3S83A

Eal domain of phosphodiesterase pdea
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
256
Chain Sequence
LALEADLRGAIGRGEITPYFQPIVRLSTGALSGFEALARWIHPRRGMLPPDEFLPLIEEMGLMSELGAHMMHAAAQQLSTWRAAHPAMGNLTVSVNLSTGEIDRPGLVADVAETLRVNRLPRGALKLEVTESDIMRDPERAAVILKTLRDAGAGLALDDFFSSLSYLTRLPFDTLKIDRYFVRTMGNNAGSAKIVRSVVKLGQDLDLEVVAEGVENAEMAHALQSLGCDYGQGFGYAPALSPQEAEVYLNEAYVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GGDEF family protein
publication title Crystal structure of EAL domain from Caulobacter crescentus CB15
rcsb
source organism Caulobacter crescentus
molecule tags Signaling protein
total genus 87
structure length 256
sequence length 259
ec nomenclature
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 3s83A00
4J40A 4HU3A 5MKGB 3TLQA 4LYKA 4Y9NA 4Y9MA 4HU4A 3GFZA 4AG0A 4F48A 2R6OA 4AFYA 2BASA 3PJXA 4KIEA 5M1TA 2W27A 4HJFA 4Y8EA 4ES4A 4RNFA 3PJTA 3KZPA 4FOKA 3S83A 3PJWA 3GG1A 3PFMA 3GFYA 4RNJA 3U2EA 4FOJA 4FOUA 4RNIA 4Y9PA 5MKGA 3HV8A 3SY8A 5MF5A 4LJ3A 3HV9A 3N3TA 4RNHA 4Y9OA 3GG0A 3PJUA 3GFXA 4F3HA 4Q6JA
chains in the Genus database with same CATH superfamily
5BXRA 2DIKA 1E1FA 4F9JA 3B05A 1HG3A 1PUDA 4Z2IA 3IUDA 3BLKA 1XL9A 1A5UA 3TFCA 3EX1A 1NDVA 2OEJA 1LCOA 3FIGA 4DO6A 1F3WA 2INEA 3QGVA 4P2VA 1R85A 3SQLA 2Z25A 3SSZA 1B4KA 4ICMA 1TPH1 3AXMA 3WZ0E 4TTGA 3TN6A 2QJIA 4ORIA 1MRQA 1L0PA 4JNZA 4YTUA 1FDJA 2Y0FA 3EPNA 4IMDA 3UJ2A 1VPYA 4ZTYA 3N4FA 3WF2A 4JTKA 4E2DA 2Z28A 1RK6A 1XLKA 5JIWA 4RZ5A 3GTXA 3FJLA 1FWSA 4F0HA 2AGKA 3TU9A 1QNVA 1Q8AA 3MO4A 2YYTA 1EH9A 1TV5A 5MF5A 4OV4A 4QAWA 5AZ0A 1ELSA 1MW2A 3VM5A 4REQA 3USBA 1LF1A 4CCCA 3KHJA 3OGRA 3W76A 3OYXA 1IYXA 3HU7A 3IEBA 4DLFA 2GJRA 4OZOA 1X6LA 4PRTA 1D3HA 2POZA 4NZ5A 3OVQA 5BYWA 2NUXA 2IQTA 2FZ8A 3DHDA 4OJYA 2E6DA 5D30A 1BXNA 9RUBA 3TZFA 4UR8A 3KBNA 5HNUA 4XD4A 3WF3A 1R9YA 3CQIA 1XLHA 2X0SA 4YWIA 1OHLA 5JBDA 4KWOA 4XSMA 4ZVJA 3PZQA 4AHQA 2GVJA 4WCJA 2VZVA 5EMLA 1ZZMA 3CUGA 2QLYA 3RRXA 4Q4OA 3KLKA 3PNUA 5EKYA 4N4QA 3LCGA 3VKBA 2VD8A 4QM1A 4HA3A 2PTDA 2MUCA 4KWWA 3A9BA 2TYSA 3WLHA 4KRUA 4AAJA 3EMQA 5DMYA 3P67A 5GQBA 4EWJA 5DXYA 2OVLA 1HKMA 3UR7A 2QIIA 1MUWA 3EDFA 3L2MA 2Y7DA 3BOXA 2VCAA 5FAGA 3C6CA 2KZHA 2GSEA 2JGQA 4W85A 4Z0JA 3U9IA 2C0AA 1D3CA 1VBUA 3LLDA 1PJ9A 4JCLA 1KV5A 2G50A 3L68A 1BTCA 4FS9A 4IQLA 3WNNA 3UZZA 2ZC1A 2ATMA 3BC9A 4QROA 1VFMA 4R9OA 3SCRA 3LTPA 3BW4A 2BMBA 2VCBA 1R9ZA 1LQ0A 2DUXA 1R47A 1GHSA 2RDUA 4WJ8A 2QT3A 2PEVA 4LGXA 1RPKA 1DWJM 2YCJA 4JOMA 3ANVA 5LGZA 2B7QA 4GWEA 4M80A 1Y8BA 3W3OA 4NU7A 3L4XA 2VELA 4HZMA 1TPC1 4JTJA 3MHGA 5HJYA 1SU5A 2E7FA 4GUGA 4DJDA 4OVXA 3P93A 1NP0A 2POTA 1W3HA 3GD6A 3N2TA 3TFXA 1DWAM 1ZUAX 3RPDA 3WF1A 4GC3A 3K30A 3MDUA 3W81A 1WX0A 4Y2WA 4HZ7A 4UNIA 3M0IA 2VR4A 1JFXA 2EQDA 1CIUA 4QJ4B 1W8SA 2DV0A 3G8EA 4A8NA 1ZCCA 1UW9A 1POJA 3TV8A 3OOQA 3CQKA 1QOXA 1ALDA 4LYRA 1EX1A 1C7SA 4LNYA 4DJFA 4WJXA 4Q7NA 3UZ5A 1JG9A 4FNTA 3NEHA 3DFYA 2D22A 4M6PA 4CD6A 1IEXA 1CCWB 2GVEA 3CWNA 3TH6A 2Y5SA 5KZEA 5D9NA 5D2YA 4HU4A 4C7DA 3LGDA 1Z69A 1D8WA 4OGZA 3OG3A 1BKHA 1Q6DA 1WP6A 2TPSA 1VBHA 3R58A 5D05A 3KAOA 4ASTA 4RZ4A 3NM3A 3WD4A 3KVKA 4ZSTA 3UVIA 1IGWA 4Y6GA 3NXLA 3V5FA 4G7FA 2YA1A 4DNMA 3N73A 5EA9A 1HUVA 4M6QA 4JIEA 4UZSA 2PRMA 3AOFA 4JL2A 3H55A 3GTNA 1U5JA 3LMZA 4GA8A 4G2DA 3MZNA 1BQCA 4W7WA 2NX1A 3QMSA 1DJWA 4WGHA 2A7RA 1PE1A 2QDGA 2GOKA 4AHOA 1LOSA 1KCXA 1S2CA 3LCXA 2WVVB 4RW5A 2VRKA 4TQTA 3G1XA 3GXDA 1RQBA 1TWZA 1IXPA 1VR6A 1BG4A 1Q6FA 1UZ1A 4S3FA 1WZMA 3W25A 1BRLA 5LNVA 2X7VA 4GH1A 2Y70A 3ID7A 3LDVA 1JEZA 3MI6A 4LB4A 4UTFA 5C8BB 2ALRA 1YHTA 4PMNA 1JCMP 2VVNA 4YCPA 3G22A 1BLIA 1R5YA 4HOWA 5F4XA 2VX4A 4LBUA 4NASA 3H53A 1UC4A 1Q6RA 4H1ZA 4AZCA 4GFIA 3A4JA 4G7EA 1AMYA 3DFNA 2ZE0A 4BI6A 4HNCA 2IKJA 3LYEA 3VK5A 3HPAA 2IPFA 4DVOA 1QOQA 4JTUA 2PBGA 3D0CA 3KUMA 1XDMA 2HV5A 4JFWA 3LZ3A 4EOUA 4Y7EA 1A5SA 3OBKA 2ZXDA 2OEKA 3BTNA 3OZMA 1UZ4A 4B5TA 4Z2HA 3E74A 4AZIA 2VXNA 2E0PA 1XR2A 1Z7AA 2XDFA 1OC5A 2EBNA 1C93A 4E8DA 3THDA 1PZ1A 4DYJA 1LQ2A 4AHPA 1KGUA 4LU0A 2JK2A 2GQ8A 5HINA 4A35A 1V0KA 2BDQA 3GNRA 1J2BA 1TTPA 3PNZA 3LV5A 2VEKA 3DUGA 1WZKA 4DJDC 2WNWA 4Q4PA 1VEOA 1B3OA 3FK4A 3KVLA 1O4UA 1TYGA 3QV6A 3ZM8A 3KP0A 3FYOA 5HMDA 1QDSA 3DDMA 4GVIA 3GNPA 2WV8A 1DJNA 4DJEA 1OFPA 3DKLA 1ZGDA 2J7DA 4ZOBA 4O1BA 4TXEA 2B31A 4DJFC 1OFAA 2J7FA 1E0UA 1C8VA 3FV9A 3L0NA 1AJZA 4IJCA 1W5PA 2WXDM 1F8MA 2V5LA 2VL4A 1X1OA 4HZ6A 1KM4A 3KS5A 4LUTB 1DXFA 1CLVA 2FGLA 4I9JA 1X98A 3CLMA 3MWCA 5CSYA 4U5KA 3O3RA 2XH4A 4RV3A 3W37A 3W83A 4NZ3A 3W2KA 4QP0A 3HZ3A 3G3MA 1PKLA 3PJTA 3E2VA 3IJ9A 2NV2A 5DCDA 3RU8X 4D6IA 1I0BA 3EWXA 3AMKA 4TX9A 3WJZA 2EG7A 1F2JA 3BZJA 1GWJA 1BYCA 4IIHA 1EQCA 2E9MA 3P80A 5A6TC 2Y89A 4HYVA 4MGGA 3NO1A 1WCGA 2G4JA 3Q94A 2PLKA 2DUZA 2QS8A 4PL2A 4UNLA 1ZJHA 3FXYA 1OQFA 3M5YA 3D6NA 3AIVA 3ZLGA 5D9PA 4GJJA 4F3HA 2QW5A 3M41A 1H63A 1AD1A 3IK2A 1CYGA 2R1NA 3N2XA 3PC0A 5AVHA 3VOCA 3NZRA 2ZVRA 5BW6A 4ZXLA 4PA8A 5FJRA 3O07A 2FYMA 2GK1B 1OYAA 4DJDD 5I23A 4A29A 4WF7A 4L1WA 3SDOA 1CXLA 3S5NA 1UH2A 4POCA 2BG5A 5TIMA 3APTA 3CL7A 3L0GA 1IEVA 3JZUA 3DXIA 4D1IA 3MKKA 1KXHA 4ZA0A 2V63A 1VC4A 2YXOA 5C9UA 2QDDA 4P5UA 