1E51A 2OB3A 2CKRA 3GVRA 3WK2A 4RUBA 5D2XA 1XR2A 4HA3A 2XN0A 3HF3A 3VKCA 4YCOA 1R5YA 4MVAA 2WQPA 2A2IA 3GTNA 1YNYA 4MNMA 1RVGA 1ECQA 4GK8A 3RX3A 3FGCA 1JDFA 4XZLX 4UMBA 3E0VA 4M24A 4GA8A 1MWOA 4PUKA 3GG0A 1GPWA 4LAOA 2HXTA 2QF7A 3EBVA 3CV6A 1WE5A 4JIEA 2PP0A 3BLLA 5M2FX 2C0AA 3PUEA 3NNTA 1DWHM 2R9RA 1NFGA 3DUGA 5JMUA 1CGXA 1U1UA 1I60A 3LGDA 1ICQA 1V6UA 4AG0A 2PWEA 4LVDA 3EOSA 3RILA 3ERPA 4FPSA 3AMGA 3FYPA 4QLLA 2VX5A 1BWKA 3LERA 3UCQA 4YYFA 1HFBA 4IL0A 1SO4A 4O52A 1UCWA 3YPIA 1LRTA 1R3SA 3SZ8A 1JI2A 4CNUA 2QR6A 1R85A 3HIJA 4B91A 3IK4A 4WR3A 2OTDA 1TJ2A 3DKLA 3E96A 4AWEA 2E5CA 1V6TA 2V38A 3GU9A 1E9YB 3IIZA 3P60A 2E9MA 3K4WA 1TFVA 4CNSA 4K1GA 1KGXA 3AHYA 1G4EA 4R53A 4DWDA 4PCFA 4REQA 1JD9A 1X97A 2X0SA 4OBSA 2AL2B 3A5FA 4DO4A 2ZA3A 3A4WA 4YMZA 5HAOA 3AYTA 3ABZA 4DZAA 4G9PA 1M68A 2GSJA 5BU6A 1E9ZB 1RBAA 2GJPA 4HSOA 2DUAA 2E5BA 5CPSA 2QCCA 4JTUA 3GKAA 2J7BA 1DYSA 3DI1A 3A4JA 1RK5A 2JKEA 1GPFA 3L2MA 3WYZA 5GNYA 3VDHA 4HNUA 4R9OA 2JGQA 5I2UA 1P0NA 3VMNA 1XBXA 3QLLA 1RAKA 2DH3A 5H8MA 2PDYA 4NAEB 1SUXA 3SY5A 3OLDA 3B8TA 3WQCA 2VFDA 4EACA 1ZNNA 5DFAA 3F1QA 4FHAA 1K9DA 2QEZA 3T6CA 1DP0A 3DFTA 2EPMX 3L9CA 3M5ZA 3QHOA 1EUNA 3HMJG 4YVPA 3STCA 4PL2A 4DAIA 2RDTA 5GPRA 3MSGA 3AMLA 3VU2A 1UP3A 4KRUA 2XIOA 3ORWA 2WJFA 2CLFA 5HBFA 4RDYA 4X60A 5AKQA 4NX0A 9XIMA 2VP8A 3TOPA 3XINA 2PP3A 2J74A 4EIVA 5C2CA 2W62A 4ZOAA 2ESCA 4Z2GA 1XLLA 3EMCA 4ZB5A 1OYAA 2FFCA 3QY8A 2PDNA 3G18A 1W9BM 1LRQA 1V08A 2L5HA 3WQOA 3NQFA 2VT0A 4XUGA 2PDWA 1DWFM 5DMLA 2NX9A 4JXCA 1MW1A 3QMTA 1NWRA 3WH6A 4DAFA 3OB8A 2FDSA 4ZCWA 1B3VA 2EG8A 4GH3A 2D24A 2WVSA 3BOXA 3S2JA 1K6WA 1TREA 4P8VA 4GJ1A 4F4RA 5EBAA 4Q8OA 3AO0A 1FWTA 3DDMA 3CL7A 4K36A 1VZWA 4DO7A 3WK3A 1HXJA 3BLEA 2VCAA 1MXSA 2UWFA 2ZADA 3VKJA 3DHDA 3M07A 1W8SA 3KBVA 4A3RA 2QAPA 2ZBTA 3WNMA 3M0ZA 2WM0A 4H2CA 4NL1A 3GNRA 3TMLA 1GJPA 3ZYZA 2VEGA 3VNIA 4I5RA 1JDDA 2QNEA 1ZUAX 2VEKA 4O54A 1UD8A 3EPNA 1TWDA 2OPJA 1L0PA 1E0XA 2OWWA 3EPMA 4CQAA 3W37A 4ICNA 1KTBA 3P3BA 4P7NA 1TJ1A 3AIVA 3W86A 1TG7A 1K4GA 3FY1A 4X2RA 1NOFA 