3S83A

Eal domain of phosphodiesterase pdea
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
256
Chain Sequence
LALEADLRGAIGRGEITPYFQPIVRLSTGALSGFEALARWIHPRRGMLPPDEFLPLIEEMGLMSELGAHMMHAAAQQLSTWRAAHPAMGNLTVSVNLSTGEIDRPGLVADVAETLRVNRLPRGALKLEVTESDIMRDPERAAVILKTLRDAGAGLALDDFFSSLSYLTRLPFDTLKIDRYFVRTMGNNAGSAKIVRSVVKLGQDLDLEVVAEGVENAEMAHALQSLGCDYGQGFGYAPALSPQEAEVYLNEAYVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords GGDEF family protein
publication title Crystal structure of EAL domain from Caulobacter crescentus CB15
rcsb
source organism Caulobacter crescentus
total genus 87
structure length 256
sequence length 259
ec nomenclature
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3s83A00
2R6OA 3SY8A 4HU4A 3PJXA 4F3HA 3GG0A 4RNFA 4HJFA 4J40A 3KZPA 4LJ3A 3PJWA 3PFMA 4AG0A 3U2EA 4F48A 3GG1A 3HV9A 3GFXA 3GFZA 3PJTA 4RNJA 4Y9MA 5MKGB 4RNHA 3N3TA 5MF5A 3S83A 5MKGA 4Y9NA 4AFYA 4LYKA 4ES4A 3HV8A 3PJUA 5M1TA 3TLQA 2W27A 4Y9PA 4FOKA 4Q6JA 2BASA 4FOUA 3GFYA 4Y9OA 4RNIA 4HU3A 4KIEA 4Y8EA 4FOJA
chains in the Genus database with same CATH superfamily
1TZ7A 1PAMA 1FVPA 4K38A 1ESWA 1Y7VA 4O18A 4OOZA 1R5YA 1MVYA 3LXBA 3AZRA 3DH7A 4DM2A 4RJEA 4GYKA 1O1HA 4C6IA 4DF0A 1R8LA 4MMWA 3LY0A 4LX4A 4UTMA 3F7JA 1ISYA 4IWWA 3BAKA 3KFTA 1F6PA 3N11A 3RITA 5A8GA 1MYRA 3M6DA 4MWAE 2VTFA 3WDHA 4HK5A 4L1GA 3N9RA 3T81A 1YPIA 2V8ZA 1XFBA 2DV0A 2OX1A 3RJYA 3M0IA 1XDJA 4LF2A 3PSVA 1GOIA 1XBYA 1MI3A 2XYLA 3S47A 1H7XA 4O1FA 3ZR5A 1X6LA 3ARRA 1C8QA 3KRUA 1ONEA 3L65A 1DXEA 4C65A 2ZZ6A 1RJRA 2E8YA 3D5HA 1MW0A 3LM3A 4GIRA 3K1DA 3SCQA 2QUTA 4Y6GA 2ZWZA 4GFSA 2YDRA 2W67A 3GR8A 3GB6A 4IP4A 5C70A 1K03A 1QWKA 3SN4A 2HK1A 3B8WA 4ZVJA 1B3YA 2JALA 4DYKA 3W7LA 3KVMA 3W7CA 2BHUA 2GFTA 4YYCA 2D2GA 1A0CA 3B0XA 4ROQA 3KOWA 2PDBA 5K7JA 3QEZA 4CU6A 3CUZA 1I4NA 1P1XA 5C9XA 1ZJIA 3VIJA 2CLKA 1OWQA 5MKGB 3SY1A 2I9EA 4AHQA 4NXSA 4JX6A 1YRRA 3WQEA 4PMJA 3VIIA 4AHOA 1WKDA 3KVJA 4UNIA 4BQ2A 2CKSA 1DIEA 3WUBA 5FESA 3WBWA 4EP8C 1QHZA 9RUBA 4M3PA 4S2CA 4UC5A 4C6LA 1DV7A 4IF2A 2Z7GA 1SM9A 2PDHA 4IMAA 4LY4A 3C3UA 1SO5A 2WJDA 5TQLA 4ORIA 3SJ3A 3MCNA 1EUAA 2A0NA 1D7KA 1OF8A 1BSLA 3PAJA 2A1YA 1E70M 4GNKB 4QG9A 1F2JA 1FWDC 1WO2A 2X16A 2ZADA 3ID7A 3GKAA 5E1QA 5ECVA 1E1CA 1KFWA 4O50A 4R3UA 4EF8A 1SW7A 4HA4A 3PUEA 4O11A 1E51A 4RDWA 3WY1A 3G1RA 3F2CA 1PYFA 3PFMA 4F48A 4KERA 3PWGA 3C8FA 4RPPA 4B9YA 1YQ2A 3K5XA 4NZ5A 3W6YA 2AMXA 1QOXA 1HVQA 4KS0A 4BEUA 3H2FA 3LI0A 4M51A 1J10A 3N6QA 3GK0A 3V7PA 2Y70A 2CYGA 3MTWA 2WMGA 1X6NA 4AD0A 2OWXA 4NG3A 1W3IA 3W7RA 2V5JA 1P7TB 2NQZA 5FJOA 2QDHA 4RNFA 2E77A 4JN6A 1ZBCA 2QPUA 1W3KA 4PUWA 4QCFA 1FH7A 4G5DA 2NZLA 3OEXA 4LUYA 4DNHA 3ALGA 4EWND 3N3MA 3WQPA 5LYRA 1P6CA 2HXTA 4JQ1A 1RY8A 3ELFA 3UGVA 1SW3A 3GH7A 3RCYA 4HMDA 1DWGM 4W84A 1V02A 2IMRA 4ALDA 4JHOA 1OD0A 1S5NA 2PDGA 5LSMA 1DVJA 3SM0A 4XZBA 3GUWA 2ZZ5A 4Z08A 2OGYA 3K8KA 3UZWA 3BOFA 3VCRA 3N9SA 5IM51 1DWIM 4IJRA 1U5HA 2Z4GA 2OQYA 3GDRA 5XINA 1XLCA 3GXNA 5DCBA 4NU7A 4Z1BA 4BZYA 2X2GA 2HK0A 1EBGA 4F4RA 2IPGA 4W7UA 2WZTA 3E2RA 3FSUA 3EWZA 2X0HA 4GQQA 4UR7A 4D2JA 3U2EA 2B81A 1CENA 1Y65A 2C13A 3VIPA 4IIHA 5MHBA 3N4FA 1IEXA 2VZSA 2C6QA 3KBJA 1X7FA 4YLWA 1JF6A 4JTHA 3WDQA 1R3QA 2D0HA 2QDGA 1EWDA 4ZE4A 3W3OA 3D3AA 3NO5A 3T4CA 4KEUA 3LMYA 3W2KA 1LG2A 3C0QA 2IW0A 1U1JA 1MW3A 4U10A 3DGRA 5AHMA 3AS0A 3VOIA 3VDCA 1XIIA 2BGQA 4Q8TA 1FWCC 2YYUA 1EPVA 2F2KA 4CD6A 2OT1A 4RV8A 2VVNA 3LRKA 4GUFA 4D72A 2BGSA 3AI0A 3WBEA 1CXFA 1KBBA 4HN4A 2QUMA 3RCNA 3L4TA 3DBPA 2EEXA 1ZBWA 2FQIA 1EJ7L 5HJYA 5D04C 1JDCA 4GHRA 1GG0A 1DE6A 2ODOA 3CH0A 4Q4MA 2VNCA 3IEBA 3VZYA 1TRDA 3L5AA 4TX6A 4W5ZA 2XVGA 3WK3A 1SGJA 4JDYA 1KFJA 2FZ8A 4OHQA 3PWAA 3S5NA 3ZVHA 3VKBA 3RM4A 5D30A 4G56A 4HYVA 2QPSA 3NQBA 3RG6A 5TIMA 1QFEA 4MG4A 3UW6A 4L80A 1C8VA 4Q22A 4JYEA 3IVUA 1J0JA 2JFEX 2VYOA 4FNUA 4JTRA 4DUWA 5I3IA 5ABGA 4OUEA 2YKKA 2X1SA 1P6WA 3RMJA 3WIJA 2WJZA 3M07A 3A24A 1KQZA 3HPXA 1QJWA 1DTUA 1MXSA 1M7PA 3G5EA 2QVNA 2KX9A 2E4TA 1BRLB 4ZQPA 5D2YA 4DBSA 3V5FA 5K3VA 1LBLA 2ZUMA 4ZXOA 4L1XA 3VZZA 1BXNA 1Q6EA 4PMUA 1QW8A 4JEQA 2E8ZA 1NWRA 4FI4A 3OQ8A 4O16A 3MVIA 4LWWA 2BDQA 4HMNA 4EPKA 3ERPA 4M19A 1UD2A 5AN7A 1QASA 3E0VA 3W1RA 4AZCA 4S39A 5LGXA 4I7WA 4FX8A 3KVKA 4D71A 3UXAA 4DIAA 4H19A 5D8WA 2UZ9A 1GUVA 1XIBA 2EGZA 3L5MA 4K7YA 2WCSA 4E6MA 1QHOA 4JN8A 4O15A 3QTPA 1RCQA 2FTYA 4ZO8A 2D1ZA 3P61A 5KZ6A 5KZDA 4AYGA 4U3AA 1BVZA 3L4WA 1AJ2A 3T78A 2Q09A 1U1HA 4K8GA 1B4EA 1PZ0A 5JH2A 1GOQA 4AY7A 3EA3A 3LOTA 2FTPA 4IIGA 3BARA 5A8NA 5I3DA 4QEHA 2VRQA 1XFCA 1KA9F 3W28A 2DVXA 3NZPA 2X8RA 4Z1AA 5AC4A 3MDUA 1B5TA 4RNIA 2V2HA 4LAZA 4R34A 1W3JA 1GEHA 1J6PA 3P74A 2IPFA 1X7IA 1NDVA 4UFMA 3TZFA 5D2XA 2DZBA 4E2DA 4LS2A 4IIBA 4CVWA 2GQAA 3NYZA 1E4LA 3S2NA 4N42A 4M24A 7REQB 4GQGA 1UWTA 4L4MA 3N4EA 2F9RA 1NSJA 2X1TA 4JX5A 1KBIA 3B8TA 1REQA 4JTIA 3P8IA 5HWMA 4LNYA 3URNA 2P3ZA 3B9NA 3DECA 3Q45A 4OECA 5C7VA 2CLMA 1NF7A 3L4ZA 5CC7A 3L7RA 3UZYA 4FMVA 4QQUA 3W75A 2PDCA 4AVFA 2GZXA 3VIOA 3OU8A 1SJDA 3CL6A 1NDWA 1S39A 4WY0B 1FA2A 3GVQA 2FVMA 3CS2A 4CCZA 1EO7A 2P8CA 1NOWA 3PBMA 1SFTA 1KGUA 1WXJA 3CUIA 4S3GA 4YIWA 4QHRA 4QS5A 3RM8A 