5E6YA 3NL2A 3K8MA 1V6XA 4DAIA 4US5A 2V38A 1E3ZA 1SQ7A 3NQAA 2Y5JA 1W0MA 1MVYA 4DPQA 3E0IA 3GG0A 3LM7A 3TC3A 2C6QA 2PI6A 1PDZA 2BOGX 4ACYA 1JCJA 4NG3A 1YTKA 1RY8A 3FYPA 3TAKA 1Q8JA 3KOFA 3N34A 1ZAIA 1V08A 3UR2A 3NPVA 3UYCA 1RBLA 3RN6A 4D2JA 5DT7A 4GCXA 4Q4KA 5KMYA 4MKSA 1YQ2A 3L5LA 3T4CA 4BJHA 4UZUA 3MVIA 4OFCA 2O55A 3VZYA 1RZMA 3NVTA 3C0QA 3TR9A 1EUAA 1GJPA 4PZVA 1R7OA 4HKPA 2NZLA 5FF0A 4AUBA 3NO3A 1IQ8A 1FWNA 5CC7A 1WDRA 2VFIA 4ATLA 1OCQA 2XVGA 2EPKX 4RPPA 1PXGA 7A3HA 3IAPA 4L80A 1DJIA 4F0SA 1AFSA 3SO7A 3OVRA 1M9HA 1KXVA 2VUYA 1ONWA 4DJEC 1QPOA 2I5IA 1DWFM 5DCEA 3THQA 4B5XA 4V2XA 2WC7A 3JR2A 5A6LA 3W85A 2DGAA 5AC8A 2CLMA 3OO2A 3QF0A 1FUYA 5A94A 2E5DA 2D24A 3F1QA 1TB3A 1XIDA 4F48A 2I56A 2W27A 4IQDA 5TQLA 1TQJA 5A3HA 1V0LA 2Z7GA 1GT8A 3V3WA 4M19A 2X42A 3EWZA 1V7AA 1E6SM 3FSTA 1B0IA 1EZ2A 3BMWA 1S3HA 4I6VA 3U8GA 2ZUMA 1KNWA 1N8IA 2OO6A 5D37A 4Q3MA 1UYQA 3LSBA 3W1XA 1ZENA 2OGJA 1GTHA 3QFEA 2FZNA 4YIWA 4C6MA 1FWCC 4BF7A 3A4AA 1J01A 1BHGA 4PMUA 2PWEA 1L6YA 1VCFA 3WBEA 1KTCA 1F9CA 5HA7A 1WDDA 1RBOB 1E55A 4DI9A 4O13A 3F2CA 1DOSA 2ZZ2A 2DU2A 1YPFA 1W3JA 4PGLA 5D2VA 1OWQA 1G7VA 1FWEC 3DX5A 1KM1A 4DBWA 3D46A 3GU9A 1P7TA 2QMKA 4FF7A 1UD4A 3BMXA 5F2GA 4F40A 1UR2A 3ALGA 3CH9A 4K36A 4MFDA 2RGLA 3WQCA 3FKRA 3PULA 2QHAA 1QI4A 4C6DA 1NDWA 2Z6IA 5CEWA 3N6QA 2WZMA 3IIVA 3KEHA 1J0IA 4D6GA 4U28A 1X38A 3CZLA 4L4PA 4FXJA 4NZCA 2G4FA 2D3NA 1DIOA 1WDQA 4KWSA 2VWTA 4K1WA 4JFVA 4DXXA 2QJMA 4DJED 3V16A 2LLEA 3RK8A 5JH2A 1E0WA 4QDWA 3WD2A 1R3QA 1GVQA 1FHLA 5I3JA 3IUHA 4WDXA 5BOFA 2J9XA 1C9DA 4RLIA 2G41A 5BOEA 1TIWA 1HW6A 1EXPA 1L6GA 4Z1BA 2GQ9A 3U48A 1TPB1 2XFFA 3WEZA 3H12A 2VEMA 1XD0A 1JZ7A 3MT1A 2WCSA 4ZFMA 1KXQA 3TE9A 4N9BA 1ITQA 4UOJA 2ATSA 1XIHA 4O15A 3ZS4A 3EAUA 1EB3A 3ZT6A 3W84A 1RD5A 1P0EA 4KT2A 4L65A 4GH3A 2XU2A 3EGJA 4JNYA 2V2CA 2WSKA 1FHVA 3LERA 3VD3A 1LL6A 1QRQA 1IWPA 3DBNA 4LRTA 3F7JA 4PTMA 1N7KA 3W53A 2BTMA 2WW5A 2XZ9A 3LBCA 2GDQA 5I24A 3EXSA 2R94A 1ZBVA 4IX0A 3E9AA 3LY0A 2G3FA 3PPFA 1YRRA 4AXKA 4RPQA 3TTOA 1W9VA 2EHHA 3HG4A 3P8JA 4PCTA 3WY1A 4HCHA 1DJHA 4RNFA 3BOLA 4KKXA 4M7TA 2SFPA 4FA3A 1EXBA 2PU1A 3DYPA 2XFYA 1CXKA 1QBBA 1Q63A 3G0XA 2CWXA 2E40A 4P7RA 3N04A 3NTYA 3IIPA 3CS2A 4DUOA 3PPHA 5KETA 3WMCA 3PSVA 4TX8A 1EJSC 4UTLA 3VI2A 3CH0A 2NQ9A 3G1FA 1TJRA 4BF5A 3DOPA 4H6KA 2I5QA 3I6EA 1ODUA 1H7XA 5A1AA 1ITUA 5GJPA 4YCOA 2Z1XA 2NX9A 1Q6GA 4FO4A 2V5DA 1OY0A 1B2YA 4US5D 1N82A 4JD4A 3FHQA 3W7RA 1FCBA 3GC5A 4AZCB 4CGTA 1UR8A 3E5PA 2PDLA 4QNWA 4EANA 1MQRA 4AIOA 3KCLA 1GKQA 1JPKA 3B0YA 1UOKA 4O19A 3ZJKA 4YYFA 4JS3A 4OKDA 2ZZ4A 3WDQA 4DPPA 1IT0A 2DY3A 1XC6A 4AYGA 2VZTA 4QFUA 4DRSA 2I9EA 1B3ZA 3H21A 1XYFA 1LUCB 4A05A 1H3GA 4J5NA 3UBPC 4J7RA 3CXOA 3LBOA 1EEPA 3MTWA 3PZTA 3WL1A 4HHLA 1CGTA 3W02A 5LHFA 1FVPA 1PAMA 3NQBA 5CSSA 3RNDA 3M7SA 5I3DA 3R13A 1YMYA 2P1FA 1KFKA 2QEZA 5I06A 3QHOA 3W7EA 4NZ4A 4MTVA 5K4ZA 1RUSA 2C18A 3B06A 1EWDA 4F0LA 1TQXA 1AQFA 5FACA 8CGTA 3VNDA 4ALDA 5E0CA 4HJFA 3NQ2A 3TDFA 3QM3A 1XFCA 3AICA 4CN4A 3VKAA 2CCRA 1XLLA 3SUWA 1XWYA 3NQ7A 4O8AA 3TN4A 3R8GA 4BCEA 4DUVA 3RPTA 4GQRA 1U5VA 1WPCA 3ABZA 3C8FA 3WEMA 3UW6A 4J3XA 3PWAA 3A12A 4INFA 2NWRA 3GU2A 2CXEA 3WD3A 5XIAA 3QRHA 1NP2A 4L1XA 3UR8A 3ZJ6A 2BLEA 4CU7A 2EPMX 3BGGA 3KBJA 5LIWX 4IX2A 4FAMA 1AVAA 2X1TA 1KRBC 2FPYA 4UQEA 5HBFA 1XRVA 4QBXA 2W67A 5FKYA 5K7JA 1XH1A 4KCUA 1Y0EA 4LQ1A 3IV8A 2GJPA 2W0UA 2CITA 3NO5A 2GGJA 2BXVA 1TZZA 2PF0A 5KEZA 1QNOA 3L4VA 3WO8A 4XAGA 4NAEA 2C79A 2W9MA 1QO5A 5C9RA 3AXKA 1L6WA 2QDHA 3OB8A 3WF4A 3GYCA 4IICA 2YCLB 4JN6A 3T2QA 1PCKA 4HU3A 2ZX5A 4LYKA 2UY3A 2C0HA 3DFTA 4JIPA 4FIRA 5EBAA 4LSBA 4NJKA 5HNRA 1K8XA 4AY7A 4C6JA 2PCQA 4O0ZA 3PZGA 2OQHA 1H09A 5EL1A 1EQPA 3NAVA 5BRPA 3IIOA 3MMTA 5FJIA 3C52A 4EKJA 4DO5A 3HG3A 4NF7A 2WQDA 1OFBA 3EX2A 3QMTA 1J5SA 2AL1A 3T0AA 2P0OA 4R7JA 4B9ZA 3WUEA 2GOUA 1V4YA 1RA0A 4M82A 4WY0A 3AMLA 1O5KA 4IIGA 1XYZA 3BW3A 1XIGA 1SO4A 3F5LA 3M0YA 4ACZB 4LB3A 1GOWA 1SW0A 2QPSA 1EO5A 2FB3A 2ZA3A 1U1UA 1W3IA 4KWUA 2J7EA 1CENA 2C7FA 1HL2A 2D3LA 3N2OA 3NOEA 1OIMA 4N6EA 1JF5A 3ZR6A 3CWHA 1TWWA 2ODOA 1XRFA 3V0UA 1E0VA 3THCA 4CNTA 4GVHA 4DM2A 1TMHA 2R14A 5A8PA 3W1AA 3TMLA 1FWFC 1E70M 1IZKA 2CKRA 1PKYA 1EP1A 3OBEA 3FJNA 3GLCA 4PCNA 2W4XA 4QE1A 1QU4A 1YPIA 1K02A 2CETA 1XP3A 1IEWA 5EMJA 4XBKA 2P3ZA 2IXVA 5C7HA 2CIPA 3H2NA 3V7PA 4NAFA 3QH2A 4JYEA 1JR1A 4ZB0A 4YWSA 2B4GA 4LOCA 3NGJA 1GW1A 3L66A 3IVSA 2F38A 1O1ZA 2J7HA 2ZX8A 5A8GA 4EAMA 4LY8A 3S1WA 1ZHAA 3P81A 5LHEA 3W82A 3K46A 1IEIA 1GKRA 2DEPA 4GXPA 4WK9A 2NLIA 3CV1A 3U7BA 3PUEA 1DHKA 1W6TA 2TRSA 4NILA 2XWDA 3LTSA 4UQBA 2E8YA 1E9IA 4AEEA 3GHUA 3EOUA 1BF6A 4QLJA 3ARUA 3NWRA 4MF4A 4N0RA 3S5YA 1J9YA 2IS7A 3IGXA 3W38A 1EPXA 2ZZ5A 3QR1A 3PZUA 3UG8A 1DPMA 1EUNA 4JDYA 4DYKA 2GQAA 3I7RA 1M68A 2I5GA 1TCDA 5KSWA 3GHSA 1FHUA 4Y9NA 1J12A 1ISXA 1AL7A 5D33A 2ZXBA 2HZGA 3G6LA 4CD7A 1XISA 3M43A 4FEZA 1ECEA 1WUFA 1X96A 2GJLA 1C7TA 4GABA 1V3HA 4IGNA 3T78A 1WNOA 1UP2A 4QDPA 1ADDA 2V3GA 3QSRA 4V1YA 4Q4SA 1I2PA 5ECUA 1A47A 5CPTA 1MZHA 1A4MA 3M16A 1P7TB 3OQEA 4QJ5B 1GYLA 3SR7A 5AB3A 3GH5A 3GUWA 4AZHA 5CAKA 1GJWA 2VUNA 4D8AA 2WBKA 3CV6A 4XIMA 3LHZA 1M01A 4C1NB 