3U57A

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
502
structure length
471
Chain Sequence
NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
total genus 180
structure length 471
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u57A00
5I79A 4EANA 3CZ8A 3VDBA 1UKPA 1XSJA 2QV4A 4AD3A 3WNNA 4QCEA 1JZ7A 2VVNA 1E70M 1NARA 3WENA 3BSGA 4XV0A 3QR3A 3B8SA 3WDQA 4CN4A 5A8QA 4H8VA 3A47A 3N1AA 4BA0A 3B9EA 4HA3A 4WK9A 5CLTA 4AC1X 1FFRA 1RP9A 2X0HA 3WEZA 1B9ZA 4E4PA 1U30A 1A47A 1LL4A 4DWSA 3TP4A 4M24A 5A6AA 3MMUA 2YBUA 3ARXA 1VAHA 1FP9A 1VEPA 1QVBA 2YDQA 1CDGA 4MNKA 4L4OA 2WC3A 1XGZA 3WQ5A 4WJXA 3THDA 2BVTA 3L4XA 9CGTA 1JIBA 5FKYA 1UWRA 2BFGA 2OSXA 2VZOA 3KL5A 3TTQA 3VKKA 2EO7A 4U5IA 3MUY1 3UEQA 1FA2A 1B3XA 1OT2A 3GBDA 5A8MA 3CZKA 5LYRA 2JF6A 1GNXA 2GJXB 2EPKX 4RL3A 2CKSA 1EH9A 5TD4A 1UHVA 3KZSA 1XCWA 1OGBA 2ZOXA 1I1XA 2PBGA 1G01A 1NWUA 5CG0A 2CESA 3E1F1 1GVYA 4PSRA 4ZFMA 1MWOA 4F79A 3BXWA 4W7UA 2DH2A 5EFFA 1KCLA 3OLEA 3WSUA 1VFUA 1AVAA 3EDDA 1Q6FA 3FAWA 1CGXA 1IZKA 5AC5A 1HT6A 1K9DA 1YHTA 1OT1A 5HBFA 4AWEA 1UKOA 1MVYA 4C7FA 3ZT6A 2ZUNA 4U31A 2VR5A 4GQRA 1LG2A 1JGIA 3CH9A 3SCUA 3IAPA 1C8YA 3PZ9A 2YKKA 4WKAA 1W32A 2EPMX 3RILA 2OYLA 5I23A 4AIOA 1EDTA 1LWHA 1WZLA 2X0YA 1HP4A 4EE9A 2WYSA 2XWEA 4M81A 5A6BA 1UWQA 4JIEA 1QI0A 2XM2A 2XG9A 3VGDA 1GORA 3ARQA 3VX0A 3AHYA 1WP6A 3QOKA 4GI9A 1JZ8A 1CXIA 4TVCA 5CLWA 1ESWA 4MAZA 1OSEA 3WD0A 2IXVA 2W4XA 4YN5A 5DO8A 3KL0A 2FDMA 3WUFA 2BXYA 3FW6A 2YA2A 2XGIA 4MNLA 1UUQA 3BAIA 1PPIA 1L8NA 2J7EA 5CPSA 4GO8A 2XVPA 3AMCA 1BSIA 3KL3A 2WWCA 3TTOA 2UY2A 5BRQA 1HVXA 1QHZA 2W5FA 4PYSA 1E0VA 1LQ0A 2CBVA 3I3DA 3W53A 4AZIA 1JNDA 2G4FA 1N82A 4H8UA 3NSMA 1JZ6A 5CGTA 2D3LA 3SCPA 5KEZA 1Y7VA 3BLKA 4P7NA 2XWDA 2Z1SA 4MB4A 1LG1A 2YOCA 4CD7A 2XIIA 1GOMA 4DWSC 4F66A 2AOSA 3WKZA 3I3BA 1GJWA 1GHSA 3MU7A 4MAVA 4DUWA 3WNMA 1ITXA 1JDCA 4AEFA 1QPKA 3T2OA 3RIKA 4JKMA 2E9MA 2G3NA 2VQTA 5JIPA 4D71A 2WMHA 1MW2A 2AAAA 3OG2A 3QHOA 4R27A 5A6KA 5A6LA 5AC4A 2GSJA 3VU2A 3OIHA 1UD4A 4D6JA 2W91A 3CZEA 4AD1A 4JZ5A 1QW8A 3CMJA 1OINA 1TE1A 5ABFA 1HL8A 4UNIA 4UQCA 5D9NA 3AHXA 3K4AA 4GPNA 3WH9A 4LYQA 2BHYA 2ZXAA 4B3LA 3WDPP 2XJ7A 4PRWA 2VRQA 1W9DM 3EDJA 3S2CA 3LPFA 4CN6A 2GJPA 3ARZA 3N18A 4WIWA 4D6EA 4HPHA 5A95A 1J10A 1GCYA 3ZSTA 2C8NA 4DWSB 1JL8A 4PMYA 4UTFA 2CYGA 4AZHA 2WAGA 1UKSA 2PWDA 1JD7A 8CGTA 2NT0A 1BYAA 1TUXA 1UWTA 1UR9A 3MV01 3PZQA 4WLCA 3GDBA 3BLPX 3ZO9A 3VPLA 3CO4A 2XVLA 1EIBA 5DF0A 1EQCA 3VGGA 4PMNA 4P8WA 5BXRA 2W62A 1X6LA 3AIVA 2VRKA 3A4AA 3L4YA 3VINA 3EBVA 3W0KA 3WMCA 1TR1A 1BTCA 4FMVA 4PTMA 4GZJA 1ISWA 3MSGA 1XCXA 1EA9C 1UZ1A 4OOZA 1V0MA 2XYLA 3RCNA 1GQKA 4QFUA 3F5JA 1GOOA 4HTYA 1MW1A 1A3HA 1CGTA 1ISVA 1MXGA 2FHBA 1VENA 3K4DA 1BHGA 3VD5A 4V27A 3WNLA 1D7FA 4XX6A 1FHLA 1G9HA 2PWEA 4HA4A 4KGLA 5C8BB 4D72A 1AQHA 2X2YA 3FHAA 2VX7A 6TAAA 4AZBA 5A69A 2V38A 1QOXA 4P8XA 4MB3A 1GQLA 4TVUA 4ATDA 1UZ4A 2OWCA 2VZSA 3O6AA 3VMPA 4PMVA 4TTGA 2Y5EA 5M3WA 3LPOA 1MFUA 1UG6A 2EBNA 3W4RA 3QHMA 3BAXA 1FFQA 1I75A 2TAAA 2J79A 2DPEA 4NF7A 1GQIA 1DWGM 5A8PA 4OOUA 4HZ8A 2YL6A 1ZBWA 4ZEPA 2IUZA 2VO5A 3SCNA 1UWUA 3AXHA 3PZIA 4QP0A 3T2QA 5HPCA 3BSHA 2WWDA 2VTFA 2ZUSA 4Z2HA 1V3KA 5IHSA 4CU7A 4NSBA 3EMCA 2FHFA 4UFJA 5I3DA 1SMAA 2ESCA 4IPNB 4QAWA 5GNYA 1UR0A 3MMDA 2VI0A 2VCAA 4W86A 2RGLA 1C8XA 1E6XM 2J7CA 2JEPA 1W2PA 1JFXA 1NP0A 5ABEA 3AIQA 2VUYA 1OGGA 2CERA 1XV8A 2W67A 1UA7A 2MANA 1QI5A 2D23A 1C3FA 2BHUA 1PBGA 2VCCA 1UD3A 3RO8A 2D3NA 2EPOA 3PN8A 3PZOA 4CVUA 4AW7A 2G41A 1C8QA 4LYRA 1ZU8A 5M17A 3AQUA 2YBTA 1UA3A 3O2LA 2QHAA 3A6OA 4URIA 4B16A 4JCMA 1HJSA 4A3YA 2YLAA 1OGSA 4CCEA 2BS9A 2G3IA 2VX6A 1E0WA 2EJ1A 4MTVA 2ZX8A 5F7UA 3M7SA 2XFFA 4QLJA 1FP8A 4A4AA 4EAMA 1ISXA 2J7BA 2VT0A 4UFKA 5A6BD 2OYMA 4PMOA 4AISA 4FLSA 1LJYA 1CIUA 2HISA 3GTNA 2J7HA 1JDAA 1HF6A 2WVTA 2X09A 3DHUA 3L4UA 4CUCA 1RH9A 4C7DA 3BMWA 4HOWA 2WHKA 3CLWA 3VIGA 3WL1A 4OKDA 3WH7A 3MUIA 5A94A 2J8FA 5KZ6A 1E6NA 1J12A 1EHAA 3AS0A 3K8KA 1UQZA 4GKLA 5GQBA 3WEOA 4AMCA 5AY7A 1E3ZA 4CU6A 1CXEA 4AIUA 1E40A 1E72M 3AIBA 2EQDA 3M46A 3WDJA 3LMYA 4DUXA 1GQJA 5DEZA 4M56A 3SCRA 2CPUA 1OWQA 1HN1A 1J0IA 2NW0A 2CIPA 3W29A 3ZJKA 4W87A 2JF7A 2YA0A 5CPQA 4Q7NA 1BG4A 5HOSA 2Y8VA 4B15A 3G6MA 3VILA 3M6DA 4BZYA 3HJEA 1UH3A 3CUFA 5IXEA 4XZWA 1CBGA 1G94A 3W24A 1UD6A 2BY1A 2WXDM 1XSIA 2BY0A 4OBRA 1W3JA 4QLLA 2YJQA 3VGBA 4QDMA 4E2OA 4FF5A 4J3WA 2WHJA 2VZTA 1FH9A 5HPOA 1IZJA 4QLKA 1V3JA 2YA1A 2QMKA 3POCA 5HNNA 4RE3A 4W7VA 1ZJAA 4YPJA 1W1PA 1H4PA 2DT3A 4KH2A 3L4WA 4M29A 2XTKA 3F5KA 4YHGA 3VIMA 3T0DA 1R7OA 1PX4A 5C71A 2QF8A 4PMUA 4ZXOA 5E6ZA 1TG7A 3VIOA 1FH7A 4UZSA 4P7QA 4EKJA 1D3CA 3WN6A 1FHDA 1MW3A 3NDYA 1WNOA 2UY4A 2DH3A 3GH7A 2CNCA 1Q6CA 1NQ6A 2OSYA 1SYTA 2ZX6A 5CSUA 1TA3A 2WLZA 4JHOA 2WLYA 4HU0A 3RM8A 1TZ7A 3CUIA 3WL0A 2XM1A 3AJ7A 1D2KA 3GXMA 1V03A 3L2MA 4L4PA 3VMOA 2FGLA 3T08A 4CCDA 1OBAA 2D0GA 4GO9A 3AZTA 1EO7A 5I2UA 1HIZA 1MXDA 3PTMA 3ZSSA 2Q8XA 3VDHA 1BPLB 1V3LA 4D1IA 1CGUA 1HX0A 1UYQA 1MYRA 2RGMA 4W84A 4PSPA 2A3HA 1R8LA 2WHLA 1W1TA 3DYPA 1WKYA 1WDSA 3AXIA 3MANA 2WZEA 3BAYA 5DT5A 