4IFKA 3AUJA 4QNWA 1LT7A 3V0SA 5CPMA 4H3DA 4WGHA 4PFHA 2PTYA 3W70A 4JKKA 1P0DA 4CNOA 3G24A 3U0HA 2Q8XA 3NQAA 3AS1A 5C6MA 3ZOAA 4YL2A 1VLIA 3DXIA 4KGLA 4O13A 3LZ5A 3ARPA 1S2AA 3QQ1A 3AMKA 1NOFA 3N13A 1IHIA 1JI1A 3VCNA 3AOFA 4AAJA 3UR8A 2X1IA 3VINA 1X1ZA 4I5UA 4IP5A 1JDFA 4A3QA 1JAEA 4PCTA 5TBOA 3C61A 5CJ5A 4KH2A 4A35A 1R85A 4BI6A 1MXDA 3BAIA 1I2NA 4M8UA 2BGNE 4HNVA 4LBSA 1VENA 4X61A 3EPMA 2NV1A 3LLFA 4K8EA 3GTNA 4ZGYA 4K68A 5DEZA 1FDYA 2G3NA 1XIEA 4OE7A 3UD6A 2XDFA 3QV8A 3PR2A 1RQEA 2RDUA 3W2MA 2ASHA 4J35A 5I3KA 2J27A 7TAAA 1ZLPA 4B5UA 2GSJA 3W1XA 3B9OA 3AO0A 3I7RA 4E0CA 1R7AA 2ZQ0A 4O1CA 2VEMA 1DQUA 1VPYA 3WH7A 2QAPA 2QJMA 3GW3A 1W0MA 5FCZA 2D3LA 2XPKA 5KEZA 4A2SA 4NXKA 1VD6A 4H8VA 3TCSA 3W1UA 3P93A 1G0CA 3SCWA 1Y0EA 5T26A 1UZ1A 5C0QA 3B8IA 3C2RA 4MY8A 3GD6A 2PGFA 3CB8A 1DJXA 3GRIA 3KCJA 4Q7IA 3MUY1 3BV4A 2BBFA 3BZGA 1IXQA 1O1ZA 2E6FA 1VFHA 3E3HA 4N0RA 3VM7A 2UV8G 4GLEA 2J7GA 2W5FA 4PEEA 4XG1A 1F73A 3E5BA 5BOFA 4M56A 2VEKA 3GAYA 1P1MA 3AYSA 4Q8OA 3AAMA 4TTUA 4JXCA 1EDQA 3I3DA 1HKMA 1SO4A 2POZA 2PE4A 5F7UA 1F3TA 3R5EA 3S9IA 5DLCA 1FXQA 2DFAA 2PURA 4AVOA 1X6UA 3PWIA 4LYQA 2XH4A 4FXRA 1CTNA 1F6YA 2FPVA 1Q7MA 2GVEA 4YN5A 3UVIA 3VDGA 3TSMA 4CKQA 1ITCA 3CPGA 3SADA 1POKA 1QI5A 4I9MA 3GU9A 4H2HA 1GGOA 5DXYA 3PM6A 4TX9A 1J0IA 3HV9A 3QY8A 2X30A 5D9NA 2OKOA 4MDOA 4XX6A 1XS2A 1IT7A 1EC7A 4NZ4A 1XIDA 2YDQA 1A0DA 1V6WA 4U4MA 3F4WA 1RLCL 4L7ZA 3UXKA 1H1NA 4Q7NA 5FL0A 2H8XA 2OSYA 1V93A 4FLOA 2G8ZA 2R1NA 3LGEA 3DHDA 4O17A 2MNRA 3TLLA 2VCBA 4FNRA 3K4WA 1UWUA 1JPHA 1KGXA 3KRSA 1MZHA 4C7DA 3P67A 2G5WA 4RZBA 2VDIA 2VJXA 5D4YA 3U5YA 4MY9A 5E6ZA 5CSSA 1W8GA 4LBRA 1HIZA 2C14A 3WZ0E 2F61A 5HWJA 4W4QA 2XGBA 5CEWA 4WRHA 3CTLA 3MP3A 1UH4A 3LPPA 4AG0A 4IX0A 4Z1DA 1CW2A 1HXJA 3NGJA 1HF6A 2QCCA 3H2OA 2VCCA 3W25A 3IJLA 2QGYA 5CPOA 3SN1A 5RUBA 3UA4A 5C8BB 3IK2A 4AX7A 4BQ4A 5CPNA 1TE1A 3TFXA 3WQGA 5GJPA 1RAKA 2PWEA 4DJDD 3AICA 1HJSA 2DZUA 2Z27A 3S5SA 3D3FA 3WDJA 4B16A 3ZJKA 3WQ8A 3W7JA 4GGHA 2YL9A 3W6MA 4PMDA 2ISWA 1XSJA 4JIRA 2ZXQA 3VXGA 4MYAA 4K3ZA 4WXYA 3P5YA 2DDXA 3DFQA 4HU4A 4GJIA 1JCYA 1ZY9A 3GG1A 3EEGA 1JDEA 2D69A 3QC3A 2QEZA 5I03A 4ZXLA 3BG9A 3SBFA 2DW7A 1EYWA 1H51A 1OM0A 3UR2A 1E4MM 4LOCA 1SFLA 2ISVA 3IUIA 3PJUA 4Q6JA 4H00A 4UUIA 4KWVA 4AEOA 3E2QA 2ACSA 3NQVA 4GNVA 5EU9A 5AOUA 5FJJA 3UR7A 5FF7A 2BOEX 2GJXB 4QE5A 3PZIA 3VDHA 4LALA 4TR9A 3PF3A 4PUJA 3G1SA 3LUTA 2B7OA 3UG5A 3HGOA 3LENA 4G6CA 3BAYA 1OFRA 3CHVA 4B3KA 1OFDA 4J9JA 1SMAA 3M64A 3O07A 3S5YA 3WQVA 3IK4A 4OU1A 4XIMA 1QNOA 3EB2A 3WO8A 4RV3A 3W1NA 3QQWA 4P8WA 3BG5A 2PDUA 3P2VA 3P82A 1BPLB 2JF7A 2PLMA 2JEPA 3S2JA 2RDXA 1R9XA 4HZ8A 1UPPA 3QBUA 3W7GA 2YZ5A 3CHEA 3IGSA 1TUFA 3A64A 1DORA 3KXQA 3AWNA 2H3BA 2I16A 3K4DA 1T7LA 2GQ8A 2XTKA 3OA3A 4UTWC 3C2VA 4EXAA 4W86A 3IRSA 2VFGA 3O16A 4G7EA 3WNPA 3TSDA 4B5WA 4OV4A 3L9CA 5AFDA 1CECA 3K4AA 3PB0A 5AZ0A 3W26A 2VGIA 4GXPA 2PAJA 3F5KA 3R43A 4M7SA 5JIWA 4N02A 1OFPA 2BASA 3W7IA 3GDMA 4JNMA 5EMJA 2AQOA 1EGVA 3H23A 2DSUA 3VVGA 3N73A 2OEJA 4O8AA 2OOFA 2XIJA 3PC0A 2QLYA 4FHAA 2XIIA 5FIPA 1AH4A 2NUYA 4IIFA 1EP1A 1E0WA 1UASA 3OGVA 4Q4QA 1CXLA 2FMOA 4HGXA 5AYBA 5CBIA 3UXIA 3ALFA 1V02E 4GYFA 3BURA 1R9ZA 5ABTA 5M3WA 2YLAA 3FGCA 2HBXA 3BG3A 3G8EA 4ES4A 3QGKC 4H41A 2HRWA 2VR4A 4FXFA 4H6RA 5REQB 3EOEA 4IG2A 2J9ZA 2ZC1A 4Y8FA 4XZWA 2V69A 2QUUA 4WD0A 3B0VC 2XN1A 2WYSA 5HBFA 4N4PA 1QNSA 1BYDA 4UTJA 4HPGA 1K70A 4H9TA 3DI1A 4QNEA 1E6QM 2FB3A 1TIWA 5DO8A 3VX0A 6REQA 4X3ZA 5H2ZA 1J8VA 3MO4A 4B91A 4JQ2A 2WM0A 1NH6A 3LNMA 4LUTB 4DO4A 1IF2A 3Q4DA 1LRNA 3AHVA 4V2XA 2PCQA 1R30A 5C9RA 4NAEA 3L4UA 1CGUA 1TYGA 2GDUA 3ARVA 2BVTA 3STPA 3DFPA 5A6BA 3WH8A 3EMQA 2QCDB 3EX4A 4L9YA 1VQTA 3WUFA 5BWAA 1ZRQA 3WX7A 3GLCA 1T41A 4XWUA 1FWFC 2BY3A 1IT8A 2VC9A 1C3FA 3CUGA 4XO6A 2IKHA 4JTDA 2V82A 3UZJA 1KM5A 1TX2A 2DQXA 3VGHA 2Z1WA 1VJZA 1US3A 2W66A 2EXOA 3FX4A 3F5LA 1DWAM 4GVFA 1B3XA 3UY7A 4YTRA 1SO6A 4X9YA 1BYCA 3ZYZA 3RRXA 4Q8VA 3N9KA 5A1AA 4JQAA 3TQVA 3TJIA 1M7XA 3URAA 5DY2A 4A3YA 3B0YA 5JU6A 3G1XA 1BWVA 5IDZA 4B5VA 3ARXA 1HKVA 3CT7A 3DFYA 4GXWA 1FHDA 5EBAA 2ZRVA 4FNQA 4PMYA 1M5WA 2CC0A 2QJGA 2DT3A 4ECLA 1BG9A 1XLMA 4LTSA 1PWLA 3UETA 1JPMA 3DG6A 4MDPA 3LPOA 5AHNA 3CYVA 2AL1A 2NSOA 1W8SA 1W9PA 5FJTA 3AFBA 4GNJA 4KWUA 3PJTA 3EX3A 4R53A 1XRSA 1ELSA 1TKKA 3EKZA 3W4RA 1NDZA 1JYWA 1YIXA 1K7FA 3RMEA 3V0UA 5B7YA 1QMLA 1KRCC 1LLWA 1DHKA 1GPFA 2GYIA 5D33A 1ME8A 1BKHA 4NYYA 3UFYA 5LIXX 3HPSA 2OFJA 4M6UA 5L9FA 5LNUA 3G0UA 5F2GA 5CBBA 2CIPA 3LV6A 1UOZA 3U2ZA 5K4ZA 2Y62A 2WSPA 1F8IA 3THUA 5AVHA 2Z2AA 3TYUA 1RXOB 3WK2A 5HXMA 1ZZMA 4AD5A 3WF1A 3TTSA 1AG1O 3ZM8A 1ZBKA 4Q4RA 2J74A 1JCNA 1E6NA 1UQZA 4O1AA 2CWXA 1JR1A 3MSGA 2WBGA 2CW6A 3PY2A 4FXSA 1EA0A 4LB4A 4JCLA 2PF0A 3BC9A 2XISA 3MSRA 2ANUA 4KCUA 4DO5A 3RO8A 3EZ4A 1PDYA 2J7FA 1DJZA 1TCDA 5EMLA 4LVAA 4I5XA 2OLAA 4X0NA 1UBPC 4Z17A 4IM4A 4XK2A 3DDMA 4UBPC 5DRIA 4RZ6A 1E6PA 1UKSA 1YNPA 1UR8A 1KD0A 1IIGA 2VUYA 4H6QA 4N9CA 3BQ5A 4WR3A 2NQ9A 1CIUA 1DWHM 2QCGA 3KVLA 5HMFA 2D3NA 8A3HA 3TH6A 3D46A 3RR1A 4C6QA 4H9ZA 1J2BA 3L21A 1KFBA 3CLMA 2RUSA 3H12A 3MSYA 2YXGA 2J79A 2RH9A 7ENLA 2YW4A 3L66A 1PS9A 1KLYA 4UTWA 2E3ZA 