3S83A

Eal domain of phosphodiesterase pdea
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
256
Chain Sequence
LALEADLRGAIGRGEITPYFQPIVRLSTGALSGFEALARWIHPRRGMLPPDEFLPLIEEMGLMSELGAHMMHAAAQQLSTWRAAHPAMGNLTVSVNLSTGEIDRPGLVADVAETLRVNRLPRGALKLEVTESDIMRDPERAAVILKTLRDAGAGLALDDFFSSLSYLTRLPFDTLKIDRYFVRTMGNNAGSAKIVRSVVKLGQDLDLEVVAEGVENAEMAHALQSLGCDYGQGFGYAPALSPQEAEVYLNEAYVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of EAL domain from Caulobacter crescentus CB15
rcsb
source organism Caulobacter crescentus
molecule tags Signaling protein
molecule keywords GGDEF family protein
total genus 87
structure length 256
sequence length 259
ec nomenclature
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3s83A00
4RNIA 3PFMA 5MKGB 2R6OA 4Q6JA 3HV8A 3HV9A 3GFYA 4LJ3A 4FOUA 4LYKA 4AFYA 3GFZA 2BASA 3GG0A 3PJUA 3PJWA 4Y9NA 3TLQA 4Y9MA 3PJXA 5M1TA 4AG0A 4Y9OA 4Y8EA 2W27A 3PJTA 3U2EA 4RNHA 5MF5A 4RNFA 3GG1A 5MKGA 4F48A 3KZPA 4HU3A 3N3TA 3S83A 3SY8A 4F3HA 4J40A 4HJFA 3GFXA 4KIEA 4FOJA 4FOKA 4Y9PA 4ES4A 4HU4A 4RNJA
chains in the Genus database with same CATH superfamily
4TMBA 3GU1A 3PFMA 4R34A 1SFLA 1EHAA 3N9RA 3V0TA 5BU9A 4AD3A 1T5AA 1DP0A 2ZX6A 4U3AA 2YDQA 4IIGA 4OT7A 1QW7A 2NXGA 3VMNA 3KOZA 3GYCA 4ZFCA 5DN1A 4ZB5A 4NY2A 3KL3A 1D3HA 3H2OA 4HNLA 3T4WA 5FEXA 5A6AA 2PDKA 3ANYA 1KLYA 3AYRA 4Y9NA 2FVKA 3SQMA 1G67A 5FJPA 2QUTA 1TTQA 3LZ3A 3SSZA 3NAVA 3V18A 5CC3A 1BVZA 1C90A 3FJNA 3KOYA 1OT1A 3TLLA 6ALDA 3T0DA 4I6KA 2GWGA 4ERGA 1W5PA 3GXPA 3ALGA 3GR8A 4OU1A 4PZVA 4GX8A 4LX4A 1Z8AA 1QT1A 3ENLA 1C9WA 4BA0A 4XZ9A 1JZ6A 1IWBA 3BH4A 4FALA 1LOQA 1UD2A 3O1NA 4L1WA 1A80A 4M56A 2WHJA 5AC7A 2XIIA 4YHEA 3V4BA 1S5NA 1LWIA 4YNGA 5LGZA 1ECQA 1TVPA 2Y7FA 3W07A 3OBAA 3L0KA 3MKCA 4YVXA 1K7XA 1WE5A 4HOWA 1O1HA 2Z1VA 3IJ9A 1Q6GA 1NVMA 3KWXA 1OC5A 4XD5A 2E1DA 2OTDA 2X1UA 4U2ZA 3EDDA 1KR1A 1H41A 2ATMA 4O53A 4WXZA 1XLIA 3G3MA 1Q7MA 2I1OA 3W9ZA 3V75A 4JFVA 2V2DA 2QCMA 3UWUA 3T78A 1GNXA 3LLFA 4DF0A 2XM2A 4UUIA 4LV9A 3NQAA 4JFUA 2MUCA 5ABEA 5FSEC 1VZWA 1Q8AA 4AVOA 3GG0A 1QOQA 3P62A 2GUYA 1E73M 2W0UA 1IQ8A 1XCWA 3A13A 3SCVA 3PK7A 4NRSA 4UMCA 2I14A 2YDSA 3NUKA 3MT1A 1U1HA 2ZRUA 2RKXA 4RDYA 2AL1A 5DCDA 2QPXA 3WX7A 3BLIA 2WMIA 3TROA 4KWSA 1TTIA 3DHDA 2HS6A 2B0MA 5T26A 4L61A 1DWFM 1A5AA 4CNNA 3WJXA 5KMYA 3IVSA 3WLJA 5GNYA 1W9DM 3EA2A 1KWKA 3GNRA 3USBA 4GFIA 3B9EA 1JUBA 1UP3A 4EF8A 2X7VA 2INEA 3DHUA 3B8SA 5HULA 2IPGA 4L7ZA 1VPXA 1UASA 3RLVA 2FIQA 1GQIA 4C7DA 3PANA 2GSEA 3O6YX 1RCOB 4O1EA 1OCNA 3VYLA 3V5CA 3DC8A 3AYTA 4K37A 1XIFA 3BLLA 2ZE3A 3NQEA 1LWHA 4UMBA 5FJJA 3R8RA 1VYPX 2J7EA 3PBUA 2Y5SA 2HPIA 1POJA 3GXNA 4KKXA 4ORMA 4QLLA 4C65A 2D20A 2Z1BA 5EB8A 1MDRA 5E0FA 4HNCA 4PSRA 1FWDC 3VZXA 3S2LA 3ZM8A 1R5YA 4MTVA 4AISA 4IIHA 4J1OA 5AC8A 2BP1A 1Z89A 4K8GA 2XUCA 2UV8G 1RJQA 4P8UA 5G1YA 5JU6A 3UWWA 2C91A 1VEOA 4C6QA 1I9CB 4M1BA 4NAFA 3CB8A 3N19B 2OX1A 3ZOAA 2IXVA 3H26A 3VC5A 3WJWA 5ABTA 4BHYA 3R79A 1PTDA 1FWSA 2VQTA 3HA1A 2QIIA 3IGUA 4PMRA 4PMJA 2ZUVA 3LI0A 2C16A 1US2A 3QHNA 1HJSA 2J4GA 3UCDA 2H9AA 4CQ8A 4QDMA 2Y88A 1M01A 4E38A 3B05A 2RGMA 2WCGA 3F5JA 2DQWA 1OX6A 3IIZA 5TIMA 2HSAA 2YXOA 1EGMA 4G6CA 3KVLA 1OX5A 3VU2A 5KINA 2ZX5A 4C90A 3DCPA 2GGGA 5I7GA 3GDLA 2XFFA 3C2YA 4QIUA 2E1WA 1JRCA 1UD8A 2VDGA 4MZYA 5ABGA 3B8DA 3EKGA 1MWOA 1GOOA 3BAKA 3WQEA 3VKJA 1XLAA 4DN1A 3CZEA 4I90A 5F4WA 4FI4A 1UMYA 4JKLA 3AHVA 4W8AA 2D2JA 2QLYA 2ZC1A 5BYWA 1R3SA 3RMEA 2V82A 1IHIA 3LTYA 2DZBA 1FCUA 4OKDA 1AG1O 2X8RA 3B40A 4WY0B 4ZO7A 3EEGA 2FGZA 2P0OA 3K13A 1JNDA 4ML9A 3WFZA 4U31A 3G8EA 2A3HA 2PRLA 3QV9A 3V16A 5CBJA 1QBBA 1R8LA 2HNHA 4HNVA 4C6KA 1XDJA 3BARA 4UQ9A 1HJUA 3KLLA 3R0KA 1QWGA 1NY1A 2VRQA 3D5HA 1T99A 4S3CA 4R85A 2ZUUA 3BDKA 2IQ0A 1EH9A 4MSSA 1DJZA 1R47A 4GI6A 4GVIA 3ARXA 1LWJA 4QBXA 3H53A 3SCOA 2C1GA 3ZSSA 3O3RA 1GVSA 1GKQA 1PHWA 3CB3A 1VR6A 3HU7A 3H21A 5TF0A 4YTRA 3B4UA 5BWAA 3OLEA 1P0NA 2NQ5A 1UWIA 2JBMA 2OWWA 1AD1A 4KFNA 1K77A 1TX2A 3DG7A 1RY0A 3URBA 1LTDA 3IIOA 3TOPA 3LK6A 1KCKA 1H09A 1CXFA 3VNIA 5I02A 4NXSA 4LAOA 2F2HA 2QV4A 4LANA 1G6CA 4AZ7A 3E5PA 5GQBA 1O7AA 4BZYA 1SU5A 4TVCA 3AS2A 1QNQA 4LCQA 4C6CA 1TJ1A 2HXUA 4PFHA 3N6JA 5HANA 5BMWA 1J6PA 1UOKA 4IIFA 5I24A 1TWWA 3VOCA 2VEFA 1KCZA 1Z7AA 1BRLB 3LCGA 1CXIA 5G1TA 1QBAA 4Q8MA 3QR1A 1NP0A 5BOEA 3OPSA 3N4FA 1F3WA 5C6MA 5HJXA 1UD6A 4WRHA 3UJ2A 1GWJA 3AMCA 4MLJA 2XH4A 4QS6A 3C0SA 3WELA 2DSZA 5A8MA 4FLOA 2BBFA 2PWGA 3CAQA 2PTWA 4JAWA 5IFPA 1OZMA 4QISA 4NZ4A 2HE8A 3LCHA 3V1HA 2VNCA 5DO8A 1W3HA 2XN1A 3N29A 1LLOA 1JZ7A 3QQ0A 4PULA 1YDYA 1JYWA 3UETA 4WGXA 4WHBA 5LIUX 3UA3A 2XG9A 2YJQA 1XXXA 4KRZA 2W79A 1L6FA 4AEEA 3RCNA 3QOKA 2YDRA 3CPUA 8RUCA 1TSIA 3WQ6A 1UPPA 2ZRZA 3H4XA 1V6YA 1ONWA 2TODA 3LY0A 3SN4A 1HKVA 4G7FA 1SZGA 5MHBA 1QU4A 5HXMA 2P0IA 4N9EA 3M6DA 1XPGA 4L6DA 3T2OA 2VFGA 1JI1A 3WLPA 5CJMA 3QXBA 3VFCA 1UC5A 1LBLA 2NVDA 4R7JA 2DW7A 4AZHA 3GXTA 2VD9A 1QPNA 1A3XA 1ECEA 3NM3A 1K8CA 2YCJA 4YLWA 1R3TA 4GRSA 2CZEA 4FX7A 4UQEA 2FPVA 1KXHA 1BAGA 2BGQA 3ECQA 3WF1A 2UZ9A 5F4XA 3APTA 3UXDA 2DSWA 1QR7A 4A6GA 5C2XA 4S3DA 1BGAA 3FXYA 1YXDA 3AFBA 4GJIA 3TYCA 3HOJA 4G7EB 1NWTA 3CT7A 2V5CA 4CNUA 