3U57A

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
502
structure length
471
Chain Sequence
NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
total genus 180
structure length 471
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u57A00
2WKLA 1EO7A 1Q4NX 3RDKA 2XM2A 4AZCB 4A3YA 4R5EA 2XVPA 2J7GA 1MXGA 3POHA 1HVQA 5A6LA 1VIWA 5DFAA 1WE5A 1LWHA 2WMJA 2WHLA 4CVWA 5CXPA 3AJ7A 1HP4A 3ZR6A 3AHXA 4HOZA 1UQZA 4HZ7A 3GNPA 1MW0A 3SUWA 2WHKA 4KMQA 3JUGA 1B2YA 4U3AA 3WDRA 2J7FA 4Z2HA 1UH2A 2V3GA 3AMCA 2X8RA 2VI0A 1MW2A 1BYBA 4WIWA 1IT0A 3AMLA 1LWJA 3SCVA 3U7VA 2CKRA 2YKKA 6CGTA 4B3LA 1D2KA 2BFGA 3CLWA 5DEZA 3EDDA 1W9PA 3WH8A 1I75A 1XD1A 5C71A 1H41A 2PB1A 3CZGA 1E0VA 2YDSA 2CEQA 1W91A 1CLVA 1O6IA 1E6PA 1ITXA 4GQRA 3ARUA 3OLIA 2WMGA 1NWSA 4AIOA 3WH9A 2W91A 3F5JA 4FLQA 4P7LA 3FAWA 5D9NA 2ZIDA 3NDYA 5GNYA 5DT5A 1MQRA 3M7SA 1E72M 2WSKA 4KRTA 3WQ5A 4U5IA 3ZOAA 1G9HA 1GORA 4E8DA 1BYAA 5HDRA 3L2LA 1X1NA 4PCSA 3QR3A 1BVNP 2WMIB 4Z2KA 2ZX8A 4RL3A 5ABHA 4W8BA 1QW9A 4W8LA 1KGXA 1MQPA 4ZE5A 3HN3A 1UQYA 1AQHA 2BY2A 4NRRA 2BV9A 2VZUA 1W9UA 3RM8A 4AD0A 1LL6A 5D8ZA 1CGVA 2WMFA 5CSYA 5BWFA 1CGXA 2V3FA 3AYSA 1A3HA 1VBUA 4CN4A 2GK1B 3KL3A 1ZBCA 3AIQA 3AXHA 2MANA 1W1VA 1W9BM 2VVNA 1I1WA 5A69A 3W28A 2CHNA 3BAJA 4F66A 2ZUSA 2DIJA 4QLJA 1HVXA 2J7DA 1L8NA 3WH6A 2D1ZA 5LA2A 4JFSA 5D9OA 3TOPA 2VMFA 3N1AA 1E4NA 1YQ2A 4YHGA 4B16A 2WWCA 1R87A 1V3MA 2G3JA 2Y4SA 4UZUA 1H3GA 4MJ4A 1Y7VA 1MVYA 4CD8A 1LL7A 2PWDA 1NOUA 1XYZA 3O6AA 3SUUA 4W84A 4TX8A 4B9ZA 4CN1A 5LYRA 1ZL1A 2ESCA 2E8ZA 4UFJA 4GQQA 1YHTA 2BHYA 3VIIA 4MNKA 2UY4A 3PZNA 2WBKA 3BAYA 5I5RA 1CECA 2XVKA 3UCQA 2FH6A 3W0KA 2ZXAA 3APGA 4IISA 3I3DA 1EXPA 1ISXA 3CUGA 5E0FA 4F8XA 5HNNA 3CZKA 3CUHA 3ARZA 2ZUVA 2QF8A 2GUYA 4LYRA 2WC7A 2J7HA 3OG2A 1J0YA 3D5HA 4J7RA 4PMVA 3GXIA 5E70A 3MMUA 6A3HA 1R8LA 1E55A 1KFWA 4HU0A 5EMYA 3VDCA 1B31A 2XG9A 1EDTA 5A1AA 3DHPA 5GNZA 4R27A 5I0DA 1XCXA 1B3YA 3VDHA 1OBAA 3TONA 2WPGA 4GO8A 3N13A 1BQCA 2DT3A 4AIEA 2ZE0A 4D72A 1V03A 4HZ6A 4JAWA 3EDKA 1KCLA 1V08A 4HOXA 2DSUA 4LXFA 3ZSTA 1UKPA 4PTXA 3VIFA 4HP5A 3GM8A 1WDQA 2FGLA 1WAWA 1QI5A 4CU8A 1CWYA 4LQ1A 3ZJ7A 2BS9A 5D8WA 3WD4A 3WNPA 1U30A 2VRJA 1F4AA 2XM1A 3HMCA 1JL8A 1UKTA 2VCAA 3EMQA 4HMEA 4AD2A 1R7OA 1VBRA 1EA9C 3BC9A 3EYPA 2VTFA 3KL5A 2XFRA 1VRXA 1H1NA 1HP5A 2OYKA 2F61A 2PI6A 4OBSA 4S3KA 2Q8XA 2D24A 3IANA 3PZOA 1MYRA 3WUGA 4H04A 2QPSA 4ACZA 2E0PA 1E6XM 1M03A 4OOZA 4NSBA 1V02A 5IFTA 1UWQA 2VQTA 3CH9A 3TP4A 2DQXA 1OIFA 2X0HA 2YL9A 2BXZA 5E09A 1SFSA 4IPNB 3AIWA 1HJXA 1BHGA 3UG5A 2O9PA 1XRVA 5DT7A 5BXPA 1BGAA 1UKOA 1MW3A 1OT1A 1W9VA 3W81A 4CUCA 3VVGA 2WYSA 1UH4A 4FK9A 1GZJA 1QI0A 3FN9A 4RE3A 1U33A 1UWTA 3BSGA 1B9ZA 1B3ZA 3BGAA 2EBNA 5BROA 1DWJM 3KWXA 3AIBA 2W92A 2WW5A 4ZE4A 3WMBA 2YL6A 4UFHA 1V6UA 4D6JA 3BMVA 4E8CA 1E43A 1E0WA 2PWGA 3GNRA 4GZEA 1C90A 3AFBA 5A2BA 1OCQA 3G6MA 4XZWA 1CGUA 1CIUA 2PBGA 1HKMA 1ODZA 3BSHA 4EE9A 3ZIZA 3BXWA 3WNKA 2BVYA 5AYIA 1H09A 1E73M 1VFOA 1UD8A 2J62A 3IAQA 1V6XA 4HTYA 3AI0A 1GHSA 1R86A 2WVVB 1QHPA 4KGLA 1EOKA 4URIA 3U5YA 4DWSD 2C7FA 3NDZA 4D6IA 3ZQ9A 3WMSA 1GOWA 3N17A 3MMWA 2CHOA 2D23A 2J77A 3WF0A 5CSUA 3L4UA 4UZSA 2O9OA 1JI2A 2GJXA 3BH4A 1JF5A 4GXPA 1LJYA 2OSWA 2JALA 3EDEA 2GFTA 4JL2A 3BMWA 2EPNA 2DH2A 2JE8A 5I23A 4TTUA 2CBVA 3VD7A 1JZ5A 4JIEA 1CZ1A 1W1YA 1JD9A 1CENA 1W3HA 3T2OA 3VMPA 1EQPA 3WY1A 4PCTA 1XH0A 1UD2A 1EOMA 1B30A 1DWFM 1JI1A 3W26A 2UY2A 1QHZA 1E0XA 1K9FA 2XVLA 3HU7A 2DSZA 2YBUA 3QHMA 4F79A 4MTVA 4LGXA 4UQCA 2CCRA 4AD4A 3LPFA 3TA9A 4FLSA 5CPSA 4OIFA 4E4PA 3ZJ6A 1E6NA 2J25A 3LPGA 2IXVA 1V0NA 2EXOA 4CD4A 1UWIA 3VDAA 2Z1KA 4CCDA 1E71M 4W5UA 3SCOA 4PUDA 2G41A 3VMNA 3WF4A 2CESA 3VD3A 2DT0A 3CZ8A 4ATLA 2NSXA 2V5DA 4UOQA 1XD0A 5IFPA 2D3NA 4M81A 4WK9A 1KBBA 2YL8A 2XUCA 2BY3A 1MXDA 1QVBA 4DUVA 3L4XA 3SUTA 4Z2GA 4UFKA 2O9TA 3QOMA 4MB3A 2W5FA 3CBWA 1KQYA 3RM4A 1VFMA 2FHBA 1E5NA 4ZXLA 3MUIA 4PRWA 3F5LA 1HKIA 1ISYA 3DYOA 3PTKA 3L4TA 3AIVA 1DWHM 2DEPA 1C7SA 4U31A 1CYGA 4WSJA 1C8QA 4UOZA 2C0HA 2D22A 4CCEA 4GKLA 4YN5A 1JYVA 2E9LA 1H4PA 4GZJA 1FFQA 1XC6A 3ARSA 2BVDA 1J9YA 1UZ4A 2WXDM 3BAWA 2J75A 1L0PA 2NW0A 3UG3A 1KGWA 3B8SA 3DYPA 4JHOA 4H8HA 3ZT6A 1M7XA 1GUVA 2WLZA 3O2LA 3MMDA 4PSRA 1UYQA 1HJWA 2BHUA 3ZT5A 1OIMA 1HN1A 2C8NA 1GQKA 2VRQA 2PBOA 2YBTA 3AHVA 4Z2JA 5E6ZA 1WNOA 4TVUA 1JZ7A 1GW1A 2NT1A 3BAIA 2WK2A 3CIVA 1BVZA 2J47A 2VL4A 3PZQA 5DMYA 5JUVA 4HA1A 2NT0A 3L4WA 1HF6A 2E9MA 2WC3A 3ARWA 1LLOA 3FXYA 1XCWA 4D6HA 3VINA 2ZX7A 1GOMA 1EQCA 4NI3A 1WDSA 3MUY1 5FD0A 4B3KA 1RP9A 4BQ5A 3VOCA 1Q6GA 4JFTA 1BAGA 3T08A 3AROA 2Z1SA 3SCQA 2V5CA 1CXEA 2WM0A 4FF5A 3WN6A 5EB8A 5A3HA 4JFUA 4D1IA 2VNCA 5CJ5A 4UFLA 4D6FA 2E8YA 4XUYA 1E70M 4PMNA 4CN6A 1H5VA 3KE0A 1ISZA 1V3HA 4AW7A 5BCAA 2HVMA 1TVNA 3UEQA 4A4AA 5A6MA 1HKKA 3ZSSA 2CPUA 5CPQA 4JCMA 3QHOA 4PBGA 1HIZA 1KQZA 1BG9A 4TVCA 1JZ2A 3LPPA 5I78A 3WD0A 4QCFA 4D6EA 4N42A 3AXXA 2J7BA 4Z2LA 4J3XA 4D6GA 1GNXA 3MSDA 1LG1A 1JD7A 1GPFA 2CITA 7CGTA 3T0DA 2AOSA 4F9JA 1HJSA 4Z2IA 4D71A 3SURA 3WNLA 5IDIA 3T2PA 5A8OA 2WVUA 3SEPA 2JEQA 4U2YA 1W1TA 3MV01 