3U57A

Structures of alkaloid biosynthetic glucosidases decode substrate specificity
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
502
structure length
471
Chain Sequence
NDATRISRSDFPADFIMGTGSSAYQIEGGARDGGRGPSIWDTFTHRRPDMIRGGTNGDVAVDSYHLYKEDVNILKNLGLDAYRFSISWSRVLPGGRLSGGVNKEGINYYNNLIDGLLANGIKPFVTLFHWDVPQALEDEYGGFLSPRIVDDFCEYAELCFWEFGDRVKHWMTLNQPWTFSVHGYATGLYAPGRGRSTGNPGTEPYWVTHHLLLAHAAAVELYKNKFQRGQEGQIGISHATQWMEPWDENSASDVEAAARALDFMLGWFMEPITSGDYPKSMKKFVGSRLPKFSPEQSKMLKGSYDFVGLNYYTASYVTNASNFSYNTDIHVTYETDRNGVPIGPQSGSDWLLIYPEGIRKILVYTKKTYNVPLIYVTENGVDDVKNTNLTLSEARKDSMRLKYLQDHIFNVRQAMNDGVNVKGYFAWSLLDNFEWGEGYGVRFGIIHIDYNDNFARYPKDSAVWLMNSFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Raucaffricine-O-beta-D-glucosidase
publication title Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Hydrolase
total genus 180
structure length 471
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.4.1.219: Vomilenine glucosyltransferase.
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u57A00
3AIRA 4CU6A 1MW0A 3U5UA 5A2BA 5HXMA 1E40A 3W6LA 4Z2IA 5JBFA 5BXRA 1H5VA 3TP4A 4W8AA 3ARZA 1W3HA 4TX6A 1SMDA 2PC8A 1ZJBA 3ARTA 4CCDA 3WH6A 3GNOA 3ZT5A 1AQ0A 3VDBA 2DT0A 4M1RA 5E0FA 1JI2A 1H4PA 2HVMA 4JKMA 3AMLA 1B30A 1W1YA 3VOCA 2DT1A 4RE3A 4U33A 3ZR5A 4FK9A 1UD4A 4PMVA 1UWRA 1MXGA 1RH9A 5KZ6A 1QNPA 3SCRA 3W37A 4ACZA 3VUPA 3WEOA 4XV0A 1UD2A 4UR9A 4JFTA 1W1VA 2XWDA 1EIBA 2AAAA 4CN1A 1UKPA 3B9AA 3CUHA 3WH5A 1A47A 2BVYA 1Q6GA 3MS8A 4D6HA 4Z2GA 2X09A 1UR9A 3PTMA 3CPUA 2D22A 4MB5A 3WMBA 1LF1A 1GVIA 1CNVA 1XYZA 2EXOA 3RM8A 1W9BM 4Z2LA 5EMYA 2WBGA 2WWDA 3K8MA 1QHOA 3IANA 3NYDA 2DDXA 3GM8A 2GVYA 1BVNP 2W5FA 1DWAM 4QFUA 3ARWA 3BMVA 2WM0A 3AIUA 3WDHA 3N1AA 1VJZA 5IHRA 3WF1A 1XSJA 4HMEA 2ZUTA 2YLLA 1H0IA 3AMDA 4WIWA 5E0CA 3WNLA 2VZUA 3MUZ1 4UCFA 1H41A 3UESA 1X6LA 2ZUNA 3ARUA 2E0PA 4A4AA 4AZCB 3AOFA 1JZ5A 2VQUA 2Y4SA 2XJ7A 2UY2A 1LL4A 2G3MA 1KXTA 1B3XA 2WK2A 3OZPA 3F5JA 1G0CA 4WKHA 3CUIA 4PCSA 4HOWA 1C3FA 4QCFA 1TZ7A 3ZJ8A 4OJYA 2J7DA 3HN3A 3WNNA 2VUYA 3WIJA 4TTGA 4IPNB 3L4TA 3EDJA 4JL1A 3W0KA 4D6GA 3WQWA 5JBDA 1PIFA 3DECA 3AJ7A 5E70A 3T0DA 1G9HA 3GYCA 2BHZA 2WMJA 1CECA 4PTMA 1DTUA 2A3EA 4BQ5A 2YDRA 2XVLA 4GI6A 1ISZA 1CZ1A 4OBSA 4PMNA 2JIWA 1B2YA 4H41A 4QDMA 1NP2A 5I79A 4D6EA 3AXHA 3EDEA 3G6MA 3VU2A 3WNMA 1JZ6A 1M53A 1QI0A 1NOWA 3UEQA 1UR8A 2WSKA 4AYSA 1CGUA 1NOUA 2O9PA 3BCDA 3F5LA 1EH9A 4AY1A 4UQAA 3QHMA 5A6JA 2TAAA 3EBVA 1C7SA 1YHTA 3BLPX 1NWSA 1MWOA 1W9XA 1V3JA 2ZWYA 3O2LA 3ZO9A 1EA9C 2DGAA 4D6CA 4M29A 1M01A 1WAWA 4P8WA 3VIJA 1J0YA 1WDPA 1UD3A 3I3EA 5A8QA 3WN6A 2YL9A 1KCKA 1GOMA 1HL8A 1FFRA 1JG9A 4P7QA 1UR0A 4CD5A 2E9MA 1CXKA 1JIBA 4F9JA 4E8CA 2OSYA 4GINA 1J10A 1LWJA 1XSKA 1NQ6A 2WKLA 3VIMA 4FLQA 1ZBWA 1PAMA 3U5YA 4CU7A 1OM0A 3VIOA 8CGTA 3GTNA 4FF5A 5D9MA 5GPRA 4HA4A 4CD7A 4CKQA 1B3ZA 1MFUA 2OSXA 1W9UA 5D8ZA 3UG4A 4MJ4A 2DSZA 2FHBA 4W7VA 4H04A 2YA2A 7TAAA 4AD3A 1B0IA 2OSWA 1NOFA 4U2YA 3AHTA 4WSJA 1CGTA 1E73M 1DHKA 4DM2A 2A3HA 4GZJA 5LA2A 2VT0A 2W62A 2ZUMA 2JEQA 5M3WA 9CGTA 4PMUA 3WD0A 4HMCA 4YHGA 1F4HA 4LYRA 1WZLA 3GH7A 3E1F1 1U33A 2Q8XA 4MNMA 1VF8A 2MANA 3AXIA 1CENA 1GQKA 1BQCA 3VDHA 4UQ9A 2QF8A 2CKRA 3A3HA 3ZT7A 5AC4A 3I3DA 1OBAA 3SUVA 3M07A 1Z32X 2BHYA 4BA0A 1E72M 5D9NA 4PMQA 2V3FA 1DWGM 4AZ5A 3WDPP 4UFKA 1E6PA 4PSPA 4JKKA 3CHFA 1SMAA 2J4GA 2J77A 4JCMA 4GI9A 2G3NA 1M7XA 1R8LA 4Z2JA 3B8SA 3NSMA 1V02A 1X1NA 3ARSA 5DFAA 2CETA 3T2PA 2ZICA 4HU8A 4AMCA 5I77A 1JZ4A 1C7TA 3G6LA 3ZSSA 3KL0A 4FLRA 4WKFA 2E3ZA 1CXEA 3MV01 1JDCA 1E4NA 4UQCA 4JFWA 1SFSA 1J11A 1JYWA 3RJYA 4GI8A 1B3WA 2DEPA 3RCNA 1CXFA 4JAWA 3M46A 4CVUA 4YN5A 1D7FA 1WDSA 2BV9A 3N9KA 4AIOA 4W5UA 4HOXA 1I1WA 3WUFA 3TTQA 3OGSA 3VVGA 1V3LA 3N18A 4QLJA 3RIKA 2ZXDA 2G3IA 2YA0A 1FP8A 2V5DA 3WDRA 3CZGA 1ZU8A 3W29A 3EDFA 1GQJA 3VIHA 2CCRA 5FOOA 3LPGA 1GJWA 2WZIA 3FHQA 1J9YA 1QOXA 1TA3A 3L4XA 1W32A 1QI4A 3ARYA 4IPLA 4OKDA 4V27A 1KR1A 4E8DA 2ZX9A 1FHLA 2BXYA 1DWFM 4AEFA 2WMGA 2E9LA 1MQRA 1PEZA 5A6SA 1CGVA 3FNDA 1EDGA 3TTYA 4RE2A 1OT1A 4BQ3A 4D1IA 3GXDA 4M81A 1B31A 2QMKA 3N17A 1JF6A 1VJSA 1TR1A 1W2PA 1EOMA 3THCA 2BXZA 1EO7A 4GZEA 4MB4A 4UFMA 3SCNA 5D9OA 4MNKA 1E6QM 3IJ8A 2WMIB 3W6MA 5A6MA 3OLDA 1HJWA 3DHUA 2OWWA 4ZEPA 4ATWA 4K68A 5FD0A 4X0VA 2VCAA 2XVPA 1H09A 2F61A 1WZAA 4UQEA 2UY4A 3WELA 4XZWA 3LMYA 3FAXA 2QHAA 3AHZA 2CBVA 2VX6A 2CHOA 5EBAA 1TE1A 3SCTA 3VNYA 4CU8A 1UWTA 5LA0A 1DWIM 5I0DA 4PCTA 4JL2A 1J0HA 1VEOA 6TAAA 1FFQA 2ZE0A 5LYRA 4P8XA 2JF7A 2C8NA 1K9DA 2XVGA 5DMYA 1HF6A 4WJXA 3KWXA 1R7OA 3ZIZA 1MQPA 1HJSA 1UD8A 1WDQA 1PZ3A 4B3LA 2IXUA 4D1JA 2V3EA 3A47A 1FH8A 2DSUA 3VD5A 1E55A 1BHGA 4NRRA 1JAEA 3CIVA 1NP0A 4GXPA 4TOQA 2DSVA 3KL5A 7CGTA 2XSAA 3ZT6A 1ZJAA 2EBNA 1CYGA 4DUXA 1W9VA 2WVUA 5M5DA 4IM4A 4PSRA 1AQHA 1LL7A 4R5EA 2VZOA 1CLVA 2DH2A 2VNCA 4YPJA 1Y7VA 1C8YA 3A6OA 2FHCA 3DC0A 3GBEA 1VBUA 2XIIA 2A3BA 4X9YA 5CPQA 3QR3A 2VRJA 2WVSA 4JHOA 1U2YA 3EMZA 1JYXA 1JD7A 4GO9A 1JGIA 2AOSA 3VD9A 1J0ZA 2FH6A 4AZCA 1GORA 4W87A 3WL0A 2VZVA 3BAKA 2YOCA 4A3YA 2VX4A 2XGIA 1E6ZA 5BRPA 3IJ7A 2OWXA 3GDBA 2PWEA 3WH7A 4GQRA 3I3BA 1HP4A 5TD4A 4PMOA 1ITCA 5A95A 4HZ7A 1HX0A 2XWEA 4U5IA 