4S2CA 1LUCA 1TPH1 1ADOA 1J0KA 1MEHA 1XRTA 4O13A 3W6MA 1DPMA 4KETA 4H19A 1SMDA 5CXPA 2J9XA 1W0MA 1BGGA 2RH9A 3V0UA 1JPMA 1JULA 3HGOA 2WMKA 3AMLA 1XPYA 7ODCA 1KWGA 3SAZA 3CBWA 3E0WA 4PUKA 2QJHA 3L12A 2EHHA 2AMGA 4CD5A 4OBSA 1UR9A 4MJMA 4PCPA 1K9DA 3HIJA 2Q8LA 1BHGA 5FI8A 2Q8ZA 2P3ZA 5CPSA 4M6UA 3APGA 3NO1A 3UP8A 1IE7C 3IJ6A 4H6EA 2QCCA 1TMHA 1S1RA 4MUZA 3SDOA 2PWFA 1XBVA 2OOGA 3KP0A 3DDMA 1W3JA 4UTFA 3W6YA 2YL6A 1OB0A 2AMXA 1PKMA 4Q4QA 4U5KA 3PTDA 1MVYA 3MUAA 1JF6A 1V7YA 3VNZA 4O16A 4JY9A 1V93A 1AL7A 5D2TA 1O60A 2D1ZA 2QKFA 5DT7A 1Z32X 3CZLA 5J5RA 4LB3A 2XPKA 3BSGA 4GYJA 3AHZA 2XINA 2YCLA 3DGBA 1E55A 1RJPA 2C0HA 2O4QA 3LB0A 4MKSA 1OWQA 1T0OA 4TXEA 5FF4A 1XD1A 5D4YA 4XBSA 5LXEA 4QG9A 1K9FA 5HMEA 4GI9A 2WVSA 2RFGA 4WF7A 4Y7EA 1NJJA 1YDVA 1E1CB 2OZ8A 5DBUA 5B7ZA 3PFRA 4JX5A 3TXZA 2A3LA 1BWVA 2PP1A 4HMDA 3GVVA 4NZ1A 2ZRVA 3L66A 4JTUA 3CL8A 3IGHX 3E02A 4US5D 1JDEA 3S42A 5IRPA 1Z6KA 5LIKX 4WKAA 4QJ5B 1Q6DA 5D04C 3IIPA 1R7AA 3UF9A 4RE3A 4KEUA 2PODA 1XLHA 2HV5A 2J7GA 3BG9A 2F9RA 4Q4SA 5A2BA 2WK2A 1Z69A 3GH4A 1AW1A 1CIUA 2IKJA 3GNNA 2V69A 2YYUA 3A23A 1QDSA 2NSOA 1XYFA 5G2HA 4EKJA 1PEZA 4YL2A 3WMBA 3P8JA 3WNPA 2PGRA 4HSNA 4AZCA 3WH7A 4C1LA 4KS0A 2ICSA 1XV8A 2X0SA 4Y8FA 4US6A 3UZZA 4FNRA 4ZOAA 4ENLA 3TZNA 3TJIA 2AQWA 1I1XA 4IQLA 5CC5A 2HBVA 4WDWA 2XJ7A 3T07A 2ZICA 3P14A 3DFHA 4LUSA 2POZA 1Q2SA 2QEZA 2QCHA 5HR7A 1E9LA 5SWUA 4W4QA 2IPJA 3STPA 1NP2A 2EO7A 3C2FA 3WN6A 4D6JA 1QJWA 2I5IA 4B5TA 3A47A 1MYRA 3UR5A 3REQB 1BF6A 1X7FA 4JOMA 4B16A 2BOFX 3F2BA 3EXSA 3H6OA 3WLRA 2QUMA 1RVGA 2GK1B 4UTWC 4WSHA 4G9PA 4BY3A 3WQDA 1G4PA 3IGXA 2DZVA 4UQDA 5CKSA 2JALA 3NL6A 4YIWA 5BXTA 3WG6A 3M5VA 3TQKA 5A5WA 1CENA 2ISSA 1GOIA 3CYVA 1X1NA 4LS0A 4O1AA 4H6QA 1H1YA 2E6YA 2F6XA 1FWEC 2PGFA 1VBGA 4DUVA 3M0VA 2Y24A 1T7LA 1RJRA 2G50A 4NHVA 5GNXA 1ICSA 2CESA 1GUVA 2QCDA 4E4UA 1UKQA 4FPSA 5H8UA 1H3GA 4LBSA 1FX6A 3GHRA 1GVFA 4OFCA 3CIVA 4HZMA 1OG0A 5HBFA 4ONVA 1CXKA 2OQHA 1VJZA 4HNNA 3WFLA 4CEXC 1MW1A 5FJOA 1JIBA 3QR0A 1XQLA 1XLBA 1V02E 3GFYA 2GDQA 2QQ6A 3QLLA 4WSJA 1B2YA 3MUIA 4QEHA 2GVYA 4IL0A 4D8AA 1OFEA 3LTSA 1MQQA 1LRQA 1NIUA 2CLIA 1FTXA 2RDWA 5H8MA 3HG4A 1XH2A 4B5VA 4E4FA 2OU4A 4ADTA 1PCWA 2NXHA 4JX4A 4C1NB 1Q6LA 5HJYA 2WMFA 4AG0A 1O6IA 1RV8A 1SMAA 4RCXA 2I5GA 4IGNA 4WDXA 1L0PA 1GVOA 4D72A 4QX4A 3W29A 4BWLC 1P1XA 1GW9A 1SQ7A 1THFD 4MWAD 4S3BA 3WZ0E 4EPDC 3W82A 4WOZA 3DFSA 2RJGA 2QIWA 4PMDA 4JIPA 4X9SA 3CQKA 1DTUA 1X97A 1OF8A 2VEPA 1X96A 3B04A 2PD5A 3V1PA 4Z17A 2EAWA 1FFQA 3DZ1A 5EA9A 1EX1A 5FJIA 1XL9A 3W7GA 1K70A 2R94A 2J7CA 2GJNA 3W7RA 1OFPA 4Y2WA 1V0NA 2BGSA 2CHNA 4IM4A 2UWFA 3NQDA 4FLSA 1F4AA 3LM3A 5HWJA 1QK0A 4PFMA 1OG6A 2C13A 1CXHA 2DVUA 1O68A 1Q6QA 3BLKA 1UR3M 2QAFA 5EBUA 2YFNA 4N4PA 1F07A 4Y8EA 1M6JA 1LL4A 3N4EA 2Y62A 1WBHA 1XQKA 1NWSA 2WNZA 1QNSA 2EJ1A 2J9ZA 3TZFA 1Q4NX 3AUOA 1PL9A 5CPLA 4MG4A 2PLCA 3AHXA 4KCUA 4IG2A 3FX4A 3GTHA 1H5YA 3NQ6A 1OM0A 5EPDA 1I8JA 2BXYA 3VIPA 2X0HA 3AZRA 2VR2A 3AUJA 4Z1BA 1TJ0A 1X6NA 4W5ZA 1D7FA 5AHFA 3A24A 3C5QA 4ADSA 4LVBA 3A5VA 1W5OA 3RILA 4TU1A 4GYKA 5M2FX 3AICA 4DY1A 4QG8A 2IW0A 3KTXA 1OF6A 1MUMA 3AZSA 4ERAA 4AZCB 3M07A 2ACUA 1TQXA 1UR0A 1V5XA 1F3XA 1EA9C 4JNYA 5I03A 3JZUA 1L2QA 3W25A 1W3TA 1XUZA 2E25A 3VGHA 3BAJA 1G0CA 3PB2A 2OOFA 4J28A 1BTMA 3D6NA 4MB4A 1C29A 4I5RA 4P7QA 1J8VA 3VIGA 5JQ9A 2XYLA 1CGUA 3ZR6A 3RX2A 1FDZA 2O9RA 2IMRA 4IWWA 3PB0A 3VILA 3EMCA 1RD5A 2WC7A 1CGVA 2OWXA 2WSKA 3AROA 3CUGA 4LYRA 3KZPA 4HHHA 3UJEA 3V36A 1VEMA 2VDIA 3FXGA 1G9HA 1JZ8A 3ONCA 4M81A 3THDA 1JAKA 1I6NA 3EWUA 2OO0A 1VFUA 3TR9A 5CPQA 1S39A 2VEGA 1ZJBA 2ZKMX 2GZXA 5AKQA 4ZQNA 4QNWA 1E3ZA 3U5UA 1H2JA 4B3LA 2CBJA 5DXXA 2OWCA 3EPOA 2WNWA 1UROA 3CL6A 1TPWA 2YW3A 3OW1A 3HG3A 1ICPA 5D9PA 5FL0A 1O5QA 5HQMA 1V3JA 2NQHA 1KFJA 4U4MA 1BG4A 1E6RA 3MI2A 3WF2A 3A3WA 1R6WA 1EXBA 2OEMA 5I3JA 4I5XA 3MVTA 1CBGA 1TPUA 4V28A 2OZ0A 3RM8A 2Q8XA 5E6ZA 4IP4A 5JUVA 4JGDA 1P0DA 1Q66A 4M6VA 1TPEA 1FHUA 2VGGA 3AJ7A 4AVFA 3AQUA 4AZGA 3CM4A 4GC4A 3I68A 4UBPC 1YDNA 1GOWA 4QROA 1M03A 4DBDA 7REQA 3SRHA 4LVDA 4ACZB 3RG6A 3W87A 5CBBA 3VDHA 2PDBA 4AWTA 3VKKA 4OOUA 1Q8JA 1X8FA 2QJIA 1A5MC 3VD9A 1X38A 3P81A 4DBWA 4BEUA 4GGBA 3EMQA 2WJZA 1KBIA 5FD0A 1VIZA 5A6JA 1WQ5A 1DIEA 1PWLA 2EBNA 4G8TA 4KQNA 4LS1A 2VRJA 3MMTA 3ALFA 4ZEPA 1GG0A 4ZB0A 1HGYA 4L80A 4K7YA 1VYSX 4HCDA 2EQDA 3K46A 1N55A 3NOYA 1Z3NA 3ZT6A 3PN8A 3KL5A 5KETA 5A8QA 1K8ZA 4PTNA 1W1VA 1EF3A 3EYPA 4N6FA 3ICJA 4CN1A 2EPMX 4JFWA 4DQWA 1C8YA 2IPFA 4Z2IA 4HA4A 2VENA 5MKGB 4TR9A 3OG3A 1B3WA 2V2HA 5F2GA 4FOUA 3ITCA 3SADA 4GUHA 5XINA 1AQ0A 2P50A 2Z7GA 2PDFA 3TSDA 1WX0A 8XIMA 3CLMA 1A4LA 4ZODA 1IXPA 4HTBA 3RFAA 3SSJA 1G4EA 4F3HA 3QF0A 4QAIA 1C3FA 4FNTA 4ATWA 2PZ0A 5CSSA 3NJ3A 5U4NA 1K9TA 2PB1A 3VDBA 1SUXA 4EWJA 3MUZ1 4EXQA 3I7RA 3F4WA 1KM5A 1EIBA 2IQTA 2DZWA 4QG6A 4Z2GA 3TV8A 3W4RA 1WDRA 4JTJA 3SUSA 3O2LA 3AYSA 4UZSA 1DJWA 1ZY9A 5A8PA 4IMFA 3N17A 3BSHA 3P60A 4AD2A 4LY4A 3M0HA 4FNQA 3VNJA 4ZSTA 1KFLA 1F8IA 1I45A 1XG3A 5DMLA 1VFFA 1WDWA 4NYUA 3S1UA 1BYDA 1SJBA 1ZL1A 4L9YA 3BCFA 1E3XA 1P5BA 2PDLA 3ZT5A 5D9OA 4HHMA 5BNKA 4X60A 3R11A 1DWIM 3WK3A 2UY4A 4FK9A 1TTJA 4OZOA 3VZZA 