3U57A

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
502
structure length
471
Chain Sequence
NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
molecule keywords Raucaffricine-O-beta-D-glucosidase
total genus 180
structure length 471
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u57A00
3VNYA 4AIUA 3J7HA 3VIMA 3T0BA 1CEOA 1V08A 5E0FA 2VCAA 3WUEA 5IHSA 3M6DA 2RGMA 2ZXBA 1BG4A 2CETA 2WMJA 3WDJA 4X0VA 3A4WA 1QHZA 4H8UA 4GQQA 5I5RA 3PZTA 4OJYA 1M04A 3CLWA 2DSWA 2PF0A 5A2CA 2V3FA 5IDIA 4W8BA 3CUHA 4Q7NA 5DF0A 1JZ8A 1GONA 2DIJA 3AS0A 2D0HA 3W26A 4W88A 4Q22A 4H2CA 1CZ1A 4CN4A 2ZUWA 3N1AA 3OLGA 4CD7A 1QW8A 1WDPA 2YBTA 2FH6A 1E43A 3DHPA 1DWJM 3CZLA 1E73M 2CHOA 1OWQA 1UWRA 5D9MA 4HPHA 3ZJ8A 5E09A 2XYLA 3MANA 5DT7A 3HJEA 1BLIA 5AYBA 1R85A 1EXPA 3POHA 1XC6A 4B3LA 2QPUA 5I2UA 1CGVA 2XM2A 2PI6A 5CLWA 3EMQA 3A3HA 3ARSA 3SCQA 3N15A 1PX4A 1WZLA 1QI2A 1OD8A 8A3HA 1UWSA 5CQ1A 2W61A 3AZRA 4AIEA 4L4PA 5A8PA 2VURA 3BAKA 4ZE5A 3VIGA 2VX4A 5FD0A 4AISA 3MMWA 4MJ4A 1CBGA 1RP9A 1GCYA 1XRVA 3K8MA 4XUYA 3ZT6A 5BXSA 2ZIDA 3OG2A 2GJXA 4TXEA 1EHAA 1S46A 5ABGA 4A3HA 1E56A 3CUFA 3F5JA 4PMDA 4OBRA 1EDQA 1GOOA 4AD2A 3K8KA 1LL4A 4OBSA 1UH3A 4N42A 1Q6CA 1UKPA 2C0HA 3VX1A 4OUEA 3WFZA 1W1YA 1TCMA 2E9LA 1FA2A 2XVNA 2X8RA 1TE1A 2J7DA 2WVVB 4X9YA 2BXYA 2W66A 4U3AA 1MW3A 1O7AA 1VJSA 4BQ2A 1TR1A 1WNOA 3SCPA 3IK2A 2F8QA 1J0JA 1QW9A 1CDGA 1QI5A 4MDOA 3AXHA 1ECEA 1W2VA 2ZUSA 1PEZA 3AXXA 2Y24A 2XFRA 1CWYA 2FDMA 2VX7A 3MUZ1 3PHAA 4IUGA 2J4GA 3VO0A 1OIFA 1Q6FA 2VZTA 2YJQA 1WKYA 3AZTA 1M01A 3ZT5A 3BCDA 1QBAA 3S6TA 1UZ1A 2W62A 1WCGA 4WJXA 1H11A 2W92A 3T09A 1K9FA 3VD4A 1TA3B 3CMJA 4UQCA 5E6YA 3K4AA 2WZIA 1JZ3A 4C7GA 1MW0A 1MFVA 3N17A 2ZUTA 3RILA 1JDAA 1NOUA 3FXYA 3WN6A 1JF6A 4AZBA 4AY1A 4DWSC 5EMYA 2WNWA 4EKJA 1FFRA 2X2YA 1C8XA 2ZX6A 4UFKA 3L4VA 1W1PA 1E1EA 2XVPA 4AWEA 4P7QA 3TOPA 4E8CA 3KEHA 1TVNA 1KCKA 1VAHA 1WZMA 1CXIA 4J3UA 1E5JA 2VZOA 2WC7A 4D6EA 1IZKA 4L4OA 5FL1A 1OSEA 3AQUA 3HMCA 1W9PA 2XSAA 2W63A 1JAKA 1AQMA 4V27A 4PTXA 3SEPA 1W3LA 1SMDA 3AYRA 1X6LA 4HZ8A 5JIWA 1PJ9A 1LWJA 4WIWA 1UD5A 1BGGA 1E0WA 2NSXA 3CPUA 4WF7A 3ECQA 3L4XA 2UWFA 3WL1A 4PMVA 4U2YA 1UH4A 2V5CA 3VD9A 4PMRA 2BY3A 4KRTA 4WSKA 3FHQA 2JIWA 1FP9A 4UFIA 4DWSB 4U5IA 4W87A 1C90A 3OLDA 5A6BA 3M46A 5A8OA 1B0IA 3OZPA 8CGTA 1WDSA 1QOXA 4J7RA 1F4AA 1LG1A 3FAWA 1XSIA 3ALFA 2WVUA 4XV0A 4B16A 1V02E 2BVDA 4GZEA 4Z2GA 1JD7A 1QHOA 2UY4A 3WDIA 1V0MA 4PMNA 3GNPA 1HJUA 3L4UA 4JFTA 4H8VA 4D6CA 1ZBKA 1NWRA 2YL9A 4LGXA 5BRQA 5M03A 3CHDA 2V5DA 4A3YA 4Z2JA 1U30A 4MJ2A 1SFSA 1L8NA 3WH9A 3OLEA 3THCA 2DH2A 4JKKA 2QMJA 3ZJ7A 4CU8A 4WKHA 2WMHA 2VTFA 4JKLA 4QLKA 3GH5A 4YN5A 5D9OA 2ZICA 3VGDA 2JEPA 2FGZA 3EYPA 3RJXA 3AHTA 2O92A 4ZENA 1G01A 3WNPA 2VVSA 4UQEA 1PIGA 1UD3A 3T0AA 1DWIM 1W9XA 3WD2A 3WL0A 2D0FA 1JI1A 1BHGA 3CIVA 2W4XA 1M03A 3AYSA 4HMCA 2ZOXA 4UZUA 1ODUA 4Z2LA 4XX6A 5BWFA 4E2OA 3IJ9A 1JYVA 2CERA 2D22A 4JFSA 4HMDA 4AZHA 4UOZA 1HKMA 2YOCA 4QDMA 1W3KA 2J7EA 5GNYA 4M81A 3BAIA 1RP8A 2J78A 5KEZA 1GQLA 1C3FA 4HOZA 2O9OA 5BROA 4K68A 1JZ4A 1G9HA 1SMAA 3PZNA 2ESCA 2VT0A 1CXHA 4MDPA 3RM4A 3GTNA 3WFLA 4PMQA 1GOWA 4U31A 3MS8A 3UG4A 3SUWA 2XG9A 1QNOA 4P8VA 4PTVA 3WQ4A 2YKKA 2X09A 4QLLA 5FL0A 3NSNA 5CLTA 3SCOA 4CD6A 4KRUA 3FHAA 3UG3A 4AD1A 2VOTA 3U5YA 1V6XA 1UR1A 2CCRA 4MAZA 2J7GA 1UKSA 4AYSA 1D2KA 3VDCA 2WC4A 3VDBA 4AZGA 3W38A 4EAMA 4J27A 1H4PA 3SCSA 2CBVA 3W6LA 4YHGA 1ISXA 1FOBA 3WDHA 2A3BA 2WCGA 3K8LA 4PMUA 5I77A 5HDRA 4UQ9A 3WD3A 4M29A 4GZJA 3VGEA 2JF6A 2VCBA 1M7XA 1E6QM 5E6ZA 2E4TA 1HJQA 2YIHA 5HXMA 2E8ZA 1OIMA 4JZ5A 1CLXA 1KGUA 1EHNA 3L2MA 3VD5A 4W84A 2VC9A 1LQ0A 4B9ZA 3CHCA 2VCCA 4H41A 1OD0A 5I78A 2DDXA 1TFVA 3SCVA 3ARUA 1C8QA 2OWWA 2EQDA 2OLHA 3IJ7A 2WHLA 2OSYA 3FNDA 1UOKA 3WNKA 2WZEA 2XHYA 3GBDA 2J8GA 2YBUA 4AZ7A 2F2HA 3CHFA 2GK1A 2WM0A 4IPNB 3MU7A 1HKJA 3UEQA 3AIEA 4FLSA 1E6PA 3VU2A 1MW1A 4TVDA 4F8XA 3OGVA 2IUZA 1SR0A 2ZXDA 2XSBA 3THDA 6A3HA 5A6SA 4CGTA 4RE3A 3APGA 5FKYA 1GQIA 5D8ZA 3WMSA 3II1A 1CPUA 1LJYA 5A2AA 4OOZA 4TUFA 2OSWA 1VFFA 1JNEA 2E8YA 4F9JA 4D72A 3QHOA 2JF7A 2VZSA 4P8UA 3WH7A 4HA4A 2J25A 3U5UA 2QF8A 3CHEA 4MADA 1NQ6A 3GXFA 3AIBA 1AVAA 4AW7A 1VENA 4QCFA 1OGBA 3OIHA 3VTRA 4FLRA 4GI6A 4U2ZA 2DSKA 1VRXA 4MNMA 3WDQA 2J75A 2EBNA 4OKDA 4AZCA 3VMPA 1CGUA 1EIBA 2JE8A 1CENA 3LPOA 5I24A 1B3ZA 4PRWA 1WDQA 3BC9A 1OM0A 4OZOA 4AZIA 1B3XA 3ARRA 3BMWA 1E4NA 2DT2A 2WK2A 2ZE0A 2VO5A 3ZJ6A 5A2BA 1A47A 1W2PA 3OZOA 2VVNA 3VINA 5D4YA 4TOQA 4ACZA 3WY1A 4W85A 1E6ZA 2DSUA 1JIBA 1R87A 1K9DA 4R27A 2O9RA 4QAWA 1ITCA 5BXPA 1BTCA 5LA1A 3GH7A 3ARPA 4MAVA 5M17A 1X6NA 3BCFA 4HA1A 1IV8A 2WMIB 1HJWA 4P8WA 1MQPA 1W3HA 9CGTA 5A6JA 5A6KA 1GOMA 1CIUA 1KFWA 1KR1A 3VIOA 3SCUA 3WD4A 2CESA 2FHCA 1ZBCA 3WEMA 3WNLA 3WBEA 3BSHA 3PZVA 2WXDM 4PBGA 4GQRA 3L2LA 3WUBA 3GZAA 2VQUA 5C70A 5KZ6A 1M53A 1R8LA 1UHVA 1NARA 4GIAA 3WQVA 4RE4A 3K46A 2TAAA 3L4YA 4UFJA 1L0PA 4HA3A 5M5DA 2V3EA 3NDZA 1WPCA 1H5VA 1UR2A 5A6BD 3TTYA 1KXTA 2ZWYA 3B9AA 1HF6A 3PBGA 1H49A 2VJXA 3VVGA 1CXEA 1IT0A 4KGJA 2X05A 1JNDA 1DTUA 4GO8A 3N11A 1Q4NX 3SCNA 4M1RA 