4JIIX 4H7ZA 1XIGA 4LCRA 2ISDA 1YW1A 2WLZA 3IJIA 2F2KA 2W5FA 4Q8QA 4CCDA 3CQ0A 3AWOA 3OP2A 1JQVA 1RSCA 3C2VA 3Q4DA 1IGSA 4MMWA 4Z1BA 1POKA 2VL4A 3DEQA 4QJ4B 2HK0A 3W71A 3K8MA 3O15A 3I10A 2ISWA 2H3BA 4HK6A 3NL3A 4C5YA 1EP1A 3PBYA 1R9ZA 4ERAA 1Q6DA 1V93A 2ZX9A 4PB3A 4LGXA 3CZLA 2WKJA 5CKSA 2X42A 4KGLA 3WQDA 1AMKA 4LYRA 2V2CA 4UQ9A 2GSEA 4KWUA 3WQWA 3GNOA 4F3HA 1PSCA 3CZEA 1JZ8A 2IKGA 2C7FA 3C61A 1DL3A 2PDIA 4NP7A 3UJRA 1LCOA 3HN3A 1N55A 2W27A 4Z2HA 2WJEA 5CJNA 4JBRA 3RJYA 4XZ9A 3UXIA 1AODA 1B2YA 4UMCA 4LANA 3P67A 1UWTA 2WZHA 4GIAA 4Y8FA 4PSPA 3HA1A 2QKFA 1THFD 3APGA 2XIBA 3NYZA 1UP2A 2GK1A 2ZUMA 3TA9A 1XYMA 3GVVA 4M8UA 2XFWA 1HJVA 2BZNA 3S2CA 4AXNA 4TX6A 2BHZA 3INPA 2O92A 3VAVA 4QBXA 2FZ9A 4FX8A 3OGSA 4Z1AA 2E6YA 3OQEA 1BFNA 1RA5A 2VGGA 4TUFA 2PLMA 3EA2A 1C3FA 1SVDA 4N4QA 1R3VA 2FJKA 1JRCA 3LLFA 1NP2A 2FYMA 4UCGA 2QUVA 3OHIA 1A5NC 5F1UA 3QVQA 2Z2BA 5FOOA 5CXPA 1EKOA 3EEZA 3NDYA 2AQVA 1RK6A 3NDOA 7PTDA 5LKYA 4QG8A 4HZ8A 3CUHA 4LC8A 1VF8A 3L4UA 4R7WA 1GZJA 4EAYA 2V67A 1Q6EA 4A3UA 1DJHA 4YXGA 2GWNA 3EDDA 3H53A 2EPLX 3ZOAA 3LV5A 3B8VA 4D6IA 3AZTA 2CNCA 5EB8A 5IHRA 1FXQA 2CXGA 3VOCA 3KDOA 1EJUC 3RR1A 3KL3A 2QJIA 1AJZA 1I45A 2QCNA 7XIMA 4DJFA 1VJSA 3NR0A 1H3GA 3FOKA 3O05A 4JYEA 4HSNA 1M01A 1CLKA 2Y7EA 5HA7A 4C1LA 3D5HA 5AYXA 1LF1A 4JPGA 3RPTA 3S83A 3H2NA 5HMFA 3HV9A 2C16A 3H12A 3PS7A 3WZ0E 3FAXA 1W2PA 4GABA 2QS8A 3BLKA 3THCA 3ARRA 1XLAA 5M3WA 1LOQA 2BOEX 1TA3B 9RUBA 1WBJA 3T1GA 3E2QA 1H41A 5HUOA 3GH5A 2Z7KA 2FPYA 3W1PA 4GPNA 3OO2A 4BZYA 2VVSA 3VX0A 4EAMA 1K8XA 4S3BA 1H7PA 2IPJA 4PTXA 3ES8A 5LIXX 1MEWA 1DEDA 5C7HA 3AMCA 3KFTA 1K6AA 1B4EA 3N2BA 2YSWA 3POHA 4QNWA 3W07A 4XB3A 4DWSD 3NL6A 1KRBC 1GTHA 1N8IA 2PTWA 1CZ1A 1QUMA 1TVNA 3UWEA 1ZP4A 3TSDA 1MRAA 1XKJA 4DJFC 3TEVA 1VHCA 3O0FA 1CNVA 1NF0A 2YYUA 4S38A 5L6UA 2DV0A 3BAJA 5DBTA 1NWTA 2JF7A 3LBMA 2J75A 3LI0A 3A5VA 4GD0A 4IIBA 1UR3M 2GJLA 3L2IA 1ZBWA 3K1GA 5I3JA 3EX3A 5D2WA 3SCUA 3AIWA 1UQZA 4I9TA 2Z00A 4C90A 3KVMA 3TJ4A 5D2YA 4IPPA 2VZTA 4ZQCA 4XIAA 2VVNA 5IRPA 3NQGA 1SQ7A 4O1CA 