5FEXA 5I07A 2OYKA 4UTWA 2WK2A 3TOYA 4M1RA 3CO4A 3CASA 4ZEPA 2ASHA 3UJFA 1TX0A 4CNNA 1W5NA 3IJ6A 5F2IA 3M7WA 4JAWA 1WOBA 2QPXA 1VCGA 1WE5A 3HIJA 3R6IA 4XO7A 1QO2A 2E6AA 4LH8A 1L2QA 2XSBA 3URQA 4LNCA 1VFUA 1OGBA 1RJRA 1W9PA 2REQA 4NYYA 2X7WA 3UU0A 3IS4A 1ADOA 3I4EA 3WQWA 1UH4A 4RDYA 2JEQA 3AO0A 5D03A 4IISA 2E77A 4EK7A 1R8LA 1W5OA 4IGSA 3T09A 2HJPA 4GK8A 4ZQCA 3GDBA 2J66A 5I79A 1D7KA 1KM5A 4Q7BA 1DJZA 3EB4A 2W62A 3AAMA 5DELA 4ERAA 3PAOA 1SR9A 4JFTA 4WGXA 4H2HA 5DQPA 4DO4A 3ZOAA 1LJYA 3LM3A 5EFDA 1XSKA 3SY5A 2ZA1A 4WQ6A 3EA1A 4TO8A 3BARA 4JDBA 3WJWA 4EPDC 1X97A 1AJ2A 1BXCA 3NDOA 2WSRA 4HTYA 4LW7A 2PUZA 3KBSA 1EX5A 3NQMA 4L9XA 2QR6A 3UJEA 1XKJA 1E5JA 1UR4A 2E1WA 4WZHA 3FY1A 1F3EA 3J7HA 3NQGA 1I2QA 2G0WA 3B4UA 1XHGA 4JTDA 4JIRA 6TAAA 4AW7A 1DTNA 2UWFA 1HVQA 4IJBA 2WMIB 3F2BA 3SCUA 3OU8A 4QQUA 4GUIA 3U7VA 2F2HA 3TR2A 1W1PA 2WOQA 1JCLA 5AC4A 1PZ3A 3EEGA 4PCSA 3TTYA 3KOWA 3L4TA 1OEPA 4Z1DA 1W3KA 3S2JA 3VIOA 3SIMA 3WKZA 3W71A 4YU1A 3P0WA 1U22A 1D9EA 4FNQA 2UY4A 3WDIA 1IT7A 4Y8FA 5KZ6A 1F5ZA 2WC3A 2DT3A 2OKOA 3RM9A 2DT1A 1NM9A 1ENUA 1IE7C 4CNUA 4KEUA 3CLWA 2YYUA 3N11A 1ZRQA 2ADAA 2IMRA 2VRJA 1X6UA 1JPIA 3VDBA 1R9XA 5FSEC 3ES8A 2PTXA 1S5TA 3QN3A 4K8GA 1WXJA 4E4FA 4D6HA 1XG3A 1TELA 3PUDA 3P3BA 2WSYA 2ON3A 4NKCA 1PX8A 2HISA 3CGTA 1YADA 2VFDA 2QCMA 1H0GA 4LFYA 3EDDA 4U31A 2WMGA 2UY2A 4NUWA 3VGEA 3GNOA 3QZAA 2PWFA 3NIYA 1ZJBA 4N02A 4UTWC 3A21A 2Z27A 4NJIA 4OUIA 3UY7A 2WPBA 4D6CA 2ZX7A 2X1SA 2NLYA 3PB0A 4HVXA 1POKA 4GI9A 1UKQA 3UG3A 3GW3A 3WLOA 2XSXA 1Q85A 4ZXOA 7REQA 1N55A 3ABRA 1DJQA 1JZ6A 4V27A 2RFGA 1YPXA 5M17A 2TAAA 3I4KA 5DFAA 1S2UA 3AYVA 3DC8A 5EB8A 2PZ0A 3VDCA 2OT0A 1A5KC 1OT2A 1HGYA 3WLSA 2D2HA 2WNQA 1NH6A 3ICJA 4BEQA 3W7QA 1ME9A 3Q37A 4ZB5A 1H7RA 5CPNA 2QCNA 3II1A 4RKAA 3FFSA 1YTEA 2Q8LA 1AH0A 1WB0A 2VM8A 2YA2A 2C3ZA 4LCQA 2R1KA 5HMEA 3BLDA 3IJDA 1Z41A 3NEVA 2QCEA 4NL1A 1FP9A 4N42A 3P14A 2FPVA 3R94A 2VYOA 4Z0SA 1GZ1A 4AX7A 1YW1A 1HIZA 1DV7A 1OD8A 3G8RA 7ENLA 2J75A 1CWYA 2HBXA 3XISA 3W7NA 1MQQA 5E09A 3BLFA 2V5KA 4H8NA 3SBFA 1UG6A 5HAOA 1OT1A 3MUZ1 4H7ZA 3MSDA 3CB3A 3HG5A 1OYBA 4DBDA 2OPJA 2VDIA 1QPQA 2J47A 2DZVA 3QYQA 4CNSA 1V5XA 1NSJA 2WMJA 4L9YA 1B30A 2RGMA 3AS2A 3AALA 1EC8A 5A6BD 4M5PA 2RH9A 4M81A 3OHMB 3QY8A 2OXNA 2QV4A 2I1OA 4LAKA 8TIMA 1M6JA 3ATZA 3H24A 3LX9A 1L8PA 4I7UA 1R7AA 2O7SA 1MNSA 4PULA 4YMZA 4DYEA 1E0XA 4X2PA 1LBLA 2Y5EA 1NELA 2DSVA 2WSPA 1VZWA 1S38A 1VFOA 4ERIA 4MNLA 4GZ7A 4H9UA 3OIHA 3LPFA 2YCEA 3VZXA 2FKPA 2Z2AA 4GI4A 2QCDA 4I5UA 3BG3A 2ZRXA 1Q7MA 3A9IA 2GSHA 5LIUX 4HNNA 2CHOA 1NARA 1W31A 1MFVA 4EPBC 2PDHA 3ARTA 1F6KA 1OF6A 5LGXA 2YX0A 1UKSA 5K3VA 1KWGA 4RR4A 1K70A 3WQ8A 3NL3A 3VX1A 3L4YA 4MLJA 1NOFA 1P0KA 4WSJA 2D69A 4YVXA 4MZ1A 2A7NA 4O1DA 2GJNA 1SPQA 4FLSA 2ZDRA 5BOOA 3W2LA 2TMDA 1N8FA 1EEXA 4MJMA 2PRLA 4L5ZA 4Z42C 2GDVA 2WMKA 2FGZA 3KM8A 1VJZA 3ZSSA 2Z2UA 2D73A 3N17A 1JFHA 2QCGA 2YDQA 3BG5A 2V5BA 1KM3A 4Q6XA 2Y6ZA 3NG3A 4GZEA 4KCTA 2VEIA 4CQBA 4P8XA 5GJNA 3PZVA 4K7YA 2JQXA 2BOEX 2ZUUA 3BV4A 1FCQA 4AF0A 3OQ8A 4HMDA 1TUXA 1GOOA 1D3GA 4IM4A 3C2RA 3N4EA 2P88A 2CHNA 4AVOA 5C6MA 3EEZA 3K8KA 2XH7A 3C86A 2BY1A 4PMXA 1PTGA 3WFAA 4L56A 3IIXA 2HK1A 4NXSA 3QKEA 3N2BA 3CC1A 3ZZ1A 1KXTA 3USZA 4L61A 4O1AA 3L5AA 3H54A 3HQPA 1HKIA 3L21A 3P62A 4PTXA 1P0DA 5G2HA 4HMCA 3HQOA 3NZGA 4B3ZA 1HJVA 3TSBA 1TV7A 4KEVA 3GR7A 3EYPA 4FOUA 3TYBA 5RUBA 2ZUNA 1VFLA 1REQB 4A8IA 3PM6A 4MM1A 2CLPA 2VX6A 3FGCA 2FVLA 1QNRA 1S5MA 4H2CA 4LUYA 5G2IA 3IARA 4ORMA 4NYUA 1GOIA 4WHBA 1F4HA 4PUWA 4XTIA 2PGWA 3NQCA 4KCVA 4LRSA 2Z0IA 5FIPA 5D2XA 3R10A 1JDCA 4QLKA 3CUJA 4EF9A 2GGGA 4S39A 1OX4A 4ZODA 2Z1WA 1NF7A 1BQGA 4R5EA 1HP4A 3OW1A 3WEOA 1UR1A 1TZ7A 2A21A 3R7MA 3IANA 4A22A 3CO8A 4XKMA 3LCFA 1XRTA 4Z2LA 5T9BG 1I2NA 3STGA 3MYPA 1W37A 3W75A 2PDYA 1KA9F 1DE5A 1G69A 1UKTA 6TIMA 1JZ2A 2X1RA 4E3VA 3GXIA 1PX4A 3DG6A 2NV1A 4OOUA 1A3XA 2YCIX 3H2CA 4DZ5A 4IIDA 3SCQA 3N29A 1GONA 3EPOA 4KH2A 4TU1A 1HO1A 5FD0A 3TC7A 5DY3A 4OECA 1BYDA 3H4GA 5FL1A 1TR1A 4F2UA 2CLOA 1KRMA 1TA3B 3T4WA 1E1CB 1YXDA 1A5AA 2PDBA 2ZADA 1EDGA 1TFVA 4X61A 3K13A 4GD0A 2PRHA 3W07A 1X1NA 4GNJA 2VVSA 1FWHC 1Q6QA 5CJNA 3AS1A 1T5AA 1PZ2A 1FWAC 4NT0A 4H6QA 2Z6JA 3PUOA 1S39A 4XQ6A 2C1GA 1PYMA 4QTGA 2PDCA 1TR9A 1RALA 4RDVA 4XB3A 3TQKA 3U2ZA 4JQ2A 4XZWA 3QR0A 5FL0A 3CHEA 2HXUA 4PMOA 2ZRVA 1J0YA 2CLIA 1A0EA 3GC4A 3HTWA 2YB4A 1LTDA 3M0XA 3PBMA 3BQ6A 4PCFA 2V6AA 2J7BA 2YL9A 5CAHA 5GVJA 4PN2A 1CEOA 3WLMA 3HA1A 2OOFA 1H41A 2BP1A 4MUPA 3NQ6A 3A5FA 1J0JA 1A3WA 4XKYB 1S2VA 3R5EA 1RK5A 4AH7A 3HG2A 1DJGA 1Z44A 2WO5A 3YPIA 3PPGA 3LUTA 4O53A 3HN3A 4DBSA 1E71M 3R8HA 2HWGA 4OUEA 1G4EA 3CAWA 3VIKA 3CT7A 3WDRA 2OO0A 3LZ5A 3KTCA 4AD1A 4JYFA 4IG2A 2AKMA 3QQ0A 2NUYA 1G6CA 2HNHA 2NSXA 4KEMA 4K8HA 5KINA 2OKTA 3EWDA 3PK7A 2XGBA 3UFYA 1XI3A 4Q4RA 1G9HA 5H2ZA 1TPVA 1LROA 2QUNA 3QZ6A 4HN4A 2WKJA 3MJMA 1ODZA 4J3TA 5K4XA 4IZGA 2H9AA 3TQVA 4IPLA 1FXPA 1V3JA 2X41A 1KM6A 3CIXA 3NPUA 5M2FX 1IWBA 5JQ9A 3E38A 4ICCX 2CNCA 5CCZA 1V03A 3NGFA 3TYEA 3WMLA 1Z6KA 5D9OA 3U3HA 4C91A 1JAKA 3F4VA 4OBTA 2CLHA 4N9DA 3AS3A 5HR7A 3RGTA 3MCOA 4HA0A 4ZE5A 3W01A 1QOPA 3U4FA 3UZXA 3H70A 2PODA 4UQ9A 3GR8A 