1E43A 1HJXA 2J7BA 2FGLA 1XRVA 2ZX5A 2BY0A 3CGTA 1ODUA 3W26A 4ML4A 2BY2A 5A6LA 2VC9A 1XSIA 4DUVA 2CIPA 4W85A 3WQ5A 3NUKA 2ZOXA 3VINA 4KGLA 1OWQA 1V6WA 3IAQA 3CLWA 3EMCA 3II1A 1L0PA 2J62A 4H8UA 1GOIA 1UR2A 1HKIA 2XVKA 1US2A 2O9TA 1AVAA 4M82A 5I6SA 1EQPA 2BHUA 1KWGA 1CXHA 5ABHA 5IHSA 1V0KA 4MB3A 1EDTA 4NRSA 1G01A 4KRTA 3SURA 1KWKA 3CUGA 2VCBA 2EO7A 2PWFA 5FL0A 5A8OA 1JYNA 2WHJA 1FA2A 1LJYA 1QW8A 4MADA 5A2AA 2VVSA 5FIPA 3OBAA 5DT5A 3SCSA 2W91A 3VGDA 4AD4A 3WSUA 1KB3A 1PZ2A 1LG1A 5E6YA 4F8XA 4MTVA 3VGEA 4GZIA 5F7UA 1K9TA 1ZBVA 4PRWA 1VFUA 4W7WA 3AHYA 1Q6CA 4UQDA 3OGRA 1E5NA 4JFUA 5BCAA 1BPLB 1B3VA 2YKKA 1KFWA 2V38A 1JZ2A 3AS2A 4J3VA 1JZ8A 2CBIA 4W84A 5BROA 2XM2A 3PZVA 3FAWA 4JHZA 3IAPA 3BAXA 3VO0A 1E6RA 3GH4A 3VD4A 5CZKA 5A69A 2WANA 1M03A 1H49A 1IT0A 2WC7A 1GHRA 1O6IA 1UZ1A 1OIMA 3SCPA 1W9DM 5CPTA 1UUQA 2JEPA 5IDIA 1QHPA 1KQZA 2CXGA 1KQYA 2CNCA 4TUFA 2IUZA 4DUWA 1Q6DA 3N04A 1NM9A 1V03A 3CBWA 1XH0A 3GNPA 3HJEA 4QCEA 1W2VA 1UR4A 4J3SA 4OOZA 2Y8KA 1HN1A 4KWUA 1SR0A 4NI3A 1B90A 1WP6A 1MFVA 4PTXA 2VURA 2PBOA 4W8LA 1UOKA 1OGBA 3PZGA 3PZNA 3SCWA 1GZJA 1X6NA 2GJXB 3DYPA 3GH5A 2XUCA 1JL8A 4V2XA 5GQBA 5A8NA 3AIVA 2WVTA 1UKQA 4MAVA 2XYLA 1TMQA 3CMJA 5I3DA 2WVVB 1E4MM 2GDVA 1ECEA 5CSYA 3BAIA 2NT0A 2C0HA 3SUSA 4GIAA 1EOKA 3PZMA 1QNOA 4J3XA 1JF5A 1MW3A 3M6DA 1CDGA 3NSNA 2GFTA 2CITA 5IFTA 1QI5A 2DH3A 3NDYA 1V02E 3NSXA 3N13A 1UZ4A 4Z2HA 1SYTA 3L4YA 2GK1B 2XTKA 4CD4A 3WNPA 3AXXA 4H8VA 4QLKA 4XX6A 1UH4A 5ABGA 1JXJA 2RGLA 2WB5A 1PX4A 2XG9A 2WC3A 2WC4A 1TUXA 1XH2A 4MDPA 2BY1A 1E4IA 1HNYA 3O6AA 3WNOA 1PBGA 3DYMA 1QBBA 2VZSA 3BSHA 1VEMA 1XC6A 1VENA 2CHNA 5I2UA 3ZJ7A 2VR4A 1EQCA 2JIEA 1NH6A 3WD3A 5HPOA 1ODZA 3L4VA 3ARPA 1WB0A 3CZKA 4ATLA 4HZ6A 4KGJA 1UA3A 1OINA 1TFVA 3K4AA 3ECQA 4F79A 2WMIA 2D3NA 2DSWA 3WH8A 2BVTA 1WE5A 2UWFA 4PYSA 1J01A 3T08A 5FL1A 5I23A 4P8VA 1RPKA 1W9PA 1V3IA 3A4WA 1BGAA 3AHVA 4W89A 3W38A 3AROA 4JFSA 4JKLA 2NSXA 5D4YA 1DP0A 3CHCA 3THDA 4D72A 1VFMA 2VMFA 2J25A 2WLZA 3K8KA 1UWIA 1BFNA 5CJ5A 2X0YA 2AMGA 3RJXA 1UH2A 3WF3A 4LX4A 1CTNA 3F5KA 5HDRA 2NT1A 3L4ZA 2J8GA 1IZKA 5CLTA 1C90A 3RDKA 1D3CA 1QI3A 4CCEA 1UD5A 1GW1A 3DHPA 3N15A 4UFLA 2FH8A 1BG4A 1VIWA 2WW5A 5GNYA 2W92A 3SUTA 3NCOA 2DSKA 2J7HA 4P7OA 3DYOA 2ZX7A 4X0NA 2D2OA 1V6UA 3W53A 2X1IA 1EDQA 1UWUA 4TX8A 3SUUA 4J27A 4UQBA 3K46A 1B3YA 3PTKA 3CUJA 5HPCA 1UA7A 4U3CA 1TVNA 3BCFA 4F66A 5ABFA 2X05A 3T09A 1V3KA 3QHOA 2D0GA 2VQTA 1H3GA 2BS9A 2ZWZA 3WQ4A 4PEEA 3B9DA 1JFHA 5M17A 1I1XA 4YHEA 4HZ8A 4UOQA 2VI0A 2W4XA 5BWFA 3B9EA 4GQQA 5EFDA 1GONA 1WZMA 4CVWA 2PWDA 1G1YA 1HJVA 2JF6A 5EFFA 1CWYA 4Y7EA 1CLXA 5CGMA 1E9LA 4UZSA 3UR8A 2CBJA 2WYSA 3M7SA 1W3KA 5C70A 4AD0A 4ZE4A 3KEHA 4ZXLA 3VMNA 1ZS2A 2WHLA 1BSIA 1TVPA 4E4PA 2ZXAA 1HJQA 2OYLA 3MU7A 3AS1A 2VRQA 5IFPA 3W25A 2C7FA 5E09A 1IV8A 2WWCA 3L2LA 2O9OA 2DQXA 4OOUA 4AZHA 1B9ZA 2J47A 2Z1SA 2X2YA 4Q7NA 1KGXA 3AZRA 3WL1A 1UQYA 5BXSA 5CLWA 2XIBA 2DIJA 1PIGA 5FCZA 2J7GA 3AIWA 3OIHA 1XCXA 3BMWA 3VIIA 4CN6A 2GUYA 1CPUA 1DEDA 1BGGA 4JFVA 3W24A 3NDZA 2VRKA 5C8BB 1WCGA 3VIKA 5CQ1A 3BSGA 3QOKA 1RD6A 4PMDA 3TTOA 1PX8A 2FDMA 2W61A 1OB0A 2YDQA 2YDSA 3UERA 3W81A 3WQ8A 4UZUA 2CESA 2ZXBA 4W86A 1V6YA 1LL6A 5AC5A 1BYCA 1M04A 2VTFA 1V6XA 1FHDA 4PUDA 4FLOA 1H0GA 3ZR6A 3OB8A 4IUGA 3AIQA 2WNWA 2WHKA 5HNNA 3VIPA 3IK2A 1RP8A 3W27A 3POHA 4B9ZA 2CPUA 2J74A 4UFHA 1QNRA 4DWSC 1UH3A 2G8ZA 1Q6EA 4ZXOA 2FGZA 4IISA 4TTUA 1KXHA 1UQZA 2XFRA 1JFXA 2A3CA 4W7UA 3OZOA 2OLHA 1K9EA 3AMGA 3ZM8A 2D0HA 1HVXA 3WUBA 4HOZA 3WDQA 4P7RA 4KH2A 4A3HA 3MUY1 1J0KA 4BZYA 5A2CA 1UKOA 2VVNA 2RGMA 3VX0A 2J75A 4D6IA 5A6AA 2D20A 4QAWA 4W5ZA 2YIHA 2CEQA 4W8BA 2ZIDA 2VX7A 1JI1A 4ZENA 3WMSA 3BLKA 2CKSA 1YQ2A 1UKSA 2GDUA 4MDOA 2YJQA 1OGSA 2EPLX 3AIEA 2J78A 3QOMA 1J0IA 3WMCA 2PBGA 1QI2A 1OD0A 3K4DA 1V0MA 2DPEA 5A6KA 5JIPA 4TVCA 4AD5A 2CERA 3WY1A 4CUCA 3EYPA 3WD1A 4HPGA 1W91A 4LYQA 3AIBA 4EAMA 5I78A 4RE4A 2GJXA 1HKKA 4U2ZA 3ZJKA 3GXFA 1JYVA 1FP9A 2D24A 4M80A 3SCOA 4PBGA 3WD4A 5JUVA 1A3HA 3U7VA 3O9NA 4C7FA 4P7NA 3W4RA 3EMQA 4UOJA 4AZ6A 2WVVA 3WF4A 1BVZA 5DEZA 1QPKA 1OD8A 4R27A 4B9YA 1VB9A 2YL8A 3CHEA 2G4FA 5DF0A 3AISA 1FH9A 2FHFA 4P8UA 3S6TA 2D0FA 3KL3A 1E15A 3OGVA 1H1NA 3PTQA 3MANA 3LPFA 5HOSA 2VX5A 1KXQA 2GK1A 4JIEA 3K1DA 5AYBA 2WCAA 1KBBA 3GXIA 4QLLA 3S2CA 3FY1A 3WQVA 4FLSA 3WD2A 5BRQA 5A94A 4HU0A 2PWHA 3VM7A 4CN4A 5IXEA 4EANA 5A6BA 3OLIA 4W88A 3PZOA 4LYPA 2EQDA 1GQIA 3SIMA 2XVNA 5HBFA 4AEEA 2JE8A 4P7LA 1VRXA 2QPUA 1JZ7A 1QNSA 1UWQA 1ESWA 3D5HA 3WQ6A 1JDDA 3VGGA 1BF2A 2ZXQA 4ZE5A 3VD7A 2XGBA 3MV11 2WZEA 2BFGA 1N82A 3ALFA 1WDRA 1PX3A 4PMRA 4J7RA 1E0VA 2E4TA 1HKJA 3WH9A 3T0BA 1EHNA 3J7HA 1NWTA 2PWGA 2YA1A 2Y8VA 1R85A 1EGZA 2Z1KA 5A6BD 1HT6A 5BXTA 3L2MA 4E2OA 1C93A 4M24A 3ZSTA 3VDCA 5C71A 4HTYA 4L4OA 1ZBKA 2F2HA 1CBGA 4EE9A 4ACYA 2ZX6A 3VPLA 1V08A 1WZKA 3WBEA 1GNXA 1K6AA 2D3LA 3VM5A 4WSKA 1JNEA 1CXIA 2WMHA 1DWHM 2E8YA 2WCGA 1E4LA 1WPCA 3D3AA 1JAKA 3TA9A 1GOKA 2WXDM 5D9PA 4LGXA 4AWEA 3RM9A 3GNRA 5D8WA 3WDIA 1AMYA 3T0AA 1R86A 4AC1X 3WBAA 2PF0A 1K9FA 3MMDA 1E5JA 2ZUSA 3UR7A 1RP9A 3WUGA 5ABEA 3LPOA 3FHAA 1ZB5A 1C92A 3SCQA 4DM1A 5EB8A 3VKKA 3IJ9A 2XPKA 2IXVA 1BTCA 4DWSB 2V3DA 3NJ3A 