2P88A 2XGZA 3TOYA 3WMCA 1TWWA 5JIPA 4OIFA 1TPH1 1MRQA 4W8BA 4IQDA 1EJUC 1HUVA 1UUQA 4MWAB 1K6WA 3QY7A 2OZ8A 1DJYA 1NM9A 1OK4A 5IFPA 2XGIA 3W6LA 2VZUA 3WLSA 2VCAA 2ISFA 4W7VA 4B9ZA 1LOQA 2CLOA 2A21A 3W84A 4KRUA 2ZTJA 3FEMA 5JXQA 3NVDA 1XYZA 2EPOA 3DCPA 2J6XA 2ZZ3A 3PSWA 1TR1A 3HGRA 4AW7A 2GQ9A 3S6DA 2GGHA 4XTIA 3LRMA 2YR1A 2HQAA 1W1TA 3V5OA 4XKYA 1YEYA 3TQKA 3IS4A 2PWUA 2CLIA 3GNRA 4C6FA 4E2VA 4IPNB 3CC1A 2O9RA 4GZEA 3MI6A 3WUEA 4ZQMA 1QNQA 5I78A 5FF0A 1HVXA 3IJQA 1OFQA 3CL7A 2VX6A 1TV7A 1RALA 5EL1A 1C93A 4DBWA 4X9SA 1D8WA 1MFVA 4WOQA 4IX2A 3G6LA 4OGZA 4NL1A 1J96A 1O5XA 1B30A 2P50A 3CO8A 1EB3A 1W2PA 4GE8A 5E9XA 3BK0A 2DIKA 4X60A 1OADA 1EH9A 4GG9A 3S46A 5BROA 4UNLA 3SUUA 1IEQA 4ZMGA 1EA9C 4A8NA 2AGTA 3URBA 4K6AA 5FD0A 1W5PA 3TK7A 3IGHX 4JX4A 3H2NA 2YGYA 1GZGA 3S1VA 3SCOA 4F0RA 1V79A 3W07A 3FHAA 1PDZA 4QE1A 1XGDA 3SJNA 4O28A 1CXEA 1MNZA 1XBVA 1F61A 2BY1A 1XF0A 4A8IA 2CZVA 4NRSA 3CQIA 2WLZA 1OG0A 3EKGA 3FA4A 2VZTA 4XD6A 2PWDA 4PR4A 3FKKA 3VUPA 5EMKA 5HNNA 3NWRA 4XB3A 4NT0A 3DFSA 4LVGA 3UPBA 4JEJA 2DVTA 5A6BD 4DBDA 1EXBA 3WLNA 2W79A 3S1WA 3GVGA 3W7NA 3GBDA 2VOMA 3GG0A 4C91A 3H70A 2VENA 2W9MA 1GG1A 1EJVC 4E4FA 3U57A 1AMYA 2WMIB 5AECA 1NU5A 5BOEA 2A4AA 2A85A 1V3LA 4BS0A 3Q65A 4R9XA 3VOHA 1PTDA 4PTNA 1RJPA 3EWYA 4ZA0A 4UMCA 4HU3A 1ICSA 1FP8A 4OTKA 1TPWA 3VI2A 4AD2A 3ZWSA 4C6OA 2E5CA 5DELA 5HWNA 2PI6A 3RX2A 1JCMP 4MZ8A 1WDQA 1VFFA 4YNGA 2J25A 3S83A 2Y5EA 2CZDA 1RP8A 2CZ5A 5H8PA 4JBRA 3E74A 1Q45A 4W85A 3T7VA 1QO5A 3QV9A 3P3BA 1V3MA 3H4GA 3EPOA 1AL7A 2UY2A 2EQDA 4I9AA 2H90A 1OX4A 4M81A 1XDLA 3ITYA 5ECUA 2DQWA 3UCCA 1VRXA 2YIHA 2ATSA 4DZAA 4JOMA 4O12A 5K4XA 3M16A 3OBKA 5I24A 1TZ9A 4QJ1A 2VDGA 2PZ0A 3ZT7A 3VCCA 2XN0A 1EQCA 1A5SA 3A9BA 3M4HA 5CSUA 3T09A 1QOQA 3SFWA 3AUOA 4Y8EA 4DF1A 1PWMA 3NQ6A 4LUJA 4DJFC 3CV2A 4CEUC 1VEOA 4ERAA 3MCOA 5DCEA 4D9PA 3PK7A 4E5TA 4H6KA 3I68A 1UR3M 5D2VA 1F3WA 4GFIA 4PL2A 2YCIX 4A22A 3GC2A 1OCBA 3IJ7A 4J2PA 3PFRA 3O1NA 2VFIA 1V77A 1Q66A 3ZT6A 2GOKA 2EPLX 2I5GA 2J88A 2XHYA 3LGGA 4KW2A 2Y88A 1QWGA 4ZQCA 1ZNNA 2HPMA 3I6EA 3W53A 5LIUX 1GOXA 3VPLA 2WWDA 4UFLA 1RZMA 5BRPA 1FCBA 3V35A 3NQFA 2WC3A 3HPFA 3MA8A 2JK2A 4WIWA 3A3WA 4BA0A 2CZFA 4DRSA 3DFHA 4R7OA 4I5RA 1WAWA 4AZGA 1PJ9A 1V3HA 2R8WA 3S9YA 2NUWA 4AISA 1XYBA 1EIXA 1UR9A 3KAOA 4AX6A 3MUZ1 1MQRA 1PB0A 1E9YB 1P0EA 4HPJA 4WDUA 2OB3A 4WDWA 3W1LA 4JR5A 3MV11 5FL1A 4PBEA 5CZSA 2QT3A 4FSAA 3QF0A 1GHSA 3T8LA 4HU8A 3FAWA 3DC0A 3MZNA 4DBEA 3AIBA 4IL2A 3WK1A 5J5RA 3C0LA 2PDIA 4J7RA 2Z25A 1B0IA 4NJIA 4K37A 3BGGA 3W83A 4C5YA 4J3UA 1VPXA 3UG3A 4LVDA 2P10A 4GBUA 5A69A 4FB7A 3PPFA 1V0KA 4P5UA 4QLKA 1ZL1A 1V03A 2W0UA 3WF0A 1K7EA 1KFLA 3CZKA 1EP3A 3VKAA 2C18A 3TZNA 4JYFA 4PRWA 3S3GA 1OYBA 2XU2A 3I7QA 2ZUNA 4NZJA 4QBXA 1VBJA 1MSSA 4UQDA 1JQVA 2EBNA 1CGVA 1H1YA 3APGA 4EK7A 2DH2A 1U30A 5DY3A 4J3XA 3ARUA 3ZT5A 3K1GA 4AEFA 4GCAA 2DJLA 3G8RA 4QX4A 1ZUAX 1FY6A 1GW9A 4TMBA 3LCFA 1GVIA 4UZSA 1NIUA 1H7RA 3G77A 4PUEA 3M6YA 2PZNA 4TOQA 3F4CA 4QJ4B 1AD4A 2XH0A 1ADDA 4YVPA 1SZEA 2QV5A 2QUNA 3S9ZA 1XKYA 4JNYA 2ZX8A 4P7OA 3TC7A 3ES7A 2PWFA 1L6WA 3N4AA 4GVIA 3WNNA 3W74A 4UTIA 1AH3A 3EWCA 3TYBA 3IWPA 4IPLA 3QSRA 1GOOA 4MB1A 4XIAA 3SCNA 3OYZA 4JFTA 3CQKA 3TONA 1LT8A 3F4VA 2L5HA 1XBXA 1GKRA 3DU0A 3O0FA 1XIJA 2VT0A 3ATYA 5HQMA 2EHHA 4UTUA 1VFMA 1XJBA 4MJMA 2V30A 2KAUC 4WKHA 3WKZA 3SN0A 5FKYA 4D6DA 2V2CA 2H9AB 5AHFA 2OSWA 4LUIA 3M1ZA 4KRTA 3WNMA 3BMXA 2J62A 1XSKA 2WMFA 1Y5XA 3FA3A 3OLGA 3LN3A 2BVDA 2PMQA 3SY5A 3W29A 2QCEA 3KL3A 3URQA 1RPKA 4TVUA 3VD5A 1VLWA 1H7WA 5GJMA 3ITOA 3HGSA 3PBUA 3KS5A 3MHFA 3EMCA 3H53A 3H4WA 4JL1A 1XCXA 2PGWA 1BWKA 5J8LA 4QSFA 1DIDA 1J4EA 1W6TA 4PSPA 1VFOA 2HROA 2YX0A 2WVVA 4FOKA 3W87A 3IV8A 4ERIA 3T42A 3STEA 2IPWA 3P14A 4CNSA 2XWEA 1ECEA 4GX9A 2XFWA 3OBEA 1TELA 4WF7A 3RJXA 1JZ2A 1B3OA 2V0TA 2E1WA 2YZRA 4O10A 2Y61A 5HDRA 4ZFCA 1BLIA 1LYXA 4OVXA 3S42A 3U3HA 1VCVA 4JTUA 3VNLA 5K9DA 5A8PA 2OLSA 1E9ZB 4JD4A 4HZ7A 4UQAA 3MQTA 1NTHA 2ZOXA 2E67A 1D2KA 3H7RA 4NY2A 2HVMA 2QIIA 4JKLA 1C9WA 4F66A 2NLIA 3HMCA 1HX0A 3R79A 4NASA 4W87A 3HG4A 1QPQA 2C3ZA 2NWRA 5JH1A 4LY8A 3RILA 2VUNA 4IT1A 1M1BA 3T44A 5A6SA 1FHLA 3F1QA 4HP5A 4U33A 3CM4A 3TXZA 5G2WA 4Q3MA 2JF6A 3GH4A 5DMYA 1OVDA 2DW6A 3W1PA 4CU7A 1WKFA 2J6VA 1UMYA 4I9JA 4ERGA 4DJFA 3BLOA 4P7NA 1XUZA 4GX8A 1HL9A 2NVDA 2ZA2A 4DQWA 3RUBL 3ECQA 2INEA 2YXOA 2CLEA 4J3SA 2AL2B 2EKCA 4G8TA 1RVGA 3PANA 2FGLA 5EA9A 2I5QA 4IMCA 4J3WA 1EJRC 1NWTA 1W3LA 2QF7A 1ZAJA 1XLBA 1XYLA 1EEPA 3NQCA 4PMRA 2HCVA 3PPGA 2HNHA 2PDNA 1E40A 2HISA 3VNIA 4TXEA 9CGTA 1WDRA 1UIOA 3EOLA 1EBHA 1DQXA 2VZOA 3IRDA 2O0TA 4RKAA 4GD0A 1S3HA 2OEMA 3KDOA 1AQMA 1HO4A 1YXYA 1GTEA 2A3AA 3N15A 4HK6A 4MPKA 1E55A 3O63A 3USZA 3NEHA 2VWTA 3QZEA 1FCQA 3OG2A 4ONVA 2PDJA 1JJKA 4M0XA 4AD4A 5GPRA 3AIVA 2P8BA 4C7GA 3GH5A 1WZKA 3OG3A 5G4WA 4PBFA 3GUGA 3D0CA 4CQCA 3B06A 1KBLA 1NQKA 4H83A 4TV6A 4ADTA 2NV9A 4ZB2A 2CFFA 3VO0A 3L0NA 4F0SA 4GBDA 5IOBA 5LHFA 2IKJA 4DPQA 5XIMA 4ML9A 2WOQA 3B05A 3GNDA 3OVGA 1EQPA 3T6CA 3NVTA 1XL9A 3B8SA 3LTPA 2LLEA 3WLRA 4GIEA 2DZPA 2FH6A 5DANA 1L6YA 1PEZA 2YDSA 3BMWA 3CUFA 1T40A 3SURA 5L6UA 3NEVA 3TEVA 2QYGA 4M82A 