3U57A

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
502
structure length
471
Chain Sequence
b'NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 180
structure length 471
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u57A00
1NH6A 1GOKA 1JIBA 1JDCA 4AD2A 1W2VA 4HOZA 3DYPA 1UWIA 2C0HA 1H2JA 1US2A 2JF6A 2ZWZA 2DPEA 1JZ7A 1HJVA 1N82A 4KWUA 3QGVA 1H5VA 2O9RA 2V38A 3VIFA 5M5DA 1V08A 4H41A 5HDRA 1GHSA 2Y8VA 5IFPA 1OGGA 1C7TA 3PZMA 4NSBA 1V3MA 1UD4A 2O9OA 3LPFA 1V0NA 5E0CA 5DEZA 2VQTA 1LG2A 1KGWA 1E3XA 3CTTA 4E8CA 3AHZA 5BCAA 5A6JA 4OKDA 4CCEA 1QNSA 1TMQA 2A3BA 3AMLA 3RPMA 4Z2JA 1E72M 1ESWA 4HPHA 1JXKA 4CD7A 1B3XA 2EO7A 1BAGA 1R87A 2VTFA 3N12A 4P8XA 3W4RA 1NP0A 3SCNA 7CGTA 4M8UA 1MW0A 4HU8A 4W8LA 2IUZA 3F4VA 1CGWA 4LQ1A 1VRXA 4CU8A 1Y7VA 2YBTA 1SMDA 2FHCA 1EQPA 4W8AA 1MXGA 4JFSA 4UZSA 2XIBA 2ZX8A 5A8MA 1UKOA 1L0PA 3CHEA 4QCEA 2CBIA 1CEOA 3L4VA 4BQ2A 5ECUA 2D3NA 4PTVA 1ZJAA 4JFTA 3SCSA 4WKFA 2G3NA 2ZIDA 1KBKA 3NYDA 2F8QA 4OUEA 3WQ4A 2GDVA 1V0KA 2JE8A 3PBGA 2J62A 3WF4A 3BAXA 2A3EA 3O9NA 1E56A 4R27A 5A69A 2OLHA 5A6SA 4WSJA 1B30A 1CECA 1TCMA 1WZAA 4C7DA 1ZBKA 5A1AA 1WE5A 1M7XA 5F7UA 2WMHA 2A3CA 1I1WA 1KGUA 4CU6A 1FH9A 3PN8A 3UG4A 3QOKA 1KCKA 3F5KA 1GQIA 5I0DA 1J11A 1KR1A 5D8ZA 1VJSA 2E9BA 4C7FA 3AIEA 3F5JA 4JFVA 4JIEA 1WCGA 2CPUA 3AMKA 4U5IA 1B3ZA 5JBDA 4GXPA 4GKLA 1XCXA 4ACYA 1B3VA 1MFVA 2WC4A 2CKRA 2G3MA 1EH9A 1ZJBA 3N13A 4NI3A 3PTQA 1UD6A 3CIVA 3VMPA 1ZB5A 2Y4SA 1JD7A 4XUYA 5JBEA 1UWTA 5CPTA 3EBVA 4JL2A 2QPUA 3KZSA 4D6JA 1CZ1A 3MKKA 1DWGM 3VDHA 1C3FA 1H0GA 3VIIA 2YL8A 3QHMA 1W32A 3UG3A 1EDTA 1H49A 1KXHA 2JALA 1UR8A 3S2CA 3T0AA 1JDDA 1IT0A 3L2MA 5GQBA 1J9YA 2VCBA 3B9AA 5IHSA 2VI0A 4W85A 1RH9A 2OSXA 5D9OA 2J75A 2WAGA 4LPCA 1WO2A 5JIPA 1XH1A 3LPGA 4AZHA 4PMDA 4AC1X 3AYSA 2IXUA 1TZ7A 4GZIA 4TUFA 2VZTA 4M82A 5TD4A 2TAAA 4N42A 3TTQA 3PZVA 4UOQA 3FAWA 4AD3A 2J8FA 3MS8A 1MQPA 1GQJA 1VEMA 3MV11 3NSXA 4LXFA 2W67A 4ZFMA 3WEMA 5JBFA 4DWSA 2WXDM 4NZCA 5IFTA 2XVNA 3PZTA 1OIFA 1BYBA 3VM7A 1E15A 5DFAA 3THDA 4QCFA 1NP2A 5CQ1A 2VX4A 1W1VA 2ZX6A 2GJRA 1BVNP 2OYLA 2BXZA 4KGJA 4XZBA 4D6HA 3TONA 4J3XA 3WD1A 4GZJA 1BPLB 3WN6A 2OWXA 4JCLA 1J0HA 4AZ5A 3OLDA 3CZEA 3TP4A 2CERA 5KZ6A 2WKGA 2BY3A 1PX8A 1OINA 2XIIA 2XVPA 2XFYA 1JGIA 4UQEA 1VIWA 1MWOA 2VQUA 1TR1A 2PWHA 1H3GA 2W91A 3S6TA 1H0IA 1O6IA 4D6FA 1E4LA 1KXTA 5D8WA 1V03A 2BHYA 1GOQA 4P7OA 4S3KA 1V6VA 4PMVA 3BH4A 3SEPA 2Y24A 2CITA 3MU7A 1W3JA 3WKZA 4CD4A 2EPKX 3WUFA 5I24A 2QMKA 1QNRA 3NSNA 1B2YA 2J7CA 4TX6A 3AIUA 2V3DA 3N04A 3A47A 2VJXA 3MV01 3J7HA 2BXYA 1WNOA 2NSXA 3AISA 4U3AA 3AXHA 2J77A 3ARVA 4KRTA 1Z32X 5GNXA 4MNKA 1ECEA 5HBFA 4AZ6A 4J27A 5AYIA 4FLSA 2FH8A 1ISZA 4B3LA 1UKTA 2WMGA 3VMOA 3K8KA 3PZGA 4ML4A 4TTGA 1J12A 1E1EA 2ZICA 2O92A 3OA5A 4CCCA 3FW6A 3EYPA 3ZSTA 1KR0A 3WIJA 1H41A 1PEZA 2D0GA 1CXHA 3CZGA 4AWEA 3G6MA 5CG0A 3ZO9A 2YA2A 1W9BM 1EHNA 4EK7A 4PCTA 2WCGA 4AEFA 2QF8A 1DEDA 4WKAA 1LL7A 3ZJKA 5E9AA 4MB4A 1EO7A 2WWCA 4IPNB 3BMWA 4W89A 1ISXA 4JAWA 5BXTA 3GBEA 3ARXA 2V3GA 1DWAM 4PTXA 1GCYA 1Q6CA 5I78A 1GOWA 1OB0A 3CHDA 5A6LA 3RILA 4KRUA 4BS0A 2WHKA 3W25A 1NOWA 3UCQA 2DSWA 3GM8A 3PZOA 3AS3A 1QW8A 3EMCA 2E8ZA 2D0HA 1ISYA 4QLKA 2W62A 2WMIA 3IAPA 1UH2A 3ZR6A 1UWRA 2XFFA 1MXDA 3N18A 1W1PA 5ABFA 1ZBWA 3I3BA 5GNZA 1WP6A 1FHLA 3WD4A 4ACZA 1QNOA 4WJXA 3W81A 1R86A 3POCA 1MW2A 4MAVA 1ZBVA 4YHGA 3CUIA 4H04A 1G1YA 3AHYA 1EOMA 3T0DA 4J3VA 1MQRA 1HKKA 5I79A 1B3WA 1BTCA 2VR5A 2EJ1A 3SCTA 4XX6A 1A47A 2VOTA 4H8VA 1WZMA 4CU7A 4PMZA 2XG9A 3VX1A 4CD6A 1HNYA 3SCQA 3CZKA 4JFWA 3EDKA 1UD2A 2J7HA 3LMYA 1K9DA 5IHRA 2EXOA 1US3A 3BXWA 4A3HA 1H11A 1UD5A 1UH4A 2NW0A 4BQ4A 1DP0A 4UNIA 2A3AA 3SCRA 4ZXLA 3SCOA 4PCSA 5A8OA 2YL6A 1KB3A 1Q6GA 1C91A 3DHUA 3GXFA 2J7EA 2WKLA 3A6OA 1HXJA 3ZJ8A 3EDEA 4E8DA 1PX4A 1EGZA 4WK9A 3RDKA 3VIMA 5CLTA 1KWGA 1HVQA 4PMXA 1V3KA 3ARQA 3W26A 3CMJA 1XH0A 1DWJM 1MYRA 1PAMA 4UTFA 1XRVA 1BVZA 1TUXA 3WQVA 2ZOXA 4W7UA 3O2LA 3ZIZA 3GH4A 1JF6A 3D3AA 2V3FA 3MSGA 5ABHA 5A8PA 2YDQA 1GJUA 4LYQA 3AS0A 4TTUA 1O7AA 1E6RA 1E6ZA 1UG6A 1PBGA 1EO5A 1FFQA 2CBUA 5HNNA 1H09A 3LPPA 4KMQA 5CLWA 3WDPP 1NWRA 2D3LA 1XD1A 3VGHA 4MB1A 2PWDA 4GZEA 1VAHA 3ARYA 1HJWA 3N15A 5FKYA 3CPUA 1AQMA 4QP0A 5A2BA 1EA9C 1HKMA 1VENA 1JZ4A 4D72A 4AZCB 1J01A 4NRRA 1TG7A 3OLIA 1KGXA 3BAIA 2WK2A 2WPGA 3W38A 4AYSA 5A6BD 3W28A 1NOFA 2GUYA 3GBDA 4QAWA 3SUWA 3WDHA 3VDCA 3WQ5A 1VFFA 5M17A 3WH8A 4F9DA 3AS2A 3WNKA 1CGYA 3W27A 1KXQA 1MFUA 4Y7EA 4PUEA 5KEZA 4OBRA 1QI2A 1VJZA 3AROA 5AY7A 5CGMA 3FAXA 1OD0A 2JEQA 5EBAA 1E6PA 2J7BA 3THCA 2D0FA 4V27A 3WELA 1UYQA 5A8QA 4IPLA 2E0PA 5A95A 1W9DM 4GQQA 1G94A 2OSYA 2ZX5A 1UR0A 3L2LA 1W3HA 5AC5A 2VT0A 3II1A 2XJ7A 2IXVA 3L4XA 3VO0A 4FLQA 1E70M 3AIBA 3WNLA 1OM0A 5A6KA 2VRJA 2QV4A 4MAZA 1YQ2A 5C70A 3W53A 4U31A 2OYKA 2A3HA 1V3JA 3QHOA 3WDIA 2O9TA 2CKSA 3AHXA 4NF7A 3W82A 2VR4A 1QBAA 4AZGA 2VZSA 3OGRA 4J28A 4HZ7A 5GPRA 3CLWA 3GZAA 5I23A 6TAAA 3CUFA 2PI6A 1NOUA 1RP9A 2J7FA 2B31A 2GK1A 3W6LA 3OIHA 2QHAA 4HP5A 3VIGA 4P8VA 2W4XA 2G3IA 4DWSB 4JKLA 3AMGA 4JFUA 4J3UA 3OG2A 2F61A 2NT1A 