3EMZA 1BAGA 1BG9A 4MB4A 2A3EA 3BLKA 2PB1A 4JCMA 1TVPA 2WVVA 2WZHA 1MFUA 1KGXA 3VIFA 1KGWA 2J74A 3FW6A 2VZVA 5DFAA 4PEEA 2CPUA 1XH2A 1JYWA 3OB8A 4YHEA 3MV01 1MWOA 4CVWA 1W9UA 2J7FA 2VRKA 3VGBA 1DP0A 3IAPA 3O2LA 2E40A 2QHAA 3RPMA 4ZEPA 1V3HA 2BS9A 2ZX8A 4IISA 2J79A 3EDEA 1V0NA 4JKMA 5D8WA 5JIPA 3POCA 1JXJA 1MQQA 1E6RA 1XV8A 3JUGA 1DWFM 1E4IA 2VX5A 1G1YA 2ZXAA 4W8LA 1H2JA 4S3KA 4JL1A 1NWTA 4TTGA 3PN8A 2EJ1A 3N04A 1JL8A 4CCEA 2XIBA 1BVNP 3B9EA 2WMFA 3CMGA 4A4AA 4EK7A 1V6WA 2ZXQA 1PX8A 1OT1A 3S2CA 3VM5A 3E1F1 1Q6GA 2G3MA 2EO7A 3VX0A 1ISVA 1J0HA 5M3WA 1E0VA 3WQ5A 3RJYA 4M8UA 3N9KA 3WDRA 4ACYA 1E55A 3VM7A 2GFTA 3ZOAA 3O6AA 1FH7A 3ARYA 2FGLA 2G8ZA 4NF7A 2XM1A 2CITA 3BXWA 1CGXA 1GW1A 2E9BA 4HU8A 2EPMX 3AMGA 1GVIA 1V0KA 1TA3A 1GOIA 3AHXA 4CD8A 3ZSSA 1MVYA 2VL4A 3AHVA 2VUYA 4PSRA 4H04A 3EDKA 4RE2A 5AY7A 5DO8A 1EDTA 4J3VA 3NUKA 1GORA 3W24A 1OT2A 1CTNA 2HVMA 3AS1A 3PZIA 1E1FA 1E15A 5A8MA 5HOSA 1JDDA 1R7AA 3AIVA 2BVTA 4HU0A 1JD9A 3ZO9A 3VIHA 1UUQA 4HZ6A 3VUPA 3WF0A 1ZU8A 2G3JA 5BXTA 3MSGA 3VOCA 2OWCA 2DIEA 4PTWA 3EDDA 2ZUVA 1EQPA 2D23A 3AROA 3ARQA 5ABHA 4C7DA 1UWTA 1UD6A 1V3LA 3OBAA 4N0RA 2XFFA 3RCNA 3BAWA 3WQWA 1KXQA 1WZAA 4W7VA 1H0GA 7A3HA 2DQXA 2QLYA 4BZYA 3GNRA 5JBFA 1NWUA 3WEOA 3NDYA 2W67A 1B1YA 2BFGA 1B3YA 4EANA 4PCSA 4PN2A 5A94A 4WSJA 3ZQ9A 5LA0A 1LWHA 4PUDA 1WZKA 3AMKA 2AMGA 2DT0A 1J0IA 3UETA 2BHYA 1Q6DA 2WHMA 2GJPA 3O9NA 4U3CA 5A6AA 3CZJA 4CVUA 3IAQA 1LL6A 3MUAA 1QHPA 1BYBA 2XGBA 3N13A 1KXVA 2BY0A 4CUCA 1V0LA 4P7RA 3QOKA 1R86A 2D1ZA 3T2PA 1E3ZA 3CZ8A 3WMBA 1Y7VA 3D3AA 4MNJA 3EDJA 3ZT7A 1XGZA 3A4XA 3UR7A 4HMEA 4AZ5A 4U5KA 2WKGA 2PWHA 1E0XA 2PWEA 4ZFMA 1V3IA 4ZE4A 2WVTA 1RH9A 5CPSA 2XGIA 3OA5A 4MNKA 4UQDA 1E9LA 1XH1A 4MPKA 1ZBVA 3T0DA 1KBBA 1V6VA 4UFMA 2CNCA 1DWHM 4M82A 4NZCA 3AIQA 1QI3A 3PZ9A 1QNRA 4JFVA 2YDRA 2ZUUA 1UWIA 3CUJA 4UZSA 3WQ8A 3GNOA 1US3A 4OIFA 3HN3A 2NW0A 4PMYA 3IJ8A 1UZ4A 2VZUA 1UWUA 2WBKA 3L4WA 4GO9A 2WB5A 1KQZA 4KWUA 5E9AA 1TZ7A 5AYIA 1XH0A 1B2YA 1LL7A 3F5LA 2GDVA 1C93A 1GUVA 1CNVA 4CD4A 5GNZA 1LG2A 1U2YA 5A1AA 5EB8A 4H8HA 2DGAA 4AD4A 5ABFA 1GHRA 3U57A 2FHBA 1UYQA 1KR0A 1ZBWA 4M24A 1EQCA 3SUTA 3TA9A 4ML4A 3TONA 4UFHA 2YA2A 2XPKA 1E70M 1I1XA 1V02A 3SCRA 4V2XA 3WKZA 1NWSA 5LA2A 3MMDA 2CEQA 2G3IA 1B3VA 7TAAA 1E6SM 2DT3A 1E6NA 1ODZA 2C8NA 2WKLA 2WWCA 1NP0A 4NSBA 3W29A 5ABEA 1HL9A 1PIFA 1BQCA 2ZX9A 2J62A 1XSKA 4P8XA 4R5EA 5IFTA 2GDUA 4F66A 3AS3A 1UKQA 3AISA 3AMCA 1GQKA 1ZS2A 4AEEA 3DYPA 1AQHA 2Y8VA 1A3HA 3MKKA 3I3EA 1B31A 4AD0A 5AC4A 2PC8A 1CECA 3DYMA 3CGTA 1XCWA 1K9EA 3M07A 1TG7A 3GXMA 4FLQA 1WO2A 2EPLX 4TVCA 4C7FA 1N82A 5DEZA 3UESA 2YDSA 5BCAA 3W6MA 3PTQA 4DUXA 3ARTA 2J7HA 5D9NA 4CCDA 3WH6A 2QMKA 4LYRA 5D9PA 3OGRA 4D1JA 4XZBA 3BLPX 3VD7A 3BGAA 1UR8A 2CBUA 5EBAA 2J7BA 5GQBA 4BCEA 1BVZA 2Y8KA 3WH8A 1BYCA 3T2QA 2ZX7A 1MYRA 1XD1A 3D5HA 2XTKA 1BSIA 3VKKA 1BFNA 1UQZA 3A6OA 1JZ7A 2GJRA 3WF2A 1W1VA 3VDAA 4AZ6A 3NSXA 4MB1A 4D1IA 3AOFA 3QHMA 1BPLB 3DECA 4TX6A 2VQTA 3W28A 3VPLA 1J9YA 1LLOA 4NRRA 2XVGA 1YQ2A 3GH4A 5CPTA 4ATLA 3PZMA 1PZ2A 3I3DA 5A6MA 5HNNA 5HPCA 1W3JA 1HP5A 4AEFA 1FHLA 2VI0A 1EOMA 3WNOA 2CHNA 5IFPA 3GYCA 3ZM8A 2XJ7A 3W81A 1J10A 5E0CA 3RDKA 3PTKA 1GJWA 1HJSA 4UTFA 2OSXA 2ZX5A 4ZXOA 4CN1A 4D6JA 1US2A 2UY5A 5F7UA 1TMQA 1J12A 1OB0A 2WVSA 2AAAA 1UD4A 4FMVA 4D71A 1UA7A 3FAXA 4PMZA 3B8SA 4W7WA 3AZSA 1C7SA 4AD3A 3BAXA 1JAEA 4W5UA 3WDPP 1PBGA 1I1WA 2EPNA 1C7TA 3GDBA 3QOMA 1E72M 5A8NA 2CKRA 5EFFA 4DM1A 1C8YA 4PSPA 4J3XA 5A95A 1VEOA 4LXFA 1JYXA 3IANA 2WLZA 2ZWZA 1H41A 4DM2A 5GNXA 4MB3A 3BSGA 5E70A 1E5NA 4UQAA 3PZGA 3BMVA 3ARZA 4WK9A 4Y7EA 2QPSA 2CYGA 1J11A 1CGWA 5I23A 5LYRA 1GVYA 2CXGA 3ARWA 3TTOA 1ISYA 2OYMA 2FH8A 3WELA 3VIKA 1EOKA 4W7UA 2AOSA 5JBEA 4GINA 4LQ1A 3SUUA 1D3CA 4QCEA 1QNSA 1VIWA 4DUVA 4HPGA 3SCTA 1V6YA 3KWXA 4AXNA 1J18A 4D6FA 5I0DA 1EGZA 4CKQA 1K9TA 4M80A 1KQYA 2DPEA 1JFXA 3TP4A 4UFLA 3CH9A 3NYDA 2XFYA 4JFUA 1Z32X 1ZB5A 4J28A 1IZJA 4M56A 3PZUA 2PWDA 1FH8A 3PZOA 1UD8A 3VGFA 1GHSA 4P7LA 3QR3A 1XCXA 1VB9A 4XZWA 1H0IA 3G6MA 2E3ZA 3AXIA 4YPJA 1GPFA 4CN6A 3RM8A 3AMDA 2E9MA 2VRQA 3DYOA 1CYGA 4J3WA 3MUY1 1NM9A 3DC0A 3MUIA 3G6LA 4LPCA 1BGAA 2WSKA 3AJ7A 3WQ6A 3CUIA 1KB3A 2IXUA 2RGLA 1D7FA 4GI9A 3NCOA 2VR4A 3W27A 1PPIA 3LPFA 2WYSA 3N18A 5IXEA 1F4HA 4J3TA 1Q6EA 2WSPA 4BQ5A 3LPPA 1P6WA 1GNXA 1PZ3A 1ZL1A 2XUCA 1ZJBA 4DWSD 2CBJA 1PAMA 3CO4A 5A69A 1SYTA 2G3NA 1EH9A 1JFHA 4EE9A 4Z2IA 3LMYA 1OBAA 3WF4A 1CXLA 3GXDA 3GM8A 4JL2A 2BY1A 2J47A 1E71M 5ECUA 3K4DA 1HVXA 3WF3A 2YA0A 4MTVA 2EEXA 1FH9A 3WNMA 4IPLA 3WUGA 2WMKA 2WHKA 5DT5A 2JFEX 2VRJA 5BYWA 3W82A 3NJ3A 1GZJA 5FCZA 1H1NA 3NSMA 3WH5A 1EDGA 5CSYA 3AHZA 4W89A 3TTSA 1JI2A 2GUYA 3ZIZA 4E8DA 3KL3A 1KCLA 3AFBA 1UG6A 3B9DA 3TTQA 2GVYA 3EMCA 4Z2HA 1EO7A 4AC1X 3BAJA 1XHGA 4ACZB 4S3JA 1HT6A 1W91A 2WAGA 4F79A 1QNQA 3W25A 1JF5A 4RL3A 3RO8A 1W9VA 1E4LA 5CGTA 1QI0A 3ARXA 3HU7A 5GPRA 1GQJA 3QHNA 2QV4A 1JGIA 4D6DA 5HBFA 1RD6A 3FY1A 1OGSA 4NI3A 4GPNA 3BH4A 5CSUA 1V3MA 4W93A 1VFMA 2OWXA 1UWQA 2WBGA 4J3SA 3WMCA 1FP8A 1FHDA 2GJXB 3WENA 4GKLA 1QBBA 1HJVA 1V3JA 2BHUA 1UH2A 3T08A 