3VCNA 2DSZA 5JH1A 4WXZA 4M29A 4DO7A 3KCJA 1CW2A 1GQIA 3O6YX 2DQXA 1Q3NA 1S5VA 2BX7A 1GOQA 2OWCA 3W1RA 1G67A 1FH9A 3T07A 2VEGA 2CZDA 4ROQA 2XIQA 1A5LC 1A3HA 1GGOA 3FAWA 5DEZA 1HFBA 2ZICA 5DRCA 1JNDA 1LL7A 4DHGA 4US6A 1CECA 2WKLA 5BU6A 4KS0A 4XAPA 5G1TA 4H9TA 1Q45A 4O10A 4NNAA 1FH7A 3TTEA 4I3GA 2GGHA 5AYYA 3F4DA 3M0JA 4DF0A 4RDZA 4HMEA 1E56A 3C56A 4BI7A 4J3UA 2FFCA 4G5DA 2YB1A 3IJ7A 1W9UA 1NU5A 5CG7A 3B0XA 4O54A 1GPWA 3LRMA 4CN6A 4V15A 3AJXA 4AEOA 1XQLA 2I7GA 3DEQA 2Q02A 2Q01A 3CMFA 3AWOA 1CDGA 1LM1A 3MP3A 3RO8A 3WLQA 1U2YA 1LWJA 1D8CA 3TOPA 3C2YA 1R3YA 4L4OA 4GFSA 3SADA 4LV9A 4LXFA 4OOZA 1ZB5A 1ITCA 1UH3A 1TPFA 5DT5A 5REQB 4H4IA 3WNLA 2YJQA 4IQEA 4EPEC 4CQ9A 2TODA 4LF1A 4J3SA 3S6DA 3TCSA 4HNOA 2E5CA 1DJYA 3ISIX 4JQ3A 1T8QA 1YNQA 3BLPX 1KBKA 2WJFA 4LWWA 4HD5A 3CT2A 4QXIA 4XZHA 5FEPA 2ISWA 1V3KA 2AL2B 2XM2A 2HS8A 1XPGA 3S46A 4NQ1A 1YTDA 3IV3A 3RRAA 3W1MA 5D8WA 1EBHA 4AWSA 2J88A 3BLIA 3CHCA 2QDEA 4R53A 4K6AA 2BHYA 3GHTA 3VILA 4AB4A 4AC7C 3KZSA 5CSRA 3H22A 1TJ0A 1JL8A 4LTSA 4AZ7A 1H7OA 1MNZA 4JTTA 1XLMA 5C7VA 3KBMA 3SJ3A 2O9OA 1UIPA 1ZNNA 2YOCA 1E6ZA 1SW3A 1J93A 4D6DA 2NSOA 4Y9AA 3TYAA 3NL5A 4MFEA 3TIMA 2C14A 1NEYA 3LBMA 1HJUA 4AC1X 3DC0A 4AD4A 4O1FA 3G1RA 4H00A 3R2GA 2C13A 5BRQA 1GEQA 1QPNA 2TSYA 4ZL1A 2FMNA 5LIKX 2A2IA 3QW3A 3W2UA 4F8XA 4JTHA 4PUNA 1XGEA 3CQJA 1TZ9A 4FIQA 3E49A 3QC3A 3CUZA 3ZMRA 1XS2A 3T0DA 3UNTA 1ICQA 1H2JA 3W24A 5AYIA 3QV9A 2VR5A 5I78A 5ABGA 1GUVA 4FLRA 1DE6A 2PAJA 3IJQA 1R3WA 4JL1A 1X8CA 3I65A 1LLZA 3GFXA 4BFAA 3G1YA 2WPGA 4CQCA 4PODA 5D04C 5HULA 4IFKB 5HNTA 2W91A 1CLXA 1Q6EA 4DZIA 1TV3A 3VTRA 3A3WA 4RUBA 1VHNA 2HNEA 1G01A 3WH8A 1FFRA 3BURA 3M9YA 4A4AA 1XLIA 2DVUA 3PP7A 1UQZA 2CZEA 3CAQA 4O4VA 3WK1A 5CJ5A 4UFIA 3VKCA 4DUWA 1QFEA 3ARQA 3LENA 3MP4A 3FLUA 3W1NA 2VC7A 3PTDA 4PR4A 2ZOXA 1Y7VA 1TWSA 4Y9OA 2P50A 1ISVA 3U5UA 3D3FA 3V18A 2KAUC 4EF8A 3E3HA 1RPXA 4MJ2A 3MHFA 2WVVA 1QHZA 3CPUA 3WK0A 2F61A 3E2QA 1IXQA 1OIFA 3B3DA 3IPWA 2XN1A 1RCXB 5G4WA 1HGWA 1JDAA 2YFNA 4B3LA 3RHGA 3GDMA 1Q6OA 3B04A 1TO3A 3W7PA 4Z1YA 4O11A 3NZPA 2ZE3A 2NXHA 1W9XA 4W89A 2F6KA 4UTIA 3ZWTA 3NYZA 2HXTA 1AD4A 1Z32X 3VD9A 1M7PA 3RLGA 5CQ1A 3O0KA 3O15A 1UWRA 4JIHA 1Q65A 1KFEA 5AFDA 3XINA 3REQB 1KFLA 2IXUA 3E0WA 4WSKA 1E73M 5AKQA 1A5CA 4AD5A 2D0GA 3PFMA 4AD2A 4WDTA 2PTYA 3GIQA 2VGBA 3BCDA 3UXLA 2X2YA 3WMSA 3ITOA 3A13A 1A53A 3NQ8A 4Z17A 1GOMA 1G94A 4A3HA 2Q8XA 3EWCA 4W7VA 3APYA 5FJJA 2DIJA 1YX1A 2E5BA 5HK4A 2X0HA 4QG9A 2BOFX 4XAYA 3N25A 5I2UA 5DBUA 1KWKA 2ZXAA 4HZ8A 6ALDA 4JKMA 3UCDA 1UD8A 3TUUA 1UR3M 1B1YA 3C0SA 3NZQA 2X05A 2PDJA 1KB3A 3TTQA 2A3LA 2ZZ3A 4DF1A 3TWAA 4FB7A 2D2GA 7TAAA 4H7CA 1TWDA 1IZCA 4AU0A 1R6WA 1O94A 5K2ZA 4FMVA 4JGDA 3W22A 3QR3A 3ECQA 1VH7A 3T42A 4E2VA 2A3HA 3SJNA 3M0MA 2INFA 2NQZA 3I7QA 5IRPA 3AZSA 2VFGA 1JYVA 3HPFA 4PUEA 3BDKA 1RXOB 4W8BA 4Z2KA 1SFJA 1ZAJA 3COTA 3ONBA 1DYSA 4LUTA 4FNUA 1XIBA 4I7WA 4XZBA 3GKAA 3DG3A 3TC6A 2H8ZA 1F3XA 4X9SA 3P2VA 3TLLA 1MRAA 1O5RA 4PUKA 5FESA 1YEYA 1F61A 1HT6A 1THFD 4MMWA 1Z48A 3S5ZA 3QHMA 3LLFA 3STEA 2V2DA 5E1QA 3WN6A 5E9AA 4DBEA 1HQTA 1E6NA 3IVTA 3RX2A 5A6SA 2RAGA 4Z1AA 2CLKA 2WNZA 2J8TA 3PHAA 4J3WA 3GG1A 4I5XA 3VFCA 2XM1A 4O1EA 1EBGA 1SFSA 4GJIA 4PTWA 1OD0A 5T26A 4JZ5A 1RH9A 4PEKA 1PO9A 3UWUA 3WLRA 2Z26A 2OG9A 3QPZA 3W7CA 1OYCA 3IWPA 2GK1A 3O7UA 4PH6A 2ZX9A 5LIYX 4JR5A 4BQ3A 3DIPA 3W2MA 2CLFA 3AJ7A 3NCOA 3B8TA 4IF2A 4LYPA 1SMDA 4ZQOA 1PVNA 4J4KA 3KVMA 2H9AB 2WHMA 3BG9A 4PBFA 4B5WA 3UPWA 1QHPA 3WNMA 2E68A 4O16A 4IP5A 4O17A 3EKLA 4NZJA 3O0FA 4XIAA 3FA3A 3AYRA 1FA2A 3A4WA 4F0KA 3RR1A 3G1SA 1I75A 3SW6A 1UIOA 3W86A 7TIMA 5I3IA 3MSGA 4ZQMA 2JE8A 4AVFA 3VYLA 1SO6A 1JULA 2XINA 1XLCA 3ZIZA 2VEPA 2QZRA 3WQ5A 4UR7A 5BNKA 1ZU8A 1T41A 3CWOX 1W1VA 4EACA 2ZBTA 1OGGA 2XISA 1JJKA 3W74A 4LUSB 5TAOA 4E8GA 1KBBA 1EO7A 2A85A 3JW7A 3TLQA 2VZUA 5E9XA 4YLWA 2DSKA 4DAFA 3ITLA 1EP2A 5BXPA 1PYFA 1MUCA 1YBQB 2J9ZA 5AY7A 4JHZA 1F4AA 1LBFA 6REQA 1CB2A 5ABFB 3W1QA 4D8ZA 3JS3A 4TX6A 1N2VA 5H8UA 2DH3A 5C2GA 1R87A 3PG9A 3WLJA 2CU0A 2GUUA 5GNZA 4DIAA 1MEHA 3VNMA 3GZ3A 2DZAA 3VINA 2AQVA 2IUZA 1KQZA 1FX6A 3NSXA 2OZ8A 4RE3A 5J04A 2FHCA 3E0VA 5M5DA 2ZUVA 1SZRA 3JUGA 2FFIA 8XIMA 1U83A 5BU9A 2QUMA 3ORWA 5M03A 2F6UA 4QJ3B 1SUXA 4MHBA 3SCVA 4KGJA 3T44A 2IPGA 1UOZA 2Z1SA 4MUZA 3TJXA 2BODX 4PMZA 3MUXA 3OLDA 1KLZA 2XYLA 3OODA 3O06A 3D47A 3H4WA 1US0A 1EHNA 3VNZA 1J5TA 2I16A 1F76A 3L67A 5CBJA 1E4IA 4I5RA 3KRUA 1SGJA 4LAZA 4B5SA 3MY9A 3VUPA 1H1ZA 4X3ZA 4FXFA 2HBVA 3K5XA 4O14A 3QV7A 1FHDA 1JZ8A 3QKZA 4LVGA 4Z1CA 3MB9A 2V81A 1QVBA 3DG7A 2A6LA 5FJOA 3UNDA 3BVJA 2CBUA 2PTZA 2IPWA 1MW0A 4UQCA 1PBGA 3LRKA 2A3CA 1XBVA 3RMJA 3CMJA 3WUFA 2XHYA 2FHBA 2O9RA 2C15A 3SY1A 3EX3A 3MHUA 3UA4A 2IKHA 3W73A 2VP8A 3BLOA 1D2KA 5GJMA 2EG8A 2FMOA 3I10A 3VCRA 3GVGA 1IF2A 5DMNA 4X22A 1B4EA 4E5TA 5C9WA 2V3DA 3W27A 1ONRA 3UEQA 3H2MA 2YLAA 2BGQA 3WQGA 4Q8UA 1J79A 1I2OA 3MV01 4IP4A 2DQWA 3EWUA 1JVNA 4HSHA 5CSUA 4H8VA 2GUBA 2OYMA 1ME7A 2JIWA 5LA0A 4RNJA 1FRBA 1AODA 3IIZA 5CGMA 2PGFA 1I6NA 4E38A 3WF0A 3VGDA 3A3HA 2F84A 1JXJA 3BAYA 4RX0A 2I9UA 1WV2A 1XLBA 2QUVA 3E5BA 2OZTA 4K2SA 3B8SA 1OK6A 3EA3A 3DHFA 1C91A 