1RPKA 2Z2AA 1W17A 1KTNA 4HZ6A 1CPUA 1SZFA 2ZXAA 1HUVA 2QYGA 3QY7A 4H8NA 2VELA 3GW3A 4XTDA 3IANA 1L8NA 4RE4A 4Q8QA 3B0PA 3QKEA 4A3YA 4PCNA 4MB3A 4AD1A 3G6LA 1TG7A 3B8IA 3OG2A 1FH7A 2W4XA 3BLOA 3JUGA 5JH1A 2V3GA 4NZFA 1DXIA 4Q8TA 1R3WA 1J9YA 3DHPA 3M0ZA 2ZBTA 4KW2A 4LUTB 4PMNA 5CSRA 3IIVA 3PJXA 2WMHA 2BY3A 4YHGA 1QCWA 2A6NA 1E43A 3AJXA 3S0CA 2PC4A 2PE4A 4F40A 3LHVA 4HMEA 4TVUA 4D1JA 4F0MA 1EL3A 1MO0A 3I4KA 4LWWA 3VGGA 4N02A 3IRSA 3EWWA 5TAOA 4GZEA 4YJ5A 3P74A 4XVEA 2ZXQA 2H3DA 3G1FA 1ZQ5A 1MFUA 4DO5A 3TCEA 1P0BA 1E40A 4KIEA 4HCLA 3WQCA 4YMZA 1ZBCA 1V79A 3AU2A 2D2OA 1ZP3A 1AH0A 3QKZA 1AW5A 1GKPA 3AYVA 1AD4A 3NWRA 4OV9A 3OHMB 2H8XA 4S3FA 5I3IA 4LOCA 3AMGA 4MGGA 4QJ1A 2PDMA 3GVRA 2XSBA 4JIIX 2A3EA 2ZUTA 2VR4A 2CLOA 1JYXA 2PU0A 1PDYA 3SBFA 5A6MA 3WLIA 4JHOA 3A4XA 1A53A 1R86A 2GJXA 1DJGA 2WPGA 4G1KA 3W22A 4LRTA 4WIWA 2DP3A 2E40A 4ZQPA 4FX8A 3EWZA 4NSBA 4UNLA 2QULA 4AWUA 4PYSA 2NVAA 3PAJA 2YOCA 4IJBA 2A7RA 4DWSC 3CV1A 2ISDA 1FQ0A 3PUDA 2FZBA 2NX9A 5D2VA 1KRCC 3TH6A 1ML1A 1K3UA 1KXTA 3POHA 3MKKA 3MDUA 2Y7EA 2WAGA 1T6MA 4D71A 3W2KA 1BSIA 4AD4A 2R82A 5I00A 5G4WA 3JZEA 1WXYA 3BZJA 4LC6A 3MB9A 1X6LA 4EXAA 5K9CA 4O11A 4Q7NA 3E2VA 4GMEA 5IDIA 2XIOA 3ARVA 3TC3A 4GY1A 1OBAA 2Z4GA 1LLWA 3MO4A 1BYCA 4O1BA 3M7SA 3I6TA 3R5EA 4J5NA 4J40A 4IG2B 3SCWA 1V8EA 1NOFA 1GOQA 3S9IA 1K4HA 1TX0A 3GRIA 3NFUA 4N2YA 1E15A 5BRQA 3AALA 2PBGA 3LN3A 3CHDA 5K7JA 3LENA 1FXQA 3WMSA 4RXGA 1J2BA 3G77A 2R8WA 4LU0A 4S23A 3NL5A 1XSJA 2VTFA 1DBTA 3L7RA 1LBFA 2X09A 1D3CA 4EVZA 1E6XM 3D46A 3WUEA 4GUFA 1TYGA 4PBFA 3AMDA 2PGWA 1C8VA 5ECVA 4GGHA 4PSPA 4AWEA 1K4GA 3QZAA 6TIMA 1XC6A 3FDKA 4F2UA 3WQFA 3NDOA 1LCOA 1B57A 5CSYA 6REQB 4FSAA 3TMQA 2CXGA 1SR0A 1E0VA 3RLUA 4AHOA 3T4CA 3BL3A 1VFOA 1TVLA 3KOFA 1Y5VA 5LIXX 1JXKA 2VGIA 3U7VA 1RA0A 3GH5A 5EKYA 4W87A 4GX9A 1VFSA 4F2BA 3T44A 1HT6A 4WX2A 3WLHA 3UJRA 3MHFA 4OIFA 5F1UA 2TSYA 4HU8A 5I78A 5CAKA 1XP3A 2ZVIA 3IWPA 3W7EA 1TE1A 1XG4A 2REQB 2XIMA 1RK6A 4MJZA 1XIBA 1HN1A 1AMKA 4HVXA 4C6IA 2HK1A 2D0GA 5JXQA 1DORA 2WC3A 3GH7A 3CZGA 1O12A 5M1TA 3UWQA 3PWGA 3PTKA 4A35A 5C7VA 2EKGA 2HS8A 3SB0A 3FY1A 4C6FA 3QYSA 3NPUA 3ITGA 4AC7C 1TIMA 3OODA 3LZ5A 4XAFA 2DT2A 3WLNA 4KESA 4IICA 1OGBA 2I5QA 2ON3A 5L9FA 3L0NA 2WWCA 4S3JA 3VNKA 1E0UA 5BU6A 3ERPA 4ZMGA 1K6WA 4E2BA 3GG1A 1ELSA 2ZA1A 3PZMA 4LAMA 4A8LA 5MKGA 2PRMA 3AI0A 3KW3A 4H8HA 1YRRA 4W7VA 5EU9A 2V5JA 2OJPA 3IRDA 4KWWA 5RUBA 3DUGA 5AYZA 1XH0A 3KS6A 7XIMA 3LV5A 1ONEA 1FCQA 5AYYA 3W7QA 4YTQA 3H7VA 2OFJA 1JCYA 1MUWA 1LM1A 5A95A 3BV4A 2C79A 3N73A 1EXPA 3LYEA 3FVMA 3SRFA 2QHAA 1IT8A 2J6VA 3DYPA 2E9LA 4PUDA 2E77A 4H6RA 4DLMA 2Z1SA 1A49A 2C7FA 3T42A 2X41A 1QUMA 3H22A 4WUIA 4DYJA 1M53A 5I5RA 3BAWA 2J25A 4CCEA 2TRSA 4GY7A 3OA5A 3TYBA 1US3A 4LBRA 2VD8A 1KM1A 3SRDA 3W27A 4ZO8A 1ZS2A 1EP2A 5EFFA 1HP5A 3TONA 2ZTJA 1EJ7L 3W2LA 1AFSA 2C6QA 3EDFA 3NEHA 1H7XA 1UWUA 2OYMA 4NI8A 3WDJA 4UIOA 5TBOA 3VIKA 4JIHA 2VO5A 3HURA 1VCGA 3TSBA 4A8IA 3QQ1A 5LZLA 2OT0A 4NQ1A 4AUBA 3B8VA 3FHAA 4UQAA 1XYBA 3PNZA 1SJCA 1EUAA 1DE6A 5HUPA 1UPMB 2YXGA 4PBGA 5AB3A 3QPZA 4B15A 4N7QA 1V6TA 1YTDA 2NZLA 2YB4A 3VMOA 4BR1A 3QFEA 4HP5A 1CGXA 3T81A 1KCXA 3WMCA 3G1AA 2NT1A 3NZQA 2ISWA 3RIKA 2PP3A 3WQPA 6TAAA 1E6QM 4X9YA 2B31A 4P7LA 3M0YA 2AL2B 1VP5A 4FLQA 3DG6A 4X0VA 3FKKA 4CNOA 3LPGA 4PTDA 1TQJA 1WNOA 3DI1A 3TWAA 1K1DA 1TCMA 3G1SA 2QCEA 1JEZA 3NYZA 2UY3A 4GQGA 5E09A 1OJXA 3L2MA 4K1WA 3KEHA 4GXMA 3W28A 4CU7A 1PTGA 4JR5A 3EPNA 2XFWA 3BAYA 4GABA 2A3AA 4KGJA 2VC9A 4D6DA 5A94A 5TNVA 2WVVB 2OG9A 1P0EA 3P93A 2BXZA 2A79A 1C92A 1IXOA 2BLEA 5G2WA 2BFGA 4UTWA 2GLKA 3IJLA 2GSJA 3W7DA 1WAUA 1A5BA 4WSKA 3ONBA 3UJFA 1F73A 3M9YA 1GW1A 3DYOA 3W83A 4NJKA 4GZJA 3STEA 3BXWA 3W72A 3H2MA 3SCQA 3CYJA 3KCOA 3VE9A 3P3BA 5GJNA 1E4LA 2TAAA 1OYAA 4GOAA 3C86A 3LA4A 4HPXA 4O15A 3FVDA 1ENUA 4R88A 4DJEA 3W53A 4DM1A 2QAPA 1VAHA 2Y8KA 3S1XA 3IV3A 3ZYZA 4H41A 1J12A 1W9PA 2WYSA 2W3ZA 3THUA 1Z48A 3WLOA 3UJSA 3DFPA 4AIBA 5CPTA 4JHZA 3S46A 2P76A 3W7NA 3LRLA 1SZNA 3II1A 2G3NA 2ZC8A 3KCJA 4B5XA 4IIEA 3THCA 5FIPA 4I8DA 4Q4RA 4CU6A 4IPLA 3VAVA 3RNDA 3DKLA 4XIMA 1KKOA 3DOPA 1NSJA 4AEFA 3PJWA 1XIDA 1OFAA 4IFKA 4OWGA 3ABZA 1RPXA 1FH8A 1NEYA 1ME7A 3BV7A 3RRAA 1B3XA 3PZTA 1XIJA 4AY7A 2QJNA 4L1GA 1P1MA 1GHSA 2NX3A 2HEJA 3TKFA 4UTUA 2WSYA 1KFEA 2VVNA 4MNMA 2AGKA 3O6AA 3O9NA 4XUYA 1IT0A 3H7RA 5LHFA 3QPEA 1QPQA 4HN8A 3VIIA 4ZB2A 1OVDA 3CMGA 4KF1A 1M3UA 5DQPA 1JDCA 1Y65A 2X30A 1R2SA 1UA3A 3PPFA 2QR6A 1D2KA 1HKKA 3HPAA 4NILA 4IZGA 4NZCA 1H0GA 2QCFA 3ARSA 1AJ2A 1JCNA 1GG1A 2FQIA 4S39A 4KCTA 4F66A 3OOQA 1HJXA 2Y0FA 4HA3A 4J3ZA 1FCVA 3QTGA 1F6PA 2CZVA 4KPLA 4RJEA 3N04A 2PDJA 3TJ4A 3WDQA 3WH8A 4TQTA 3TTSA 2WHKA 2YCIX 1RQHA 2XH2A 3RDKA 3QBUA 4LAUA 3Q2DA 3B8TA 1PB0A 1RBAA 2G3IA 3WD1A 3WMLA 3STGA 1PS9A 2XFRA 1BWKA 3DYMA 3LCIA 3GC5A 1RLCL 3GAYA 3IARA 2DVTA 3N9SA 1WXZA 3LD5A 3L21A 3E2RA 4E3TA 1GOKA 4NNCA 3NQ8A 1B4KA 4MKVA 3NO5A 1AL8A 5A6BD 4DWDA 1PCKA 3LX9A 3UZXA 1RUSA 3RR1A 3BG5A 1Q6CA 2VX6A 3C8NA 1UUQA 3B0VC 1PHQA 1WDSA 3H2NA 5G5IA 1PIFA 1JFXA 1XH1A 1X1ZA 4XB3A 4KT2A 3U2CA 4G2DA 2Q6ZA 3DC0A 2WBKA 4EK7A 5IHRA 2WZTA 4YPJA 4KFPA 4DVOA 5BOOA 3Q65A 