5A1AA 4DM1A 1CXKA 4JHZA 1NOUA 2D0FA 2XVGA 3CUJA 2Y8KA 5A2AA 2C7FA 1JFHA 2PWGA 3KEHA 1W2VA 5I5RA 1CLXA 4Q22A 4E8DA 1W1YA 2V3EA 2WMKA 3GNRA 1DWJM 2W92A 2VC9A 1AQMA 2WZIA 3GNPA 4OUEA 4PUDA 3AHVA 3U5UA 2VVSA 1BVZA 3VNYA 1E1FA 4MADA 3TTYA 1X6NA 1RP8A 3A4XA 4H04A 1VF8A 1KGUA 4JCLA 3CZLA 5A8NA 1JYXA 1Q6EA 4UFMA 4BS0A 3AROA 2E40A 4HMCA 1VIWA 3CIVA 4N0RA 3WMSA 3ZT7A 4LPCA 2WBGA 3PHAA 1V6XA 4Y7EA 1M7XA 5BCAA 1W9PA 1CTNA 3TTSA 1J0HA 1GHRA 1VBUA 4IUGA 4XB3A 2BV9A 3WDHA 4TUFA 2ZX7A 3W38A 4NRRA 4NI3A 3RMEA 1HJXA 4PTXA 1O7AA 2D22A 1H2JA 4CCCA 2WC7A 4W5UA 1V0KA 1B2YA 1E4LA 1CECA 3VOCA 2XVKA 1L0PA 1E1EA 2DT0A 4ACZA 4NRSA 4PBGA 4V2XA 3AS3A 1UH2A 4BQ5A 2XSBA 5BRPA 5FL0A 1E43A 1V6VA 4JFSA 2ZUMA 3FNDA 2BY2A 2IXUA 4IISA 1E4MM 3OB8A 2CETA 3TA9A 4AD4A 1LWJA 4W85A 1J0ZA 2OLHA 5ECUA 1ZS2A 1WZMA 3POHA 3UERA 2E0PA 1XSKA 4CGTA 3ZIZA 3WH8A 4TX6A 1JZ5A 4W93A 5ABGA 2WSPA 1NWSA 2VJXA 2PB1A 1C92A 2O9TA 1DWHM 1R87A 1VEMA 2PI6A 5D9OA 5A3HA 5CXPA 1KBBA 4AD5A 3VDAA 1CWYA 4AZCA 2DDXA 4B9ZA 3AMKA 3MUAA 1GOIA 4M8UA 2VL4A 1KXVA 4GIAA 1OIMA 3NSXA 3IJ8A 4H41A 1V3IA 3WEMA 4R5EA 4W8BA 1H3GA 5C70A 5IFPA 3WNOA 1VEOA 1IT0A 4M80A 3VIKA 2CXGA 3A4WA 4WKHA 4UQEA 2BVYA 1EGZA 1QI2A 2CBUA 2ZUWA 2X05A 3MV11 1BAGA 3GH4A 2VR4A 4GQQA 1H0GA 4FK9A 1B0IA 3N04A 1UQYA 3BGAA 1GW1A 2BY3A 3T0BA 1JAEA 3WD2A 1TA3B 2J8GA 1VRXA 1B90A 3MMWA 1HP5A 1QNSA 1EOKA 1HKIA 3AI0A 3ARWA 2FH8A 2DIJA 2O92A 3MO4A 4UOJA 3J7HA 2WHMA 4Z2LA 2DSWA 2YIHA 4FLQA 5FL1A 1CLVA 3BAJA 4LXFA 1H41A 1UOKA 1W3KA 3BAWA 4NZCA 2PC8A 1B3VA 3AHZA 3GXIA 3BCFA 1BYDA 2ZXDA 3WH5A 8A3HA 1GOWA 4D6GA 3W6MA 2E8ZA 1QBAA 4PMZA 3PTKA 2ZICA 3SCSA 1FOBA 3WDIA 3IJ9A 2F8QA 4JAWA 1GJUA 2AMGA 1E4IA 3AMGA 1KQZA 3WBAA 3VIHA 1MQPA 4UQBA 1JNEA 3PBGA 3RJXA 3CZGA 5EMYA 3WF4A 1VB9A 1B30A 2ZXBA 3BH4A 5A2CA 4HOXA 2E8YA 4U2ZA 3ZT5A 5E6YA 1G1YA 2D0HA 1J0JA 3WBEA 3WF3A 2BNJA 2W61A 4B9YA 4ATWA 4CKQA 4CD8A 4CU8A 2Y24A 1QHOA 2WBKA 3ARUA 2J74A 5CQ1A 1JF6A 1EQPA 1ZB5A 2ZE0A 3S6TA 1P6WA 4OBSA 3CHCA 3NIYA 4J27A 3ARSA 4XUYA 2OYKA 1KB3A 4AZ5A 4AEEA 1CGWA 2QPSA 2WANA 1XRVA 1UH4A 1O6IA 3RM4A 3WQ8A 1E6PA 2O9OA 1RD6A 3WQVA 1W9XA 2PWHA 3VM5A 4D1JA 3N12A 5GNZA 1E6QM 3OGRA 4X0NA 4ACZB 3DYMA 1J11A 1KQYA 1VFOA 5A2BA 2CBJA 1K9TA 2J25A 4HA1A 4UCFA 1UR1A 2DT1A 1KGWA 1QBBA 1PJ9A 3N11A 1OD8A 2DEPA 1BFNA 4WSJA 3AS1A 1BGAA 5JUVA 1CXLA 2GUYA 5M5DA 4UQAA 1EXPA 3UG3A 2CITA 3ZOAA 3DC0A 2Z1KA 3UR7A 3VDCA 2HVMA 4P8VA 1PEZA 5FCZA 6A3HA 1HJVA 3HU7A 2DSUA 1H0IA 3GM8A 4OJYA 2J47A 1K9FA 2DSZA 4UQ9A 1MW0A 3SUUA 1WB0A 4AZCB 4M1RA 5DFAA 4ATLA 4GINA 3NCOA 1M04A 2YDSA 1IV8A 3HN3A 5JBFA 1V6UA 4JFVA 4C7GA 3SCWA 1QNPA 1MQQA 3FN9A 3SUVA 1W1VA 5ABFB 2G3JA 1PX3A 4U3CA 3DHPA 4KGJA 3WNPA 3II1A 1V3HA 5E09A 5BYWA 2CBIA 3CBWA 2VZVA 1DWFM 2JEQA 4CN1A 2OWXA 1NOFA 1G0CA 3UCQA 5D9MA 1AMYA 3VIFA 3ZR5A 1VBRA 1TMQA 4HOZA 4ZE4A 1UD2A 3I3EA 4PMDA 2V5DA 4TOQA 5BXSA 1JYWA 2QLYA 3WDRA 3K8LA 3B9DA 5A6MA 1KXQA 1QHPA 2CCRA 2WM0A 2ZWYA 2FH6A 4J3UA 2OSWA 3AZSA 1DHKA 3WF0A 3VMNA 1S46A 3OZOA 4EK7A 1E55A 2DT2A 4J3TA 3T0AA 3NUKA 5IHRA 4PTVA 2ZUTA 3CMGA 1PZ3A 4W8LA 3NJ3A 1EO5A 1XC6A 5DT7A 2VRJA 3OA5A 1H1NA 1HJQA 4D6IA 2WMFA 4HZ7A 1UR8A 1KBKA 2O9PA 3ARRA 3ECQA 1ZBVA 3CHDA 1H49A 2WC4A 5E0CA 3CHEA 4UQDA 4MB5A 1U2YA 1E73M 1KR0A 3LPGA 1CYGA 1PX8A 3IANA 1ODUA 4B3KA 2J62A 1CEOA 1GONA 1VJSA 2XIBA 2XPKA 3OBAA 4LX4A 1TFVA 2YL5A 1E6ZA 4KRUA 4D6CA 3F4VA 1J18A 1BLIA 4GXPA 1YQ2A 2QPUA 1NWTA 5D4YA 3WFLA 4AXNA 4PMQA 3VD4A 4WF7A 2UWFA 2Y2WA 4BQ4A 5I24A 3AXXA 3T2PA 5D8ZA 1X1NA 3KWXA 4W89A 1WE5A 3ALFA 3PZUA 2UY5A 3CUHA 2YLLA 3U7BA 2X1IA 3N9KA 3ZJ7A 1UR4A 3FXYA 1WDQA 2O9RA 1UR2A 4HMEA 1ITCA 3WUGA 3VGHA 4GI8A 1H5VA 1GUVA 4JL2A 4J3XA 5AYBA 3SCOA 2D2OA 4OZOA 1BYCA 3EYPA 3GNOA 3OLDA 5EFDA 2XUCA 1J0YA 1KXHA 1XD1A 4GI6A 1JZ2A 1OD0A 3W27A 3AHTA 4PMRA 1WAWA 3O9NA 1W9UA 4H8HA 3T09A 4PCTA 4RE2A 5I77A 4PN2A 3VIIA 3B9AA 1ZBKA 2FGZA 1EHNA 5IDIA 2DSVA 1V0LA 1SR0A 3VD3A 1QI4A 3MUZ1 1QNRA 5A6JA 1J01A 3EMQA 3EMZA 2V5CA 5IFTA 3EDKA 4UR9A 2EPNA 1QNQA 4P7RA 2JFEX 1KWGA 3AIEA 4U5KA 5BWFA 1R7AA 4FLRA 5E70A 2ZXQA 4ML4A 2WMIA 3SUSA 3SCVA 3CHFA 1XD0A 2PWFA 3IAQA 2ZX5A 4N42A 3NDZA 1E6SM 2C0HA 5I6SA 1VFMA 4A3HA 1Z32X 1E4NA 3GXDA 2YDRA 3ZJ8A 1C90A 2V3DA 4UOZA 1CENA 1SFSA 3RPMA 1H11A 4JFWA 3VD9A 1FH8A 2J4GA 2WK2A 3IK2A 3WMBA 1M03A 2VQUA 3MKKA 4OIFA 1TVPA 1ISZA 2A3EA 1XH0A 5JBEA 3VVGA 4HZ6A 4ACYA 2WZHA 2F61A 4LYPA 4AY1A 2WKLA 3DECA 1W9BM 4JFTA 4ZXLA 3WNKA 3BCDA 5A8OA 5CJ5A 4MNJA 2GK1A 2EPLX 3CPUA 5CZKA 4MPKA 3TOPA 1ZJBA 5I0DA 1OM0A 2GDVA 1JZ4A 4BCEA 2E3ZA 4F9DA 2YL9A 3UETA 4J3VA 3D5HA 4UFIA 5CGMA 1WDPA 5LA1A 5GNXA 3SCQA 3NSNA 5A6SA 3OLGA 3OZPA 3PZMA 1W9VA 2ZWZA 4U33A 2D24A 2WCSA 5EBAA 3N15A 2VZUA 3AISA 3VO0A 1OCQA 4UZUA 4RE4A 1Q6DA 4W7WA 4W8AA 4D6FA 3W81A 2ZIDA 1GOKA 1F4HA 1LL6A 7TAAA 1PZ2A 2WSKA 4CD4A 3APGA 3FAXA 4AIEA 2JIWA 1KCKA 2B31A 5AYIA 2WVUA 2F2HA 1W91A 1DP0A 1JXKA 2E9LA 2FHCA 2OWWA 4X0VA 3N13A 2DSKA 1E0XA 4J28A 4X9YA 3BC9A 1JZ3A 3AMDA 1E3XA 1UKTA 2J77A 1JYVA 2CKRA 1E15A 3AFBA 2WVVA 3WELA 1E6RA 2ZUUA 1K9EA 2WMGA 1ECEA 3GBEA 2G8ZA 4MJ2A 3ZM8A 