3GFXA 3M44A 3UZ5A 4JTIA 2ATSA 3ABRA 3LXAA 4FLQA 1FDZA 1TUFA 4GHRA 1UHVA 3UZJA 2CWXA 1AJ2A 4GJJA 1TV5A 4UBPC 2VR5A 5FESA 2A7PA 2YBTA 3A9BA 4LPCA 1LYXA 3NOEA 3NZQA 5D2TA 3BG5A 4H4IA 2HPIA 2RFGA 3B8WA 1O5QA 4V2XA 3DH7A 5TIMA 4ZQMA 2DQWA 4S3JA 4WUIA 5K2ZA 1FFRA 2UY3A 3A21A 4PEEA 2Y5SA 1JCYA 1VR6A 4X9YA 3VD5A 5AZ0A 1KRCC 5I03A 3EWBX 1A3XA 4UUIA 3GYCA 3G1AA 1LLOA 3Q94A 3R0KA 4Q4OA 3S42A 3WQPA 4OFCA 1VJZA 3Q67A 4Q4KA 2VX6A 3USZA 4IIDA 1IXOA 1RY8A 3TWAA 3CZKA 4R85A 5C0QA 4JD4A 1OZQA 2RKXA 3QGKC 3SRFA 5T8GA 3VYLA 1V3KA 3STEA 3DHUA 4W5UA 4MJ4A 2H9AB 1ZBVA 4BQ3A 3CB3A 1AH0A 1PKNA 1GNXA 1B3OA 2VFGA 1W9UA 3EDKA 4B2DD 3KVKA 3GLCA 1TR9A 4F2BA 2WJZA 3AQUA 3PBGA 3WNLA 2OWXA 1QASA 4JN7A 1FHLA 4H2HA 3WLSA 2OCZA 1VPXA 4JQ2A 2XZ7A 3N13A 4O57A 5DQPA 2GK1B 4J40A 4WGHA 3H21A 4ZE5A 4FR6A 4D6HA 2GYIA 3EMZA 4IPJA 3RUBL 4AIEA 5D37A 1OIMA 1KWGA 1YDVA 1FCBA 1EOKA 1G7UA 2ZOXA 3RLUA 3IUHA 2HTMA 3F4WA 1CXKA 1PVNA 2PZNA 3CHFA 4UFMA 7TAAA 1KQZA 1W1A1 3NA8A 3VUSA 3HFYA 3RXZA 4DO6A 1KGWA 4EXQA 4N0RA 2V3FA 4B5VA 2WKGA 5D02A 1SZRA 3D3AA 3FA3A 1S3HA 1WKEA 3LSBA 4Z08A 3GH7A 5AOUA 2QQ6A 3THUA 1ZY9A 3NSNA 1TJPA 4UZSA 2PCQA 3PC0A 3W7JA 3IIOA 4P7QA 1DHPA 3W1UA 3F4VA 5A69A 3UPWA 3SCSA 2PBGA 2PDPA 1ESWA 2Y88A 2X1IA 3KHDA 3W7CA 3BGAA 1XSIA 3MI2A 3LRKA 3SSZA 3WJWA 3BDKA 5REQA 3SCOA 1JZ2A 2I1OA 1GTEA 1PBGA 1YDYA 1JAKA 2GJXA 2W92A 2PGRA 3BQ5A 1JF6A 4ADTA 1CGVA 3QC0A 1E6QM 1QNQA 4YTRA 2VXNA 3DHFA 4TXEA 3VIKA 2J62A 3WLPA 2A6LA 1IIGA 3AICA 4UWMA 1PTGA 3OODA 3IJ6A 3U57A 6ENLA 2DW7A 3VDAA 4JFWA 1DV7A 4KIEA 5LGZA 1W2VA 3AHXA 2QCLA 2PDFA 3BLDA 2CESA 4PUNA 3W1TA 1AW2A 2UY5A 5FEXA 2XDFA 1ZAJA 1EDQA 1QW8A 1XG4A 3MSRA 3G24A 1XQLA 3ZT6A 1KWKA 1S2VA 1M65A 3DERA 3BJSA 3E0LA 4QCEA 1M5WA 5HQEA 3TN4A 1GCYA 1W3KA 3SJ3A 5HNRA 1CENA 4OV4A 2E40A 4AVOA 1AQHA 4L9XA 1W1B1 2ZRYA 4TOQA 1XRFA 1J18A 3HPZA 4BKNA 4JTSA 1W1ZA 5EMLA 4XTDA 4DEFA 2JEQA 4DYJA 1BXCA 4PB5A 1NDZA 4K8GA 3VPLA 1A47A 2NQLA 4F0MA 1M1BA 2PLJA 1IV8A 2WQDA 3O9NA 4PMNA 3IWPA 5BOOA 4LRTA 5LIKX 1GW1A 2CBUA 4KEUA 1OGBA 3BJTA 4CGTA 