2MANA 1QNPA 4CNPA 4GWEA 1QI5A 4AB4A 3V3WA 4PA8A 3VKCA 5C70A 3WJZA 4YYCA 2DT1A 2XWEA 1VFLA 4EANA 2C15A 1U83A 5D02A 2I56A 2BV9A 2FVMA 4H3DA 3NQ7A 3OP2A 1W1TA 3HPSA 3EB2A 3OLIA 1HJQA 2W6RA 1V0MA 3RGTA 3QY6A 4LAKA 3S5ZA 5BRBA 3WLKX 4QQUA 4QGCA 1B5TA 4E4PA 3B06A 2XWDA 5DT5A 2XZ7A 3PZVA 2RDXA 1CT5A 2PZNA 1HX0A 1T8QA 3O06A 2Z6JA 5HNTA 4PGLA 2W67A 2W66A 4BWLA 5BROA 4GPNA 3W1LA 3NPVA 4F79A 1ZRQA 2G4FA 4LAZA 4HNUA 1J5TA 2WKGA 1WA3A 2V5DA 1OADA 1EBHA 5LA1A 3EEZA 1KGUA 3L65A 4GNVA 4YU1A 3T6CA 4BCEA 1J93A 2ZADA 3BSMA 4X2RA 1VH7A 4MM1A 3H2FA 4LNCA 2VFIA 3A21A 2NLYA 5HNRA 1FWGC 3LHYA 2ATSA 3HO8A 1J4EA 1YEYA 1UZHA 1X98A 4ZE4A 2ZZ7A 1Q45A 4GH3A 3W76A 1AQMA 3HQ1A 4JNMA 3FS2A 1UUOA 2E3ZA 5CZ0A 3WUFA 4RNFA 3BQ6A 3L4ZA 4GKLA 4PRRA 1J01A 1AH3A 2AL2A 5K9XA 1S2UA 3QFWA 4RXFA 4OTKA 2PDCA 2WKLA 1TV4A 1W2PA 5AC5A 3OYZA 2A7PA 4RZ6A 5FACA 3SJNA 5C2GA 4L64A 3S9ZA 1ZENA 4WK9A 3E9AA 3W6LA 4I8YA 3T7VA 3OZPA 4V33A 2V68A 4ZO9A 2WBGA 4AY8A 3NM1A 4Z2LA 3MA8A 4KEVA 2ZYFA 5GPRA 1FWNA 3IJ8A 3C3NA 3TNBA 4AYGA 3WEOA 3UGRA 4XKYA 3MSRA 3AHTA 3FLUA 3W2JA 4ML4A 3UYCA 2YL5A 3VIFA 4YWSA 4TVDA 1A5OC 1TWSA 1UD3A 3A5FA 2XH0A 4O57A 5A8GA 3ZQ9A 1ALDA 4DLFA 3UY7A 3TIMA 4A21A 2O9TA 5LKYA 3GIQA 4Q8UA 3SQSA 5I2UA 3T0AA 5I3GA 1HKIA 4XSLA 1EZ2A 4L9ZA 1FDJA 2CNCA 2HWGA 4JQ4A 3FYYA 1UR4A 2I9EA 1JZ3A 4R7WA 4FAMA 3QV7A 1H7NA 2BNJA 3W7LA 1L6GA 1UZ4A 4WCJA 2DZUA 4FOKA 4P8VA 2A3CA 2GUBA 5T91A 3B9AA 4H9MA 1IGSA 3GHUA 2D3NA 3N1AA 5K3VA 4AHPA 4HHLA 2WOQA 5FEPA 1QI3A 2Z7KA 4O0QA 1PTAA 1GT8A 1CYGA 3AIVA 1F2JA 1GYLA 2P8BA 4C91A 2XGBA 1JNEA 3SUUA 4BJHA 3B8UA 5DRCA 4PR4A 2P88A 4F9DA 4ADUA 1A5NC 3UG5A 3WDPP 2OMAA 5CZJA 4W84A 1S5VA 1QMLA 2ALDA 1N8IA 3SY1A 3GBEA 3AC0A 2J8FA 3QC3A 1Y5WA 4Q8VA 2FTWA 5LHEA 5REQA 3LM7A 3N2OA 3T2QA 2VZOA 4M7SA 2QJMA 2E4TA 2VFDA 4HYRA 1TPDA 3MSDA 2X2GA 4JYFA 4BQ5A 1G4TA 4Q8NA 2V38A 2HPMA 4B9YA 4NG3A 4GY0A 2WW5A 1E1CA 4L4MA 3T08A 1U1UA 2NT0A 2ZX8A 2F6UA 3EKZA 1OCBA 3NZ1A 1UH4A 3K8MA 1K8YA 3M64A 5CJNA 3HBLA 1FRBA 1H7WA 1R2RA 2EPKX 1X8CA 4JQAA 2CLMA 4DXVA 4GACA 2J79A 2FJUB 3HQPA 3WO8A 4CVUA 3WQOA 1W8SA 2PPGA 4NX5A 4W5UA 1F8MA 3E74A 2BHZA 3DESA 4FX6M 1KM4A 3MYPA 3CHVA 2PURA 4M19A 1S2VA 2W5FA 1FVPA 4PCTA 3LSCA 5ABFB 2ZVRA 4JL2A 2F2KA 3W0KA 1IEVA 2QMKA 3QHMA 1UOZA 3PF3A 1TRIA 2BG5A 3FAWA 3DGRA 1TB3A 3MMWA 3GVWA 4XD3A 2A5HA 2Q3OA 3U6WA 1RK5A 2YX0A 3UESA 1CW2A 3GWQA 3NQBA 4R9OA 4EAMA 3SEPA 3CU2A 3RLGA 3OO2A 4R3UA 3MMDA 3DHFA 1LF1A 1WDPA 1O5XA 5JVLA 3OTRA 4PMOA 2PDNA 2FDMA 3PR2A 5LIWX 1NOWA 4F0KA 1UWTA 4A3UA 4LV4A 3FK4A 1KRAC 4D9PA 3DFNA 3VD5A 4C7GA 3MYOA 4UFIA 4Q33A 2G8ZA 1EPVA 4JQ3A 3BLDA 4A05A 1OX4A 4AYSA 4UFJA 2CLEA 3A3XA 3E0LA 3PG8A 4ZE5A 3RYSA 4HQVA 3GX9A 4ICNA 3UG4A 2OEKA 3MTWA 2W61A 3VUPA 3HFYA 3VXGA 3MP3A 2B7PA 1L2UA 3DFTA 3TAOA 3T8LA 2DZSA 4CEUC 4JTEA 4X2PA 2P8CA 4KWVA 3LMYA 5HDRA 4QAWA 1R3YA 2AKZA 1GJUA 4INFA 4HA1A 1KB3A 2PWUA 1E51A 4CQ9A 3KCLA 4ZOEA 2VEMA 3MCOA 2H9AB 1K02A 2WKJA 1EJTC 4XQ6A 3UT0A 1BYBA 1FCBA 2QGHA 4G5DA 2ISFA 3LOTA 4HU3A 2PWDA 3GVGA 4PCFA 4D6FA 1ZFJA 3OZYA 4LYKA 2WQDA 3ES7A 2X40A 3SGUA 3EGJA 1SJDA 2D2HA 1KM6A 1JPKA 2NWSA 3WUGA 3BICA 2XVKA 4UTJA 3R58A 4IQJA 1WP6A 1PKLA 3ARQA 6XIAA 1CI1A 3WYZA 2HBXA 4YYFA 1ZHAA 4A2RA 3S5NA 4I9JA 1XLKA 3M0LA 4C60A 3CPGA 1S2AA 2BXVA 2A6LA 1KM2A 5C9XA 3NZPA 4J27A 3PUGA 1JF5A 4IISA 1KV5A 4PB4A 3QV6A 1V6VA 3BGAA 2QF7A 4MAZA 4GE8A 1GONA 4JTHA 2CIPA 3UZ5A 4LCRA 3TJXA 2F7FA 4NZ5A 5I07A 1GVIA 4JN6A 3CV2A 5MF5A 3W7KA 3G1HA 1RP8A 1IXQA 1AA1B 1XCXA 5FSDC 5IBXA 2CBUA 3ELFA 4NZJA 5CSUA 4Z08A 4K6AA 2J78A 3C0LA 3P80A 4PTVA 2PF8A 4N0RA 1VBJA 1JD7A 4QDPA 3C61A 4M29A 2GSHA 4NRRA 4MJ4A 3R94A 1OCQA 1RQBA 1LOLA 2VWSA 4GUJA 1NQKA 1KFKA 1PJ9A 3MSYA 3EOOA 3BW2A 4DUWA 1QI2A 2R1PA 1DJHA 1KV8A 3A4WA 2TPSA 1AODA 5CZSA 3JRKA 3VIHA 1KTBA 5D2YA 1EOKA 3OHIA 4P8XA 1QPKA 4DJDA 2XM1A 4Q22A 1NF0A 3UVAA 1VQTA 3AO0A 1U22A 3WBWA 1KBBA 4KEMA 5AYIA 1BXBA 3AS0A 5JBFA 3PZIA 2ZIDA 2OR2A 4JTCA 3TXVA 1NF7A 4DM2A 2YA0A 1EKOA 3KUMA 3VVGA 3BW3A 5DY2A 1XGDA 2W63A 4KCVA 3TX9A 1R7OA 3HGRA 3REQA 3ZMRA 5KTLA 1PUDA 1AK5A 4YN5A 3VNYA 3IS4A 2ZXDA 4HOXA 3R10A 4AFYA 1XM3A 1OX4B 2CLHA 1GTHA 3N13A 3MHUA 5BW6A 3RAOA 1D8WA 1RLDA 3UQNA 4PN2A 2QS8A 5CH9A 2FGBA 5J04A 2E67A 3FKRA 5A6TC 3NDYA 3PTMA 2VEKA 3RO8A 4ZO6A 4QCEA 3W1XA 5FJTA 3W7CA 4AD5A 2FZNA 3PJUA 3ATYA 3EMZA 2WLZA 3UR8A 3W01A 5IOBA 3QQWA 2DQXA 5CJ5A 1H61A 3TTQA 3I3BA 2ZUWA 4W8LA 1HKWA 1U33A 4YVPA 3KLKA 4NJIA 1YIXA 1YX1A 3RR4A 4S3GA 3DKJA 1JCJA 2OO6A 2Z00A 1OD8A 3EWXA 5EY5A 4Z0JA 2F38A 4XVDA 4Q4MA 5T9CE 4XV0A 4LW7A 2QCLA 4DBSA 2ABBA 4DF1A 1E0WA 1HKMA 1UB3A 4XZLX 2INFA 3GK0A 4RE0A 2HMCA 4IPNB 4DUXA 3F5KA 3TWBA 3VCRA 1J79A 4W86A 2Z27A 1QHOA 4OBRA 5CC6A 4B5SA 1FWWA 2Z6IA 3W1AA 2JIWA 4AMCA 5DMNA 4FIQA 4XAPA 2KX9A 3M47A 3BMVA 4AD0A 3BJTA 2DY3A 4S3EA 4GLEA 4REQA 3R1ZA 5C71A 5EYWA 1B30A 3M0XA 4TUFA 3M0IA 3AU6A 2ALRA 2DT3A 1FWCC 1R3VA 3FV9A 3B97A 3KBJA 2CU0A 4DYEA 3ZSTA 4XAZA 2VXNA 5J8LA 4Q8WA 1OFOA 3R6IA 1N8WA 1TMQA 3HTWA 5F1VA 3IJIA 1A4MA 1GHRA 4KWUA 1TE6A 4EIVA 3NSMA 3TEVA 2BVYA 4LSBA 4QFUA 2CZFA 1P48A 3GVQA 1E6PA 1P43A 3LHZA 3PSVA 3KS5A 2Z28A 1P0KA 3CEPA 3WL0A 1E4IA 3B9NA 