3VIJA 3ZSSA 2XGIA 4X9YA 1X6LA 1E6XM 3FNDA 1B0IA 1J0JA 1B90A 1DWIM 1E43A 3WUEA 1QHOA 4H2CA 4PTWA 2DH2A 1C7SA 2OWWA 1E3ZA 1GONA 2BV9A 5I5RA 4M81A 3CMGA 4WIWA 2YL5A 4W88A 3WEOA 1W1YA 3F5LA 1HJSA 3PZ9A 4BQ5A 1HL9A 1QI0A 2CETA 3ARSA 3RJXA 5HPOA 4E2OA 1J0ZA 2DSVA 2VMFA 2V3EA 2J7DA 5A2AA 4B3KA 1UR1A 1GZJA 3KE0A 1QBBA 2JEPA 3T2PA 4M80A 3VGBA 4PMNA 4YHEA 1EXPA 2EPLX 3LPOA 1U33A 3MUY1 4AEEA 4EE9A 2CHOA 3FXYA 1V02E 1GOIA 1OGSA 1MW3A 4F8XA 1OWQA 2X0HA 1VFOA 2OWCA 4ZE4A 3ARRA 1UKSA 2FGLA 1ODUA 1LWHA 3SURA 2W61A 1E4NA 1K6AA 3OB8A 4GIAA 5JUVA 2YLAA 1UHVA 5BYWA 3WL0A 2UWFA 3WH7A 3UETA 5LA1A 3AIQA 2DH3A 1ODZA 1F4HA 4TX8A 1X1NA 1I1XA 2PB1A 1E6QM 4FF5A 1UZ4A 3U7VA 4ATLA 3CH9A 4HTYA 2GDUA 1CBGA 1X6NA 1FH7A 4NRSA 1PJ9A 2UY5A 2QMJA 1HVXA 2VX6A 4AIUA 4P8UA 1UR9A 4E4PA 1E71M 1XSIA 3IJ8A 1ZU8A 3VU2A 1E40A 3MMDA 1HX0A 1XD0A 3AJ7A 1UA3A 5E6ZA 1H1NA 2CHNA 3VIHA 3BGAA 4D6DA 1HP4A 2BHZA 3WD3A 3T08A 1C8QA 1W91A 1B1YA 1XSJA 2PWGA 2WVVA 5A6AA 3SUTA 4HMEA 3K4AA 4AZBA 1ISWA 3EDFA 2CBJA 4D6IA 1QI3A 2O9PA 3WBEA 3VILA 2WMKA 2WHJA 1XYFA 1V3HA 2YJQA 1AMYA 1Q6EA 3G6LA 1LF1A 4GO8A 5CSUA 3PZQA 1CDGA 1HL8A 1JYWA 1JYXA 2YLLA 1FA2A 1Q6DA 3AXXA 1OSEA 1BYDA 2XM1A 3VGFA 3WUBA 4MNMA 1V0LA 1B3YA 4AZIA 2HVMA 2ZUNA 1A3HA 1W3LA 3WF0A 3WF3A 1GUVA 3APGA 3UERA 4KGLA 3WENA 5I2UA 5FD0A 3U7BA 6CGTA 3SUUA 1E0WA 3VGEA 3DC0A 2VRKA 3ZT7A 2WNWA 3AXIA 1WB0A 3AZSA 4BA0A 2D20A 2BVDA 2E40A 3CUHA 8A3HA 1WDQA 4OOUA 3BAWA 1UKQA 3NCOA 1QNPA 3L4UA 1WDPA 1CWYA 1MW1A 1NM9A 2CNCA 4M29A 2J25A 2WVSA 1OBAA 3AOFA 1UD8A 1F4AA 2X8RA 4AD0A 3KL3A 4PMQA 2CESA 1FH8A 1AQHA 3OZOA 2OYMA 3T2OA 2WZEA 3M7SA 3PZIA 1CXKA 1J10A 1XC6A 2HISA 4JL1A 2W5FA 4R5EA 2VX7A 1XCWA 3WFLA 4B9ZA 4Q7NA 3K8MA 2EPOA 1RP8A 3WEZA 1G9HA 4WLCA 4RE4A 4OOZA 1E6SM 4F9JA 1BFNA 4UFLA 1R7AA 3B9DA 2CXGA 4JHOA 4PEEA 1CXIA 4Z2GA 1SYTA 4CUCA 2RGMA 2BY0A 3MUAA 4B15A 2RGLA 3AQUA 1GQKA 1UA7A 2G8ZA 4AD5A 4D6EA 2UY4A 4CVWA 1VFMA 1BHGA 2WMFA 4UFIA 4A4AA 1TA3B 1V6YA 3WNMA 2FHFA 2C7FA 4CKQA 4UQBA 4TVDA 4HMCA 4LYRA 1HKJA 4JKKA 4M56A 3CGTA 4M24A 3RM4A 5EMYA 3VD3A 2E4TA 2ZUSA 4OJYA 3K4DA 3RMEA 2VVSA 2X09A 4WF7A 5FOOA 1C93A 5A6MA 2XPKA 4X0VA 4W7VA 1UH3A 1J18A 1XH2A 4EANA 4GI9A 1MVYA 2XUCA 1JNDA 4GO9A 3DYMA 2J47A 4FLOA 3VDBA 1EQCA 5JIWA 3CHFA 4PSRA 5BWFA 4JHZA 4UZUA 1LWJA 1UZ1A 5CSYA 4H7VA 4CN4A 3CBWA 3BC9A 3K8LA 5CGTA 2W63A 4UOJA 4RE2A 1GOMA 1K9EA 2BVTA 3W37A 4P7LA 4JCMA 4AZ7A 1HJUA 4P8WA 3GDBA 4URIA 1L8NA 5LA2A 3BCFA 2VZUA 4FK9A 3WF2A 3VMNA 2AOSA 4J3WA 2YDSA 1HJXA 2WSPA 2Z1SA 4IUGA 4PTMA 3RM9A 1KQZA 3MUIA 4IISA 4BF7A 2DIEA 4PMRA 1NWUA 2YKKA 2V5DA 2WM0A 3VGDA 4A3YA 2EPNA 2AMGA 1FOBA 3OBAA 1TFVA 1HP5A 1RPKA 3I3DA 1B9ZA 4D1IA 5ABEA 4ZEPA 2ZXAA 1G5AA 1GOOA 1QPKA 1JDAA 2JF7A 3AS1A 4AIEA 3A4AA 4PSPA 3PHAA 4V28A 5HPCA 3CUJA 3GNRA 5EFFA 2DSUA 1SMAA 4PMYA 1OD8A 1GVIA 1DHKA 2EPMX 4P7RA 3AHTA 3B9EA 1GW1A 2XVGA 4CD8A 3WMSA 4FMVA 2WC3A 4XB3A 2WBGA 2FGZA 4W84A 2ESCA 1DTUA 4UR9A 1VEOA 2Y5EA 4PYSA 1NARA 5CPSA 3RM8A 1D2KA 2E9MA 3IJ9A 1P6WA 3VOCA 3HJEA 2GJXA 2XVLA 2WB5A 1OT2A 1QW9A 5HOSA 4PMOA 2WZHA 1E6NA 4X0NA 2ZUUA 3AIWA 1IZJA 4U3CA 4XV0A 9CGTA 1EDGA 2ZUTA 1OGBA 1KQYA 3WD0A 1GJWA 4XZWA 2J79A 3ALGA 1XGZA 4U2ZA 2VL4A 2FHBA 1TVNA 2WHMA 2D2OA 3CHCA 2WCAA 3BLKA 2X05A 1RD6A 3ZM8A 4UQ9A 2GSJA 3AFBA 1U2YA 3T2QA 1BGGA 3NIYA 2PWFA 1BF2A 3VD4A 5FCZA 2G4FA 4W8BA 4WKHA 2WSKA 4ZE5A 3TA9A 3AHVA 1HIZA 3UESA 3QHNA 3ARZA 4QFUA 2VUYA 4UFMA 1JAKA 3VINA 3WH9A 3ARUA 5DO8A 1JL8A 1QNQA 2WYSA 1OIMA 3RIKA 2DSKA 5BROA 1UUQA 2VZOA 3NDZA 2QPSA 1S46A 1BSIA 3KL0A 4MNJA 2WWDA 3CUGA 2J4GA 3IK2A 5DMYA 2Q8XA 2JIEA 3BAJA 2WC7A 2DT2A 1W2PA 1QI4A 3VD9A 5EFDA 2J78A 4QDMA 3MUZ1 3NSMA 2ZXQA 1IV8A 2ZUMA 1LL6A 3W24A 1GVYA 5AC4A 5I6SA 2JIWA 3UEQA 2GJPA 3VNYA 2VO5A 3KL5A 1W1TA 1CENA 3VM5A 4CN6A 1FFRA 1V0MA 4C7GA 1V3LA 4DWSD 5M3WA 1UQYA 1Q6FA 4HMDA 1U30A 4DUVA 1JFXA 5GNYA 2CEQA 5FL0A 3DHPA 4BCEA 1EHAA 2YIHA 4K68A 1KXVA 1JZ8A 2NT0A 3VVGA 2ZE0A 1R7OA 2BS9A 1EOKA 3UG5A 5C8BB 1V6UA 3K1DA 2F2HA 2WVVB 1CIUA 1I75A 2WMJA 3SCVA 1UR4A 1ISVA 3NJ3A 3WH6A 4GI6A 2Y8KA 3MANA 3POHA 2E9LA 1D3CA 3BAKA 3WDRA 2BVYA 3VIPA 1PIGA 3AZRA 1YHTA 1V6XA 5HXMA 3AI0A 4UQAA 1B31A 2YOCA 3VUPA 1WKYA 1MQQA 4D6GA 4MJ2A 3AICA 2W92A 2ZUWA 2YA1A 2ZX7A 3EMZA 5LA0A 2DIJA 5D9PA 4F79A 2WHLA 1XYZA 4TVUA 3WBAA 4D71A 3OGVA 1E73M 3DECA 2XWEA 4W87A 1E55A 3D5HA 1JZ5A 4PN2A 3AMDA 1JYNA 1J0IA 1JNEA 3WF1A 4AD4A 3GXDA 3NDYA 3RO8A 3VGGA 4EKJA 2CCRA 3WD2A 1E4MM 4HZ8A 2D24A 1C8XA 2E3ZA 4AZCA 3ZQ9A 2BHUA 1HJQA 2GFTA 1SFSA 1HN1A 3ZJ6A 2X0YA 4QLLA 3ARTA 4BQ3A 4JZ5A 1K9FA 4TVCA 4AISA 3MMWA 5CPQA 2XTKA 4MTVA 2BY2A 1GHRA 3IJ7A 1TE1A 4EAMA 2YL9A 5BXPA 3EMQA 2EQDA 2CIPA 3W29A 7A3HA 1WPCA 2XFRA 4W7WA 4FLRA 1PIFA 2VNCA 2XM2A 4UFJA 2XHYA 3AIRA 1PPIA 1BYCA 1CXEA 3NUKA 3CZ8A 3T0BA 4P7QA 3WH5A 5A6BA 2VURA 3RCNA 5FIPA 3SCUA 1CLVA 2UY2A 6A3HA 4Z2IA 1VEPA 4MADA 4DM2A 3MO4A 4IM4A 2VRQA 1OCQA 4OBSA 1E5JA 1UWUA 3FHQA 1LG1A 1VB9A 2PC8A 4CVUA 1M04A 1VF8A 1C8YA 2D22A 1JAEA 2E8YA 1AQ0A 2DGAA 4QLJA 4U2YA 1JXJA 1ZBCA 1WZKA 2WBKA 3PTKA 2XYLA 1CXFA 1UWQA 4ATDA 4B9YA 2VVNA 