3FYYA 3CQHA 3WQ6A 3CAKA 1HJWA 3K2GA 3L12A 4O18A 4QR6A 4ICNA 2OT1A 3K4DA 5CZ0A 3O16A 1V79A 4YTRA 1VB9A 1FWDC 4XZNX 3RX3A 3PSWA 2WZEA 3BOFA 3TXVA 1OX6A 1GHRA 3GAYA 4M6VA 3KXQA 4PB3A 3WDPP 4S2BA 1VPQA 1VLIA 5LNUA 3DFQA 3VOJA 4NSBA 1CI1A 1BFNA 3ZXWA 2ACSA 2ISSA 5CGQA 4BY3A 3W26A 1NQ6A 2PD9A 2OR2A 2PDUA 4H6RA 4CCDA 2QJNA 5H91A 3OHIA 4HPHA 3W7KA 4JHMA 3W72A 2CZ5A 1TMQA 3UPMA 3LK6A 3OP2A 2GDUA 3GAKA 3S47A 1UQYA 1WKDA 1EZWA 5I3KA 4P8UA 1ZBKA 2WCAA 3M0VA 4B2DA 2BXZA 5G5IA 1JD7A 4U2ZA 5J5DA 4HPXA 3IUIA 4P7QA 2AKZA 1XM3A 4R33A 3W7OA 4DUXA 1DL3A 3KL5A 1XRSA 3S6OA 5E70A 5T91A 1DIEA 3UZWA 5HANA 4KERA 3DI0A 2RKXA 2CZVA 1H4PA 2WMHA 3W7LA 1PHQA 3RCYA 5IOBA 2GWGA 3WNKA 4A21A 2YIHA 1PSCA 3LHWA 3DI1A 4TVCA 4AG0A 4ADSA 4ERGA 3LB0A 1JGIA 2JIEA 3ABOA 3GS6A 4KRTA 3URBA 3RMEA 2ACUA 3Q58A 2NW0A 2F7FA 3EXTA 3WUGA 3MO7A 1TKKA 4HHMA 4LUJA 1XLEA 2G3NA 1LP6A 1OCNA 1ECQA 4GUHA 2RUSA 1H1YA 4B5NA 4O4WA 1LUCA 1OFDA 2BFGA 1MXGA 1MW3A 3ONCA 3WQ4A 2BVWA 5EGRA 2XUCA 3S5OA 1UWUA 1E43A 3AHZA 3WBYA 3LCHA 1UROA 1NVMA 1KCZA 3SIZA 2V30A 1PCWA 5CXPA 1O6IA 2PS2A 1M1BA 4NJJA 2PA6A 3LMYA 2ZXQA 4YXGA 1KR1A 2CLEA 2ZZ6A 4UNKA 1H7WA 1XBXA 4ZB2A 3F03K 3TVAA 2PE4A 1B9BA 2XN0A 1H62A 4JTSA 4WSHA 2YBUA 1G0CA 1SZGA 5JBFA 4IPPA 2GVYA 1TVLA 2PWDA 1V51A 5U4NA 1JYXA 4QS6A 4ZQPA 2XFWA 2PZNA 5HPCA 2PDQA 5AHLA 3CTLA 1ZS2A 1CB7B 1OBAA 2ZRYA 1J4EA 3PY2A 5TD4A 4I6KA 2XJ7A 1RJPA 1YLVA 1VGAA 5F1VA 3AIUA 3S83A 3HM7A 4DN1A 1UBSA 4CCZA 3LGEA 4AY8A 1F7BA 1EKOA 3TP4A 1GORA 3KRSA 4IWWA 2G5WA 3WLTA 1SW7A 4PMVA 5IDZA 1HKVA 4C6FA 4UXDA 2OB3A 4RL3A 4PFMA 4B5UA 2D23A 2JKPA 2V3FA 2YGYA 1HNYA 3RG6A 3QHNA 4LT9A 1HX0A 2BVDA 2FQIA 3GNDA 5HQMA 2A1YA 2ZRWA 4S3KA 3S8HA 2OEMA 2FH6A 1TE6A 1T0OA 1SO3A 4PC8A 2BY3A 3ABQA 3GHRA 4CQ8A 3GZAA 3FX4A 3I7SA 1RHCA 5C70A 3H4XA 2CFFA 4L1GA 1XJBA 3ANUA 1VJIA 5CC3A 3DYOA 3AROA 5IXEA 3VNJA 1KLYA 3CL8A 3PFRA 2YCLA 1KBJA 3WL0A 1DORA 3G0UA 5MHBA 1J8VA 2Y1HA 4FZIA 2OOGA 1KM0A 3A47A 2VQUA 3UG5A 2XH2A 3G77A 4PYSA 3TA9A 9XIMA 4S3DA 3WJXA 5A2CA 4PTNA 1PB0A 1VFSA 1L9WA 4QNEA 1OCBA 2VZSA 1P6CA 4UTJA 1C29A 3UYIA 3GTIA 2GLKA 2FVMA 4Z2JA 1A80A 2FZMA 4DBUA 1H5YA 2BGNE 3DHUA 2D1ZA 2Y88A 1KCLA 3IJIA 1Z42A 4TIMA 1XQKA 1Q2SA 3MPGA 3U0HA 2Y61A 2ICSA 1M65A 4O28A 4KFOA 1EJWC 1TRIA 2DT0A 4IGMA 2VT0A 4MAZA 1BVWA 2EG6A 3DGRA 4IMCA 4ACZA 5I09A 4B92A 1G1YA 3WSUA 4E0CA 3LHYA 3P7YA 3M5XA 1W3TA 3ARZA 3VGGA 3N18A 3N13A 3LXCA 1F05A 4UTMA 4JY9A 4BA0A 1CXHA 1FQ0A 3CYJA 3BAXA 4PRRA 4QG6A 2B7PA 1XYAA 4QSFA 3LU2A 3O9NA 4X0VA 1MUMA 2EEXA 3CNYA 3ME3A 1XLDA 4O0KA 1RJQA 4I7VA 4C5YA 4XX6A 4Y9MA 3UWQA 4AZGA 5JXQA 5HQEA 1CGVA 1A49A 3BSGA 4F0MA 1JI2A 2BXYA 2E9BA 3CV7A 4R9XA 2V8ZA 6REQB 5D8ZA 3ES7A 5A69A 1S46A 2XZ7A 3E12A 5I03A 4MSSA 1XGDA 4B2DD 3VIIA 3UWWA 2X1UA 4QCFA 1EJXC 1UZDA 4MWAB 4WOZA 4Q7IA 4IXHA 3T7VA 3HF3A 4HHHA 4J28A 3VA8A 1K77A 3CZ8A 5ABTA 3VKJA 5I0DA 4LCSA 3KRBA 4H9YA 3UVAA 3RM4A 2AAMA 2YW4A 3T1GA 4PB4A 1X6NA 3L4ZA 5CPLA 2W66A 1JIBA 3CTTA 1AG1O 5I02A 4WD0A 2DW6A 1OF8A 1KRCC 1PTAA 1R46A 3T40A 4GUFA 4LEFA 4LVBA 3S42A 4DWDA 2ISDA 5FCZA 1C8XA 2OQLA 1CZ1A 1GJUA 2I17A 4GY7A 1GVEA 4GQ0A 3BO9A 2GGIA 3WBXA 3WELA 3UESA 1F3TA 2DIEA 3AMCA 2FDSA 3CM4A 4AIBA 1NFGA 4ADTA 3EX4A 4JHOA 3AIWA 4S1FA 1EJTC 4GRSA 1UP0A 3E1F1 3DYMA 4GKTA 4QHRA 5FJUA 5HMFA 3OBAA 4C6PA 3O1NA 1IEQA 4FR1A 1I4NA 2O0TA 1DP0A 3LG3A 3OA5A 4J3VA 4WRHA 3MU7A 4W9TA 3FSUA 3LCIA 4ZZ9A 3L65A 4ILSA 4U3CA 4U33A 1F07A 1IR1A 4FALA 3DENA 2A79A 3TSMA 3CZKA 4Q4QA 1E9ZB 4QRNA 2H90A 2ZUSA 1IGSA 1IIHA 3E2RA 4C1NA 4B4HA 3RJYA 4CVWA 5A2BA 2AQOA 2O7QA 1NTHA 1XX1A 3H2EA 4E6MA 1GYMA 2Q71A 3VD4A 3HQ1A 3H7RA 3VGHA 4FLQA 3AHYA 3WD1A 3ARPA 2CLLA 1XBZA 4MB3A 3N9RA 1SJCA 1RQEA 2YLLA 1FTXA 4XD6A 4Z08A 1J0KA 3KWXA 2PC4A 1ADSA 4PBGA 1VP5A 4WDUA 4KETA 4HPJA 1KO0A 5EY5A 3GE7A 1BAGA 1IR2A 2WHJA 4CCEA 5A6MA 1LBMA 2PDFA 1TPWA 4YHGA 2WZIA 1VS1A 3PWGA 1DKWA 4XG1A 2DT2A 3CHVA 7XIMA 1NWUA 2JF6A 3WMBA 2VC5A 4C6NA 3BH4A 4QISA 1MFUA 1FKXA 1J6OA 4XSLA 6CGTA 2OELA 3L5MA 1LLOA 2R24A 2W5FA 2XPKA 3UQNA 4QCEA 3N3TA 3CAVA 2QIWA 4F2BA 1UKOA 1JCYA 2DPEA 1A5BA 3T05A 3VGBA 2VC9A 4YPJA 5BMXA 4F79A 1W3LA 1A5OC 4QSHA 1E9LA 3S1UA 1XXXA 2WB5A 3UERA 1W91A 1MYRA 2Y4SA 4XUGA 4N4PA 1RP8A 5D32A 1UD2A 3AXHA 3FEQA 1E6RA 3V0TA 4NRSA 3G0SA 1M41A 2WMFA 3NQFA 3UXAA 1JUBA 3U2OA 2XVLA 4LS0A 1KQYA 4UCGA 4E8CA 1OG0A 4ZQRA 2XVKA 1G4PA 4DXVA 2YL6A 2WMIA 4NZ1A 5CLWA 3GXPA 1XUZA 1P6BA 1LRTA 4EWND 3PBVA 3PBUA 4OHQA 2V0TA 1JDDA 1W54A 3V1HA 1SJDA 3EOOA 2EKGA 4DY1A 3UGVA 1FY6A 3LEPA 5AYXA 2O9TA 3AMGA 2OCZA 1B57A 1K6AA 4WLCA 4HBKA 1K9TA 3RM8A 3ZFHA 2PGEA 4F2TA 1HO4A 3EOLA 1Q4NX 5LNRA 1Z89A 4AISA 3ZWSA 2HMCA 3N1AA 1BEUA 4W88A 1XIJA 4GUJA 2Z2BA 4HA4A 2X16A 4CD8A 2J74A 3K8LA 4HTBA 3QMRA 4PE8A 4X63A 1WZLA 3FS2A 5G1YA 3TA6A 3RF9A 4LYQA 2UV8G 1GNXA 1T8XA 2NWSA 2FZ9A 1WKEA 4B5VA 5CC6A 3IGUA 2DW7A 5FF2A 1I1XA 1ICPA 1EIBA 1PIIA 2QGYA 4A8RA 3TYZA 4CU8A 1G7UA 3W6MA 3DH7A 3SN4A 1F74A 3Q2DA 4L6OA 1S2TA 1B31A 1VFFA 1NIUA 4HGXA 4IUOA 4CVUA 2PWGA 4GE8A 4LAUA 3LLXA 3S9YA 1WDSA 2OZ0A 4DLMA 4S3EA 1GOKA 1FWTA 1JPMA 4MKVA 1X39A 2DP3A 1W1A1 1O66A 1M04A 4NP7A 4JIIX 2FB2A 4Q8MA 1E40A 4C7GA 4TTUA 3N9KA 3EKZA 