4HOWA 1GVYA 3NYDA 1H0GA 4DWSA 1KCKA 1UOKA 4PSPA 4AEEA 1DWIM 4PN2A 4WJXA 3CO4A 3S2CA 1EDQA 3GNOA 4JHZA 2XSAA 2GVYA 4AC1X 1QHOA 1J0JA 4EANA 1QNQA 2A3BA 5AC4A 1M53A 3AHYA 1VB9A 2VX4A 1CNVA 1IZKA 5A8MA 1W3LA 2QV4A 3VIMA 5A95A 5JBFA 1HJQA 4D1JA 3VU2A 1V3KA 1E15A 4W8AA 2ZX9A 5TD4A 2OYMA 1J11A 4UR9A 4EKJA 3AQUA 1CPUA 4UQEA 1PIFA 3BLKA 4HPGA 4MDOA 3RCNA 3WDHA 1V0MA 2O9RA 4D6CA 2JF7A 4MADA 2V3DA 3WUFA 3VM5A 1G0CA 2JFEX 3UR7A 3RJYA 3WF2A 1C92A 2X0YA 2VURA 1VAHA 2XGBA 2GDVA 4MB5A 1NH6A 1I1XA 2ZUMA 3PHAA 1N82A 2ZXDA 2WHMA 4P7RA 2G3MA 1ZS2A 2J79A 1FHDA 2WBGA 3CMJA 2DT2A 1ZBKA 3M07A 3IJ9A 3A4XA 4WF7A 5HXMA 2D3LA 2D20A 5A6SA 4U3CA 1NWUA 1C8XA 2IXUA 3CGTA 4TX6A 1ECEA 1DEDA 3SCSA 1C8YA 2E3ZA 4W5ZA 4TUFA 3AS2A 1W3KA 3CHEA 4HZ8A 1TFVA 4U2ZA 3T0AA 2CBUA 3ARVA 1XV8A 3AOFA 1CGWA 2XIBA 4DUXA 3L2MA 1TA3A 2QMKA 4YPJA 3POCA 2ZWZA 3W37A 2PC8A 3AIRA 4N0RA 3W25A 3A4WA 1BLIA 1W9DM 2OWXA 2VUYA 4H2CA 2BXYA 1K9EA 4PMOA 5FL0A 1W2VA 3MS8A 1V6VA 4MAVA 5DF0A 1E1FA 3PN8A 4W88A 3WQ8A 5A94A 3TTYA 3OA5A 2X1IA 1X6LA 1QI3A 2WZEA 1E4IA 1WDRA 4AZ5A 4UTFA 3F5KA 1J01A 3THDA 4Q22A 3O9NA 1ZB5A 1AQMA 4FLOA 1JAKA 4UNIA 1EO5A 4MAZA 3B9DA 4NF7A 5A2CA 4EK7A 3AMGA 1TA3B 1A47A 1WZLA 2EPOA 3CPUA 4J27A 4L4PA 3WUBA 1TR1A 1UA3A 1CXKA 4UCFA 1J0KA 4QLKA 1PIGA 1H2JA 2XFYA 4HMCA 3WFZA 1QI2A 3WH5A 2VCCA 4LYPA 4UQ9A 1NWTA 3FW6A 1FFRA 1ZBVA 1HL8A 1B90A 1F4HA 1W2PA 3W38A 5EBAA 4OJYA 2EJ1A 3OIHA 1E6QM 4MB1A 4PUEA 5A8NA 3NSMA 2XGIA 3VGGA 3SCTA 4Q7NA 2CYGA 1JGIA 2XHYA 5E6YA 5GPRA 5HOSA 4W7WA 1K9TA 2EQDA 3T09A 4UQAA 1GOQA 1WB0A 1US2A 1V3IA 1DWAM 3CHDA 3WDJA 5HBFA 1KXHA 1V3JA 4OZOA 8A3HA 4MJ2A 2TAAA 1VF8A 1M04A 1ZJBA 1AQ0A 2CXGA 1O7AA 4DUWA 1JG9A 4HMDA 3UESA 2HISA 2EPMX 4F9DA 4PTWA 3ARPA 4H8VA 2QLYA 4Y7EA 1HT6A 1NP2A 2VX5A 3VX1A 3NJ3A 3PZMA 2Y2WA 4GI8A 3WKZA 3PZIA 3U57A 3AHZA 3AIUA 1PX4A 1VFUA 3G6LA 3FY1A 2RGMA 4AZCA 1GQJA 4EAMA 3MANA 1W32A 3B9AA 2DPEA 3MO4A 3WD1A 1MQQA 3RM9A 3SCWA 1VEOA 5I3DA 1CBGA 4AMCA 3U5UA 2G8ZA 4BQ4A 8CGTA 3RJXA 1BG4A 3IAPA 1BFNA 5ABEA 3WEZA 5M17A 5CG0A 2J8GA 4M8UA 3WQVA 3WSUA 1MFUA 1QBBA 1XSKA 2EEXA 3ZJ8A 2OSYA 2DSKA 5DO8A 1V6WA 2J78A 3ZM8A 5A8QA 2JIWA 1JNDA 4WLCA 1B3VA 4GINA 1HXJA 3AZRA 1QI4A 1JDCA 3TTOA 2VX7A 2YL5A 2Y5EA 3CUJA 3WMCA 1UR2A 4IUGA 4OOUA 1GONA 3K8LA 2BNJA 1FOBA 5CPTA 3NIYA 3KL0A 1LG2A 1TCMA 5BRQA 1QNRA 1H11A 2YLLA 3WD2A 1E4LA 3WDPP 3ECQA 1XSIA 4U5KA 4CD7A 3K4DA 4QP0A 4M29A 3PTQA 4WKFA 1WP6A 5FOOA 3RILA 2W61A 2ZXBA 1WZKA 2XWDA 1WCGA 1MFVA 4H8UA 2W4XA 3AS3A 5BRPA 1QNPA 2YIHA 3VPLA 1US3A 3KEHA 2VR5A 3W27A 3WL1A 1BSIA 1V3LA 4KH2A 3OGVA 4GI9A 2J8FA 1W9XA 2OWCA 1E40A 3W6MA 1C91A 5AY7A 1W1PA 4BA0A 3VGHA 1CGTA 3AHTA 3VIKA 2FHFA 4B15A 2YA0A 1RH9A 3GXFA 3SUVA 4PEEA 4ZXOA 3SCNA 4AZBA 5D9PA 3U7BA 1OSEA 7A3HA 4ATWA 1G1YA 5JIPA 5I79A 4ATDA 3E1F1 1VEPA 2CBIA 2GK1A 3PZUA 2WNWA 5CGMA 1DHKA 4CCCA 2VO5A 4OUEA 1KGUA 1HX0A 2XFFA 2Y8KA 4RE2A 1E56A 1SMDA 3N11A 3WF3A 3PZVA 4UQBA 2VRKA 2GSJA 2DDXA 1EGZA 3RPMA 4JFVA 4P8UA 3PBGA 5BXRA 3K46A 1X6NA 5FCZA 5EFFA 1PZ3A 3ZMRA 4W93A 2A3AA 4M82A 2JF6A 4WKAA 1ZJAA 2W62A 2YOCA 2OYLA 1E4MM 2BY1A 2YA2A 3IK2A 4W86A 6TAAA 4X9YA 3W82A 5FIPA 4BS0A 1KXVA 1EDGA 1ZBWA 2W67A 3M46A 2FHCA 3VD4A 3FAXA 3WDIA 2GJRA 1BYDA 2F2HA 2G4FA 4C7GA 1XH2A 3OB8A 1VJZA 1UH3A 3GYCA 2WSPA 4ZEPA 4IPLA 1UKQA 2Y24A 4H7VA 2VZSA 2WCAA 4TXEA 1JYWA 2ZUTA 1ISVA 3VIOA 1CXFA 3VIPA 4V28A 1WZMA 3L4YA 4X0VA 3UETA 3AXIA 1SR0A 1JZ3A 1FHLA 1JZ8A 2G3IA 1CEOA 1RD6A 2CERA 3VUPA 5FKYA 1HNYA 3GXMA 3BAXA 4C7DA 4JKKA 2D2OA 2QMJA 3CHFA 1UR8A 4XB3A 3GBEA 3VD5A 5AYBA 1PBGA 2WAGA 2WCGA 3WUEA 1TVPA 2VVSA 3AMKA 4DM2A 1E3ZA 1OGGA 4IM4A 4C7FA 4OKDA 5JIWA 1PAMA 3ZJKA 2YDQA 1HKJA 3VD9A 4GO9A 4JFWA 4A3HA 4TOQA 4PTVA 4P7OA 3S6TA 1JFXA 3UR8A 1CTNA 1XGZA 3VIHA 1J0IA 3VGEA 1EH9A 3N18A 1EHAA 1CDGA 1LQ0A 2F8QA 1B3XA 2YA1A 4LX4A 3VILA 4PMUA 3MKKA 1JIBA 1JDAA 1FA2A 2Y8VA 3FHQA 5C8BB 1G94A 1PX3A 2EPLX 1XSJA 2WWDA 2WVTA 1KBKA 3WH7A 1NQ6A 2DGAA 5A6AA 3WQ6A 4AZ6A 2V3EA 4MNLA 1CGYA 1WKYA 5I77A 5KEZA 3WD3A 1CXLA 4CD6A 4DWSB 4AIUA 1ODUA 4LYQA 4BZYA 1OD0A 2VZTA 3VO0A 4MDPA 1B3WA 5A6BD 3K1DA 2X05A 4M1RA 3WFLA 1OB0A 1QNSA 1OWQA 1H49A 1BGGA 3K8KA 3ARQA 3FHAA 2YJQA 4AXNA 2D0FA 1C3FA 4AY1A 4L4OA 3SIMA 1K9DA 4BF7A 1C93A 1SMAA 1GVIA 1UHVA 3PTMA 1MWOA 1S46A 2AMGA 3SCPA 2WVSA 4OBRA 2ZWYA 4JKMA 4YHEA 5CZKA 1V6YA 4BQ2A 3N9KA 4J3SA 4XX6A 2OWWA 1J18A 4E2OA 4TTGA 1M01A 2ZX5A 5I24A 4PMYA 4HU8A 1TUXA 2XTKA 1CXHA 4AD3A 5LA1A 4CVUA 1E1EA 3NSNA 2DIEA 2QPUA 3GDBA 3KZSA 2X09A 4AD1A 1PPIA 3DYMA 4GIAA 5CLTA 3GH5A 1QPKA 4ML4A 2PWHA 2UY5A 2GDUA 1XHGA 1BF2A 3EMZA 4M56A 3BAKA 3L4ZA 1JYNA 2VT0A 3VTRA 1UD4A 5EFDA 2PWFA 1UZ1A 1JXKA 2RGLA 3WEOA 4ZENA 2VR4A 5A8PA 2CIPA 1K6AA 1GJWA 3W29A 1HL9A 2CETA 1OT2A 1RP8A 2BHZA 4QFUA 5GNXA 5ECUA 2XYLA 2WZHA 3QOKA 1B1YA 4J3VA 1Q6DA 2D0GA 4AEFA 2BVTA 1UD6A 2JEPA 1GJUA 3OBAA 5C70A 4UQDA 3ALFA 3CTTA 1RPKA 2DT1A 3HJEA 2XVGA 3VGDA 4DWSC 2ZX6A 3SCUA 3BCFA 1W3JA 4PMDA 1GOOA 1JXJA 1KR0A 4JL1A 1NARA 2V38A 3OZOA 3UG4A 1GOIA 3K8MA 3SCRA 3QGVA 3CUFA 3TTQA 5CLWA 3I3BA 3D3AA 3GXDA 5CQ1A 4UFIA 1HJVA 