1H60A 4ML9A 3O07A 3NDZA 4B15A 1FVPA 2BV9A 1ZBCA 3MB9A 4OWGA 4HKPA 4WXZA 5CGQA 1CYGA 4LJ3A 3U6WA 1CXEA 2VZSA 1QNVA 5JBFA 3ABQA 3GDLA 5E1QA 2P50A 1QU4A 4Q4PA 2E9BA 1XD1A 1RVKA 1ENUA 2OJPA 3PULA 4NY2A 1H7WA 3W82A 4DLMA 3N2TA 1NARA 5AC5A 3WF3A 4E8GA 3FHAA 5G4EA 2ADAA 2Y8VA 3KDNA 1AZ1A 2OQLA 1EWEA 2QCEA 4UTTA 4QHRA 3ZFHA 1L6GA 4ZBCA 2YLAA 1LUCA 5E9XA 1EC7A 3TP4A 4M7TA 4IISA 1XCFA 2F6XA 2QJHA 5I24A 1SFJA 1G4TA 1ITQA 3P7YA 2VENA 3H7UA 3TC3A 4QG6A 2ZE0A 4Y9NA 4AIBA 5D9NA 4MLRA 2P5NA 3DFHA 3UXAA 2I56A 1VEPA 3UNDA 1F7BA 4M5PA 2IW0A 2XINA 3WQGA 2ZRWA 2J4GA 1VBRA 3TLLA 2NWSA 4I9AA 4R33A 1POJA 5C55A 3QYQA 4B92A 2VKZG 3CQIA 3KHJA 1FWRA 1FP9A 4I8DA 5FAJA 4J5NA 1ECEA 1MO0A 4MGGA 3BW4A 2VR2A 1TTIA 3CS2A 4UQEA 2PDJA 4ZODA 1CWYA 3SBFA 4XAFA 1F5ZA 4J3XA 1Q8AA 1GVIA 4AH7A 1BYBA 2DZWA 3QOMA 4LEFA 4UTTC 2ZDRA 3OZOA 1FWFC 2HDJA 3WDQA 4MB3A 4NU7A 5H8UA 5C9UA 2XM2A 4N9EA 4ZTXA 4A4AA 3RAOA 3NQDA 4QXIA 3EWCA 2FPVA 3CIXA 3SCVA 5KITA 3D47A 3SAZA 4ADUA 8A3HA 4DWSA 4DBWA 4HOZA 3WY1A 3GNNA 2HNEA 4H1ZA 1MUCA 5HPCA 1KFLA 3STFA 2Y70A 3LZ5A 1VPQA 3BURA 5HJLA 1KFWA 4W89A 4WSHA 4YIWA 1C8VA 4EE9A 2PF0A 4UOQA 2NUYA 3PPFA 1TQXA 2YR1A 1XIHA 2Z24A 3WLTA 1WXJA 3A9IA 4Q3MA 2ZX7A 2YCIX 3AXKA 4LCSA 4PH6A 1Q85A 1LORA 1JZ7A 4L4LA 4UTLA 1W9XA 1EIXA 1KCZA 4Y6GA 3ELFA 1VEMA 5CZTA 3FKRA 1HKKA 1CGWA 3SRDA 1H0GA 5JIPA 3CWNA 3L21A 3GXPA 1V4YA 4DWSC 5TBOA 3WBYA 4KERA 2PTXA 3TE9A 1LBMA 2AMXA 1YPXA 1EXBA 1W1YA 3EKZA 4X0VA 4OOUA 4GXPA 4HPNA 1QVBA 4I90A 3WLKX 2ABAA 3ITYA 3P5ZA 4DX3A 1BD0A 2JALA 3S4TA 2OZ0A 4QISA 2VX4A 2C14A 5AECA 1OFPA 2P53A 4LVGA 3WDRA 2J66A 2QF8A 3R12A 5BOFA 5HNTA 3OBKA 3GHTA 1FY6A 3RHGA 4FNPA 3JS3A 4IL2A 3HGSA 1GQJA 2RUSA 3BWWA 5I77A 1M3UA 5AHMA 3ZZ1A 3L2LA 3SUWA 3UJSA 5AVHA 3HMCA 4RNFA 1REQB 2GDQA 3UWYA 3NUKA 1SO5A 5CPLA 4ZO8A 2JK2A 3E0IA 3LG3A 1HQTA 1V6XA 1W91A 4M6QA 3WLQA 1VB9A 3OQ8A 1OY0A 4O50A 3QR0A 3S2LA 4KFPA 7ENLA 2HS6A 3NZPA 3UVIA 4H6QA 2J78A 2BGQA 3S5OA 4HB7A 1RZMA 3UFYA 3V1HA 1VHNA 3H70A 1SJCA 1T6MA 5J5DA 1KLZA 4WIWA 4MADA 5G1MA 2I17A 2RGLA 