5B7ZA 4GQBA 3THAA 5XINA 4BZYA 4PUJA 4AWEA 4P8WA 2ABBA 2BS9A 1ME8A 2X09A 4L6HA 2C19A 2R6OA 3HMCA 2IPJA 3GVVA 3R0KA 3SGUA 1PX3A 2OLHA 3UF9A 2OZ3A 1E4MM 1DQUA 2WJZA 2CXGA 2PDWA 4KIEA 1C8YA 2QKFA 4XZMX 1ZQ5A 1J6PA 3U2CA 2VOMA 1AW1A 2FTPA 1XBYA 4C65A 1WXYA 5I3FA 3HGOA 2DSWA 4RNHA 4GIAA 1HKWA 4D6EA 5CJMA 4RW3A 3M0KA 1UHVA 1EA9C 4XD5A 3WH6A 4TMBA 1US2A 3AC0A 1AQHA 3DGBA 4LBRA 2QJJA 1QAPA 1E15A 4KEZA 1SZEA 3W9ZA 3M5VA 2PF8A 1HL8A 4K3ZA 1GQLA 1Y65A 1LT8A 2XSAA 1V6VA 4I9MA 1EDTA 1BD0A 2H3DA 3LHUA 3FA4A 5K9XA 4M7SA 3S6TA 2HPIA 3VNYA 4IGHA 4ZOCA 3ENLA 3NM1A 4UOZA 2VCCA 5T8GA 4OE7A 5H6HA 3Q65A 3GBEA 2VGIA 4WJEA 4GACA 1R86A 1SJAA 4UFMA 1JDEA 1KFCA 1UWAA 1OJXA 3AFBA 1V93A 3S5SA 3OZPA 5KZMA 1ISWA 3THUA 3KZPA 5C71A 3BLEA 4QITA 1OFRA 4J40A 1EPVA 3FW6A 3PVFA 1Q6CA 3C3NA 1WKFA 3L4WA 1C9WA 4LS1A 4O57A 1OB0A 1FFQA 2GFTA 3IGHX 4PEEA 4HCLA 3VC6A 4W84A 2J8GA 5JU6A 1BVNP 1K8YA 4G1KA 3B97A 5A6KA 3ZVHA 4GJ1A 3CBWA 2ZTJA 1M03A 1KRAC 4LANA 4N9EA 3BLLA 1J2WA 2ZQ0A 3ITCA 4GVFA 2WSQA 2VJXA 3GBDA 2DSUA 1QMLA 5CGTA 2IQ0A 6XIMA 5E0KA 1B3VA 2R9RA 4H9ZA 4WR3A 4WX2A 4NVTA 1KKRA 1JAEA 1DHPA 2GJXB 3F5KA 2J7GA 3W6LA 2WANA 3ZR4A 4HIBA 4WKHA 3T8LA 1TVNA 3ARYA 5E0FA 1FWIC 4FX8A 3S2NA 3NJ3A 2P0IA 2QV5A 5CBIA 4J27A 2HVOA 4Q8PA 1XLFA 3U5YA 1NDZA 4LUIA 1WDPA 1E4NA 3N6HA 2OYLA 4PUUA 3A64A 5CKSA 1VCVA 3VX0A 4MAVA 4ZOEA 2PWVA 1O5XA 3BW2A 1IWAA 2OSWA 2Z4GA 3VIPA 4A3UA 4PUDA 5DN1A 2HROA 3AS0A 4F66A 4MJ4A 5H1WA 3NNTA 4QE4A 4O1CA 5C5YA 1E3XA 1UD3A 3HO8A 4JTLA 4UQDA 1OVDA 3NURA 4MNJA 3SRKA 5CZSA 6PTDA 2A3EA 3APGA 2G96A 3W7HA 2J79A 1UUQA 1VYRA 2J77A 5HOSA 4JBRA 3UR5A 4D72A 2PURA 1PZ0A 1OM0A 3OLEA 4KBXA 1Q5MA 3WDJA 1GW9A 2J7CA 2RJGA 5HWJA 2PP3A 1REQA 3FN9A 4NRRA 1XYLA 4HK7A 3WLPA 2GQ3A 2YW3A 3OZOA 2NVCA 2HEJA 2J4GA 4FI4A 1OZMA 3D3AA 2VKZG 2MANA 3TX9A 3WH5A 3DERA 5C9ZA 4AZ6A 1UMLA 1TV4A 4O50A 1ZPTA 3I3BA 8RUCA 4L9ZA 3AU6A 1CLKA 1TV8A 2E09A 3ITYA 1VYSX 3RFAA 5JMUA 3T6CA 3W00A 2CEQA 2DZWA 1XLGA 2CZFA 1W2PA 2VX5A 4P7NA 2GL5A 2XVNA 3WYZA 1H49A 3B40A 3R0UA 3LSCA 3MUAA 1AQ0A 4U4MA 3BWWA 1XSIA 4F0RA 3A23A 2R91A 2EO7A 2WLYA 2AQWA 4JKLA 4GBUA 3VNLA 4FK9A 1M3UA 4H3DA 3M0HA 3F4WA 3AHTA 5AN7A 3UY8A 5B80A 4DXKA 1L2UA 4FNRA 3NXFA 4KESA 5A6BA 4CN1A 3H2OA 1TJPA 3RILA 1UWQA 3I3EA 4GQQA 2IQDA 1UR0A 3CIWA 5AHIA 3CL6A 1U33A 4YNGA 4CNPA 3RYSA 1R3TA 1PV8A 2Y8UA 4C6QA 3T08A 4H9VA 1FCVA 4P8VA 3TQ0A 5GNXA 4PMQA 1TA3A 3VABA 1K6WA 1RCOB 2JALA 3PBGA 1E1CA 4CEUC 4BR1A 1XF0A 3GC2A 1BPLB 3QOMA 4KIRA 4MY8A 3MSYA 2O4MA 5HDRA 3OYZA 4OTKA 1MQPA 3B9EA 3ARRA 1XKYA 3PF3A 3CIVA 4H6EA 1JQXA 2CERA 1VBGA 1MWOA 2PP1A 3KOXA 1VFTA 3B8WA 3U6WA 5IHRA 2NXGA 2XVPA 1ESWA 3FA5A 2PCEA 2ZZ7A 2VX7A 4RXFA 3MI2A 4YVVA 1O5QA 1DQXA 3EZ4A 3WJSA 4GINA 1VD6A 1EIXA 3GXFA 4NI3A 2WBGA 3EOEA 3SCWA 4D9PA 3BPWA 1K7XA 1HN1A 5LNSA 4XKYA 4AY1A 3AIQA 3ITGA 3B8DA 2J9YA 3KS6A 1GVRA 4XVEA 3W1TA 3MJYA 1PWMA 3WBAA 3NFUA 4MPQA 3CB8A 1Q13A 4QEHA 3RCNA 3M0LA 4Q8WA 2OX4A 3VNKA 5ABEA 3GDLA 3SCTA 2IKIA 4Y96A 1R3SA 1K9EA 1XSJA 5TNVA 3WQFA 1Y5WA 1Z9AA 7PTDA 4LC6A 3W7MA 1UPPA 1S1RA 2O56A 1T99A 2DZSA 1W5MA 3ITXA 4S3AA 4WKFA 3QZEA 3WFZA 3KBWA 4I9AA 1BGGA 1VKFA 3RLHA 2AGTA 3OG2A 4DWSA 2HQAA 5MKGA 3G1VA 5TBOA 2Y85A 8A3HA 2Z1KA 2YDSA 1VEPA 1TREA 2XG9A 2Y2WA 3CEUA 4AIUA 1YDNA 2NQHA 2BASA 4WUIA 4GKLA 2WWCA 3AZRA 1E4LA 1GQJA 2NT0A 3W87A 3VIGA 5ENLA 3GG7A 5D4YA 4GVGA 2OTDA 3N2MA 4FNPA 2B7NA 3M44A 3NSNA 3URAA 3UCQA 1SSDA 3PTMA 1XCWA 2ZFAA 4YS1A 3RJXA 2VI0A 2EPLX 4XVDA 4D8LA 1FWWA 3FKKA 3PTQA 5BROA 5CG0A 4XZIA 2DORA 3LV6A 3KP1A 1SFLA 2EGZA 3H2AA 4NHVA 2V67A 1PS9A 2EPNA 4URIA 1PPIA 1RD6A 4IMEA 4JN7A 1AZ2A 1W1ZA 3GTHA 4W5ZA 1RSCA 1TWIA 1QXLA 3AISA 1YXCA 4UTKA 2JGYA 2P76A 1ZJIA 4CUCA 1EF2A 5AC7A 5B7YA 2W6RA 3GWQA 3QY6A 3ZQ9A 1BF2A 1YDOA 4GI8A 2FLIA 4LC8A 2VGGA 1W5QA 4FOJA 2A7PA 3ARWA 1OADA 3HOJA 3K4WA 4IUGA 1V77A 2HK0A 4XV0A 5AVNA 4CD4A 3VMPA 3LHTA 2HVMA 3L4UA 1QI2A 4GIYA 1F73A 3O63A 3GM8A 2FIQA 1JZ3A 2G8ZA 3E2SA 1SSGA 1QT1A 2JF7A 4H7VA 3LCLA 1XD1A 4BI5A 1QI5A 1TV2A 4WVXA 3TEVA 3E6EA 1NDYA 1B54A 1OFQA 1M7OA 1V3IA 3M1ZA 4C6BA 3A22A 3GXTA 1K7EA 3WUBA 4R7OA 2ALDA 3W7GA 4HU8A 2A3AA 1QCWA 1MDLA 3M07A 4V28A 4MPKA 4UOQA 2OLAA 3CK5A 2VHLA 5DBTA 2G97A 4ZFCA 5KITA 2QVNA 3N14A 4DEFA 3R25A 3UWZA 3PZ9A 4OWGA 4UBPC 5REQA 2C1IA 1DQWA 2XFRA 3CZJA 2XGIA 4PB5A 2ZX6A 3EA2A 4DJFD 1KD0A 1YDVA 4QDMA 1K1DA 1KBIA 1DIKA 4YJ5A 2FPTA 3QBUA 4P7LA 3IVUA 5EMUA 5BWAA 5F7UA 1LL4A 4QX4A 1EJUC 5HATA 2GYIA 2FTWA 3WD0A 3PTKA 4WOQA 4ZO6A 2AL2A 2HPMA 3VKDA 3A5VA 1K3UA 4REQB 4N2YA 1AA1B 3BL3A 3WK3A 1AQMA 1ZCOA 5J5RA 3C0JA 4DM1A 1CX9A 3OZYA 3C2FA 1G5AA 4ZMGA 5F4WA 1K9FA 3ABXA 3G5EA 5FSDC 4MY9A 3LCWA 4J9JA 1Q6LA 1PWLA 4JCMA 4RJEA 2V5CA 3R43A 4Q8VA 3BAKA 3PBYA 1W8GA 3PJWA 4PL1A 4EXQA 5C55A 1TTIA 1FWBC 1ONEA 2C91A 3B03A 1HL9A 4GCAA 3MZ2A 4Q33A 3POHA 4ATWA 3WJYA 4YYCA 4DWSC 1UUMA 3RU6A 4MIMA 3H8AA 3T0TA 3WK2A 1C3FA 5CPSA 1B9ZA 4HK5A 4ZO8A 3G3DA 1SR0A 4MB4A 4S23A 3W88A 5DMMA 3MDWA 4FSAA 2QJGA 3RAOA 2XN2A 3SSJA 3P8IA 2BVYA 4XZLX 3QY7A 3S1VA 4QE5A 3TYCA 1M7XA 3HB9A 1LT7A 1S5NA 2W92A 2PD5A 1OFOA 3ZVHB 3N12A 4C6KA 1TMLA 3BJSA 3MUY1 1KKOA 5I00A 1WO2A 4EE9A 1HZYA 3P60A 