4QLLA 1UR0A 4W7UA 5HPCA 3AYRA 1AMYA 1FH9A 1NOFA 4DM1A 1TG7A 2EO7A 1KWGA 4QCEA 1OGBA 3RMEA 1Q6FA 3ARXA 4JCLA 4QAWA 3ZT7A 1E5JA 1MW1A 3EBVA 2CBJA 1NWRA 3WIJA 3DHUA 1FP9A 1TZ7A 3A47A 4K68A 3MUAA 3WEMA 3OLDA 2G3NA 1J0HA 3A3HA 4AZHA 3MU7A 3OLEA 3AZSA 3BLPX 3WL0A 1UKSA 4M80A 1GHRA 3PZ9A 5A2AA 3CZLA 1G5AA 1TE1A 1OINA 3PZTA 5FL1A 3AICA 4J3WA 1UWRA 1U2YA 1QW8A 4PMZA 2PWEA 3OGSA 4UOJA 3EDJA 4W7VA 2DSVA 1P6WA 3DC0A 1V0KA 1KXQA 3WNNA 4CD5A 2WKGA 1FH7A 1UWUA 3OLGA 2X2YA 3W4RA 1QNOA 1VEMA 4JZ5A 2VJXA 1XYFA 4V27A 4XV0A 4ZFMA 4J28A 3GH4A 4P7NA 2XSBA 1FH8A 1J12A 2IUZA 2WHJA 3NCOA 5JBDA 2OSXA 3BCDA 2WB5A 2VC9A 3PZGA 1ITCA 4P7QA 1E6RA 3AZTA 3A6OA 1KWKA 2W66A 1ZU8A 4GI6A 3VGFA 4S3JA 3A4AA 3CUIA 3WENA 2ZICA 3RIKA 1TMQA 1UD5A 3W24A 3TTSA 1KB3A 1GOKA 4P8XA 5ABFB 1SYTA 1BYCA 2FGZA 4BCEA 5D9MA 2A3HA 2XVNA 4D6DA 1GQLA 4BQ3A 1EIBA 4AISA 2PF0A 5HPOA 2WCSA 1JF6A 1UWSA 1UR1A 1BPLB 2CNCA 3AS0A 2YLAA 4PMXA 4QDMA 1ESWA 9CGTA 3AISA 1PJ9A 4ACZB 4J3UA 2CKSA 4AD5A 1OD8A 5JBEA 3NUKA 3WNOA 1BTCA 1E6SM 4PMQA 1C7TA 4X0NA 2ZOXA 2ZUNA 3IJ8A 4HA4A 3VX0A 4B9YA 2A3EA 1QBAA 2AAAA 4H41A 4HPHA 1JDDA 4NZCA 3CHCA 5A6JA 1JNEA 1FP8A 5I2UA 5ABFA 3W6LA 4U33A 1KR1A 3T2QA 4AYSA 4RE4A 2WMIA 3J7HA 2XWEA 4LPCA 2O92A 5A6KA 2WMKA 3VNYA 2YDRA 5F7UA 3WF1A 1UG6A 3VMOA 1JFHA 1V0LA 2BY0A 2ZXQA 1ISWA 2ZUWA 5GQBA 4WSKA 3WQWA 5A6BA 1Q6CA 4TVDA 3CZJA 4GZIA 2UWFA 4W85A 3MSGA 2E9BA 2J4GA 1CLXA 3ALGA 4J3TA 4PTMA 5LA0A 4JKLA 2JIEA 1G01A 1OGSA 3GTNA 4HA3A 1QOXA 2VZOA 3VIGA 5IXEA 7TAAA 1J0ZA 2WVVA 1WDPA 3K4AA 3GBDA 1PZ2A 2J7CA 2GJPA 4ACYA 1H0IA 4AZ7A 1NP0A 4AWEA 1VFFA 5ABGA 3EDFA 4MNMA 1E3XA 1Q6EA 3QHNA 5E0CA 1D7FA 5IHRA 1IV8A 4MPKA 3OZPA 3F4VA 2FH8A 3VDBA 3WBEA 3DECA 4UFMA 3ARTA 2VX6A 3VM7A 3L4VA 2GJXB 3N12A 1UR4A 3LMYA 3VKKA 3W53A 3THCA 4W89A 3WQ4A 3VNZA 4PMRA 4CU7A 2WC4A 1Z32X 3M6DA 1PEZA 4WKHA 3N04A 2DSWA 3VIJA 4GPNA 2FDMA 1NOWA 3AMDA 4V2XA 1JZ4A 1WZAA 3I3EA 3AIEA 4CU6A 1R85A 3WNMA 3WELA 4MNJA 3CMGA 4FMVA 1WPCA 1E6ZA 2WZIA 2D0HA 1IZJA 3NSXA 4P8WA 4AZIA 2J74A 2UY3A 1KXTA 4KGJA 3B9EA 1UR9A 4PYSA 1GQIA 1HJUA 5IHSA 1UA7A 1E9LA 2E40A 3OGRA 4KWUA 3CZEA 3WDQA 5AC5A 2EPKX 1WO2A 5M03A 3EMCA 1NM9A 1JZ6A 5E9AA 4NRSA 3AS1A 3ZR5A 3ARRA 1OM0A 4MB4A 2QHAA 2E4TA 3ZO9A 1DWGM 2VOTA 4CKQA 2XJ7A 4P8VA 1VENA 2B31A 1V02E 1UUQA 3MUZ1 2J7EA 1VJSA 2W63A 3GH7A 1LL4A 1B0IA 1XH1A 1JYXA 3VGBA 2WMHA 2OLHA 3UERA 1EHNA 3II1A 3WBAA 3LPOA 4KRUA 1DP0A 3MV11 4CGTA 5CGTA 3SUSA 3IJ7A 5BXSA 3FNDA 4M24A 2WLYA 4AZGA 3T0BA 1CXIA 2VCBA 5KZ6A 1GCYA 1AVAA 2XIIA 5M5DA 1R7AA 4W87A 2VZVA 3ARYA 1JAEA 4XZBA 3RO8A 4FLRA 5D4YA 2DH3A 2XPKA 1J10A 3N15A 2VQUA 5M3WA 1D3CA 1DTUA 1PX8A 2WANA 1UD3A 5BYWA 3GZAA 2ZUUA 5BXTA 2A3CA 1LF1A 5I6SA
chains in the Genus database with same CATH superfamily
5DCBA 4Y9PA 4XAFA 1GEQA 1WX0A 4R85A 3CTLA 3WBWA 5A6LA 1KTCA 3AWNA 5DFAA 1LWHA 2V2HA 2ATMA 2WMJA 5CXPA 3AJ7A 3C4UA 4MMWA 1JPIA 2I57A 4OUIA 4O1BA 2QUUA 3EXRA 3G3DA 2GUBA 1RBAA 2CZFA 3GO2A 4L1GA 5HMFA 1YE6A 2FMOA 2G37A 4GA8A 4IPJA 2PODA 1B9BA 3QLDA 2GQ9A 3W2NA 3NPUA 3WQOA 4Y8FA 4IMAA 3SCVA 4PCFA 2YKKA 2WZMA 2B7PA 6CGTA 4BF5A 3CLWA 1R3VA 3QXBA 5JVLA 1FRBA 4AWSA 1D8WA 3L5MA 2CEQA 1Q63A 5HULA 1VR6A 4GQRA 4HMNA 4PUWA 3MWAA 1ZSXA 1NWSA 3PY2A 2VWTA 3WH9A 2NXHA 2GGIA 4RDYA 2QGYA 1K3UA 4JX5A 3W6YA 4FX7A 2JKPA 3PFRA 1FDZA 4FF7A 2E6YA 4I3GA 1SSGA 3O0KA 4FALA 4MFDA 2BASA 3I10A 4E8DA 1BYAA 1HZYA 5HDRA 4KBXA 1L6WA 4PCSA 1XKYA 2YB1A 3OW1A 3QLLA 1HL2A 2A2IA 5KZEA 3TUUA 4Y90A 3QTGA 3PBMA 5ABHA 4ZE5A 1UQYA 1AQHA 4RNFA 4NRRA 2BV9A 5DMLA 1LT8A 3WJSA 4LUYA 1XGDA 4DRSA 4R88A 3W85A 4CQ8A 2FB3A 3UWVA 5RUBA 4FP1A 3E02A 3W3OA 3W7OA 3BLOA 2H3BA 1GPWA 5K3VA 3UZWA 1A3HA 2GK1B 3BLEA 1ZBCA 3MBFA 4NYYA 1CB7B 5HJXA 2CHNA 3PSVA 4F66A 2ACSA 3QJAA 2XH7A 1L8NA 2RH9A 3OOQA 5D9OA 1ZNNA 4CCZA 2VMFA 5FEZA 4Z0SA 4DJFA 4G9PA 1YQ2A 4ZO6A 2VP8A 4B4FA 1R87A 4UZUA 2QW5A 2QF7A 4O19A 3W01A 1MVYA 3L5LA 1BSLA 1LL7A 4EXAA 3CV1A 4ICMA 4LANA 1BWLA 4W84A 4LV4A 2C1GA 4G7EB 3ZYZA 5LYRA 3I65A 4UFJA 4GQQA 5DN1A 3CB3A 3AU2A 4PTDA 5F2GA 3KW3A 4MNKA 2TMDA 4M6PA 5G4WA 3NL5A 3BAYA 4JNMA 4O8AA 2QDEA 3KX6A 5K7JA 3GC2A 2Z00A 4QDWA 3B8DA 1Z42A 4H9UA 5HNNA 2VD8A 3SN4A 3V0TA 3ARZA 4A8NA 3VOHA 4JEQA 3VE7A 2QF8A 4CNNA 2YDAA 4GJIA 4XKMA 4YWSA 1GJPA 3S46A 3L65A 3S8HA 4XVDA 5DBTA 1SZNA 5J5RA 4L61A 5CC7A 2EAWA 2XZ9A 3W2LA 3GXIA 3W1AA 6A3HA 1R8LA 1E55A 1NEYA 1B31A 2XG9A 2B7OA 4IFRA 3HPFA 3QSTA 1XCXA 1B3YA 1Z69A 1OBAA 2ZE0A 4D72A 4S2CA 1V03A 1RD5A 4JAWA 3KTXA 4GOAA 4GRSA 5T9BG 1KO0A 4Q6JA 3SECA 1QTWA 2PTXA 1CWYA 5D8WA 3WD4A 1U30A 3UWEA 2XM1A 3HMCA 4PUNA 2VCAA 1LORA 2P0OA 3BW2A 3RK8A 2IPGA 1VBRA 1EA9C 4JY9A 4ADTA 2XFRA 2ANUA 2R82A 1S2TA 2FVKA 2F61A 2PI6A 3URBA 3G3MA 2Q8XA 4OFCA 2D24A 3RX3A 4RDWA 4ZOCA 2XFWA 3PJTA 1M03A 4XBKA 5AHFA 4NSBA 3SN0A 5BMXA 2YBVA 2X0HA 2YL9A 4G1KA 4Q4KA 2BXZA 3APYA 4O17A 1XRTA 2EGZA 1UIOA 2O9PA 5BXPA 1KRAC 2A79A 5DT7A 5C2GA 1TPUA 1OT1A 4IQLA 2QCDA 2BGNE 5KITA 4MZ1A 3C0JA 3H2OA 1QI0A 4E8GA 4O13A 3MMTA 4JTTA 4GCXA 3BGAA 3KTSA 2EBNA 4MYXA 4M7SA 3KWXA 3W1TA 2W92A 2Y89A 2WW5A 4ZMGA 4UFHA 4E8CA 