2VURA 4Z2GA 1G5AA 3L4TA 1C91A 4AZGA 1I1WA 3AIRA 1JXJA 4Z2IA 3CGTA 4ZE5A 1TVNA 1UD5A 3AZRA 2WCGA 1LF1A 1OIFA 3ZJ6A 3EDEA 1UKQA 3MSDA 3VX1A 4CD6A 3RM9A 1E71M 4W5ZA 4S3JA 3AMLA 4PCSA 4WKFA 3WQ6A 3VTRA 4P8UA 3RDKA 1HJUA 3PZTA 3AOFA 2CEQA 2XFRA 4QCFA 4TXEA 4KRTA 2XHYA 2A3AA 5D9PA 3A3HA 3WF2A 1K6AA 4MJ4A 5E0FA 4KWUA 4MB1A 3U5YA 3K8MA 3UR8A 1V08A 2YL8A 3AIUA 3VNZA 3AYSA 2PBOA 3ALGA 3FY1A 3OGVA 1KWKA 4HU8A 1HKJA 1E5JA 3UG5A 1V6YA 1V6WA 1WZAA 1KXTA 3L4ZA 3NYDA 2J78A 2V3GA 1ISYA 1NP2A 3M07A 1NWRA 3SUWA 2W66A 3L4VA 3SUTA 2Y4SA 2XSAA 3WQWA 1B3ZA 1C7SA 3PZVA 4YHEA 3WD4A 4PMXA 1U33A 3GXFA 1V3MA 1HKMA 2QMJA 2WMIB 3FHQA 3ZQ9A 5CPTA 4LQ1A 3AIWA 3AYRA 4D6HA 4K68A 2NSXA 4AD0A 1GPFA 3RJYA 1E9LA 1SMDA 3ZR6A 2EEXA 1E56A 1QI3A 3GYCA 4TVDA 3ARPA 5LA0A 3F5LA 1XYFA 2ZUVA 2A3CA 3D3AA 4AZ6A 1HKKA 5BXTA 3DYOA 1MQRA 1US2A 3W25A 1US3A 4J7RA 3EDFA 2G3MA 3W6LA 4PUEA 1DTUA 4HMDA 3AS2A 5I78A 2WNWA 5FD0A 1WDRA 1V02A 2V3FA 3PZNA 1RPKA 2DQXA 4LGXA 2XFYA 2GK1B 3TONA 1WPCA 1CGVA 1PIFA 4XZBA 3SCTA 1QNOA 1R86A 2BXZA 4MNMA 3WIJA 3ARYA 1GZJA 1EOMA 1KGXA 5BROA 2VOTA 3CUGA 4KMQA 1F4AA 1HVQA 1V0NA 2WMJA 5EB8A 3WD1A 1HXJA 4F9JA 6CGTA 2CHNA 1UD8A 2VX4A 2NT1A 4HP5A 3OLIA 3CZJA 4HPGA 2GFTA 4DWSD 4UOQA 3CTTA 3QGVA 3QOMA 1NOWA 2XVNA 3VD7A 7CGTA 2D20A 4JKLA 3GZAA 1CZ1A 4TTUA 4ZENA 1LL7A 4IPLA 3SIMA 4WSKA 1HNYA 4IM4A 4JL1A 1CGYA 5FIPA 3MS8A 1B31A 3G6LA 5HDRA 3BAKA 2CHOA 1CXFA 1BG9A 2J75A 1JYNA 3ARTA 1NM9A 5JBDA 3W26A 3BMVA 1B3YA 2JE8A 2DIEA 1M53A 1M01A 5D8WA 1NH6A 2X8RA 3ARVA 1W3HA 3U7VA 5GPRA 4U3AA 2WVVB 4CD5A 4GZIA 1CNVA 4JFUA 1JI2A 3VIPA 3IJ7A 2A3BA 1R85A 4H7VA 1QW9A 3WUEA 4AYSA 2EXOA 3K1DA 1TCMA 1VFFA 4AD2A 1W3LA 2GDUA 1XH1A 5HXMA 1GOQA 3VIJA 4JKKA 1ODZA 1ZBCA 5M03A 1J9YA 4MDPA 1C7TA 2GJXA 5ABHA 2ZX9A 3QHNA 1EDQA 1B1YA 3KE0A 2VCBA 1MFVA 4S3KA 1CPUA 4BQ3A 2E4TA 4AZ7A 2J7DA 2JIEA 4TX8A 4D6DA 1XH2A 4E8CA 1WCGA 1E5NA 1KFWA 5DMYA 3SEPA 3UESA 1JAKA 1V02E 1VJZA 2VMFA 4Z2JA 2WVSA 2VX5A 3HMCA 4UFHA 4DM2A 1BGGA 5BXPA 2UY3A 3AICA 3L2LA 2WKGA 1CXHA 4PEEA 1DWIM 2DGAA 4MDOA 3UG4A 1BVNP 2BVDA 3WUBA 1WZKA 1DEDA 1UWSA 4W88A 4PTWA 1ZL1A 3VGFA 2JALA 3THCA 1DWAM 2XGBA 5FOOA 1BQCA 1JI1A 3OGSA 3U57A 2E9BA 1B3WA 1LLOA 4F8XA 7A3HA 1BYBA 1GVIA 4FLOA 1JG9A 4M82A 2WB5A 3JUGA 3WF1A 4DUVA 5LA2A 1HL9A 3PTQA 4GZEA 1WO2A 1Q6GA 1PIGA 2GVYA 3PZGA 3WFZA 5CSYA 1JF5A 1JDDA 1Q4NX 5E9AA 1AQ0A 3W28A 2J7GA 1BF2A 2W63A 1KR1A 1PAMA 2GJRA 3W82A 4P7OA 4U2YA 4Z2KA 1H09A 3N17A 4J3SA 2BHZA 2J7FA 5JIWA 4UFLA 1UWIA 1HJWA 2WPGA 4BF7A 1OB0A 1XHGA 4H2CA 3ZMRA 4BQ2A 2VNCA 3SURA 3K46A 2WW5A 1XYZA 3WY1A 1C93A 3W37A 3WQ4A 2PF0A 3LPPA 1J0KA 1EDGA 3VUPA 3WD3A 2WCAA 4V28A 4CVWA 1JD9A 4P7LA 3GH5A 3WH6A 3VM7A 2D1ZA 3VGEA
chains in the Genus database with same CATH superfamily
5I79A 3VDBA 1WAUA 3I7QA 2QV4A 1DQWA 1A5SA 3WNNA 4AD3A 3WLKX 1P0NA 4H3DA 3GUWA 2I9EA 3ZS4A 2VFFA 4F0RA 1YRRA 3N1AA 3B9EA 5CLTA 3AYTA 4Z1YA 2X0HA 1EFZA 5DMNA 4E4PA 1DHPA 1U30A 1LL4A 4AVNA 3UY7A 3WBYA 1IEIA 3EX4A 2XN0A 4M24A 5A6AA 2YBUA 3LI0A 2PDWA 4QQUA 5ABTA 4L6DA 3WQ5A 1XLAA 4UTKA 2ZDRA 1EC9A 1PXGA 4HTBA 2BVTA 2QJIA 5FI8A 1UWRA 2BFGA 2OSXA 2ASHA 1F05A 1S5VA 3C3UA 3GBDA 4QSFA 3HFTA 1VFHA 3P67A 3IRSA 2FPTA 1F6KA 1GNXA 2GJXB 4RL3A 5TBOA 5TD4A 5LGZA 1Q7QA 4WDXA 4H8NA 4C1NB 4S3BA 3E1F1 4PSRA 4UR8A 4I5UA 3BXWA 1D7KA 5EFFA 4XTDA 3OLEA 1UC4A 1AVAA 3NO3A 3FAWA 3LGDA 1UKOA 3LOTA 2QXWA 4C7FA 3G1XA 4OHQA 1A0CA 4U31A 4UIOA 3L68A 3QW3A 3CH9A 4Y9OA 1C8YA 2YKKA 3MJYA 1W32A 2EPMX 3WJWA 2FTPA 4I7UA 1UASA 3W1TA 3CQHA 1PV8A 3RYSA 1O94A 4EE9A 2XWEA 5C2XA 1QI0A 2P88A 3DBNA 4PUUA 4RW5A 3WJYA 4ZFCA 3AHYA 5BW6A 2EJAA 4IJBA 3IJIA 3U2ZA 1CXIA 2CLPA 1PKLA 1ESWA 1H1YA 3OODA 3SN0A 4ZMGA 3PBYA 2FDMA 3AMCA 1BSIA 4WQ6A 4GIYA 5CC6A 1Q66A 4NJJA 1KC7A 1QHZA 2Q01A 2R8WA 2WKJA 2WNQA 1PCWA 1QDSA 1Q2RA 4LH8A 2BOGX 1HZYA 3W53A 3FYPA 5J04A 3AUOA 1PKNA 2Y5SA 5CGTA 3FCPA 2C1GA 4ZQPA 1XIHA 1G67A 1K6WA 4MB4A 3SFKA 3UYCA 1KTCA 2XIQA 2RKXA 5LZLA 1XG4A 4MY1A 3MU7A 4DUWA 2P50A 1U22A 2DORA 3TYEA 1Z8AA 2WSYA 2G3NA 3PTDA 1UW9A 4D71A 1MW2A 4DVOA 2BOFX 5AC4A 2GSJA 3H22A 4H2HA 1AG1O 4J4KA 4D6JA 2ISFA 3CZEA 1OCBA 5LKYA 3UA3A 2PD5A 1HL8A 4UNIA 4UQCA 3K4AA 3HIJA 4LYQA 1EP3A 2RJGA 5CJNA 1R2SA 2XJ7A 4PRWA 4MZ1A 4RNHA 1X39A 4JD4A 2RDUA 3RMJA 5C0QA 4CN6A 2FDSA 4PTDA 2RFGA 1QPQA 2AL2A 3N18A 3H21A 5A95A 4M6VA 1VPYA 4PMYA 2BTMA 4HNUA 3CQJA 4B5VA 3EKGA 3MSRA 4AMAA 4IMGA 4E3VA 1BYAA 1TUXA 4XKYA 2R6OA 3GDBA 2C15A 4R53A 2NSOA 1SQ7A 3QFEA 3VGGA 3JU2A 3VC5A 1QAPA 2DW7A 2G95A 2VRKA 4TX9A 3L23A 3A4AA 4L9ZA 5F1UA 3VINA 3QZEA 1JR1A 3W0KA 3WMCA 4GZJA 1EA9C 1PVNA 2HEJA 4OOZA 3EB3A 1V0MA 2XYLA 3NL5A 9XIMA 4Q6XA 3DUGA 1MW1A 3R13A 3NL6A 3EGJA 4AU0A 3MBDA 1VGAA 3BO9A 4UTLA 3TQVA 3W7HA 4FXRA 5C2CA 2PWEA 4TO8A 4KGLA 2X2YA 3TEVA 2V38A 1GQLA 3IJLA 4ATDA 3SB0A 2OWCA 2VZSA 4L6OA 3TN5A 3O6AA 2ACQA 5FAJA 4JEJA 4TTGA 5H8PA 3HJZA 4QX4A 2W9MA 3MBFA 3PANA 4WY0B 1MFUA 2PDQA 4HHMA 2Y88A 3B03A 3QHMA 3PG8A 3UXAA 3GVWA 4NF7A 4MKVA 1E9ZB 2R91A 4QE1A 2YL6A 3P8JA 2VO5A 3G1YA 3SCNA 3YPIA 4QP0A 5HPCA 3BSHA 2H3DA 1XRFA 2ZUSA 3M4HA 1TZZA 