3GD6A 1TV7A 4MF4A 4QEEA 1P6BA 1K7EA 3Q37A 2VMFA 3H4WA 2WANA 4U28A 3LLDA 1E0XA 3PBYA 4EAYA 4QSFA 1SR9A 4RZBA 4KGLA 1GVEA 4KIRA 2E6DA 1UW9A 2OEJA 3LV6A 4PMYA 2HVNA 4IFOA 4IFRA 2OZTA 2E8ZA 2HVMA 3EAUA 1XLEA 4OBTA 1HP4A 2AAMA 5AZ1A 4EOUA 1WPCA 4XZIA 3GTIA 2VKZG 4RDZA 3M1ZA 4H7CA 1QI4A 2DIJA 3NL2A 5C9UA 4YVVA 4O8AA 1UYQA 1AMYA 1ADSA 1GTEA 3C3UA 5I3DA 4IPJA 2HZGA 1S5WA 1J11A 3CWOX 3H54A 2OLAA 1A5KC 1SZRA 3QSRA 3RM4A 1F76A 1YMYA 5PTDA 3RK8A 1IV8A 5AFDA 2R91A 3M0KA 3I7SA 4XX6A 2ZE0A 4NL1A 4AH7A 3LUTA 2IUZA 5LYRA 4WR3A 3HV9A 2CBVA 2X2YA 4AIEA 4DO4A 2CKSA 3KFTA 3IJ7A 4Z1AA 2Y7GA 3G2GA 4FB7A 5KSWA 3COTA 3CO8A 1OYBA 6ENLA 4DAFA 5HPCA 3H12A 4OE7A 3BQ5A 4OV4A 4E2OA 2EPNA 2G4JA 3EOEA 4V1XA 1F05A 1TPB1 1IWPA 1EQCA 1RALA 4PBEA 5LIYX 3CHEA 4O54A 4PUMA 4J2MA 2EPHA 4UTTA 4J7RA 1YXYA 3CUXA 2ZFAA 3M6YA 5AHEA 4O19A 2QXWA 4CQBA 4GBDA 4Q4PA 1T41A 1BQCA 2YB1A 1EEXA 1UZ1A 3HM7A 3RPTA 3FJ4A 4GZ7A 2OELA 2Q71A 3PM6A 1W6TA 1XBXA 3ITTA 1MEIA 3GDTA 4P5UA 5EFDA 1EGVA 4UOZA 4MNKA 4QLJA 4KBXA 5FKYA 1B1YA 3GBDA 3GNXA 3M5YA 4HN4A 1REQB 1EA0A 4M3PA 1LQ0A 4C1KA 4F9JA 2DW6A 4UFHA 2FDSA 1AVAA 3CC1A 1RZMA 1HVXA 2BOEX 1JPDX 4PEKA 1EUNA 1XKYA 6XIMA 5ENLA 2YLAA 3V35A 1N82A 4F2TA 2VP8A 1QNOA 3QHOA 2RDTA 3QJAA 3Q4DA 2DIEA 3PZUA 4HOZA 4F0RA 4YTUA 4JFSA 2GDVA 2G95A 1XCFA 1IR1A 3EWCA 3W1RA 1XW8A 3V5OA 4A3RA 3R7MA 3TE9A 4K8EA 4B92A 1CX9A 4GINA 4GI4A 4B4FA 1FXPA 1XRFA 2WB5A 3CAVA 3WY1A 3SIZA 1UZDA 3CZKA 3SI9A 3USZA 3TYEA 2DSVA 4WVXA 4GIEA 3N6QA 3N3TA 3W74A 1LBMA 3EDKA 4WKFA 3TN6A 5IFTA 5BCAA 4N9DA 1I0BA 4QE5A 3O05A 3I4EA 4D6GA 1V3HA 2GVEA 4O1CA 3NXFA 3G8RA 3XISA 1UBSA 3DH7A 5E6YA 1S2TA 1G4SA 1Z42A 3CUHA 4DO6A 1IZKA 2Y5EA 3C2VA 1E1EA 4X61A 3CTLA 1GYMA 2CPUA 3ANVA 2RDUA 1TV8A 4OECA 1QK2A 4O10A 3K4DA 3LGGA 2J27A 2FTPA 1XIHA 3W38A 3UPWA 3FSTA 3MZ2A 8CGTA 4H8UA 1L9WA 2V8ZA 1EF2A 4J3XA 2E7FA 3QZ6A 3W7JA 1XJBA 3FNDA 1QO5A 3P61A 2UY2A 4IGSA 4PUNA 2B7NA 3SRKA 4TX6A 4ZQCA 1EJSC 1K9EA 4DZAA 1DYSA 4NAEA 4O12A 2H90A 5C5YA 1ZAIA 1OFQA 4BKNA 2X05A 3W2UA 1SO3A 1PAMA 5BXSA 5M3WA 4G56A 1VCFA 1LG2A 2OXNA 5JBEA 1VHNA 5I09A 3VO0A 1C91A 3NPWA 4FHAA 4NKCA 3GXDA 1POKA 3PG9A 3VOHA 5D2WA 3QZEA 3VOIA 1G7VA 4RNJA 2BVWA 4K68A 2YW4A 2V3DA 1KXQA 3F1QA 4MWAA 3RU6A 5ECUA 3TQ0A 1EWDA 1LQAA 3AISA 5ABFA 4LVGA 1H7PA 2QVNA 4ECLA 4PH6A 2OQLA 1VJIA 1FY6A 1EYEA 2V5BA 1JCXA 3WF0A 3VDCA 3WJSA 3C2OA 4LTSA 5C55A 4A3QA 3R0DA 1S3HA 2FGLA 2ASHA 4HA0A 1PXGA 4TV5A 4NI3A 4AHQA 2OSWA 1TV3A 3G0SA 3BCJA 5H6HA 3M5ZA 3QR3A 2AQVA 3QW4B 4PC8A 1M04A 3VX0A 1ZALA 1MUCA 1IZJA 4ALDA 4UQBA 4MNLA 3TU9A 3GQYA 1TUXA 4M6QA 5D2XA 1R46A 4JTSA 2BTMA 5LNUA 3FSUA 4B2DD 4M24A 3UPMA 3MHGA 3VKDA 1WO2A 1I2OA 5I3HA 3CK5A 3KBWA 3HF3A 3ITVA 4ACZA 3PNUA 1VLIA 2UBPC 3W7IA 3P0WA 4FA3A 1XS2A 3MC5A 1H0IA 3PTQA 7TAAA 3O6CA 4PL2A 2CITA 3LCFA 1UBPC 4LQ1A 1A5LC 1HL9A 4LBUA 1BSLA 3L5LA 5CG0A 3IVUA 3KOWA 5A8OA 4D8ZA 1DWGM 3OQ8A 1DXEA 3TC7A 3TR2A 1TJRA 4GNKB 4C6LA 4RPPA 4FXSA 2Y89A 4HTYA 1QHPA 1EBGA 1S5TA 1MXGA 4HMCA 2A7NA 1ITCA 3KBVA 3NR0A 4U3CA 1CDGA 1ZAHA 1BEUA 3S2NA 2PSNA 1Z44A 4M8UA 1DE5A 4KFOA 4N9CA 2GQ9A 2XISA 3ISIX 2XSAA 2REQA 4GKTA 4XZNX 1NAL1 3ABSA 1XLFA 1TWZA 3E0FA 1F7BA 2CLLA 4B5NA 3KHDA 3R89A 3QN3A 1MDLA 4N9BA 5D03A 1B3VA 1J6OA 2O9PA 1EWEA 3ORWA 4O14A 5D9NA 1ODZA 4Y9PA 3CMJA 2D24A 3HMJG 4NVTA 3L4WA 5FAJA 3CHFA 1HJVA 1H62A 4H9TA 3W81A 1WCGA 3GE7A 2Z29A 3LDVA 1M41A 4NIRA 4XZWA 2VFFA 2YZ5A 3SN1A 3JS3A 3LQLA 4C6DA 4X0NA 5BWFA 1O5RA 4B91A 1US0A 3C6CA 1O95A 1JZ5A 2E68A 4HJWA 5EMYA 1FHVA 2PTYA 3S8HA 2UY5A 1RR2A 3LXCA 4GXWA 3STFA 3BJSA 4PE8A 3LHWA 3CEUA 1H11A 1MXDA 2R1MA 2V2CA 3T0CA 5E93A 5A6KA 5IHSA 3P2VA 3UR7A 2O92A 3DU0A 1TWDA 1PZ3A 4GVGA 3EZ4A 2VX7A 1LT7A 2QZRA 2OB3A 1EJVC 2FHFA 5U7SA 2FJKA 1V0LA 1V02A 3G1YA 2E9MA 4C1NA 3VX1A 4ZCWA 3D3FA 1UR2A 2HVOA 1VHCA 2PCQA 3L5AA 3O8AA 4I9TA 4CN4A 4GIRA 2ZZ3A 1MZHA 1SW3A 4N42A 4XWUA 4NUWA 4LRSA 4JYDA 1W1B1 4EXBA 3PBGA 4BQ3A 1MQPA 2YL9A 4JTGA 2OCZA 3KRSA 2GVLA 3CO4A 3S2CA 3IIXA 1UKSA 2G96A 1WUFA 3DBNA 3I65A 3SZ8A 2AKMA 4CNSA 2QDEA 5E0CA 1SW7A 3U4AA 2BWGA 4Z1DA 4WXYA 3XINA 4BQ2A 2J13A 5EGRA 3GM8A 4IGHA 3VGDA 4B2DA 2X1SA 1WDDA 4IMAA 1VF8A 4DWSA 5C0QA 4AQLA 1F6KA 2EPLX 4MZ1A 4TO8A 4GK8A 2DH3A 3EXRA 4NF7A 4LVFA 3VCCA 4E8GA 4HU4A 4WEVX 1MW2A 1PZ0A 4J3TA 2OKOA 2FZ8A 3HG2A 3NIYA 4C6NA 1REQA 2G0WA 1QATA 1MW3A 1Q6OA 4K2SA 1OZQA 3UU0A 4E0CA 5A8NA 1XLGA 4PTXA 6PTDA 3VUSA 1VGAA 3LBMA 1NTHA 5LNSA 1G7UA 1DQUA 4JKMA 3VNMA 5CZKA 4Q8OA 1NDZA 4LVAA 1JCLA 4N4QA 2ZOXA 4IGMA 4FXJA 1W9VA 2WXDM 3OVRA 2JKAA 3TW9A 5C9RA 1PYFA 1SFJA 1R9ZA 1EYWA 4E3VA 4JS3A 4S38A 3S6TA 3VOFA 1Q6FA 1S2CA 3VZYA 1G69A 4CLMA 2V67A 1LZOA 4JN7A 1KGXA 4GH1A 3GZ3A 4JTFA 1AW2A 2JIEA 3KX6A 2C71A 3CUFA 1HQTA 3ZR4A 2YKKA 1YKWA 1E71M 1ZBKA 1CLKA 1QO2A 2Y1HA 4JDYA 1DEDA 3WDRA 1KCLA 8TIMA 3M7WA 3GU9A 3KTSA 2PTDA 4ZSUA 3ZLGA 3H8AA 5FF2A 2PU1A 4D2JA 3G22A 1WKYA 4CD4A 3N6HA 3RCYA 5D30A 4ACYA 1LQ2A 3W7PA 1A5SA 3KAOA 2DORA 2PTXA 2GL5A 1JL8A 5DANA 4HBKA 3ZXWA 2DV0A 3EOSA 3B3DA 4EF9A 1DJXA 4JTTA 4ZQRA 1XHGA 1WOAA 3CNYA 3LBOA 3GNPA 2DJXA 4DAIA 4FZIA 1I1WA 3HQOA 3W2NA 2FMOA 2YYTA 4QTGA 4Z2HA 3OEXA 1CECA 2NX1A 1V6XA 3UXLA 2WV8A 