3WQGA 1E43A 2OJPA 2PWGA 1UP3A 5A2BA 4QE4A 3A24A 1NTHA 3WQFA 3BSHA 3ZIZA 3C52A 4RV3A 5LNSA 1QO5A 4Q8VA 3DFYA 5HWNA 1Q7MA 1I0BA 4EPBC 1UD8A 6ENLA 4A3RA 1W1ZA 4NVTA 4JNZA 3WBXA 4HTYA 4B2DA 4MSSA 2B7NA 4DQWA 3STCA 2J6XA 4C1NA 5HAOA 1JCXA 1XISA 4DJDA 3WMSA 1YADA 3N17A 1FHVA 3MMWA 1E0TA 2D23A 1TJRA 2J77A 4K7VA 5A5WA 1Q4WA 2CLKA 1YXCA 3W7IA 2DP3A 3MYOA 1S3HA 3BH4A 2PURA 3IGUA 4FX8A 1OK4A 3P61A 2FGBA 3R4IA 5FEPA 1TR9A 3O3RA 2QXWA 2H8ZA 4TTUA 5I23A 4N02A 2CBVA 3ITOA 4JIEA 5DANA 3E0IA 1W1YA 4CNUA 1FWCC 1EQPA 1LP6A 1THFD 1B30A 2TYSA 3DESA 2PRMA 2DSZA 4PGLA 4O10A 5F1VA 4F79A 2J9XA 3MSRA 4AD4A 2ZBTA 3H7VA 5CPSA 1A5NC 1IEVA 3OP2A 2WOQA 3P5ZA 1DVJA 4LJ3A 1IE7C 2CWXA 3PWAA 2WKJA 2EXOA 1UWIA 3H7RA 1E71M 1CT5A 4W5UA 3M47A 3TTEA 3S4TA 4B5WA 3VD3A 1A3WA 3CH0A 1MSSA 3R12A 5IFPA 1T96A 3E0LA 4WK9A 1P0KA 3QVQA 3YPIA 1MXDA 3VA8A 2UV8G 1QVBA 1XF0A 1FWHC 4RW3A 7XIMA 4L1XA 4UFKA 2OGYA 3GTIA 4GX9A 4O1DA 2O9TA 4EVZA 4AYGA 2C6QA 2W5FA 3CBWA 1FQ0A 2FHBA 3FK4A 4UMCA 4PRWA 1R5YA 5EPDA 1OFAA 1ISYA 5DY2A 2UBPC 3C8FA 3VFCA 4U10A 2F38A 5DX7A 4LAMA 3BMXA 4ZQRA 4U31A 4UOZA 3PNZA 4DO7A 2W79A 2D22A 2VFIA 4CCEA 4XTDA 4IFOA 3MI3A 4XAGA 4QSFA 2X7VA 1M6JA 5HR7A 4LV9A 3W71A 3MDUA 1FFQA 2HQAA 2ZTKA 4KEMA 1J9YA 1L6SA 1E1CA 3E74A 2DZBA 3LSCA 3FOKA 3B8SA 3NAVA 3OIXA 4JHOA 4XZLX 3ZT6A 1M7XA 2FYMA 1GUVA 3AJXA 3NZ1A 3MMDA 1PDZA 2VRQA 3ZT5A 2VM8A 3AHVA 1AW2A 5DQPA 2JGYA 1TWWA 3LCFA 3XIMA 4TVUA 2NT1A 3BAIA 2DY3A 3GUWA 2WK2A 2A7PA 2NWRA 3N2OA 3ITVA 1BVZA 2OMAA 4A05A 1SO6A 4AXKA 3DI0A 4C6KA 4QAIA 3P7YA 4HU3A 1YDNA 2E9MA 2WC3A 1YNPA 3SN1A 1LLOA 3FXYA 1XCWA 2ZDRA 3IUHA 1WDSA 3PPHA 2DZAA 2X41A 1RP9A 3ABXA 3H53A 1Q6GA 4JFTA 5DLCA 5U4NA 2OZ3A 4JQ4A 5CPNA 2AQWA 3SCQA 4LRSA 2FZBA 4FF5A 3H2AA 2WNNA 2E8YA 3BQ5A 1Z89A 5BCAA 1H7WA 3ZR4A 1DJQA 1TVNA 1LM1A 1EKOA 2IS7A 2DZXA 1DQWA 2CPUA 4AWUA 2RDWA 4JCMA 2QULA 1KQZA 1JZ2A 2V5JA 4UTTC 1JDFA 3KLKA 4DXKA 4DHGA 3M6YA 4HK5A 1FWJC 4J3XA 4JQ1A 3KBVA 2VDGA 1V7AA 3SFKA 3U2ZA 3VKCA 1GNXA 4PR4A 2CITA 3KHDA 7CGTA 2AOSA 5D30A 1HJSA 3SURA 1UOZA 3N9RA 2PP1A 3NG3A 4B5TA 3A22A 2JEQA 1H5YA 3SGGA 1KM5A 4W9TA 3MV01 2XDFA 3NYDA 5C9RA 1H0GA 4C65A 1KCKA 1UOKA 4AEEA 4WJXA 3CO4A 2VC5A 3GNOA 3LRKA 2GVYA 4OWGA 3M43A 1O4UA 1J0JA 4QS6A 2ABBA 5AC4A 4H8NA 3D0CA 1VB9A 5F4XA 4QTGA 3VIMA 4XQ6A 4WUIA 4NZ5A 3W22A 7REQA 1TIMA 3IJLA 3RNDA 4E0CA 2R24A 2PLCA 4H83A 2ZX9A 5TD4A 2OYMA 5B7YA 4EKJA 3AQUA 4UQEA 4TQTA 4MDOA 1SZFA 1V0MA 2ISVA 2O9RA 2JF7A 3L67A 4MADA 4RK8A 2EG8A 1MUCA 2VEKA 2QR6A 3P81A 3DCPA 3UR7A 4ECLA 2X0YA 2VURA 4IQJA 3W7MA 2XGBA 2GDVA 2ZXDA 2J79A 4MY8A 2WPBA 1K8XA 4Z1CA 2FZMA 2DT2A 1JCLA 3T9PA 1KFEA 4IGHA 4IL0A 2DZWA 3VI2A 4HU4A 1D8CA 4WF7A 2D3LA 3W76A 2D20A 4P2VA 1ZALA 3W9ZA 2E67A 3S2JA 3P60A 3G18A 4XZNX 2V6AA 3LCWA 4PB4A 3CHEA 1Z3NA 3GVGA 2CBUA 3AOFA 4DX3A 1TA3A 4YPJA 5EU9A 1I2RA 4KPLA 1BLIA 3LNMA 2HVOA 4H2CA 1HKWA 4ZQMA 4GYJA 3USZA 4PMOA 3TK7A 2DW6A 5FL0A 4ZGYA 1ZTVA 3RITA 4MAVA 5IDZA 1E1FA 3WX7A 1VLWA 1U5HA 3S2MA 1GEHA 1L8PA 1QI3A 5F2LA 1N8FA 4DLMA 1J01A 2QDGA 2J13A 1HGYA 2PTWA 2I17A 1W1B1 2AGKA 3FV9A 3GG1A 1JAKA 5CPLA 4UNIA 1EGMA 2WNQA 3FJ4A 1TA3B 3QY7A 1A47A 5CC5A 3BARA 4I90A 2YCKX 2Y8UA 4AU0A 4LVGA 4F2BA 1A0CA 1ZP4A 4KFNA 3BDKA 1QI2A 3OHIA 3T1GA 2VCCA 4UQ9A 1PKLA 2G0WA 1NWTA 4C6EA 4HK6A 1HL8A 3UP8A 1B90A 1K8ZA 3LOTA 4DJFD 2ADAA 4ZOAA 5EBAA 3OQEA 2ON3A 2EJ1A 1M1BA 4IMEA 2DV0A 3N34A 5LNUA 1VFLA 1IT7A 5A8NA 3VGGA 2BVWA 3UNDA 1VP5A 4KEVA 4L7ZA 2Q3OA 3LD5A 5LIXX 3W2MA 4RPQA 4GE8A 1ZAHA 1Y0EA 2PD9A 3RG6A 1K4HA 1W0MA 4YLWA 4EACA 1R3TA 1HG3A 4W7WA 5CC3A 1SJBA 1R3YA 1K9TA 1JCTA 3QH2A 1S39A 3BG3A 1G6CA 1GOQA 5BMWA 1US2A 1GZ1A 5HBFA 4BF9A 4MJ2A 4NAEB 3TDFA 1JGMA 2YW3A 4GKTA 4GYKA 3SJ3A 3WLOA 3KBMA 4JN6A 1VBGA 1JG9A 2E77A 2HISA 3M9YA 1DE6A 5H8MA 2EPMX 4US6A 3R8GA 4PTWA 1WQ5A 3N2BA 4B5XA 3IIVA 1F61A 1J96A 1FCVA 4H8VA 2QLYA 3W07A 2VX5A 1PHQA 4GI8A 3PZIA 3U57A 3AHZA 4WOZA 3S1XA 4KKXA 3E2RA 1XQLA 1D7KA 4EAMA 4DAIA 3MA8A 1S2UA 3MO4A 2BTMA 5I3DA 3DHFA 1CBGA 2VFGA 1W8GA 5AYXA 2JBMA 5K9CA 4J40A 1UR3M 2J8GA 3WQVA 3W02A 1MFUA 2XH0A 3P84A 3RPTA 4AQLA 4YMZA 4X61A 2PTYA 2CZ5A 3UD6A 2JIWA 1TELA 3R6IA 2BX7A 4AVOA 2CWNA 3TTOA 1XG4A 5T26A 1UR2A 1YMYA 3PJWA 4WY0F 3QSRA 3GD6A 5D2VA 3ECQA 3VKDA 3UXAA 3HV9A 3DOPA 3K4DA 3Q4DA 4IQEA 2YGYA 3CS2A 2Q8LA 4LEQA 5F1UA 4WKFA 1QW7A 1O5KA 3RILA 2ZXBA 2GQ8A 1MFVA 3TSMA 5AHLA 1QPNA 2NQLA 3GXTA 4YTQA 2R94A 3FIGA 3THUA 2GQAA 4ADUA 3W27A 3WL1A 1DE5A 3EWCA 3N73A 1W9XA 2E25A 5K9XA 2QKFA 3VKBA 5AY7A 2I9UA 1WYIA 3VIKA 3HG3A 4B15A 1XUZA 2YA0A 3SUVA 3IEBA 3QV8A 3U7BA 1RSCA 1TWSA 2OOFA 5JIPA 3CPRA 4ATDA 3E1F1 4GCAA 1VEPA 4OV9A 1V5XA 4MUZA 2CLMA 2PPGA 3CAWA 1SFTA 5G2IA 4Q4SA 7PTDA 2Y8KA 1E56A 3WF3A 3B03A 4Q8QA 3IIPA 3UJEA 3BK0A 3M1ZA 4JFVA 4LFYA 2FKPA 5BXRA 3LS9A 3ITGA 5EFFA 3S83A 2G95A 1AL8A 4P5UA 4CNSA 2JF6A 1P0NA 2QIWA 2YOCA 1Q3NA 3GLCA 2OYLA 1E4MM 5D38A 2YA2A 4GYPA 4W86A 4DVOA 4FNUA 3HQ1A 3QFEA 1R38A 5FIPA 4BS0A 1RLCL 1LTDA 3OBEA 1KXVA 3KP0A 2RDXA 1PB0A 3KUMA 4WSHA 3WZ0E 4IG2A 3WDIA 2PDHA 4O1CA 2GJRA 2G4FA 4ES4A 4I6KA 1BEUA 1XLGA 3IJIA 