4CCCA 2PBOA 3QGVA 1HP4A 3WBAA 1X1NA 1GOQA 1WDRA 2A3CA 1UR0A 3KE0A 1HXJA 1DWGM 4PTMA 2DH3A 1G94A 4QP0A 3WSUA 1KWGA 2Z1KA 1NOWA 3FN9A 4TTUA 2J8FA 1HKKA 5HPOA 4ATWA 2YL8A 4HOWA 3VGGA 1ZJAA 4XB3A 2X0YA 1H3GA 4CU6A 3KL5A 3ZR5A 4MNLA 1NOFA 1WAWA 3ZR6A 3F5KA 2HISA 4B9YA 3W4RA 2PWGA 1HNYA 1ISZA 5BXRA 3UERA 5A3HA 1CLVA 4AD5A 4F9DA 5CGMA 2MANA 1CGYA 4BS0A 1FFQA 1WP6A 2G4FA 4HZ7A 2D20A 4IM4A 3W53A 1WE5A 4HOXA 2PWFA 2NT0A 3RM9A 3OGSA 1JZ6A 2CKSA 3ZMRA 1VFUA 4KH2A 3WEZA 1ISWA 1ESWA 4GZIA 2BHZA 2D3LA 3ZJKA 4HP5A 1VBUA 4W8AA 1UA3A 1V03A 2BV9A 3VNZA 2D0GA 5JUVA 1LF1A 3BAYA 1HL8A 2JIEA 3UG5A 2VR5A 3GBEA 3SIMA 1DEDA 5CJ5A 2VX6A 4GI8A 1HVQA 5CG0A 1HIZA 3EBVA 1UQYA 3MO4A 1JYNA 3AIWA 3WIJA 4D6IA 1JZ5A 1DWAM 3A4AA 4QFUA 4GXPA 1TUXA 3PZQA 4DWSA 2YLAA 3M7SA 1OCQA 2DEPA 2WMGA 3CZKA 5AC5A 3AS2A 1CXFA 4DUWA 4AZCB 1HX0A 3VIIA 1W1TA 4AIOA 4PUEA 2YLLA 4UCFA 2O9TA 4D6HA 2JEQA 1E4MM 4W86A 1UKTA 1MW2A 2GSJA 5FIPA 2CBIA 1R7OA 4QLJA 2PBGA 2X1IA 2BY2A 1J0ZA 3VIPA 1W9DM 2NT1A 2YDQA 2C7FA 4P7OA 4W5ZA 4HTYA 4FLOA 2YA1A 3AHYA 3AI0A 1XYFA 1MXDA 4ATDA 2WWDA 1NP2A 2D24A 1W9BM 3AIUA 2XVLA 3WF1A 5TD4A 1W32A 3PTMA 4LYQA 4H7VA 2YL6A 1U33A 1MQRA 2WHJA 2WCAA 2FHFA 2VNCA 5C8BB 1CXKA 4KMQA 2D2OA 4ZXLA 5I6SA 1E6XM 1QVBA 3VMNA 3MV11 3SCWA 1G0CA 3W0KA 2XVKA 3CUGA 3AIRA 3ALGA 3W37A 1V6UA 1I75A 3GXIA 3UR8A 2GK1B 2WPGA 4URIA 4E4PA 1GJUA 4JCLA 2WMIA 4LX4A 3L4ZA 1MXGA 2YL5A 2X0HA 3I3BA 1KBKA 3WD0A 4UQBA 4PCTA 5CPQA 1JXKA 2WCSA 4LYPA 2Q8XA 1VJZA 4FF5A 5I3DA 3DHUA 3MSDA 5JBDA 5I79A 1QNPA 4PMXA 1JZ2A 5ABFB 1XD0A 1UR9A 4CU7A 2BXZA 3K1DA 2IXVA 1BF2A 2D3NA 4WLCA 1VEMA 2ZUNA 2V38A 1HN1A 2G41A 2JALA 1GOKA 4V28A 1CGTA 2Y5EA 4AMCA 1ITXA 5EFDA 4JHOA 6TAAA 2DT1A 3KL0A 2WW5A 3CBWA 1NH6A 1O6IA 1RPKA 2BNJA 2W5FA 2A3HA 3CZEA 3U7BA 3RMEA 3ARVA 3EDFA 2EXOA 5CXPA 2Z1SA 2XIIA 1B30A 2OYKA 2V3DA 1JDCA 2V3GA 2O9PA 4B3KA 7CGTA 2W91A 4BQ3A 1H09A 4UOQA 2Y4SA 3LPGA 5A6LA 1VFOA 1EO5A 4TX8A 1J01A 2EPOA 2OYLA 1B90A 4UR9A 5C71A 1V3KA 4OOUA 2XWDA 4Z2KA 4WKFA 4BQ4A 5A8QA 2UY2A 4JIEA 5CZKA 4MB5A 2XWEA 1HJXA 4D6GA 4WKAA 3NIYA 1DHKA 1YHTA 2WLYA 1EA9C 4X0NA 3UCQA 3ZSTA 2UY3A 1VBRA 1XYZA 2EPKX 1UD2A 2BVYA 3SURA 2Y2WA 1KXHA 3MMUA 3L4TA 2VMFA 4U33A 1JG9A 2A3AA 3OLIA 4NRSA 1J0KA 2B31A 1BYAA 2F61A 4UOJA 2J7CA 3SUSA 4JFWA 1HKIA 4TVUA 1G5AA 3VGHA 3WUFA 3SUVA 3RIKA 3VMOA 3U7VA 4PYSA 2J77A 3CTTA 6CGTA 1B9ZA 5BRPA 1VEPA 3WNNA 1C92A 1VF8A 4KGLA 3F4VA 2WC3A 3VD3A 1QI4A 4PMOA 2WANA 5FOOA 3KZSA 1KWKA 3CZGA 3VIJA 2DSVA 1WB0A 2E0PA 3N12A 4B15A 4UNIA 3AICA 1E40A 1XSJA 1B3WA 3VDHA 1AMYA 2DSZA 3T2OA 5DMYA 2CIPA 1BYDA 1PX3A 1UKOA 3A47A 1J0YA 3WD1A 4BF7A 1OGGA 3AMLA 4BA0A 1QPKA 4JHZA 3VILA 1E3XA 4P7NA 4CD5A 1OINA 2ZUMA 4FK9A 1K6AA 1AQ0A 4JAWA 1C91A 5IHRA 1UR4A
chains in the Genus database with same CATH superfamily
4RW3A 3UXIA 3ZVHB 3PWAA 1O4UA 1V08A 1YKWA 4C6PA 5E0FA 3WQFA 2CHRA 4PMJA 4QS5A 3M6DA 2ZXBA 2WMJA 5CJMA 3WDJA 2ZFAA 3A4WA 1QHZA 4H8UA 2OTDA 4OJYA 3CLWA 1KBJA 1YDVA 5DY2A 5A2CA 1GPWA 3UWZA 4W8BA 3CUHA 4S3FA 2OPJA 1EXBA 2E6DA 5B7YA 4CN4A 1DORA 2IKJA 3R8HA 1QW8A 2GUBA 3DHPA 3QC0A 1E73M 1XCFA 4AAJA 1OWQA 3GU1A 5CG7A 5D9MA 1WDDA 4Q3MA 3ZJ8A 4DNHA 1LRNA 4ZQCA 3MANA 3Q58A 2NX3A 3TN5A 1J5SA 1AK5A 5AYBA 1R85A 3POHA 5EY5A 3GXNA 2OODA 4O1AA 2BMBA 4GGBA 3EMQA 3A3HA 4LAKA 1PX4A 1QI2A 3GSMA 1UWSA 4QJ3B 2W61A 5LSMA 4AIEA 1A5LC 3NO5A 2PGEA 1QDSA 3VIGA 3VAVA 1RP9A 1XRVA 3N29A 4F2BA 8XIAA 2ZIDA 1AMKA 4JTFA 2WPBA 4H9MA 1S46A 3ICJA 5ABGA 5PTDA 3LOTA 1EDQA 1Z7AA 1LCOA 1UC4A 4EVZA 2C0HA 1W1YA 1ML1A 1OC7A 4F2UA 1PTAA 4LAOA 5H1WA 4AF0B 4JTHA 3HQPA 5DRCA 3KCJA 3G0SA 1TR1A 3SCPA 3IK2A 3JZUA 2NVCA 1J0JA 4FOUA 1QW9A 1WX0A 4MDOA 2OELA 2ZUSA 2Y24A 1CWYA 2VX7A 3N2MA 2EGZA 1XUUA 2NQHA 3L2IA 3PHAA 4LJ3A 1GZ1A 3LLFA 3ZT5A 4GJIA 3BCDA 1UW9A 2W62A 3ZLFA 5AC7A 1K9FA 3BJSA 3G1VA 4ZOBA 1XIIA 1ME7A 2OO0A 4XQ6A 5C2GA 3N17A 2ZUTA 1FKXA 3RILA 3FXYA 4D9PA 4FF7A 3LCLA 2X2YA 4RDVA 4RPPA 1C8XA 2ZX6A 4UFKA 1W1PA 1SZFA 1RR2A 1N55A 2OMAA 4E8CA 5LXEA 2FFIA 4Z42C 5MKGB 2VZOA 2WC7A 1IZKA 5FL1A 1OSEA 2XSAA 3W1UA 4N7QA 2A79A 1AQMA 4JHMA 4HHLA 5DCEA 2GZXA 4LUYA 3SEPA 2E5CA 1SMDA 1YTEA 3AYRA 3I10A 4HZ8A 3BCJA 2B4GA 4WIWA 1FWTA 2X1RA 2XN2A 4LCQA 1E0WA 4YJ5A 3WLNA 2CFFA 4K7VA 2UWFA 1ZNNA 1DVJA 1IIHA 4EXAA 4CQBA 5HATA 2V5CA 3W72A 3SN1A 4KRTA 3BW3A 3KW3A 1FP9A 3OHMB 2P1FA 4IOTA 4L64A 1B0IA 4F3HA 2X0SA 4O8RA 1WDSA 1SSGA 4K36A 1F4AA 4NU7A 2WVUA 4DO4A 4Z2GA 1JD7A 1YXDA 3A24A 1DIKA 1L2QA 5F4SA 1V0MA 3IEBA 1HJUA 4JFTA 1H60A 2VEFA 1FRBA 1U30A 1WOBA 2G37A 1R0MA 2Y63A 2G96A 4JKKA 4B5TA 1J79A 2QMJA 5FEPA 3ZJ7A 1G7UA 1DQUA 1UC5A 2WMHA 3AWOA 2XH7A 3NNTA 4QLKA 2GGGA 3AJXA 4CNNA 5AYZA 1EWEA 3CV7A 3VGDA 2JEPA 1TPDA 4QEEA 3T05A 3WNPA 4JTIA 3WD2A 3IVTA 1IE7C 1JI1A 2V30A 2W4XA 1M03A 3AYSA 4K8HA 2ZOXA 4UZUA 5BWFA 4LY4A 2Y61A 3M47A 1JYVA 2C13A 2EPHA 4AZHA 1HKMA 3R8GA 1KO0A 3VKAA 1DJZA 3A13A 1R38A 1M9HA 5GNYA 4M81A 3I6RA 3NR0A 2J78A 1TWWA 3QV8A 4MVAA 4HOZA 6ALDA 3R13A 4K68A 2W79A 4MUZA 4UTLA 1OABA 1SMAA 3VC5A 2EAWA 3VDGA 4MDPA 3GTNA 5BWAA 4PMQA 2J88A 4YTSA 3MS8A 4CEUC 3SUWA 4FZIA 