1VBRA 2CBVA 1CGVA 3M46A 3AMCA 5A2CA 3CZLA 4BZYA 1PX3A 4HA1A 4MB5A 3M6DA 4U33A 2MANA 4JKMA 1TVPA 2G41A 1R8LA 3L4ZA 1QVBA 2D23A 2Y2WA 3N17A 3FN9A 1CGXA 1LL4A 3A4WA 1V02A 5BXSA 4AMCA 4HPGA 3L4YA 4W5ZA 1BLIA 2WMIB 2VC9A 4H8UA 3WNPA 1WZLA 4W86A 5I3DA 1XV8A 4WSKA 2BY1A 4UQCA 5ABFB 4MDOA 4HZ6A 5E6YA 2FH6A 1M53A 3GH7A 3ARWA 4ACZB 2DSZA 2WW5A 4GINA 1UKPA 3DYOA 2WVTA 2J74A 3WY1A 1UD3A 1V6WA 1D7FA 4S3JA 1GNXA 1LQ0A 3WQ6A 2XVKA 2WLZA 3ECQA 4J3TA 1KCLA 1QOXA 3W0KA 1CGUA 2YBUA 4UFKA 5AYBA 5CJ5A 4TXEA 4B16A 2ZXBA 5EB8A 3KEHA 4YN5A 3SCPA 3QR3A 4KH2A 1HT6A 1CYGA 2DT3A 4AXNA 2WLYA 3E1F1 1XHGA 4N0RA 3VIOA 1DWFM 3BLPX 4W93A 1PZ3A 5E0FA 3BSGA 2X2YA 1K9TA 3ZJ7A 5E09A 3IANA 1UQZA 2DDXA 1W9UA 1BG9A 2VCCA 3M07A 4CN1A 1BQCA 3N11A 1ZS2A 3SIMA 5D9NA 2VCAA 5LYRA 4ZXOA 5A3HA 1W9PA 4UQDA 1G01A 1UR2A 4Z2KA 3WFZA 1CTNA 2XSAA 3HU7A 4F66A 3CO4A 5CXPA 3GXMA 1FP8A 1W9VA 3FY1A 1JZ2A 1JI2A 3TTYA 1E0XA 1UWSA 1HKIA 3W6MA 5FL1A 1JZ3A 2GJXB 4PMUA 4MPKA 5BRPA 4LYPA 5C71A 2GVYA 4PUDA 4GPNA 2DT1A 2BNJA 3MMUA 3WNNA 2G3JA 5DT5A 3ZT6A 3GXIA 3OLGA 1JG9A 4UFHA 4AIOA 2BFGA 3TOPA 3TTSA 3SUVA 3WDJA 4MB3A 1VBUA 5I77A 2UY3A 3GNOA 4PBGA 4HOXA 1JI1A 3VDAA 1GPFA 3O6AA 1GORA 1KWKA 1J0KA 3A3HA 3KWXA 4DUWA 2PBOA 2ZX9A 3I3EA 1E5NA 1W3KA 4Z2HA 4AD1A 1OT1A 5CZKA 3ALFA 3WMBA 1QI5A 2WCSA 4HA4A 3AYRA 4HOWA 3U5YA 4Z2LA 1QHZA 2C8NA 1JFHA 3N9KA 3VIKA 4CCDA 1BYAA 3PZNA 1BG4A 2WZIA 2YDRA 3UR7A 4AY1A 3U5UA 2AAAA 4M1RA 5ABGA 2OSWA 2DEPA 2J7GA 4YPJA 4LX4A 2PBGA 1M03A 3BCDA 1W9XA 1E9LA 4ZENA 1NWSA 1UOKA 5D9MA 3WL1A 3U57A 4D1JA 1ITXA 5A94A 3B8SA 2PWEA 2PF0A 4H8HA 4OIFA 5A8NA 3VPLA 3WMCA 1NWTA 4UCFA 1KBBA 1CNVA 5IDIA 4L4OA 3L4TA 3GYCA 3VD7A 4UOZA 2V5CA 2Z1KA 3BSHA 1LJYA 2VZVA 3ZR5A 3MSDA 4V2XA 4L4PA 4MNLA 2J8GA 1V3IA 5IXEA 3EDJA 3T09A 3ZT5A 3PTMA 3CZJA 4GI8A 1G0CA 3GTNA 1E4IA 3JUGA 1HF6A 3WUGA 1FP9A 2ZUVA 3SCWA 1JD9A 3VKKA 4DM1A 4DUXA 1WDSA 3WDQA 2CYGA 4ATWA 4P7NA 2WVUA 1CPUA 1QHPA 4OZOA 2EBNA 3K46A 3HMCA 5DF0A 2FDMA 1EDQA 2YA0A 2EEXA 2GK1B 1Q4NX 2W66A 3GNPA 3FHAA 2XSBA 3PZUA 1E1FA 1SR0A 1TA3A 3OLEA 3WSUA 4AW7A 1WDRA 2JFEX 3IAQA 3EDDA 4RL3A 4D6CA 4LGXA 1GQLA 3WQ8A 3OGSA 1WAWA 3VTRA 3AZTA 1VFUA 5DT7A 1CGTA 3RJYA 1JF5A 1JZ6A 1DWHM 3SUSA 3BMVA 3L4WA 2QLYA 3QOMA 5E70A 4HU0A 4MJ4A 4J7RA 1NQ6A 4MDPA 3GH5A 1CXLA 5BRQA 3UR8A 3OZPA 4PRWA 3N1AA 1CLXA 1J0YA 4J3SA 1E0VA 1C92A 1EIBA 2XWDA 4Q22A 3VD5A 1ITCA 3BAYA 4CD5A 1LLOA 2ZWYA 2DQXA 1FHDA 1C90A 3WQWA 1ZL1A 1IZKA 1AVAA 8CGTA 4CGTA 3HN3A 2X1IA 2ZXDA 1R85A 1XSKA 4W5UA 1M01A 2XGBA 4GQRA 1BGAA 2DT0A 3VNZA 3ARPA 3AIVA 2VX5A 4TOQA 3ZOAA 2WANA 1JYVA 4U5KA 3TTOA 2D1ZA 1H4PA 3WNOA 4RE3A 7TAAA 5BXRA 4DWSC 5D4YA 3VX0A 1KFWA 5M03A 3A4XA 4HA3A 1PZ2A 3ZMRA
chains in the Genus database with same CATH superfamily
3CQKA 4KIEA 1JIBA 3UPMA 2QJJA 1W2VA 3K30A 4YL2A 2C0HA 3BJSA 1AG1O 1QOQA 2JF6A 4I9MA 2DPEA 4M6PA 1JZ7A 4Y8EA 3S5OA 2O9RA 3W88A 1PS9A 3M43A 3V36A 2GGEA 3PM6A 4AY7A 1C7TA 2IKIA 1UD4A 1V0NA 5E0CA 4EAYA 1IT7A 2VQTA 1E3XA 4E8CA 1A0DA 3T1GA 3AHZA 5DY2A 1AW1A 4TMBA 2Q3RA 5A6JA 1TMQA 3AMLA 1ESWA 2GGJA 3BICA 3MQTA 4CD7A 3N12A 4XKYA 4P8XA 1TWWA 4OBTA 1NP0A 3SCNA 5D2XA 1OYBA 2I56A 1MW0A 3ITYA 4S3GA 3UCCA 3A12A 2IUZA 2G0WA 1TJ0A 4MY1A 4HHPA 1CGWA 1Q6OA 1YE6A 4CU8A 1Y7VA 1IXPA 4PB4A 1EQPA 4IXXA 4UZSA 4H7ZA 4GE8A 2HCVA 7TIMA 4O0QA 1L0PA 1BRLB 1E0UA 2CBIA 3MCNA 1CEOA 3L4VA 1M7PA 1XLBA 3DBNA 3KBJA 1REQB 1ZJAA 4JFTA 3V0SA 3SCSA 4WKFA 1OFAA 4KETA 2ZIDA 1KBKA 5FI8A 3ITLA 1PXGA 2E6FA 3BDKA 3LUTA 3WF4A 3P2VA 2OO6A 3BAXA 3TSDA 2I17A 2VGIA 4R27A 3TJIA 4C6JA 2OLHA 1PKMA 4KWWA 1CECA 4I6VA 5FEXA 2X1UA 1ZBKA 3N73A 4B92A 1YIXA 4N9CA 4DN1A 3MB9A 5D09A 2INEA 3HQNA 1KGUA 4S1FA 5FF2A 5D8ZA 4JFVA 1WCGA 1GK8A 5TIMA 4GKTA 1TYGA 5JBDA 1AFSA 4GXPA 4GKLA 3K5XA 1MFVA 3WLPA 4XTIA 1XLHA 1SJAA 3M6YA 4NI3A 2FVKA 1TV2A 4HU4A 4I9TA 3VMPA 1ZB5A 3ANVA 4QXIA 4XUYA 4QJ1A 2ZZ3A 1OG6A 4JL2A 1EWDA 2VWSA 3KZSA 4J2MA 2GZXA 4D6JA 1T40A 1RBAA 5JH2A 3ABOA 4MZ1A 3VIIA 2J6VA 3UG3A 7PTDA 1FTXA 3UG8A 1LUCA 3L2MA 1J9YA 3B9AA 1M9HA 5IOBA 5D9OA 3FFSA 3N6JA 2QCDB 5JIPA 3R25A 1F3EA 2QQ6A 3QV6A 3C6CA 1P43A 2I5QA 3CB3A 4Q33A 1SW0A 2CFFA 3VNJA 3P3BA 1Q7QA 4B5XA 4TUFA 3TCEA 2TAAA 3ZZ1A 2WQDA 3PZVA 3FAWA 4R88A 1RV8A 2J8FA 3MS8A 1MQPA 5JXQA 1QNVA 1VC4A 4NZCA 5IFTA 1XRSA 2XVNA 3PZTA 4R33A 1OIFA 4WGXA 3VCRA 3NEHA 4HNVA 3SQLA 5DFAA 3THDA 4QCFA 3EKGA 3GR8A 2PA6A 2VX4A 4JY9A 2ZX6A 5LNSA 4GXWA 3TONA 2IKGA 4AY8A 2GUBA 4KCWA 1IIGA 2OWXA 2ISDA 2Q09A 4FA3A 1TTJA 2DW7A 1FWEC 3DUGA 1DE6A 2GJNA 4NL1A 3LX9A 3BLLA 3VABA 1XYCA 4L65A 2GL5A 3DKLA 4ZO7A 1OINA 5EY5A 3TCSA 4XZIA 6ENLA 1MWOA 1J4EA 3ZFHA 1TR1A 2W91A 4JTSA 3S6TA 1EPVA 1H0IA 1O6IA 1WV2A 3T42A 4D6FA 2FPVA 1H7PA 1E4LA 3F4CA 1JPKA 1GOQA 4S3KA 1AJ2A 4PUWA 1YPIA 2CITA 1PE1A 2X0SA 2EPKX 3LG3A 2V68A 3WUFA 3O8AA 5I24A 1L9WA 1B3OA 3NSNA 3UBPC 3KS6A 4C6CA 2V3DA 2FYMA 2VJXA 2OVLA 3UXKA 3J7HA 3R1ZA 5F2IA 4U3AA 1TTPA 3AXHA 5AHEA 4KRTA 5MKGA 1ECEA 4J27A 4I8DA 1OC7A 3ISIX 5D2WA 2AQWA 4FLSA 1F07A 1UKTA 2WMGA 3RMJA 1R38A 3W1PA 4ML4A 4JQ4A 1TMLA 3OA5A 4A3UA 3ZSTA 3GSMA 1PEZA 3CZGA 4AWEA 