2ZZ6A 2QAPA 1W37A 4ZEPA 1XLMA 2Y24A 3NPVA 2XH2A 2ZUTA 1ONRA 4FPSA 4XD4A 1CXFA 3W7GA 4ZVJA 1QNVA 1GYNA 1GK8A 1A5AA 4HJFA 4IIHA 2MUCA 1SR0A 1JZ3A 1FHLA 5BWAA 1TWIA 2F6UA 4IPIA 1RD6A 4K3ZA 3VUPA 3BO9A 4C7DA 1SU5A 3MJYA 3GBEA 3NZGA 5AYBA 2G5WA 1PBGA 2WCGA 5AHMA 4C6LA 3SSJA 1TVPA 1WV2A 3V35A 4O4WA 1XLFA 2Y61A 1TJ2A 1SZGA 1PAMA 1ZHAA 4KWOA 4QQUA 3UR8A 5DMMA 4UTJA 2R1KA 2A3LA 3FA3A 3VGEA 1QRQA 1PCKA 1MRQA 4DB7A 2C0AA 2ODOA 2F8QA 1B3XA 1Z8AA 5C54A 2Y8VA 4DO6A 2FZ8A 3IVSA 5D09A 1G94A 2DUXA 4DF1A 1O12A 4UIOA 3P8JA 1J2WA 4OHQA 2ZADA 2ZZ5A 3E0FA 3WQ6A 4AZ6A 3PPCA 4JICA 3LM7A 3CL8A 1LYXA 1CGYA 3TR9A 5I77A 4RE0A 4CD6A 4AVNA 4K2SA 4AIUA 1I45A 1VHCA 1OD0A 4WEVX 4GH3A 1MEIA 1B3WA 2O7SA 1BXNA 3WFLA 3W7PA 2PDNA 2DVXA 2ZCGA 2H90A 3K8KA 3ARQA 3E0VA 3FHAA 2YJQA 4L4OA 2PDKA 1SMAA 3JZEA 3Q58A 3M5VA 4S3AA 7ODCA 2YXGA 1PZ1A 4TMCA 5REQA 2X1UA 4H9YA 3SCPA 2WVSA 1UP0A 3T44A 4YHEA 4JKMA 3FKKA 4TV6A 4BQ2A 3G1HA 3BZGA 2QUNA 3N9KA 3NM1A 4AF0B 1H60A 4L6DA 5DBUA 4J3ZA 2QVNA 1IXPA 1TUXA 4IP5A 3LCLA 2ZA3A 4GC4A 1YIXA 1E1EA 3MTWA 3AAMA 3IIZA 3HO8A 3RAOA 1FWRA 3KZSA 4AD1A 2Y7EA 3GH5A 4DXVA 1QPKA 4ML4A 2HS8A 3BOLA 3NYZA 2PWHA 1DORA 5CBJA 1XHGA 2PC4A 3OU8A 5FJJA 3C0SA 1GWJA 2YFOA 1X98A 2JKAA 2VT0A 1FWTA 3VTRA 2RGLA 3GW0A 2VR4A 5A8PA 3B05A 3SY1A 2BMBA 2CETA 2I1OA 2BHZA 2PCQA 2OEKA 2J6VA 1P7TA 2P1FA 4PCPA 3NDOA 1PWLA 4YU1A 4PEKA 2BVTA 1UD6A 4ONVA 4YTSA 4RZBA 1G7UA 3HJEA 3DFTA 1DPMA 3VGDA 2ZA2A 2GVJA 3KOYA 3V75A 2PP3A 1C9DA 3ZVHB 4ZQOA 3TJIA 1GOIA 5CZTA 2HDJA 2VEIA 3IGXA 4L80A 3KOWA 3H22A 1XICA 3D3AA 2NXIA 2GZXA 3A9BA 4GZ7A 4NXKA 3AYRA 1NOFA 4DM1A 5AECA 2P8BA 3JVAA 2EO7A 1KWGA 1YEYA 4WX2A 1Q6FA 3MVIA 3B40A 4KCTA 2OKTA 1H50A 1VD6A 2CBJA 1H7RA 1KFLA 2CZVA 4UTTA 2GGHA 3HGRA 1TZ7A 5LKYA 1XYAA 1NU5A 1J0HA 1SUXA 1I0DA 1Q45A 4M80A 1GHRA 1DJHA 1YPXA 1OINA 3N29A 4QJ3B 4H9TA 3E2QA 4DO5A 1QUMA 4F0HA 1DJXA 4E2DA 3IVUA 2PWEA 1Z9AA 2Z4GA 4US5D 4R9OA 4EPKA 1P6WA 1KXQA 4I9MA 3OLGA 2X2YA 2Z2UA 3NGFA 4JZ5A 2QGHA 1XYFA 4MF4A 4MZ8A 4XV0A 3UA4A 1FH8A 1A5OC 2OQLA 3E49A 4NAEA 3NCOA 4HHLA 2HK1A 3W1LA 3PR2A 4KIRA 4GJ1A 1E6RA 1Y5XA 5EY5A 2W66A 3BLDA 1DIEA 4GI6A 4B91A 3NQEA 1N2VA 1W6TA 4OV4A 1L9WA 2ZICA 1TMQA 4NHVA 2NLIA 1PTDA 4X9SA 3MT1A 1W56A 3VUSA 3TV8A 3REQA 2FGZA 4BCEA 5D9MA 5AN7A 3QEZA 6REQA 4G5DA 4Q6XA 2WCSA 1UWSA 1UR1A 4WDWA 1L6GA 1GKPA 3O06A 5TQLA 3B0PA 2B81A 5LHFA 1G67A 1ESWA 3OHMB 4J3UA 4AD5A 1AD1A 3W1PA 2OOGA 3NUKA 4O15A 4PMQA 1T6MA 3LMZA 1C7TA 2GDQA 1NY1A 4HA4A 3M41A 3VX0A 3IACA 3UJRA 1FXQA 1N7KA 1FP8A 3LSBA 2DORA 3C2FA 4KFOA 3UPWA 5ABFA 4AYSA 1BRLA 2XWEA 4LPCA 6ALDA 2VGIA 2WMKA 3E9AA 3VNYA 2YDRA 3TU9A 3MZNA 3M64A 3CXOA 3RU6A 1JULA 3QRHA 1RLDA 1I8JA 2ALDA 4TVDA 1GVFA 3A9IA 4W85A 2QJMA 4JXCA 5BOEA 4J3TA 5LA0A 1MNSA 2P50A 2JIEA 4RNIA 1KBLA 2BXVA 2VZOA 3VIGA 3WK0A 3F03K 3N14A 4R9XA 1J0ZA 1KLZA 3GBDA 2XH4A 2J7CA 3TYUA 4AZ7A 2NUWA 3PPGA 5ABGA 1XIFA 3GG0A 1RA0A 4JN8A 1IV8A 2OO6A 4XD5A 3ARTA 4WR3A 2G4JA 2VOMA 3AUOA 4EIVA 4LY4A 3ZLGA 3N12A 4LF2A 5FEXA 4JTKA 1KFJA 1FWEC 1XRFA 4B5UA 3BL3A 4HN4A 4GIYA 4PMRA 1PEZA 4WKHA 4L6OA 1OJXA 4GPNA 4QROA 5DRCA 2H9AA 4Q4QA 3LM3A 3I3EA 1DJGA 4IMCA 4JQ3A 3P3BA 5HUOA 1FUYA 4BWLA 1OFDA 3QYQA 1YNYA 4DXXA 2OU4A 1K6WA 2KAUC 4ZB0A 1A5UA 2D0HA 3NSXA 2J74A 2UY3A 5CZJA 2Q3RA 1KXTA 4HNLA 2WQPA 1QFEA 3B3DA 5EMLA 1E9LA 3NQBA 1IZCA 2EF9A 4QSHA 1EC8A 3EMCA 4RR4A 1I60A 1KM6A 1YTKA 3ZR5A 3DGRA 3H24A 3M5YA 4LBSA 2H9AB 4YYFA 1X1ZA 4POCA 1XIGA 4JDBA 3ZVHA 1VJSA 2Q02A 2UZ9A 3GH7A 4DJDD 2POTA 2A6LA 1XH1A 1O5RA 3UXLA 3VGBA 4IJCA 3WK1A 3ZS4A 2VGFA 4WVXA 4JS3A 3WBAA 4KIEA 2R1PA 5B7ZA 4L64A 3TYDA 3F2DA 1UB3A 3E6EA 1E9IA 3FNDA 1SFJA 4AZGA 5HK4A 1JDEA 3I4EA 4Z0JA 1AVAA 4ROPA 2XIIA 3UWWA 5M5DA 4OGZA 3I7SA 3ARYA 1JAEA 4XZBA 1R47A 1F6YA 1TTQA 3RO8A 1P1MA 2DW7A 4EWJA 4H2HA 1NF7A 5M3WA 3NL6A 3W2KA 1PKMA 3GZAA 4C6QA 1LF1A 2YXOA 3M0JA 2WKLA 1ELSA 3QZEA 1EO7A 1Q4NX 1M7PA 1TB3A 4MPQA 3WFAA 1ADDA 4DN1A 4A3YA 1F3WA 2J7GA 3H8AA 4DJEA 1FWFC 3LX9A 1HVQA 5EA9A 3TC6A 4JTSA 4O8RA 3TMLA 3QM3A 3ZR6A 3PFMA 5LNWA 3MCNA 3H54A 5T9CE 2E1WA 5CG7A 1H62A 1MW0A 2BGQA 8RUCA 4UTWA 4RPPA 4FNSA 1U5VA 4Z2HA 1UH2A 2B7QA 4H7CA 2GLKA 4UCGA 2X8RA 3P5YA 2VI0A 2IKHA 1DV7A 1MW2A 2XZ7A 3KCLA 5FESA 1LWJA 3U7VA 3SQMA 3EWYA 4QIUA 3ISIX 5DEZA 4I9TA 4EX4A 3WCZA 4O0ZA 1LQAA 2V2CA 4K6AA 3U8GA 2PB1A 3GC5A 1XL9A 1E0VA 2YDSA 1Y5WA 1W91A 1CLVA 3AWOA 3A5FA 1O6IA 3LA4A 4A8RA 5LIYX 1LZOA 4AIOA 3TZFA 4JBRA 3JZUA 1XIBA 3FAWA 3QQ1A 2Q8ZA 1O5QA 1RUSA 1I6NA 2ZIDA 1TKKA 5C55A 3B9OA 2CXEA 2ZKMX 1HQTA 4ZOBA 5D37A 4ZB2A 2NQHA 4ZOEA 4GY7A 2GVEA 4J35A 1A5BA 3QR3A 1LLWA 1BVNP 4RL3A 4HHHA 1QW9A 4TV5A 3HGSA 3GU9A 1REQA 4AD0A 3RM8A 1W9UA 3RGTA 1OC6A 5AB3A 2W9MA 3H23A 1CGVA 5JXQA 3IJDA 4F3HA 1R3SA 3BGJA 3RCYA 5BWFA 3UBPC 3DFQA 1TTJA 1FKXA 2QEZA 1VBUA 3FVMA 3KL3A 5C2XA 1W9BM 2VVNA 3CQJA 1I1WA 3KM8A 4E3VA 1HVXA 1QPOA 4JFSA 2JK2A 9RUBA 4E6MA 3BG5A 2P3ZA 4J2MA 3GWQA 1E4NA 3MHGA 1DQXA 4B16A 3S42A 1ADSA 3XISA 1Y7VA 5AC7A 3CK5A 3SY5A 3W7JA 2O4MA 3LV6A 4ZSTA 3O6AA 1PXGA 3OTRA 4TX8A 5I07A 5CCZA 4CQBA 1EBGA 5HQEA 1ZL1A 2OT0A 2E8ZA 