2PWEA 3QMSA 2E6FA 1TKKA 4HK5A 5CGTA 5HJLA 1SJAA 2AGTA 3S1VA 3WQ8A 2FVLA 4UTIA 1XDMA 2CWNA 4J4KA 3LPFA 3N9KA 1K7FA 1ITUA 1KLZA 1GZJA 1XX1A 2QPSA 1XF0A 1QNVA 4Y6GA 1L8PA 3AIUA 3TTYA 2DUAA 5HATA 1SO4A 1E9ZB 3GNOA 3UZWA 4V1YA 3W86A 4DI9A 4AC1X 2O55A 1E70M 1J0YA 1DHPA 1H5VA 3P6LA 3OB8A 3Q45A 3VGEA 1PIIA 1XIEA 3LPOA 1QPOA 3A22A 3U0HA 3URAA 1TR9A 4W7WA 1MRAA 3C2RA 3MV11 3KRUA 1F61A 4A22A 1GJWA 2D3LA 5K9DA 1A5CA 1JQVA 1KR0A 1P7TB 2BZNA 1I75A 1WZLA 4DUOA 5CZTA 4AX7A 1LRTA 4MFEA 1E72M 3WNKA 4OGZA 3W70A 3SCTA 2ZUSA 2GJPA 2PD9A 2RGLA 3L5MA 4TTUA 4HNTA 3PY2A 5FCZA 1DV7A 4PCSA 1BG9A 3G1RA 2V81A 1MSSA 1DHKA 4YS1A 1KGWA 2OLHA 4MPQA 2VYOA 2Y63A 2Z24A 3AWOA 4JDBA 2WMGA 3SFKA 1EIXA 3MKVA 4P61A 4OJYA 3RXZA 3ARYA 2Y8UA 3BGJA 3ZLHA 4CD7A 1JGMA 4GVHA 3TW6A 2PI6A 2MNRA 4JTAA 1RP9A 3RJXA 3IK2A 3WH5A 2VUYA 4JPGA 4DIAA 4UNKA 3W84A 9XIMA 4Q7IA 4KCWA 3T9PA 1V3KA 1X39A 3TJLA 1YW1A 4ZQMA 1MXSA 3SQLA 3U4FA 1HF6A 3FJ6A 3TQPA 3FHQA 3PUEA 2PEVA 1QXLA 4Z2KA 3OJGA 4IQEA 4M6PA 2Q02A 1PBGA 1Q85A 3C8FA 1JCTA 4ICMA 1NDYA 1R3QA 2DVXA 4CN6A 2FFCA 5CEWA 4ZXLA 3M44A 1RVKA 4JEQA 2VWTA 2NVCA 2BODX 3ABQA 1TCDA 1VPQA 1EC8A 2PAJA 2FH8A 2ZZ2A 1V0KA 3WBEA 3DN5A 5BMXA 3ZLFA 4IJRA 2C19A 4DI8A 3W7HA 1I2PA 3CWHA 3T0BA 1PVNA 4FO4A 4AX6A 4LH8A 1JJKA 1Z9AA 4MOZA 5A6LA 2E0PA 5CGQA 3EB3A 4OHQA 3A9BA 1H63A 2PDUA 2PWVA 4M51A 3P82A 1F5ZA 1N7KA 3N2MA 3MZNA 3BOLA 4RR4A 2R6OA 5AC6A 4PUUA 4KH2A 4QJ4B 2QF8A 1SO5A 2VR5A 1S2WA 4K8HA 4EWND 2JEQA 3AIBA 4O0KA 1V6WA 2Y6ZA 4ZA0A 1OC6A 1V77A 4K1GA 1UKPA 4RV3A 1W1A1 3UGVA 3CQIA 1HXJA 4TOQA 3MBDA 2IKHA 2XHYA 2VVSA 3AZTA 2GVGA 1CEOA 8A3HA 1T40A 2YLLA 3MU7A 2BDQA 1F4HA 1F6YA 3GFXA 1CGYA 2ZZ1A 2DT0A 3BO9A 3GG8A 3N2TA 4RNIA 1HG3A 2EKCA 2FYMA 3WQWA 3ZWTA 1EPXA 3DG3A 1VRXA 2RUSA 1XD0A 1SFTA 2YPIA 4UFKA 2FHBA 1ITQA 4IT1A 1YNPA 2V9DA 2ZX9A 4V15A 3N4AA 2Y85A 5KZEA 5EMKA 2ADAA 4ICCX 3UZJA 5IDZA 4LUYA 1XGZA 2PDXA 1IF2A 3NQCA 4A29A 5HMSA 4LGXA 5A2AA 3SCSA 1ZNNA 2ZA2A 1PSCA 1VC4A 3AMKA 1ZB5A 3OGSA 2EXOA 3WK2A 4KERA 1FWAC 1J18A 1WV2A 1YQ2A 3OQEA 1Q2RA 3H70A 5XIMA 4H9YA 3L4UA 1TFVA 1W8GA 5DF0A 1VENA 3TCSA 3H2CA 3IV8A 3TMLA 9CGTA 3I3DA 1MQRA 3EWBX 2KAUC 1KTCA 4QLKA 3E1F1 4EP8C 3VM5A 3UZYA 1V7AA 3PJTA 3IAPA 4J3UA 2BHUA 5C54A 2PLJA 1IEWA 2D0FA 1ITXA 3R25A 3GW0A 2H6RA 1PX4A 4CCDA 4MFDA 3M0JA 3C2EA 1DOSA 4LUTA 3ZZ1A 3VIJA 3KVKA 4C6EA 2Z1XA 2NQ9A 5G2IA 2JKEA 3BPWA 5TD4A 1H1NA 1X7IA 4B9ZA 1C7TA 4DJFD 1RXOB 1I2QA 1AQHA 1A3HA 4DWSD 3TTOA 3M46A 4F4RA 3HPFA 2O56A 1UH3A 4Y9OA 1XINA 1K03A 2VCCA 2PDQA 1DJYA 3D0CA 1QW8A 3NG3A 1XIIA 4DZIA 3DX5A 4JTKA 4K3ZA 3MSGA 3RMJA 1XSIA 2R1LA 1MMFA 2GOKA 2Y2WA 2CBIA 5EMUA 4KWOA 4HPJA 1ZLPA 4LUIA 1KO0A 1OIFA 1PO9A 2CC0A 2ISVA 1YDOA 3S1WA 4AZIA 1TPC1 4IIBA 3CTTA 4DJED 4FOJA 1HO1A 3N11A 3Q94A 3WKZA 4O50A 2ZX7A 4FP1A 3VNLA 1VIWA 4CQAA 1LOSA 4LUJA 3MS8A 4QS5A 1HGWA 4ILSA 4K39A 1GKRA 3WD3A 1YNYA 4GXPA 2CLKA 3MJMA 4DJDD 3SN0A 1EX5A 2C3ZA 3T8QA 3LS9A 3UG8A 2WVTA 1Q3NA 4O4WA 3ITOA 4AMAA 4GC3A 4CD8A 1E6SM 4LF2A 2PDYA 4XKMA 4IHCA 4GQRA 3FAXA 2VX5A 1FH9A 1TZZA 4W9TA 4FEZA 4WJEA 4KMQA 3U7BA 1JYNA 2GFTA 3WH9A 5T8GA 1IZCA 3FYOA 3QGVA 3VGFA 1FHLA 1V4YA 2OPJA 3WLMA 3URQA 5D05A 3RX3A 2VFEA 2E6AA 3U2OA 3UVIA 3WDHA 1OSEA 3U9IA 4FXFA 4BI5A 3T2PA 5C7HA 1A0DA 5GVJA 1FWHC 4XTIA 4LYPA 1SSGA 1EC9A 3TLQA 4PTMA 3S6DA 3UPBA 2ZZ5A 1E56A 4WKHA 3ARZA 1B9ZA 1K6AA 4QE4A 3P5YA 3I7QA 4ERIA 2E9BA 5A69A 4XO7A 1JRBA 1QRQA 1YXCA 2GVJA 3BCDA 2I17A 3VNDA 3PPGA 1FKXA 3PZ9A 4Q6XA 2DIKA 3A6OA 5M17A 5D09A 1JZ4A 2WCAA 2P5NA 4I3GA 3EX6A 4Y9AA 4X22A 2WSRA 2EG7A 2WVUA 3WNLA 3KE0A 1SYTA 1TWIA 1PKNA 2A1YA 2R1KA 2BMBA 3BTNA 3KZSA 3H23A 2HK0A 3EX2A 5DBTA 3KHJA 1XR2A 1KXVA 4QP0A 4LF1A 3L9CA 3DECA 1NM9A 1ZPTA 2CETA 3H55A 5AHIA 3QSTA 1ME8A 4YCOA 4ZR8A 1JDDA 3RO6A 3GS6A 3ES8A 4HB7A 2PDWA 3R8HA 1XSKA 3BLEA 4BK9A 4DEFA 3BGGA 4RZ4A 1GK8A 3ZWSA 3HB9A 1RCQA 2HQAA 2QDDA 1LL6A 3L4TA 1ZBVA 3ANUA 1VLWA 4DBEA 5KZDA 1RQEA 1EC7A 1DIKA 3S83A 1AJ0A 2JF7A 3DXIA 1EP1A 3F2DA 4HJFA 4POCA 4HMNA 5L6UA 3GIYA 4RUBA 3MO7A 3MCNA 1SM9A 3O6DA 5FF0A 4L4OA 2OGYA 1A5UA 3B9DA 1GZGA 2I7GA 5M03A 3RRXA 1QPRA 3UCCA 1FUYA 1OK6A 2AQOA 3B03A 3S5OA 4XUGA 3O07A 3L67A 2Z25A 3E2QA 3G24A 3URNA 1TA3A 1ZUAX 1AJZA 1KA9F 3G18A 1R38A 1YHTA 1H4PA 4GUIA 3TN4A 4IJCA 1JPIA 3KRZA 4W88A 2QCDB 3WL1A 3H2AA 1OFBA 2C1HA 4MMWA 1P7TA 3WNMA 4J3SA 1NFBA 4FF7A 3FFSA 1FWTA 3CUJA 3MWAA 3S1GA 3SCRA 5F2IA 3PZGA 7CGTA 2QDHA 2DPEA 4F0LA 1DWAM 2ZDSA 4BFAA 3VI2A 1TMLA 3RLHA 2G37A 4JCLA 4L6HA 2X1TA 2HCVA 4V2XA 3L68A 2QUUA 3L23A 1O94A 2YL8A 1XC4A 5FJRA 4PEEA 2HJPA 1RAKA 2X1IA 3PP7A 2HTMA 4HPNA 3E0VA 3R8GA 4LY8A 3K1DA 1UD4A 1EJXC 4UWMA 3CIXA 4L9XA 4GCAA 1BF2A 4JCMA 1BQGA 1ZZMA 2VC7A 2ZCGA 2HDJA 3MCMA 1IT7A 1JDFA 1JFHA 3N25A 4NYYA 3G1VA 1E0TA 4A3HA 1FP8A 1TR1A 4QRNA 4JTIA 2ANUA 3WD0A 1YTEA 1XIMA 2J7FA 3BMXA 2NWRA 3VC6A 2ZUMA 5FA5A 3ZO9A 1EQPA 1A50A 3PZNA 4TV6A 6A3HA 3LERA 3OVQA 3RX4A 3KVMA 2EJAA 3LGEA 5E9AA 1DIDA 3R2GA 5DRIA 3TUUA 3ZJ8A 2J75A 4XAGA 1M65A 3ZVIA 5DLCA 4GNJA 2VHLA 3SCUA 1O5KA 4ES4A 1S38A 2J7DA 2ESCA 2FFIA 4HYVA 4IX0A 1JVNA 2FH6A 2DUZA 3UXAA 1GPFA 2PBOA 4P7NA 1TJ2A 1IWAA 2IKGA 4AXNA 3CQHA 4DO7A 3B8WA 2CFFA 