3SRFA 4DJFC 2YYTA 4PA8A 4WDWA 2YCJA 4KEMA 1W9BM 2WCGA 2QF8A 1DEDA 5EKYA 3TN3A 3QEZA 1RJQA 5E9AA 3SIZA 4BY3A 1EO7A 3U4AA 4AH7A 1NU5A 2G95A 4FXSA 4C5YA 2WPBA 4NJKA 1A5MC 2V3GA 4OE7A 4PTXA 5FAJA 3IGUA 1H7RA 4YMZA 5G1MA 4KRUA 4RV8A 4LF2A 1NOWA 2VFEA 1NDZA 3AS3A 3PZOA 3EMCA 2C15A 3P81A 2D0HA 3IRDA 1TPH1 4M6QA 2OQLA 4HNTA 2IKHA 3NOEA 4PRTA 1ZBWA 4S3DA 5GNZA 3RRXA 3WD4A 4ACZA 3TR2A 3LCIA 4GH1A 3G24A 4LV9A 3TQ0A 4H04A 3SJ3A 1G1YA 4NAFA 1EOMA 1XX1A 3W2UA 1M7JA 2PS2A 5I79A 2VR5A 1WKEA 3SCTA 4EX4A 1P1XA 1WZMA 2G37A 4PMZA 2YCLB 3VX1A 1HNYA 4JFWA 4RDWA 3H4WA 4YLWA 2PZ0A 4O28A 1H50A 3L67A 4I7WA 1US3A 3TYEA 3MBDA 3T4WA 5FSDC 4A3HA 1H11A 1UD5A 2A3AA 2P5NA 3EOSA 3LBOA 5A8OA 3GVGA 1Q6GA 1C91A 1FKWA 1YPFA 4IJCA 4TX9A 3WQCA 2Z2UA 1P0KA 1KWGA 3MC5A 1NTHA 3M7WA 3W26A 3I68A 1DWJM 1SZRA 1UP2A 1TUXA 3MA8A 3WQVA 3O2LA 1UC4A 3IGSA 4KWVA 3EAUA 3F1QA 2DVTA 4TV5A 1RY0A 2EPHA 5A8PA 5I3JA 4LYQA 3AS0A 4TTUA 1O66A 3O1NA 3THAA 5CSRA 2CBUA 4LWWA 1H09A 3DGRA 5HNNA 2CZEA 2UBPC 3PB0A 3QY8A 5I07A 1NWRA 4O12A 3SW6A 2D3LA 1J5TA 4MB1A 2PU0A 1VAHA 3ARYA 3N15A 1IEIA 3EKLA 3TAOA 1LQ2A 2WSRA 1AQMA 4F2UA 1EA9C 3K4WA 3LENA 4GBDA 4WDTA 3P5YA 4D72A 2VELA 3BLIA 3HV8A 4NRRA 3OLIA 1T8XA 1KGXA 4I9JA 1YDOA 4AYSA 3FIGA 4R53A 5A6BD 1NOFA 2GUYA 1AJ0A 4QR6A 3SUWA 1TWIA 1VFFA 4N02A 4LUSB 1KXQA 1MFUA 4Y7EA 4PUEA 2ALDA 5HATA 4BKNA 4OBRA 3AROA 4K8HA 3FAXA 2JK2A 1XF0A 5EBAA 4ENLA 3W7QA 4JTHA 4CNTA 2E0PA 5A95A 2H3BA 4JTIA 3WQEA 4G56A 1R47A 2VT0A 3II1A 3BV4A 4LAMA 5FA5A 4XUGA 3U0HA 5HR6A 4XZMX 2P53A 3PULA 4LCRA 3VO0A 4HK5A 4FLQA 1XXXA 4IX0A 4WR3A 1O60A 5A6KA 4HNNA 1PB0A 4PUKA 1QPRA 1Z9AA 2GGIA 4LEFA 4MZYA 2PDXA 2OYKA 1V3JA 3CS2A 3F2BA 1UROA 4AVNA 1SJDA 1R3SA 2QIIA 2A7PA 4J28A 4X9SA 1PKNA 1TQXA 1WKFA 3CUZA 3KTXA 5I3HA 3GZAA 3H22A 5I23A 4IOTA 2PI6A 1NOUA 1QWKA 2J7FA 1RA0A 5BMXA 1EFZA 3VIGA 4FI4A 3N2MA 4MKNA 4LEQA 4XTDA 4DWSB 3UYIA 3AMGA 4JFUA 3OG2A 2GOKA 1AODA 3VIJA 3UU0A 3W7JA 1X6LA 3UWUA 3RCYA 4XSLA 1J0JA 1DWIM 1TR9A 3G1YA 1G67A 1T7LA 1QHOA 1F3XA 1H60A 1E3ZA 1DQXA 2CZDA 4WIWA 1W1YA 3F5LA 1HJSA 3K2GA 1HL9A 1QI0A 2CETA 3ARSA 3S1UA 2V3EA 3RXZA 4GK8A 5A2AA 1F73A 2OMAA 2GQ9A 2JEPA 4M80A 3VGBA 1X7IA 4Y9OA 2XFWA 5CC6A 3FXYA 1GOIA 1JCJA 1OGSA 3BUVA 1WXZA 2X0HA 4DQWA 2H9AB 1I2PA 2FGLA 2V5JA 4MG4A 1U5JA 1E4NA 4GIAA 4JYEA 1S2AA 1UHVA 1V79A 1QFEA 5LHFA 3UPWA 5BYWA 1UZHA 3WL0A 1X1OA 3WH7A 4QGCA 3UJ2A 3W1QA 2JKAA 3C2EA 1ODZA 3H70A 1EP3A 4IFKB 4A22A 3LB0A 3NL6A 4JIPA 1CBGA 4I8YA 5AC6A 4F0MA 1PJ9A 1HVXA 4GQGA 4IFRA 3LDVA 1UR9A 4E4PA 3NQ8A 1GVSA 1HX0A 2J8TA 3SSJA 5E6ZA 4QTGA 4JTCA 3DKJA 4EACA 4ZQNA 2PGRA 3SUTA 3TROA 1KFLA 4EP8C 3WG6A 3EDFA 2YYUA 1F5ZA 4JXCA 5BU6A 4E8GA 4J2PA 3KTSA 1XYFA 4NZ3A 1KC7A 4ZA0A 5FEPA 4WY0B 4GJ1A 3A3WA 3AALA 1OX4B 3GTFA 4QDWA 1JDFA 4DBEA 2PDYA 5C2CA 4DELA 3MDUA 1HL8A 1JYXA 1QPNA 2NV2A 1FA2A 3AU2A 1BRLA 3HQ1A 4RW3A 2A79A 1DTNA 1REQA 1V0LA 3S47A 4AZIA 3WF3A 3BG5A 1XDLA 4Z08A 4FZIA 5I2UA 4IMGA 1P1MA 3U7BA 3WBYA 1NDVA 4EF9A 4UTWC 3VGEA 3ZT7A 3AXIA 3CUHA 1WDQA 1XM3A 4OOUA 4HYVA 5IBXC 1LZOA 3QY7A 2X1SA 5EU9A 3G2GA 1MO0A 1AL8A 1L6FA 3V75A 3WMLA 1DQWA 4DLFA 1NM9A 2YB1A 1FWIC 2VC6A 1OBAA 2I9UA 4S2BA 4E5TA 4AD0A 1OFBA 3KM8A 3PJTA 1TPFA 2Y8UA 5CGQA 3PZIA 4Q7IA 4C6IA 3PJXA 4ZR8A 1ITUA 4JL1A 1K02A 2W5FA 1E1CB 1VRDA 3O15A 4B9ZA 2EPOA 3LK6A 1I45A 2VFHA 1DJIA 3SN4A 3RAOA 3NGJA 1A49A 2ZZ5A 3FJLA 1YRRA 4JHOA 4K39A 4PEEA 4Z2GA 2XN0A 3TMQA 1A3XA 2BY0A 3MUAA 4UMAA 1M41A 4KFOA 1UB3A 4KESA 4AD5A 4CVWA 3H53A 1BHGA 4MWAB 4LYKA 4UFIA 3UZXA 3KOXA 5JU6A 1RLCL 3DXIA 1V6YA 1VBHA 2NX9A 3WNMA 3TC3A 3I4EA 2YPIA 1YXDA 4ZQOA 3RLHA 1JQXA 4IHCA 4UQBA 4TVDA 1S38A 1PKLA 1I8JA 4M56A 2P0OA 2NVCA 1F61A 3CGTA 3VKCA 5ENLA 2MNRA 3BO9A 2QCDA 2EAWA 2ZTJA 3K4DA 4P5UA 3O7UA 3KP1A 5EYWA 2F38A 1XIIA 1Q63A 4EANA 3VCNA 4GI9A 3W7DA 1C9WA 1PHWA 1DE5A 1F6PA 1RY8A 3L21A 4MWAE 3KBVA 4UZUA 4F0SA 4DO6A 3CYJA 4R34A 5GJMA 5CSYA 2YDAA 4CN4A 3CBWA 4RXFA 3W86A 1FWRA 4RE2A 3MKVA 1LP6A 5K2ZA 1K9EA 5EMLA 2BVTA 3LLFA 4AZ7A 4XAYA 3GDBA 3I6RA 1L8NA 5M1TA 3KVMA 2BOGX 5LA2A 3BCFA 4FK9A 1QUMA 1EBGA 1HJXA 3APTA 4MUPA 1KQZA 4IISA 1SZFA 2DIEA 2E6YA 1NWUA 1BVWA 4XAZA 1A5OC 2AGTA 3V5CA 4LNYA 4A3YA 1VFTA 2EPNA 2V5KA 3TLLA 1E9YB 4I5UA 1HP5A 3W7IA 3I3DA 1B9ZA 2VDHA 3U6WA 4ZEPA 1GOOA 2OKTA 3W1NA 3WJWA 2FTWA 2JF7A 3NOYA 5ECVA 4XO7A 3AS1A 3A4AA 2A7RA 4V28A 1R2SA 3GNRA 5EFFA 4PMYA 3UZZA 5LNUA 4M3PA 3AHTA 3B9EA 1GW1A 4GYFA 1JRCA 2WC3A 2IPJA 3LRKA 3S46A 4MGGA 1DTUA 4Q4MA 4R85A 1K4HA 2NWSA 1FWWA 3NZ1A 4O1BA 4IIDA 1NARA 3IJ9A 3G3MA 4G9PA 4WX2A 3EWDA 4W9TA 2OOGA 1SR9A 1KM1A 2WB5A 4V1XA 1QW9A 3VNMA 5HOSA 3U2ZA 4X0NA 3AIWA 1G7UA 4Q4OA 1WA3A 3QTGA 9CGTA 1EDGA 3HGOA 4C6QA 1GJWA 4XZWA 5EL1A 1X6UA 4U2ZA 4FNQA 2QDHA 2FHBA 1EF3A 3QN3A 2D2OA 3YPIA 3CHCA 2WCAA 4JNMA 4PMJA 3BLKA 3HGRA 4Z42C 5DRIA 5EMUA 1HG3A 3ZM8A 2BDQA 4UQ9A 1KLYA 1OFQA 3CPRA 4L4LA 3VZYA 3GVRA 3SQSA 3OVPA 5FCZA 3PSVA 4WKHA 2NQLA 2V8ZA 3FJNA 3UESA 3MKCA 1T8QA 4KEVA 2X41A 2WYSA 3DENA 1CI1A 3NDZA 1XW8A 1TO3A 4DZAA 4QM1A 3HQPA 4G2DA 2JIEA 5C54A 2WC7A 2DT2A 1LT7A 1L2UA 4GUHA 1AL7A 