1V3KA 4CU7A 4NSBA 4UFJA 5I3DA 1DIDA 1SMAA 1TRIA 1UR0A 4FOJA 3MMDA 3UWZA 4D8ZA 5H2ZA 4W86A 5BOOA 6XIMA 1A3WA 4RDYA 5AKQA 3LCLA 2V5KA 1E6XM 2J7CA 2JEPA 3FEQA 1FWIC 4DIAA 2VUYA 2QCEA 2MANA 1QI5A 2D23A 1C3FA 1DXFA 3WLOA 2VCCA 5AN7A 3TX9A 2JKAA 4GD0A 4C5ZA 2PCQA 2C71A 3NOYA 5D2VA 3W72A 5M17A 4DQWA 2YBTA 4GNKB 5IBXA 3A6OA 4B16A 4JCMA 1FKXA 2YLAA 3R58A 4IGMA 2ZRVA 1IYXA 3NNTA 1J93A 1P0KA 5F7UA 5FEPA 4EAMA 2VT0A 3P62A 2OYMA 4PMOA 3I7SA 4MLJA 1SM9A 3O05A 3TH6A 3H7RA 3LQLA 5KZDA 1XM3A 1LJYA 2OT1A 1RLCL 3GTNA 3N19B 3VI2A 3L4UA 4CUCA 1TQXA 4JTIA 1K77A 4DYEA 1S2TA 3QSTA 3BMWA 3CLWA 5G2HA 4R3UA 1W56A 1JCXA 1KV5A 5HNRA 1A5OC 1YDVA 3QLLA 3LTYA 5EMLA 2G0WA 1HO1A 1UQZA 1O1ZA 3WEOA 1ZZMA 1E3ZA 5G5IA 5AY7A 4AIUA 1E40A 3SJNA 1PDYA 3AIBA 2GQ9A 3PSWA 4S3EA 4U10A 3LMYA 4XKYB 1Q65A 1GQJA 2WNZA 2CIPA 2NVCA 5MHBA 3N4AA 5JVLA 2JF7A 5CPQA 1GGOA 4EAYA 3BE7A 1RY8A 4NZ3A 1K7FA 3LV6A 3V35A 4GCXA 2E7FA 2BMBA 5F2MA 1KO0A 4DF0A 4LUJA 4DYKA 4ICCX 1UH3A 4S2CA 3CUFA 4XZWA 3NQ7A 3STEA 4KEVA 5HR6A 2BY1A 2WXDM 3TC6A 3DU0A 4QDMA 4XD5A 4E2OA 1YNQA 2WHJA 3GIPA 3ZLFA 4O54A 3HQNA 5HNNA 6XIAA 4EP8C 2FMNA 2E5CA 2WPBA 3QF0A 4YPJA 1YPIA 2XISA 1VD6A 2ISDA 1E9IA 4B5WA 3NR0A 5DX7A 1MNSA 1V8EA 4YHGA 4PB3A 4LT9A 2CZFA 3VIOA 1FH7A 3KBWA 4PEKA 1D3CA 2HBXA 1ECQA 1MW3A 4YXGA 4LAMA 3TKFA 1C9DA 1DIOA 1Q6CA 3R8RA 3GVVA 5CSUA 1TA3A 1NIUA 2ZZ3A 3BG9A 4KS0A 3QV9A 2Y6ZA 2HV5A 3V16A 3L2MA 1TJPA 3BLFA 5F4SA 4CCDA 1TREA 2Y62A 1XPGA 4D2JA 5DCEA 1HIZA 3M0XA 1DBTA 3BDKA 4RPPA 1YKWA 3G0SA 1MXDA 3IIPA 2L5HA 3VDHA 1BPLB 1V3LA 1EKOA 1CB7B 1UYQA 3PAOA 2RGMA 4PSPA 2A3HA 1R8LA 3STCA 3C2YA 4YYCA 1W1TA 1WYIA 3SJ3A 1OFAA 3QFWA 4PL2A 3BAYA 3S1GA 3DFYA 5A1AA 2OKOA 3LCHA 3P0WA 5HMFA 4RJEA 1NOUA 2G37A 2Y8KA 4G9PA 2C7FA 2Y1HA 1JFHA 3KEHA 2GWNA 1SFLA 4Q22A 3B04A 3R2GA 3GNRA 3MYOA 2G50A 1AQMA 3VOHA 2WZIA 3GNPA 4IQJA 5DQPA 3LHVA 3U5UA 3S4TA 1LT8A 1WKFA 2C16A 1KW1A 1GW9A 3S3GA 2PURA 3TTYA 1X6NA 4JTLA 1OG6A 1L6YA 4H04A 4I8DA 1DE6A 5A8NA 1JYXA 4ZSUA 3UBPC 3OJGA 4J9JA 1VIWA 3E0LA 3UFYA 1Q8AA 2WBGA 4L1WA 5BCAA 4O12A 1GHRA 4JQ2A 1PDZA 3WDHA 1RQBA 3GZ3A 3RX2A 4H7CA 4LTSA 4C6DA 4DHGA 1HJXA 1JCNA 3W23A 5CKSA 3VOCA 5B80A 1L0PA 1E1EA 2DT0A 4A35A 3UJSA 2OLAA 3MMTA 1X97A 1XIBA 4PBGA 4V2XA 4H1ZA 3SRKA 3NFUA 4JFSA 3FNDA 2IXUA 4IISA 2W0UA 3AWNA 2BBFA 4C1LA 1LWJA 3POHA 5CZ0A 4LC8A 2E0PA 3CWOX 1QASA 1U1HA 2OZ0A 4AFYA 1K8ZA 1RSCA 5ABGA 3WQDA 2QAPA 4RZ5A 2Y7DA 2PI6A 4JTQA 8TIMA 1BXBA 4NIRA 4GZ7A 3NZPA 1CWYA 2DDXA 3KXQA 7ENLA 3EPMA 2NXGA 2YGYA 4JQ3A 3PBUA 1E51A 2VL4A 4HNOA 5AECA 2GGJA 4CCZA 4O19A 1EX5A 3AXMA 5D02A 3WEMA 3CMFA 1PSCA 1FWSA 4EWND 3E0IA 5C70A 2XDFA 4FZIA 1VBGA 1WQ5A 1OFEA 1EGZA 3MV11 1BAGA 4L64A 3GH4A 1VR6A 2VR4A 3CV6A 2OMAA 3R10A 2YDAA 2QCLA 3BPWA 1UQYA 4IWWA 1GW1A 1TA3B 3UWWA 3MQTA 1B90A 1ZY9A 3S46A 1F76A 1U1JA 4C91A 1W3IA 2AAMA 3THUA 1YW1A 2PLMA 5FEXA 4FA3A 3E02A 1HKIA 3ARWA 3DIPA 3MO4A 4UOJA 3WQPA 1XCFA 1AH0A 2DSWA 3A23A 2YIHA 4XISA 5FL1A 3S9IA 1TTPA 1H41A 5LHEA 3LMZA 1B3VA 1NELA 3G8EA 3GXIA 3BCFA 4S39A 4DF1A 1I60A 4KF1A 2E8ZA 3QTGA 1IEXA 2Z25A 2Y7FA 4PMZA 1OJXA 2F8QA 4N4PA 1R46A 2WJDA 4OWGA 2VR2A 2AMGA 2QUVA 2Z1XA 4OV9A 4WOQA 2NV2A 3KFTA 1E0UA 1GG0A 3CZGA 2J9ZA 1VB9A 4HZMA 5A2CA 3DG7A 4S3AA 4M1BA 3TYZA 3W1XA 5E6YA 1VP5A 1J0JA 3WBEA 1VFSA 1JQVA 3CT7A 3EEGA 1KKRA 1BD0A 4ENLA 4DWDA 5G1YA 2BVWA 4BFAA 4MJMA 1KFBA 3ARUA 5CQ1A 4LRSA 4BWLA 3TXZA 3RN6A 3Q65A 3DI0A 3XIMA 2GDQA 1JQXA 2QPSA 3B8DA 4J35A 1QPRA 1XRVA 5HJXA 3U6WA 1UH4A 3UXDA 3WG6A 5A8GA 1R6WA 5LNWA 1YDOA 1AODA 4RDZA 1W9XA 3W84A 1XIDA 3AUJA 1FRBA 3W1MA 1E6QM 3WLTA 1SJBA 2FZNA 3EOLA 3PJWA 3CQ0A 3O6CA 5LNSA 1KQYA 5D32A 3B05A 2CBJA 2BXVA 4MY9A 3GQYA 3L0NA 3N11A 2VC6A 1K7XA 1OD8A 4CEUC 3PK7A 5CSSA 1CXLA 2GUYA 3WJXA 3GDKA 1A5UA 1LROA 2HMCA 1ELSA 2Z1WA 3ZOAA 4WEVX 3QW4B 3NL3A 3VDCA 5DELA 3GR4A 4LV4A 1Z6KA 2CLLA 3PFMA 1VPXA 1GOXA 2H8XA 1X8CA 1XBZA 1XYBA 3AALA 1GVOA 1H0IA 5K9XA 4DZHA 2J47A 1XDJA 1XDLA 2PTDA 4HPXA 2G5WA 5DFAA 4AX7A 2CLOA 2ZRXA 3OTRA 1IV8A 3HN3A 4UTWC 3BANA 3E2QA 3QQWA 4HYWA 2C6QA 3UR5A 1ALDA 1V3HA 4JTUA 1WXYA 3S1XA 2OWXA 4IQLA 4ORIA 1NOFA 2ISVA 1AMYA 2YB4A 4ZE4A 5AHFA 3DAQA 4B5UA 3I3EA 3NM1A 3TYBA 2V5DA 4N6FA 3L21A 3V3WA 3CS2A 3QM3A 3LENA 5BXSA 2QLYA 5A6MA 1BTMA 5AZ1A 1ME9A 2V2HA 9RUBA 3WQFA 3LY0A 5U7SA 4MWAE 3AZSA 1DHKA 5BNKA 2J27A 3IRDA 3VMNA 4J3TA 1Q5MA 3SI9A 5C9RA 2A4AA 4E2BA 1QXLA 3BLEA 2A2IA 3GHUA 3NJ3A 1XYAA 4JTGA 3VE7A 1EC7A 1VHNA 3HG4A 1XC6A 1XI3A 4KETA 4GYKA 4MWAC 2Z27A 3HGOA 3VNMA 1HJQA 1LLWA 5A5WA 1KBKA 5LXXA 1ZBVA 3RLHA 3CHEA 2RHGA 1WDDA 3LPGA 1CYGA 5J5RA 1IIHA 5REQA 3TR2A 2XPKA 1VJSA 1UB3A 3ES7A 5G4HC 3F4VA 2QNEA 1YQ2A 2QPUA 1NWTA 3CM4A 3JZUA 2WJZA 1U83A 2UWFA 3UJ2A 1O5RA 4HPNA 1Z69A 3T2PA 3KWXA 1M7OA 1N55A 2V63A 3BZGA 3ALFA 4H7ZA 4XWUA 2X1IA 1UR2A 1JJKA 1QWGA 4EPDC 3HG5A 3DKJA 4ZBCA 3RLGA 5AYBA 2CXEA 3KAOA 3KCOA 3EYPA 1O1HA 4MPQA 2E6YA 1OD0A 4UCGA 1K1DA 3O9NA 3NO5A 3P2VA 4PCTA 2PDMA 1PKMA 2BOEX 1RZMA 4RE2A 4HA0A 5FSDC 3VIIA 4A8LA 2ZRYA 4DAIA 4GUGA 4KT2A 2DSVA 1V0LA 3VD3A 1ONEA 1J5SA 3MUZ1 4MMWA 5F2LA 1QNRA 4FOUA 