3U4FA 2PU0A 2ZTJA 3VOJA 3WBAA 3TYDA 2MANA 1TPDA 3PZUA 4IMAA 2G3NA 2WC7A 8XIMA 2BX7A 3E2VA 6TAAA 1QOQA 2C1HA 3T4CA 1CBGA 4PCTA 2G96A 1LT8A 3VD7A 4W8AA 1HO1A 3S5YA 5EFDA 3NO3A 1NOUA 1WDDA 4CN6A 4GC4A 1HJWA 1Y0EA 1MFUA 2ON3A 1O6IA 1KFEA 3VIPA 3MA8A 2BTMA 4D6FA 4HU3A 4DF0A 4MJ2A 1S3TC 4F79A 1GYMA 2A7RA 2GSHA 1NY1A 4WF7A 3MCNA 4FF5A 2WZMA 1Z9AA 1OHLA 2OO6A 3GDTA 2LLEA 3C3UA 3GHUA 3KS6A 1UJQA 2IPWA 3FDKA 3A4XA 1RR2A 2AQOA 4HP5A 5CJMA 1JPIA 3LCXA 1DJWA 3ZS4A 1DJYA 5LIYX 1CW2A 3MMTA 2RJGA 4EF9A 1UA7A 2A7NA 4WCJA 1IT0A 3CEPA 3N3TA 3T2PA 4B5NA 4RNIA 1KM3A 4UFJA 2WM1A 5JBDA 3OU8A 2J8FA 4LQ1A 1DHKA 2IXUA 3WJYA 4AD0A 2EHHA 3FKKA 3MS8A 3NGJA 4DZIA 4Y96A 8XIAA 3M0HA 2A21A 2HNHA 4Q8VA 4O28A 1A0DA 2P8BA 2VZVA 3VTRA 1EH9A 3HU7A 1WKFA 4N6FA 4V28A 3KS5A 1Z41A 5CG7A 1PZ0A 5KZ6A 1K3UA 1OT1A 4DWSB 4RZBA 4HNTA 2XM1A 3F2DA 1YLVA 4MFDA 4DJDD 3MYOA 4I5UA 5RUBA 3HTWA 2GGIA 1VAHA 1KXQA 2NX3A 3L67A 3LM3A 5SWUA 3F7JA 3RX4A 4LBUA 3O3RA 5E0CA 1RH9A 2MUCA 2XGIA 2QYGA 1IGWA 3IEBA 4AZIA 1IR1A 1DIDA 1OX5A 5ABTA 1T5AA 2OYKA 4E5TA 1RPKA 3AIEA 5AC6A 4MWAE 3SCTA 4O8RA 1SPQA 4K6AA 3FYYA 3W9ZA 2DZAA 4OBTA 1O1ZA 3KRSA 3L0GA 4Q7NA 4GUHA 1ZAIA 2DDXA 1WKDA 1ZENA 3ZR4A 4QJ3B 5I07A 1Q5MA 4RE4A 4DUXA 1I8JA 5GQBA 3W2UA 4ATLA 1OFRA 3H7VA 1DJNA 3LA4A 5U7SA 3KEHA 3MUZ1 3SRHA 1U33A 2WZTA 2V5LA 1B5TA 1VFLA 3PZGA 3TK7A 3EX4A 1PHQA 1K02A 3GXNA 5D9PA 1A3WA 1LBFA 4FOJA 2KAUC 2GUUA 4KMQA 1JCLA 3IGSA 4JR5A 1XQKA 4GI9A 1W5OA 3CXOA 1XLJA 1V0LA 1WBHA 4D2JA 2XIQA 4Z0SA 3MCOA 3CO8A 2YX0A 2HE8A 3QV7A 3T09A 1LL7A 1NWUA 1XF0A 2CITA 5F2MA 5LXXA 1DXFA 3ABSA 1D2KA 3T8QA 1K1DA 3DAQA 4JHMA 4LALA 2VC5A 4MPKA 3SDOA 2O9TA 2HCVA 4I3GA 3ZLGA 4AHQA 3REQA 3QPYA 2W4XA 5H8PA 2FMOA 2A6NA 4MKVA 2J8TA 1DIKA 4CQ8A 3A3HA 2W3ZA 4Q8PA 3L68A 4LNCA 4S3AA 3BLIA 3L4VA 1TMQA 2X16A 3WDHA 4LYQA 5DXXA 4S3EA 3R8RA 1DVJA 1OGSA 3ZM8A 3VNDA 1A53A 5G4WA 1F73A 3LDVA 2FTYA 3PWAA 5BXPA 4AEOA 2X1RA 4J7RA 1J0IA 3MU7A 4RK8A 2J7EA 3AROA 4N02A 5ECVA 1PS9A 4JTLA 3KUMA 5T91A 5DMMA 2QGYA 5I3FA 2PWVA 4HTYA 4YCPA 1WDQA 1VFFA 2V69A 