2PD5A 2X7WA 2O55A 3VIIA 1RK6A 2UY4A 3PBWA 3FDGA 3FJNA 2XVKA 3CYVA 2FH6A 3W0KA 4NZFA 4X3ZA 3GVWA 4A2SA 1EXPA 3QW4B 5E0FA 3HG4A 2GUYA 1ZJHA 4S23A 1EJRC 2PWUA 1JCJA 1LRQA 1A5CA 2J7HA 2PTDA 3OG2A 3SDOA 3GTXA 2QCLA 4I8YA 4FZIA 3GUGA 5EMYA 2F6XA 3VXGA 2D2JA 2FJKA 1EDTA 1EC9A 3PUDA 3RLVA 5IRPA 5GNZA 4R27A 3NR0A 5I0DA 1UIPA 3VDHA 1GG0A 2NQZA 4NYUA 1Q8JA 1KCLA 3GU2A 3P6LA 3ZSTA 1LBMA 3TNBA 3W7CA 1EYWA 2IW0A 3VIFA 3GM8A 4WRHA 2GVGA 2X30A 2LLEA 4AUBA 2V5BA 3T4WA 4KT2A 3WNPA 3H2NA 4XAZA 4RUBA 4H9MA 1WDWA 1DYSA 2Y5SA 3O6YX 4C6JA 3LCHA 5EL1A 4C6PA 3W83A 2QCFA 1KFBA 2H6RA 3NQ7A 2GUUA 2OYKA 1S5TA 4WJ8A 4OBSA 2VDIA 5FSEC 1XGEA 3IANA 1MYRA 3G5EA 3OJGA 2QCCA 8XIMA 4ACZA 2E0PA 1E6XM 2Z27A 1V02A 3BLLA 4JNYA 1BKSA 2HPIA 2DQXA 4M1BA 5E09A 1SFSA 1M7OA 3AIWA 4B3ZA 1HJXA 3CPGA 2YW4A 3W7RA 3UG5A 2O4QA 1BGAA 5AFDA 3DH7A 1UKOA 1XPGA 3KLLA 4QJ1A 3T8LA 1MW3A 6XIAA 2WYSA 3FN9A 2PTZA 5REQB 2E5DA 1F2JA 4RE3A 3G1VA 1B3ZA 3N4EA 2XU2A 3AIBA 2DZTA 2X42A 2AQOA 1QOPA 2XN1A 3WMBA 1V6UA 3BMVA 1TV4A 4GZEA 3AFBA 2OZTA 3G6MA 4XZWA 1CIUA 5G1YA 2E28A 2PBGA 2BP1A 1ODZA 3BXWA 5MF5A 3WNKA 3B9NA 2BVYA 1E73M 1VFOA 2J62A 4IJRA 1DBTA 1V6XA 1U83A 1GHSA 4XO7A 1R86A 5J5DA 3VK5A 1QHPA 2OEJA 4ILSA 3BUVA 1GVQA 4DJDC 4E2BA 2R8WA 4NJIA 4BWLC 1EJ7L 3ZQ9A 1V51A 3EPOA 3WF0A 5CSUA 3L4UA 3GVRA 4UZSA 1JI2A 2GJXA 1O95A 3EEZA 4HCLA 3LERA 4GXPA 4Y8EA 2OSWA 4XIMA 2CLHA 3EDEA 3BMWA 2EPNA 6XIMA 2DH2A 5G2HA 2PGFA 3HV8A 3M5ZA 4NNCA 2VEMA 3VD7A 4GYPC 1CZ1A 5AVHA 5LZLA 2Z2BA 1W3HA 3TW7A 3UY7A 1OFQA 3WY1A 5M1TA 5I3IA 1IR2A 4XISA 1UD2A 1F3TA 4R33A 1VZWA 5TIMA 1QHZA 1VKFA 4FNTA 3HU7A 3PB0A 5C7HA 1KKRA 3QHMA 3HIJA 2ZRYA 3NGJA 2WSQA 4MWAE 2CCRA 4FLSA 1UUMA 4AHQA 3PWIA 2J25A 4PFMA 5HJYA 3C6CA 3RX4A 4F4RA 2VFEA 3VDAA 4CCDA 3SCOA 4GLEA 3UR5A 1GG1A 2NVDA 3VMNA 2CESA 2DT0A 3CZ8A 1XD0A 5I3GA 4M81A 1ONXA 4OTKA 4IP4A 3IPWA 5BOFA 2BY3A 1IEXA 1OQFA 1KBIA 2IPJA 1IQ8A 3L4XA 3SUTA 4HZMA 4Z2GA 3VC5A 3QOMA 4MB3A 4LEFA 4NNAA 1K1DA 1XM3A 4NQ1A 4ERGA 1VFMA 1RQBA 1E5NA 2NV9A 1HKIA 1AQFA 5JH1A 1R0MA 2X1TA 3L4TA 3AIVA 1DWHM 4AX6A 3DAQA 3MYPA 1ENUA 1FCBA 4KCUA 3TFXA 4N9CA 2ONEA 4GHRA 1QR7A 5CBBA 2E9LA 1JCNA 1H4PA 1UUOA 4M3PA 4GIEA 1YBQB 3NO1A 1TQXA 4GMEA 1DJZA 2WXDM 5I7GA 2J75A 1L0PA 4G8TA 2NW0A 4AAJA 1KGWA 2E6AA 2TPSA 2WLZA 4IX0A 4PSRA 1A53A 1HN1A 2C8NA 4Z2JA 5E6ZA 4BKNA 2R1MA 2VL4A 5JUVA 3UYIA 1OFPA 3H12A 2IKIA 2RKXA 3L4WA 5E1QA 3ARWA 2J88A 2CZEA 2Y7FA 4NI3A 1VCGA 1T8XA 4AWTA 4AG0A 5FD0A 4BQ5A 1F9CA 3VOCA 1BAGA 3MHFA 4LRTA 3AROA 5CSRA 2Z1SA 4HKPA 2TRSA 1CXEA 3NNTA 3N9SA 3WN6A 4K8HA 5A3HA 1SO4A 3UW6A 1H7NA 2VNCA 5CJ5A 4D6FA 4CN6A 3RLGA 5AVNA 1G4TA 1SZRA 1ISZA 4GUJA 4X63A 4AW7A 2GSHA 2HVMA 2Y0FA 1HKKA 3L21A 1K4GA 1JR1A 2ZC1A 1FHUA 1X6UA 1US0A 4TVCA 1BG9A 3LPPA 3JW7A 5I78A 3WD0A 3ITYA 2HNHA 1RQHA 2ASHA 3MCOA 4FSAA 4D6EA 3NQ8A 1S1RA 3N4FA 4D6GA 1MZRA 2HZGA 3NQ6A 3MSDA 1JD7A 3CUZA 3N3TA 4PTNA 3ITXA 3BW3A 5A8OA 4MY1A 4HOWA 1PV8A 4ZA0A 1BXBA 3GY1A 1EEPA 2Y5JA 4PN2A 2V9DA 1KV5A 2XSAA 5G1MA 1ML1A 2QCEA 2A3BA 3AHYA 2VX4A 3SRDA 1CNVA 4YYCA 1IGWA 5A8MA 1W3LA 1EP1A 4PODA 1HJQA 2BG5A 1V3KA 4W8AA 1J11A 3CWNA 3MP5A 4PCNA 1NFGA 1GW9A 1YTDA 1CPUA 1RVGA 1PIFA 3RCNA 4H4IA 3VZZA 4YWIA 3WUFA 3VM5A 1G0CA 1OK6A 3TC3A 1DIKA 2I5GA 5AC6A 3UT0A 1K77A 3MUXA 1U5JA 1GVEA 2WHMA 4P7RA 1ITQA 4NZ1A 4XVEA 1ZPTA 4G7EA 1XYMA 3QW3A 1TMLA 3QTPA 3CMJA 1ZBKA 2VWSA 1EIXA 2Y1HA 1S3TC 1KM1A 3A4XA 3GU1A 4GQ0A 4IT1A 3GKAA 4JTRA 3CGTA 1DEDA 4BEQA 1C8YA 2E3ZA 1IGSA 1K7EA 5E93A 4TUFA 3AS2A 4EF9A 1W3KA 1G4SA 4HZ8A 1TFVA 3Q45A 5LNRA 4WCJA 1A4LA 3BURA 2PC8A 3AIRA 4N0RA 2PE4A 3A4WA 4I5XA 1IXOA 4JIHA 2OWXA 2VUYA 2OT1A 3LGDA 4LALA 5FJRA 4X2RA 3MS8A 5DF0A 3CEUA 4W88A 3WQ8A 5A94A 4NUWA 4S3EA 2PLJA 1OADA 1X6LA 2WZEA 1WDRA 4UTFA 3F5KA 3GYEA 3EEGA 3KTCA 4S1FA 3NXLA 3E96A 3TJLA 1UASA 3QR1A 4C5YA 2GSEA 1XIIA 4FLOA 2C91A 3B9DA 5A2CA 4EK7A 3AMGA 3CUXA 3ZVIA 2PMQA 1OX4A 5LGXA 3KVLA 1RALA 1TR1A 4GACA 3S5ZA 3KOXA 1TV3A 5K4XA 4IF2A 4XKYA 1XUUA 3H4GA 4JIRA 5EKYA 5HNUA 2XFYA 4HMCA 5HWMA 3EX4A 3TXZA 3UVAA 1FKWA 3BW4A 3O6CA 1EEXA 1FFRA 3FW6A 4LC6A 4DPPA 4UTKA 3E2VA 1W2PA 3RR4A 4FXFA 4PUEA 4K7YA 4WDTA 2XGIA 4Q7NA 4C6FA 3D46A 4K8GA 3OO2A 5FJOA 2P10A 2XHYA 1BD0A 3ANUA 2EQDA 1SJCA 3B06A 3Q94A 1TMHA 4BJHA 1WB0A 1XYLA 3WDJA 1YLVA 1KXHA 1V3JA 4KEZA 4OZOA 1F05A 3GRIA 3PUOA 2DZUA 2PDPA 3BVJA 1XKJA 2CXGA 3F4DA 4PFHA 4HMDA 4AHOA 4O1FA 1QT1A 4F9DA 4DF2A 4IIGA 1W3NA 4LY8A 3VCCA 3PZMA 3DEQA 1MNZA 3P93A 1PX4A 4XZ9A 3G6LA 3NQGA 3NVTA 4AZCA 1K8CA 3UGVA 1W32A 3GFYA 2QJHA 3ANVA 3OODA 3WD1A 3SCWA 1VEOA 2G8ZA 3LK6A 1ALDA 3UFYA 3RJXA 4BY3A 2Z0IA 3H70A 1RQEA 5M17A 5CG0A 1RVKA 4M8UA 3CL6A 3GVVA 3Q37A 3ZJ8A 2OSYA 5F2MA 2J78A 3CQHA 3ZM8A 3GS6A 1AJ2A 1AODA 3R7MA 1IF2A 1QI4A 3S6OA 2YL5A 3CUJA 3WMCA 1ADOA 4OOUA 1GONA 1GKQA 4PMJA 2IQ0A 2DVTA 4J1OA 5CPTA 3CQIA 3PS7A 3KL0A 1SSDA 2DIKA 1QNRA 1E9YB 1H11A 3WD2A 3S9IA 3I6TA 3W1MA 3CEPA 2QUTA 1H7XA 1OYCA 4GWEA 3PTQA 3ABRA 3UXKA 1S2CA 2W61A 3MBDA 4JTLA 2PDMA 1NVMA 2XWDA 2QNEA 3V4BA 2W4XA 3ZWTA 1JPDX 1UWAA 5BRPA 4NJKA 2X40A 1RBOB 4JTUA 3VPLA 5BOOA 4P61A 