2XWEA 1WAUA 3MS8A 4AZ5A 1DTUA 1EWEA 3AU2A 4KWVA 4ZENA 4NJGA 4QLLA 5C9XA 4QAIA 5C0QA 4IFKA 2C8NA 5JUVA 3AZTA 1L6SA 1JZ5A 1BXBA 5ECVA 3DAQA 2A5HA 3C2EA 2Q3RA 3FEMA 4JFUA 4N9CA 5LZLA 1V02A 4JQ4A 1F6YA 2PDGA 1XCFA 3I68A 3G1HA 4EP8C 1HTIA 3GK0A 3P5ZA 4G8TA 5A6AA 1CGWA 1JNEA 4GISA 3WH7A 4UFLA 3SRFA 3V0SA 3R89A 1W1TA 5CBBA 3R12A 4DX3A 1P0NA 3LNPA 4MYXA 3KTXA 4GNKB 3V75A 2DFAA 3WQDA 1WKYA 7ODCA 1QR7A 1ICSA 3R0DA 1A4LA 1G4SA 2BZNA 3RX4A 1V6YA 2CWNA 5CC5A 1UZHA 1WBHA 1IZJA 2D0FA 2Y8VA 3GNNA 3UT0A 1LLWA 3VCCA 4DWSD 2OSXA 3QQ1A 4XUYA 3BE7A 1E9YB 3UGRA 1EJVC 2VTFA 4JIQA 4GHRA 4XD3A 1Q4WA 3M4HA 1TIMA 1XG4A 1O68A 3TCEA 2HE8A 1HKJA 1SMAA 4NNBA 3MMUA 1V0NA 3D5HA 3QYSA 3REQA 1AZ1A 1M5WA 2UBPC 4NZFA 4NX5A 3GVRA 1S2WA 1FP8A 2VNCA 4L64A 2BBFA 4HHPA 1UKPA 4AWTA 1OC7A 1PL9A 2YL8A 3AHXA 5A95A 2AMXA 5FEWA 1E6QM 3BICA 2QCCA 4H41A 2X30A 4OT7A 2J6VA 4JXCA 3MA8A 2VC6A 1CXFA 2VURA 3W7JA 4C1LA 3NQVA 4JFSA 4GLEA 5CPQA 3DFPA 1AW2A 4OU1A 1GQKA 1DBTA 4PMDA 2H3BA 5IM51 3HPXA 1KBLA 4MG4A 1OX5A 3BCJA 3AHVA 1ZTVA 3MW7A 2DVXA 3MP5A 4FX7A 3ALFA 1S1PA 1V6UA 4OBSA 1TPDA 1Q7ZA 3IACA 1EFZA 3CZGA 2P5NA 4PUMA 4UC5A 3VE9A 4MKNA 4BWLA 3B9NA 1TE1A 3ZR5A 3VD7A 3DCPA 3QC0A 1YNPA 2XIOA 1JXKA 2C71A 3NSMA 2FJUB 2F9RA 1JUKA 3PBWA 4HQVA 4U10A 2BVTA 3MBFA 4HPGA 3SFKA 4FXSA 3TAOA 3WLKX 1C8QA 1QW7A 3FDGA 4JPGA 4HA1A 4LALA 1BRLB 2FHFA 3C5QA 4GPNA 1CGUA 3CHDA 3QVQA 4Y9PA 4MZYA 4IOTA 2NQLA 4JEQA 3H7VA 1SYTA 2B7OA 3L7RA 4B3KA 4XBSA 1KW1A 3RPMA 2WM0A 2OGYA 1E6PA 3MANA 5EFFA 3GO2A 2Q6ZA 2DJXA 1S5WA 3JU2A 1VFHA 3ZYZA 3ZVIA 1FOBA 1XIMA 4HYWA 2XIIA 3MKCA 2BHZA 3VUSA 1P48A 4G7EB 1EGVA 3GXNA 1ZP3A 4IXXA 4JY8A 4Q8TA 1LWIA 4R85A 4UR9A 1XGZA 5KTLA 2Q8ZA 1PTDA 5FI8A 3EPMA 5D02A 1BSIA 3W29A 1XINA 2ESCA 4AWUA 5C54A 3M0ZA 4J1OA 3ANYA 1T40A 5AOUA 4UTHA 2AOSA 2EPOA 2WAGA 5EPDA 3IRDA 3SFWA 5IBXA 4ATDA 1KC7A 1UA7A 1ZJAA 4LPCA 4UMAA 3K4AA 1TPEA 2QCLA 3TJIA 4X2RA 1EP3A 2XTKA 1AW5A 2YFOA 4C60A 2QUUA 2PBOA 4AQLA 3GIPA 5FF3A 4CNOA 2GVLA 2OSYA 1GG1A 5E5CA 3HV9A 2ISVA 3AXXA 1BKSA 1H5VA 1EJ7L 2X40A 1GCYA 4DI8A 3H7UA 2V3EA 3O6AA 1K8ZA 3EDEA 4HNVA 2QJHA 1PHWA 2EXOA 1HJQA 3R8RA 4ZTXA 2HCVA 1GQNA 3QSTA 3VPLA 1XIIA 3ZT5A 4RE2A 2YZRA 4DWSB 1FXQA 2HDJA 2WVTA 3O6CA 5MKGB 1GVYA 3BMVA 3H6OA 1MXDA 4TVDA 2P10A 1J10A 3CUIA 2PPGA 2WCGA 3KWSA 3VIMA 5IFTA 5G4HC 3MMDA 4JX5A 1LG2A 2NQ5A 3F4CA 3DECA 1TJ1A 5FJPA 1H1NA 2F2KA 1MI3A 3VKKA 1SM9A 3T55A 3WQPA 1CBGA 5AYBA 4UFKA 3LA4A 5CZKA 4F9DA 5DO8A 4MZ8A 3S2LA 6XIAA 2QCFA 2VDGA 1U1JA 1MEIA 4BKNA 4PFHA 5KZDA 3B0PA 1RLCL 2G95A 3BK0A 3TJLA 3EMZA 1KV8A 1AL8A 1UP3A 3KTSA 3LGGA 4LUSA 1YE4A 3UP8A 1QATA 5F2MA 4D6FA 5LXEA 1SZFA 2WJEA 1K03A 2R1LA 4TVUA 4C6CA 3S9ZA 1VLWA 3GW0A 2DZTA 3W4RA 4Z2GA 3PJUA 1J0HA 1B3WA 4S3BA 5G4EA 1M53A 1YBQA 3MWAA 3RLVA 3PG8A 1VPXA 1YYAA 3R1ZA 4BWLC 5ABFA 1MSSA 4GBDA 4Q32A 2ISFA 1X8FA 2Y24A 2WZHA 1KR0A 3RITA 2NVAA 3ELFA 3OLGA 3ARVA 4LF2A 3NYDA 1UBPC 4YTTA 3ZLFA 1US3A 4HNUA 3SN0A 2EF9A 3UWYA 1U1HA 3FJ6A 4L6DA 4HK6A 4S3GA 4V33A 4C1KA 4NIRA 1BSLA 3TQPA 4AZBA 1ITXA 2E25A 2QVHA 3KX6A 3FAXA 4EX4A 2QULA 1MDRA 4R7WA 3A6OA 4FP1A 4JN8A 4ZO9A 4AEFA 2DUAA 3FOKA 2YKKA 4A3RA 5FJTA 5EMYA 3E0LA 4GGHA 2BY2A 3V4BA 4M0XA 3C4UA 1D7FA 4HT3A 2F8QA 3V5OA 1YKWA 3NDYA 4ZBCA 1T6MA 1LQAA 3BANA 1LOQA 2I57A 1TUFA 3E96A 2DZUA 2Z29A 3PZMA 1FWRA 2J78A 3VFLA 3TYUA 1AJ0A 2VDHA 2QQ6A 5XIMA 4LAOA 3SN1A 5IBXC 4EPKA 1OCJA 3KBVA 3JZEA 3W0KA 1F8IA 3KFTA 3AUJA 2QNEA 3LNMA 3CPRA 1LDCA 1KGWA 3SI9A 3OVGA 4AXNA 1VQTA 3NQEA 3M47A 4QGCA 3BAWA 4UCFA 2GUYA 1TPUA 3NQDA 1CPUA 4LY4A 1E0TA 1UWIA 4EAYA 3HJEA 3GVWA 2YA0A 2VD9A 4IIEA 3GRIA 1C92A 2PLCA 1W1IE 3TKFA 4IP7A 2E6FA 1DWIM 5I77A 4IT1A 4HB7A 4H04A 5LIXX 3VD5A 2YPIA 4WKAA 3T2PA 4K7VA 3ABSA 4L4LA 3BGJA 4CU6A 3GU1A 1TCMA 2BSLA 1Z3NA 1RQHA 4IQJA 1LWHA 3W2NA 4D71A 1FKWA 3R4IA 4K68A 4MNMA 1W56A 1NWSA 1FWJC 1H60A 3F5JA 2Z1BA 3QLDA 1JRBA 3HBLA 4TR9A 1SFTA 3SQSA 1R3VA 3MUIA 4XISA 5HUOA 4J3ZA 2WJDA 2OWXA 4RZBA 4Q8OA 1HJSA 2EJ1A 3PJXA 1DXIA 1XYCA 2PGRA 1E51A 1QWGA 5U7SA 2EKCA 4DZAA 4IMAA 1ZBWA 4CQDA 5F4SA 3AWNA 3UXKA 3K1DA 2UY5A 3VIJA 3GNXA 2O9PA 3GYEA 5AECA 1V7YA 2B0MA 4Y8EA 3WLLA 1IV8A 2NUWA 2CKSA 3W2JA 3VDAA 4C90A 4B90A 2E1DA 3EOSA 3OVPA 3ZJ7A 4UTUA 1PIFA 4IIBA 4I8YA 2PDPA 3EMCA 5DRIA 1I0DA 3BGAA 5EU9A 4RDWA 5I5RA 2ZWZA 4GNVA 4S38A 1NOWA 2E67A 3BV7A 1HVXA 5JIPA 2DVTA 2C16A 4ADUA 1LG1A 1E72M 4PBEA 1R38A 4U2YA 4GQGA 2QF7A 4K38A 2XIJA 1HF6A 2J24A 3LQGA 3N3MA 1XPYA 1O1HA 3T0BA 5HWMA 2W79A 1AK5A 2E28A 2OU4A 2PMQA 2HRWA 4C6EA 3CV2A 4LBSA 1E5NA 2V68A 2XIBA 1J0ZA 3KE0A 2NVDA 3WFLA 3C2OA 3DFSA 3JRKA 4LVFA 4P61A 5PTDA 2WVUA 2WM1A 5L9FA 5A8MA 4HN8A 5EYWA 2JFEX 4GZJA 3SUVA 4GYPA 3LI1A 4W4QA 3SURA 3WENA 3G1DA 1A0DA 3KW3A 3LPGA 3NUKA 3WG6A 3R79A 2V5JA 4HCDA 5HR6A 1UA3A 5ABHA 2DDXA 2YL5A 1QJWA 3W1PA 2ANUA 4A3YA 2J13A 1W17A 1VYPX 1VHCA 4PMYA 1EOKA 4H9MA 1P4CA 4MB5A 3UD6A 4H19A 3OLIA 3Q4DA 3NZ1A 1WUEA 3KVJA 1BWKA 1GVOA 4K8EA 2NQJA 4PCPA 4JYDA 5TF0A 1TVPA 4IPJA 4HSNA 2QAPA 2VWSA 1V02E 4HMNA 3V35A 5G2WA 4UB9A 3SCNA 3QGKC 4I90A 1M7JA 3KCOA 1DJXA 1MEWA 2E4TA 2O92A 3B8VA 4YN5A 3M5ZA 2OQYA 4KPLA 3UWVA 4ES4A 3L23A 1BVZA 1XH0A 1V6TA 3B9DA 