3AU6A 3SSZA 1AW1A 5FL0A 2NV9A 2X7WA 4KRUA 2VOTA 4EACA 1V6XA 3LB0A 1VYRA 3OA3A 4GRSA 2CCRA 7PTDA 4DWDA 5C54A 1XLHA 1V4YA 3VDCA 2PDXA 2RJHA 5FSEC 2GGHA 3ANVA 3SCSA 4O57A 2CBVA 4K8GA 4YHGA 4INFA 4FX6M 1N8FA 3TK7A 3N14A 4PMUA 4ZSTA 5I77A 4WY0B 1RQBA 3WD3A 4BK9A 3NQ2A 2VGFA 1AW5A 4QM1A 1E0TA 5D33A 3TSMA 4DBWA 3TMQA 4LF2A 3IWPA 2YIHA 5JXQA 5HXMA 5CJNA 4LU0A 2E8ZA 1W3NA 2Z7KA 5C9UA 3IUIA 2ASHA 3G8RA 2ABAA 1XLDA 3EWXA 1I2PA 3H12A 4B9ZA 3Q94A 2VEPA 1KRMA 2YR1A 2DDXA 4K39A 3TYCA 3SCVA 4DPQA 1RK6A 3BE7A 4JXCA 2VDIA 2WQPA 3GBDA 1XRFA 3NPVA 2ZA1A 3UXLA 4PFHA 2F84A 2J8GA 3CHFA 2GK1A 1K8XA 4JNZA 1EYEA 1W5QA 3UEQA 4PEKA 4B4FA 3R4IA 4R9OA 1MW1A 4F8XA 5BMWA 3DFSA 5G4WA 3FIGA 3L66A 3NXFA 5CBIA 2WJEA 1GKQA 2GWNA 3WMSA 3C0QA 4H9UA 1UUOA 2OSWA 3WLOA 4F9JA 3HO8A 3QHOA 3WH7A 1Y5WA 3CHEA 4TU1A 3H7UA 4E4FA 5DQPA 2V81A 1AVAA 1PDYA 4QCFA 3RLVA 1F05A 3OIHA 1CI1A 3EOUA 4D8ZA 3TC3A 4HA0A 3VMPA 3EA1A 3UYCA 5DANA 3SECA 1EIBA 3M5XA 3C2OA 2GVJA 4PRWA 2R94A 3B8VA 4AZIA 1KFBA 1HL2A 2PSNA 4DVOA 3UR2A 2QXWA 4EXBA 1UZDA 4GIYA 9RUBA 4ZZ9A 1GVRA 3VINA 1Q6QA 2DORA 2NQZA 4ACZA 3GC4A 3WY1A 2OKOA 3SQLA 2DU2A 4R27A 4PC8A 2O9RA 4PBEA 3NQAA 3B06A 3ARPA 4MAVA 4NT0A 1X6NA 4KBXA 3BCFA 2WMIB 2F6UA 1HJWA 3HPZA 1DIDA 3QBUA 4ZQMA 4ZVJA 3EPNA 2C19A 5A6KA 1DXEA 1GOMA 5DELA 1KFWA 4GK8A 2QJMA 3WK1A 3GHTA 3WEMA 4QE1A 1Q6OA 3OVQA 3WBEA 2PLKA 3BSHA 2QCMA 3WUBA 3GZAA 2VQUA 4Y9OA 5KZ6A 2ZZ1A 2YBVA 1NARA 4Z17A 3PY2A 3CAKA 3A64A 5J5RA 4HYWA 4IT1A 1EB3A 4HCLA 4N02A 2AGTA 4UFJA 4HA3A 1GYMA 2QIIA 3SY5A 3MO7A 5EBUA 2V3EA 1EIXA 3NDZA 1H5VA 4Y96A 2ZWYA 1L8PA 1KV5A 4HJFA 2YCIX 3CYJA 2P0OA 5F2MA 1D3HA 3PBGA 4ZB0A 3M4HA 4KW2A 2VJXA 4KGJA 4LRTA 4K3ZA 3IARA 3VNDA 2NXGA 3CQ0A 3MYOA 3PTDA 4GO8A 4JIIX 3SCNA 3EMZA 4AB4A 1BG9A 3RCYA 2ADAA 4AQLA 5CZ0A 3RX2A 4AXKA 4NXSA 4DXXA 4JCMA 1TVPA 3OO2A 1KGXA 3CV6A 1XF0A 4H83A 3N2OA 3WBXA 1M7PA 1MZRA 5DFAA 5HQEA 3V5FA 3A21A 4US5D 4PEEA 4GBUA 4E5TA 1L6WA 4PB3A 2W3ZA 4H9VA 4JTQA 1W9UA 3O6DA 3VGBA 4DEFA 2FQIA 4XAYA 4ZEPA 3OEXA 2Q6ZA 1H7RA 3EX2A 1XX1A 2SFPA 3N6QA 2HV5A 2ABBA 2BGSA 3HG2A 3EDEA 1IXOA 4JKMA 3W1QA 2PZNA 1E6RA 1XV8A 3JUGA 2R1PA 1DWFM 1E4IA 1UB3A 2TMDA 1DJHA 2V9DA 1H7WA 4S3KA 4JL1A 4TTGA 3KVKA 3P3BA 1F2JA 3N04A 3PUDA 4A4AA 2ZXQA 2HSAA 4DF2A 1Q6GA 2EO7A 2C1GA 3BVJA 1J0HA 4IICA 4DPPA 5M3WA 2CLIA 2A7NA 4ENLA 4H9YA 2VELA 3SADA 3QEZA 2GFTA 4NF7A 1A53A 4JIQA 3W7CA 1ECQA 3RU8X 1XW8A 4JN7A 4WY0A 1K3UA 4CD8A 3IK4A 1MVYA 2VL4A 4GFSA 4QDPA 4PSRA 3VABA 4L4MA 4H04A 5HWMA 3P5YA 5K4ZA 4LAMA 5DO8A 5HULA 4J3VA 1GORA 2PLCA 3W24A 1UIPA 5KITA 5U7SA 3NGFA 4S3CA 4LC8A 4F4RA 3WG6A 4UTTA 4C1LA 3EPMA 3BQ5A 5TAOA 1E1FA 3CIXA 1SO6A 4DO6A 5HOSA 1MRAA 4F0LA 1JD9A 3EX1A 3ZO9A 3W23A 3VIHA 4HZ6A 1A49A 3VUPA 4N9BA 3NQFA 1ZU8A 2GGJA 3VOCA 3EDDA 2C15A 5C9WA 1EQPA 2D23A 5ABHA 4C7DA 1UD6A 3TH6A 1V3LA 4WX2A 5DCBA 3G18A 4N0RA 3MKCA 2FZ8A 4Y9NA 2ICSA 2TYSA 1F6PA 4A05A 2DQXA 5HR7A 2QLYA 5JBFA 1NWUA 1PTDA 3NDYA 2W67A 1B1YA 4XIAA 3UA3A 1Q85A 3PG8A 3BWWA 1LWHA 3D3FA 4PTNA 1OX4A 5CPMA 4PUDA 3FJ6A 2GOKA 1DBTA 1VYSX 3EOLA 4FB7A 3ABXA 4A21A 2IPGA 1GVQA 4ZTYA 4L1WA 4U3CA 5A6AA 4CVUA 3IAQA 3Q45A 3N13A 3ITLA 1FXPA 3W7DA 3LTYA 3Q37A 4QITA 4XBSA 1X7IA 3UWVA 4LUSA 2AL2A 1R86A 1XIDA 5JQ9A 3T2PA 5AC6A 3U3HA 3TC7A 4MNJA 3NZQA 1DQWA 3A4XA 3H7RA 4HMEA 3NQVA 4AZ5A 3QW3A 3CMFA 2PWHA 2PWEA 1TRIA 1QT1A 4RNIA 3CPGA 5CPSA 4KQNA 2VGIA 2OEMA 4MPKA 3BANA 1OZMA 4UFMA 3U4FA 1DWHM 4M82A 4NP7A 4FHAA 1QI3A 3V7PA 1QNRA 4JFVA 1K7XA 3FFSA 3E96A 1UWIA 3W2NA 2BXVA 2V82A 2ZTKA 1F6KA 3BGJA 4PL1A 2NW0A 1Y5XA 3ONCA 3LHVA 4OV4A 4PMYA 1FXQA 1TWZA 1UZ4A 3IJ8A 3EX4A 1UWUA 3N4AA 4KPLA 3L4WA 3WLPA 3OQEA 2W0UA 3W2MA 1FDZA 2GDVA 3S2JA 1GUVA 1XPGA 2GSHA 3C8NA 2O7QA 4O28A 2REQA 4V1YA 3CWOX 1X97A 5A1AA 2D69A 5ABFA 3U57A 1UYQA 4M24A 1EQCA 3SUTA 3O05A 4S3DA 3I7QA 2OXNA 3QPEA 1TJPA 4OT7A 1JCJA 4NJHA 1E70M 5BW6A 3GVQA 3WMLA 3WKZA 1B3VA 1JRCA 3P8JA 1KTNA 4H6KA 3B04A 2XINA 4AEOA 2C8NA 2WKLA 1AUSL 1NP0A 4NSBA 3W29A 3R10A 4F0KA 1IHIA 4DNMA 2R9RA 4R5EA 5IFTA 2CU0A 2GDUA 2PD5A 3AS3A 1UKQA 3DESA 3AISA 3H2OA 5RUBA 1U5JA 3UZWA 3H4XA 1FVPA 1OYCA 3GVVA 4RZ6A 4AD0A 3P62A 5FEZA 5AC4A 5C55A 2PDWA 1Q8AA 3QSRA 3HA1A 3M07A 1TG7A 4FLQA 3P7YA 4LVDA 1WO2A 2EPLX 4M7TA 3G2GA 4LRSA 4B91A 2WZMA 5BCAA 2FZDA 1DIOA 3RFAA 2B7OA 1P43A 3TZNA 4D1JA 1REQA 4XZBA 3VD7A 2CBUA 1F8IA 2P8BA 1XDMA 1ZP4A 3U2OA 2ZX7A 3D5HA 2Y7EA 1YE6A 3VKKA 2PTXA 1F8MA 1K02A 1YIXA 4JEQA 3NSXA 4MB1A 3WK3A 3LSCA 1OX4B 4Y8FA 2VQTA 5CPOA 3PUOA 1LLOA 3L67A 1I4NA 3SN4A 3W02A 3G1AA 1FWFC 4YTQA 1HP5A 1EOMA 3ZWTA 4Q8TA 2XIOA 4NZFA 3QMSA 1S5NA 3NOYA 2QDGA 4I6VA 1H7NA 1HJSA 3GX9A 3RPTA 4ZXOA 3W7PA 1OG6A 4CN1A 2RDUA 1US2A 2UY5A 3O15A 5LXXA 2VDHA 3EEGA 1XRTA 1DKWA 3KBSA 4NX0A 5GJMA 4V15A 3WJSA 5D2WA 3BAXA 2Z1VA 4W5UA 3PSWA 3EOSA 2EPNA 2FZBA 1Q6RA 3KOFA 3SRDA 1ENUA 2ISVA 5BNKA 5EFFA 2VFFA 1C8YA 3VOIA 4K8EA 1DHPA 4LXFA 5K3VA 2WLZA 3GYEA 4ZB2A 1O12A 5GNXA 3BSGA 1NDYA 2Y70A 2PRHA 3PZGA 4IJCA 4UQAA 3BMVA 3H2CA 4XISA 3ARZA 3S1XA 1VBGA 4L1GA 3M1ZA 1W5OA 3W7KA 3WLLA 1UMLA 3ARWA 1FDJA 4GC3A 2Y88A 1EOKA 3NVTA 5GJPA 