2J78A 3OIXA 5AC4A 3NA8A 2YCLA 3VNYA 3KL5A 4GMEA 3ABZA 2C16A 3CXOA 3VM5A 4DWSD 3LCLA 1XIFA 1UQYA 3UJFA 3EXRA 2ZZ1A 4HMDA 1YTDA 1R3QA 5G2WA 1FWSA 1XISA 4A6GA 3DHPA 3W1LA 1LQAA 3BE7A 1F6KA 2BTMA 7XIMA 1JZ8A 3MW7A 4Q8MA 2NT0A 3IRSA 3MY9A 3ITGA 1V77A 3UG5A 4IIBA 4YTTA 1SJCA 3Q37A 2I57A 2WMJA 2A5HA 1ISVA 1N8WA 3DERA 1SGJA 4ZGYA 2NVAA 2BG5A 4PB3A 1TPEA 3L5AA 4HPNA 3POHA 3W1RA 5K3VA 4BI6A 4DAIA 1QWGA 2QGYA 1S2CA 1XDJA 5HXMA 1MZHA 3LNMA 4UQAA 1MQQA 5FF4A 1L8PA 4E38A 3PK7A 2DZWA 3AICA 2YA1A 2VDGA 2DIJA 3BURA 4F79A 2WHLA 1W3TA 3WBAA 5G1YA 3W7CA 1E55A 1WYIA 4YCPA 3FOKA 2EGZA 1JYNA 1JNEA 4AD4A 3VGGA 1FBAA 2J6XA 3UGRA 1D8CA 1VCVA 2GFTA 3ZJ6A 1H1ZA 5K4ZA 3ARTA 1DXIA 4JZ5A 4DXVA 3CB8A 4IFOA 4C91A 1GHRA 1AD4A 3T9PA 4EAMA 4LUSA 5BXPA 2CLPA 3EMQA 2CIPA 3GXTA 2NVDA 2PE4A 6ALDA 2P50A 3MPGA 3CAWA 3VE9A 3W7RA 4EPDC 3RR1A 2VNCA 2XM2A 4YCOA 4GNKB 2XHYA 3AIRA 4ZO9A 3O07A 3ATYA 4Z1AA 3SAZA 2BXVA 4H9ZA 4DJEA 1ZJIA 1TQJA 3AWOA 3T0BA 3VFLA 4BWLA 3UD6A 2O7QA 3H12A 3SCUA 1GYLA 4IIEA 3SQMA 4Z2IA 4HPXA 4DM2A 1GG0A 4OBSA 4IMCA 3EX6A 2PC8A 4CVUA 1M04A 1AQ0A 1C8YA 2E8YA 4TO8A 4U2YA 3DN5A 4GCXA 4ZBCA 2WBKA 2ICSA 1CXFA 3EPNA 5DN1A 3UZJA 2GWGA 4C6BA 2VVNA 3BLFA 4LTSA 4F4RA 4LVFA 1ZY9A 1CGVA 3TH6A 2DFAA 3PG8A 4BZYA 2PWVA 1PX3A 3IIXA 1IWBA 2MANA 1R9ZA 4JKMA 3DG7A 1QVBA 4LC8A 3M16A 2ZC1A 2D23A 5HMFA 1LL4A 3W22A 1XFCA 3L4YA 1BLIA 4C65A 3GY1A 4NZ5A 3PS7A 3T0CA 1XV8A 4WSKA 3TC7A 3GTHA 4HZ6A 5EMJA 2YCEA 3DIPA 1M53A 1B5TA 1KKOA 4NP7A 1R5YA 4GFSA 4S3EA 2WW5A 3F7JA 5TF0A 4GINA 2WVTA 4PODA 4MZ8A 4O16A 3HGSA 1D7FA 1LQ0A 2D2GA 3LM3A 3STEA 2C18A 4LVGA 3I7SA 5F4WA 3QV7A 4XAPA 3MYPA 1UPPA 3GXPA 3W0KA 4DEFA 2B7OA 1JUEA 3UA4A 4CNOA 2PSNA 4TXEA 3TZFA 3S8HA 4LSBA 5EB8A 2WQPA 3KEHA 4YTQA 4UTUA 4ROQA 5C2XA 5JVLA 3MO7A 1WOAA 5BNKA 3SCPA 4B2DD 2E28A 3S9IA 1LBFA 1HT6A 4D2JA 5FF0A 3LM7A 3E1F1 3MBFA 1XHGA 3LN3A 3NR0A 3QFEA 4W93A 4WGHA 1XPYA 2H9AA 5E0FA 4PFHA 4ZOEA 3QYSA 5DX7A 3PPFA 2WNZA 4PBEA 2PEVA 4ZFCA 1DJXA 5HA7A 1ZS2A 4ZB5A 3SIMA 5D9NA 2FFCA 2H90A 1QASA 3I7RA 4CQDA 4ZXOA 2FPYA 3TIMA 1ZUAX 3UVIA 1NELA 4Z2KA 4O0ZA 3DFYA 1GVEA 3P61A 4IFKA 3FY1A 5EA9A 1PUDA 4JX4A 4JY8A 5FL1A 2GJXB 4YVPA 5LGZA 3UJEA 3JU2A 4LYPA 9RUBA 3BJFA 5C71A 2GVYA 4PUDA 4O8AA 4GPNA 3WJYA 3SB0A 3H26A 2G3JA 4FF7A 3I6TA 2W79A 4LC6A 2F6KA 4UFHA 1R3RA 1SFTA 4UTMA 3TOPA 2JGYA 3SUVA 3WDJA 5I77A 2UY3A 3GNOA 4Q7BA 3PBVA 4HOXA 1JI1A 1SO3A 3Q4DA 3VK5A 2EKGA 1J0KA 3KWXA 2PBOA 3FDGA 5D02A 2ZX9A 1E5NA 3W87A 2PDFA 1OK4A 3VOGA 1UWAA 3ALFA 4WY0A 3WMBA 1IWPA 1O1HA 3E0FA 1QI5A 1OX4A 2WCSA 4GVFA 4I5RA 4RKAA 4YVXA 4ZB0A 1V51A 2Z26A 4HSNA 4YU1A 4RLIA 3INPA 1QHZA 4YWSA 3VIKA 3PZNA 4C6OA 3TWBA 1VIZA 1GQNA 4Q6JA 4M1RA 3A4JA 4DI8A 3U3HA 2Z1XA 3QSTA 1E9LA 2ZADA 4IP5A 5D9MA 4UCGA 4L9YA 3U57A 4C5ZA 1K4GA 4D1JA 1ITXA 1L6WA 5FJUA 1W31A 2HEJA 3DDMA 2PWEA 4OWGA 3QZEA 4PB5A 3PUDA 3VPLA 2ACSA 3TJLA 3WMCA 3W75A 1ADDA 4UCFA 2FZ8A 3SO7A 1O4UA 3IWPA 2UV8G 4L4OA 4N6FA 1X1ZA 3WLLA 3NVDA 1LBLA 2WJZA 1LJYA 4IH3A 1HO4A 3ZR5A 4V1YA 4L4PA 2O4QA 4MNLA 2HVNA 3PWIA 1V3IA 5IXEA 2FMNA 4V33A 3TYZA 4IQDA 5TAOA 4GI8A 3WLQA 3LHVA 1UOZA 1E1CA 3P67A 1JD9A 3VKKA 1T99A 4DM1A 4DUXA 2FZBA 5D2VA 3FEMA 2WVUA 4ZQPA 3PFRA 5AVHA 1CPUA 3CK5A 2FDMA 2GK1B 2YA0A 4J1OA 1A80A 3TXZA 1EBHA 4O54A 1NVMA 4RZ4A 3OLEA 3WSUA 2JFEX 3QW3A 3URNA 5XIAA 3L7RA 1XIBA 3EX3A 1IQ8A 1GQLA 4FO4A 4LCQA 5CAKA 1NF7A 1DWHM 4ZVJA 3Q45A 3GH5A 5BRQA 1K8CA 3B0PA 4KBXA 2R1LA 3NGFA 3OZPA 3N1AA 2PGFA 5CBBA 4J3SA 4GJIA 4Q22A 1VBJA 3EPOA 4CD5A 3NPWA 1TWDA 1FHDA 4GLEA 3QV8A 3EX1A 3VFCA 3JW7A 4AWUA 3GG1A 2PFHA 4X2RA 3QM3A 4I7UA 5CKSA 4J9JA 3NG3A 2VX5A 3D0CA 3C0LA 3M1ZA 1H7NA 4DWSC 3BPWA 1KFWA 3M0YA 5F1VA 1JEZA 1GOKA 5H2ZA 1UUMA 3L0NA 3W1UA 1VCFA 4UTHA 1OFEA 1DJYA 2NQHA 3A9BA 4KWUA 3QGVA 1A5CA 1H5VA 2ZRVA 3VIFA 2E6DA 1EA0A 4OV9A 5M5DA 3UWZA 1V08A 3CAVA 3G18A 5HDRA 2HRWA 4HT3A 1GHSA 4C6NA 1OGGA 3MUCA 3LPFA 2EG6A 2PCEA 4CNSA 3RGTA 1DJGA 3TN6A 4ZQCA 4OKDA 4CCEA 3TZNA 2A3BA 4Z2JA 4GJJA 4WCJA 3Q65A 1YNYA 1BAGA 1R87A 2FIQA 2Q71A 4DAFA 3UWQA 4B4HA 4FNPA 2R82A 4HNUA 3F2CA 2HTMA 1WAUA 4NJJA 3WYZA 3F4VA 5E5CA 4LQ1A 4UTTC 2YBTA 1SMDA 4B5VA 2B0MA 1QK0A 5A8MA 1UKOA 1BSLA 2A2IA 5G4EA 1NAL1 3KRUA 4BQ2A 3LXBA 2WOQA 4OU1A 3EWXA 1X96A 2RJHA 3QPYA 3ICJA 2GJLA 3K13A 4YS1A 2G3NA 4Q4QA 3F4NA 3KBNA 4IMDA 3E0WA 4LY4A 1ME8A 3UJRA 2JE8A 3PBGA 2J62A 3OODA 2A3EA 3UNTA 3E49A 4JIQA 1IEVA 2MUCA 1TKKA 3EB3A 3V35A 1G6CA 5A69A 2KAUC 3QMTA 4Q4SA 4MOZA 5A1AA 4X61A 1WE5A 3S6OA 5K9CA 1RJRA 1M7XA 3GUGA 4J35A 3GDMA 4OECA 2IKJA 3WJSA 1I1WA 1O5KA 3PN8A 3OTRA 3QOKA 4A8NA 2Z1WA 2B81A 3NQ6A 1VJSA 2E9BA 3AIEA 1N2VA 2VEGA 3QRHA 3BARA 1SO4A 5G1TA 3TTEA 2POTA 4DJDC 2I5GA 4R3UA 4WRHA 1FDJA 2CKRA 1A5AA 2G3MA 5B7ZA 1EH9A 5LNWA 1ZJBA 5AFDA 1V5XA 1UD6A 3R12A 1KM5A 3LCFA 2OT0A 3IARA 1JD7A 2DZBA 4GY7A 5JBEA 1ICQA 1UWTA 4ZO6A 3DGBA 3EBVA 3CUXA 3L66A 4LNCA 1AH4A 3VDHA 2YL8A 3QHMA 3EB4A 1H49A 4GUIA 3GTXA 3DBPA 3S2CA 2VR2A 3BTNA 1IT0A 2VCBA 1I0DA 2XIOA 4JEJA 2VI0A 4W85A 1JCXA 4JTTA 2RFGA 3IACA 2J75A 2WAGA 4LPCA 1WO2A 1ZALA 3LPGA 6REQB 4PMDA 4AC1X 4GA8A 