3O2LA 3GFYA 4JTGA 2GZXA 1K8CA 3EDKA 4MVAA 4D6JA 3HPSA 1L8NA 4MOZA 3CU2A 4A2SA 4MB1A 1JCTA 5A5WA 5I3GA 1EC7A 2FVKA 3MV11 4S3CA 1F6PA 1CGXA 4JTRA 1KFBA 1TX2A 1RP9A 1VENA 3GUGA 3RDKA 3HV8A 3W7DA 4BF9A 1JUEA 4H83A 3GY1A 1R0MA 5SWUA 2BGSA 2WYSA 3BCFA 3UETA 1O60A 2XIMA 4MADA 1OINA 2FGBA 4G6CA 3VE7A 2FH8A 3NOYA 3W28A 1DEDA 1CXEA 4B4FA 5A8NA 4NNCA 4W8AA 4GYKA 2NXIA 3A3XA 2Z00A 2VGFA 1BG9A 1TTQA 3T0CA 3M64A 3G2GA 2CC0A 1RR2A 4UQAA 4GX9A 3T9PA 1LOLA 2Q09A 4M51A 1QNPA 4HU0A 1OGSA 1LRQA 5CLTA 3TTSA 1KFJA 3MSRA 1B90A 3IK4A 4D1JA 3U57A 4QJ1A 4M3PA 1XCXA 2P8BA 4M8UA 3TNOA 1OSEA 3HFYA 3AQUA 3PUGA 1UJPA 4GI6A 5D38A 4UWMA 4JNMA 3E02A 4EVZA 1OABA 4B15A 2VRQA 3FNDA 4ZCWA 2WQPA 1U5HA 5DMLA 2P8CA 4EIVA 2ZC8A 5HXMA 5A2AA 3UA3A 3GFZA 1UWTA 4NXKA 3BSHA 2PDXA 4QG8A 3EWBX 3FVMA 1UJQA 2ZCGA 1MO0A 4DZHA 3WX7A 3EBVA 3C61A 1QI0A 1V3LA 2PLJA 3CMGA 3PR2A 1H7NA 4HNLA 3CUFA 4XO6A 3NL6A 2GWNA 2FTYA 2OMAA 3KRZA 3C2VA 3P84A 4GIEA 1RBAA 2CBJA 1MW1A 3AIEA 2GVGA 4AFYA 1HXJA 2PWHA 1UCWA 3KDNA 5T9CE 4GYPC 3UJSA 3CYVA 1W1B1 3UCCA 5GPRA 1QPRA 2MNRA 1U30A 2ZUWA 3KOZA 4GGBA 4C6IA 4EXBA 1JPDX 3S3GA 2GGEA 5FOOA 2VEFA 3MI3A 1E1EA 2VQTA 4GMEA 2Y7GA 5JBEA 5LKYA 1GOXA 1LZOA 2ACRA 4FOKA 4N6FA 2OLSA 1EYWA 1CT5A 3WQOA 3KL3A 4C6LA 5D09A 3L2IA 4UMBA 2Y7FA 3QJAA 1AUSL 1H61A 3EKGA 1MMFA 2G3MA 5A6JA 1EC9A 2R8WA 4UTTA 3C0LA 4PMRA 3URNA 3O8AA 3QPEA 4UFJA 3SUSA 3AMDA 3PB2A 3PN8A 4FHAA 2PDKA 1H50A 1QPKA 1WOAA 4R3UA 1TG7A 3NVDA 4DELA 4ZSUA 2W63A 3RIKA 3UPBA 5HNNA 5LXXA 1YE6A 1V8EA 5D9MA 2IW0A 1UD6A 3W1LA 1JD9A 1W9BM 3H23A 3CUHA 1IXOA 5BZAA 2GPTA 4DF2A 1GG0A 3CJPA 1WA3A 3GKFA 4HJWA 4NAEB 3QPYA 1FH8A 4NY2A 2D2JA 3QLLA 3CQ0A 1ISYA 2B81A 3L9CA 4MWAA 4M24A 3IJ8A 4HSOA 2PDMA 1O12A 1TRDA 3S1GA 2WKGA 4KFPA 5CPOA 2JEPA 5F2LA 3WQVA 4ML4A 3DFOA 3VO0A 3SCOA 1GEHA 4Q8NA 1ZLPA 2Y8KA 5E93A 2DZPA 3TSDA 1GZJA 3LPPA 3MMWA 4A6GA 3QQWA 2DJLA 3BAJA 4F4RA 1Z8AA 1WDWA 2ABAA 1I45A 5FAJA 3A24A 3ZT7A 5DLCA 1NFBA 3VM7A 2YCKX 4JX6A 4MDOA 3IJLA 5FEZA 4G56A 3QW4B 4GX8A 3DBPA 2V9DA 4WY0B 2CBVA 2CYGA 2HSAA 3W7IA 1WZAA 4ONVA 5D2WA 1JYWA 4WDWA 2A4AA 5H8PA 3TMQA 5AHEA 3LTYA 2OWWA 1LRNA 6ENLA 4G9PA 4A8LA 1ONXA 1N8WA 3HURA 3SM0A 3VC5A 1S3TC 4I8DA 1TSIA 3GDTA 2QUTA 3N19B 3HPZA 3I6RA 4OBRA 4JTEA 4RXGA 2CBIA 1QK0A 2QCHA 1KTNA 4TV5A 5IDIA 2WC4A 1K4GA 1JCXA 1QNQA 2BV9A 3MCMA 3UXDA 2O4QA 4BQ2A 5I3HA 5AZ1A 2L5HA 3TZNA 3WH9A 4MDPA 2E6YA 1XICA 3B9AA 1CGYA 5AYZA 4AYSA 2VFEA 1QK2A 1OC6A 2R82A 2RDXA 4LVAA 4NAFB 1XIEA 3C8NA 1EGZA 1X7IA 1FDYA 2CHRA 1WYIA 4WXYA 2J8FA 1QI3A 3IAQA 2NT1A 1UB3A 1UC5A 1OK4A 3STPA 3ITVA 3WNPA 4NX0A 3B0VC 3WIJA 1KCKA 3DFHA 4PMJA 3P0XA 3KOYA 2HS6A 3SUUA 3BJTA 4HOZA 3QGAC 1BWVA 1H7PA 3EXRA 4YTQA 2DZBA 3BSMA 1VIWA 5HQLA 1GZGA 4CD5A 1WQ5A 1P6WA 2D0HA 4UMCA 3PZOA 3P6LA 4O12A 3Q67A 3IGSA 1RVGA 5CPMA 5LA2A 4PRWA 4WY0F 3XIMA 4UTTC 3TNBA 5DF0A 2PDNA 4ZOAA 4JX4A 4DQWA 4ZR8A 2WHKA 1XW8A 1GVSA 3V5CA 3OTRA 1EOMA 2YR1A 3GIYA 3LN3A 4XTDA 5GNYA 3RR4A 3FVDA 1SZNA 1LORA 1O7AA 2JKAA 1PIGA 4IMFA 5AHMA 2F6XA 5AC6A 1P1XA 2G3JA 3S1XA 2CPUA 3UG4A 1RV8A 2QPUA 1ZAHA 3KDOA 4HP5A 4L4MA 3GDRA 1ZBCA 3DU0A 1AH4A 3ERPA 3VNIA 1P43A 5BWFA 1VEMA 3B8UA 4JQAA 1BYBA 1SJBA 2FDMA 4KGLA 1UWSA 3MCNA 4IFOA 2E8ZA 4KW2A 2ZKMX 4MWAC 4J2MA 1JCNA 1WBJA 3STFA 3T2OA 3M46A 4O52A 2GSJA 1I1WA 4S2CA 4CLMA 3C3UA 3FDKA 4IJRA 1CXIA 4UIOA 3HFTA 1PDYA 1FWGC 2BB0A 4ECLA 4RE0A 3UZYA 1J96A 4NJHA 1P0BA 4CKQA 4W5UA 1C90A 1HKKA 3PZIA 3O6DA 3NDZA 4E2BA 1Y5XA 5DCBA 2REQB 4X60A 4XK2A 3FJ4A 1VBJA 2AAAA 4Q6JA 3MC5A 4MNKA 3CEPA 3CHFA 1RVKA 3AYTA 4HYRA 1W2VA 4B91A 1EJRC 1TTJA 1JYNA 1R30A 4FNSA 1GYNA 2BNJA 2PWUA 3B8IA 5C2XA 3ZLHA 1OG6A 5K9DA 1P1MA 1YDYA 3S2CA 5BXSA 5CH9A 2PB1A 5M1TA 4JQ1A 3MYOA 4M6UA 2G3IA 4M56A 4IIFA 2BWGA 4ENLA 1H11A 2H8XA 4K37A 4O8RA 1I9CB 3VVGA 3GG8A 3WDHA 3GSMA 1JRCA 2PFHA 3EWYA 3GH4A 1OZQA 3DHPA 5HPOA 1EDQA 2YXXA 3VZZA 5FF7A 1W1YA 2A0NA 1NFPA 2IKGA 3CPGA 2ACQA 5EBUA 3QTPA 4S3JA 3W6YA 4EXAA 2VMFA 4GIRA 3MBDA 2FZDA 3Q45A 2YZ5A 3L0KA 1X1ZA 1R3RA 4MWAD 4OQVA 3SAZA 1DWHM 5BMWA 1JQVA 3N9SA 4LVDA 2YBTA 2X8RA 3EDJA 4RNIA 1XDLA 2PLMA 1W9DM 2PTWA 3LXAA 4KRZA 2WVSA 3LI0A 3E0FA 1ZALA 4U5IA 3RLUA 1A0CA 2ZWYA 3QXBA 2CW6A 3ARXA 1GK8A 4GY0A 3SEPA 2ZRZA 5IHSA 4H01A 1B3XA 1MXSA 3O05A 2HE5A 3H2FA 5M3WA 1AMKA 3KL0A 2P3EA 3TYDA 1B3YA 2G37A 1RAKA 4FF5A 4YHEA 4OIFA 1PEZA 6A3HA 3QTGA 1GTEA 2PU0A 2H6RA 3AI0A 3VOGA 5BCAA 2WHLA 4HNTA 2FZBA 1K7FA 3S4TA 9XIAA 2YXGA 4GXWA 2J62A 4Q8QA 4U3AA 2X1IA 4NI8A 1IT8A 5LSMA 1NOUA 1KGXA 2EPHA 3PZNA 2HVNA 4PSPA 1G4TA 3SRHA 1OFEA 4AMAA 1KFWA 4H8UA 1T7LA 4KMQA 4BQ5A 1ZP4A 2VOTA 3LPOA 4R27A 4BS0A 3AXIA 4AIEA 4JTIA 3B9OA 4GG9A 4DNHA 3HMJG 4W93A 2PC8A 3OIXA 2J27A 3HQNA 4Q22A 4IL0A 1JF6A 3HGJA 4FXRA 5LYRA 4V1XA 4AMCA 1R2RA 3GTFA 1ZFJA 1RCQA 3UJRA 4X9YA 3DZ1A 3TWBA 1BGAA 4KF1A 4FR6A 4LCRA 2E9LA 3OEXA 1J11A 3VDHA 1A5MC 1RLDA 1QHOA 3B0UX 4G1NA 2VZOA 3ZJ8A 7REQB 1VAHA 3SUTA 5L6UA 1I60A 2E3ZA 3LXBA 3SY8A 1EYEA 3G6MA 1H0IA 2JBMA 1VRXA 1XH2A 1ML1A 1Q2RA 5AHFA 4CQAA 1GKPA 3G1AA 3OPSA 4RZ6A 5I6SA 4C7FA 3NPWA 1EL3A 3GR4A 3DESA 1UMYA 1EF3A 3NPXA 3RXZA 1B5TA 5I7GA 4IH3A 4MJZA 4RK8A 4E4UA 3AIRA 1L6FA 2NV9A 1QNSA 1SO5A