4GINA 3V5OA 5TF0A 1TV4A 4QCEA 2XDFA 4DUVA 3T0CA 4AXNA 3H55A 4NASA 1DXIA 1K9TA 3IJLA 3M44A 3G1HA 4AH7A 2XFYA 2Z6IA 2Y7DA 4JFUA 5LIXX 4M56A 2H6RA 2PWDA 1UD8A 4U4MA 3VGFA 4QJ4B 2R82A 2C1IA 3FGCA 3G6MA 3EWDA 4XKMA 2ANUA 4Q7IA 1Q7ZA 4CN6A 1EPVA 3RM8A 1TV2A 3DYOA 3MZ2A 1HKWA 3DC0A 3MUIA 3G6LA 4LPCA 3SDOA 5FF0A 5A6TC 3QC3A 1RZMA 5I3IA 4LBSA 2RGLA 2A21A 2BGNE 5EL1A 4IFKA 3PP7A 2VENA 2X2GA 4FNPA 4IFRA 3C2EA 2XIMA 3HPAA 3CASA 3KX6A 2XUCA 2QJHA 2CBJA 4RXFA 1PAMA 1LUCA 3TCEA 3GU2A 2PU0A 1SYTA 2PEVA 1EWDA 4GYKA 1XIMA 5T9CE 4MZ8A 1F3WA 3OZMA 3LMYA 4Z2IA 3CAQA 3R25A 5FACA 4DBSA 1LBLA 4Q8OA 4JL2A 4RW5A 5DMLA 1LT8A 2OQYA 4P2VA 3H2MA 1HVXA 2YB4A 1KW1A 3WF3A 2EEXA 3C4UA 4QJ1A 2FB2A 1WUFA 5DT5A 3V18A 4WVXA 5BYWA 1GZJA 5FCZA 4C65A 4R88A 1UPPA 3EZ4A 5LGZA 1JVNA 5FAGA 1JI2A 2GUYA 3IGXA 4XVEA 4AMAA 2QCGA 2FTYA 4O13A 2A5HA 3VKJA 3EMCA 4QQUA 3QKZA 4AC1X 3BAJA 3WZ0E 2RH9A 3A9BA 2Z27A 4I7VA 4HD5A 2PCQA 4F79A 4ZTXA 3GDLA 1RJRA 2H9AA 2OCZA 4HHPA 2ZC8A 3RG6A 1E4LA 5CGTA 2YCEA 1QI0A 3HU7A 5GPRA 1GQJA 3QHNA 3G8EA 1RD6A 4FXSA 4NI3A 3TJ4A 1Q7QA 1LQAA 3QF0A 1YADA 2VC6A 4NJIA 2OWXA 4DBEA 3WMCA 1FHDA 5I09A 4I7WA 4RNFA 1L2UA 4AC7C 1KM6A 1QBBA 4BI6A 4F0HA 5LHFA 3F2DA 1KCZA 2E68A 3HFYA 2PBOA 3QGVA 4R7WA 4UCGA 1LORA 1K4HA 1GOQA 4DLMA 2A3CA 1GGOA 1PHWA 3S2LA 2OLSA 2DH3A 5CKSA 1VHCA 1NOWA 3FN9A 2IQDA 5HPOA 3KCLA 4LNCA 4ASTA 1IT8A 2CLMA 4XB3A 1QAPA 4ZO9A 2PGFA 3KL5A 4A3RA 1YNPA 1WAWA 3URQA 3ZR6A 3W4RA 2PWGA 4QRNA 4EPEC 6REQA 1P1MA 5A3HA 3O8AA 5ABTA 1RBLA 3WQGA 4I8YA 3B05A 1CGYA 1FFQA 1WP6A 1AJ0A 2D20A 4QE5A 2OZ8A 5XIAA 3TR2A 2WOQA 1VFHA 1JZ6A 2CKSA 4JD4A 3VNLA 3T4CA 1B9BA 3UY7A 5JH1A 2D3LA 1K8ZA 3R6IA 3VA8A 2YDAA 2ZE3A 3JS3A 3VNZA 5JUVA 3LM7A 4H4IA 2C79A 3KHJA 5I3HA 1DEDA 3EA3A 1VFTA 4LAZA 5CC7A 1HVQA 2R1MA 4JBRA 3TNBA 3G22A 1LOQA 3AIWA 4D6IA 2GQ9A 1ZHAA 3CB8A 1LQ2A 3UWYA 3PM6A 1TUXA 3PZQA 3RUBL 1JPHA 1QK0A 4US6A 5AC5A 3CK5A 4C6IA 3AS2A 1CXFA 1ZGDA 3M9YA 4AZCB 4DUWA 4N4PA 3RX4A 3B03A 4AIOA 4C6JA 4HQVA 3T07A 2QDDA 1AD4A 2GSJA 4QLJA 2PBGA 3PF3A 3GR8A 2NT1A 3VIPA 1QCWA 2IMRA 2YDQA 1R3QA 3NG3A 4W5ZA 4YYFA 1XFBA 4FLOA 2YA1A 3AHYA 1XYFA 3ITCA 5B7ZA 1MXDA 1QATA 2PDCA 2D24A 1W9BM 1FCQA 1W32A 5GJNA 1Z8AA 3SQMA 3VI2A 1GTEA 2GUUA 3APTA 3W7QA 2VNCA 2D2OA 1E0UA 3BLEA 4Q4QA 4IQJA 3VMNA 4FX8A 2HEJA 4PZVA 3UZXA 3M0XA 3W0KA 3LI1A 2Y5SA 3ALGA 1E1CA 1PKLA 2PDLA 3M5VA 4UB9A 2BB0A 2GK1B 4URIA 3T1GA 4L1XA 3B8WA 3BW2A 1F61A 1F76A 4E3VA 3L7RA 3PNZA 3R0UA 2E6AA 5I07A 4S39A 4PCTA 4LB4A 1TR9A 1VJZA 4FPSA 2PTWA 2WJZA 5F2GA 3MB9A 4DF1A 5I79A 5K2ZA 4PMXA 1JZ2A 3VYLA 1UR9A 4CU7A 4ERGA 3K1DA 1BF2A 5KTLA 1VEMA 3HMJG 1HN1A 2FMOA 4V28A 4LY8A 1ITXA 4JYFA 3KP1A 3C52A 4NZ3A 2WW5A 1NH6A 2INEA 3U48A 3L0GA 4CEXC 1LRTA 3MDWA 3I6TA 2Z1SA 5T8GA 5FF4A 2V3GA 2O9PA 2VEKA 7CGTA 3C61A 1XGDA 3VC6A 1E51A 3ERPA 1T6MA 3WJWA 1F3EA 3LPGA 3BLDA 4S2CA 1EBGA 3BL3A 1UP3A 1S2AA 1TKKA 3LSBA 3V75A 5C71A 2ISDA 2XWDA 3TQ0A 5JMUA 3BG5A 4JIEA 4MB5A 2VOMA 3YPIA 1HJXA 3G1DA 1L9WA 4UTJA 4MWAB 1YHTA 1IEXA 4KESA 2UY3A 3E5PA 1XXXA 2XIJA 1UD2A 1JUKA 3FKRA 2RFGA 3L4TA 4U33A 4MZ1A 3OLIA 1G4SA 4C6MA 3C56A 4A8RA 3CQIA 4I8DA 2QNEA 3ID7A 1JQVA 3NFUA 1MDRA 3RLUA 3U7VA 2ZZ4A 3DFQA 4QDWA 3DG7A 1C92A 3T40A 3RMJA 2WANA 4KS0A 1PZ1A 3S83A 3LHUA 3AICA 3RK8A 1XSJA 3TKFA 1J0YA 4OGZA 3AMLA 4XD4A 4JHZA 3UW6A 1IEVA 3VNKA 1JPIA 4EPKA 2ZYFA 3TVAA 3PPHA 2WJFA 4LUTB 3S2MA 1R3SA 3GG1A 3C6CA 5HMEA 4AIUA 4K7YA 4WR3A 5HINA 2VCAA 4NHVA 1DE5A 3EEZA 5IHSA 2HROA 4J5NA 4X0VA 3TXZA 4GQQA 5I5RA 4PUKA 1GW9A 2QJJA 1OJXA 2PDBA 2PF0A 1VP5A 3R1ZA 2CLLA 4LV9A 2QJIA 3AS0A 3QH2A 4WQ6A 4Q22A 5DN1A 4YMZA 1QR7A 4H2CA 3AALA 3LGGA 3HM7A 3TLLA 3P84A 1JCMP 1O60A 4YLWA 5HANA 3W7JA 2R1NA 3N2TA 3PANA 1RUSA 2RDXA 4JX4A 1UR3M 4NZ1A 3QLLA 1UBSA 2HDJA 1TWSA 3EOEA 4R34A 3HV9A 1K7EA 3HJEA 4JICA 4GUFA 4UIOA 1XC6A 4B3LA 2QPUA 3PPFA 4RCXA 4E2BA 2XM2A 3G1YA 3GVWA 2Q71A 2PI6A 5CLWA 2FJUB 3V1HA 3N15A 3MZNA 2PMQA 2HK1A 1WZLA 2FFCA 5CQ1A 2XZ9A 2I5QA 2XZ7A 4G7EB 3BAKA 4NKCA 4AFYA 4AISA 4IJRA 1SGJA 3RYSA 1DE6A 3EKGA 3K8MA 2RJGA 4XUYA 4RV8A 2GJXA 4TXEA 2VGBA 1RPXA 2DW6A 3PJTA 1TZ9A 2X1TA 4M51A 2C0AA 1E56A 3CUFA 4PMDA 1T96A 4I9MA 3FK4A 4AD2A 1GOOA 1T5AA 1UH3A 2X16A 4OUEA 3W87A 3WFZA 2E9LA 1SO4A 3GTIA 3DKJA 2BXYA 2ZADA 3RN6A 3DFOA 2W66A 4ZL1A 3HGOA 4U3AA 1XLGA 4NQ1A 2WNQA 4CNUA 1KRAC 1WNOA 3SIZA 2F8QA 4JTCA 3LCFA 5I7GA 3MCOA 1IXNA 5DY3A 4DJDC 1J93A 2GQ3A 1ECEA 1W2VA 1QO2A 3WBWA 2REQB 3GB6A 2VZTA 2YJQA 1MUWA 3AZTA 1M01A 1XPYA 1KCXA 1TJ0A 4IIGA 1TPVA 1HKVA 5C5YA 2OOGA 2X1UA 1ICPA 4X9SA 5CZJA 4WJXA 1EX1A 2W92A 3T09A 3S5NA 4UQCA 5E6YA 3W6YA 2WZIA 3ZVHA 1V7YA 1F3TA 1C8VA 3BQ6A 1NOUA 3LU2A 4AZBA 4RZ4A 4CQCA 3Q4DA 1FFRA 1FCVA 4GQBA 1T0OA 1E1EA 1S5TA 1JCYA 4G1KA 1OK4A 4P7QA 4LC6A 2CZFA 3O16A 3KEHA 1KCKA 1SQ7A 4J40A 1VAHA 1CXIA 1OF8A 2Q3OA 1E5JA 2FVLA 5ENLA 3QZ6A 1FDYA 3HMCA 3HTWA 2W63A 3TW7A 4XUGA 3CV1A 1X6LA 5JIWA 1PJ9A 3GG0A 3FGCB 1LWJA 3ZYZA 1UD5A 3CQKA 3E0FA 2NSXA 2Y7FA 3OU8A 1XYBA 5IRPA 4WF7A 3L4XA 2OGYA 4Q4SA 1D3GA 4PH6A 3WLKX 1G4TA 3GUGA 2INFA 3ITOA 2OZ3A 1C90A 4UTHA 2W9MA 3M0YA 3OLDA 