4Q8PA 1IEQA 7PTDA 3UXKA 2C8NA 2Z26A 1RY8A 4BQ4A 1RA5A 2PDHA 3QRHA 1KFCA 3WD2A 1FA2A 4GYPC 5DXYA 1WZMA 4MDPA 3W71A 3AHYA 5HR6A 3RN6A 3VE7A 3U2ZA 1R0MA 4GZIA 2R1NA 1NDWA 3WBYA 1RCXB 2H3BA 5C9WA 2J88A 2GJXB 4UMAA 2PLMA 2OYKA 4C6OA 5FL1A 4ZXOA 1Q5MA 1FKWA 4J3VA 1XFCA 2J9YA 4LXFA 1B3ZA 3UCQA 2E28A 4W85A 3MPGA 3SW6A 5G1MA 2YCKX 3QY8A 1OABA 3F4NA 3N2BA 4HK6A 2OODA 5GJMA 1YPXA 4KRTA 1PDZA 2XDFA 1KNWA 4L6OA 2G97A 4HPHA 1VBHA 4KRUA 4W89A 2NV9A 1WBJA 1J0JA 2GGIA 1A3WA 2V3EA 1EJUC 4FR1A 3CIWA 4D6CA 1R87A 2Y4SA 5D33A 1V6UA 2I9UA 3LBCA 1OGSA 2R9RA 3CXOA 3C4UA 2XN2A 4JBRA 3NL3A 3NA8A 3Q67A 1DTNA 5AHNA 1XISA 4RL3A 1U5VA 1NFGA 2YA2A 4C5YA 4NASA 4X63A 4S3KA 4QCFA 1PV8A 3F5LA 4DB7A 2PA6A 3ABOA 1ZBWA 1R9XA 3TQVA 3NOEA 3G0XA 4JIEA 1JR1A 3FIGA 2QGYA 3JR2A 3W1PA 3QM3A 3A9IA 3W24A 1I4NA 5C9ZA 2YIHA 4REQB 3TA6A 4YTTA 3OGVA 3GKAA 1EZWA 2VZVA 1JD9A 5T9BG 2YCEA 3NTYA 4IIDA 3L4VA 3W02A 2R14A 2Z1KA 1HJWA 1GQLA 5JH2A 4RNHA 1W54A 4GA8A 1JGIA 1ZP4A 5I6SA 3S2JA 5LNVA 4JTDA 3T09A 3UW6A 3SUVA 4NAFB 4GO8A 1SFSA 3ABRA 2R24A 4NAEB 3VKAA 3CT2A 5C8BB 4LS2A 3CZ8A 1CLXA 1U5JA 3EPMA 3B4YA 3N15A 3C0QA 4W7UA 4UOQA 1B54A 2BS9A 4JYEA 2YDAA 1LJYA 4M0XA 1XIGA 1LLZA 3S3GA 1S46A 1E4MM 3BW4A 3RM9A 1BKHA 4CU8A 4HZ8A 2JQXA 1YLVA 3RHGA 3SM0A 2A85A 1BWLA 4HD5A 4CUCA 2NSXA 3RU8X 3S47A 3VOJA 3OU8A 1LT8A 3QGKC 3TNOA 1GVQA 4EACA 4XZMX 4HSOA 2ZZ6A 1UWQA 3W1TA 3IVTA 3ZVHB 2A4AA 4OQVA 5A3HA 2RHGA 3AIRA 1IGWA 2KZHA 3GAKA 3QMTA 1W5NA 3OBKA 4IXXA 1BFNA 2WSPA 4EE9A 5H2ZA 3PS7A 2QNEA 4UR9A 3T40A 3HMCA 9XIAA 2ZUNA 5HMDA 2G3JA 4GIYA 1XYAA 1JZ2A 4DX3A 4TX9A 3WJYA 4DWSB 3CUZA 3MW7A 1GOMA 2PDGA 3NQMA 4IH3A 3CV7A 4TMCA 1DQXA 4JQ1A 3UA4A 3ARWA 4ZOCA 3WNNA 3H4GA 4WQ6A 1J10A 1P6CA 3EX4A 3W73A 3WDIA 1OK4A 5D8WA 5EMJA 4MWAB 5FAGA 5HK4A 2J7HA 1E5JA 1J0ZA 4LEFA 3E0IA 1TELA 1AH4A 3AS3A 3NNTA 2DH2A 1VKFA 1W3LA 2VOMA 4MADA 3LEPA 4GYFA 2C1IA 1F3EA 4AEOA 1QAPA 3ME3A 3W85A 3CWNA 1UKOA 1HVQA 4OVXA 2J66A 3EA1A 4O0ZA 2QCNA 1C8QA 3PPCA 4L56A 3N12A 3S2MA 5CGMA 2XGIA 3QTPA 1W32A 1XDLA 2Y5JA 3FA5A 3UYIA 4XZBA 4IUOA 3N3MA 2JKPA 3MY9A 4BI6A 1QOXA 4K7VA 3WNOA 3HN3A 1LUCB 1M1BA 1OD0A 3ARPA 4CD6A 3VCNA 4LNYA 4WZHA 1MNZA 1XLCA 1EP3A 4GIAA 4GYPA 1V08A 4B5WA 3GR7A 4UCFA 3O63A 5K4ZA 4I6VA 2F61A 3UNTA 5LA2A 1Q65A 5D37A 2G5WA 3WBXA 3NZGA 4Q3MA 3N14A 3NXLA 2VURA 4AZ5A 1FWRA 1LROA 1MEWA 1A0CA 3ITXA 2XIBA 1GYNA 3CUIA 2BY1A 1BVNP 4PODA 4Z1CA 1ZJHA 1W2VA 3KXQA 1EHNA 2WZIA 5FF3A 2VJXA 2OKTA 3ATZA 5HUOA 1Q7ZA 3GTNA 2D69A 3FJLA 3G6MA 2PS2A 4EPKA 1CWYA 1LYXA 2G41A 2F6KA 4GHRA 2EG6A 2J77A 1D7KA 3NCOA 1JCMP 5CPNA 4QXIA 4IOTA 4L1XA 1WZAA 4A8RA 1IR2A 3L4XA 3WEMA 3WENA 4K38A 1OEPA 1DJQA 3K30A 3W26A 1KFBA 2QW5A 3LCWA 3N2XA 1HTIA 4BF5A 4GFSA 3GC4A 4WJXA 1EO5A 3TN3A 5LNRA 2J7BA 4WJ8A 2GPTA 1YPIA 3VOGA 1UWRA 1EDQA 3KWSA 3GXFA 1J96A 4HHPA 1RD6A 1M7JA 1UHVA 3H2EA 3UERA 1DIOA 4WLCA 3E49A 3QGAC 4ZQOA 1FFRA 5CLWA 2DDXA 1FHDA 2A21A 5HMFA 3TP4A 4E5TA 4Z1YA 4OUEA 1J0HA 2A3BA 3OGRA 4Q32A 1W1ZA 3UNDA 4DELA 2X1RA 2JFEX 5H1WA 5DY3A 4GO9A 3WIJA 4LC8A 4YTSA 3D47A 3OIHA 1MFVA 2IKIA 4MY9A 3A64A 3IK4A 3FGCB 3CLWA 2DGAA 5D8ZA 4QE1A 1IEXA 4ATLA 2OVLA 1QVBA 3ITYA 2IQDA 4RDWA 3SUWA 3WLTA 4DNMA 2B4GA 3NYDA 3WF3A 4R53A 1OFRA 4H9ZA 3BMWA 3LCLA 3DFOA 1CGTA 2XIQA 4DJFA 1TPVA 1Q6EA 1Y0EA 3QVQA 3U2EA 4H1ZA 1XWYA 2Y61A 3TFXA 1H49A 3MUY1 2W9MA 3SY8A 1RBOB 1GGOA 1MI3A 2WWDA 2BX7A 4LYQA 1V3MA 3S5SA 5I06A 4ATDA 4YCPA 3VK5A 1AUSL 3GR4A 5DELA 4Z42C 3QEZA 1H1ZA 3O0KA 3EBVA 3QPYA 5BOFA 2WHLA 2XN0A 2PC8A 3WH6A 4MLRA 3LSBA 2VC6A 3LTPA 3VD4A 1EGZA 2VRKA 4RE2A 1W56A 4GUGA 3DFYA 1PIGA 2I16A 4B4HA 1W3IA 3GXIA 4UNIA 3G1DA 1TREA 3NZRA 1LRNA 4GJJA 3QYQA 1JYVA 2O4MA 3KM8A 2GQ8A 3TYZA 3GKFA 5DMYA 3GDKA 1GQJA 3BK0A 2WQPA 4D8LA 2GYIA 3BVJA 2H8ZA 2YXXA 3EWYA 3J7HA 3OVPA 4LEQA 3SUTA 4GISA 1TV2A 2ZRYA 1FWFC 4H7VA 3E3HA 3SCPA 2HISA 4AF0A 3GY1A 4D6HA 2OT1A 1ADDA 3NVDA 3BZGA 7TIMA 1E6NA 3VA8A 2ONEA 4A8NA 4DRSA 3MP4A 1XLMA 3GDMA 3UWVA 1U2YA 3DENA 2J47A 2CWXA 3SIMA 1DVJA 3YPIA 2GGJA 4UR7A 3LNMA 4L4LA 2VOTA 1A0EA 1M7XA 3E2SA 1WDQA 4RPQA 3EWDA 9RUBA 2J8GA 3LNPA 1BLIA 3GYEA 2D22A 2VGBA 2CW6A 1NU5A 1AQFA 4ZENA 2BVDA 3NQ2A 2XTKA 3NPXA 3PAOA 4IL2A 3GHTA 4GI8A 3VDGA 3KDOA 3PBMA 2FPYA 3PZOA 1GCYA 1JAEA 1QTWA 1QWKA 4F48A 1KFWA 5CCZA 3UD6A 5HQLA 2CERA 2GDUA 4A4AA 1IIGA 3KBNA 5E9XA 3MQTA 4PMUA 5HQEA 4FXRA 3VD7A 5E5CA 3OIXA 1Z41A 3P84A 1ONXA 4AAJA 4AY1A 3G3DA 3NO3A 3UEQA 2RAGA 2WZMA 3VINA 1GPWA 4NXKA 4DPQA 2X16A 3H7UA 1VJSA 1BYAA 1C7SA 4NJJA 5GJPA 2P3EA 4ZFMA 4H7ZA 2NUYA 3P0XA 4UTKA 1S3TC 3ID7A 1R30A 2XSXA 5JMUA 3W3OA 2YSWA 3C56A 2P10A 2A0NA 1LDCA 3CPRA 3INPA 1PZ2A 2W27A 3IEBA 2GOUA 3HJEA 1AZ1A 1EEPA 1HIZA 3PWIA 1ZTVA 4IXHA 2V63A 4QHRA 5F2LA 2OSXA 2Y70A 4O1FA 1UP2A 1W1PA 3LRMA 1IXNA 2WMIB 3UWYA 4FMVA 4PMQA 2WSQA 5I77A 2VUNA 5FESA 2X0YA 4H2CA 5DCBA 3FW6A 2J8TA 3GIPA 2C0AA 4Z2JA 4P7RA 2CKRA 5HWMA 4M5PA 3BE7A 4J35A 1KD0A 1G5AA 4F8XA 3M16A 3T05A 5FOOA 3SGZA 1NELA 3FEMA 4GVFA 1D9EA 2E5CA 2V5KA 3QMRA 1GZ1A 3LHTA 7A3HA 1NFPA 2E5BA 5I79A 1D8CA 4WOQA 3EOUA 1JXJA 3WLSA 3S4TA 1KW1A 1BVWA 2J62A 4DPPA 3PBWA 4MWAE 3UFYA 3NSNA 3I3EA 3EOLA 1I60A 3SO7A 3RCMA 4LFYA 1KBLA 