4KWSA 4CD4A 1CPUA 4BHYA 2WVTA 1QI3A 3THQA 4MY1A 3UESA 2PC4A 3V36A 1UH2A 3SFKA 2D0GA 3SCUA 1CCWB 4OBRA 4IPIA 3LS9A 1PX4A 2JKEA 4DXKA 4Z2GA 2Y7FA 5LNRA 5FEXA 1R3VA 3GNNA 5LA1A 1YNQA 1G01A 4FO4A 3BVJA 5FF4A 4E2OA 2QR6A 1UG6A 2YB1A 4ML4A 4XTDA 2DZSA 3RHGA 3DC8A 3TC3A 3CIVA 2IQTA 4IMFA 3M5ZA 3A21A 5D02A 1GORA 3VUSA 1NEYA 1C29A 3SCPA 2J7CA 3S2MA 4C6MA 1E9IA 1LP6A 1TVLA 2EG7A 4YWSA 2WJFA 3M7SA 4G2DA 3TYCA 2XH7A 2XFRA 1LOSA 3NSNA 2PLKA 1QHPA 4KGJA 4B92A 1ZBVA 1AJ0A 2A79A 1WB0A 5J04A 1R3WA 2Q71A 1OY0A 1M03A 3BW2A 3JUGA 1FQ0A 4EANA 4RPQA 2Q3RA 2OYMA 4BF5A 2ZUSA 5LNWA 3EBVA 1AW5A 4MSSA 5GNYA 2Z1XA 3UYIA 4C6BA 1TPEA 2OSXA 4DJEC 4U2ZA 1ISVA 1T99A 4S3JA 2H3DA 3QW3A 4KEZA 3SIMA 3A5FA 2QQ6A 4KCTA 1JZ7A 3VMNA 1R87A 4JTAA 5ABFA 4UTTC 1O95A 4JNZA 3W7KA 2BP1A 4PC8A 5B80A 1KKRA 6XIMA 1LQAA 3BAXA 1VFTA 1A4LA 1RY0A 1BSIA 2VR2A 3KTXA 1MDLA 2WNQA 2RJHA 1OZMA 5AHLA 2CBVA 4DNMA 3JR2A 1Q4WA 3QSTA 4BF9A 2O9TA 4AD3A 1J5SA 2V9DA 1TJRA 2X40A 3CUJA 1GVYA 3EWXA 3FA5A 2FHBA 2J8FA 1ENUA 4AY1A 5C9UA 4B5XA 1JQXA 1XV8A 3GC4A 2E6DA 3AHXA 4PEKA 1J0YA 8XIMA 1J0KA 1XYCA 3OZMA 5A6JA 4LRTA 2VDHA 4INFA 1EDTA 2DZVA 3DBNA 1G4EA 3WG6A 1R9YA 4L6DA 4R88A 3MANA 2AAMA 1O94A 5I5RA 4KIEA 3TYEA 3UNTA 4MB5A 5HNUA 3VYLA 3VNKA 2OG9A 1N55A 3FKRA 5AB3A 1QNPA 4IJBA 4QISA 4PN2A 4B5TA 3L68A 4G9PA 4FK9A 3E0FA 3WCZA 4B3LA 5HAOA 1V3JA 2PB1A 4GIYA 3W02A 1KV5A 2XVPA 3PZGA 2NQHA 1EGMA 4MF4A 1W37A 1JCXA 4CD5A 4HPHA 4B4FA 3PTDA 3K8LA 4ZFMA 1XR2A 4MLJA 3QR1A 3UJ2A 1MUWA 1LG1A 3R2GA 2BXVA 4YTQA 4CNTA 3W7OA 1B9ZA 1SPQA 3TTEA 1AW1A 2OVLA 4JCMA 1E1CB 5FOOA 4A2RA 3ATZA 4DJFD 3ZR6A 3MB9A 2YW3A 2FKPA 2ZZ7A 3WLPA 4ICMA 2Q8ZA 2FFIA 3SUTA 3XISA 1YXDA 2BNJA 1R47A 4HB7A 1UZHA 1Q6CA 4Z2HA 2ZDRA 2W27A 3W7MA 3U2CA 3BSHA 3PTKA 4UB9A 4NZCA 1FFRA 3M5VA 3PZUA 5C55A 1F4AA 3SAZA 2CBJA 4AXKA 1AJZA 3NJ3A 3RO6A 3PUDA 2D2JA 3QH2A 4JTQA 4PUUA 4JTEA 2J78A 1JUBA 5GJNA 5A8OA 4UQCA 2PWVA 3R94A 2WBKA 1E6RA 3OJGA 4JTLA 4UFHA 3GXTA 3W7DA 3W7HA 3TW6A 1I1XA 2F7FA 1KRMA 3LM7A 5EMYA 4LRSA 5B7ZA 3OZPA 1LRTA 5G1MA 4IJCA 4LT9A 5E09A 1I2QA 1XC4A 2DY3A 1HKJA 1TMLA 5LA0A 1CGYA 4D8LA 2QNEA 3GU2A 4MAZA 1W9DM 2XZ7A 5CBJA 2BWGA 3POCA 3EB3A 4FEZA 2Q02A 4HA0A 4Q33A 1U22A 1FWWA 4LXFA 3E12A 3JU2A 2C19A 4JY8A 5U7SA 2WM1A 3SIZA 5C9ZA 3GAKA 1Y5WA 1WUFA 4I6KA 5PTDA 3VIKA 1U33A 4TUFA 3GR7A 1MW2A 5FEZA 3HFYA 4GYJA 2PP1A 5DRCA 3L67A 5KINA 3UZXA 3L23A 2P5NA 2DZAA 1OIFA 3BJSA 5I06A 2A3EA 4IPPA 4CQBA 3OW1A 3MWCA 4LCSA 1LUCA 3R0DA 1H50A 5AZ1A 3QMTA 2UWFA 1YTDA 1TTPA 5AHIA 3WUGA 3EPNA 2DH3A 2ADAA 1WA3A 1EC8A 1OF6A 2RDWA 2YCJA 1XDMA 1JI2A 3H6OA 2FIQA 3NL5A 1T6MA 3VDAA 1FWGC 3J7HA 1F8MA 2E40A 1K9FA 1OCJA 1W1VA 1GJUA 2QCLA 5BNKA 2PDWA 5I02A 2TPSA 2SFPA 3APTA 1SR0A 3WQDA 1JGMA 1IXOA 1ADOA 4GK8A 3H21A 3M0ZA 2HVOA 4KKXA 3SSZA 3D6NA 4DO6A 3LG3A 4FF7A 1G9HA 2INZA 3OVPA 4Z0JA 2INFA 4HTYA 1GNXA 4V1YA 1V0MA 3QVQA 2Z0IA 1CDGA 2VELA 4QXIA 2Y8KA 3EX1A 3GS6A 4O53A 1OCQA 3NDYA 4AWUA 3MUAA 4KRZA 4PUMA 3VNYA 4A3RA 2G3JA 3BGJA 5HMDA 4MJ4A 3QZAA 2VRKA 2ZUUA 1YMYA 3GSMA 3N25A 4JFVA 1A5MC 4UTTA 1YBQA 3W1MA 2JIWA 4ROPA 1JULA 4UWMA 4HMCA 4H8NA 3WNLA 2OX4A 3UCDA 4HHHA 2DGAA 1JUKA 1UWIA 4B5SA 5CGMA 5CSYA 1XLEA 4AQLA 2Q3OA 1GKPA 2QW5A 1ISXA 3NA8A 1WXYA 3LB0A 4ICNA 3II1A 1XH1A 1TWSA 5LIWX 2VFEA 2XM2A 2W62A 3PHAA 1S1RA 1R3RA 4Q6XA 4K2SA 3FAXA 4XBKA 4REQA 2VFDA 3UF9A 5A6KA 4W89A 2ZVIA 1NARA 1M04A 5BOOA 2Z6JA 1E1EA 2C0AA 1M6JA 1HGWA 1CLXA 1XG4A 3M0HA 4UR8A 2Y89A 2Z2UA 2CLPA 1Z69A 4MTVA 3L2LA 1O6IA 4HVXA 2EKGA 3H54A 5BU6A 5KSWA 3O6DA 3WDRA 4QROA 5H1WA 3HG5A 1GQNA 4OZOA 3VKDA 2PDYA 3EMZA 4HA3A 3WJSA 4BWLC 1QI4A 4Y7EA 4AZCB 3BH4A 4MUPA 4OJYA 4LEQA 4WZHA 3N29A 4DUOA 2WC4A 3K2GA 4L9XA 1RBLA 2RDTA 1PCWA 3IIVA 1V8EA 4FP1A 3QJAA 1A49A 4FOUA 3RLUA 1DTNA 2ON3A 1IZJA 1LF1A 1EXPA 4C6DA 4EAMA 3ZSSA 5I6SA 4QTGA 3EXRA 3KCLA 3TW9A 5FSDC 3WLLA 1YPXA 2ZZ1A 3MHUA 1H5VA 2GOUA 4CCCA 2WHLA 4M1BA 4L56A 3TYDA 3O06A 3QYQA 4JY9A 2ZKMX 3CMJA 3A3HA 4AH7A 1UZ4A 4HNCA 2RHGA 2PP3A 4BI5A 4CQAA 5HPOA 1F4HA 3FJ6A 3S5OA 2JE8A 1VC4A 4FXJA 4PCNA 3AJXA 5T8GA 3ABOA 4V28A 3P8JA 4IQLA 1VH7A 2NWSA 4O52A 5C9WA 1ICPA 4UFIA 1EZWA 2HXUA 2YSWA 1W1B1 2FYMA 3N04A 2O92A 1PVNA 3AXMA 3B8DA 3S1GA 1UP3A 1IV8A 1TJ2A 5LNVA 1HO1A 3E96A 3HQ1A 1I6NA 3KTSA 2ZRWA 3R10A 4PB4A 4S1FA 3WH6A 5M2FX 4IICA 2CHNA 1FHUA 1E0VA 2FVLA 4LANA 4MZ1A 3EB4A 4RZ4A 4JQ4A 3KZPA 1I0BA 1REQB 4ZOAA 1AL8A 4Z0SA 1OC7A 4C6NA 4EIVA 2GPTA 3VIMA 1UW9A 3IGUA 4XVDA 3TVAA 1IXPA 4PUKA 4EPEC 5FA5A 2OWWA 4MJZA 5G1YA 2MANA 4AHPA 1XIFA 4AVNA 6XIAA 1S38A 5A6AA 4RE3A 1A5NC 3LCLA 5E93A 3I10A 1OZQA 4DJDC 1W5QA 3GXFA 3T4WA 2CPUA 2VKZG 1U1UA 4UQEA 4A3UA 3EX2A 1HJXA 3RR4A 4C6EA 3GDKA 2PTXA 1VJSA 2QCHA 3NXLA 4HT3A 1XPGA 2DJXA 3CL8A 4CCEA 1E0TA 3T9PA 3VK5A 4IFKB 3WJXA 3UWYA 1Z3NA 2P0OA 4JN7A 1GQJA 1HKKA 1L6GA 2VEIA 3GVVA 3IAPA 4AEEA 3V5CA 3FIGA 5EGRA 3L4VA 4LYPA 1M01A 2PRMA 3GHTA 2F6KA 3NQMA 3TN4A 3DENA 1W32A 4XAFA 3WH9A 4C1NA 4GY0A 4QCEA 1KTNA 3B9AA 3ANVA 3MWAA 4M6PA 5A6MA 2TAAA 1I75A 2ONEA 1FRBA 4QDWA 4LCRA 4P2VA 1NFPA 3KL0A 3GU1A 2D0FA 1FTXA 1PKMA 2YBTA 5LNSA 3WJWA 5CC5A 4HOWA 3A22A 1VZWA 3ME3A 3AXKA 3F2BA 5I3GA 3WEZA 5I3HA 4GJJA 