1KC7A 4QR6A 3KP1A 2V5DA 3C3NA 2YCJA 1OC5A 1EO5A 3GO2A 3WEMA 4V15A 6REQA 3GXMA 2WVUA 3B04A 1JL8A 4R27A 2GGJA 3TJIA 4N9BA 1GQLA 2YZ5A 2DPEA 4LB4A 4PC8A 2XYLA 3HURA 4TX9A 2P10A 3TAKA 1L9WA 2YDAA 3NVTA 5EMKA 2BOFX 2HPMA 2XUCA 1OC6A 4H6KA 3VFCA 1SMAA 5CLWA 4PCSA 4GY0A 4Z1YA 2A3CA 3W00A 3GSMA 3QR1A 3VZYA 3ARUA 4PTDA 1Y5VA 3M0JA 4DELA 3CTLA 2GGGA 1RXOB 3MQTA 2INFA 3KE0A 2QIWA 2J9ZA 3TU9A 1FWDC 4IUGA 4WD0A 1W9DM 4AISA 3UWVA 2Y89A 1UKPA 4U33A 1VBGA 1MQPA 3E9AA 5C2GA 2Z7GA 3G22A 2GUBA 5TNVA 3CV2A 3KBMA 3DBPA 2XH7A 1OFQA 4GVFA 4X22A 4DN1A 2VJXA 3G5EA 1YE6A 3CAVA 3WX7A 3G8EA 3AXIA 2TYSA 1MQRA 3ZVHA 1EYEA 3TTSA 1O66A 1V5XA 1CI1A 1VYRA 5AC7A 3MJMA 4H3DA 1YYAA 4PMZA 1GZ1A 5A1AA 4LTSA 1YTKA 1KBJA 1GZGA 2OX4A 4ONVA 4OTKA 1ME7A 1R9YA 1LQAA 3L4TA 5BROA 2WMGA 3ARYA 3ITVA 2CLIA 1WA3A 1TWZA 2FZBA 4AF0A 3DFYA 3KRZA 4OGZA 1XV8A 3W38A 3W1XA 3MP3A 3GXIA 3CQHA 1KM5A 5FSDC 3OPSA 3BV7A 4LWWA 1D8CA 2XH4A 3KBJA 1UD2A 1EX5A 2BY2A 1ONRA 4YJ5A 4P7RA 2YPIA 4DQWA 1PV8A 4CLMA 5HJYA 3ARTA 3M0LA 4KESA 3KOZA 1FP8A 2ZRZA 4K37A 1E4NA 2VDHA 3M9YA 1P0EA 1PL9A 4GMEA 4MYXA 4HPJA 1CXLA 5GJNA 3HJEA 2RJHA 5DXYA 4O14A 2DU2A 3KBWA 4D6DA 2EPKX 4ZO9A 5KTLA 2ZZ6A 1G6CA 2Y2WA 3SUTA 4Q6XA 2D23A 4IIHA 3E5BA 5BRPA 4BK9A 3VIGA 5EKYA 3P80A 3LCIA 1PWLA 2G4JA 2YJQA 3W2NA 5K3VA 5LHEA 3EA1A 3I7SA 4XZNX 4JFVA 4GJIA 3RPDA 3O2LA 4NI8A 4LY4A 4HT3A 2GDUA 1O60A 3LBOA 2XWEA 3AYRA 2QV4A 2O9PA 1VRXA 1V02E 3NURA 2WSPA 2O9RA 3VD9A 5IDZA 1MNSA 1X1OA 3POCA 4ZFCA 1Q7MA 3VOHA 2BY3A 3UJEA 2XISA 4XBKA 4HSHA 3UA4A 3R2GA 3CV1A 3W74A 3W25A 4PUWA 2YA1A 5DN1A 2FGLA 1GVEA 4CN4A 2PDBA 1QI4A 3CHEA 2O9OA 4NJJA 3I6EA 2Y7DA 1A0CA 1OQFA 5FJTA 3JRKA 3PBMA 2G41A 1TIMA 1R47A 2CHRA 1US2A 4JYFA 4Z2LA 3GVQA 1KGUA 2IXVA 2Q71A 2V3GA 1E73M 3UWWA 1B9ZA 1DXIA 1UC4A 2BXZA 4CN1A 3C4UA 4KIRA 3PJXA 3UJFA 3WQFA 3KTCA 3A64A 6CGTA 1ZS2A 4US5D 2FTPA 5I6SA 1J2WA 1UR0A 1EL3A 3CAQA 3ZT5A 5TQLA 3FCPA 2VEMA 1QNSA 3TR9A 1V3JA 1EQPA 3TW7A 1VD6A 3N3MA 4GBUA 1PIGA 3VZZA 3FFSA 4W87A 5M5DA 1V0KA 4YLWA 4DYEA 5A8PA 5CPMA 1Q6LA 2Y5EA 2R14A 