3W28A 1E6NA 1KCLA 4UNIA 3WENA 2YBTA 4PN2A 2Y5EA 2W67A 4B3KA 2OYMA 3F4VA 4J3TA 1IZJA 3MSGA 4M8UA 1US3A 5CXPA 4CD8A 4L4PA 3NIYA 5BXPA 4AXNA 4U31A 4AD2A 4AZIA 1V0NA 3CH9A 4EK7A 5KEZA 1UWSA 3U57A 5I5RA 2E8ZA 3AZTA 3WF0A 3AYSA 1QBAA 4UFJA 1XHGA 5DT7A 3VMPA 2W66A 4EKJA 1F4AA 4Z2KA 1E6XM 1MW1A 4MB1A 3TONA 2J79A 3OA5A 4F9DA 1GPFA 1XGZA 3N12A 1H2JA 1QHZA 1UD6A 3CZ8A 1KXVA 3WUEA 1EO5A 3WKZA 1FH7A 1HKMA 3VGHA 1NARA 1R7AA 3RPMA 3MSDA 1R87A 3CUFA 1XV8A 4JZ5A 4ATDA 1ISYA 1E3XA 2QPSA 1TG7A 2ZUUA 2ZX8A 2XHYA 3BAJA 1GUVA 4CGTA 2VCCA 4WLCA 2X0HA 3FN9A 1E1FA 1GVYA 1C91A 3JUGA 1D2KA 1ISXA 4OIFA 1EXPA 2E9BA 1UKTA 1V6VA 3AMKA 2YBUA 4V28A 3BC9A 1HL9A 3BAYA 3VGBA 1FOBA 4BCEA 2V3GA 3VD3A 4D6DA 3BXWA 1WKYA 3POCA 3PZTA 1KGWA 4GPNA 1CIUA 3ARXA 2J7CA 5DO8A 7A3HA 4GO8A 3GZAA 4XZBA 2VR5A 2VO5A 5M03A 2WSPA 3OLEA 2WMFA 4N42A 4CCCA 1E6SM 3UG3A 3WF2A 1Q6FA 4AZGA 1OCQA 2WZHA 4ACZB 4HP5A 1OSEA 1KGUA 5A1AA 3HU7A 4D6FA 2EPMX 5A8PA 3FXYA 4UTFA 3AMCA 3MUAA 1P6WA 1VEPA 3VDAA 4MNJA 1W1TA 2BY3A 3UETA 3WNKA 4WKAA 3T2OA 1XD1A 2WCSA 4FMVA 4S3JA 1AQMA 2WBKA 4B16A 3W82A 2ZUWA 3PZQA 2PB1A 4BQ4A 1BYDA 3AZSA 3BH4A 3CZJA 1H11A 2G41A 1QW9A 4GKLA 1BYAA 2WLYA 1GQLA 4PUEA 1I75A 4BF7A 3BAWA 1XYFA 3AYRA 5FKYA 1V0LA 4XUYA 4KRUA 1E0XA 3RO8A 3CTTA 4U5KA 4AISA 3RMEA 2O92A 4RL3A 1U30A 2V5CA 3L4UA 1JXKA 2QMJA 4U3AA 3BGAA 3TTSA 3AS0A 1G5AA 4HPHA 1BYBA 3PBGA 1W3JA 5AYIA 1G94A 4CD6A 1NWRA 4M56A 1GOOA 3T2QA 3CZLA 4NSBA 3LPPA 1JNDA 1UR1A 1XH1A 3ALGA 5BYWA 4XB3A 4PMZA 4WF7A 2OYKA 3WDJA 2D23A 1BG9A 5LA1A 4HMDA 4B15A 1QVBA 4PTVA 3CHDA 6A3HA 4PTWA 1VFOA 4N0RA 3VIGA 4PMYA 4D6JA 1Q4NX 4ZFMA 4UOZA 2W63A 3U7BA 1O7AA 2UY3A 1VBRA 1MXDA 1JD9A 4H7VA 1GOWA 4MAZA 4AZBA 1QNQA 2VJXA 1HP5A 1LG2A 4C7DA 4TVUA 1TCMA 3QHNA 3AI0A 1MYRA 2XFYA 1E71M 1V3MA 2J8FA 3AHXA 1V3HA 5E6ZA 3L4WA 2DIEA 3VX1A 1UHVA 1E56A 1LQ0A 5A8MA 4AW7A 1UG6A 1WO2A 4MNLA 2YL6A 2WKGA 3PN8A 6CGTA 1ZL1A 1HIZA 3VGFA 4Q22A 2EEXA 1EHAA 3WEMA 1J12A 5A3HA 2PI6A 1HXJA 2OWCA 2JFEX 3EDDA 4BS0A 1OT2A 5GNZA 5CSUA 1E1EA 3WFZA 3VMOA 3CO4A 2D1ZA 4WK9A 3UCQA 4J3UA 5GNXA 4W93A 1S46A 1B1YA 3K8LA 3ZMRA 3VNZA 3WEZA 1ISWA 3RILA 4AD1A 2A3AA 3PZIA 3AFBA 5I24A 1GCYA 4AIEA 1ZBCA 3OLGA 4OZOA 3MKKA 1VAHA 2G3JA 3PZUA 1C8XA 3MUIA 4AZ7A 1LWHA 3KE0A 1J0JA 8A3HA 5CGTA 2XFFA 2E40A 4MJ2A 2J7FA 3A4AA 3OG2A 4J3WA 2VOTA 4J28A 3ZJ6A 3PZ9A 1KBKA 3QGVA 4TVDA 3VILA 4LXFA 1WNOA 1UYQA 2VZTA 1E0WA 3SCUA 2JALA 5CG0A 2QLYA 2Y2WA 2Y24A 4JCLA 3MMWA 4QP0A 1L8NA 1CGXA 1XCWA 2NW0A 5ABFB 2GSJA 4TXEA 2XM1A 1C8QA 1KR0A 3CZEA 1BAGA 4DWSA 3ZOAA 1HVQA 1BLIA 3TOPA 4HA1A 4H8HA 5JBEA 5AY7A 3PHAA 4AIUA 4H2CA 4MPKA 2WPGA 1LLOA 2QV4A 1MW2A 1E3ZA 4NF7A 2GJRA 2VL4A 3ARVA 4KMQA 4URIA 3VIFA 4OBRA 3ZQ9A 2UY5A 1PJ9A 5E9AA 2EJ1A 2ZUVA 3GXMA 3GBDA 2CYGA 2WHMA 4PMXA 4S3KA 3APGA 1XD0A 3KZSA 1JZ3A 1OIFA 1MQQA 1CGYA 3HMCA 2BNJA 2B31A 3AS3A 4LPCA 1PPIA 1GHSA 2YLAA 1DWJM 1OGGA 4DWSD 2CBUA 3WFLA 3EDKA 3CMGA 3UG5A 4NZCA 4C7GA 2F8QA 2X8RA 1W1PA 5ECUA 1CGWA 4LQ1A 3SCVA 3A4XA 2GJPA 3MO4A 3AICA 1GJUA 3AQUA 2O9RA 3MMUA 5CPSA 1NWUA 1ITXA 3ARQA 1TA3B 2BVDA 2EPKX 2WMKA 2ESCA 2J7EA 1VFFA 1ISVA 3RM4A 3N11A 4HA3A 2XSBA 2DT3A 2EPOA 1GOQA 2HISA 3VTRA 4OUEA 4D71A 2DT2A 3SUWA 1HJUA 3ARRA 1JDAA 1E70M 2YL5A 1CXLA 4UFIA 5JIWA 2WAGA 3FW6A 1MVYA 2EPNA 1CEOA 4BQ2A 1J18A 1W3LA 3SEPA
chains in the Genus database with same CATH superfamily
1U83A 4EXQA 2DQWA 1Q3NA 3U5UA 3KZPA 1E40A 1X7FA 4LEFA 3W6LA 4Z2IA 2E5CA 5BXRA 1H5VA 1ZAJA 3TP4A 4NJJA 4W8AA 3ARZA 1W3HA 5D2WA 3ARTA 3GNOA 2P76A 3ZT5A 4L5ZA 4M51A 1AQ0A 3VDBA 5E0FA 4UTLA 3VA8A 1JI2A 4ICNA 1GVOA 1H4PA 3U4FA 1W1YA 2A4AA 1KRBC 2DT1A 4FK9A 1RH9A 2BGQA 1UD2A 4UR9A 3S1VA 4NJIA 3QGAC 1XLJA 2Y7EA 3SGUA 2OVLA 1PZ0A 1H1YA 2X0SA 1TV7A 3EWDA 3GHSA 1UWAA 4MWAE 2BVYA 1YTEA 1QJWA 1RA0A 2VFEA 2CU0A 3MS8A 3IJ6A 4ZO9A 1F6KA 2X09A 4YCOA 5GJNA 3Q58A 2D22A 2Y88A 1Q6QA 2I5IA 4Z2LA 2GGGA 2W9MA 1PZ1A 4HMNA 3OVGA 3SN1A 3IANA 3LRMA 2IKHA 3GM8A 1BVNP 3W1PA 2Q3OA 3T8LA 2W5FA 3NQVA 4K1GA 1TTQA 3UWVA 3AIUA 3WDHA 4A2RA 3QW3A 3FJLA 3M0YA 2QGYA 3NL3A 4V15A 2YLLA 1DXIA 4WIWA 3EEZA 2VZUA 4UCFA 3HPSA 4A4AA 1PHWA 5AHIA 2Y4SA 4GQ0A 3TJ4A 4DJDA 2WK2A 1G0CA 3IJQA 5DN1A 3QBUA 3CUIA 3D6NA 1GYNA 2QGHA 1W3NA 2J7DA 1SJDA 1G4PA 3RF9A 3WNNA 2X16A 7XIMA 4IPNB 3L4TA 3EDJA 1PB0A 3W0KA 2X1TA 3BCJA 3DFQA 3W1TA 5E70A 2BHZA 4W4QA 1CECA 1LCOA 3BMXA 1W1B1 3QMRA 5C7HA 4GI6A 1CZ1A 4PMNA 1YDYA 5DQPA 3W1AA 2CLPA 5F2IA 4QDMA 7ODCA 4RCXA 1LWIA 1EZWA 1NP2A 3E2VA 3AXHA 3EDEA 3G6MA 5HINA 5REQB 3NAVA 1DQXA 1JUBA 3B40A 2ZRUA 4QDPA 4FI4A 1QI0A 1V5XA 2Z1XA 4ERGA 1NOUA 2O9PA 1UJQA 5EA9A 4BF9A 5K2ZA 4AF0B 2W0UA 1X1ZA 3NTYA 3NVDA 4Q7BA 1QRQA 2FVLA 3S42A 5JH1A 4DN1A 3BLPX 4HYVA 3MHGA 1V3JA 3O2LA 3OOQA 3V0SA 3MBFA 3S1GA 3STEA 2YB4A 4D6CA 4QEEA 4PUJA 3W7RA 3VUSA 4NNCA 1YMYA 3E0LA 1PO9A 2YL9A 1KCKA 2PDYA 5BU6A 1YNQA 3GG0A 4CD5A 2E28A 1WKEA 2FB3A 4F9JA 3FYYA 2OSYA 1SO3A 4K6AA 3N4FA 2RUSA 3VIMA 1HQTA 4CU7A 4TV6A 1H61A 4AFYA 3VIOA 1OK4A 4UC5A 3TVAA 3GTNA 3JVAA 2ZCGA 2OSXA 1VD6A 3DN5A 4ZO6A 1ZSXA 1IGSA 1TX2A 3OVQA 3WQEA 5D03A 1W56A 2OSWA 3AHTA 4XD5A 4GZJA 5M3WA 4IMEA 4S38A 2ATSA 3CQ0A 1AH4A 5I06A 1F4HA 4PUWA 3W7EA 3GD6A 3WBWA 1OCNA 