3W38A 2ABAA 2ZX6A 3PPCA 5BMWA 1K8CA 2HSAA 3G18A 3ZXWA 2DUZA 1QR7A 4BR1A 3AC0A 4L6HA 3RCMA 5JBFA 1MNSA 2J7HA 1QK0A 1ZJAA 3SY8A 3PG9A 3CB3A 4F9JA 4E4PA 2ZTKA 2YCLA 4QDMA 3QXBA 2BHYA 3IVTA 3T07A 1E73M 2BXYA 3DHFA 1OABA 3C0JA 1DEDA 3CGTA 5F4SA 4JQ3A 2OELA 2W61A 4GQBA 3PZOA 1Q63A 3TQ0A 3UWWA 3P0WA 4DI8A 4N6FA 3L4XA 4M6VA 3O2LA 1K02A 2J75A 2R1MA 4NAFA 3G1HA 2XIMA 3TYZA 3WLIA 3ZMRA 1VYSX 4H6EA 1TB3A 4AY8A 5HULA 4S3AA 4GRSA 2H6RA 3T2PA 3F5JA 3WLMA 2VO5A 3CWNA 2REQA 4XQ6A 5F2MA 4OUIA 1GK8A 1OSEA 3LEPA 4F0MA 2YXXA 4DJED 2HDJA 2TODA 3DFNA 6A3HA 5HQLA 1G7VA 3GM8A 3MHGA 5I0DA 2WZIA 1LORA 3PS7A 1AQHA 1JD9A 3VKKA 3RNDA 1SW0A 3GNXA 1W9BM 2C1IA 3LXCA 2F2HA 4WSKA 1B4KA 1FWNA 3SR7A 1UA3A 2AOSA 4K36A 4OOUA 1GZ1A 3QHMA 4IMEA 2CHOA 1EHAA 3M9YA 4Q4OA 2OO6A 1OT1A 2WQDA 1XLLA 1I2OA 3W2JA 4W88A 1A3XA 1JZ5A 1FH9A 2Y8VA 1VS1A 4YMZA 3EDEA 4WCJA 1CXHA 4ZO7A 2WANA 1R3SA 1HFBA 5D2WA 4BFAA 1TSIA 1TCMA 4FA3A 4JIPA 4LAUA 1O5RA 3IIZA 2WXDM 4IISA 3FS2A 4DY1A 1F74A 3PG8A 4JFUA 4BWLA 3NGFA 1UR4A 2G3MA 1YX1A 3HOJA 2PF8A 4NJJA 4B2DD 3MUCA 1BF2A 3CHFA 4Q32A 3C56A 5H6HA 2YDAA 2UY5A 4GXMA 4UTFA 1KR1A 3VKJA 3OLIA 3G1VA 5LIKX 3IIPA 2PA6A 3W71A 4MNLA 2GJNA 3N17A 4XAGA 4YHGA 3C0SA 3A4WA 1FFQA 4KCWA 1S2WA 4M6QA 3OVRA 1VB9A 3Q58A 1IE7C 3ISIX 1TV4A 5D38A 4DO7A 2OU4A 4WOZA 1BQCA 4J3TA 1G67A 2PRLA 3UBPC 2W63A 3BJTA 3MMWA 3BLPX 1TE6A 3WF4A 2CXEA 2ALRA 1BTMA 3I3EA 3BW3A 2PDKA 2Q01A 4WUIA 4XD4A 3NIYA 1DXIA 1GVQA 3T08A 3CZ8A 5DN1A 1V3KA 2GWNA 4NHVA 2WNNA 2QCNA 2PU1A 4Q4SA 4LNCA 3GYCA 1GVOA 3BOXA 3IUHA 1Q6LA 1H5YA 2PDFA 4MB3A 2V3DA 3W24A 1O12A 3A13A 2WW5A 4HCLA 4GY1A 1Q85A 5H91A 1XG3A 3UYCA 4JHZA 4U2YA 3BAWA 2FHFA 3KLKA 2P76A 3A3XA 3C2EA 2Y24A 3ITGA 1DPMA 3EDFA 3OPSA 3FJNA 2DT2A 4ENLA 3SRHA 4M7TA 5I09A 3MI3A 1XICA 1HG3A 5EMMA 4PRRA 4Y9PA 2QGHA 3LHWA 3RN6A 3E2VA 1T5AA 2F8QA 1ONWA 1VF8A 3EWUA 1RP9A 1FWSA 1JG9A 1GONA 3ITVA 1J9YA 1Q6OA 5MF5A 2X05A 1JAKA 3KDNA 3R12A 4DJDA 4KPLA 1M41A 3DYPA 4HZMA 3NL2A 3GTHA 2J24A 3DIPA 2NQ5A 3UERA 2OKTA 4U28A 5CLWA 1LDCA 1BYAA 1IT0A 3KOFA 2YCEA 2BOGX 3P81A 4MADA 3BJFA 5D09A 1HGYA 1TA3A 3C52A 3NTYA 5JBDA 4XUGA 1KM3A 1LROA 1VEMA 2YL8A 2WCAA 4K7VA 3OHMB 1BAGA 3OGRA 3QPYA 2WMJA 1R6WA 3AIWA 1E71M 2DZTA 2GDQA 3TKFA 4XISA 3G1YA 3L2IA 1A5CA 3TA9A 1VKFA 3UWEA 2C91A 5CSRA 4MNJA 3MKKA 4BEQA 1ALDA 2J66A 1KWGA 1Q3NA 4MWAD 1N82A 2OODA 3PP7A 1JPDX 4MNKA 2YBVA 1VYRA 5CJMA 3DERA 3BLIA 4G7EB 3TAOA 2JIEA 1TJ0A 5M5DA 2DPEA 4PULA 4PFMA 1Q6GA 3ZSTA 1IQ8A 1V6VA 4D6GA 2NT1A 4HD5A 1V6YA 1E43A 2OO0A 2Q8LA 1EO5A 3RPTA 3TU9A 3AJ7A 4BF7A 1LQ0A 1SJCA 2JKPA 4W8AA 3INPA 3SW6A 3LMZA 4F0LA 1UYQA 2FZBA 3TFCA 1C92A 3VE9A 2CLHA 1ISWA 4RR4A 1GOMA 1GYMA 3STGA 4ATDA 4FOJA 5CLTA 5D9MA 1TPDA 4MKSA 5I07A 3A4XA 2ATMA 3FGCB 2WVSA 1F6KA 3E38A 2VD9A 3HQOA 4LAOA 2O7QA 3BSMA 1JZ3A 3GHUA 2MUCA 4IG2B 3DKLA 3AXIA 1WV2A 3CQHA 2PLJA 2J9YA 2PD5A 3GVRA 5H8UA 3R0UA 3MKVA 9XIMA 4JTFA 7ODCA 2CLFA 3GHSA 3ANUA 4PMZA 1W3NA 6REQB 1OG6A 3PBWA 1X38A 5BCAA 1TV5A 1JPIA 3AIQA 3UP8A 4G1KA 3CO4A 3CT2A 3N2XA 1KXQA 5D32A 3EDKA 2HEJA 3GW0A 2J7EA 5EPDA 1PZ3A 4FIQA 1VJIA 2IQDA 4NAEB 4DUVA 2E5DA 3O0KA 1A80A 3ES8A 3LHTA 7CGTA 2R94A 1IIHA 5E9AA 3IACA 4PUDA 1SFJA 2A2IA 2WNWA 5FAJA 4N9EA 1NELA 1GEQA 2ZX5A 4TMCA 1LL7A 1JVNA 2FMNA 2D73A 3HQNA 4Y90A 5BYWA 2FGZA 3NO1A 4MKNA 3RRAA 2ZRXA 4GY7A 4JS3A 1L2UA 1R38A 4M80A 3QR0A 5AVNA 4ICCX 3LRLA 5FF3A 4AZBA 3CWHA 3TDFA 4S23A 5I79A 2BV9A 5M03A 5C2XA 4ATWA 1YNYA 1DHPA 3RM9A 2Z1VA 2GJPA 1SZRA 2DZXA 3EOOA 3AXHA 1AODA 1ZALA 4KQNA 2V6AA 2CNCA 1RBOB 4IXHA 4C6JA 1QRQA 4FR1A 4JDBA 4H9XA 3I4EA 1AW2A 3TN6A 3CEUA 3NPXA 1L6FA 1V51A 1P5BA 2AKMA 3CMFA 3BAJA 3MBDA 2ZYFA 2BG5A 4P8UA 4LCQA 1DOSA 1TUXA 3MJYA 2OZ0A 4LS0A 1M65A 4PB3A 1EYEA 1IEIA 1T0OA 2DSVA 4HKPA 1SMDA 1S2TA 1IR2A 5AYZA 5CZ0A 8XIAA 3W1AA 5HMEA 1WUEA 3SQMA 3FW6A 1R7OA 1GYLA 5HK4A 3ABQA 5M1TA 4E8DA 4OV9A 1XXXA 4D6CA 2WMHA 4NNBA 1D3GA 3AHYA 1ZJBA 4D8ZA 4D6HA 2GSHA 2BVYA 2ZC8A 1I45A 1I0DA 1ONRA 3IPWA 2HE8A 4Q4KA 1G7UA 5E0FA 2ISSA 2VXNA 4NX5A 3AWOA 3MV01 4Q7BA 1NVMA 4CQ8A 5J5DA 3A4JA 1PKNA 4UFKA 2BY2A 2NQJA 2FDMA 3B40A 3NFUA 3THCA 1S2VA 1EJTC 2EPHA 1TV2A 1JYVA 1US2A 1W1ZA 3PTQA 4LAKA 1FUYA 5HPCA 2QV4A 4AC1X 1WOBA 1AMKA 1SR9A 4WSJA 2QDEA 4DWSC 1UUMA 3BICA 1ODUA 1ZCCA 1XGEA 1B57A 2ACRA 5F2IA 2QAFA 1KXTA 4J5NA 3WLHA 1BGGA 5F1UA 2NVAA 2X0SA 2QCMA 3WD2A 2QKFA 3W2UA 4YCPA 3ARSA 3N6JA 1Y5VA 2VM8A 3FSTA 2W92A 1C8YA 1BQGA 1H09A 1PX8A 4MB4A 1ITQA 3TP4A 2F6UA 4DVOA 3QKZA 4GGBA 1E15A 3WJYA 1SSDA 1HTIA 2XH2A 4P7RA 1G5AA 1AD1A 4AIBA 3KWSA 3WFLA 1YTKA 1R3YA 4JTTA 1TTIA 3H4XA 4XSLA 5U4NA 1MEWA 1SZNA 1A5UA 3W85A 5G2IA 3C6CA 1QI2A 1HP5A 3FV9A 4PMQA 1YDVA 4FNPA 3CIXA 1UC4A 2NXHA 3TLQA 3BANA 3HA1A 3WLQA 4W8LA 2E6AA 1BFNA 3ABSA 5C7HA 2O9PA 4HJFA 4GI9A 1EHNA 4N4QA 3LK6A 4F2BA 1UB3A 1V6XA 1U2YA 3ZR4A 3TAKA 4X2RA 3GXPA 3E49A 3QFWA 3QC0A 3MP4A 4R7JA 1IGWA 3AROA 2GQ3A 3M0JA 3DFTA 1TO3A 4ACZA 5BRQA 3W37A 4L9ZA 4S3KA 4LW7A 3OVQA 2I56A 2A7PA 1HQTA 1SVDA 4FAMA 4H7ZA 3QV6A 3REQA 3FHQA 2IXUA 4EPBC 1YE6A 5F4WA 2V3FA 4EE9A 3BCDA 3RXZA 2YFOA 4HCDA 4D8AA 4N2YA 2HNEA 3TCEA 4AF0A 4LS1A 1VIWA 4RLIA 4XKYB 3FVDA 2EPMX 4Z1CA 