1S5WA 4L61A 4ONVA 2IXUA 3L0KA 2EG8A 1QW7A 5TD4A 4M82A 3KLKA 4KWOA 1JPDX 4LS0A 1B9BA 3NSXA 5AHMA 3W7EA 3BGGA 2W67A 3N2TA 5I00A 4GC4A 1RBLA 3SGGA 4AAJA 3H4XA 4NAEB 3VM7A 2W0UA 4LVDA 5CQ1A 3H8AA 9XIMA 2GJRA 4KFPA 4MWAC 1BVNP 1EEPA 4MY8A 4YJ5A 2OYLA 2O56A 2BXZA 3GG0A 4D6HA 2VFIA 3WD1A 4Z1CA 3BLEA 3GU1A 2B4GA 4AZ5A 5D2YA 2G50A 3CZEA 1XBXA 4WUIA 5KZ6A 2BLEA 2DV0A 2RHGA 3TSMA 4Q6XA 4UQEA 3TX9A 1F9CA 3IUIA 4PCFA 4ZOBA 3W2JA 2A6LA 4ZSUA 2VQUA 3GHUA 1RLDA 2FZNA 1H3GA 2NV1A 3PPHA 3W76A 4GWEA 1X39A 1V03A 4BEQA 1V6VA 3B8IA 3BH4A 4JD4A 5CZ0A 2Y24A 1IEXA 3F4WA 1EX1A 4AHQA 4ASTA 2BB0A 3N4EA 1QNRA 3W1XA 2QV5A 2GPTA 3EEGA 3OVRA 2Y5SA 3AIUA 3N04A 2RDTA 3NAVA 2Y88A 1WNOA 2J77A 1ME9A 1Z32X 1DJWA 4MNKA 1US0A 5HBFA 2NUXA 3S1XA 2AL2B 3SM0A 5DXXA 4P2VA 5AYIA 4S23A 3QPZA 1ISZA 1XIGA 4JTEA 4B3LA 5I3FA 4Q8NA 2E67A 2WM1A 4IPIA 3PZGA 2E68A 5D37A 3EXTA 2ZRWA 1E1EA 4HA0A 1XP3A 3ZO9A 2VHLA 1EHNA 4QEHA 4EK7A 1XS2A 1YKWA 4AEFA 1CT5A 3PPCA 5BOFA 3B8WA 4WKAA 1LL7A 1H1YA 3ZJKA 2WWCA 1Q7ZA 2C3ZA 1IEWA 1LRQA 3BMWA 3D6NA 2E5DA 1EIXA 1M3UA 4BHYA 3LZ5A 1DWAM 3NQAA 4REQB 3P8IA 1O94A 1XLCA 1Q6CA 5I78A 2FGBA 3HV9A 2WHKA 3P0XA 4PEKA 4L6OA 1SJBA 1DBTA 2Z28A 1ISYA 4QLKA 2BP1A 1UH2A 3HB9A 3W1TA 3CT7A 3BGJA 4F0LA 4WJXA 1XLKA 1XG3A 3VC6A 3B97A 1ZBVA 3TC6A 1IZCA 5K4XA 3CPGA 1MQRA 3SFKA 5AZ1A 2VOTA 2NZLA 4H8VA 4CU7A 1ADOA 1TPDA 1UZDA 3VOIA 1D8WA 4PFMA 2NX1A 1W1A1 3FXGA 2J7HA 3QGKC 1K9DA 3N2XA 5IHRA 4XSMA 2LLEA 3C2FA 3OQ8A 3NXLA 4A21A 4XBKA 3LHWA 2KX9A 1U1UA 1PTAA 1DP0A 3THQA 1KM3A 3LMZA 1Z69A 2Y7EA 4PCSA 1EEXA 4Q4RA 5J5RA 2V5LA 1K8XA 2WKLA 4ZZ9A 3JZEA 1PX4A 4XKYB 3RDKA 4H6QA 3T44A 5CLTA 5C0QA 1HVQA 1SQ7A 3GHRA 4MFEA 2VENA 3MWCA 1V3KA 5CJNA 3ID7A 1VD6A 3GHTA 4UTFA 1PAMA 5FJTA 1BVZA 1XLDA 3G0UA 4GGBA 3ZIZA 3H7UA 3GH4A 4WEVX 4FXFA 2I9EA 5ABHA 1MXSA 3W2MA 2QCNA 1E6RA 3TOYA 1E6ZA 1UG6A 1A0EA 3GU9A 3EOUA 1PBGA 4LW7A 2D2JA 4BFAA 4DYEA 5PTDA 3LPPA 5CLWA 1IE7C 4GZEA 1HJWA 2BODX 5FKYA 3CPUA 4FPSA 3RPTA 3IJDA 5A2BA 1IR2A 2CLMA 1JZ4A 3LQLA 4GY0A 3QY6A 2ZRUA 2PLMA 3OG3A 3TWAA 4YYCA 2WK2A 4UR7A 2PMQA 4BF9A 2Y7DA 4Y8FA 2ZZ4A 4QAWA 3EOLA 3WDHA 3VDCA 5FEZA 5M17A 4F9DA 3AS2A 1CGYA 5K7JA 4FS9A 4UWMA 1YNPA 5KZEA 2QCEA 2Z29A 1DJQA 1NJJA 3N2BA 1THFD 5KEZA 1XG4A 3LTPA 1EYEA 1OD0A 1E6PA 4Z0SA 3THCA 2ZZ2A 5A8QA 1P6BA 2QJHA 1UR0A 2DP3A 2XJ7A 3NO5A 4AMAA 4UNKA 2IXVA 2DZAA 3S1WA 1E70M 1EJSC 3AIBA 2P3EA 1ADSA 1EKOA 1YQ2A 2ZKMX 3W53A 3PF3A 2ZFAA 6XIMA 3TSBA 3SN0A 2CKSA 2AL1A 3O06A 2PDIA 4AZGA 4XIMA 3OGRA 3SDOA 3H2AA 4GNJA 3WLRA 3QR0A 4HZ7A 1OC5A 4Q32A 1R9XA 1VYPX 2B7PA 4Z1YA 4AFYA 3DFHA 4L1WA 4QJ3B 1YLVA 2B31A 2GK1A 4L6DA 1T5AA 4M19A 3OIHA 4XISA 4BJHA 5F4XA 3L5MA 4KCVA 3R5EA 3GR4A 3ZSSA 2XGIA 4FEZA 5I03A 1FWJC 1B90A 1EX5A 3M5VA 5A8GA 3GZ3A 4H1ZA 5AYXA 1MZRA 4H2CA 4AC7C 2J27A 1BF6A 2DH2A 5I5RA 3CMGA 4W88A 3WEOA 2HPMA 1QXLA 3PZ9A 4BQ5A 3VKBA 4E2OA 4O53A 4K7YA 4LB3A 2DSVA 2VMFA 3BG3A 1NQKA 4IQLA 4CNNA 4B3KA 3KE0A 1GZJA 1VPXA 3GRIA 1OQFA 2YXOA 1W5QA 1U33A 4AEEA 4QQUA 2CHOA 1V02E 2R1NA 4HJWA 4XBSA 3HQOA 1OWQA 4QROA 1ODUA 3PAJA 3VOJA 1K6AA 5JUVA 5HJYA 2YLAA 2OLSA 3LOTA 3WLTA 2VFDA 4D8AA 4ZMGA 2A85A 3S9ZA 5LA1A 2UZ9A 3AIQA 3H6OA 3OP2A 1F4HA 2GLKA 4TX8A 1X1NA 2PB1A 4FF5A 1UZ4A 1BD0A 3P6LA 4JTQA 4NJHA 1O95A 1X6NA 2GWNA 2Y5JA 2Z2BA 4IICA 3SADA 2GGGA 4AQLA 2IQTA 1KTCA 1OC6A 1P0BA 2R91A 1XSIA 4XD3A 1IHIA 3IJ8A 3KRZA 1ZU8A 2ACQA 1E40A 2WNNA 1YXYA 3A22A 2CHNA 3VIHA 2PLJA 2QZRA 2BHZA 2Z6IA 3DFPA 3R0KA 3WD3A 2ONEA 3T08A 1C8QA 1W91A 3SY8A 1B1YA 2PWGA 3K4AA 4C6MA 1Z41A 1FXPA 3KOZA 4H3DA 2PLCA 2O9PA 4F0HA 1LROA 3LV5A 3WBEA 1EWEA 1V7AA 4DY1A 4PCPA 4PTNA 5H8PA 1XQLA 3CWOX 3GU2A 4B5UA 1AMYA 2VD8A 3G6LA 1TE6A 1VGAA 3TU9A 5CSUA 4H8NA 3I10A 4Q4PA 1CDGA 2W27A 2HXUA 1L6YA 4GUJA 1S2UA 1SSGA 4Y6GA 4NQ1A 2XM1A 5LIXX 3WUBA 1B3YA 2HVMA 4IX2A 3QBUA 1RCQA 2E09A 1I2RA 3OVQA 3LSBA 3OPSA 1FWHC 3SUUA 4WDUA 2PPGA 1F76A 2WNWA 3AZSA 1I60A 4H6EA 2E40A 1DIEA 3W84A 4H9TA 3MP5A 2QEZA 3NCOA 4NXKA 3KZPA 1OFOA 1QNPA 3GX9A 2GVGA 3RN6A 3MUXA 3R8GA 4LUIA 2CNCA 1PYMA 2J25A 1UD8A 1H5YA 2PDGA 2X8RA 2NXGA 2X7VA 1XIHA 3IV3A 4X22A 4HN4A 2OYMA 4GD0A 3T2OA 2WZEA 2XIMA 3E5PA 2ACRA 3N14A 1J10A 3RF9A 4V15A 4NU7A 1D7KA 1DIKA 4HNCA 4R5EA 2VX7A 5DANA 3LY0A 4NNAA 3K8MA 4NYYA 3WEZA 3AWNA 1G9HA 4MY9A 4OOZA 1E6SM 1BFNA 2CXGA 3P5ZA 2QXWA 3NQBA 5D03A 3CL6A 2G8ZA 4DZHA 1RK6A 1VFMA 2VM8A 3T81A 2WMFA 3GR7A 3RYSA 3ZVHB 2YFOA 2GSHA 3ZXWA 2FHFA 4JTRA 1XC4A 4HMCA 4LYRA 3OJGA 1HKJA 2B7NA 4O18A 4US5A 3TVAA 4M24A 4ZB2A 1XRTA 5EMYA 2VEKA 3VD3A 2G3FA 2AMXA 6REQA 3RMEA 2OU4A 2X09A 5FOOA 3M5ZA 4W7VA 1J18A 2Q3OA 1U83A 3URBA 1J6OA 2XUCA 1JNDA 3HTWA 3R13A 4QG8A 1TUFA 3VDBA 2C91A 4QHRA 1F74A 4E4FA 5JIWA 1W1IE 4PSRA 1W3IA 1OEPA 4NAEA 1P4CA 1LWJA 3B40A 3UVAA 1GKRA 2W63A 4J5NA 3S5YA 4TQTA 3W37A 3BQ6A 4JCMA 3VKDA 4MYXA 1HJUA 3MCMA 3C56A 3CV1A 1JCNA 1RA5A 1A50A 2VZUA 5HQMA 4YNGA 3VMNA 2YDSA 2Z1SA 4IUGA 2OOFA 3FS2A 4BF7A 4PMRA 1F3TA 4IZGA 2YKKA 2V5DA 2WM0A 1XIJA 3VGDA 1A0CA 2E1DA 2PD5A 2AMGA 3OBAA 1TFVA 4GHRA 1KFBA 1KFJA 4RK8A 4MYAA 2XINA 1I2QA 1UPMB 3PHAA 3CUJA 1SMAA 