3TMLA 4UTJA 3PJWA 1GQKA 3TR2A 3P7YA 4UQ9A 2QF8A 1OC7A 3MYOA 2OODA 3QN3A 2NWSA 4GJIA 1OBAA 3SUVA 1QO2A 2RAGA 2BHYA 4C6DA 2RHGA 4LT9A 4EPKA 2R91A 4E3TA 3FYPA 4PSPA 1SMAA 4K8EA 2BASA 1GW9A 3O8AA 3B0VC 3T2PA 3V1HA 5CPNA 3W1UA 1GKRA 4AMCA 5I77A 4N2YA 4GX8A 1JZ4A 3R0UA 3G6LA 2V81A 1FQ0A 3CQJA 3RLVA 1AW1A 4GY1A 3EPNA 2QVNA 1E4NA 3KBMA 2IQDA 1JYWA 4L56A 1R3RA 8RUCA 2DEPA 7PTDA 3C2FA 4YIWA 4BKNA 2BV9A 1Q85A 4OBTA 4HOXA 1I1WA 1TV2A 1UMLA 1J4EA 4NJKA 3OGSA 3RIKA 1WX0A 2YA0A 1FP8A 2V5DA 5U7SA 4JNMA 3WDRA 1RR2A 3CZGA 3EDFA 1XIFA 4JYFA 5LZLA 2WZIA 3FVDA 3W00A 1QOXA 2Z26A 1XIBA 2HRWA 3L4XA 1QI4A 3ARYA 4OKDA 3QPZA 1FHLA 3U48A 4AEFA 5CCZA 2C18A 2AGTA 2Y1HA 1CGVA 3FNDA 3PVFA 2V30A 3SY5A 3TTYA 1OYBA 3TKFA 3GXDA 1B31A 1A5NC 3L0GA 1TR1A 3VI2A 3C0JA 3LENA 3QM3A 3E2SA 1A5UA 3LHUA 4ATWA 3RHGA 4C6EA 4K68A 1J79A 4ERAA 3UXAA 4X0VA 1TPWA 2VCAA 1ZCOA 2IPJA 2F61A 1UBPC 5HK4A 4H9ZA 3C52A 3WQGA 2UY4A 4XKYA 4XZWA 3LMYA 4KCTA 3G0XA 2HXUA 2FGBA 3B8UA 3SY1A 4MG4A 5EL1A 5EBAA 4CU8A 1LRTA 1DWIM 5I0DA 3PWAA 3IGUA 1GG1A 4JL2A 3WBXA 6TAAA 1FFQA 2WQPA 3W7OA 3HGOA 2I14A 4HB7A 1HF6A 1KD0A 1WUEA 4LV4A 3KWXA 1R7OA 5D33A 1VFTA 1MQPA 4L7ZA 1VHNA 4B3LA 3R11A 2B7QA 4LAZA 1R3YA 3UGRA 4Z0SA 2EBNA 4DUXA 4O14A 4DZHA 5M5DA 2G4JA 1ZENA 2XFWA 4PSRA 4H4IA 3DKLA 1R9YA 3K1GA 4L80A 1P7TA 2VNCA 4FPSA 3MJMA 4YPJA 1Y7VA 1S2WA 3GBEA 5A5WA 3QR3A 3VYLA 4EACA 4JHOA 1U2YA 3PC0A 3LNPA 4GRSA 1SSGA 3QKZA 2FH6A 1GORA 1FXPA 1VBHA 3BAKA 2XGIA 3U3HA 1C8VA 3CS2A 4NL1A 3WH7A 3PPHA 1HP4A 4DYKA 5TD4A 5E9XA 4HPNA 3HMJG 4JQ1A 4HZ7A 4DIAA 1SW3A 3T05A 2A6NA 3I4EA 4U5IA 3L5MA 1AJZA 1HJXA 2NXGA 3IPWA 4TO8A 1MEHA 3QLLA 2QCDB 3RX2A 4YJ5A 4UCGA 4AVFA 1VIZA 4NU7A 2BY2A 1XSIA 2ZA1A 3RPDA 1UOZA 1GWJA 4KFNA 1U1JA 2R1KA 6ALDA 3WQ5A 1WKDA 4LUTB 1PDZA 2ZOXA 1H50A 3QXBA 4RNHA 4DXKA 3PY2A 1SU5A 1FY6A 3AC0A 3H2NA 4AY8A 2R6OA 4HYWA 1US2A 1U1UA 1RVKA 2YCKX 2DZAA 4DJFD 4I5RA 3RX4A 2DIKA 5ABHA 4NRSA 5D05A 2REQA 3W7IA 3SURA 4XD3A 1J6PA 1WXJA 3GIYA 4F2UA 2QCLA 1BXNA 3B4YA 1JYNA 2DZSA 3IRDA 1XISA 1OHLA 4LOCA 2MUCA 4PH6A 4ZO8A 5DT5A 3SCSA 3ZWSA 2PDCA 4MTVA 4O11A 2C15A 3HV8A 3VGEA 1IEQA 3BANA 4UQDA 2QIIA 4GYFA 3L67A 2C79A 4WJEA 3L9CA 1B3VA 3W1NA 2DJLA 3CYVA 2V38A 1Y5VA 4W84A 2I9UA 1EUAA 2J24A 2DW7A 3H7VA 4JHZA 4JTSA 5MHBA 3VO0A 4ICMA 1K1DA 1E6RA 3GH4A 1KLYA 5CZKA 1F7BA 1O1HA 5A69A 3W1XA 3VABA 1H49A 3SRDA 2UV8G 1UZ1A 3SCPA 3SRHA 5JH2A 3AXKA 4MFEA 1SW0A 5B80A 3MDUA 4TUFA 1Q6DA 5C9XA 3JZUA 4ROPA 3CBWA 4JN8A 3VK5A 3HJEA 2DZBA 5LKYA 1ELSA 5FSDC 4OOZA 3NOEA 2Y8KA 5HQMA 3DIPA 1IZCA 1IT7A 2UZ9A 3CUZA 1DJGA 2F6XA 4NI3A 4PTXA 3LX9A 1K7EA 3SSJA 1Y65A 3SCWA 1A5MC 1P6CA 3GH5A 2VFGA 3N3TA 5GQBA 3LI1A 2QJMA 3AIVA 1S5NA 1MNZA 5E1QA 2GJLA 1PTDA 5FEXA 3TYBA 2GDVA 1ECEA 3O15A 1YPXA 1UW9A 3V16A 2WZMA 3PZMA 3W2LA 3KHDA 1F3EA 4IP4A 1RZMA 4GC4A 4MSSA 1MW3A 4UMAA 3M6DA 2GFTA 2CITA 3A12A 4ZQRA 2QJHA 3NSXA 1SYTA 4CD4A 3I7RA 3TN4A 1ZAIA 1SZFA 4XX6A 1JXJA 2XG9A 4MDPA 1QCWA 3LXBA 3BURA 4HPXA 2FZMA 2G97A 5DCBA 1VEMA 2Z6IA 3LM3A 1A49A 1TCDA 2CHNA 1FWNA 5I2UA 1TZ9A 3PBMA 3GXTA 4NVTA 4PFHA 1RJRA 5DMLA 4XAGA 3QV8A 3PS7A 4UTMA 5HANA 5EY5A 3CZKA 3FVMA 1X8FA 3NYZA 3GFZA 2WMIA 3EX2A 1WE5A 1J01A 4G9PA 1M7PA 3RN6A 5FL1A 1BGAA 3AHVA 3W38A 4AWSA 2EAWA 3CHCA 4D72A 1TV3A 3EXRA 3WLRA 5CJ5A 2HPIA 3NGFA 3BL3A 4J2PA 2ZVIA 6ENLA 2PFHA 3QW4B 5BRBA 1UH2A 5BW6A 1VJIA 1CTNA 5HDRA 2OZ0A 4CEXC 2NT1A 3BO9A 3Q4DA 1M9HA 2E1WA 3RDKA 1D3CA 4PBFA 1H7PA 4JTQA 1UD5A 1GW1A 3DHPA 3N15A 2FH8A 1VP5A 1BG4A 3ITCA 4OECA 2WW5A 3NCOA 3H2OA 3T81A 1FUYA 3EA1A 5KETA 4HCLA 4ZSUA 4LSBA 2HK0A 4O8RA 5KITA 1EDQA 3SUUA 3GK0A 2XH4A 4DWDA 3R79A 1GK8A 2CLIA 3K46A 1TPEA 4JY9A 1Q5MA 2WSRA 3CUJA 5HPCA 1R2TA 4U3CA 1TVNA 3DHDA 5ABFA 1N8WA 1W17A 4ZFCA 5M17A 3CL6A 4UOQA 3B9EA 1JJKA 1O4UA 3TC3A 1HJVA 1XG3A 5FEZA 1I0DA 3M7SA 1W3KA 3A5VA 4ZE4A 1SZGA 2ASHA 2BBFA 3VMNA 3KVMA 1LORA 1U22A 1E9ZB 1W31A 2I16A 2ZXAA 1HJQA 3M1ZA 2OYLA 1WKFA 3VNIA 1OCJA 2C7FA 4GUGA 1IV8A 2WWCA 4HBKA 5D2YA 3TTEA 3T40A 4XD4A 4HD5A 4YLWA 3TNOA 3DERA 2X2YA 1VYSX 3PAOA 2NVCA 2QZRA 5BXSA 2XIBA 4K36A 4OE7A 2G50A 2Z1BA 2SFPA 5FCZA 3OIHA 3QZAA 3BMWA 4OWGA 2B7PA 2F6UA 4INFA 4G7EA 3F4WA 4DBEA 3BSGA 1J93A 1RD6A 3TTOA 4DI8A 3P82A 2FDMA 2J8TA 1EYWA 1EJXC 4IG2A 1V6YA 1ZNNA 3STGA 4Q3MA 3H21A 1FHDA 4PUDA 1XXXA 4FLOA 4MWAB 3R6IA 4LS1A 3SR7A 3VOGA 4QJ5B 1UCWA 2CZFA 3OB8A 2V2DA 3TSBA 3IK2A 2EF9A 1X39A 3RG6A 5AOUA 1G7VA 5D30A 4JN6A 2G8ZA 8XIAA 4MUPA 2XDFA 4GE8A 1IEWA 2FGZA 4MKNA 5D37A 1KXHA 1UQZA 3GVGA 2A3CA 4S2CA 3EGJA 4W7UA 5G1MA 4ES4A 3FJ4A 3G2GA 1Z6KA 3S0CA 1YDOA 4OFCA 4Y9OA 3K4WA 2DW6A 2QPXA 3MUY1 3CWOX 1J0KA 4CLMA 3V5OA 1JEZA 1FWBC 1VCGA 2RGMA 3PB2A 3VX0A 5A6AA 5CAKA 2CLFA 1DJXA 2D20A 3WLKX 4W5ZA 2YIHA 4XUGA 1IF2A 1YIXA 3QY8A 4EOUA 3BLKA 4LEQA 4GUJA 5LXEA 2EPLX 3R7MA 1J0IA 3GWQA 3WMCA 1D7KA 3IARA 4GVHA 3K4DA 2DPEA 2J6XA 5JIPA 1R3VA 4H9UA 4TVCA 2CERA 2H9AB 2V5LA 3AIBA 4GX9A 1OC5A 3IV8A 2ISDA 1YEYA 3N29A 4U2ZA 5GJPA 3SCOA 4PBGA 3WD4A 5AHFA 2E5BA 7REQB 4UOJA 3BW2A 3OPSA 1E0TA 3Q45A 4K8HA 2C13A 3TYZA 4KEVA 2CFFA 1AQFA 3CU2A 4F0RA 3AJXA 3UYCA 2P1FA 1JQVA 1MEIA 2Y61A 4N4QA 4RDWA 3AO0A 3SAZA 2G4FA 3M43A 2HBXA 4IH3A 2FHFA 4P8UA 2QVHA 