3L9CA 5K7JA 1J01A 1V5XA 2YW3A 1RLDA 4IOTA 1TMHA 2D73A 4UR9A 1M7PA 4P7RA 4FR6A 3SBFA 3QMRA 2JFEX 4DPQA 4GNVA 4U5KA 4FLRA 5E70A 2ZXQA 1DJYA 3B8UA 4DO5A 3GG7A 3IAQA 2F6KA 2GVLA 1VFMA 2GVJA 2QJJA 1Z32X 3S0CA 2DZTA 4ROPA 2CFFA 1C90A 2V3DA 3VD9A 2WK2A 3MT1A 2VQUA 4C60A 5ENLA 3HGJA 3DH7A 4F48A 4QGCA 3VZYA 3GTFA 4WDWA 4ACYA 5PTDA 4AY1A 3SAZA 2WKLA 1TPB1 4JFTA 5A8OA 2BSLA 2CZEA 3WNKA 1A5MC 3BTNA 3DFNA 1QO5A 3CPUA 4O11A 3G1FA 5CZKA 3TW6A 4X22A 1J6OA 1O5KA 4UR7A 2GDVA 1OQFA 4RR4A 3RFAA 1JZ4A 1W31A 1UUMA 2YL9A 4J3VA 3D5HA 4UFIA 5BOEA 3VNKA 1WDPA 5I06A 1I6NA 2J6VA 5GNXA 3NSNA 1TV8A 3WJSA 3KWSA 4Q33A 4B4HA 2D24A 4I6VA 5AHLA 2Z7KA 1QW7A 5HQEA 3VO0A 1OCQA 4D6FA 3W81A 2HJPA 2ZIDA 1R3VA 1F4HA 7TAAA 2QEZA 2P0IA 3N14A 4H01A 3T05A 2WVUA 5DMLA 4BEQA 3QR0A 3BARA 2VFEA 1VBJA 5KSWA 2Q71A 1D3HA 3RGTA 1P43A 4Q32A 2A7RA 3AMDA 3ES8A 1UKTA 2J77A 2PGRA 2YSWA 4IMDA 3OZYA 3W1QA 2WVVA 4J2PA 1MRAA 1S5TA 3W00A 2CLFA 3TSMA 3GBEA 3NQDA 4US5D 1ADSA 1OZQA 3LTSA 3L4TA 2PP1A 1I1WA 2FPVA 1JXJA 4Z2IA 4JGDA 3CGTA 1TVNA 1UD5A 2WQPA 4UB9A 4NG3A 5BMXA 5EPDA 2PDBA 4PL1A 3VX1A 3IEBA 4KIEA 3CIXA 3TZFA 1W6TA 4MJZA 1V7YA 3DG6A 3W7KA 3AMLA 4RXGA 1OABA 4NHVA 4WKFA 4Z42C 3WLLA 3OYZA 1U5JA 1IWAA 1GVQA 2HSAA 2NUYA 3L66A 2XFRA 3PG9A 4QCFA 4TXEA 3G5EA 4KRTA 1FWCC 5D9PA 3M0LA 1K6AA 1UIOA 3VYLA 5E0FA 4KWUA 3LERA 4AQLA 3MJMA 3V0TA 3TU9A 1V08A 2YL8A 4BKNA 3AYSA 2FJKA 3UGVA 1W1IE 5CZTA 1V6YA 1WZAA 1KXTA 2GJNA 2OOFA 3SUWA 1RA0A 3L4VA 5DBUA 3HFYA 2Y4SA 3NDOA 5A6TC 4PMXA 3TE9A 4PC8A 3CAQA 1ICQA 1L6FA 3UR2A 3MHFA 3W2UA 3CLMA 4LQ1A 5LNVA 3RCMA 2TRSA 3EX6A 1F9CA 3CB3A 3HA1A 3VOIA 3CHVA 3ITGA 4C6EA 5BOFA 3V18A 6REQA 3C2FA 3W22A 4G6CA 4AZ6A 3KX6A 3CO8A 5BXTA 3DYOA 4ZQMA 3I65A 1J5TA 3W25A 1US3A 4J7RA 4LVAA 3EDFA 3KUMA 3GFYA 1F07A 4JY9A 2OQHA 2DZBA 3WCZA 2DQXA 1KTNA 3KTCA 3DOPA 3N6JA 1PIFA 1FWNA 4GUFA 3SCTA 2BXZA 3KTXA 1GZJA 2ACUA 1SZNA 1EOMA 1YLVA 3E3HA 2FPYA 1QUMA 1KFJA 4JHMA 1HG3A 1SSDA 1V0NA 4C6OA 3TDFA 5TNVA 3EX2A 4BF9A 2E25A 4HYVA 1L6GA 1UD8A 2VX4A 3IV3A 4HP5A 4HPGA 3L0KA 3NQVA 2GFTA 2J24A 4YL2A 4L5ZA 2DP3A 3CTTA 3QGVA 1LQ2A 1SO5A 3KRBA 1YPXA 3QOMA 3UWUA 4DUOA 7CGTA 4NQ1A 1Y5WA 2D20A 1HNYA 1KRMA 4AWSA 4JL1A 1NDZA 5FIPA 3URAA 1AJ0A 2EG8A 1P6BA 2J75A 2IPWA 3B0XA 1JYNA 5FF4A 3ARTA 2PGEA 4GMEA 4GX8A 1M53A 1M01A 2Y89A 1NH6A 2X8RA 2QVHA 1SZRA 4QQ3A 3CIWA 2WVVB 3WLRA 3WLIA 4K8GA 4GZIA 3FX4A 2FTWA 1QK2A 2A3BA 1JRBA 1G7UA 1RXOB 1TCMA 1VFFA 3W02A 1J8VA 2PLJA 1W3LA 2GDUA 1XH1A 1RAKA 1GOQA 2J8TA 2QR6A 1AMKA 1JULA 3MY9A 3QGKC 3TAOA 3W7JA 4DJEC 4UNLA 1NU5A 4PULA 1W5QA 2ZX9A 1EDQA 4PFHA 4K2SA 2VCBA 4JY8A 3BLOA 2ZTJA 3A13A 4S3KA 4BQ3A 4AZ7A 3M9YA 1YNYA 3GHSA 4GOAA 4UTTA 1KBJA 5DMYA 3SEPA 1V02E 1OG0A 1XR2A 1MI3A 2HRWA 2W79A 3OO2A 2WVSA 2XFWA 1WDWA 2GGEA 3AICA 1A80A 2TSYA 3AU6A 1DWIM 1PHQA 2DGAA 3PBMA 1WZKA 2OXNA 3VGFA 3CT2A 3CB8A 3T42A 3V0SA 1BQCA 4H9ZA 4I9TA 2D2HA 4A2SA 4ZTYA 5H8MA 3MI6A 2V81A 1BYBA 5EMKA 3WLNA 3BW3A 6PTDA 1JEZA 3N9SA 4M82A 3BQ6A 1YPFA 3GWQA 3WF1A 1EJXC 3PTQA 1Q85A 3N34A 3CL8A 3PZGA 5CSYA 1Q4NX 1DJQA 4PZVA 4YWSA 2W63A 4C5YA 2PDIA 2YXGA 2XGZA 6REQB 4Z2KA 3WYZA 3N17A 4J3SA 3ATZA 2J7FA 3AYVA 3N2OA 3RCYA 4BF7A 1OB0A 1XHGA 3U8GA 1H7XA 1XKYA 2PZ0A 1F8MA 1XIMA 2NQLA 3SW6A 3K46A 3VKCA 4X2RA 5CPNA 1H61A 4WDUA 2VM8A 2F84A 2FVLA 2J88A 1C93A 4I8YA 1VKFA 3IVSA 4GVGA 1EJVC 4B4FA 1G4SA 5TQLA 2E6FA 3FSTA 3MW7A 3BOFA 1GPWA 1IGSA 4V28A 2ZRWA 1JD9A 2NXHA 4CVWA 2D1ZA 3VGEA 4V1YA 4EANA 1GZ1A 4G56A 1UKPA 3R11A 1FWEC 1KLYA 4Z1BA 2ICSA 1JZ7A 3P61A 1NARA 3LA4A 1US0A 2PLKA 4XV0A 3B8SA 3GR8A 2I14A 5A8QA 1IXOA 3PNUA 3A47A 2DU2A 1IE7C 4WK9A 1G4PA 4RNIA 1FFRA 3RRXA 3CH0A 1ZCOA 2X0SA 3O8AA 3M41A 1RP9A 3A12A 2VENA 3CV1A 1ZGDA 4R88A 5TIMA 4JQ1A 1W3TA 2PPGA 5B7ZA 4MOZA 3TP4A 3I4KA 3ABQA 3MMUA 3ARXA 1A5BA 1VAHA 1EWDA 4GYPC 1GQNA 4LB4A 1QVBA 5JU6A 4MNKA 2YCLA 5AHNA 1XGZA 2WJEA 3GXPA 3T7VA 1Y8BA 2E67A 3KBSA 2DFAA 4IT1A 1FCVA 1OEPA 1YTDA 2VZOA 4XZIA 3OOQA 2EO7A 3MUY1 4PRTA 4IL2A 2I7GA 3COTA 3R6IA 1OC6A 2Y0FA 3UT0A 3B8WA 5LYRA 2X40A 2AGTA 2EPKX 1H7NA 2CKSA 1UHVA 3IV8A 3JVAA 4FALA 1ADDA 4Q8TA 2A1YA 1I1XA 4YVVA 1QU4A 1NWUA 4DF2A 5CG0A 1GVYA 4O4WA 4PUJA 1MWOA 4W7UA 1KCLA 3WSUA 1VFUA 4L1XA 3EDDA 3FEMA 2VOMA 3FJ4A 1THFD 1IZKA 1YHTA 2ZADA 1MVYA 4Q8UA 4UMCA 4AHQA 5EMMA 4GQRA 4WY0F 3IAPA 3GAYA 3CK5A 4WKAA 5JQ9A 2R1PA 4IP5A 3ITOA 5I23A 1FWTA 1I2PA 1EDTA 2WYSA 5A6BA 4BI5A 3W76A 3RR4A 3ARQA 2NUXA 1WP6A 3PAJA 4GI9A 4TVCA 5CLWA 3NQ6A 5C54A 3I10A 3P3BA 2BXYA 3FW6A 3BAIA 1L8NA 2J7EA 4C6BA 3T1GA 2XVPA 2NVDA 3KL3A 2WWCA 4H00A 4ADSA 4PYSA 1GKQA 2F6UA 4C6CA 5HULA 2CBVA 3O16A 1JNDA 4TR9A 4H8UA 1JZ6A 3LCXA 4FF7A 4R33A 1G4TA 4QE4A 1Q45A 3WBXA 3SCPA 3VZZA 3BLKA 3PBWA 1IT7A 2XIMA 4P7NA 1LG1A 2YOCA 4K8EA 1DIEA 4O4VA 1IR1A 2XIIA 4F66A 1GJWA 5HWNA 4NJIA 4MAVA 3S8HA 4JN7A 1JDCA 4JKMA 2E9MA 1PE1A 5I7GA 2AAAA 3LX9A 4R27A 3FGCA 1RJPA 5SWUA 1M65A 3H54A 2OLSA 3R12A 4L4MA 1QW8A 3CMJA 3U2OA 3WH9A 4B3LA 4LVDA 3S2CA 8XIAA 2GJPA 3NZGA 5CEWA 3ARZA 4WIWA 4D6EA 4HPHA 2BZNA 3ZSTA 2Y61A 2PDJA 2C8NA 1LBMA 4UTFA 2CYGA 3DFPA 3PR2A 5HJLA 2YCLB 