1ZP4A 5G2HA 1BKHA 1Y5VA 2EPMX 4P7RA 2WSQA 3BOFA 4A8RA 3WMSA 4KERA 4XB3A 2YZRA 2BMBA 5B80A 5AB3A 2ESCA 2J88A 4LCSA 1UIOA 2JGQA 4GYPA 2WNQA 1J6PA 1PL9A 4RUBA 2IMRA 2AL2A 4L4MA 1W8SA 3ORWA 3WK0A 2ZDRA 1QOPA 3VZZA 1V8EA 4B5WA 3G0XA 2WJEA 3TFCA 4JX5A 1IZJA 1R3TA 4RNIA 3C2OA 2PGEA 3UWWA 1UJPA 1HGWA 3COTA 3WX7A 3AXKA 2WHMA 2Y6ZA 2PDMA 4H9MA 4JYDA 3BZGA 3PVFA 5HQLA 3I4KA 3NTYA 3IVTA 3K1GA 3EWZA 1UBPC 3T2QA 4JTGA 3KBWA 1J93A 3NIYA 1FDYA 1H61A 2R1PA 1J5SA 4REQA 4B5SA 4O14A 2YGYA 1AZ1A 1M5WA 4W8BA 3C2RA 3W2NA 5HNTA 1HIZA 3OBEA 3ARZA 1Q8JA 3NPXA 4QFUA 2VUNA 2VUYA 3NQMA 4H83A 1JAKA 1JL8A 1QNQA 4Z17A 2RDXA 1IYXA 4QG6A 2QPSA 1S46A 1BSIA 4AX7A 4GIRA 1VJIA 5C7VA 2J4GA 3W73A 3GKFA 3UR5A 1C29A 4GQ0A 3BAJA 2VC5A 1W2PA 3NL2A 1FCVA 3EWUA 5EFDA 1Q85A 3DAQA 3MUZ1 3NSMA 1F6YA 3M47A 3STCA 4S38A 3N19B 3W24A 3NQCA 1NDYA 3C3NA 2OEKA 3O6YX 3W7MA 1VYSX 1KM0A 4QEEA 1XKJA 2Y85A 2ZDSA 3NXFA 1W1TA 1CENA 2PLKA 1ONEA 2VC7A 4JN7A 2Y7GA 3MJMA 4DUVA 1JFXA 4BCEA 5D30A 1EHAA 4K68A 1O68A 2DW6A 2OT1A 3GC5A 1F3WA 2AGKA 1VHCA 2ZE0A 1R7OA 3RLGA 1EOKA 4JX6A 2W9MA 5C8BB 2QJMA 4JIHA 1JRBA 3K1DA 4A3QA 3MHUA 4ROPA 2Y8KA 1ONWA 1MEHA 3MANA 3U2CA 3PNUA 5HANA 1Q45A 5BW6A 5D05A 1E9ZB 2A3LA 4RDYA 4POCA 4A3RA 2X16A 3GIPA 4D6GA 3UA3A 3NQ7A 5FEWA 2OZ8A 2ZUWA 1FWTA 4HHHA 1S2VA 3HPFA 1EF2A 2G97A 4GYKA 4FHAA 4HBKA 3VI2A 3OGVA 2QPXA 3O16A 1E73M 3QQ1A 3DECA 2XWEA 4ORMA 1RALA 3FSUA 3FV9A 3D5HA 1J0IA 1XQKA 3GXDA 1VHNA 1WQ5A 4EKJA 1OFPA 5DMLA 3LGGA 3WD2A 1TPWA 4HZ8A 3HG4A 1C8XA 2P0IA 3ZQ9A 4HIBA 2BHUA 1HJQA 3KHJA 1S5MA 4QX4A 1NFPA 1O5XA 5KETA 2R24A 2DZPA 4QLLA 4BQ3A 1LCOA 1K9FA 4O17A 1E9IA 4N6EA 2BY2A 3IJ7A 4XZNX 1TWSA 4X63A 1AW2A 4HCLA 4RJEA 2H8XA 4NVTA 3OBKA 4CQ9A 2XFRA 5TNVA 1CX9A 4FLRA 1Z7AA 4K2SA 3CWHA 4HKPA 4UFJA 1EGVA 4RV3A 1OCJA 4LAZA 3CZ8A 2PWUA 4IMAA 4WY0F 1POKA 3C4UA 1CLVA 3QYQA 3XINA 4E6MA 4R9OA 3T05A 3MO4A 3GB6A 2O4MA 4JTUA 1Z8AA 2Z27A 1UWUA 1NEYA 5IRPA 4WQ6A 1G4TA 2ANUA 1WXYA 1XKYA 4QE5A 5J04A 1JXJA 1ZBCA 2XYLA 4ATDA 1UWQA 4QNWA 3FLUA 4HNLA 3TJ4A 3H21A 4I7VA 1W56A 3R79A 3KWSA 3CZLA 5A2CA 5CBIA 4HA1A 4MB5A 3KP0A 4Z1BA 4NX0A 3TN5A 3D3FA 3FN9A 3EWYA 3A4WA 3LSCA 1V02A 2VEIA 5BXSA 1RAKA 1RBOB 3E12A 4TV6A 2VC9A 4M7TA 2HSAA 4UQCA 5ABFB 4DO7A 3VDGA 4MDOA 2OEMA 4GX8A 4ICNA 4E4UA 5E6YA 4E2BA 1H7WA 3HFTA 1W5PA 1YADA 4Q8OA 1KBJA 4JICA 4TMCA 4DI9A 2IS7A 1V6WA 3IJLA 2DQWA 3L9CA 4O0KA 5DBTA 4DYJA 1K7EA 1QOXA 3E38A 2VGGA 2HXTA 2P8BA 4UFKA 1TJRA 5AYBA 5CJ5A 3E9AA 5H1WA 1RQEA 2JKPA 1M1BA 1XI3A 2QJNA 3ONCA 4YN5A 1N8FA 4KH2A 2ZVRA 3W3OA 2FFIA 2ADAA 4PBFA 4AXNA 5DY3A 4GRSA 3URAA 1MUWA 1F7BA 2V2DA 2PURA 4E3VA 3VIOA 1OYAA 2GVJA 1F2JA 3GVWA 3FVDA 3EB2A 1C8VA 2X2YA 1K9TA 3ZJ7A 5E09A 3IGHX 2Z6JA 1BG9A 4CN1A 1GKQA 1S39A 5I09A 4Z1DA 1XLEA 1VKFA 4EF8A 1XLFA 4UTIA 3E2RA 4LFYA 5A3HA 1W9PA 1W54A 4UQDA 4F0RA 4CCZA 4LRTA 5CXPA 5CC7A 1W9VA 1JZ2A 4LBUA 5HR7A 1HKIA 2PDBA 3PBMA 1DIOA 3QKZA 5HJXA 3WLNA 1W1ZA 4A2RA 5ABTA 3KVJA 3GFXA 2Y0FA 3DU0A 5AHNA 2DT1A 1Z42A 2H3DA 3HZ3A 4O4WA 2ODOA 3GXIA 3Q94A 1JG9A 4GVGA 4AIOA 4O1DA 1UP0A 4OT7A 5HMDA 1JR1A 4PBGA 3VDAA 3O6AA 1GORA 1SFJA 3A3HA 3IVSA 3P62A 3VA8A 3M0VA 1U22A 5DCEA 4EVZA 2IPWA 4QQ3A 1LTDA 2C0AA 1WDDA 3DI1A 3BV7A 1HL2A 4U28A 3RNDA 1KRMA 1J8VA 2E77A 4HOWA 5CH9A 4Z2LA 3PG9A 2RH9A 3S5SA 1RQBA 4CCDA 1MSSA 1BYAA 1BG4A 2L5HA 2YDRA 3UR7A 4AY1A 2I14A 2AAAA 2OSWA 3BCDA 4JTLA 1W9XA 1AW5A 2DUZA 4ZENA 1SVDA 3S5NA 5A94A 5LNVA 1DIDA 3B8DA 4O15A 4X3ZA 2OPJA 1KO0A 4H8HA 4OIFA 4C6FA 1NWTA 1XBVA 1ZFJA 3CAKA 2QAPA 3ZYZA 3FK4A 1KBBA 1T0OA 5IDIA 3B0VC 4B91A 3L4TA 3GYCA 3H24A 3EX2A 4FSAA 2VZVA 1XGEA 3MSDA 4ADUA 3GO2A 2TMDA 4FB7A 3EDJA 5BRBA 3N6HA 3H2MA 2NSOA 1E4IA 3KTCA 1GZGA 2ZRZA 1AH3A 3WUGA 3A21A 3N25A 3SCWA 1AZ2A 1WDSA 2EJAA 1W0MA 1A5NC 2OO0A 3TMLA 1H51A 2Q02A 3GNPA 3PSWA 3FHAA 3USZA 3CU2A 1TPVA 3PZUA 4NZ4A 1YDNA 2R14A 3FKKA 3MI3A 1MDLA 3ZVHA 5LIKX 4XZLX 5CC5A 4IGHA 4ZODA 4G6CA 1XLJA 5GJPA 1WAWA 2XH7A 3RCMA 5DT7A 4RZ6A 1TZ9A 2QYGA 4FOJA 4LUJA 2QLYA 3QOMA 1LLWA 3W1MA 4MJ4A 3B8VA 4MDPA 1CXLA 3NQFA 4KW2A 5DXYA 3P80A 1E0VA 4DBWA 1XBYA 2XWDA 4J4KA 1ITCA 3BAYA 4YTUA 2ZWYA 3FA5A 4DF0A 4RE0A 3WQFA 3LBCA 2X42A 3HN3A 2ZXDA 4X2PA 3N9RA 2VXNA 1X98A 3BZJA 2DT0A 3AIVA 3ZOAA 1JYVA 3TTOA 4ICCX 4RE3A 1OYCA 4PUUA 5BXRA 1BXCA 4IQEA 2P76A 4IXHA 3WBWA 5LSMA 3VX0A 1S5TA 4EXAA 1XJBA 3RRAA 4G1KA 3W70A 4IL0A 2YR1A 1PZ2A 1T96A 2RJGA 3EX4A 4D9PA 1JCTA 3TV8A 1UWIA 1H2JA 2PTDA 3KCLA 5AHLA 4JDBA 3T7VA 3TQVA 1US2A 4AX6A 2ZWZA 1HJVA 3AAMA 2V38A 3R94A 1PYFA 4H41A 4FNTA 3ITCA 2Y8VA 3B4UA 5IFPA 1SPQA 1JCYA 2O9OA 4FOUA 1LG2A 3MTWA 3CTTA 3M0ZA 5AYYA 1QK2A 1I6NA 3V5OA 4XZ9A 1SSDA 3RPMA 4JS3A 4HPHA 1JXKA 3GD6A 1TTQA 3L2IA 1ICSA 3UJSA 1DQUA 5HMSA 3WLHA 2BVWA 4M8UA 4Q8PA 4RNJA 4IGMA 4W8LA 1FXQA 3UXLA 4JEQA 4L1GA 1VRXA 2I7GA 3HJZA 3VC5A 3P0WA 4RCXA 1RVGA 1OHLA 4G5DA 2FHCA 4JFSA 2XIBA 2ZQ0A 1DXEA 3CHEA 3MYOA 1K7XA 4QCEA 1TZZA 1KRAC 3CV6A 4AUBA 3FGCB 3T0TA 3NYZA 2D3NA 4RDVA 4PTVA 4DYKA 2GSEA 3WQ4A 2PUZA 1HKVA 1V0KA 3S5ZA 2ZYFA 3KS5A 3A13A 1VH7A 1TCMA 1WZAA 4C7DA 2Q8ZA 3M0JA 2QVNA 1E51A 4RPPA 3E2SA 