4BHYA 1JGMA 3CO8A 5CBBA 1H1NA 1KKRA 2P3EA 3HIJA 4JIEA 1EJRC 2OU4A 3K1DA 5AYBA 3WK0A 5LNUA 3GXIA 2PWUA 3FY1A 3WQVA 4KKXA 2DUXA 3L7RA 3M0JA 3VM7A 1QPOA 4EANA 3FK4A 4LYPA 2EQDA 4QG8A 3SIMA 1P0BA 1PUDA 4QDWA 5HBFA 4AEEA 4C91A 1YRRA 4FA3A 3NL5A 3D5HA 3WQ6A 3BGJA 1OCBA 3B8IA 1WBHA 4FEZA 3VD7A 2B7OA 4H9MA 1F6YA 2BFGA 3NR0A 2Z00A 1AA1B 3WH9A 3SIZA 1EA0A 3J7HA 1FX6A 2YA1A 2DZVA 4QGCA 3MVTA 2Y8VA 3WG6A 1A5CA 1EGZA 2Z1KA 3CAWA 4B2DA 2AAMA 5A6BD 1C93A 4M24A 3R13A 1AJ0A 1LLZA 4HTYA 4L4OA 4IT1A 1XIJA 2F2HA 1NELA 2ZX6A 4J9JA 4IFKB 2WJFA 1WZKA 2G95A 2JBMA 3UZXA 3WQOA 1EFZA 3VE9A 2QCEA 5H8UA 1JNEA 5C9ZA 1CXIA 2E8YA 5EGRA 3ENLA 3TLQA 1JAKA 3GRIA 2FPVA 4AWEA 4WUIA 3A3WA 3NFUA 1O5QA 2YYTA 5D8WA 5J8LA 3W1LA 3WBAA 4LNCA 2PF0A 2QKFA 3BOXA 3VNKA 4LBUA 4NZ1A 1O94A 3XISA 5ABEA 1A0CA 4DM1A 3KWSA 3G0UA 1H51A 2IXVA 3VKDA 4NT0A 3RU6A 4DWSB 2V3DA 3NJ3A 3NQ6A 2ZZ6A 4RNJA 1E6NA 4BEQA 1YX1A 3EOUA 3UCCA 1XYAA 3JRKA 4QISA 3F4VA 3G24A 2GWNA 4J3TA 3PR2A 2QCMA 2VGGA 5HR6A 4U31A 4QHRA 2WKJA 4AD2A 3WYZA 3RUBL 3CH9A 4GBUA 4JTCA 1M7JA 3ITYA 1YBQB 5I3HA 2CZVA 1JULA 4A3QA 1QBAA 3HOJA 4F0SA 1U5VA 2GUUA 3L12A 2W66A 3QVQA 2QQ6A 4Z2KA 2FLIA 2DY3A 3UCDA 3TONA 4Z1BA 3OA5A 4Z1AA 4A05A 1XGZA 3UGVA 3CZ8A 3JZEA 1Z69A 4R88A 1GVFA 1EO5A 3D0CA 3SGZA 1HKMA 3JS3A 3MP3A 3NPWA 4ZB2A 3MSDA 1R87A 3ZR4A 4KWVA 1L6SA 1MRQA 4JZ5A 1ISYA 2NQ9A 2ZUUA 4ZR8A 4NUWA 5GJMA 3BAJA 2OKOA 2HXTA 3RNDA 2OZ3A 2X0HA 2JKAA 4PFMA 4WSHA 1C91A 1X97A 3KTSA 4LANA 2ACQA 2XN0A 4BFAA 3LLDA 4PUKA 2YBUA 5M2FX 4V28A 3BC9A 3A5FA 1HL9A 2GGIA 1S5VA 3BAYA 3VGBA 1XC4A 4XZLX 1WKYA 2ZA2A 3PZTA 4PA8A 3LLXA 1T8QA 2VOMA 1Y5XA 4GFIA 3R5EA 3ARXA 4N9EA 7A3HA 4XZBA 4E4FA 4WHBA 5BOEA 1XKYA 4I6KA 2QNEA 2WMFA 4N42A 4CCCA 5FESA 4AZGA 1OSEA 1RY8A 3PSVA 3GAYA 5KZMA 5HULA 2HS8A 1NQKA 3I10A 2B7NA 4XIMA 5A8PA 6PTDA 3FXYA 3AMCA 1WV2A 4I90A 3CT2A 4PODA 4ML9A 4MNJA 4CQ8A 3SW6A 3NQBA 2WCSA 4B16A 2DZPA 2NVDA 4BQ4A 3M5XA 3W85A 3PANA 2H6RA 1H11A 3M47A 1JDFA 4Q7IA 1QW9A 2Z29A 3BAWA 4X2RA 1AK5A 2PDUA 2ZRVA 4G2DA 4LC8A 4EF8A 4EWJA 5FKYA 1OJXA 3NEHA 4XWUA 2A85A 1VPYA 3P8IA 3RO8A 5JU6A 4F0LA 4RL3A 1BRLA 1XINA 3QC0A 5FI8A 1U30A 3L4UA 3T4WA 1JXKA 3W22A 3REQB 1N55A 2FZ9A 3B0UX 1G5AA 4KWWA 1EEPA 3PBGA 5DCDA 1W3JA 4ILSA 2HROA 3BLLA 5J5RA 3T2QA 1NFGA 1AMKA 1MMFA 2TMDA 1TPFA 1JNDA 1UR1A 3ALGA 5BYWA 1R47A 4H9YA 3QEZA 2OYKA 4M6UA 1KRMA 1FDYA 2D23A 1BG9A 3M0LA 5JMUA 4E8GA 2R8WA 1VFOA 3VIGA 4PMYA 4D6JA 4IIEA 3T44A 1VKFA 4AH7A 4ZFMA 2W63A 2Y8UA 4IF2A 3N2XA 4I5UA 3UWQA 3H7RA 1QNQA 3SRFA 1PV8A 4V33A 1V7YA 5FEPA 2AKMA 3AI0A 1JUKA 1MYRA 2XFYA 1E71M 1V3MA 3TZNA 1V3HA 3DFOA 1XLMA 1A53A 3S47A 4C6BA 1IE7C 3KW3A 3TEVA 1AL8A 1WO2A 3OTRA 2V9DA 1SFLA 1T6MA 3GVRA 3CXOA 4WX2A 5T8GA 5A3HA 2OFJA 2PI6A 1UP3A 5CPOA 2C1IA 3H2AA 3WLLA 1TPVA 4QIUA 3M44A 4WK9A 3H4WA 2P50A 1B1YA 3UFYA 3K8LA 3ZMRA 3VNZA 5F1VA 5AHEA 3C5QA 4G1NA 3VAVA 5I07A 2ZRYA 1ZBCA 2IS7A 4OZOA 3MKKA 2EG6A 3FLUA 4UBPC 4AVNA 1EZ2A 3PUDA 1LWHA 3R10A 1K4GA 3T4CA 2PU1A 8A3HA 5CGTA 2XFFA 2E40A 4LCRA 1LDCA 5AZ1A 2R94A 2VOTA 4JTLA 1KBKA 4K8GA 4O19A 3CTLA 4ZOEA 1F3TA 1XCFA 4JCLA 3MMWA 3UXIA 4DLFA 3H2FA 3TW7A 1W3TA 3KDNA 1L8NA 3UXLA 1CGXA 1S5WA 2E6FA 4DB7A 1AD4A 4DUOA 2GSJA 1XIMA 4TXEA 1LUCA 1MI3A 1PWMA 2XM1A 2Z7KA 3A3XA 3ZOAA 1HVQA 4H8HA 2VFHA 2NXHA 4H2CA 4MPKA 1BQGA 4TR9A 1E3ZA 3GHUA 2A79A 3NPXA 4OBRA 1NF0A 2BG5A 2RKXA 2EJ1A 2VGIA 1N2VA 2WHMA 1GTEA 3APGA 1ME7A 4LRTA 4GYPA 1JZ3A 1MQQA 4DJEA 3DKJA 1YE6A 1GHSA 2YLAA 1OGGA 3WFLA 2HCVA 2VGBA 2YBVA 3SRKA 5ECUA 1CGWA 4LQ1A 3SCVA 3A4XA 2GJPA 3MO4A 3CWHA 1EBGA 4UMBA 3C8FA 1ITXA 2CC0A 1LOLA 2EPHA 2BVDA 4JTRA 3RM4A 1VFFA 3N11A 1H5YA 4HA3A 2XSBA 4AU0A 2E25A 3E6EA 1LBFA 2FZNA 3VTRA 1PYMA 3SUWA 3LU2A 1XBVA 2A7RA 1N7KA 3ARRA 3CLMA 1E70M 1D3GA 1F6PA 3V18A 4H83A 1FWFC 5JIWA 3MQTA 1VCVA 2VFDA 2Y62A 1YADA 4Y96A 4BQ2A 3WEZA 1A3XA 1DQUA 3CIXA 3LM7A 5A2BA 2GPTA 4K7VA 5JBFA 3U2ZA 4TX6A 1QPRA 1ZJBA 4RK8A 4C6MA 4GXMA 3WH6A 4CCDA 3W2KA 4DO6A 2DT0A 1XRSA 2HVMA 4JKMA 2G96A 1O12A 3GC4A 1UD4A 1UWRA 3A64A 2GVJA 3FJ6A 2J13A 3SCRA 3PFRA 4L9XA 5JXQA 4JFTA 2XWDA 1EIBA 3VFLA 2Y0FA 3LNMA 2ZDSA 3VKAA 2AAAA 4EVZA 3EB3A 4CN1A 4KETA 3VNLA 1UKPA 4R3UA 1A47A 4M7TA 5FJOA 1I6NA 1KM2A 4J2MA 4I9TA 4AB4A 1EL3A 3WMBA 2VEGA 2EXOA 3BV4A 2WBGA 5I03A 1TJPA 2H3BA 3NYDA 2DDXA 3H55A 4ZQPA 1KBIA 1P7TB 4QFUA 3BMVA 4FOUA 3N1AA 4ZQCA 2QIWA 1R3TA 3U4AA 1ZLPA 4IMDA 1DHPA 5D04C 3LLFA 5E0CA 1H0IA 1UPMB 3AMDA 1RBLA 3MUZ1 3UESA 1X6LA 3ARUA 2E0PA 1TWSA 2VQUA 3M0ZA 1I60A 1TMLA 2UY2A 2Y89A 1W8SA 1LL4A 4ENLA 3RR4A 3OG3A 1KXTA 4NNAA 4HOWA 1C3FA 4C6CA 2AKZA 4S3GA 4OJYA 1P1XA 3RX3A 3WIJA 4JX4A 4JL1A 2BZNA 4J40A 1U5JA 5JBDA 3E5PA 3DECA 4E0CA 5XIMA 1G9HA 2ZRZA 2WMJA 3RITA 1FCBA 2IQ0A 4PTMA 4O52A 4QJ4B 2HJPA 2V0TA 2A3EA 3H6OA 2YDRA 5I3FA 2XVLA 1OC6A 3UPBA 4H41A 1EWEA 3KRZA 5MF5A 4D6EA 3WNMA 4NIRA 1GEHA 1Q8JA 1W5MA 2ABAA 1NOWA 1FWAC 4PUNA 1UR8A 3S8HA 2WSKA 3BCDA 4AVOA 2GDQA 2OQLA 1EH9A 4AY1A 3QHMA 5DXXA 1C7SA 4Y9NA 4AIBA 1YHTA 2REQB 3KLKA 2QCCA 4JQ3A 1NWSA 3W7KA 4NX0A 5HR7A 3MVIA 5CZSA 3EKGA 1F8IA 5T91A 1WAWA 3UJRA 3VIJA 1J0YA 1WDPA 1UD3A 3WN6A 1SVDA 1KO0A 2PTDA 4DI9A 1HL8A 3UZZA 4R34A 4RE0A 3G1FA 3LCLA 1JPMA 1T0OA 