1UB3A

Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
211
structure length
211
Chain Sequence
DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldolase protein
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 85
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ub3A00
3VFLA 2YDAA 1D3GA 3NQGA 5E1QA 5KINA 2VXNA 1UBSA 1XI3A 2WV8A 4IXHA 4DXVA 4MY9A 1O5KA 4MJZA 3TV8A 1OABA 3R2GA 4IMEA 4YXGA 1OYBA 3B0PA 2TYSA 3EEGA 1OF6A 4O1CA 1C9DA 3KVJA 2G5WA 3DFSA 3EXRA 4WUIA 4PC8A 3C0JA 1G7VA 4DO6A 2ISSA 1I8JA 3L21A 4JTHA 4JDBA 1K8XA 3S5YA 3G1AA 2JGYA 1JVNA 3NM1A 1OJXA 1GVRA 1KM1A 5CSRA 1JULA 3W72A 3W7LA 1LBLA 3LLDA 1NF0A 4DELA 4CLMA 2PRMA 1GQNA 1SZEA 3QH2A 5AYXA 1TV8A 2VEPA 3IVTA 1HTIA 2B7NA 1OYAA 2F84A 4DO4A 2J6XA 5G1YA 2CZ5A 5FF4A 4JYEA 3IIOA 3NQ2A 3SGZA 1DQWA 4XUGA 1H5YA 2V2CA 3CLMA 3GAYA 1JCYA 3UWWA 2WNQA 4KKXA 3W1RA 1SSDA 4ZQCA 5AFDA 3DFQA 1AW2A 2WOQA 1W5PA 2YZRA 1TTJA 3OHIA 2LLEA 2GVLA 2QAFA 4FNSA 4H4IA 4PTNA 4LU0A 4C1KA 3GZ3A 3EKZA 3UWYA 3LCWA 3LCLA 1OFDA 1LZOA 4LNYA 1EIXA 3LX9A 4S1FA 1W31A 5E0KA 5HMSA 3FLUA 7TIMA 4O10A 3O07A 5LHEA 5AHLA 1LBFA 1GVSA 1G69A 5CPNA 4O8RA 3BW4A 4CQ9A 5AOUA 3BARA 3O06A 2NUXA 4I7WA 3M44A 1AG1O 1FWNA 1GG0A 5D02A 2FB3A 3NZRA 1W1ZA 4I9AA 1SZFA 5AYYA 3SR7A 4LY8A 3S6DA 2VFEA 5BW6A 2QCCA 1W3IA 3LCGA 1W3TA 3PSWA 2C1HA 3UZJA 4AVFA 5KZDA 4XZ9A 2B7PA 4LRSA 3EWWA 3BG9A 1FDZA 4O12A 4UFKA 3NQ6A 3TQKA 5D33A 3NPUA 4O0ZA 2BTMA 3HMJG 2C14A 2E6AA 2TRSA 3C2OA 3C3NA 5F2LA 2ZTKA 3WJXA 5AC6A 1AL7A 3WFAA 4GXMA 3W7RA 2HS8A 3DHFA 5TBOA 5D09A 3SY5A 3RLVA 1TREA 3M5XA 3W1UA 4GUJA 2QCDB 2NX1A 4ORIA 1DKWA 5H91A 5LNUA 1ZY9A 5F4WA 1GEQA 3S9YA 3Q94A 4JDYA 5L6UA 4Y6GA 4QJ1A 1X7FA 3UXAA 1FX6A 2C19A 4GUHA 3TC7A 4GUGA 1XM3A 5F2MA 1TMHA 5FF3A 3KXQA 1FUYA 4E2BA 4HHPA 3TQVA 3ATYA 5HR6A 4ZQOA 4NU7A 3VNDA 3QMTA 2E68A 3W7PA 1YDNA 3VKJA 5LNVA 4HN4A 4NXSA 2FQIA 1KTBA 2QF7A 5LNSA 3FS2A 2V9DA 1B3OA 4H6KA 3LLFA 5KMYA 2DP3A 1VQTA 2IQTA 4P61A 3PAJA 5KTLA 5K2ZA 3CTLA 3INPA 2C3ZA 1EUNA 3CEUA 5DCEA 3W1PA 5I3HA 1TYGA 2RFGA 1KM3A 4WQ6A 1NSJA 2CLMA 4P2VA 1LCOA 5EPDA 1Z41A 3QSTA 4R33A 1RQEA 1GYNA 3M5VA 1DOSA 3LRMA 3G8EA 3HIJA 3TNOA 2ZRXA 2WQPA 3LHWA 1VLIA 2CLFA 1OYCA 1ZAIA 4JS3A 1TJRA 3NL6A 2QUVA 3QRHA 4R53A 2QJGA 1QNVA 3MHUA 3MYOA 1Q6LA 3UPWA 3RFAA 3T44A 2E6DA 2GJNA 4Y8FA 2Y85A 4LC8A 