2DVXA 5BZAA 2WMHA 1P7TB 4CQ8A 3WBXA 4K1GA 3LXAA 4CU6A 3UG4A 2ALRA 1I2OA 1J11A 1KFCA 3F5JA 4JIEA 4GQBA 1RK5A 4U5IA 2Z1VA 2Z00A 2ZA2A 1B3VA 4ACYA 2WC4A 2ON3A 4NZFA 3RO6A 2CXEA 3S42A 3CIVA 3FDKA 2YW3A 2Y4SA 3PANA 4RNFA 4PZVA 1XDMA 4S3BA 1K7FA 1TV3A 3U8GA 3PAOA 2QPUA 3STGA 4WOZA 1ONRA 4Y9NA 3C8FA 4Q8UA 4AG0A 1H0GA 4PUJA 1W32A 1EDTA 3UT0A 2JALA 1ME7A 3KX6A 3GE7A 5GQBA 1FY6A 4UR8A 5IHSA 3HGJA 3KRSA 1HFBA 1NFBA 5K9DA 4N4PA 3TDFA 3IIPA 4QJ4B 1EJRC 4DZ5A 4AZHA 4MKSA 3ZLHA 1R0MA 4GI4A 3AYSA 2Q01A 1X7FA 3E6EA 4N42A 3TTQA 2CLEA 4AD3A 3V0UA 3U4FA 1QAPA 1GQJA 1VEMA 3L5LA 3DCPA 1ZTVA 3UY8A 1JDEA 3UNDA 4S39A 4ZFMA 3WEMA 5JBFA 2WXDM 1BYBA 1B54A 3LZ3A 4NKCA 3VKJA 3LI0A 4H9XA 1R30A 3GW0A 1Q2SA 1LOLA 3KRBA 1W1VA 4IF2A 3MWAA 1MUCA 2VOMA 1FUYA 4KGJA 4C1KA 4XZBA 3VNLA 3QVQA 4MIMA 1BPLB 2QGHA 2V82A 4AXKA 3OLDA 3WFAA 3BWWA 3T40A 2QJIA 3TP4A 4JR5A 4N9EA 2D2HA 1EP1A 2WKGA 2BY3A 3B0YA 3FX4A 1PX8A 4MMWA 2XIIA 3EZ4A 2XVPA 4LVBA 2XFYA 1JGIA 5BU9A 1I9CB 3H2NA 2PWHA 3LTSA 2V2HA 2G5WA 3NO1A 3QTPA 4MM1A 2BHYA 4P7OA 4N2YA 5BMWA 3SEPA 1PVNA 1PTDA 1W3JA 4GG9A 4CD4A 3EWWA 2QMKA 4AF0B 2OJPA 1B2YA 3P7YA 2J7CA 4TX6A 3LI1A 3MV01 3QPEA 5SWUA 3ES7A 1AA1B 1NF0A 3AISA 3W7NA 1Y0EA 5GNXA 1S3TC 4HGXA 4AZ6A 1EUNA 1KKRA 1AMKA 3F4DA 3UR2A 3HG2A 1JQVA 4UBPC 3MSRA 5AC8A 3RPDA 3VMOA 3K8KA 3FJ6A 4H00A 1J12A 5CPOA 4KT2A 2ZICA 1PDYA 2NQZA 2O92A 4LRSA 5J8LA 4CCCA 1W5OA 1SW7A 2SFPA 3EYPA 2D73A 1KR0A 1H41A 2DZSA 1CXHA 3M64A 5CJMA 2NLYA 3D47A 1SZNA 3A5FA 1MI3A 4AYGA 1TCDA 1ZAHA 2FMOA 4U4MA 3O05A 5CSSA 4LS1A 3B9OA 2DIKA 4K8EA 4JQ2A 5BXTA 1QT1A 1DVJA 2G4JA 3MHFA 3EOOA 1OB0A 5A6LA 4BS0A 3W25A 8XIMA 3DZ1A 2DSWA 1QU4A 1H63A 3DEQA 3IAPA 3ZR6A 3UZ5A 3PFMA 5M2FX 5ABFA 3PNZA 2TSYA 1YYAA 3W81A 1R86A 3POCA 4MAVA 1A53A 1KTBA 2FVMA 4YHGA 3CUIA 3FA3A 3UCDA 3AHYA 4M51A 2C1HA 1SW3A 4J3VA 1S2WA 2V6AA 3S2NA 1KA9F 3SRKA 5JQ9A 1BTCA 2EJ1A 1A47A 1XWYA 4CD6A 3S0CA 4O4VA 1FWNA 3CZKA 3SCQA 2C19A 3EDKA 4H6RA 4P61A 3PUGA 3P14A 3N3TA 4ILSA 3U48A 3WK1A 2QJGA 3IIZA 3BXWA 1UH4A 4BQ4A 3TR9A 4UNIA 2Z7KA 4OV4A 4JTAA 3CM4A 3KCJA 1KB3A 3KUMA 3GXNA 3R0DA 2C6QA 3GXFA 1VQTA 1HXJA 1T41A 3ZJ8A 1YEYA 3ELFA 3EDEA 1EGZA 3VIMA 3NL5A 3QFWA 4LB4A 4UC5A 5XINA 3ARQA 3CMJA 3E0IA 3G1AA 1P0EA 4JGDA 1XUUA 4K36A 3NQEA 1LWIA 4W7UA 1LRTA 4YWIA 1JF6A 3D3AA 1K03A 2YDQA 1GJUA 3N9SA 2PP3A 5AKQA 3MDWA 3LD5A 1EO5A 1FFQA 4DF1A 4NILA 3WDPP 4JIIX 2HS8A 2NUYA 2HBXA 5F1UA 4UMCA 1F8IA 3BANA 4QP0A 3B05A 1P0DA 4IGNA 2TYSA 1M6JA 4LUYA 1BEUA 4AZCB 1J01A 3FJ4A 1QPQA 3FYYA 3CJPA 1SU5A 1A5BA 4FNSA 4DJED 3UFYA 3BAIA 4OHQA 3W38A 1HQTA 3CT2A 3L68A 1WUFA 1W8GA 4IWWA 3W28A 4MHBA 3EWBX 1ZCOA 3GBDA 5AN7A 1HTIA 3WQ5A 3WNKA 5G4WA 5T8GA 2TRSA 1PZ1A 5CPLA 1E0TA 1QI2A 4RNHA 3B9NA 5CGMA 3SI9A 3T8QA 2INFA 2J7BA 4V27A 3WELA 1UYQA 2CZFA 1G94A 1R3WA 3L2LA 1KCXA 4DJFA 4MFDA 3B8UA 1W17A 3L4XA 1OY0A 3DHFA 3KOFA 1DORA 2F6XA 2HE8A 3WNLA 4WSHA 1EJUC 3CAQA 2QV4A 3SECA 3S2MA 5HAOA 2FZ9A 1J2BA 2A3HA 1SO6A 2YZ5A 5EMKA 3QHOA 3NFUA 3WDIA 2O9TA 3AHXA 1A3WA 4NF7A 1FX6A 2V30A 4NNCA 4DRSA 2VR4A 4IL2A 2VZSA 2TPSA 2RKXA 3EA2A 5GPRA 3NM3A 4DZIA 3G77A 1G7VA 2R1MA 1TSIA 3NL3A 4NT0A 3EWCA 4R7JA 3DFQA 2QHAA 4HP5A 4P8VA 1IXQA 4B3ZA 2G3IA 1Q6RA 3BOXA 2DVUA 2EG7A 3N4FA 3NEVA 5FACA 1RD5A 4GIEA 4HZMA 1RPXA 3LGEA 3SZ8A 5H6HA 2F6UA 1E6XM 3FNDA 5I06A 3W7HA 4O10A 1E43A 3VYLA 3WUEA 2FB2A 1GJPA 3HBLA 1HO1A 4BEUA 1GKPA 4QG9A 4DPPA 4EPEC 1L2QA 1GONA 1LYXA 4M81A 4MVAA 3IJIA 5HPOA 4O1AA 3WLMA 1J0ZA 3OYZA 3V1HA 1UR1A 3C0JA 1QBBA 3T2PA 4HMNA 4PMNA 4HSHA 2P1FA 1EXPA 2EPLX 3LPOA 4FX8A 3L65A 3MUY1 4PC8A 3S83A 4OGZA 4BI7A 4WZHA 1MW3A 4F8XA 1VFOA 3JVAA 3ITVA 4ZE4A 3ARRA 2VP8A 1LM1A 1W5NA 2EHHA 1SZEA 2W61A 3HPSA 3MVIA 2Y61A 3W2LA 1JUBA 1TJPA 2UWFA 3UETA 1QRQA 2V2CA 2DH3A 3G1DA 3IPWA 1E6QM 3U7VA 4ATLA 3CH9A 4ZSTA 5TQLA 1IGSA 4KEUA 1GT8A 1FH7A 4NRSA 2UY5A 2P8CA 2QMJA 4P8UA 1Q6QA 2J66A 1FQ0A 1GPWA 2WJFA 1TTIA 3E2QA 1H1NA 3DOPA 5I3IA 3BGAA 1HP4A 4HCDA 4Y96A 5I3GA 3DX5A 2NX3A 2PDHA 2WVVA 4HMEA 4PH6A 4DJDD 1ISWA 4QSHA 4C6DA 3QGAC 1VCGA 3VILA 2WMKA 2WHJA 1UMLA 5DBUA 4XWUA 4NUWA 3LTYA 3ZS4A 2ZE3A 3H2EA 1SFLA 4C90A 1OFRA 5G4HC 1LF1A 3D46A 2XDFA 3W7KA 4GO8A 1RR2A 4HJFA 4HCHA 3LERA 4GGHA 3LHUA 4O11A 2CU0A 3V16A 1OSEA 1BYDA 1MNSA 2RDUA 3FGCA 1ZSXA 3WF0A 2ZUNA 1W3LA 1X97A 2PDQA 1YDVA 3E0LA 2HK1A 3I6EA 4L1XA 2YW4A 3UERA 4KGLA 3WENA 4G7EB 5FD0A 6CGTA 1E0WA 2VRKA 2ZC8A 1WB0A 4BA0A 1B4KA 2HVOA 2XH2A 5F2GA 2D20A 1LOSA 1EZ2A 3BAWA 4C60A 4YTRA 4JNYA 2J24A 1WDPA 3L4UA 2C14A 1PZ0A 1SZGA 2A0NA 2OXNA 1P7TA 2WVSA 3IK4A 3AOFA 5BWAA 3KL3A 1AQHA 4MWAD 3M7SA 3KHDA 3E74A 1CLKA 1CXKA 1FCQA 1XC6A 4QDPA 3MT1A 3TLQA 4Q3MA 5LIUX 1VPQA 4ADSA 1I4NA 1RP8A 4WLCA 4RE4A 3V0TA 4UFLA 1R7AA 3B9DA 3O6CA 3UWYA 1FHVA 4O1FA 1CXIA 3FSTA 1RCOB 2RGMA 3GVVA 3WQDA 5FJIA 1JPHA 3A64A 4B15A 3AQUA 1GQKA 1UA7A 2VGBA 2OQYA 2XN2A 4JQ3A 3MZ2A 1I0BA 5FJPA 2C7FA 3AYTA 2XH4A 4Q8QA 3P74A 4S3AA 3LEPA 3WLKX 3RM4A 2Z1BA 1PO9A 3ABSA 3GS6A 1TX2A 4OJYA 5CAHA 3CC1A 4HHMA 1VLIA 4WF7A 5B7YA 2DORA 4GX9A 2XPKA 4DB7A 4X0VA 2PTWA 1K3UA 4ICMA 4RDZA 2PDJA 3F2DA 4HQVA