1UJPA 3MT1A 4FX6M 1MRAA 1LBMA 3GHRA 1EOKA 1DE5A 1W9XA 1XPYA 1XCWA 3AMLA 3UGRA 1FCVA 2ABBA 2E28A 3NR0A 2V5LA 3PNUA 1HL2A 4B4HA 2Z00A 1O5QA 3UG4A 2NUXA 1RK6A 1UC5A 1DYSA 3VNJA 3KM8A 2G3FA 2O56A 1NOUA 5IDIA 4I9TA 2YYTA 5AC6A 3RF9A 4PTWA 3AYTA 4Q8WA 3R0KA 2ZX7A 4WDTA 2WAGA 3F03K 5FF2A 3WQCA 2VZVA 1WDSA 1DJIA 1SQ7A 2PS2A 2Z2BA 3B8VA 4KESA 3W1QA 1WZMA 3CIWA 3VIGA 1K9EA 3VGEA 1M7JA 3AS3A 2GK1A 3LNPA 4L65A 3SUVA 1RVKA 5CPQA 1I2PA 3WH5A 2IUZA 3CZJA 1IXNA 4S38A 4ZOEA 1QNVA 1TX0A 2QVHA 1WXZA 3GZAA 3W9ZA 3HV8A 2YA2A 1FH8A 1DJWA 2DSZA 4WEVX 5E0KA 3R25A 3BSGA 4GVHA 5I3JA 3NPVA 4PCPA 3TR9A 4HBKA 2P53A 3ZZ1A 3QV7A 3KZSA 2V5BA 4A4AA 3ZFHA 4U5IA 1UKQA 1AZ1A 3IJIA 1QW9A 4GVGA 3NPWA 4J28A 3BO9A 4LGXA 3S1UA 2NSXA 5FJPA 2ZE0A 3NL3A 2ACUA 3KP1A 3LU2A 3SECA 3QMRA 1N7KA 2D22A 3KOZA 4H9MA 5TD4A 3CQJA 4HSHA 4JTSA 2ZDSA 3PBVA 4DPPA 3FYYA 5CQ1A 3G6MA 3CASA 1BD0A 1XRVA 3A12A 3XINA 2FZNA 5KMYA 3HTWA 1TJPA 3R6IA 4NNAA 2HMCA 2OEKA 1JD7A 1KFEA 3OB8A 1XINA 1C91A 1Z8AA 1KGWA 5IHRA 4Q8UA 1OX4B 3B3DA 1H63A 1QU4A 4GKTA 4BQ5A 3V16A 4WK9A 3U48A 3GFXA 2RKXA 3WBYA 4CEXC 1KRAC 4IMGA 5HA7A 3MZ2A 1QBAA 1KM0A 1GVFA 3STFA 1W54A 4P61A 3CWOX 2C1GA 4LB3A 4J2MA 2WZHA 3EWBX 5A8MA 4WJ8A 4J3VA 3FJLA 2HS8A 4XZNX 4IZGA 1BHGA 1S5MA 1FWEC 1T8QA 5D37A 4AC7C 4DLMA 1B90A 3DG7A 4YJ5A 2CEQA 4I7UA 4RDZA 3NDZA 3W7EA 4OKDA 2FLIA 4S3CA 2QCFA 3DOPA 1Q4NX 3KOYA 3LXAA 4DWSA 4K1WA 4WSHA 4AYSA 4CNPA 1X39A 3USBA 4B3ZA 1BVNP 1Q6RA 1KQYA 4B5NA 1HT6A 3UQNA 2HS6A 4GABA 4EF9A 1TVPA 5K2ZA 4OBSA 4H7VA 3LERA 4GIAA 4N9DA 4RXGA 3SDOA 3VNMA 3RU6A 4XSMA 4CNNA 3SQLA 4O14A 1Q8AA 4YXGA 3BE7A 2I5IA 1XH2A 2HWGA 3I6TA 2QUVA 4DF2A 1UCWA 4CD8A 4JIHA 4NI8A 4HPNA 3IANA 1WKEA 1ME7A 4YTSA 3NYDA 4ZQOA 1EFZA 2A5HA 4HNOA 4MLRA 4Z2LA 3HN3A 5TNVA 4D6FA 2EO7A 1NFGA 4DZ5A 2ZBTA 2R9RA 4NF7A 3PZMA 1TWDA 3N34A 3LHZA 4H9UA 4JAWA 1EIBA 2PLCA 3T2QA 3WLJA 1YYAA 2VX4A 3IJ6A 1PHWA 4TIMA 2BOFX 3UWVA 1HN1A 1EJSC 1ZCOA 3OOQA 3V18A 3CV1A 1S46A 2FVKA 3B4YA 1W1IE 4Z2IA 4ILSA 4Q8NA 3ABXA 3VGBA 1UHVA 1KCLA 4UTLA 1ZU8A 1N8WA 3SGZA 5BZAA 2A7RA 2WKLA 3MSDA 2HJPA 3VFCA 3WQ6A 1S3TC 1D3HA 4AWSA 3NZQA 1JPKA 2E6YA 1RH9A 4NRRA 1JF5A 1UKOA 3RAOA 1HKIA 3B4UA 5EYWA 4J40A 3PVFA 4Q8PA 3QLDA 4F2UA 1EEXA 3OIHA 4HNLA 3DKJA 3WELA 1F3EA 4Y9AA 4RE4A 4EKJA 1I1WA 1VFLA 3SSJA 3A6OA 4UOQA 4LPCA 1E0XA 1XYAA 4WJXA 3EA1A 3NQDA 1PO9A 2WC7A 2NXGA 4KIRA 4E4UA 2X0YA 5AY7A 3FFSA 3K13A 4UMAA 3EDJA 3DYMA 3U8GA 1ONXA 3EDDA 1E4IA 4L5ZA 2GL5A 1X96A 1SSGA 3WFZA 5CGQA 2GVLA 1B3WA 2V5CA 4NJKA 4ZTYA 3WQFA 4LUSA 3TQPA 3GX9A 4LYRA 4IHCA 1HZYA 2VFHA 4ZO9A 2CXGA 4P7QA 1FXPA 1UOKA 3IJ9A 1A47A 2I57A 1UP2A 4LQ1A 1CWYA 1W3TA 3HO8A 1K77A 1B2YA 1G4TA 1UA7A 1E3XA 2WZMA 3CHCA 3MP5A 2G97A 3UXLA 2VR5A 3AXXA 4IQJA 2B31A 1DL3A 1V0LA 2XSXA 3LBOA 1TPB1 3W86A 3N18A 2YOCA 2FB2A 4XZHA 4MYXA 3R58A 3VOGA 3VILA 4FF5A 1HJUA 1FWJC 4X2PA 5C71A 3ITXA 3WENA 1WZLA 2WPBA 1K9DA 4FLRA 4XAPA 1QTWA 3GFYA 4QIUA 4ZQNA 3CNYA 5CZKA 1A5BA 4A6GA 3HF3A 5C2CA 1W1A1 1UR2A 3QOKA 3M44A 1F5ZA 4IMDA 3O3RA 3TWBA 4O4VA 3AALA 2AQVA 3SZ8A 1TTJA 1A5LC 1GQIA 2TSYA 1VR6A 3VABA 2GVJA 3WL1A 3PNZA 5CH9A 1NY1A 1B54A 2PSNA 1R2TA 2ZXDA 3CH9A 2QMJA 3BL3A 3A5VA 5G4HC 1P0BA 1HJVA 3WL0A 2WVVB 1DIOA 3GTIA 2QJHA 2QHAA 3C86A 1Q13A 8CGTA 1L9WA 4MAVA 1ZENA 3AMGA 2GGEA 3VM5A 1KB3A 1D8CA 3PZVA 4GI6A 4YCOA 3H24A 1GCYA 5K9CA 1V08A 3S4TA 2A3HA 1J2WA 1RUSA 2E5BA 2VX5A 1U5JA 4E8GA 2B7PA 2WV8A 4GJ1A 2FFCA 1PIIA 2DT1A 2PU0A 3NZRA 2ZZ2A 1XD0A 1HJQA 1CBGA 3LDVA 4KF1A 3VKCA 5M17A 4S2BA 3UXDA 5A8QA 2PWHA 3M0YA 2QDDA 3MS8A 4MHBA 4CN6A 5FI8A 4B90A 2PWGA 1JNEA 2OZTA 3VGFA 1J0ZA 4C90A 2Y7DA 5MKGA 1YADA 2F38A 4Y96A 2DIJA 3KS6A 3NUKA 1J5TA 1VRDA 3SQSA 2YCKX 1W1YA 2J77A 3U4AA 1R2RA 4IGHA 4L4OA 3WLTA 5G1TA 2FPYA 5CPTA 4E3TA 1DXFA 1R3TA 4HHLA 1TIMA 2PDLA 2BODX 2NX1A 1F76A 1BG4A 5CPSA 2OPJA 1TQJA 3CU2A 3UPWA 2QIWA 1V6TA 2Y4SA 1CGWA 3IGXA 5XIAA 1WYIA 2WKJA 2ZWYA 1PZ2A 3A9IA 4AZ7A 3BTNA 4BK9A 4PE8A 2PPGA 3EWWA 3HJZA 5CC3A 2UY4A 4UOJA 2WO5A 4JIIX 1TG7A 4KT2A 2X7VA 4GI4A 4UXDA 2UY3A 2OMAA 1JUEA 1DIKA 4WQ6A 4XZIA 3UVAA 1EPXA 3AIEA 1N2VA 4DWSD 4RE2A 1A3HA 2E68A 4FLSA 3ZWTA 1JXKA 2VI0A 3T2OA 2WK2A 3I65A 1L0PA 4JICA 1W91A 3EXSA 3H2CA 1UROA 2BMBA 3RLGA 4L61A 2QZRA 3C3NA 5A94A 2VVSA 3OHIA 2XIQA 1SU5A 4LV4A 2CLLA 3RGTA 3I4KA 1QAPA 1EX5A 4GINA 4YS1A 2HBVA 1W5NA 4LU0A 3HJEA 1B1YA 4DYEA 3T1GA 1POJA 2C1HA 3O6CA 3GYEA 3GIPA 1P7TA 3BXWA 4KEMA 3VIFA 3EX6A 3JZEA 3KHDA 1VFSA 3ARZA 4A29A 4IXXA 1RK5A 3UT0A 3HQPA 2E25A 3WMLA 5GNXA 2WB5A 1RSCA 4PODA 2PEVA 4LF1A 3H7VA 3GC5A 3MC5A 3WNKA 3AHZA 4GOAA 1D9EA 2DUXA 4L4PA 3QKEA 3EGJA 2R1PA 4QEEA 4EOUA 4CU8A 2V2DA 4P7LA 3GFZA 3S6TA 2PP0A 3CV7A 4E38A 1OHLA 1XWYA 3WYZA 3TWAA 5EB8A 1Q5MA 3U5UA 2W4XA 4RXFA 1ICQA 1P48A 2Z28A 4MUZA 1VP5A 4AU0A 2E9MA 2Y8UA 1F07A 3FN9A 3NOEA 4GUJA 3CTTA 4GZ7A 4JTCA 4FLQA 3O9NA 3M46A 4EVZA 5DBTA 4QRNA 2BFGA 2IKGA 3VC6A 1BGAA 1XLFA 1KC7A 4PMNA 1TTQA 5SWUA 1JL8A 3O7UA 2XSBA 1ISZA 4HYWA 3AS2A 4QAWA 3KRZA 4OT7A 3ZIZA 2QXWA 4O0QA 4ZZ9A 2VGFA 2FH8A 1QXLA 4DXVA 2BB0A 1ZP3A 4F0KA 3VC5A 3TJ4A 2CKRA 3V3WA 1JCLA 1Y8BA 1G94A 1GOKA 1AH0A 3C4UA 2GGJA 2ZRZA 3G1DA 1E4NA 4S3DA 4DELA 4OBTA 