4XAYA 1P5BA 2J8FA 3W6MA 1C91A 2PSNA 3TAOA 1J5SA 1CGTA 3GXFA 3NFUA 1GT8A 4PEEA 2C71A 4IWWA 5D9PA 1JVNA 1J2BA 1BF6A 4HVXA 2FZDA 5I79A 3UGRA 2CBIA 7TIMA 2GK1A 3PZUA 2WNWA 4QG6A 1DHKA 1V8EA 3C2YA 3WQPA 1KGUA 3DXIA 3GIQA 1SMDA 3PZVA 5KZDA 4ICCX 1EGZA 3GR8A 4P8UA 4DF0A 1X6NA 2ISWA 2OXNA 2JQXA 2I16A 3E12A 4IUOA 2A3AA 4Q33A 1G4PA 1ZJAA 5BNKA 1XIDA 2BY1A 3IK2A 3I6RA 2A6NA 3W82A 2DQWA 1CCWB 3B0VC 1R2TA 4GY0A 5FJPA 2W67A 2ZZ1A 3NQ2A 2PLKA 4WD0A 1ME7A 2YCLA 3T0CA 3VD4A 2C16A 4HIBA 4KESA 2V63A 4N9EA 1XH2A 3S1WA 3ITLA 4HNUA 3GZ3A 5FA5A 4IPLA 1UKQA 1EP3A 4FOUA 3DZ1A 2WCAA 1PL9A 1X7IA 4V28A 3W84A 3KBWA 1WZMA 2NWSA 5TF0A 1V93A 5DXYA 4X0VA 3UETA 3AXIA 4L5ZA 3LRMA 4G1NA 2CERA 4MWAC 4RCXA 1F07A 3HQOA 3GXMA 4IGSA 2YX0A 2QMJA 3NA8A 1F6PA 1UR8A 2AL2B 4H6EA 1HFBA 4PE8A 5LIKX 2WAGA 1SO5A 2ATSA 5C0QA 3EX3A 1OGGA 1SGJA 3FLUA 3AYVA 4CNPA 4C7FA 5FF2A 3R0DA 3VD9A 4GO9A 4JFWA 4A3HA 3S6TA 3QR0A 3STFA 1B4KA 5H1WA 2DJLA 1XGZA 4R34A 4EXBA 1RJPA 2PRHA 3W88A 3GVQA 1EHAA 3LI1A 4MFEA 3PM6A 4Z1DA 3VILA 4LX4A 1J8VA 3MKKA 2OR2A 1Q66A 3O8AA 4BFAA 2DUZA 1D3HA 3LTSA 4YNGA 1NJJA 3GDRA 5FSDC 3WH7A 2DGAA 1M3UA 1VH7A 3NXFA 2QQ6A 5H8PA 4FNQA 4PULA 4AY8A 2D73A 1AG1O 1YDYA 1W31A 4GVHA 1LQ2A 3WD3A 4DWSB 1EWEA 4RZ5A 5K2ZA 4UR7A 3W7NA 4LYQA 5IM51 2VZTA 3NM3A 3WJXA 3S9YA 3K1DA 2X05A 4M1RA 4HA0A 1QNSA 1OCNA 4MHBA 1BGGA 4AXNA 5XIMA 4AY1A 4RV8A 1K9DA 4BF7A 1N8IA 1UHVA 4C90A 3PTMA 3QFWA 4F0LA 2RDUA 5CJNA 4LAZA 2AMGA 4QJ5B 4OBRA 1Q6RA 1ZAIA 2PDJA 4J3SA 1Z6KA 2OWWA 3IV3A 1J18A 4E2OA 4N6FA 4RW5A 5I24A 4PUJA 4HU8A 2FPTA 3OVQA 4AD3A 3TYEA 2FQIA 2NX1A 3TQ0A 1NFPA 4PBEA 3LXAA 5CLTA 3RCMA 4N4QA 1N55A 2VYOA 1XS2A 1BF2A 4DJFC 3EMZA 4TO8A 3LHTA 2YCIX 5EFDA 2PWFA 4Y6GA 3WEOA 3IIXA 1JRBA 5KZMA 5T91A 1F5ZA 1NF0A 2PU1A 3KVKA 4C6MA 3W29A 1HL9A 3S1UA 2XIOA 3TZNA 4FB7A 1F7BA 4R7WA 5GNXA 1VGAA 4K1GA 4RDZA 2E09A 3QOKA 1B1YA 1JUEA 5HUPA 4Q7BA 3QY6A 2D0GA 1SJDA 1GYMA 3CWOX 1Z44A 2A21A 4O54A 4LWWA 2DT1A 3EB2A 3HGJA 1IR1A 4O52A 4K37A 1X96A 2V67A 4PMDA 3SI9A 5L9FA 4DAFA 1JXJA 4GG9A 4F40A 3VE9A 1AH4A 2V38A 3OZOA 3WG6A 5CZ0A 3TFCA 5CLWA 1TE6A 5GJPA 2QCNA 3W00A 5BU9A 5HPCA 3FYYA 3SAZA 5HA7A 2WJEA 5IBXC 5HATA 1OGBA 3ARXA 3IGHX 4QAWA 1E5JA 1MW1A 1EPXA 2Z26A 2BDQA 3WK2A 3N2TA 3DFHA 4UMAA 3DHUA 4WOQA 1EJWC 3DHDA 3HTWA 3MUAA 3U2EA 1J5TA 2G3NA 1LRTA 3M0ZA 3PZ9A 3EKGA 3V0UA 4H3DA 3PZTA 5FL1A 3LN3A 2DJXA 1UWRA 2P5NA 1U2YA 2CLIA 1TV8A 2ZZ2A 3DG6A 4UOJA 3EDJA 2NVAA 2OVLA 4W7VA 2DSVA 1QATA 3DC0A 3WNNA 4CD5A 1LBLA 2XGZA 2E5CA 4CQ9A 1RZMA 1UJQA 3GH4A 1QWKA 4P7NA 3RX2A 1J12A 2WHJA 2QZRA 3ABOA 4C6IA 3R10A 1EYEA 3CO8A 4PZVA 4I9AA 3BCDA 3PZGA 2AMXA 4EPEC 1EP2A 3AZTA 3A6OA 2OFJA 4NP7A 3A4AA 3UU0A 3CUIA 5H91A 3UZYA 3WENA 4DYJA 4DYEA 4MUPA 4HT3A 1UD5A 1KB3A 1GOKA 3WJYA 4P8XA 5ABFB 4WZHA 1BYCA 2A3HA 3M0YA 1EIBA 4AISA 2PF0A 5HPOA 1JF6A 1BPLB 1P6CA 4JD4A 2YLAA 4GVIA 4PMXA 4BI7A 2P3EA 2QDHA 3IUIA 2G3FA 1PJ9A 4UXDA 1K7FA 4ACZB 3R8HA 1OD8A 5JBEA 1OFRA 3OG3A 1R30A 3WNOA 1FWIC 1XP3A 3B0XA 1M68A 1KBJA 2ISSA 1E6SM 1VJIA 3BLIA 3EPMA 4X0NA 1XCFA 3IJ8A 1TPDA 4H19A 2A3EA 1QBAA 4L4MA 4HPHA 3WMLA 4HNOA 4NZCA 4D8ZA 1JNEA 3LNPA 1XDMA 3URNA 3REQB 3G8EA 4AB4A 1W5PA 2IKJA 4RE4A 6REQB 4JTGA 5CZSA 3BSMA 5A6KA 3C5QA 4GH1A 4MOZA 5EBUA 5CBIA 2AKMA 2BY0A 4B5VA 1GTHA 3MZ2A 1OFEA 1PDYA 5AHEA 4OT7A 2NLYA 1Q6CA 3NPWA 4R7OA 4WDXA 1Q6OA 3LLXA 1T40A 3LI0A 3CZJA 4O11A 1SVDA 3CNYA 4A21A 2ZRXA 4A3QA 2J4GA 4IIBA 1OGSA 4HA3A 4MWAB 3E3HA 1DTNA 1QOXA 3R89A 7TAAA 2V5LA 4C5ZA 2WVVA 4JTDA 1K8YA 3K4AA 3GX9A 2VFDA 3AUJA 3APTA 2GVLA 2QS8A 4HNCA 4A29A 2FMNA 2Z25A 4WXYA 1BRLB 1KCXA 3EDFA 4MNMA 1E3XA 2ICSA 2W3ZA 1X8CA 4MPKA 1RY0A 3WBEA 3DECA 4UFMA 2VX6A 3SJNA 3VM7A 3KP1A 2VXNA 1WBJA 1ZENA 3LMYA 3VKKA 4I5RA 3COTA 3WQ4A 2CLFA 3VNZA 4CU7A 2WC4A 2I7GA 1LBFA 4IH3A 3VIJA 4ENLA 2FDMA 3AMDA 4V2XA 1JZ4A 1WZAA 3PAJA 4CU6A 1A49A 1R85A 3W1RA 4GI4A 4JDYA 2E1DA 1WAUA 4LVDA 1VPYA 4N2YA 3CMGA 3M4HA 3ITCA 4P8WA 4AZIA 1IEQA 4H7ZA 1EJVC 4DPQA 4GNVA 1UA7A 4ZQPA 1ZAJA 4PL1A 3CZEA 3GC4A 4KWUA 2EPKX 2Z29A 1Y8BA 1NM9A 1JQVA 1VQTA 3A21A 2DZSA 3AS1A 3ARRA 1OZMA 1FY6A 2QHAA 2E4TA 2QUVA 3V0SA 1LOSA 1OCBA 2HCVA 3T0TA 3W74A 1JCMP 5CPOA 3G0SA 1UUQA 2W63A 3VCRA 5DMNA 1QMLA 1LL4A 1B0IA 4LVAA 3HURA 1JYXA 5ENLA 3O05A 5C9XA 3SADA 3U6WA 1ZZMA 1GKRA 2ISDA 4HHMA 1TJ1A 4US5A 1XLIA 3SUSA 3IJ7A 4FXJA 3NURA 3INPA 4M24A 3T0BA 1CXIA 1XFCA 3TJXA 2VCBA 5KZ6A 1GCYA 2L5HA 3TQVA 4UTIA 3UG8A 4ZTXA 4UTHA 4FLRA 4WGHA 3N15A 1S2VA 1PX8A 4AIBA 1XG3A 2RJHA 1OC7A 3DKJA 4FEZA 5BXTA 1IWAA 3RDKA 1E1CB 2XM2A 1RJRA 4G2DA 4YVVA 4AZCB 1WXJA 4XIAA 3POHA 1WE5A 1IYXA 4CVWA 4CNOA 4HOZA 1VLIA 1UQZA 2VFHA 2WHKA 4KMQA 3JUGA 3G1DA 2J7FA 1PSCA 1TTIA 2V3GA 3AMCA 4PH6A 1K02A 4H1ZA 3VOGA 3WO8A 3TE9A 1BYBA 4IX2A 3AMLA 4S3FA 4ZQNA 2DFAA 4DBWA 4I6VA 3EDDA 5CSSA 3WH8A 2GPTA 1PCWA 5C71A 2X1RA 3CZGA 1XI3A 3M16A 4GGHA 1MDRA 2REQA 2OLSA 4C1NB 5JH2A 4C91A 1E6PA 5BU6A 1ITXA 4LUIA 3UR2A 2WMGA 1KTBA 2HMCA 1K7XA 3URQA 2W91A 3N6HA 3RPDA 3F5JA 2X1SA 4TIMA 3OA3A 4IHCA 5D9NA 3NDYA 5GNYA 1MQRA 4HSOA 3M7SA 1E72M 1ONEA 2WSKA 3I7RA 4KRTA 5HINA 1XJBA 