3G1AA 4GINA 3SJ3A 1B4KA 1LWJA 1XSKA 1NQ6A 4DELA 5TF0A 4PGLA 4JS3A 1ADOA 4BWLA 8CGTA 3WZ0E 3KXQA 3P67A 4CKQA 4HIBA 2PDXA 1OQFA 4PTDA 2R1LA 4W7VA 1F5ZA 4MY8A 2QR6A 4CQAA 4AD3A 1B0IA 7TAAA 1NOFA 4B5UA 3CWNA 2PDLA 4C5ZA 1C9WA 4MLRA 4MUZA 2CWXA 2ZUMA 2W62A 2JEQA 9CGTA 1W1IE 4HMCA 1PKYA 1H7NA 4YHGA 3SGGA 3W7DA 3LY0A 3QSRA 1XYLA 4LYRA 4YTRA 1F2JA 2Q8XA 4MPQA 1OFEA 4G1KA 4PCFA 2GWGA 1H7RA 3ITTA 3Q37A 2C14A 1LT8A 5DRIA 3QGKC 3VDHA 3I3DA 1AW5A 3W2JA 4ZMGA 2QCHA 1Z32X 4QNWA 3THAA 3MYPA 1JCXA 1G6CA 2XH0A 4EIVA 2PC4A 3R1ZA 4E4UA 3TC7A 4AZ5A 2PRHA 3K5XA 1E6PA 2CZ5A 1DJIA 4JKKA 2J4GA 3B8SA 3QQWA 1V02A 5G4HC 4HU8A 3W74A 1S2CA 5KZDA 4PB5A 1F61A 1C7TA 4ORIA 3KL0A 2E3ZA 2OX4A 3DI1A 2C19A 1CXEA 2C3ZA 1SFSA 3UR5A 3RJYA 1B3WA 2A1YA 1IR1A 2FFIA 2VEIA 3TUUA 1K7XA 1XICA 3M46A 4YN5A 4W5UA 3VFCA 3S5YA 3TYCA 2FYMA 2NX3A 3N18A 2ZXDA 4OHQA 2DVUA 4RV8A 4HK6A 4R33A 1ZU8A 3W29A 1GQJA 4PZVA 3CUXA 3GO2A 2ALDA 1QWKA 3DG7A 3E49A 1TA3A 3AU2A 5IDZA 1XFBA 3IK4A 4V27A 1KR1A 4E8DA 3DGRA 2PDNA 4C1LA 1XM3A 1S2UA 4JQ2A 1UZHA 4FAMA 3IRSA 2GSEA 4GHRA 2VEFA 4RE2A 4D1IA 3NQEA 2QMKA 1UC4A 1W2PA 1ML1A 1R9ZA 1SJBA 4IIGA 2BXZA 1EO7A 3BLDA 4UFMA 2BDQA 4L6OA 2ACRA 1E6QM 4C6JA 2WMIB 1EB3A 3PUEA 3R89A 3W6MA 1KC7A 3OLDA 4XZHA 3OIXA 2BGSA 2OWWA 4REQA 3B06A 1EC8A 3CQIA 1ADDA 1XIIA 5FD0A 1XRTA 3LA4A 3JR2A 1A0EA 4Q8VA 1TELA 3RMJA 4MJMA 3EWUA 2PEVA 1LBLA 3L21A 3TZFA 4P8XA 1MRAA 2O4QA 3T1GA 4XVEA 2C8NA 1K9DA 5DMYA 3QJAA 4R9XA 1XIGA 5CEWA 3APTA 4IJCA 1HJSA 3E0WA 5AYZA 1E51A 1CB7B 4O28A 3QV7A 2WNQA 3A47A 2DSUA 4GNKB 1NFBA 3N6QA 1O1ZA 4GXPA 3VCNA 1ONWA 2ZC1A 2ON3A 3UA4A 2XSAA 3ZT6A 1BKSA 1CYGA 1ZAHA 1XF0A 2QJIA 4JEQA 3C4UA 1LL7A 4GIRA 2VFIA 2VZOA 3IUDA 1C8YA 2WZTA 2FHCA 3DC0A 4X9YA 1Q63A 2XIIA 2A3BA 3TSMA 2WVSA 3ANYA 4GUFA 3P14A 3DHFA 4MZ1A 4H6EA 1JD7A 4GO9A 1JGIA 2AOSA 2OQYA 1P4CA 1J0ZA 1PIIA 4AZCA 3WL0A 2OGJA 2VZVA 2YOCA 4GABA 4A3YA 2VM8A 4ZO7A 5LXXA 3T0TA 2BX7A 2VUNA 3W87A 5TBOA 4PMOA 2R1MA 4DJFA 2XWEA 3AYTA 5M1TA 3O06A 1S38A 1X7IA 4O0ZA 3H53A 4JICA 4POCA 2LLEA 1KFEA 2VC9A 4DUVA 4A21A 3IJLA 4W85A 1V6TA 1XUZA 2VC7A 2WPBA 1OWQA 2V2CA 4C65A 5L9FA 2J62A 1GOIA 4CNTA 1OG0A 3TOYA 3EX1A 1IIHA 1BF6A 4IMFA 1YW1A 1IWPA 5I6SA 2BHUA 4G7EB 1EC7A 1CXHA 4YTSA 4DPPA 4HYRA 4O53A 1JPDX 1KTNA 5FF7A 4BK9A 3S5ZA 3OO2A 4F0MA 1CW2A 5C9UA 5FF4A 3CV1A 4IG2B 4L64A 3EWXA 4EWND 2FJKA 2EO7A 5FL0A 5A8OA 4UR8A 2D2HA 5DLCA 3ZS4A 1QW8A 3OBAA 1GQNA 1X38A 4JHMA 1QR7A 1KB3A 1LG1A 5E6YA 4F8XA 4FNRA 1K9TA 1VFUA 3AHYA 2BTMA 2HVOA 3LI0A 3KOYA 4HU3A 4MY9A 3BGGA 2E6YA 3ITVA 1DJZA 2P5NA 3GU2A 5G2HA 3RRAA 1XX1A 1VH7A 3PNZA 5XIAA 3EX6A 4UNKA 1S39A 5RUBA 1XPGA 3AS2A 1H7OA 5BROA 2XM2A 4RV3A 3EB4A 2VEKA 3CB3A 4F4RA 1TE6A 2XN1A 4NAFA 4QBXA 1O6IA 4XK2A 1UUQA 2JEPA 3NO5A 5T9CE 3ZLFA 2QS8A 2TSYA 2CXGA 2CNCA 3W71A 3GDLA 4L4MA 4DUWA 5DY3A 3N04A 2YXOA 1V03A 3GNPA 4QCEA 1VFHA 4J3SA 1HN1A 3UY8A 4Q8QA 3GDKA 3WQPA 1WP6A 1MFVA 5DANA 1EBHA 4QAIA 2PP0A 2PMQA 2EG7A 3M0HA 1GZJA 1EP3A 1K77A 1Z8AA 2XUCA 5K9CA 5DXYA 1RUSA 4V2XA 4S2BA 5A8NA 1R38A 1A5SA 4KESA 2XYLA 4CQ9A 1FHVA 4MLJA 3GB6A 3GVVA 3QRHA 2OG9A 5CSYA 2GZXA 2NT0A 2PZ0A 3SUSA 1K70A 1EOKA 1QNOA 3DESA 4J3XA 3S9IA 4QSFA 3LOTA 4MWAC 3LTPA 1JCLA 1NSJA 1QI5A 1TV8A 5LNSA 2PP1A 1V02E 3CM4A 3CNYA 2AMXA 4XBSA 4Z08A 3AXXA 4H8VA 3SO7A 1UH4A 2RGLA 1TV4A 1PX4A 4Y2WA 2WC3A 2WC4A 1TUXA 3P0WA 1E4IA 4NZ3A 1PCWA 1HZYA 3WNOA 3S3GA 3DYMA 3IIZA 3BSHA 1RA5A 1XC6A 3M16A 4EXBA 3KDOA 3TJLA 2VR4A 3WJXA 2WSYA 3FGCB 4UTTA 1NH6A 3WD3A 1ODZA 3LCGA 3ARPA 4ATLA 5C5YA 2Y63A 1GZGA 1OINA 4O1CA 5F2LA 4F79A 2D3NA 4AHPA 2A7PA 4K39A 3F4CA 8XIMA 1I4NA 3T08A 5I23A 1W9PA 3R12A 4ZL1A 2NSXA 4JKLA 1EYEA 3DENA 3L65A 3LGEA 1VFMA 2VMFA 2J25A 3K8KA 3A22A 5PTDA 2F84A 4G56A 1SFTA 4KERA 4Q8OA 3RLHA 3WF3A 4LX4A 2YFOA 2QDGA 2J8GA 3GG7A 3G3MA 1TVLA 5CLTA 1C90A 3DBNA 3NM1A 4L4LA 5LHFA 3GDTA 3ZFHA 3DC8A 3SUTA 5G1TA 4UTWA 3DYOA 2D2OA 2I5QA 3BICA 3W53A 4HSOA 4Z17A 2X1IA 4AY7A 3HG5A 3C56A 4S3DA 4TX8A 5FJIA 4DBSA 4MYXA 1OX4B 4Q33A 3TYDA 4O50A 5C2CA 3AYVA 1B3YA 3N19B 1TR9A 4JTEA 3SB0A 2PDHA 3BCFA 2X05A 5DCEA 3T09A 2D0GA 1H3GA 4PEEA 4IQEA 1K8YA 4GYJA 3W7JA 4HZ8A 2BXVA 4A3RA 2VI0A 2W4XA 3WJSA 4ZQOA 5EFDA 1EEXA 4CVWA 4FOJA 2PWDA 4Y6GA 2NXIA 3PG9A 3UP8A 2CZEA 1PDYA 2A7NA 4UZSA 4MYAA 3PSWA 4O4WA 3GTXA 2VD9A 2PU0A 5C70A 3BTNA 3TQPA 4ZXLA 1ZS2A 1SO6A 1QK2A 3GKAA 3H24A 2Z2UA 3LCHA 3VZXA 1A5KC 3MU7A 2VRQA 3PJXA 5IFPA 1V77A 2YW3A 3ABRA 3W25A 3EKLA 4DNHA 3HQOA 2O9OA 4GNJA 3GYEA 4DO4A 2FVKA 1FWEC 3DH7A 1JCMP 2P88A 2VEMA 4GVFA 3NZQA 1B9ZA 2J47A 2Z1SA 3PBVA 1LOQA 1THFD 3UJSA 4WJ8A 2VR2A 3BUVA 4XQ6A 5CLWA 4UR7A 4WY0F 3P6LA 2DIJA 1PIGA 3BG9A 2D73A 4O1FA 3E2QA 3GX9A 6REQA 5AC6A 1XCXA 2YR1A 4XO6A 4CN6A 1BWVA 1DEDA 4JFVA 3LEPA 1WCGA 3VIKA 2Y7FA 3GG1A 5CQ1A 1H7XA 3QOKA 3QQ1A 3W2UA 2NQZA 3IVSA 2W61A 1OB0A 4NNBA 3URBA 2JQXA 3UERA 3WQ8A 3V5CA 3LSBA 3GU1A 5AC5A 3CEUA 1AZ2A 1M04A 1EP2A 1V6XA 1QOPA 1H63A 3TFXA 3GW0A 3UWYA 1KV5A 3AIQA 1X8CA 1GKPA 3WCZA 1RP8A 4Z1CA 3W27A 4B9ZA 4GOAA 5H8MA 4UFHA 4DWSC 1YLVA 3E2RA 1P0DA 3H4GA 4IUOA 3B3DA 4H9XA 4R7WA 1K03A 3SZ8A 2XFRA 2ZYFA 1JFXA 1XDJA 3A9BA 5CPMA 2OLHA 3ZM8A 4DAFA 4V1YA 1HVXA 3WUBA 2OKTA 4HOZA 