5GVJA 1K9TA 3CUHA 3KEHA 3GIQA 1ZPTA 3VD7A 2POTA 2E09A 1AZ2A 3RPDA 3GNOA 5IBXC 3AU6A 2OLHA 4MPQA 4YPJA 2Q6ZA 4GPNA 5BXTA 3S8HA 2J13A 2J8TA 1IZKA 4NYUA 1CNVA 5D03A 3HU7A 1MZRA 1Z48A 2G0WA 3C8NA 3MYPA 1D3CA 5C2GA 4MZYA 3N2OA 4H1ZA 5F4XA 1L6SA 1I8JA 2NT0A 4WHBA 3M43A 4FPSA 1C90A 4AIEA 4UZUA 5ABFB 4F8XA 2G4JA 4GUIA 3QW4B 3PZ9A 1RR2A 2VC5A 2JGQA 4FNTA 1EJWC 1PUDA 3UA3A 2XFYA 2AGKA 3CK5A 5LXXA 1PIFA 4L1WA 2B7NA 3FY1A 3VA8A 4PCFA 3BLDA 3P84A 3GTFA 5KTLA 3IAQA 2IKIA 2VL4A 3UWZA 3GR4A 1KM4A 4ZO6A 1XYMA 4NJHA 3KTCA 4DBUA 3AISA 1K4GA 4MKVA 1JFHA 1EX1A 3R1ZA 4RW5A 4XBSA 1ZP4A 1CXIA 1YDOA 1NWSA 4QITA 2XJ7A 3WDPP 2FZDA 3GTXA 1WDPA 1XLDA 8RUCA 1SO3A 3RFAA 4D6JA 3XIMA 5IFTA 1I2RA 2NX9A 1BXCA 2IS7A 2JEQA 3W2NA 3ARWA 1X8CA 2JGYA 2PD9A 2VGGA 3TIMA 3KHJA 2TYSA 4JIQA 1K3UA 1M68A 1KLZA 1CLVA 3L4YA 1V7AA 4N6EA 1UWRA 4HTBA 3KBMA 1LLZA 3UR5A 1BRLA 4HN8A 1KR0A 3VMOA 2RGLA 4US5A 4HOZA 3W81A 2W91A 5DCDA 2ZX9A 4J4KA 2VHLA 5F1VA 1S5WA 3R8RA 3JZUA 3W7QA 3PZNA 3VFLA 2WZEA 2V3GA 2V38A 3CPRA 3TN5A 5CZTA 3AMCA 4PMXA 3SCTA 4EACA 4HQVA 3EAUA 2R1LA 4TQTA 3AYVA 4HA1A 3TW7A 1S1PA 2PFHA 3PBGA 2F84A 3QOMA 1YLVA 1E9LA 1NJJA 1H0GA 4HCHA 4J3ZA 1M9HA 1QCWA 4PSRA 3U7BA 1LWHA 1US0A 3M47A 1EWEA 4G1NA 1Q8JA 1MMFA 2VRJA 3JVAA 3BPWA 1W3HA 4W93A 1Z9AA 2VD8A 1VBUA 4KFPA 3F4DA 4J27A 4BI7A 1TRIA 3HIJA 1J18A 3R8HA 3TE9A 1VBRA 2P3EA 1WCGA 3KBWA 1VIZA 5CCZA 1XRTA 2NLYA 3VOFA 2Z29A 3SCRA 3CPUA 1GVRA 3VE7A 4CLMA 4O0KA 3ZLHA 4JTJA 3CAQA 5D8ZA 4PBGA 4EXBA 3LYEA 1S2UA 1JDAA 3VD4A 3R11A 1XM3A 1E56A 4PMOA 1AK5A 3C2OA 1O66A 1TPFA 4POCA 5CPLA 1I9CB 1XD1A 2TMDA 3L5LA 1ODZA 5BW6A 4US6A 3CAKA 3AZTA 4I7VA 4W7WA 1OIMA 3GDTA 4XZLX 1BTCA 2O55A 4I90A 4NNCA 3QM3A 5HNTA 7REQA 3QN3A 1QPRA 3T40A 1WDWA 2C0HA 4D1JA 2GJRA 3BWWA 3QGVA 3LTYA 4JKMA 1JGIA 1W1PA 3GNPA 3MMUA 3SCSA 1GQKA 2G37A 4AWTA 1XLGA 4R9OA 3QYSA 3AIUA 4QFUA 2XG9A 3N2CA 2E0PA 1UMLA 3HGJA 1BYBA 4RL3A 3EYPA 3W01A 3R4IA 5LXEA 3SUWA 2PTZA 1DBTA 3CAVA 3UWUA 3VDBA 3T8QA 2DZWA 4Z1YA 1IZCA 1O7AA 4S3BA 5BU9A 4ZE5A 4RE0A 1H11A 4PMVA 5A95A 4HHPA 1WKYA 1N8IA 4WY0A 1UD5A 3UCQA 3E0LA 4GQ0A 4FS9A 3BMVA 1AQFA 3QY6A 3B9DA 3UG8A 3M0LA 5DF0A 3GXDA 4RNHA 1MO0A 2Z7KA 3W72A 4DN1A 4QQ3A 3KBSA 2HE5A 6PTDA 2VP8A 1Q7QA 3GXMA 1LUCB 2I9UA 5C54A 2ZXBA 3FXYA 2DORA 3FVMA 4WLCA 3MJMA 3LHUA 1H60A 1XLAA 1XYFA 2E1DA 3OLEA 4LVBA 1XLKA 3PPHA 5EBUA 3FXGA 4GC4A 2YL6A 4DXXA 5H8MA 3LHVA 4FALA 4WKFA 1MXGA 3ARTA 3NQ2A 1GWJA 1Q2SA 5HUOA 1A5KC 4NILA 5E6YA 5EFDA 5HATA 3UZ5A 1NDYA 2ZE3A 4UCFA 5AC8A 4QE4A 1FWRA 2PODA 3KLLA 1W9UA 4LSBA 3W0KA 4O57A 1THFD 4LV9A 5IBXA 3Q37A 4KEVA 1WBHA 3DUGA 4ZEPA 1E0UA 3H7UA 4N9BA 5HQEA 4AXNA 4KETA 1UD8A 4UQ9A 1LWJA 2X41A 3PN8A 1GQLA 1WPCA 4A3HA 1LM1A 3KWXA 1LOLA 5DMLA 4DLFA 4CQDA 3WF2A 2NVCA 1IEWA 3OBAA 3GDBA 4R7WA 3LI1A 4C7FA 2YL5A 4RNJA 1JNDA 4N7QA 2QJNA 2AAAA 1M53A 1ADSA 2ESCA 4Y9NA 1H49A 1YBQB 4IGMA 2FHCA 2Z24A 4DI9A 4DYJA 4GISA 1OGGA 2FZMA 2FJKA 5T9CE 1E6SM 2CBUA 4CN4A 3I6RA 2XVKA 2ZA1A 1MQQA 4PTDA 1OFOA 1CXKA 2OCZA 2CHRA 1O60A 4CGTA 1WX0A 3RX3A 1YKWA 1WQ5A 1HNYA 1YDYA 4DEFA 3KUMA 9XIAA 3RLHA 1A0EA 4ORMA 4Q8MA 5LHEA 4GYPC 1DP0A 1V5XA 1S5VA 1SYTA 1ZTVA 3UJFA 3QQ0A 4CN1A 3KCOA 2EPNA 3CLWA 2QJIA 2DUAA 5D05A 4XAZA 3W1TA 2VURA 2OYKA 5IXEA 3O05A 3V4BA 3PAOA 4REQB 3CV6A 5D2TA 1F7BA 1AUSL 1X97A 3N1AA 4HHMA 4TV5A 3EXTA 3EWDA 2A6NA 2WLYA 1PL9A 1GYNA 2J7BA 3LBMA 4HPXA 3BQ6A 2ZFAA 2UBPC 3DESA 4Q4PA 5JVLA 3B03A 2CU0A 3GVWA 1F05A 4TX8A 4H9YA 1SZFA 4ZBCA 5T9BG 3LGDA 4FZIA 3MW7A 4IQEA 3CZEA 5ABEA 3TSBA 3M0KA 4RK8A 6ALDA 1KM2A 1RBAA 1XH0A 2J47A 1PX3A 1OJXA 5CG7A 3N3TA 1QK2A 1WOAA 4RW3A 1D7FA 1OYCA 3KE0A 4ZB5A 4Z2KA 1YTEA 1HL8A 3N6HA 4GZJA 1QI0A 4US5D 4UIOA 1L2QA 2ICSA 5G4EA 3LX9A 1OT2A 1PTAA 3LBCA 2G4FA 3CUXA 1K8XA 4CCDA 4YTUA 5KITA 5CGTA 4NIRA 2FTWA 2G96A 4MIMA 5D9PA 2Z1SA 1RJQA 1KM6A 5GQBA 1UD4A 1TMHA 1B3VA 2WHKA 3SGUA 1CB2A 3MO7A 2ZZ4A 1ZAIA 5I23A 2PBOA 1ME9A 4EAYA 1K7XA 4Y2WA 3O6YX 4TTGA 4XZMX 2V68A 2OYLA 4V33A 3BDKA 5HNRA 3WBAA 1DWFM 2ZUWA 5HMSA 4YHEA 3EKLA 1WAUA 3BGAA 3QPEA 3LCXA 2Z1BA 3ANYA 2Y85A 1V3IA 2J8GA 2TRSA 1TMQA 4LC6A 3TNOA 1FP9A 4NP7A 2VQTA 3N2MA 2OJPA 3M41A 3WBXA 2VOTA 3BV7A 3HG3A 1LTDA 4ATLA 1UPMB 3WD4A 4AUBA 1MW1A 1F9CA 3QZ6A 2PTWA 4PRTA 5FEWA 3SB0A 3PBYA 3COTA 3BZJA 7XIMA 2WCGA 1A4MA 1FX6A 1DJQA 2A6LA 3DAQA 3BLKA 3ONBA 3R7MA 1UQYA 3WN6A 3LQLA 2XSAA 4ZOBA 1I60A 4NKCA 4YVVA 5HR6A 3K8MA 1TPUA 3CQ0A 1M3UA 3IUDA 4Z2JA 1GPWA 1W31A 1ZFJA 3Q94A 1E5NA 3WD3A 3UJSA 1L8NA 4IGSA 2WQPA 3M7WA 5JQ9A 3NL6A 1B31A 4C1KA 2WVUA 1IEVA 1CGXA 4O1BA 5FJRA 4IGNA 1BEUA 2NW0A 1VCGA 2WWCA 4QAIA 5CXPA 1JZ8A 3CMGA 3P60A 4O54A 1OC6A 5AC7A 3DX5A 7TIMA 1KNWA 4HU0A 1QNRA 3H2AA 1OFEA 1J11A 1UD6A 2GJXA 5G5IA 3T05A 2XIBA 3LCGA 4QJ5B 1ZGDA 3K30A 1WBJA 4C1NB 1DKWA 4CD7A 3CXOA 4MVAA 4QR6A 4PZVA 1LLOA 2ZXAA 1PCKA 3PB2A 3UPMA 2Z6IA 5KZEA 2XINA 3PZTA 1XSIA 1ZAHA 1YW1A 3B0PA 1JXJA 4O19A 3TC6A 1AVAA 3SUSA 4I3GA 2DT0A 3RDKA 1CYGA 2OOGA 2XFFA 3OGSA 1XLHA 2XN2A 4CNUA 4X63A 5T91A 4F2TA 1GOWA 1C9DA 3TV8A 5DBUA 3HPAA 3S2CA 1P0NA 3CJPA 4XZ9A 5DFAA 5FAGA 1QPNA 3P6LA 1KBKA 4GUHA 4QSHA 3U2OA 2YCLB 1Q6QA 3T0CA 2C71A 1OD8A 3OYXA 1EUNA 1OX5A 1KCZA 