3WQ5A 4CNTA 3ZOAA 2IQDA 1KC7A 2ZVRA 1X1NA 3IS4A 1UMLA 3G1YA 4Z2KA 2ZX8A 3OPSA 4W8BA 4LBUA 1KGXA 1MQPA 3HN3A 2Y6ZA 5HMEA 4Y2WA 4AH7A 2BY2A 2VZUA 5D8ZA 1GGOA 2WMFA 2NUYA 2I56A 1TV7A 2WSRA 5CSYA 5I3HA 1TVLA 4UUIA 3PP7A 3EWZA 3S0CA 3AYSA 4CN4A 1P7TB 5D2YA 5HNTA 2CLPA 5CEWA 3M0VA 3AIQA 4GFIA 4PA8A 2MANA 2Z1BA 1W1VA 3G8RA 3PTDA 5A69A 3W28A 1P48A 3BAJA 1ME8A 4G7FA 2BODX 3N6JA 2X0SA 4QLJA 4L9XA 2D1ZA 3VAVA 3LGEA 4UWMA 3TOPA 3C61A 1UJPA 4IIFA 4PUKA 3RRAA 4YHGA 2G3JA 2VKZG 2Y4SA 3C2VA 3NVDA 4MJ4A 5FI8A 4XZIA 2HWGA 2PWDA 1GYLA 1VYSX 3VNMA 1A0EA 1P1XA 1RR2A 2WQDA 4CN1A 3T6CA 1XPYA 4UTUA 2ESCA 1P0EA 1YHTA 5JMUA 1ZUAX 1NAL1 1Q7QA 2BHYA 3DG3A 2FVLA 3GHTA 3PZNA 3HBLA 2WBKA 4E2VA 2EKCA 4QG9A 1CECA 4IXHA 5I06A 3W7EA 2ZXAA 1L6FA 3APGA 4YVPA 4IISA 4M0XA 1ISXA 3CUGA 1ECQA 3CZKA 3CUHA 2V8ZA 2ZUVA 4NZ4A 3GHRA 5EGRA 2WC7A 3K1GA 4DBSA 1PE1A 3VNDA 4PMVA 4Y9AA 3TLQA 2YPIA 3MO7A 3H21A 1SFLA 4ZBCA 1KFWA 4LS1A 1KCZA 5A1AA 5AC8A 4FOKA 3TONA 5DCEA 3N13A 4GO8A 4H01A 3UYCA 1BQCA 2DT3A 4ADSA 1GVSA 5FAJA 1L2UA 4AIEA 3E0WA 4FX6M 3ICJA 2DSUA 4LXFA 2J24A 4PTXA 4J4KA 3V5FA 4C6DA 1MO0A 2FGLA 1QI5A 3P80A 4MG4A 4LQ1A 2BS9A 1F4AA 3I4KA 5HR6A 3S3GA 3T8QA 1JL8A 1UKTA 4HMEA 4AD2A 4QNEA 1IT8A 3BC9A 4F0MA 3EYPA 4MLRA 5SWUA 3UY8A 1H1NA 1HP5A 3N4AA 1GVRA 3HGOA 4LUTA 3WLHA 2NQ5A 3PZOA 3WUGA 1XLHA 1XYCA 2J66A 1UWQA 1U1JA 3CH9A 3TP4A 4AC7C 1OIFA 5E0KA 1MRAA 4GXWA 4HNVA 3FVDA 3QYSA 3OYXA 4IPNB 1ZP3A 2Z7KA 1XLKA 3M0IA 3W81A 3ITTA 4PBFA 5M2FX 3VVGA 3K2GA 1UH4A 1GZJA 1EZWA 1UWTA 1U33A 5FF0A 4Q8PA 3L12A 1DJIA 3OVGA 2HNEA 4Q3MA 3P62A 4ZE4A 3TLLA 2YL6A 2OX4A 5HMSA 4D8LA 3W87A 1AH0A 4D6JA 3GNRA 5J04A 1OCQA 3HF3A 4UC5A 3OEXA 4LBRA 1HKMA 3M0XA 4PB3A 5AYIA 3B0YA 3ATZA 3SIZA 4O53A 2I9EA 3AI0A 1UC4A 1VIZA 3I7QA 1RBLA 2WVVB 1I2OA 1LRNA 1EOKA 3VOFA 2BOEX 3MPGA 3U5YA 4DWSD 2C7FA 1TX0A 4D6IA 2XN0A 1GOWA 1KFCA 1TX2A 2CHOA 3KDOA 2I5QA 3GNXA 5EYWA 4HGXA 3FSTA 3VFLA 3LQLA 1JF5A 1A5MC 2ZYFA 1LJYA 1FWGC 2JALA 2Z1XA 3STPA 2GFTA 5C5YA 1WOBA 1HO4A 4C1KA 2BSLA 2Z6IA 3D6NA 4IP7A 3IJ6A 4C6CA 1REQB 4J9JA 3MCMA 1EX5A 3DKLA 3T2OA 4PCTA 1DWFM 1JI1A 2CZDA 2UY2A 3EX6A 3VABA 1E0XA 2XVLA 4IIEA 3W72A 1U1UA 2YBUA 4ZSUA 1UZDA 5CPMA 3F2BA 4W4QA 4MTVA 4LGXA 2YR1A 4UQCA 3LPFA 4OIFA 2Y62A 4E4PA 3ZJ6A 1E6NA 1XBVA 1V0NA 3L0KA 3GHUA 5HANA 3P74A 1UROA 2VC7A 3RU8X 3BWWA 1O1ZA 2Z1KA 1W5NA 3CHVA 4N6EA 4PUDA 2G41A 3OQ8A 3B4UA 4ZODA 1O1HA 3WF4A 2V5DA 4UOQA 4YJ5A 2D3NA 3ATYA 4WDUA 3L5AA 3EA2A 5FF7A 3F4WA 4C6NA 4DUVA 1WXZA 3C3NA 1M9HA 2VR2A 4Q4RA 3RM4A 4LU0A 2V2DA 4ZXLA 3IRDA 1VS1A 2A85A 3TQKA 3DYOA 1QWGA 1KM2A 2DEPA 3FDKA 3ANYA 4WSJA 2WV8A 3CYJA 4YTUA 2C0HA 3UCCA 3AYTA 4YN5A 1JYVA 1XBXA 2E6DA 4GK8A 1XWYA 1F73A 4MLJA 4NT0A 4QHRA 1OYBA 2SFPA 3DN5A 3L0NA 1M5WA 3OVPA 3LBCA 1K03A 1P0DA 3WLLA 1XC6A 4KWWA 2BVDA 3LRLA 1E0UA 3DX5A 1UP2A 3BAWA 3KBNA 3PBVA 1WKEA 3HG5A 5D2XA 1I2NA 3UG3A 4NASA 4DEFA 1RJQA 3H2CA 3DYPA 4H8HA 1WA3A 4V33A 5GVJA 3QC0A 4MY9A 3O2LA 1UYQA 1HJWA 1OIMA 2GWNA 2YBTA 4AY7A 1WNOA 4B5NA 3G24A 1B4EA 5FEWA 4BHYA 3CIVA 1D3GA 2J47A 3PZQA 5C7VA 1ZLPA 4HA1A 2NT0A 3EKLA 1XLBA 4UNKA 3E5BA 3EB3A 3NQAA 5LXXA 1B5TA 3MUY1 2Y88A 1OF8A 3GDTA 4RZ6A 4O12A 2WM0A 4LC8A 1W1IE 3PF3A 1AFSA 4LCSA 3QKZA 1E70M 1H5VA 3KE0A 1V3HA 2REQB 5A6MA 1J4EA 3NQMA 3XINA 8XIAA 3ZSSA 2CLEA 3ABQA 3FEMA 3QHOA 1UCWA 4FO4A 4PBGA 3GNDA 3QY8A 1QO2A 2FVMA 1DXEA 4KWSA 1SM9A 4N42A 3AXXA 2ZZ7A 1GOXA 4L9ZA 4DBUA 3T0DA 4F9JA 2YXXA 4Z2IA 1TREA 4D71A 3WNLA 2VUNA 3O07A 2PWVA 3T2PA 2WVUA 3M44A 2BBFA 4KQNA 1XIEA 4U2YA 1G7VA 1GVYA 4FOJA 1O68A 4DWSA 4Y9MA 3E38A 3HQNA 1DWIM 5A8GA 3WQCA 3LXBA 3S2CA 4JHZA 3N2CA 1Z7AA 1HO1A 3NPXA 1QNQA 1M53A 5G5IA 2QV4A 3KHJA 5A95A 3TN4A 4GXMA 3M0LA 4NX5A 1VBHA 5C2CA 3K4WA 5JBFA 4D1JA 3DDMA 3W70A 4Z1BA 4H9XA 4HPGA 4I7WA 5CGQA 3G22A 4C6BA 2FZNA 1C92A 4UB9A 1VAHA 1VRDA 2QIIA 4MB5A 1NH6A 2BWGA 3ZFHA 3LXCA 4ZCWA 1N82A 1LROA 1WKDA 4GX8A 1YW1A 4K36A 3W7DA 3PSWA 4ZTYA 1FHDA 1VC4A 3S1GA 3M07A 3TX9A 1OG0A 1IIGA 3FS2A 4NKCA 3DBNA 3HPXA 3VNLA 3IJ9A 4HNTA 5A6SA 4U3CA 3NO3A 4TX6A 4Z17A 1AK5A 2JKEA 4PUMA 3KVMA 5D04C 4W5ZA 1JUBA 3OZMA 1T5AA 4DIAA 4U2ZA 4I5UA 5CJMA 3ARVA 1XV8A 4AEOA 5BRBA 4DUXA 3W37A 1P6BA 3PULA 5EMUA 2PRLA 3W25A 4LNYA 4X22A 4EPDC 2IPFA 4AVFA 2BXYA 2P53A 5EMMA 4B90A 1DIDA 1V6VA 4GUFA 4Z1YA 3PN8A 3R43A 3L66A 3OA5A 4DBDA 1QU4A 2OZ8A 3W7QA 1ICQA 2GYIA 4Q22A 1TWDA 2NX9A 1ZB5A 4H6QA 1AQMA 4JIQA 3FX4A 1EO5A 4MAZA 3KCOA 3SRHA 3GK0A 4J27A 2EPOA 3CQ0A 3WUBA 3TNOA 1UA3A 1RXOB 2I14A 2ZRZA 4UCFA 1J0KA 1H2JA 3DU0A 1DJWA 1VCVA 3WH5A 2HS6A 4LYPA 4XBJA 1XXXA 1ZBVA 1F4HA 3TKFA 3W1NA 3OIHA 1E6QM 3IK4A 3N3MA 3DUGA 2NUXA 4XAPA 4INFA 3I6EA 3M0KA 1JGIA 5XIAA 2PLMA 5E6YA 3UF9A 3U0HA 4HBKA 1NDWA 5HOSA 5U7SA 3BQ6A 3NQCA 4C1LA 1LOQA 3CHDA 4JX4A 1WUEA 4S3CA 5AYYA 1XLEA 1EX1A 2GJLA 2TAAA 1VFHA 2PGWA 1ZJBA 1AQ0A 3B8WA 4GYFA 1S38A 1O7AA 4JR5A 4O4VA 2PDLA 3UESA 2C19A 2DZPA 3ARPA 3LLFA 1GQNA 1EJSC 3TYZA 4WQ6A 4Y7EA 1HT6A 1NP2A 5KMYA 3VX1A 5HQLA 3D47A 4DZ5A 3WKZA 3RF9A 3AIUA 1V77A 1VFUA 2RGMA 1GQJA 4D9PA 3MANA 1KTNA 4FA3A 3GNNA 4HPXA 3L7RA 4NILA 4IGMA