2XIOA 3WBWA 3H2AA 3LLFA 1UWTA 4YS1A 1SW7A 3MV01 4TU1A 5BU9A 3VPLA 4AY7A 3CO4A 2XVLA 5LNRA 2C1HA 1XLGA 4WXZA 3H7UA 4IICA 5BXRA 4QJ3B 2IQTA 5C7HA 2NUWA 3DERA 4FNSA 2Z2UA 4GH1A 3IARA 3LLDA 3LQGA 1TQJA 1UZ1A 3V4BA 3SM0A 1F3EA 3RCNA 1GQKA 1V79A 3E0VA 4IMCA 4LUIA 4NXSA 3I4EA 3MDUA 3F5JA 1GOOA 3IUDA 1N8FA 4LU0A 1A3HA 1CGTA 1X7FA 1R9ZA 3UPBA 2O0TA 3TMQA 1MXGA 2FHBA 3K4DA 4PUWA 4HA4A 4GUJA 1LORA 5C8BB 4D72A 1AQHA 3FHAA 6TAAA 4DRSA 4I5XA 1QOXA 2IS7A 4ZZ9A 3UWVA 1UZ4A 3RITA 1OK6A 1RJRA 3VMPA 4PMVA 3UXIA 4FIRA 3APYA 4C6PA 4LUTA 1EA0A 3TYDA 3WO8A 2B4GA 3Q2DA 3BAXA 1FFQA 5FJUA 1I75A 2J79A 1GQIA 1DWGM 4KW2A 1P1XA 2GVEA 4LCSA 1XLKA 1ZBWA 2IUZA 4R9OA 1HW6A 1S2CA 4GK8A 4N9EA 3EWYA 3EMCA 1TWZA 5D37A 1KTBA 3G1SA 2RAGA 1ZSXA 2VI0A 2VCAA 1A5CA 3PWAA 1C8XA 1HL2A 2E6AA 1D3GA 4W4QA 2BHUA 1EL3A 3XINA 1UD3A 2ISSA 1XBVA 3PN8A 3PZOA 2OZ3A 4DI8A 3GSMA 4AW7A 3KLLA 4X63A 1GJPA 1K4HA 3V1HA 4LYRA 3AQUA 1UA3A 4URIA 3T55A 5BRBA 1UIPA 1HJSA 2E5DA 1SSGA 1OGSA 1Z89A 4CCEA 1TV5A 1V4YA 2G3IA 1R3WA 2ZKMX 3DCPA 4YWIA 4ORMA 3N6QA 1EXBA 3RLVA 5CPLA 2OR2A 1FP8A 2Y5JA 2HVNA 4QNEA 4JN8A 4UTMA 4UFKA 3CEUA 4QISA 4AISA 3M1ZA 2PC4A 4FLSA 4LCRA 4N6EA 4IHCA 3DHUA 4C7DA 5C9ZA 4HOWA 1LOLA 3VIGA 1FTXA 1F6PA 1J6PA 4GA8A 3WL1A 1IF2A 5A94A 2DZUA 1E6NA 1EHAA 3NQFA 3V5OA 1VRDA 1DJGA 2VC5A 3AS0A 4AMCA 2ALDA 3TQPA 1K3UA 4XD3A 3G0UA 2GQAA 4H6RA 1E72M 3F4CA 3GVGA 2EQDA 3RO6A 4EIVA 3WDJA 3SY8A 3FK4A 2Z2BA 3W3OA 2CPUA 1HN1A 4UMAA 4IIFA 2NW0A 1EPVA 4MHBA 3ZJKA 4W87A 3KCLA 2I56A 4MGGA 4Q7NA 1BG4A 3ENLA 3QY8A 3H24A 2YFNA 2GWGA 3G6MA 1LYXA 4NZ1A 3T78A 3VILA 3M6DA 4BZYA 5HMSA 2QVNA 1M5WA 3L5AA 1RPXA 3TW7A 4NZFA 3F2DA 4AWUA 4WSHA 4FAMA 1MO0A 1XSIA 2YJQA 4NX0A 4ICNA 5HPOA 4M51A 2V2CA 4YCOA 3N4FA 4KCUA 2YA1A 3CAVA 1PB0A 1PHWA 3SQMA 1PYFA 4M0XA 3QZAA 3PUEA 3PULA 1KCZA 2QV5A 2HVOA 3P5ZA 2PGFA 3BG3A 5AHIA 1UROA 2XTKA 1SJCA 3PBVA 2NVAA 3VIMA 3T0DA 1PX4A 2QF8A 4PMUA 4UZSA 1UJPA 4P7QA 4GRSA 3EXRA 2OEJA 3N9RA 1WNOA 4H6EA 2DH3A 3GH7A 2VKZG 2AMXA 1SYTA 1A4LA 1NFBA 3L5MA 2WLZA 4JHOA 4HU0A 1TZ7A 3WL0A 3R43A 4GYFA 3AJ7A 4YTRA 3GVRA 1V03A 3KHDA 1XLJA 3VMOA 2FGLA 2D2JA 4PA8A 2D0GA 2HBVA 2PEVA 3LM7A 3P8IA 2ZZ4A 2PLCA 2F6XA 1EO7A 5I2UA 4GHRA 3R5EA 3PTMA 3LTPA 1V93A 2PSNA 2O55A 3TQKA 3HV9A 4F0KA 2VEMA 1P6CA 3KRZA 4FS9A 2C14A 1WKYA 2DY3A 1WDSA 5KZMA 2H3BA 2E09A 3ZXWA 4DM1A 4XTIA 4DXVA 1W1A1 2GOKA 4MWAD 1ONWA 3RXZA 3TNOA 2PWGA 4WJEA 1W2VA 5I5RA 4F2TA 3TLQA 1KFLA 3A22A 1CLXA 3NGFA 1YNPA 1W1YA 4E2VA 2V3EA 1HUVA 1OFPA 2W92A 5LGXA 4GH3A 2PDHA 5D2YA 4BJHA 4GABA 4R85A 7ODCA 2OZ8A 2PDFA 3HPAA 3ZFHA 1XINA 3E12A 3A4XA 3H53A 1KGUA 3CZLA 3M0YA 2QF7A 1Q6EA 1VQTA 3QZ6A 4BS0A 2E40A 1FHUA 3CIVA 3ZT7A 4LPCA 3PHAA 4Y7EA 1W9PA 1CTNA 5HNTA 1XLCA 1XLEA 1VBUA 4IUGA 4GJJA 3BK0A 1VHCA 4BF5A 1NSJA 2ZX7A 2IPJA 4NRRA 4LALA 5FF3A 4DBEA 3GY1A 4PTXA 5CPMA 5JH2A 1O7AA 4KERA 4W5UA 1V0KA 2OODA 4ACZA 3BICA 3R89A 5EL1A 3WMLA 4IGSA 1UH2A 3RX3A 1XYCA 4BQ5A 4DJDA 4RV8A 3LBMA 4NP7A 1E43A 2ZUMA 3B06A 3VKJA 3FS2A 4XZNX 1FUYA 1E4MM 2WO5A 4ICMA 1OYAA 3W7OA 4ADUA 4MKNA 3TA9A 3GC5A 1J0ZA 4XBJA 5ECUA 1ZS2A 1SR9A 3UERA 4TX6A 4O8RA 4W93A 4ZO8A 4KWOA 2DZWA 4ZO9A 5LIUX 2VJXA 1UUOA 2PB1A 2O9TA 4DJFC 1W5MA 2Z0IA 4N9DA 1RCXB 4AZCA 1ZUAX 1DXIA 1VLIA 1GOIA 4M8UA 5E1QA 2GSEA 2I5QA 3L67A 5G2WA 1V3IA 2FZ8A 3TNBA 1Z7AA 1H3GA 3BJTA 1UWAA 2ACSA 1I2NA 3A5VA 3N3TA 4M80A 4DO4A 3V36A 1F6YA 2YB1A 4LF2A 3GG1A 2CBUA 5CC5A 2F9RA 2P53A 4JEQA 1L2UA 2ZDSA 1JPDX 1L8PA 3BL3A 4MZYA 4GQQA 1XYMA 2G97A 1KM2A 4E6MA 4H9UA 5AHEA 5AVNA 3BGAA 3G24A 4KCVA 3M0IA 1TWWA 2BY3A 1JAEA 3KOZA 3IIOA 1LUCA 1VRXA 2I16A 1QNSA 4GY7A 1TR9A 2O92A 4QNWA 1AK5A 3RR1A 3J7HA 2WHMA 4K38A 4FNTA 1VPQA 4EOUA 3BAJA 4PBFA 1UOKA 2FJUB 4NZCA 2PC8A 4O1EA 4UTWA 2Q3RA 4NX5A 4X2PA 4OT7A 1BYDA 8A3HA 1GOWA 4K6AA 6ENLA 4O8AA 2A3LA 1QBAA 5BU6A 2ZICA 1VCVA 3SCSA 3U0HA 2VEPA 1FOBA 2ABAA 3S1WA 1QFEA 1JUKA 4JAWA 3C4UA 1UJQA 3LLXA 1JRCA 3NVTA 4IQDA 1E4IA 3B8TA 2YXOA 1JNEA 3WF4A 3TYUA 2ZCGA 2ZXBA 3BH4A 2CHRA 2OZTA 4U2ZA 3ZT5A 4FB7A 3LCGA 2D0HA 1N7KA 2HS6A 1TPC1 2BNJA 4ATWA 4OECA 4CD8A 4CU8A 3WFAA 1NFPA 1M1BA 2WBKA 5EBUA 1QNVA 7TIMA 1GYLA 2J74A 1PO9A 2BLEA 1EQPA 1RBLA 3NWRA 3VCCA 1POJA 1E0TA 3GNDA 4OBSA 4GI4A 4Y96A 4NXKA 4AEEA 1CGWA 1I2RA 1QOPA 2C79A 4JIQA 2HE8A 3A64A 3TC3A 2O9OA 3WQVA 3EWDA 2PWHA 4D1JA 3A3XA 2QCHA 4X0NA 3NPUA 2QGHA 4ACZB 1LQAA 3OHMB 1MUWA 5A2BA 1K9TA 4B91A 3BZJA 4UCFA 1S5MA 2DT1A 1KGWA 1QBBA 3EXSA 2ZVRA 2BODX 4HSOA 3LSBA 4WSJA 4NYUA 1DV7A 2QZRA 3O15A 5M5DA 1QO2A 1EXPA 1XPYA 3CL7A 3EWUA 5C5YA 1EZ2A 2YCKX 2ZE3A 3EX3A 2RUSA 4S38A 3UR7A 4H9XA 1RQEA 5FCZA 4FNQA 3NM3A 2DSUA 1ZAIA 3TV8A 2BGQA 2DJXA 2VEFA 2DZPA 1K9FA 2DSZA 3H7VA 4AZCB 4M1RA 4ATLA 4O18A 3W2MA 5JBFA 2HZGA 4JFVA 2AKMA 3SCWA 3FN9A 1MQQA 1GZGA 1TPFA 5HNUA 1W1VA 5ABFB 2G3JA 1PX3A 3DHPA 4KGJA 1BF6A 5E09A 3NYZA 2VZVA 1XC4A 3MKCA 4JTKA 3HV8A 1ITUA 2DW6A 3SY1A 5LXEA 1TMQA 1AW5A 2VFDA 1EYEA 4TQTA 1TCDA 4HSNA 2X1SA 3K8LA 1JDFA 2Y70A 1QHPA 1A3XA 3DN5A 4TIMA 1LM1A 3W7PA 2PTXA 2RDTA 4L56A 1P1MA 4P2VA 1T96A 5IHRA 3T0AA 2ZUTA 3CMGA 3ZLHA 4M6UA 4WUIA 