2DV0A 5CZTA 5A2CA 1XRFA 3N2MA 5CBJA 4YCPA 4IL0A 2VVNA 1TX0A 4IFRA 1XIEA 2INFA 1Q7ZA 4ZA0A 2WV8A 4W8BA 1XR2A 2Q8LA 2JGQA 2VX7A 4QE1A 3HPAA 2FVMA 3PUOA 3WMSA 4MDOA 3CK5A 2PRMA 2J78A 2HZGA 4GUHA 4EPBC 3ZLGA 2WJEA 1RALA 1QI2A 1OD0A 1OFOA 4GBDA 4LVFA 2GLKA 2PA6A 3C3UA 1KM1A 1NY1A 3LXAA 2PWVA 4HPGA 3CPRA 4FR1A 5I78A 3GVWA 1O68A 3ZJKA 3GXFA 3R94A 2V82A 1S2TA 3FXGA 1X6UA 5CC6A 4C7FA 3MP4A 4RDVA 1S5MA 4FX7A 4UMCA 3UJFA 3FA3A 4IICA 3WF4A 4M7SA 1BVZA 2PP3A 1OD8A 3RPTA 6TIMA 1B9BA 3CHEA 4A8LA 1PKNA 1A80A 4PCPA 3ATYA 4MOZA 5AB3A 1E15A 2E1DA 3ELFA 5REQA 2VX5A 4HZMA 4LC6A 1KXQA 3MMTA 2G0WA 3MB9A 4QLLA 5HWMA 4FLSA 3RAOA 5BRQA 1U5HA 2PWHA 1WDDA 2GJNA 5A6BA 1OX5A 4ADTA 4W88A 3GTHA 3PZOA 3MKVA 3IV3A 2RDUA 4O8AA 4N02A 2R82A 4K2SA 1SZNA 4XSLA 2QUTA 2H3DA 3AU6A 2OPJA 1JZ7A 1UWQA 1ESWA 3W1RA 4Y8EA 1JDDA 1FXQA 1BF2A 1XYCA 2C71A 3MUCA 4ZE5A 3AUOA 3MV11 3UWWA 1MO0A 1XWYA 3ALFA 4PMRA 1PX3A 3OBEA 2INZA 2E4TA 1HKJA 2WM1A 1NWTA 1R85A 3LV5A 2GYIA 5BMXA 4GXWA 4ZCWA 3QPEA 1BWKA 3GKFA 4E2OA 3VDCA 1NDZA 4YL2A 3CJPA 3UW6A 4GIYA 1P0EA 4ACYA 2RJHA 3MUXA 4JPGA 3VPLA 3TYUA 3HGRA 2YCLA 3TXVA 4DJDC 1GNXA 3DZ1A 2D3LA 5U4NA 4XAFA 4MFDA 3VOFA 1I0BA 2WCGA 2KX9A 2D2JA 3PPCA 2NV2A 1WPCA 3S6DA 2ZRXA 3TA9A 5D9PA 2WXDM 4HT3A 3RM9A 3GNRA 3WDIA 3T78A 3T0AA 3UNTA 4AC1X 3BG5A 1I2RA 1E5JA 1WQ5A 3WUGA 3LBCA 1TIWA 1LUCB 4PULA 3VKKA 3UT0A 1EUNA 3A24A 3RYSA 1CX9A 3MBDA 3V7PA 3W28A 3NOYA 4UNIA 5CJNA 4C1NB 5C54A 4PL1A 3GAKA 3P60A 3ABXA 3MZNA 1OFQA 4CNOA 3OVRA 4ZB0A 4B5TA 1I2OA 4ONVA 5CXPA 1SW7A 1PKLA 4L4PA 3F4NA 2ALRA 1V0NA 2ZZ7A 2VHLA 5KEZA 2Q09A 1UWSA 2HBVA 5EMJA 3AZTA 3AYSA 3KVKA 1XHGA 1RQHA 1DBTA 1F4AA 3SADA 1J8VA 2YCJA 3PAJA 2POZA 4M19A 5C2XA 4F9DA 4HGXA 1R46A 2P0OA 1GPFA 4F48A 5FSEC 1UASA 3WUEA 1O5RA 4Q4RA 1FH7A 4GZ7A 1L9WA 3VGHA 1NARA 1Q6LA 4JTIA 1DE6A 3LHWA 1R7AA 3RPMA 3BLFA 1XV8A 5F4SA 4ATDA 4J3ZA 1E3XA 1ZTVA 2A0NA 4LB4A 3TYEA 2ZX8A 2XHYA 4CGTA 4WLCA 3KBSA 1GVYA 3JUGA 1HGYA 3LXCA 4HTBA 1QMLA 1ISXA 4J35A 3W7MA 3UJ2A 1B4EA 5TAOA 1KCXA 1IIGA 5IBXA 3P3BA 3UZWA 1E9IA 4BCEA 2V3GA 5F2GA 4GPNA 4OV9A 4RLIA 2VKZG 2ZRWA 2EKGA 1ICSA 2J7CA 3KBWA 5DO8A 4UTUA 3PBUA 2VR5A 3W75A 5M03A 5LSMA 2WSPA 3QY6A 4IP5A 3WF2A 1KFCA 2WZHA 2WJDA 4HP5A 1W5PA 2NSOA 2F6KA 4D6FA 1YNYA 1XFCA 2OELA 3KHJA 1JCYA 2EPMX 4P61A 3NO1A 4A22A 3MUAA 4C90A 3FKKA 4JTAA 1P6WA 3MKCA 1FWTA 1Q45A 1DJNA 4LU0A 3MI6A 3UETA 1FWIC 1L6WA 4FMVA 2WBKA 3U2EA 2ZUWA 4AXKA 3PZQA 4LAOA 2PB1A 1BYDA 3AZSA 3BH4A 4CNSA 3CZJA 2R1PA 2PURA 4IPJA 4GKLA 1XG4A 1BYAA 2WLYA 1GQLA 5IRPA 1ONXA 4LRSA 2CHRA 2YXXA 1YDNA 4BF7A 3NZPA 4H6KA 1XBYA 5DX7A 1TJ1A 4WZHA 3ANUA 4XBKA 3G3DA 5LGZA 4GH1A 1F8MA 4L1WA 4KRUA 2J6VA 4NJGA 3CTTA 4AISA 1D8WA 1Q65A 4GG9A 3TWBA 3UA3A 4YYCA 1Z7AA 2E68A 4U3AA 4DPQA 3NQDA 1GKQA 1KM3A 3EWZA 3TTSA 3MSYA 1BEUA 3AS0A 3MHFA 1LROA 1BYBA 4CEUC 1G94A 4CD6A 3ZLHA 1GOOA 3CZLA 3HG3A 4FHAA 2XH7A 1XH1A 1OG6A 2X40A 4XB3A 4RXGA 4WF7A 4DBUA 4V1XA 4OUIA 1V51A 4HJWA 3FFSA 2WNNA 4B15A 4PTVA 4Q32A 3CHDA 1XLDA 6A3HA 1NAL1 4JYEA 4LUYA 1ZPTA 3U7BA 1O7AA 3MJYA 4IGMA 1TZZA 1JUEA 1JD9A 1XLGA 4H7VA 4F0KA 1GOWA 1VRDA 1H7WA 1HP5A 1ME8A 3ABSA 4I5XA 4FNTA 3GR8A 2DFAA 2WJZA 1CLKA 3AHXA 4JX5A 5EBUA 1Z48A 2QAPA 3G1RA 4LUJA 3VX1A 4ZB5A 1Q13A 5F4XA 5A8MA 1FDZA 3RLGA 3CL8A 3PN8A 3YPIA 6CGTA 3VGFA 2HV5A 3GLCA 3UVAA 4Q4QA 3GVQA 1YPFA 5K3VA 2VWTA 1HXJA 2AQOA 3EDDA 1OT2A 4YMZA 3LQGA 3WFZA 1QNVA 2D1ZA 2EHHA 2D2GA 4J3UA 4DQWA 4W93A 5D2XA 3WJZA 2CLHA 3VZZA 3GXNA 1ISWA 3RILA 3PZIA 4FX6M 5EMMA 4A3UA 4A8NA 2YZ5A 1YNPA 3R58A 3PZUA 2CXEA 1K6WA 4EF9A 3Q94A 2PD9A 1G4TA 2ZTKA 1K7FA 4FNUA 6XIAA 1S2AA 4MJ2A 3NQ7A 2QT3A 3PZ9A 4O13A 3CYJA 3DI0A 1E0WA 2Y5JA 1OYCA 1KM5A 3T42A 3NQ2A 2QLYA 4LJ3A 3B05A 3P80A 1UB3A 4Q8MA 2IPWA 4GC3A 4FNPA 4LAMA 1O5XA 1J2WA 3LHTA 2CW6A 3R2GA 1C8QA 1YYAA 1KR0A 2DVXA 2INEA 3CZEA 4XZIA 1YTKA 3KTCA 1Z9AA 5CGQA 1EIXA 1BWLA 1XLCA 1DIDA 3TOPA 5JBEA 3PHAA 1KBLA 3LYEA 4FIQA 4XVDA 1WA3A 4HVXA 5FJTA 1XP3A 1ZFJA 2GJRA 2VL4A 4XTIA 2Q71A 4KMQA 3VIFA 3ZQ9A 1B5TA 1PJ9A 5E9AA 2F38A 3GXMA 4S3KA 3L68A 4HHMA 4C6FA 4LUSB 1HW6A 1TWDA 1OIFA 4FR6A 1OY0A 3BQ5A 1CGYA 3HMCA 4ZOBA 1FHUA 1PPIA 1ICQA 3CMGA 3UG5A 2NLYA 2X8RA 1W5NA 2G3FA 1W1PA 3OEXA 4UIOA 2YGYA 4DZ5A 3E3HA 1GJUA 4PUMA 3IUIA 2O9RA 2PCEA 3N9RA 4L6HA 1NWUA 3ARQA 5CPSA 1TA3B 4LB3A 2J7EA 1ISVA 2EPOA 4OUEA 1GEQA 4S39A 1HJUA 1PTAA 2IPGA 3SN0A 1PVNA 3H26A 2YL5A 2BMBA 4NQ1A 3GC5A 3CQKA 1H60A 3DX5A 4REQB 1J18A 3JU2A 2GVEA 1W3LA 3GIQA 4FOKA 3NQCA 3Q2DA 4KS0A 1VBGA 5HXMA 4NILA 3GTIA 3S6OA 2TYSA 1LRQA 3S1UA 2PC8A 2PDBA 2C1HA 2HVNA 3T9PA 4M1RA 2FDSA 1FTXA 1KBJA 4YTUA 4HKPA 3AMLA 3VOCA 4RE3A 3ZR5A 5KZ6A 1QNPA 3W6YA 1P1MA 3W07A 4RR4A 2HSAA 3NWRA 3VUPA 4DBDA 4F40A 1SR9A 3M4HA 2C16A 3TU9A 4Y9MA 3GU9A 4NZ4A 2OT1A 1F76A 4RZ5A 4D6HA 4Z2GA 1UR9A 2NV1A 2QEZA 3CPUA 1LF1A 3GNXA 4AHQA 3BLEA 3VKBA 1CNVA 1XYZA 2ACUA 4AWUA 5EMYA 5D2VA 1QHOA 4IGSA 1HG3A 3GTFA 2GVYA 3AXMA 3OW1A 1FWHC 4K3ZA 1DWAM 3FOKA 3ARWA 1YXDA 2QUNA 2GQ8A 1FWWA 4LAUA 1VJZA 1QAPA 1M41A 5IHRA 3WF1A 1XSJA 3LSCA 4O15A 1OK6A 3R4IA 3PFMA 5BWAA 1XIDA 2ZUNA 1KFKA 4AZCB 2J27A 1KRCC 3OZPA 3F5JA 4WKHA 4PCSA 1IR2A 4QCFA 7ENLA 2NQLA 3HN3A 4TTGA 4BF5A 4QE5A 4WCJA 