3LENA 2ACRA 4DNHA 2FJUB 3VZXA 5TAOA 2Z1SA 2XGZA 3E3HA 3TC6A 3CZJA 4PUEA 4LU0A 2CZ5A 1JZ5A 5EYWA 5FF7A 5A2AA 3H2CA 5A8OA 1M7OA 3FSTA 5LGXA 5LNRA 6REQB 4DJDA 3UNTA 2QLYA 3GDMA 3K46A 4WVXA 3M16A 1MZHA 4J1OA 4GY1A 4CKQA 1LG1A 3HGOA 4HD5A 4EPKA 3MPGA 2VDGA 4XX6A 4E38A 5A8MA 2WV8A 2WB5A 2C13A 3LQGA 5I3IA 4D8ZA 6TIMA 5EL1A 2FZMA 4CD4A 2BXYA 1A5BA 1F8MA 4JKMA 1QBBA 2YIHA 4GUJA 4DIAA 5CSRA 1Q7QA 3VGEA 1ZALA 3OGVA 3H8AA 5ABHA 4HNLA 2EKCA 4DBEA 2WO5A 1AZ2A 3G8RA 1NFPA 4PUDA 3RIKA 3N4AA 2BGSA 2NSXA 3WBEA 3C0JA 2PUZA 3KX6A 4KT2A 4MNJA 4DJDC 4D1JA 1RLDA 3CHCA 3N18A 4MLJA 1X6NA 3BGGA 2QPSA 4YPJA 1W32A 4FNSA 5I78A 3LI1A 1OADA 4G1NA 5CSYA 2IPGA 2WMIA 3KTXA 2NV1A 4JTGA 3LLDA 4Q8TA 4E2VA 1FTXA 2RAGA 3HG3A 5KZEA 2J25A 2VI0A 4P7OA 4QLJA 3RDKA 1UD6A 1EJTC 3HQNA 4WKAA 4XG1A 5D4YA 1HVQA 1FCUA 4NHVA 4AZCB 1MVYA 4RJEA 1TZ7A 4WSJA 1PUDA 3IACA 1TWWA 4W4QA 3M64A 1HZYA 3IRDA 3PNUA 1JRBA 2Z1XA 3LXCA 2Z2AA 1OZMA 3P0WA 5D30A 1N8FA 2GDVA 4AF0B 1WB0A 1VS1A 4XTIA 1JYXA 1KCKA 4D8AA 3LPPA 3UPMA 4PFHA 1PO9A 2AL1A 1KBLA 2VX7A 3MJYA 3IVUA 4IFOA 3KRBA 2DSUA 5T9BG 4HHHA 1ZZMA 3ABOA 3A24A 5E93A 1MYRA 3UR7A 1J0YA 1GG0A 3RLVA 2YDQA 2CHOA 1UZDA 4R5EA 3TLQA 1US3A 1RBOB 4UFHA 1GUVA 4KEZA 1KXHA 3BAXA 3VK5A 1XLHA 3AXXA 2Y7GA 3KL0A 3TUUA 4P8UA 3W7PA 3TAOA 3N6QA 4BJHA 2BNJA 3M5VA 3BC9A 1FHVA 5CPOA 3WH8A 2G8ZA 3NL2A 3CH9A 1GOWA 3N9RA 4QE5A 3BCJA 1MEHA 3E0WA 2HVNA 4V33A 4C6OA 3AOFA 2PTZA 4AZ6A 3C86A 3GVWA 3I3DA 1UG6A 2ALDA 3VIFA 1GVSA 1MUMA 1Z7AA 3WDIA 4GQRA 1QPRA 2X30A 3IJDA 3EGJA 3B9OA 4CU7A 2YBVA 4DPPA 3EWXA 3G1SA 4FIQA 3BG3A 1PHWA 3VD4A 2HBXA 4QIUA 4IM4A 4D6CA 2ONEA 5FAGA 2O4MA 1J93A 1CGTA 2XJ7A 2VFHA 4RV8A 2YBUA 5IBXA 4CNPA 3WQVA 3WUGA 2VDIA 3NEHA 3W73A 1OIFA 1SO3A 4I5XA 4DUWA 3UJ2A 2OR2A 1SJAA 1RUSA 1W3TA 1WZAA 1OT2A 4JX6A 5KEZA 2V2DA 1QI5A 3GQYA 4PBEA 2PDLA 1ZAHA 3AHTA 4QS5A 3ARXA 4LC6A 1GOQA 1R3TA 4QFUA 1XLDA 2NQ9A 1E15A 3URBA 4AWSA 4CQDA 4A8RA 4AZ7A 4KWWA 1V3HA 2HWGA 1E9IA 4U4MA 3SB0A 4U31A 1OYCA 3NWRA 3SIZA 4POCA 1CXHA 5GNXA 3QZAA 2VRQA 1PZ1A 5D32A 3IIPA 5JH2A 