4KFOA 5A8OA 3OZPA 4HCHA 1NJJA 2PDJA 2INZA 4AHPA 3ALFA 3IVSA 4XV0A 3W1TA 3CUXA 4QSHA 1V02E 4GZEA 3D46A 3RHGA 2UY4A 2YW4A 1XLMA 4GIEA 3QXBA 3GNPA 4IJBA 2PGRA 1Q8JA 1TPFA 4H8VA 2XFWA 3QY6A 1GVEA 2JBMA 4Z2JA 1SZGA 4MJ2A 1SFSA 3OLEA 4M1BA 3THCA 2Y7GA 2VTFA 3PFMA 1OF6A 2ZICA 3RLHA 3SB0A 4HU3A 3AHTA 2O92A 5KMYA 2VVSA 3T0AA 4HIBA 1DWIM 3KLLA 3E9AA 2D0FA 4HNNA 4HPXA 1EC8A 3G3DA 5F1UA 1ODUA 3W1AA 3LGEA 4E2OA 2CERA 1EFZA 4JFSA 4HMDA 5H8UA 3P82A 2EG6A 2YOCA 3S47A 5EU9A 4UMCA 1XLKA 1B5TA 3GNXA 2NWRA 3MHUA 5KEZA 4IMDA 3UD6A 1G7VA 2ZZ6A 2OB3A 4QTGA 1CXHA 9XIAA 3V5CA 3HPFA 3SSJA 3WQ4A 4FIRA 4PULA 1NF0A 3UG3A 4I5RA 3U5YA 1UR1A 4QSFA 4MAZA 2J7GA 4C90A 2PDYA 2YZRA 1J5TA 4KEVA 2WC4A 4HTBA 2J13A 3IGSA 4XKYB 4AZGA 4EAMA 4J27A 4H8NA 3W38A 1XKJA 1H4PA 2OZTA 3PUGA 3W6LA 3S9ZA 2E5DA 1NU5A 2A3BA 2WCGA 4JDYA 4NJGA 4OECA 1VLWA 2E1WA 3V0SA 4UNKA 4GZJA 1NF7A 3VGEA 1M7XA 3MDUA 4C5ZA 5E6ZA 2E4TA 3DG3A 3EB2A 3TNOA 3GO2A 1U1JA 3GW0A 4E4UA 3SY1A 3RITA 2MUCA 3HG5A 2VCCA 4H41A 5KZDA 1OD0A 2E6FA 4QGCA 1R2RA 2CC0A 4LTSA 1UUMA 3ARUA 1C8QA 2OLHA 2WHLA 4A2SA 2O56A 3FNDA 1KM5A 4HT3A 3W1MA 2WZEA 3WNKA 2XHYA 4YNGA 4AZ7A 2F2HA 2GSEA 3QYSA 3TIMA 4NAEA 4IPNB 4O0QA 3QFWA 3AIEA 3M0IA 4ROPA 4BF9A 1E6PA 4L4LA 3VU2A 4TVDA 3OGVA 4W4QA 1RXOB 1PIIA 1MNSA 3THDA 3BLOA 3DUGA 1BRLA 4CGTA 5FKYA 1GQIA 3II1A 4YCPA 1LJYA 4OOZA 4TUFA 1JNEA 1YPXA 1GT8A 1GQNA 3MMTA 4CLMA 2ZDRA 1GKRA 1F6YA 4P8UA 4IIBA 3WJXA 3G77A 4DJFC 3H4GA 1NQ6A 1H50A 4AW7A 3ABOA 1OGBA 4TMCA 4RKAA 2CZVA 4GI6A 1AODA 1VRXA 4KWVA 3WDQA 2J75A 3VUSA 1TWDA 3UNTA 1CGUA 1CENA 2EKCA 4F0MA 3CYVA 1WDQA 3BC9A 2PURA 4DYEA 1X6UA 3AO0A 3LNMA 4DQWA 2OKTA 1LBMA 1PS9A 4S3BA 2PWVA 3ZJ6A 5A2BA 1A47A 1VHNA 1GVOA 5D4YA 1KLYA 4W85A 2DSUA 1JIBA 1W17A 2ZDSA 4QAWA 1ITCA 5LA1A 3UZ5A 2PDHA 5LIYX 4HA1A 3AU2A 5MF5A 1OK6A 1W3HA 9CGTA 5A6JA 1KR1A 4H6QA 3VIOA 3RRXA 3LTPA 2DZBA 4RUBA 2OEJA 2QV5A 3GC5A 3MBFA 3SCUA 3WD4A 3W7LA 4O0KA 4EXQA 3R8RA 4AWSA 1Q66A 3PG9A 3W7MA 5CH9A 3L2LA 1W1A1 3VOFA 1MEWA 4D2JA 4HMNA 4Q4OA 3WQVA 3L4YA 3QQ0A 1L0PA 3LBCA 4LWWA 2ZBTA 3COTA 1TMLA 2E09A 2BASA 3GE7A 1HF6A 1BKSA 4ALDA 1IT0A 3REQB 4FNRA 3IS4A 3N11A 3S1UA 2JKEA 1T8XA 3E5BA 3LM3A 1BAGA 1RLDA 1KFJA 3N25A 3KBNA 5B80A 1ZAIA 2WVVA 4O1EA 3B8IA 1MFUA 4ZODA 3QVQA 1KGWA 4H3DA 3FW6A 5KZEA 5KZMA 3AYVA 2NSOA 3UWQA 1XICA 3OB8A 2BOFX 4AX7A 4CVWA 1DP0A 4HBKA 1GVFA 2QHAA 3RPMA 4TX9A 4NJJA 2VWSA 4PA8A 2BS9A 1FUYA 1XFCA 4XG1A 3MTWA 1DYSA 1NDZA 1M6JA 2NXIA 1UPMB 1V0NA 5C7VA 4UXDA 1MQQA 5FJJA 4LW7A 1HGWA 1G1YA 1H1ZA 2ZXAA 3RRAA 4CNPA 4XD5A 4O14A 1BVNP 3PR2A 1Q13A 4ORMA 1IT7A 4YTUA 4GQGA 3XINA 3OPSA 3WQ5A 3GIQA 1ZLPA 4PRTA 4R7JA 4X60A 1BWVA 2JGYA 1MEIA 3ZOAA 3P67A 3WQEA 3W9ZA 3BXWA 1GW1A 1K1DA 1O68A 2E9BA 3QPZA 4J1OA 1V0KA 3AHXA 3P6LA 1SJBA 3ZSSA 2R1KA 1GYLA 3C2VA 3LA4A 2PZ0A 4LF1A 2ZZ5A 4EAYA 5AY7A 1SO3A 1OT2A 2HVMA 1A5SA 4EWJA 3AS1A 1KTBA 1UP2A 3LQGA 4QG9A 4ZO7A 5A8MA 1A5MC 3HZ3A 1O1ZA 3N6HA 3JW7A 1OFQA 2UZ9A 1JDDA 5BOEA 3L65A 1E9YB 1YBQA 2G3JA 3MUCA 1Y8BA 2XN0A 3AROA 3VK5A 1UWTA 3MP3A 2DZWA 2EKGA 3B8DA 4HNOA 3OHIA 2Z25A 3S9YA 3RCNA 3BV4A 3VNIA 1N7KA 1OX6A 3GRIA 3B0UX 1KXQA 1WZAA 1A4MA 1XIFA 2VC7A 4BZYA 3IRDA 4LUTA 2PP3A 2P76A 4HCDA 2BFGA 2FMNA 3TJLA 1CCWB 2Z0IA 4EANA 3W00A 4DZIA 4PCSA 4DZ5A 2VFIA 3AMKA 1KD0A 2AMGA 2UBPC 5HK4A 3UETA 2BHYA 4DJEC 2ZZ3A 1IIGA 1TPUA 1LL6A 2QJNA 4XSMA 1LBFA 3MUAA 4M6UA 3TA6A 1VIZA 2E28A 5D2XA 1V0LA 4CUCA 3KVMA 2GPTA 3IJIA 4PUUA 2D1ZA 2EF9A 1RBAA 3WMBA 2I9EA 5DRIA 2P8CA 3RAOA 4POCA 3F4CA 4C6LA 4U5KA 3BMXA 1E0XA 4ZFMA 3FLUA 5D02A 4IPJA 2WVTA 1RH9A 4H1ZA 4HSHA 2XGIA 1ZQ5A 3SN0A 4UQDA 2ALDA 3HPXA 1E9LA 1XH1A 3UGRA 1V6VA 2B81A 3G1XA 3CUZA 3AIQA 1JPDX 2G50A 1P5BA 5AECA 2X42A 3FVMA 2YDRA 1TIMA 4NNAA 3S1WA 1R9ZA 4O8AA 3W22A 3FXGA 1S2TA 2WBKA 3DX5A 1OFOA 1KKRA 1OYBA 2WB5A 4UTWC 3WLIA 5AYIA 5E9AA 1WV2A 1B2YA 1BXBA 1LL7A 3F5LA 1TMHA 4CD4A 5GNZA 2OOFA 3FYOA 2DY3A 1U2YA 4H8HA 2DGAA 1GHRA 5M2FX 3GNNA 4GY1A 5LIUX 1TPWA 3FJLA 4JQ4A 5AN7A 4BFAA 2XPKA 1V02A 2PLMA 2OQHA 1QWGA 5LA2A 4FSAA 3TQKA 4XO6A 1EYWA 3N2XA 3N3MA 7TAAA 2DT3A 1E6NA 2QS8A 2WWCA 3BO9A 4V33A 4REQA 1JULA 2J62A 4P8XA 3ABRA 4WD0A 4F66A 3PC0A 4HVXA 2V5KA 3AMCA 1Q2RA 2CLKA 3D47A 3DYPA 4AEEA 4KCVA 3VZYA 3OVRA 2XU2A 3W2UA 3I3EA 4O1CA 3UYIA 2XISA 3DYMA 3HB9A 3CGTA 4J2PA 4LYKA 1XCWA 3PB0A 4HK5A 4TR9A 1K9EA 1VZWA 1TQXA 3NO3A 2ONEA 1FBAA 4R7OA 3BJFA 1GK8A 1SSDA 1JR1A 2J24A 2PDNA 4M0XA 4LVAA 3ITGA 2J66A 4ZOEA 3NURA 3ZS4A 2J7HA 4CCDA 1Z9AA 1US0A 3P93A 3OTRA 1AH3A 3QM3A 4JPGA 3B9OA 7TIMA 5GQBA 2Y8KA 3T2QA 3ONBA 1AH4A 1OHLA 2XTKA 1BSIA 4REQB 2AAMA 3WF2A 3VDAA 4AZ6A 4LUJA 1F07A 1K6WA 3QHMA 3W75A 3W28A 3VPLA 1J9YA 1SU5A 4NRRA 4JTJA 3MT1A 4ZR8A 1YQ2A 3ITVA 3IUDA 1CB7B 4M6QA 3PZMA 1WBJA 1H1YA 2NV1A 3G0UA 3NEVA 5HPCA 5J04A 1JCXA 1PSCA 1FHLA 3WNOA 2CHNA 3DENA 3GYCA 3ZM8A 2DUXA 4C60A 3QMTA 4XTIA 3PTKA 4NAFB 3TLQA 3C2RA 1D7KA 4UTFA 1QOPA 5F4XA 2OSXA 4PODA 4YTTA 3QTGA 3PAJA 1S5MA 4A35A 3ITXA 1RA0A 3DEQA 4I5UA 3HPSA 3FAXA 4G6CA 4GIRA 4W7WA 3C8FA 7REQA 1JAEA 5K4XA 1PBGA 1NDVA 1F5ZA 3WLJA 1C7TA 3H21A 2F2KA 4GYFA 1KTCA 