4W8LA 1KRAC 3PS7A 1EIXA 2FB2A 2X1UA 4GIRA 5D33A 4KRZA 2ATSA 3NO1A 1H1NA 3DHFA 2I1OA 1UR8A 3ARRA 1H49A 2WC4A 5K4ZA 3VKAA 3M0MA 4MB5A 5E5CA 1E73M 1KR0A 1GWJA 4OU1A 2PD9A 3IANA 2J62A 2XIBA 2YL5A 3TJIA 1RCQA 4DYJA 1J18A 3GDTA 1QPOA 3NQGA 2J13A 4PMQA 1CT5A 4WF7A 2Y2WA 4I90A 1RK5A 1WE5A 1FWWA 2UY5A 3CUHA 4MY8A 3U7BA 1FWHC 2O9RA 1ITCA 4L65A 4Q4MA 3TMLA 2IQDA 4YTTA 1XLFA 2IPFA 4Q7IA 2CZVA 1GUVA 2QYGA 3CV7A 4J3XA 4CNOA 1W5NA 3FKKA 4FOKA 3TA6A 4MWAB 3UZXA 4QS6A 2WZTA 5IBXC 1IXPA 1KXHA 1XD1A 2SFPA 2XH7A 3AWOA 2QDGA 3K13A 3AHTA 1WAWA 3PB2A 4AC7C 3G2GA 4NZ5A 5C9WA 1W9UA 5I77A 3IGHX 4ROQA 4DJED 1UR3M 5CBJA 3C0JA 1YADA 4AAJA 1ZBKA 1LRQA 4M19A 2BDQA 4B5SA 3H2FA 2YBVA 5C9UA 1T41A 4MFDA 3EMQA 4QJ4B 5BZAA 4MUPA 3W1UA 5IFTA 3SIZA 2XZ9A 2EPNA 3SRHA 2YX0A 2FZBA 2C3ZA 3IIXA 3M5XA 4YIWA 1WXJA 3M5ZA 6TIMA 4H83A 4IFKA 4OTKA 4XIAA 3SUSA 4OUIA 3SCVA 3NDZA 3DENA 1BSLA 1E6SM 1OFRA 1X1ZA 2C0HA 3B4UA 3R7MA 3QR1A 4UOZA 2VWTA 4Q4SA 4JFWA 5LIKX 1JUEA 2E6DA 4LWWA 3D3FA 3WMBA 1R47A 4JTAA 1M03A 1ISZA 3LB0A 3TN3A 1Z3NA 3R79A 2F61A 1ICSA 5KINA 2IKIA 4QDPA 3PC0A 4GACA 2DZAA 1ZTVA 3W7QA 3D46A 2PE4A 3QYSA 2Z29A 1CLKA 3QV6A 4LBSA 4PB5A 3N6HA 5HMDA 3ZR4A 1YE4A 4ALDA 5LSMA 3GU2A 4J40A 2J66A 5A6SA 3OLGA 2DUZA 3CYVA 4R34A 3MCNA 4GNJA 5EBAA 3N15A 2VZUA 3AISA 2ZRUA 4WY0A 1GEHA 3KVLA 1AH4A 1XG3A 3URNA 4A3UA 3LRMA 3BJFA 4ASTA 4Q4PA 1LL6A 1BXNA 1OFBA 1RBAA 3W7LA 3O63A 1PZ2A 5FF7A 3FAXA 5AYIA 3BURA 5DCDA 3N3MA 4NJHA 3ONBA 3MHUA 2FHCA 4ONVA 4GBDA 2OWWA 2PF8A 1DE5A 3N13A 1XFBA 2QDEA 3DZ1A 5CJMA 3UWYA 3TWAA 1JYVA 4A22A 4RKAA 2CKRA 1EUAA 3Q45A 1KM4A 3AFBA 3QH2A 1NQKA 3HQ1A 3WELA 4JPGA 1DKWA 4LSBA 3SGUA 3ZM8A 1F8IA 1G5AA 3M0VA 2R14A 4LNYA 2VEKA 3AIRA 1FCUA 4HCHA 4ZE5A 4G5DA 2WCGA 5D38A 4ZO6A 1UC5A 1BVWA 1MUCA 5G4WA 4CD6A 2AL1A 1LRNA 4S3JA 2DJLA 3I7RA 1AL7A 1W3NA 4PCSA 1Z44A 3MZ2A 5T91A 1GVSA 3EKZA 4CQ9A 3KOFA 4HHHA 3NQAA 3W1RA 4UTJA 1WX0A 4JTJA 2XHYA 2IQ0A 3RG6A 2Z24A 3VAVA 3WF2A 4EVZA 1GKPA 4MB1A 3UR8A 1IWBA 1B4KA 3ALGA 3FY1A 3OGVA 4OBTA 1KWKA 4HU8A 4YYFA 2V30A 3UG5A 3VZXA 4Q8OA 2OKTA 2J78A 3U9IA 1ISYA 1MNZA 1NWRA 5EY5A 2W66A 3PY2A 2GQ3A 4Q8MA 3WQWA 3PZVA 4FNPA 4YHEA 4OFCA 1V3MA 2Y7GA 3VDGA 4IFKB 5CAKA 4P5UA 1MMFA 3ZQ9A 3B9OA 5CPTA 3AYRA 4D6HA 3VOGA 4E5TA 3MP5A 4AD0A 2FKPA 3ZR6A 2FQIA 1IR2A 1E56A 1QI3A 2XINA 4IZGA 4FXFA 4PB4A 3F5LA 1XYFA 2A3CA 3D3AA 3E5BA 1HKKA 2PP0A 3SN4A 3S83A 3V5FA 2Z1VA 3W6LA 1DQUA 4XBKA 1FKWA 5FSEC 2WNWA 1V02A 3S5NA 3KW3A 1FQ0A 1FVPA 5LIYX 1BKHA 1MUMA 3C0QA 2WQDA 2XSXA 3MI3A 4MNMA 1TVLA 4QG6A 1KGXA 3B0UX 3CUGA 1GKRA 1HVQA 3BVJA 1NF0A 2OPJA 3FYYA 3WD1A 1HXJA 1EP2A 1OFDA 4F9JA 6CGTA 2PU1A 2CHNA 1X1OA 3CZJA 1R2RA 4F2UA 4D8AA 4ERGA 3LCIA 4JR5A 3GKFA 4Q8QA 2PCEA 3W87A 1JCMP 5HMEA 4TTUA 5I02A 4IPLA 4QJ1A 1FXPA 5FAGA 2CLIA 2GOUA 1Q3NA 3IIVA 1ZJHA 4RK8A 3N29A 5JBDA 2Q6ZA 2JE8A 1KKOA 4Q3MA 5D8WA 3P84A 4IJRA 1PWLA 1W3HA 5M1TA 5GPRA 1RV8A 3Q94A 1VCFA 3GU9A 4NYYA 1JI2A 1Q7MA 1K8CA 3KZPA 5CAHA 3K1DA 1XISA 3JR2A 3PUDA 3SSJA 1A4MA 2VUNA 3B9NA 2X16A 4AD2A 2YXXA 3W7DA 4Q4QA 1Q63A 1J9YA 3I6EA 1C7TA 2DVTA 4A8IA 5ABHA 1B1YA 2CLHA 2VXNA 3KE0A 4KEZA 1WOAA 3IGSA 1XUZA 7REQA 2E4TA 2J7DA 1TTIA 4TX8A 1Q13A 1XH2A 4E8CA 1F74A 4C6JA 5DY2A 3ABOA 3NZ1A 1JAKA 3KCJA 1TIWA 1VJZA 4IJCA 1DYSA 3LDVA 3B0PA 4B3ZA 4Z2JA 4PUMA 2VX5A 4WVXA 1BGGA 3Q67A 4BK9A 3RPTA 4PFMA 2UY3A 3NEHA 3W85A 3LBOA 4MDOA 2VD8A 2PP3A 2AQVA 4N4QA 3WLPA 1DEDA 1UWSA 4W88A 3GO2A 2BWGA 4GVFA 3S47A 5LNUA 1DWAM 3MHGA 1VC4A 3HG2A 1JI1A 3UU0A 3OGSA 4O10A 2VDHA 3U57A 3QV7A 5C7VA 1OK4A 2E9BA 1TYGA 1LLOA 4F8XA 2NQHA 1RCOB 2QCFA 1X8FA 2DZSA 1H60A 4BHYA 4DUVA 3QVQA 1HL9A 1MRQA 4BI7A 4BWLC 1KNWA 1XBYA 1FDZA 4Q4KA 1JF5A 5E9AA 3H23A 1Q6LA 1BF2A 1KR1A 1LOQA 1PAMA 2GJRA 3GD6A 3GIQA 3W82A 1H09A 1DTNA 4R7WA 1SO3A 3HM7A 2WPGA 1J79A 3LXCA 3GTIA 3KBNA 5IRPA 4H2CA 2CZDA 4C6FA 4JIRA 4S3DA 4IIBA 2WW5A 4JQAA 1XYZA 4C6LA 1Q4WA 3WY1A 3H70A 2ZZ6A 3W37A 2TODA 3G8RA 5T9CE 3URQA 4LCQA 2PF0A 5K9DA 4S3FA 1E9YB 4BR1A 3UPWA 1EWEA 2QUNA 3VUPA 3WD3A 2WCAA 3QPEA 2V68A 2J9XA 3V7PA 3WH6A 3VM7A 1ME7A 3UCCA 3CZ8A 1XLHA 1XSJA 3T4WA 4C6QA 3SECA 2VVNA 4EACA 1ZQ5A 2R94A 2YCJA 3QR3A 3N2BA 2G3FA 4H8VA 4AX6A 4A2RA 1XLMA 3T40A 2FZ9A 2BB0A 3S1UA 3DGBA 3HGRA 2HE5A 1B9ZA 1DJWA 1A47A 4LAUA 4F3HA 1LCOA 3LM3A 4N02A 4WOZA 3NPVA 1OZMA 1R9XA 2PUZA 1QR7A 1VEPA 2VFHA 2YDQA 1CDGA 4QIUA 3G3DA 1J2BA 2WC3A 1WUFA 4E4FA 3WQEA 4O1CA 3GKAA 4KEUA 4EXAA 4WJXA 2TMDA 2XH2A 1M9HA 1XIGA 3ANUA 2Q09A 5FKYA 4EX4A 3KL5A 3TTQA 3EWBX 1B4EA 1KBLA 4X61A 4U5IA 4I7WA 4MZ8A 4R7OA 1B3XA 5A8MA 3TW9A 3ME3A 3CZKA 3GNNA 2ZC8A 3KZSA 3E0FA 1OGBA 2X41A 7REQB 1AH3A 3G1AA 4A3RA 1O12A 2PBGA 1G01A 1W54A 3S2LA 4ZFMA 4F79A 5HWJA 3ZVIA 5I09A 2C0AA 4V15A 1Q6FA 1DL3A 2HCVA 1CGXA 1HT6A 1K9DA 3M0ZA 4H19A 1OT1A 5K2ZA 3NQCA 1ZNNA 3ZT6A 1Z41A 3P5YA 2ZUNA 3GLCA 4Q8PA 3CYJA 2V2DA 1JGIA 3SCUA 3EX1A 3PZ9A 4AWTA 2ON3A 3PJUA 3RILA 4KCWA 2OYLA 1LWHA 3LI1A 1HP4A 3UZWA 1UWQA 4JIEA 4HVXA 3VX0A 3QOKA 1JZ8A 1YDNA 3BMXA 2OQYA 3G77A 4MAZA 3CUZA 4JN6A 4JTSA 5AYYA 3WD0A 2QCNA 2IXVA 2W4XA 4YN5A 3KL0A 4XAZA 2YA2A 2XGIA 