4F8XA 3GTXA 4LH8A 2FZDA 5J8LA 3OZPA 3WFAA 5DELA 4IIFA 5A6KA 3DFNA 5CPNA 3U7BA 1BRLA 3NIYA 2EO7A 2HQAA 3SCQA 1IEXA 1JAEA 4EVZA 4PCNA 3GIQA 3S1XA 2F38A 5EY5A 4AYGA 5IBXC 4US6A 3QY7A 4XD5A 2V82A 2WVVA 2HMCA 5A6SA 3HFTA 2GVGA 2O56A 2QUMA 2V3EA 2QPUA 1UH3A 3RRAA 3CO4A 4A6GA 5AYBA 1KXTA 4PRWA 4FXJA 2OKOA 4PE8A 4C6LA 4CEUC 1OABA 4IH3A 3C5QA 1TV7A 1C7TA 1OCBA 3W28A 5ABFA 5EBUA 4ACZA 2FHFA 3SCWA 1FWEC 3CUXA 1J4EA 1TPH1 3RJXA 1UWRA 1BWVA 3VGDA 1V6YA 2AAMA 2R91A 4O12A 1KV8A 1KD0A 3E2SA 3B4YA 2JF6A 2CKSA 4W7WA 2PLKA 3N2OA 1BWLA 5C71A 3BH4A 3KLLA 4CVUA 1WZMA 4Y9OA 2Z25A 3F4NA 3XIMA 2PODA 5A6AA 3ARQA 1E6RA 4DBSA 4UOJA 3UXLA 4H01A 4HN8A 2RDXA 1IHIA 3EZ4A 2DSZA 3A13A 1K9FA 5BRBA 3BAIA 4J3SA 4ZB2A 4O1BA 3T0CA 3G1YA 2PDMA 1M6JA 4JHZA 4FLOA 2D22A 3WJZA 2WMIB 4DBDA 2REQA 2FGZA 3PB0A 2J7FA 3RMJA 2XH0A 3C8NA 2SFPA 3DFQA 5FJPA 2QV5A 1EEXA 2I9UA 1Q7ZA 3CLWA 4GQBA 1W31A 1FWIC 3QW4B 4JN8A 2F61A 1KQYA 1KBKA 2G5WA 3PFMA 1WXZA 2TAAA 1Q2RA 1JQXA 1EF3A 1UP0A 4TQTA 1I4NA 1QJWA 3LU2A 1OK4A 4LFYA 4U3CA 4DY1A 4A8NA 1Q6CA 3BGJA 3O6DA 1IEWA 4PODA 3OW1A 1T41A 2GQ3A 3BMWA 1MQQA 1ZPTA 4JTKA 3FS2A 4K8EA 5H1WA 1O12A 1AMYA 2PC8A 4C6MA 4US5A 4K7VA 4IPNB 2WCAA 2PWDA 3UR8A 3TOYA 2ZRUA 2F7FA 4H9TA 2RHGA 3MW7A 3B8IA 1LQ0A 3M0XA 1O7AA 4EXAA 4JDYA 3I7QA 5CC5A 5HPOA 3G1RA 2PS2A 3LUTA 4Q8WA 4PFMA 3S9IA 2A79A 3AUJA 1M9HA 5A6TC 3P14A 3VDGA 1UW9A 2VWSA 3MVIA 2PGWA 4WY0A 5D03A 3WFLA 4RW5A 4CD8A 4C6DA 3ANVA 5BXTA 2C19A 4AHOA 3EYPA 3WD2A 3DX5A 1SMDA 1BKSA 1C8YA 4GFIA 4NYUA 3T81A 2D69A 4Y9PA 5FACA 1IT8A 2NQHA 3E49A 1TE6A 2XSBA 1SW7A 4GI8A 4QS6A 4MOZA 3TYCA 2ZXAA 1OJXA 5I79A 1QK2A 1CB2A 3W75A 2E0PA 3H4XA 1DIEA 1ISWA 4AD2A 3ZIZA 3CHDA 3KOXA 2XIJA 3C0SA 4GCXA 5FJUA 3ZJ6A 4QSHA 3F5LA 5CGTA 4FXFA 1SFSA 3BTNA 4GINA 4C7GA 3HPSA 3D46A 1JYVA 3FW6A 3KTSA 3CPUA 2WSYA 2DT0A 3M5XA 1XJBA 4A2RA 1AL8A 4JTRA 2GL5A 2OELA 2EPNA 3VIHA 4DYKA 5L9FA 4H9ZA 4OOZA 1FOBA 2J7DA 3FSUA 4AEEA 1GHRA 1LDCA 1EDTA 1E1CA 3VCNA 3WQ6A 1ZHAA 1W1IE 2F9RA 4QLKA 5DRCA 4UTKA 3GD6A 4F2TA 5HNUA 3PZIA 3VM5A 4HU0A 4PBFA