1G69A 1OG0A 3QW4B 4OU1A 4DM1A 1NDWA 4PSPA 3UFYA 4J3XA 3E3HA 1H41A 4DM2A 3KFTA 2HJPA 1E5NA 1C9WA 5DLCA 3KZPA 4Y7EA 5BOOA 2QPSA 5FF7A 1ZJIA 1RA5A 2CYGA 3CL8A 1O5KA 4MPQA 1CGWA 2G5WA 5I23A 1GVYA 4W9TA 2CXGA 2OLAA 1ISYA 2OYMA 2ZZ7A 3TN4A 4G9PA 3VIKA 4K1WA 4LQ1A 3SUUA 2OGJA 1Q5MA 1VIWA 2FZNA 4HPGA 4LUSB 3SCTA 3CM4A 4QIUA 1A5NC 3DOPA 1D8CA 5I0DA 2RDWA 1JUBA 1XLIA 4DZAA 3TFXA 7REQB 3CH9A 1Z32X 3CU2A 1TCDA 2YYTA 3PZUA 2OT1A 1FH8A 3PZOA 4YU1A 3HFTA 1GHSA 3QR3A 2V2HA 4XZWA 3E74A 2E3ZA 1P4CA 3AMDA 1SR9A 5CCZA 5CBBA 1TV5A 3TSDA 2AQWA 1A80A 1R47A 1KB3A 2E1DA 2IXUA 3SRHA 3C0JA 3MHFA 2NLYA 1FWIC 4IIDA 4JS3A 3BOFA 3RLGA 4HKPA 3NCOA 2VR4A 3W27A 3GFYA 2Q01A 2ATMA 2WYSA 3N18A 5IXEA 3UCCA 4J3TA 4FIQA 3KOYA 4M5PA 2QZRA 3LGDA 3LPPA 4DXVA 2LLEA 3OYZA 1PZ3A 1ZL1A 1N8IA 3LX9A 5AB3A 3DGBA 1OCNA 1S2CA 5A69A 2DZPA 4NZ4A 4O1FA 1QASA 5D32A 3ES7A 4UNLA 2R6OA 3O0FA 3WF4A 3GXDA 1ZP3A 4O4VA 2WQDA 1E71M 5ECUA 2I5IA 3EKZA 2YA0A 4GJJA 1FH9A 3WNMA 4IPLA 1VCVA 4HK6A 4QR6A 1Q45A 2WMKA 2H8XA 3QN3A 1P0KA 1XBVA 4RK8A 2P0IA 2Z2BA 1FWEC 5CSYA 3LRMA 3ZIZA 2WZTA 3KL3A 3AFBA 1DQXA 1W8GA 1UG6A 3B9DA 1BXNA 2BOGX 3OBEA 3KRBA 4XWUA 1EF3A 1K8YA 1W91A 2WAGA 3T42A 1JGMA 1QNQA 5J5DA 1BWLA 2AQOA 1EZWA 1JF5A 4H19A 2ALRA 3NQ8A 5DBTA 3VZXA 4IX0A 2NWSA 4MJZA 1XIGA 1S2VA 3UJEA 2QV4A 1W5MA 5D09A 1PCWA 4D6DA 2VGGA 3W1XA 3MJYA 2Z28A 4GPNA 3JVAA 3F2BA 4O12A 2IQ0A 3BH4A 1ALDA 4DI9A 5CSUA 4W93A 1D9EA 3QPYA 4IZGA 3RR1A 4HU4A 5HMDA 1VCFA 1UWQA 2WKJA 1FP8A 3FEMA 4HZMA 2GJXB 3ANUA 4A8LA 1O66A 1XRSA 4GKLA 3KHDA 4I90A 4CCCA 2C71A 4N6EA 4IWWA 3WBAA 1AH0A 1X1NA 1ZPTA 3CJPA 4RNJA 1X8CA 1G94A 1LP6A 4YWSA 4TTUA 2YL8A 1YPIA 4GCAA 1ZJAA 4JQ1A 2QUNA 3L5MA 3OG3A 5TBOA 1LRQA 2HISA 3LNPA 4AVOA 4NIRA 1LLWA 4A3QA 3LMZA 3QR1A 4F9DA 4GMEA 2MANA 4QROA 4IM4A 4XBJA 6ENLA 4HOXA 1GVSA 3O63A 2BZNA 1V7AA 1VFUA 3WEZA 5C0QA 4RE0A 4HP5A 1TV7A 1B3OA 2A6LA 3LQLA 2VD8A 4N9DA 2P5NA 1LF1A 5I3KA 4AWUA 1I2NA 2ZRZA 2JIEA 1A5OC 3H53A 3SIMA 4LS0A 5A8GA 1SW0A 3EBVA 4LALA 5AKQA 5FESA 3WIJA 1JZ5A 3B0YA 4IIFA 3GW3A 1DWAM 5BMXA 5H2ZA 3U2ZA 4GXPA 1IWAA 1OYAA 5D04C 3MY9A 4DWSA 5U4NA 2BGQA 3CB3A 2DEPA 1Q7MA 3MA8A 4IHCA 1EJTC 1CLKA 2WJDA 3KOWA 3VCNA 3KLKA 1KRCC 1HX0A 1V93A 5CZSA 3DI0A 1RD5A 3QV6A 2H8ZA 3TE9A 5KINA 1MW2A 3GQYA 5FIPA 2CBIA 1R7OA 4RLIA 1J6OA 2X1IA 4KERA 2O0TA 3FA3A 4HTYA 3IPWA 2JQXA 3WYZA 1PKYA 1RQHA 4Y6GA 3AIUA 2XVLA 3WF1A 5E1QA 4NG3A 5EA9A 1MQRA 1SW3A 2WCAA 4RZ5A 3NXLA 1CXKA 4R85A 3E0WA 4ZXLA 5I6SA 3STCA 1XYMA 3SCWA 1G0CA 3W86A 1ZRQA 4JTKA 2NV2A 3MSRA 3AIRA 1V6UA 1GOXA 3LRKA 4G1NA 5XINA 1RV8A 1TPH1 1I75A 3UR8A 1OFRA 1QPOA 3SJNA 2WPGA 1GJUA 2VEMA 3O3RA 2WMIA 2Y6ZA 3S1VA 4LX4A 2IPJA 1P6CA 2IPWA 1DTNA 4QJ5B 1KBKA 1UASA 3WD0A 4UQBA 1JXKA 3DHDA 2WCSA 2P88A 1AL8A 1FWGC 3URNA 1OFDA 5I3DA 3DHUA 3MSDA 5AHEA 2I1OA 4S3EA 2IXVA 1FWDC 4Q8NA 3W73A 4WLCA 4DHGA 5LNSA 2DIKA 2G41A 1EUNA 1GOKA 1XLLA 3KS5A 2Y5EA 5EFDA 3R7MA 2DT1A 2BNJA 3FA4A 1KBIA 4NZ5A 2A3HA 3CPRA 5CC6A 3ARVA 2EXOA 2QF7A 4XIMA 3T44A 4ECLA 3TW9A 2YPIA 2W91A 1G4PA 4EPDC 3NL6A 2VM8A 2Y4SA 1VPYA 3H2AA 3B0XA 2ZA3A 1B90A 4UR9A 3LHZA 4QISA 1S39A 3GXTA 4Z2KA 3WK0A 6REQB 4WKFA 3MYPA 4OVXA 5FF3A 4I7UA 3F1QA 5JU6A 2UY2A 1JCNA 2PUZA 3IIXA 3S0CA 4WKAA 1FCBA 1EA9C 3UCQA 4KEUA 3OZYA 1XLCA 1P0NA 1VBRA 1XS2A 4OV9A 4A8IA 3R58A 1AA1B 3MMUA 1TPC1 1KM2A 1X1ZA 1K03A 1J0KA 2J7CA 3SUSA 2B7NA 1IXQA 4MMWA 3VGHA 2O4QA 4NXKA 1XYCA 1ADOA 3SUVA 3M0HA 2Z2AA 3RIKA 5C9RA 2HE5A 4GJ1A 4UR8A 3UJSA 3E2SA 4PYSA 2ZZ2A 3CTTA 1CW2A 1B9ZA 3V16A 1OQFA 3IIOA 3ZLGA 1YLVA 5HJLA 4K1GA 1VF8A 4KGLA 6XIAA 1H7OA 1X38A 3NEHA 3VD3A 4PMOA 3KZSA 3KTCA 3TYAA 3VIJA 1OFPA 3WLHA 2FPYA 3N12A 1YDOA 5I3GA 3L23A 3PBMA 3QLDA 1SFTA 5BU9A 1UCWA 3NTYA 1PX3A 3WD1A 3NQDA 5G2HA 4BF7A 5LHEA 3LYEA 3HGSA 3M41A 4HNCA 1WQ5A 3CHVA 4E6MA 3GTHA 1K6AA 4F2TA 4I9AA 4OWGA 4JAWA 1C91A 3IJQA 1RVGA 1UR4A 3TU9A 2BVWA 3J7HA 1MMFA 1CEOA 1PKNA 2YXXA 3VFCA 2V63A 1BG4A 5HUPA 4IUOA 2YFNA 1EC9A 4KCTA 2P53A 5XIMA 5FSDC 3O07A 3I7RA 3UZZA 2V3FA 1XG4A 4Q7NA 1GONA 2ZQ0A 1WAUA 2DIJA 2QAFA 4GABA 3W26A 4W88A 5LNVA 3KRSA 1XINA 2ZUWA 3N1AA 3OLGA 2WV8A 4CD7A 1RCXB 3GIYA 2FH6A 1U5HA 1FKWA 3TXVA 1DWJM 4H01A 4J4KA 2CHOA 1UWRA 4RDZA 2I9UA 2VEGA 2XYLA 3UQNA 2Y85A 1W56A 2Q09A 4GVFA 5DT7A 3NZ1A 3AC0A 1GTHA 2V6AA 1EXPA 1LTDA 1CGVA 2YZ5A 5K9DA 1AW2A 1B4KA 3S4TA 3C0SA 4R3UA 3ARSA 5AZ0A 5AVHA 3MP4A 3MVTA 3M64A 1PL9A 2JK2A 4L4PA 5A8PA 1PYMA 5FD0A 1W31A 2IKIA 3GDMA 3MMWA 4MJ4A 4N2YA 1CBGA 5BXSA 5TIMA 3ZT6A 3A3WA 1P0EA 4FNTA 1LYXA 3C2FA 4A3HA 3NWRA 2R14A 1SUXA 3V0UA 3CL6A 4L6HA 3K8KA 3OIXA 2PODA 4N42A 4MWAC 3GS6A 1AFSA 1L6YA 1UKPA 3VX1A 4KEMA 1QFEA 2J7DA 2WVVB 4NX5A 1W6TA 3U9IA 5HR6A 1MW3A 3M0JA 3P60A 1VJSA 3UWWA 1H7XA 2A3LA 2QJGA 5FAJA 3KOXA 1QI5A 2AMXA 2NVAA 4LBUA 3AXXA 1KA9F 2XFRA 4DXKA 2DZUA 2FDMA 4IXXA 5CGQA 3MUZ1 3DFPA 2PTZA 4XTDA 4KFNA 3BK0A 1TPB1 3VO0A 1Q6FA 4LVGA 1Z3NA 1DV7A 3QKEA 5EKYA 5BRBA 1ZJHA 2I7GA 3PBYA 4ZSUA 1UZ1A 3IGHX 4LAUA 4MYAA 3UPMA 1WCGA 1TO3A 1X98A 4MF4A 2ACSA 2ACRA 3N3TA 4KWSA 1Q4WA 3HQNA 4GNJA 3VD4A 2V67A 1TA3B 3CMJA 1KFLA 1M41A 3E49A 3BTNA 1J6PA 