3T0CA 1UUQA 3FFSA 1TWDA 3VXGA 5C6MA 1VJIA 5CPSA 4EXQA 1EBGA 5BRQA 5CZJA 3M0KA 1LQ0A 4JIIX 1FDJA 3OG3A 3I3DA 4AZIA 4G8TA 4Y2WA 4K36A 2HDJA 2G4FA 1N82A 4EPKA 3UG8A 3EZ4A 1N8WA 4BI6A 1NEYA 2D3LA 4GISA 4ZTXA 1DJZA 5KEZA 1ZFJA 2Z1SA 4H4IA 4DWSC 3TN6A 3WKZA 1GHSA 3H4GA 2ZZ2A 4FX6M 3C0SA 4HKPA 3QV8A 3T2OA 4KEMA 2VQTA 2OGJA 5JIPA 3KBVA 5D03A 3E2RA 3OG2A 3ABZA 2NX1A 3P60A 4I9AA 4MF4A 3VU2A 3OIHA 3IPWA 3ZYZA 2W91A 3EXTA 4AD1A 3K2GA 1YXCA 5D04C 5D9NA 1MEIA 3ONCA 1QATA 2BHYA 2ZXAA 3WDPP 1W9DM 3QRHA 3WLHA 3EA3A 2OCZA 3LPFA 3P14A 1TV2A 2I5GA 1J10A 1XL9A 2QCMA 1SU5A 3VA8A 1JL8A 4AZHA 4DBWA 2Z6JA 1UKSA 3VABA 4PGLA 2OFJA 1CB2A 8CGTA 2NT0A 2ZQ0A 1C8VA 2ZFAA 8RUCA 3ABXA 3GW3A 1ZRQA 2VDIA 1UR9A 4WLCA 5D2TA 4A21A 4IG2A 3ZO9A 4QEEA 4B2DD 5DF0A 1EQCA 3UJEA 1RY0A 4P8WA 4C65A 2NZLA 4ES4A 2W62A 2NQ9A 2JK2A 3TVAA 3L4YA 1EJUC 3EBVA 4NKCA 4CQAA 3WLMA 1AJ2A 1TR1A 3ITYA 1XRSA 2OO0A 1OX4A 4QFUA 1ADOA 3IUHA 3VK5A 3DHDA 4JNZA 3VD5A 3WNLA 4Y9NA 1AD4A 4Z1CA 1W0MA 3MO7A 3QY6A 4XVDA 2VX7A 1FXQA 2E1DA 4AZBA 5A69A 2ADAA 5T9BG 4P8XA 1XLBA 3WK0A 3TTEA 5AOUA 4C90A 1R9YA 3UXKA 1UOZA 4E4UA 5M3WA 1G6CA 3LBCA 4Q8NA 2EBNA 4HHLA 4CNSA 3DFHA 4DJFD 4GG9A 3NVDA 5A8PA 4ZEPA 1F3XA 3NXFA 1UWUA 1RHCA 3AXHA 3PZIA 3QC3A 3T2QA 4B5TA 1GG1A 2VTFA 4WX2A 3GIYA 5IHSA 2A21A 3GRIA 2FHFA 3MA8A 3DXIA 2ESCA 4QAWA 5GNYA 4GUHA 2ISWA 3LGEA 2RGLA 5D09A 3AC0A 4HNVA 2GJLA 3F4NA 3IUIA 4ZOAA 5AZ0A 1W2PA 1NP0A 5ABEA 1SFJA 4EWJA 2CERA 2VEGA 2W67A 1UCWA 1UA7A 1ZHAA 4RDWA 3M7WA 1TPWA 2Z4GA 4O1DA 4HN4A 4LVBA 3RO8A 2EPOA 3KM8A 4UC5A 4CVUA 2G41A 3TC7A 4IPIA 3V5CA 5DN1A 3O2LA 4DNMA 3QJAA 1EJ7L 4UUIA 4LVFA 5CCZA 3LYEA 1AL8A 3DESA 1T5AA 4QS5A 2BS9A 2VX6A 1E0WA 3TOYA 4MTVA 2ZX8A 1XIEA 4DLMA 4KWSA 4S1FA 5GJNA 5C9XA 2FVKA 1XF0A 5XIAA 2XFFA 3GTXA 4QLJA 4PCPA 3GDLA 5D30A 3BGJA 3NZRA 4HCLA 2ZBTA 5CBIA 3NG3A 3A24A 3PPGA 3O6DA 3EA1A 4MG4A 2HISA 2J7HA 1JDAA 2WVTA 2OEKA 2VFIA 3IJDA 5DRIA 4OV4A 2WHKA 3VUSA 2WOQA 4E8GA 2YPIA 1UBSA 1H5YA 3V0UA 3UA4A 4QHRA 4TV5A 2J8FA 2PTWA 3GNXA 1J12A 1YEYA 3K8KA 1BWVA 3Q58A 2VGBA 3S9ZA 3M46A 4G1KA 4GQGA 2R82A 3SCRA 4IG2B 2QCDA 3ABSA 1J0IA 4GXMA 3D47A 3LS9A 2YA0A 2TPSA 4QBXA 1EBHA 4PODA 5BMWA 2OVLA 5HOSA 5T26A 3ORWA 4FXSA 2PAJA 4B15A 1OX4B 2LLEA 2CC0A 5IXEA 1MDRA 1VYPX 2CW6A 1EP1A 1G94A 3FLUA 4O15A 1A0EA 4PRRA 1UD6A 3FA3A 4OBRA 1W3JA 5AC6A 1HKVA 4J3WA 2VZTA 5TAOA 1N2VA 1IZJA 5L6UA 2QS8A 3OW1A 2QUTA 4HK5A 4GFSA 3HB9A 1ZJAA 1S2AA 1W1PA 2IPGA 1H4PA 3STGA 4KH2A 3L4WA 4NNCA 3G3MA 4CEXC 3CNYA 3F5KA 4H9YA 5C71A 4RX0A 1TG7A 3PWIA 3C2RA 5F4WA 2R1KA 2ZZ1A 4AHOA 3REQB 3V1PA 4UTTC 1A0DA 3NDYA 2UY4A 2CNCA 1NQ6A 1L6SA 2ZX6A 3QKEA 3N2CA 3C56A 5DRCA 3W2LA 3C61A 1KV8A 5EYWA 4DJFA 2P8CA 1SGJA 3IS4A 2D2GA 1D2KA 3GXMA 4JTCA 4J5NA 4L4PA 4INFA 2V5BA 4M3PA 3SZ8A 4K1GA 4GO9A 3AZTA 4H9MA 4QG9A 4JTEA 5F4XA 5FJJA 4A8RA 3SFWA 3C2VA 4O1FA 3T0TA 3ZSSA 2NX9A 4RDVA 1BXCA 2WHLA 1B57A 1EJTC 3DYPA 1KM6A 1IGWA 5DT5A 3MANA 2WZEA 1FDYA 2ZA1A 4NNBA 1P5BA 2D0FA 2FVMA 2XVGA 3SADA 3UXLA 3AO0A 3MYPA 3NQMA 4GWEA 4KFNA 1DWJM 4HSHA 4H6QA 2IKJA 4B5NA 3AHVA 1BVZA 3VNYA 4M6PA 1YE6A 3TUUA 3W71A 1RP8A 4JOMA 3OHIA 1JPHA 2YYUA 1NDWA 3CJPA 3FV9A 1P0EA 1MEHA 2Y7EA 3FXGA 2PDXA 4HMCA 3WMSA 3JS3A 1JCJA 4JX5A 1M7XA 1J0HA 3W1AA 4TUFA 2QDHA 3W38A 1HO4A 4NI3A 3TCEA 2D22A 2QW5A 4CCCA 2WC7A 3QY7A 3UJFA 1B2YA 1E4LA 2QCDB 1FWGC 3AS3A 3R94A 3U3HA 5BRPA 3QPZA 3APTA 1K02A 2BY2A 2NWRA 3GDRA 3KOWA 1W8GA 2CETA 3T4CA 4W85A 2OLHA 1V51A 1WZMA 2V82A 4NY2A 1XSKA 3BLLA 4CGTA 3ZIZA 3WH8A 3RU6A 1TKKA 1RBOB 4U4MA 4RV3A 3G18A 1QJWA 3MB9A 1JGMA 1W1ZA 3UW6A 2TYSA 4O17A 3KP0A 1DWHM 1R87A 2Z2AA 2Z7GA 5D9OA 5A3HA 1JDEA 5CXPA 4HCDA 1KBBA 4FX8A 4AD5A 1W5OA 3HPXA 4NJKA 3MUAA 4JQ4A 3UGRA 1OIMA 3NSXA 3W1LA 3CU2A 3IJ8A 3GW0A 4H41A 4PR4A 3C86A 1AW1A 1TV4A 3HBLA 4W8BA 2KZHA 3WNOA 3TXVA 1VEOA 3MVIA 3VFCA 1MZRA 2R24A 2PU0A 1ENUA 4KWWA 5J5DA 3MSYA 4UQEA 3HOJA 1QI2A 1Y5VA 2ZUWA 1VYRA 2X05A 4Y90A 3WQCA 2WJFA 5HK4A 3SGGA 4LAOA 5I3HA 1U5HA 4FK9A 1JCTA 3N25A 1B0IA 3N04A 2NX3A 4ZQCA 3LGGA 3T0BA 2NLYA 3RX4A 2J8GA 3C8FA 1QK0A 4NAEA 2ZA3A 1OFQA 3H4WA 1HP5A 4MSSA 3MMWA 4ZGYA 3EAUA 2DIJA 4WJ8A 1EF2A 3DFQA 1AFSA 5CH9A 3W7IA 4Z2LA 4FLQA 1NDVA 2DUAA 2X30A 4KFPA 4RZBA 3RU8X 5KITA 1BWLA 1W3KA 3BSMA 1O68A 1MZHA 1H50A 2ZXDA 5G1TA 3WH5A 4D6GA 3W6MA 1KBIA 5ECVA 3FDGA 2G4JA 3PTKA 3DX5A 1EPXA 2W3ZA 4F0HA 4AF0A 3GB6A 3WDIA 2O7QA 1XFCA 4YNGA 1I4NA 1GJUA 4GXWA 4UXDA 3AMGA 1XICA 4H6KA 1KQZA 3WBAA 3VIHA 3ATYA 1MQPA 2P3ZA 3PBGA 3RJXA 5EMYA 4HOXA 2E8YA 5H1WA 4DAFA 4HNTA 2PODA 4UMBA 1S5WA 4IIGA 4CKQA 3L7RA 3ZLGA 2IKGA 4GC4A 2P1FA 4M6QA 1JF6A 1VH7A 1WOBA 1H1ZA 3H55A 1ZB5A 3UVAA 3S6TA 1YMYA 3W2KA 4J27A 1OY0A 3VKBA 2OYKA 1KB3A 4AZ5A 1H7PA 3CQKA 3LZ5A 2WANA 4GIEA 5HJYA 1O6IA 2HPIA 1GTHA 3RM4A 4F0LA 1RD6A 4K8HA 1W37A 3VM5A 1SPQA 4C6MA 4C6NA 1KRBC 2MUCA 1KM5A 5GNZA 3OGRA 3DYMA 5JXQA 4NT0A 1VFOA 1FCQA 2J25A 4E0CA 1B3OA 4HA1A 1UR1A 3WLJA 2QKFA 4ADTA 1PJ9A 3BG5A 2VFGA 2INZA 4HQVA 1BGAA 1FWJC 1H62A 1P0BA 4DPPA 5JUVA 3LN3A 1ZAHA 4RUBA 1X38A 4UQAA 5I3GA 3UG3A 2CITA 2GGIA 4HB7A 2QJNA 1M41A 2QIWA