3ZJ6A 1W5QA 3TA9A 3HPZA 1TIWA 3UXIA 1UIOA 2BASA 3BG3A 4Y96A 2NQZA 4V27A 3A3HA 2AOSA 3W00A 3PZQA 2CHRA 3OZMA 4NX0A 2EPOA 4S1FA 2W91A 1RSCA 5DFAA 3LPPA 1E9YB 3T55A 3KRBA 1H51A 5DEZA 4C6JA 5AVNA 3WD4A 1YNQA 5H91A 2BB0A 2B7OA 4AIOA 2CEQA 3IJQA 3O15A 4ROPA 2JE8A 4B90A 5AN7A 1CNVA 2BY0A 3ITLA 2ZWZA 3L2IA 3U5YA 4ROQA 1ZJAA 5B80A 3ZVHA 4XK2A 4JTQA 1Q6RA 3OVGA 2DUXA 3HPXA 3AXHA 6CGTA 1E4NA 4RZ5A 4JL1A 3VIMA 5DX7A 1NOUA 4UTLA 1VBRA 2B81A 3TOYA 1DJIA 3PBVA 4AW7A 3E12A 1B3YA 1ZJIA 4NNBA 3IAQA 5C2CA 2A2IA 4D6EA 1GOXA 2PLKA 1E9IA 3ARUA 1GEQA 1BKSA 2ACQA 4U33A 4GCXA 4NNAA 2WMJA 4LCSA 4CQDA 3L0GA 3WLLA 2DZAA 4JEJA 1ISWA 4US5A 4DJEC 1SPQA 2I57A 2GQAA 4UZUA 5BZAA 2QV5A 2FB2A 2O0TA 4DF2A 3K1GA 5I23A 1UWSA 2HNEA 3DBPA 3IPWA 1XRSA 5CBIA 5LGXA 1VRDA 3KP1A 2PCEA 5D32A 2XU2A 3FA3A 4MVAA 1UA7A 3MVIA 4R27A 1WKDA 2ZZ4A 3BC9A 1UUMA 1EOMA 3DIPA 1W37A 3BOXA 1MW0A 4JIRA 4P2VA 5E1QA 3HFTA 4C6PA 3AXMA 2VC5A 4HZ7A 4O8RA 4C6BA 2OX4A 1VCVA 1QHZA 3P67A 2VL4A 1SO6A 1TZ7A 5BRPA 3CQ0A 1KM0A 4BS0A 4I9AA 3HGSA 2D0HA 2FZ9A 5F2MA 4O52A 1YE4A 3GNDA 2G3FA 4IMGA 2JF6A 3JW7A 4C7FA 5CQ1A 1G94A 4JIQA 1UG6A 1XBYA 7ENLA 5TQLA 2FTYA 2YZRA 1H50A 5I3FA 4X3ZA 5KITA 5E70A 1W1YA 3U3HA 4XZHA 4H9UA 4HIBA 1W9UA 4IMDA 3TYUA 4LALA 3B0YA 4AZ6A 1SSDA 5FEZA 3WK1A 2INZA 2FLIA 1M7OA 3W1MA 1EJRC 3K8LA 4MDOA 5AYXA 4EX4A 4MWAC 4UR8A 2P1FA 7REQB 4M80A 5E0KA 3RITA 4HNOA 1L6WA 1OINA 2XVPA 3GUGA 1UJQA 4HSHA 1DWJM 3IUIA 2D73A 4L65A 3W23A 1I2NA 5F4SA 3GDBA 1VB9A 2OZ3A 1IEIA 4BI7A 4S2BA 3WQVA 2DU2A 2WM1A 3OYXA 2ZA3A 2WO5A 1UIPA 4IFKB 3LQGA 4D6IA 2VZUA 4P7OA 2L5HA 1QNRA 4MIMA 4FF5A 3AXIA 3C0JA 3I6RA 2POTA 1O4UA 4Y9MA 4JHMA 1TUFA 4UTTC 4IMCA 4H2HA 1LG1A 3O16A 1XLDA 2NLIA 4WGHA 4QITA 3NDZA 3PWAA 1I0DA 1WKFA 4PUJA 1ISXA 4IP7A 3GG7A 1SGJA 2PTZA 3G0UA 1Y8BA 4JY8A 1QASA 1CB2A 2ZXBA 4O1DA 4DBUA 3APYA 2HROA 1H7RA 1NWRA 1WXJA 2VEIA 2WCSA 2JK2A 3UY8A 4G1NA 4E8DA 2VI0A 1PZ1A 2PRHA 2VZTA 2HRWA 4W8BA 2PF0A 5D38A 4CCZA 5LA0A 3GHSA 2O7QA 1UD5A 3N2CA 1RH9A 2VDHA 2VCBA 3M41A 1GQKA 1M7PA 1XYZA 1OY0A 3DERA 1MZRA 3UBPC 2NW0A 1JUEA 4IPIA 1VYRA 4DZHA 1HL8A 4MHBA 3IACA 3G5EA 3PHAA 3WQ5A 2BOGX 4H9XA 5AECA 1P6WA 1WB0A 4QR6A 3WSUA 3MI6A 1TRDA 3OLGA 3IUHA 5CC7A 3STCA 4JNZA 1OYCA 2V5LA 3BOFA 5F7UA 4UC5A 4E8CA 1M68A 5HA7A 3GSMA 3CAWA 3UWEA 1O66A 2F8QA 4JQ2A 5A6SA 1FP9A 5GNZA 4E2DA 1CZ1A 3GTFA 4UQCA 1VEPA 3RJYA 4WY0A 1BD0A 2ABAA 5AVHA 3EX3A 1XBZA 3AAMA 4H00A 1FDYA 5I3KA 3PUOA 3T0TA 2Z2BA 1QOPA 2BGNE 1VFHA 4Z0SA 3AXKA 4HYWA 4PUEA 4HKPA 3GZAA 2YCLB 3SY5A 2Z0IA 1Y7VA 4PB3A 1BPLB 3KOXA 1B90A 3A4AA 3GC2A 1IYXA 4CQCA 3RPDA 1GORA 1TTPA 3U48A 1B9BA 5EMLA 3F4DA 1G01A 1UR1A 2PMQA 3VPLA 3B0XA 4BF7A 1OC7A 3C52A 4FLRA 5BXRA 2IS7A 5HNNA 1S5MA 3LLXA 3GLCA 1ONRA 1T8XA 4O17A 1NDVA 4ZGYA 1RHCA 2XFYA 3TYDA 1LP6A 4ZL1A 4MYAA 4C6MA 3QH2A 4M82A 5DCEA 3VKBA 2QUVA 5K2ZA 3HJZA 5AHLA 3W1UA 3BURA 3LXBA 2HXTA 1J2WA 2G3MA 3S9YA 1EO7A 1HFBA 2GJRA 2GGHA 4GQQA 1XRVA 4H6KA 5JBDA 2XH7A 2QMJA 2YBUA 3LU2A 2DJLA 4MYXA 3T1GA 1ODUA 3TW7A 4HT3A 4FNSA 2YBVA 4GJ1A 3NQGA 3S6OA 3LGDA 3WEZA 2NUWA 4MZ8A 4E6MA 1DJNA 3V0SA 1AZ2A 1W1IE 4WDTA 3ZFHA 4GG9A 1XKJA 4G7EA 3CL7A 3AXXA 4NJHA 4EPEC 4O28A 1OT2A 5FEWA 3FEQA 1B31A 2ZRWA 4ASTA 3UWZA 1C93A 3VFLA 1QFEA 4S3AA 4BF9A 2X7WA 1YYAA 2NQLA 4PTWA 4MB5A 1UP0A 4UB9A 2DZPA 1NQ6A 4TTGA 2JGYA 2B7QA 3WQ4A 1ZGDA 3GFZA 3K4WA 5JIWA 5AZ0A 4MPKA 1G1YA 5IM51 1TVNA 1GJPA 3LXAA 1FWBC 1XYCA 1XFBA 2IPWA 5B7YA 4NJGA 3QLDA 3NQVA 4HU0A 4IPPA 4DZ5A 3BAIA 1KRBC 4DNHA 5KEZA 4RV8A 4GQ0A 1S1PA 1JPHA 2WLYA 4LJ3A 4PRWA 3GXMA 3PPHA 4PUWA 5AY7A 1MNSA 1L6YA 1KKRA 5A2CA 4L5ZA 1GVRA 1W9BM 4IQDA 3DEQA 5G4EA 3SJ3A 3CAKA 3F4VA 2RJHA 3W7OA 3W7MA 3OBEA 5D9MA 3WUBA 1R9YA 3R4IA 4F0SA 2V0TA 4MUPA 2VGFA 1PE1A 1OGGA 3GTXA 3POCA 1UWAA 4MAVA 2Q3RA 2WJEA 1DL3A 4HK7A 3N18A 2Z2UA 1B0IA 3Q58A 4XBKA 1T96A 3GUWA 3EDJA 5LSMA 4LPCA 3WBAA 2QPUA 3FN9A 5REQB 3MUCA 4FNUA 2V6AA 4H83A 3AIEA 5A6BA 1W91A 3CHCA 3L4YA 2FB3A 1HKJA 3SECA 2EG8A 3EX1A 3EKLA 4U10A 1A47A 3P5ZA 4MNJA 3P8IA 2FPTA 3G1XA 4I9MA 6REQA 3MMUA 1KQZA 1EFZA 1U30A 3SCNA 5ABHA 1DQWA 2ZTKA 4RDVA 1R85A 1OCJA 2WJFA 1H7OA 1EB3A 3MV01 3THAA 4Q6JA 1XGEA 1U1JA 3GB6A 2O9OA 5IBXC 5AOUA 3TDFA 2WZHA 3GU2A 3QV8A 4M1RA 1ZU8A 2V30A 2W62A 4GD0A 1GVYA 1F9CA 4MY1A 5CPOA 2FHCA 3ZR5A 4CKQA 5I0DA 3AWNA 1BXCA 3SGGA 4XO6A 8XIAA 2PUZA 1V03A 4U2YA 3FDGA 1TA3B 1W3NA 3WF4A 4NU7A 3BLPX 4ZOBA 4KEZA 3W1QA 3PULA 2WZEA 4QDWA 1VPYA 1HO4A 4QSHA 3TN5A 4MB1A 2FMNA 2GJLA 1EJWC 4XD6A 3MDWA 2ZDRA 3VIOA 3ARRA 3EDEA 2YFOA 2C14A 2XGZA 1BXNA 3ZT7A 1KC7A 4XG1A 3NGFA 2YR1A 2W92A 1JI2A 1FBAA 3KTCA 4JX6A 3KVJA 3TTEA 3N34A 4D1IA 4K36A 4DHGA 1DWHM 4JZ5A 1XYLA 2ODOA 1NARA 4I5UA 1HNYA 5H8PA 1B4EA 3MBFA 1C9DA 3ZIZA 1ISYA 4R33A 1J5SA 3IJDA 2HE5A 3JU2A 3CGTA 1QW9A 4WD0A 3K5XA 2PGEA 3U57A 2VZSA 2X42A 1OHLA 1PX3A 1BRLA 4IX2A 3LMZA 3FGCA 2GWNA 2CCRA 2CLPA 3I6EA 1XLLA 3B9OA 3FA4A 5CG7A 1WYIA 4QM1A 5AHMA 4URIA 1Y5XA 3M5XA 1OQFA 2XIJA 2JEPA 1SZEA 1VS1A 4PL1A 1ZCCA 1NWUA 2CZDA 4FR6A 4I7WA 1FWJC 3VD3A 2CYGA 1JQXA 3WLQA 2ZWYA 3OLDA 1U5HA 3NURA 2BSLA 4QNEA 2DZXA 2GK1A 5IXEA 4Q4OA 2ZRXA 4DXKA 1WZKA 1Q7QA 2FZMA 1F74A 2OGJA 2OYLA 4RW3A