3QR0A 4D6GA 4Q8TA 3WQWA 8TIMA 1H1ZA 3AJ7A 3RU8X 3T0DA 3GYCA 3HGJA 1EKOA 2FMNA 4PR4A 2GVLA 3O6CA 1DTUA 3S83A 1KM0A 2I7GA 4O1DA 4RNIA 2JIWA 1B2YA 1RXOB 1LQ2A 3KCLA 3WQFA 3B03A 4QG9A 1UZDA 5I79A 1EPVA 3VU2A 1K8XA 4N7QA 4C6KA 3F2CA 2H90A 3E0VA 1UC5A 1CGUA 2VGFA 5FJPA 4AYSA 3F5LA 4PB3A 3TNBA 3RLUA 3E38A 3VXGA 5A6JA 3W84A 1R6WA 1T96A 3ONBA 2HE5A 1X98A 4S3BA 1MWOA 2XH2A 3M64A 3QPYA 1RLDA 4L1GA 4JIQA 4I7UA 2DGAA 1AL7A 4GNVA 2PTYA 4M29A 1M01A 3LTSA 3NEVA 3FDGA 3C0LA 4P8WA 4M1BA 3N2OA 3V3WA 1ALDA 3ES7A 4H9VA 5H8PA 2X30A 1FFRA 1LBMA 1JG9A 4XAYA 3UD6A 1UR0A 2E9MA 1JIBA 4E8CA 1JRCA 3N25A 1IT8A 1XIHA 3B9OA 4YU1A 3TE9A 3QH2A 3P84A 1PAMA 3U5YA 1OM0A 2NLIA 5D9MA 4FF5A 4LH8A 3NDOA 5F4WA 3TN3A 4HA4A 4CD7A 1B3ZA 4A29A 3PWGA 1W9UA 5D8ZA 2DSZA 4O1BA 3PBWA 4H04A 4KEMA 2YA2A 3VOHA 4ECLA 3C2YA 4R7OA 1CGTA 1E73M 4JTKA 4DM2A 2A3HA 4NAFB 5LA2A 4LCQA 2QJGA 1S2VA 4GCXA 5H6HA 3FSTA 4JR5A 3GH7A 3SQLA 3E1F1 3KRSA 4MNMA 1A5LC 3BLIA 1POJA 4CQCA 3O6YX 4NZ5A 2MANA 3AXIA 2HPMA 2VC6A 4LW7A 3PWIA 4AG0A 5F2MA 3A3HA 1IEIA 5HWJA 4NY2A 3D47A 1E72M 5D9NA 1K4HA 2V3FA 1VBJA 2H9AA 2W79A 5FF2A 3L66A 1PHQA 3WDPP 4JQAA 4UFKA 3SQMA 2QYGA 4OU1A 1OZQA 4QS5A 3CHFA 3COTA 1R8LA 4PE8A 2VXNA 3NSMA 3FEQA 2X2GA 1X1NA 2ZICA 4HCDA 5BZAA 4LALA 5LIWX 3O16A 4FLRA 4WKFA 4B4HA 3QTGA 4G6CA 4I8YA 1BXCA 1S1PA 1TO3A 4WXZA 3MW7A 4RDZA 5LIXX 1J11A 2G37A 4B92A 4JAWA 4AIOA 1WDSA 2YDAA 1XI3A 3WUFA 3C2RA 3TTQA 2PE4A 3ERPA 4WDWA 1V3LA 4QLJA 4PMJA 1JDEA 1QK0A 1WDWA 3LHYA 3TC6A 3VIHA 5FOOA 3LPGA 4FXFA 1GJWA 3FHQA 3KCJA 3PJUA 5BOOA 1W32A 4IPLA 3LCXA 2ZX9A 2BXYA 3ITLA 2E9LA 3B0YA 1MQRA 5A6SA 1WOAA 5C55A 2NVAA 1OT1A 2YW4A 4M81A 3N17A 1JF6A 2ACSA 1EX1A 3H2MA 3THCA 3MT1A 3NZ1A 3N34A 1EF3A 4MZ8A 2JK2A 2TPSA 4B91A 2W27A 1HJWA 4HK7A 1F3WA 4XAPA 3CV2A 4DF0A 4GACA 3CHVA 2NWRA 3B0PA 1H09A 2XINA 3LGGA 1WZAA 4UQEA 5CC5A 1UMYA 1W6TA 2PSNA 4WOQA 3AHZA 1EWDA 3NXFA 4IPPA 1J96A 1TE1A 3NURA 3VNYA 4JY8A 1UWTA 3DFTA 4JTDA 1DIKA 3OU8A 3HBLA 1UIOA 2JF7A 2XVGA 3NQFA 3L23A 4JX6A 2XIQA 4HPJA 4IX0A 1UR3M 2IXUA 1RJPA 2V3EA 3VKJA 3VD5A 1E55A 1VCFA 4Q8PA 1BHGA 3DFYA 1JAEA 3CIVA 1NP0A 2GQAA 2QULA 3KL5A 7CGTA 3G1XA 1ZJAA 1FVPA 1W9VA 4IM4A 1TTPA 3O6DA 1AQHA 4R7JA 2NUWA 4R5EA 3GC2A 2OR2A 1CLVA 2DH2A 4L1XA 3A6OA 1VBUA 3DG6A 1O60A 1IXPA 2V5KA 1F05A 1Q2SA 2GQ9A 3L5AA 1KTCA 4W87A 1OFRA 1V8EA 3G22A 2VX4A 2J9YA 3GUGA 3FYOA 5BRPA 2PTZA 2OWXA 3GDBA 1RBAA 3R0KA 2PWEA 4GQRA 3I3BA 3ZXWA 1ONRA 1ITCA 3VOIA 1OVDA 1E1CB 4JTTA 1SPQA 1VQTA 1E43A 2FGLA 4R85A 4FF7A 1XRVA 1ZZMA 2BY0A 3CGTA 4PRTA 3W26A 4RZBA 4ML4A 4O18A 5A6LA 2CLKA 5AYXA 4E3VA 5KINA 3DFPA 1HFBA 4BI7A 2V2HA 5AN7A 1RBOB 4QXIA 2BOEX 3MY9A 4LF1A 1L0PA 2ODOA 3IGHX 4H8UA 1ZHAA 4K7YA 2XVKA 6REQB 2JKPA 1MDRA 3KBVA 1AVAA 1RCQA 1JVNA 4M82A 1EQPA 1KWGA 4DJED 3G18A 3MWAA 3V35A 4LUIA 3UWZA 3HPZA 3E96A 1V0KA 4WY0A 3WLHA 5LGXA 4DX3A 1EDTA 3WQDA 3UWUA 5HUOA 4C6NA 3R0DA 1P5BA 4ALDA 1SJAA 1KWKA 1GVSA 4RJEA 4FB7A 2VCBA 1JPIA 1WUFA 2PWFA 1X1OA 3EPOA 3T0CA 2WHJA 3PK7A 1FA2A 1LJYA 4MADA 5A2AA 2VVSA 3UR2A 1FKWA 2W91A 3VGDA 4AD4A 1IXOA 5BU9A 4Q4SA 1QATA 1JPHA 2VC5A 3HF3A 1ZBVA 4W7WA 1Q6CA 4ASTA 4KBXA 3FKRA 1VC4A 2ATMA 3OGRA 4W9TA 2AL2A 2ABBA 3APYA 2C0AA 3OZMA 1AODA 2HQAA 3ZVHB 4IL2A 1KFWA 1JZ2A 1JZ8A 2CBIA 3SFKA 4RX0A 3HO8A 3GHRA 2WANA 1M03A 2Z1WA 3HGSA 2I9EA 5G2IA 2PZNA 5CPTA 5IDIA 2TODA 4E2DA 4LBRA 4JIRA 1KQYA 1KKOA 4GVIA 2ZZ2A 1RSCA 3IIOA 2F7FA 2BSLA 4KWUA 1R9XA 2PS2A 4W8LA 1UOKA 4O0KA 1W3IA 1X6NA 3GXPA 4XG1A 1DJHA 3REQA 2WVTA 1UKQA 4HSNA 3CMJA 1E4MM 1RAKA 3QYSA 3EOLA 3HQNA 2C0HA 3A4JA 4GIAA 3HV9A 1CB2A 1PWLA 3LQLA 1JF5A 2I56A 3L0KA 2I5GA 5IFTA 3H23A 3NDYA 3GFYA 2P8CA 4Z2HA 1K02A 3L4YA 2WOQA 1IEVA 3N6HA 4QLKA 4RZ6A 1UUMA 1MZHA 1W0MA 5ABGA 3IACA 3G1HA 4US5D 4G8TA 1XH2A 3UY7A 1HNYA 4JYDA 2J88A 4DEFA 1QBBA 3S46A 3UU0A 1M5WA 1PE1A 5HQEA 1EQCA 5HPOA 3LG3A 4KGJA 2QUUA 2HDJA 1TFVA 3ECQA 3WMLA 2DSWA 3WH8A 2UWFA 4IQJA 4PYSA 1O95A 2O7QA 1RPKA 2ICSA 3P61A 4ZOAA 2BB0A 4A8IA 2OLAA 1P0KA 3MDWA 4MJZA 2FQIA 5LIUX 2E5DA 4JDBA 3RJXA 4O54A 4RPQA 1UUOA 4N4PA 4D9PA 3QLDA 4S1FA 4ZTXA 1IZKA 4GJJA 1QI3A 2YCLB 4L9YA 1TPH1 2WNZA 1VIWA 2XIMA 5GNYA 2W92A 4IXHA 3UZ5A 1RQBA 2DSKA 4P7OA 4P5UA 2AQWA 1BVWA 2ZX7A 4IQDA 1GZ1A 1TKKA 3H22A 4IQLA 1UWUA 2PUZA 3HB9A 1MZRA 1Y5WA 2B0MA 5TIMA 4UQBA 3EWBX 3PBYA 4NX5A 1FBAA 3PTKA 1W37A 4GMEA 4FALA 4GVGA 2Q6ZA 1UA7A 3OYZA 4F66A 2ISSA 2I57A 3KAOA 1A5AA 2VQTA 1XPYA 3WQ4A 3EA2A 3VE7A 3WLTA 3W23A 4KQNA 3N2TA 4YHEA 1GONA 4DO5A 3W02A 1HKWA 1G1YA 3BPWA 3TMQA 3PF3A 4Y7EA 1E9LA 4LVGA 1VS1A 1RJQA 3AAMA 4M0XA 4AD0A 5ABTA 3THQA 1MDLA 5K4XA 2WHLA 3IVTA 9XIMA 2POTA 3W2MA 3H7UA 5E09A 4JOMA 3PULA 1NEYA 4C1KA 4LAKA 4IJRA 3KX6A 4XIAA 3JW7A 3NQAA 5D2TA 4Q7NA 3AZRA 3N73A 1UQYA 5EPDA 4IIFA 4DHGA 2J7GA 3AIWA 2QV5A 1QT1A 4H6RA 4IWWA 5KZEA 2GUYA 4K38A 3I6RA 2PDIA 1BGGA 3NDZA 2VRKA 4ZVJA 3SBFA 4K1WA 3TCSA 4GUIA 3S2NA 3FV9A 3BV7A 1DIOA 3CC1A 2X1UA 2KAUC 1JR1A 4PMDA 2ISWA 1PX8A 4Q6JA 2YDQA 4Q4OA 3W81A 1AJ2A 4UZUA 2HNHA 4HNUA 5FAGA 1EJVC 5C2GA 1I2PA 2P3ZA 1Q66A 1RHCA 3ONCA 2P8BA 2OXNA 3M0XA 3OQ8A 3QFEA 3ZR6A 2NX9A 4NAEA 3ICJA 3RK8A 3KRBA 1QO5A 1G4EA 2WHKA 5HNNA 3VIPA 3DG3A 2CPUA 3KCOA 3H54A 1TJ2A