1H62A 4ZENA 4MJ2A 4PA8A 5HUPA 4F9DA 2D2OA 2O4MA 1PPIA 1QBBA 5DT5A 4WVXA 4H2CA 4D6EA 4LEFA 3K46A 1R86A 2PUZA 2VEFA 4MWAC 2XZ9A 3P80A 2I7GA 3TTOA 2FPTA 2QPXA 4BCEA 4TVCA 4WJEA 3G0SA 1H41A 1FDZA 3DHPA 1QUMA 3WEMA 1UUOA 4M29A 2RJGA 1YPFA 4NAFB 4H8HA 1OK6A 4V27A 5A5WA 4TO8A 1NFBA 1TR9A 3LSCA 1TWZA 3IVSA 4H4IA 3R8GA 3NZGA 3VX1A 4JPGA 3EOUA 1XKJA 2OQHA 5BXSA 3GQYA 3IIXA 3RIKA 4ZCWA 1HP4A 1A50A 1A53A 2GJLA 3LCHA 1CZ1A 2P1FA 2REQB 1LL6A 5CKSA 1KXHA 1YXCA 4BJHA 1OFBA 1IWBA 2CZEA 3BLEA 3KX6A 2PBGA 3UEQA 1KTCA 4Q8QA 1V4YA 1WNOA 2ZRUA 3WQWA 4CUCA 1EL3A 1BXBA 3V1HA 2XVNA 3WNOA 3WQOA 1XRFA 5REQA 4GYPA 3LPFA 3SGGA 3AU2A 4GZIA 3TMQA 3QGAC 4RUBA 1PV8A 1XQLA 2YA1A 3NSMA 3PZQA 3V1PA 4A05A 4ASTA 1GJPA 3CEPA 3VD3A 4D1IA 1IGSA 5BRBA 4DJEA 3ONCA 3B97A 2B0MA 3SRFA 4LUTA 4EXQA 4IIEA 1Q65A 1VYPX 3ZVHB 3H8AA 1UWQA 3GZ3A 1FWIC 3ZLGA 3KRBA 4GA8A 3S5ZA 4NX0A 1SJAA 1HJWA 1FWHC 1C7TA 2G95A 2V63A 3FYPA 3TJXA 3OZYA 4OFCA 4AMCA 4LFYA 4IFRA 1G4PA 3SO7A 3ABRA 2QCDA 1AFSA 2EJAA 1OCNA 4GUGA 5DMNA 1B3ZA 1BVWA 4H8UA 3MCMA 1KO0A 3E0WA 8TIMA 1B9BA 2BSLA 4NJGA 5CAHA 2BTMA 1JYNA 3BCFA 1GTHA 3ORWA 5G2HA 4JL2A 3GG7A 1PIGA 1BWLA 4FIRA 4O4WA 5E5CA 3FOKA 1R2SA 2JQXA 3WDIA 4JHMA 1P4CA 3N2BA 4I8YA 3UJEA 1EZ2A 4B2DA 5FSEC 3HBLA 3L0KA 1Q6DA 3MDWA 4A21A 4KFOA 1PKYA 2J9XA 1VBGA 3GDLA 1CGTA 4NZ3A 2G3IA 4RZ5A 4YU1A 7PTDA 4GH1A 3VOJA 2BVWA 1JEZA 1R46A 3EOSA 3G1FA 3P5ZA 4XUYA 3W88A 1IWAA 4PYSA 1VHNA 1KFKA 1FDJA 2P0IA 4KWWA 2XUCA 1H2JA 4MFEA 3LTSA 3ITCA 2A3LA 1VGAA 4KCVA 1XX1A 4A8LA 3N19B 2X7WA 1H7NA 4WKAA 3NDOA 4MNMA 4UFJA 3B8UA 1JZ4A 5JMUA 1MFUA 1XUUA 4IOTA 4JZ5A 3NM3A 5DXXA 1JDDA 4WY0F 4GKLA 3WK0A 1JRBA 3HZ3A 1ECQA 1RLDA 1ZHAA 4ACYA 1G4SA 1J0HA 1VPQA 5LZLA 4AIUA 4S3EA 1IR1A 1UD3A 1OFAA 3W7PA 3N2TA 1NP2A 1L8PA 3PUOA 5CG0A 2HZGA 1XIHA 1QATA 3TUUA 1J01A 3JW7A 1P43A 3DN5A 3DFOA 4HSNA 4PGLA 4EPDC 2JBMA 4V1XA 3T0DA 3GWQA 1K8ZA 3F4NA 5EFFA 3NG3A 1H4PA 2H8ZA 1RPXA 2E9LA 3H26A 1LJYA 1T96A 1F3XA 3UY8A 2R14A 1XC6A 5BXRA 2D24A 3LA4A 1JCTA 1X1OA 3OP2A 4XAYA 1CLKA 3VU2A 2A3CA 3LHYA 3SRDA 1TA3B 1M7OA 3M0VA 5IRPA 2Y5SA 4UNKA 1H1ZA 1QPOA 1DJHA 1KV8A 4U31A 2WSQA 3POHA 3KBNA 1OGBA 4NSBA 2WPGA 3LD5A 3IARA 4MOZA 2WHJA 1VCFA 2WSRA 1NP0A 1P0KA 1UJQA 1GHRA 1PBGA 1NQ6A 2DU2A 3G0XA 4P8VA 3ZJ6A 3NPUA 4JFSA 4UOZA 4NI3A 1XW8A 4C5ZA 4PB5A 3ARQA 4HK7A 2VEPA 5JBEA 4C6KA 2PCEA 2VQUA 3HPZA 3BLLA 1JIBA 2V5KA 4WDXA 2NX3A 1MWOA 2GUUA 3HB9A 5LIYX 2D2HA 3WLOA 3MI2A 4RCXA 5ABHA 1HW6A 1TQXA 1Q7ZA 3APYA 1KW1A 4ZOCA 3THAA 3N12A 1Z42A 3H2EA 2CERA 3KOXA 3H2MA 1JRCA 3TTQA 2VC7A 3GE7A 4UR9A 3VGDA 3MUIA 4MWAA 2R6OA 2BS9A 3VAVA 3BUVA 3NOYA 1S2CA 3GG8A 3S2LA 5JUVA 3E9AA 4UTKA 4UTHA 4LYKA 2YLLA 4XBJA 2KZHA 3SCVA 1OBAA 3NCOA 1E72M 4A8RA 1OEPA 2PC8A 3E0IA 5FJUA 3W2LA 1UR1A 2GGGA 3TTYA 5KZMA 1W5OA 1WP6A 3MUXA 2QULA 3WMSA 1XQKA 4MFDA 2DEPA 3VNZA 4DZHA 3LPGA 2AKZA 4HNUA 3DEQA 3G1AA 2CITA 5A2BA 5AKQA 1EKOA 4HZ6A 1PKLA 1Z7AA 2DSWA 3QR3A 2ZUTA 1XGZA 2AMGA 5AYYA 3ARYA 3BW4A 5I00A 3MYOA 1MUCA 2V3EA 3H55A 4QM1A 5A2CA 4QG6A 2VX7A 3RYSA 1C8XA 3G3DA 3ITTA 3FDKA 1XISA 5DQPA 5AYXA 1PXGA 1TFVA 5KETA 4HMEA 3WD1A 1WE5A 4IL0A 4I6VA 7A3HA 1UWAA 1LRQA 1W9VA 1J93A 3FYOA 2EAWA 2XM1A 4QS6A 4RDVA 1H3GA 3BCJA 5K9XA 3WF3A 4DUXA 2WJEA 4IUGA 4AFYA 2YJQA 3AHTA 1X98A 2BX7A 3O15A 2ACQA 1OGSA 2BY0A 3DZ1A 4WGXA 1YE4A 1RV8A 2V81A 5E70A 3WQ5A 4XD5A 3MKCA 4E8CA 2WSYA 3OQEA 3C2FA 3LCIA 4X0VA 4YYFA 1Q2RA 1TPC1 1ML1A 4HNTA 4RX0A 2AQWA 4AWEA 1A5AA 2QMKA 3QLLA 2ZA3A 3M0MA 1AQ0A 1KCKA 4KWOA 1UH3A 2B7QA 2I14A 1OYAA 3W27A 3U9IA 3EEZA 3E5PA 3ZVIA 3YPIA 1UKTA 2C7FA 1LWIA 2GLKA 5A6LA 2OT0A 1X8FA 2Y5JA 4R33A 2FGBA 4JTGA 1AA1B 2B4GA 3MBFA 3CBWA 4OWGA 2VMFA 3MU7A 3TROA 1U83A 2YFNA 4DWDA 4B15A 5AHEA 3AQUA 3DYOA 3TJLA 3C5QA 1K4HA 1EGZA 1TV8A 4XO7A 3ICJA 4TU1A 4U5KA 4H9VA 3M0XA 2CETA 2Y2WA 2Z1KA 1XLJA 3W22A 4ZB0A 2E9BA 4ADSA 4L4LA 2WMIA 1EF3A 3GO2A 2VC6A 3UU0A 5ENLA 4AMAA 4I8DA 2WKGA 2E7FA 2W6RA 4O1EA 2C8NA 1MUMA 3TA6A 2WNZA 1ZQ5A 4PL1A 4DAIA 3PJXA 3NQ8A 3DHUA 3GY1A 3NXFA 3ITLA 2A3BA 2WHMA 2C79A 2O4QA 2G50A 2VWSA 2ZICA 1O68A 3WLKX 1J79A 1FWAC 4DAFA 4O1DA 1KFCA 1TZZA 3NQ7A 5FEPA 4HYRA 3RPMA 3CYJA 3PULA 1LCOA 4DZIA 1GZJA 4WXZA 4GH3A 4IP7A 3DI0A 4HIBA 2EJ1A 2X1UA 2GUBA 3L2MA 4ZODA 4OQVA 3VD9A 3T0BA 1G6CA 3ZO9A 3T0AA 4GI8A 1K8YA 3OA5A 2Y63A 2R1KA 4AZ5A 1XHGA 2GSEA 4PUNA 4DB7A 4K8HA 3G2GA 2RGMA 1KM1A 2HTMA 1W2VA 2EG8A 3E2SA 1XI3A 1U5VA 3FEQA 1EJXC 4PH6A 2DSKA 1KBJA 1H0IA 5DT7A 2O7SA 1Q6FA 5C5YA 2A7NA 3NO3A 1NAL1 2IPJA 2PDQA 3NSXA 2VEGA 4O0ZA 4QP0A 3S6OA 5LGZA 1O4UA 3OLDA 5F2LA 1J6OA 2GWGA 1E6ZA 3S0CA 3FNDA 2OXNA 3BOLA 2ZCGA 4Y9OA 1GVSA 2PTDA 1LQ2A 1A3WA 1Z44A 4NQ1A 2PDMA 1CT5A 4H04A 3EA2A 5DX7A 1X1NA 4LJ3A 3SEPA 3U4FA 3WJZA 4F79A 2NXIA 4ZL1A 1Z89A 4GMEA 4NZ1A 4Y9MA 4AZIA 2Y7EA 3U7VA 2RFGA 2X2YA 1O5KA 4UMBA 3CZGA 3JRKA 1H7OA 2NQLA 2HPIA 1T8XA 1KTBA 4CQ9A 1V7YA 1KXVA 1QO2A 4C1LA 1P6BA 5CZJA 1H7PA 4FX7A 5IHSA 1XIMA 5DMMA 1NWUA 3S1XA 2R24A 1ZB5A 3LSBA 5BXPA 1FWTA 4QG8A 2YBUA 3GIYA 1CEOA 3CAWA 1QPKA 1GJWA 4CVUA 3B9EA 2OGJA 3E6EA 3LLXA 2VGBA 1RD5A 4M1RA 5EY5A 3RX4A 1MQPA 4L64A 4ACZB 4EX4A 4JYDA 3THDA 1VFUA 3VTRA 5LA2A 1VBHA 5A6TC 3OODA