2JKAA 4C7GA 1MW0A 3PPCA 3GIPA 3A3XA 1JDAA 3WN6A 4DWSC 5EMYA 3U4AA 3Q2DA 3R2GA 2XVPA 1IEWA 3TOPA 4OQVA 5C7HA 1TVNA 2YXOA 5AYXA 1A3WA 4J3UA 4I6KA 2NQLA 4D6EA 5IBXC 1SFLA 3AQUA 4MWAA 4EWND 3S3GA 1YPFA 1JAKA 2V5BA 1OC6A 4JNYA 3W76A 4LCRA 1W3LA 4LH8A 3MVIA 1YTDA 3SO7A 3TCSA 3C3UA 1PO9A 3L21A 4JTDA 4XD3A 2HXTA 3CPUA 2NQ5A 4IMGA 3WJYA 3N4EA 3O06A 4PMVA 4U2YA 2RKXA 1BRLB 3VD9A 4N4QA 4PMRA 4D8AA 4UFIA 4U5IA 4PUWA 1VBHA 4RDYA 1YNYA 2ODOA 3F03K 8CGTA 2V8ZA 4J7RA 1EPXA 3PJWA 3FAWA 1XSIA 2OEKA 2TODA 4DAFA 4B16A 1FWBC 4HK7A 1QHOA 4S2BA 3UT0A 2BLEA 3WDIA 3TWAA 5HQMA 3S5YA 4E2DA 5DMMA 1ZBKA 1RCOB 2YL9A 2E7FA 3CHDA 2WSYA 5M03A 2QGYA 2V5DA 4A3YA 1JCLA 4X63A 3WH9A 5E5CA 4G2DA 2DH2A 4OE7A 4U10A 2HE8A 4CU8A 2AQVA 3T7VA 3R79A 3GH5A 4YN5A 5D9OA 2VFEA 4WGHA 3WJZA 2Q3RA 2FGZA 3EYPA 4ZENA 1G01A 1KNWA 2G97A 1KKOA 1W9XA 2PC4A 3L0KA 2P10A 1TYGA 3WQPA 1GJPA 2PDKA 4O16A 1BHGA 3N6JA 3PNUA 1G6CA 4S38A 1EA0A 5H8MA 4QHRA 2TPSA 3U2EA 4UOZA 3DHFA 1F3XA 3H22A 2J7EA 2BODX 1KM4A 1QMLA 4DI8A 3BUVA 3W2JA 2VKZG 1C3FA 1JPMA 3BG9A 1RQEA 1TREA 2O9OA 2NZLA 4CNSA 1U1UA 1G9HA 2ESCA 2VT0A 2ZA2A 3K4WA 1L6FA 3RM4A 2WNNA 3VE9A 5D2VA 2XG9A 4WJ8A 2DV0A 1WXZA 1S1PA 1WA3A 4KKXA 4P8VA 4PTVA 1QJWA 2YKKA 4QLLA 3UPWA 2GVGA 3UP8A 4ZOAA 3NSNA 5CLTA 1QU4A 3SCOA 3FHAA 3MHGA 1C29A 5T26A 4FXFA 1EKOA 3EGJA 3H8AA 4PFMA 3H7VA 4IH3A 2HK0A 4KRZA 3UVAA 4IG2B 3MWCA 2QGHA 1UKSA 4AYSA 2DZAA 4GOAA 3TEVA 4AG0A 3R0KA 4WJEA 1HGYA 3GZ3A 3WCZA 5DMNA 2FB3A 1ELSA 1ISXA 1W5PA 1WXYA 3CH0A 2RDTA 5TQLA 4GHRA 4UQ9A 1IEIA 2JF6A 1Y65A 2VCBA 4QNWA 1E6QM 4Y90A 4JTGA 1OIMA 2VYOA 3AYTA 1CLXA 4DJED 1EHNA 3DU0A 4S3GA 3BZJA 1Z69A 4W84A 2VC9A 3CHCA 4DJFD 2QAPA 5I78A 4J3ZA 1TFVA 2Z1XA 4HSNA 4JIRA 4IXHA 2KZHA 4HJWA 3WO8A 1PYFA 3IJ7A 2OSYA 4QX4A 3W1LA 2YBUA 4WEVX 4K38A 4FR6A 2WM0A 5G2WA 8TIMA 4B5UA 4FLSA 4Z0SA 1NY1A 1UP0A 1ADSA 4IPIA 2IUZA 1SR0A 1QO5A 2ZXDA 3IRSA 4HYRA 3W7OA 3QTPA 3WLMA 3C2YA 3PWIA 4GC4A 5A6SA 4O54A 2J9XA 4RE3A 2WNZA 1Z6KA 5D8ZA 1CPUA 1RVKA 2IS7A 4F40A 4C6FA 2ACQA 4D72A 2JF7A 2VZSA 1TX0A 5AFDA 4HA4A 1TWIA 4WUIA 5CC3A 2XSXA 2QF8A 3FS2A 1XGEA 4LEFA 4MADA 3MJMA 3AIBA 1VENA 4TMBA 4U2ZA 2DSKA 1NAL1 2EG7A 3FDKA 1R2SA 2EBNA 4AZCA 4O53A 1TSIA 3FX4A 2JE8A 3LPOA 5SWUA 3PVFA 3KCOA 4GXWA 4FXJA 5EMKA 3I65A 2NUWA 2QDEA 2DT2A 1PWMA 5HMFA 5LZLA 1W2PA 4XO7A 3TTEA 3OZOA 1R30A 2VVNA 2V5LA 1IZCA 3DC8A 3S5OA 1K9DA 4DLFA 3GH7A 2QUTA 5M17A 4IQLA 4DB7A 1IV8A 4P8WA 2QCLA 1MQPA 1TVLA 3ABSA 3MQTA 3DI1A 4H6RA 1YDYA 1RY0A 3T4WA 3CC1A 3P0WA 4S23A 3A9IA 2CESA 1ZBCA 3WNLA 3TYZA 4GUHA 4PBGA 2XIQA 3CT2A 4GQRA 4Q4PA 3R12A 3OODA 1M53A 1R8LA 1UHVA 4GIAA 1A5UA 4X22A 3PJXA 3UJ2A 3FVDA 2PDUA 3VOGA 5M5DA 5CBJA 5A6BD 1S2UA 3CAWA 3TTYA 1KXTA 3B9AA 4ZQRA 1XYLA 3U2CA 1K77A 3VVGA 5MHBA 1WXJA 3BLLA 2I57A 4NL1A 1JRBA 4Q8MA 3LD5A 2X05A 1JNDA 4NVTA 3BW4A 4UTIA 1Q4NX 3TYEA 4M1RA 4PUNA 4MB4A 2A3EA 3BLKA 2PB1A 3L0NA 2WZHA 2BTMA 4KEZA 3VIFA 5E0KA 3TC6A 3F2CA 4US5A 2V2CA 2J74A 4G7EA 2GOUA 4YXGA 2XH0A 2CPUA 1QK2A 4GUGA 1XH2A 1H63A 1JYWA 3JRKA 2AGKA 4YHEA 1Y0EA 3MV01 4WXZA 1MWOA 2CWNA 2J7FA 4IFKB 4E8GA 3O2LA 4LV4A 1KFEA 2E40A 3LLXA 2A1YA 1V3HA 3LI0A 2P50A 2D73A 4DIAA 4IISA 4HYVA 4IF2A 3GFXA 3M43A 2J79A 3KVLA 2QULA 1W5NA 2HS8A 4YVXA 5JIPA 4AYGA 1JXJA 4L9XA 2VX5A 1H2JA 4FALA 4M19A 4PGLA 2GVEA 3PN8A 3TZFA 2PDFA 5E9XA 1JL8A 4DJDA 3REQA 2XIBA 3CMGA 2WMFA 1V6WA 3DERA 4B5NA 1OT1A 3S2CA 4Q4KA 3E1F1 3INPA 4RDWA 4RNHA 3P81A 1XQKA 3K5XA 2V0TA 2FPTA 3ZXWA 3N9KA 3WDRA 1ONXA 2AL2B 1E55A 2VHLA 4EIVA 4CQDA 3O6AA 1FH7A 2GYIA 3ARYA 4O1BA 2XM1A 2CITA 1Q3NA 1CGXA 4GISA 1W54A 4C6NA 1EJSC 3R89A 4HU8A 2G4JA 2EPMX 1GVIA 2DZVA 3MSYA 3QJAA 2BWGA 4UTKA 3CEUA 1NEYA 3WK2A 2CZEA 1VH7A 3EDKA 1JDEA 2Z1WA 1EDTA 4C6CA 1HUVA 2CLEA 1SJCA 4OBTA 1RHCA 3NQ7A 2GQ8A 3MKVA 2BDQA 3ORWA 3O6CA 1E15A 1TZZA 4OHQA 4ERAA 2JKPA 3I4EA 3LDVA 3GK0A 3AIVA 2BVTA 4HU0A 3N2BA 2J6VA 2VWTA 3SGZA 7XIMA 2X1SA 5BXTA 4LCSA 2DIEA 2ZUVA 1GKPA 1V5XA 2XFFA 3OYXA 4MJMA 3UA4A 3BAWA 4MSSA 2A4AA 5CPLA 1YMYA 3TN6A 4W7VA 1H0GA 7A3HA 1FWAC 3GNRA 4WXYA 3WEOA 1SFJA 4L9YA 3L5AA 1DJGA 3W88A 4KWWA 4IL2A 1O95A 1Q6LA 3HGJA 2NUXA 1WZKA 2DT0A 4R53A 3HURA 1J0IA 1Q6DA 2WHMA 1XYAA 3O9NA 3FOKA 4CQ9A 3CZJA 1XBYA 4A22A 1QHPA 2XGBA 1W1IE 1XDJA 2DJLA 1KXVA 2BY0A 3GKAA 2J6XA 2MNRA 4LT9A 7ENLA 1MZHA 4GYPC 1E3ZA 2E5BA 2OT0A 3NZGA 3D3AA 3STPA 3CO8A 3ZLHA 1MO0A 5K9CA 3EDJA 4B5WA 3P0XA 2YCJA 4YIWA 4KT2A 3H70A 5FA5A 4QBXA 1N2VA 2WKGA 1FWCC 4F0SA 3TW6A 1V3IA 4ZE4A 2HQAA 5BZAA 3LERA 1KFKA 1DXFA 3MI2A 2IQTA 1ZBVA 1P48A 3T0DA 2CNCA 2ZCGA 4NZCA 3PZ9A 2ZUUA 1IQ8A 1ZAHA 3CUJA 3WQ8A 4OIFA 3ENLA 3HN3A 3UWUA 3N34A 4DN1A 2PPGA 1I6NA 1NSJA 3BPWA 1G67A 1T7LA 2R24A 4GO9A 4IIEA 1KQZA 4KWUA 1TZ7A 4JQAA 3QV9A 1XQLA 2HRWA 1C93A 1T99A 3ZVIA 4DJEA 1CNVA 3M7WA 2XN1A 1W1B1 4EF8A 1XIBA 3BZGA 4LBRA 4HHMA 5EB8A 4AD4A 1S5WA 1MEHA 2FHBA 3B4YA 1KR0A 1ZBWA 3LS9A 4ML4A 3M0VA 4PUMA 3W1NA 2C16A 1DJQA 3SCRA 3QQWA 4V2XA 3L5LA 4O1DA 5FJRA 4HPNA 2AL1A 2FZMA 2WO5A 3SRFA 1E6SM 1G4EA 3W1PA 1MUMA 4JX6A 3U8GA 3AAMA 1PIFA 1BQCA 3MI6A 4JQ2A 4M6VA 4WDTA 1VD6A 3LHTA 3W7RA 1FWSA