4Z08A 3V75A 1W8SA 3F4WA 3H54A 3R89A 1IXQA 3IGUA 2TMDA 3BG5A 3PS7A 1FDYA 2J9ZA 2VFFA 1FWSA 1TTIA 1ONRA 3TKFA 3IIZA 2A1YA 1XKYA 3GYEA 3KOFA 1OX6A 2ZA1A 1JUEA 1YLVA 3W84A 1Q6RA 4MLRA 1MZHA 4NT0A 4UTWC 2CFFA 5D2WA 4FNQA 3BVJA 1KM0A 3LRLA 1TPH1 3ZWSA 3JRKA 1KW1A 1GT8A 1EWEA 1EUAA 4R7JA 1FDJA 2QCDA 4DF1A 3W7HA 5C55A 3TK7A 4WOZA 3MP3A 3A9IA 4RLIA 3V1PA 1Y0EA 5AC7A 3N34A 3NQDA 4BI6A 3L66A 3DFNA 5KITA 2BSLA 1OFAA 3DZ1A 4LT9A 1DV7A 1VJIA 1HO4A 1ML1A 3E12A 3TFCA 1JRBA 5FESA 2VEIA 1QOQA 4HNVA 3O8AA 3MUXA 3P8JA 3LI0A 2QJHA 2Z2UA 2YW4A 4GRSA 3EB2A 2AAMA 1YXCA 2Y7GA 4UMBA 4UFHA 3W2MA 3O1NA 1AW1A 3P7YA 4LS0A 2E1DA 3F1QA 4GUFA 3WK0A 3LM7A 3KRZA 4LV9A 3EWXA 4FO4A 3U2OA 1GVQA 1OK4A 4TR9A 4CCEA 2Y7EA 1BTMA 5BMWA 2FFCA 2JBMA 5AYZA 4NXKA 1YADA 1K03A 2BX7A 4WD0A 3WJSA 1GZGA 2QCGA 1IGSA 4UIOA 1SW0A 5K3VA 5HUPA 1KM6A 3LV5A 1FWTA 2RDTA 4AMAA 3GB6A 1PHQA 4L4LA 3FJ6A 4BR1A 1JCNA 4O14A 1VZWA 1P1XA 3CIXA 3G0UA 3NOEA 4E0CA 3ABSA 2V5BA 3HGOA 4IMDA 1H51A 1AW5A 1JJKA 4Q4KA 1DORA 3C6CA 4CCDA 2AGKA 3W7MA 4FNUA 3MP4A 4LVGA 2W0UA 1F05A 2TSYA 2RHGA 4I7VA 4QNEA 1EPXA 3SI9A 3TQ0A 3QEZA 5LGZA 3A5FA 4XKYB 3WJWA 3O15A 1EP3A 2VENA 2V81A 3P84A 1VCVA 4RZ6A 3N9SA 1GTEA 4O11A 1GTHA 3CQ0A 2CLKA 1JUKA 2C6QA 3CU2A 1R46A 4O1BA 3MWAA 4MKNA 2A0NA 4RXGA 1ME8A 4BI5A 4IMGA 5AHEA 2A5HA 3LTSA 3P5ZA 2E09A 5H2ZA 3C8FA 3DAQA 3U8GA 4CCCA 4M7SA 4Y90A 1AL8A 4U4MA 3LBCA 4EWND 4O16A 1NAL1 5DY2A 4NUWA 3NO5A 4NX0A 3MMTA 4MPQA 3LERA 2I14A 3OEXA 3E02A 4UFIA 3BG3A 1M7OA 1KV8A 3N19B 2ALDA 2FLIA 3DU0A 2ZA3A 4XTIA 2YX0A 3U6WA 3N73A 3TE9A 3C2VA 3LHTA 5F1VA 2DJLA 3SSJA 1PS9A 4YCPA 4N02A 1SFLA 4TMBA 3RNDA 5J5DA 3G18A 1F7BA 2XN2A 3HG2A 1YTDA 3M43A 2VFIA 4UNLA 4MOZA 1DQXA 1KV5A 3P67A 2Z1BA 1H62A 4HKPA 3CWNA 4TMCA 1WBJA 3NDOA 3DXIA 1SW7A 4RZ5A 3UQNA 4MZ1A 3FFSA 1MEHA 3NYZA 4YWIA 3G1YA 1FXPA 4NNBA 2DZVA 2VKZG 3B8DA 1BWKA 1WBHA 2Q8LA 1SR9A 3HQ1A 3MO7A 2KZHA 4LVBA 4N6EA 3QF0A 3MBDA 3LHYA 5D37A 3E96A 3TXVA 1C29A 4E38A 1T0OA 2NWRA 3A23A 1YYAA 2RDWA 1K02A 5D04C 5ABTA 3DFPA 4ADTA 3BLEA 4GJ1A 3L0NA 2UV8G 3S1VA 3W74A 5D2YA 5LGXA 2EGZA 1D9EA 2V30A 1TO3A 1LRQA 3JS3A 4AHOA 2VFGA 4A22A 5IBXA 4FX7A 3G1SA 4PCFA 2Y63A 4AEOA 1Q3NA 2ATMA 4PH6A 3ZWTA 4WXYA 3UWZA 3QQ1A 1J5TA 1QO2A 1T99A 3W1LA 2RKXA 1U83A 4YMZA 4UR7A 1IIGA 4WX2A 3W7QA 4XKYA 2EF9A 1IIHA 2V8ZA 3DBPA 4NJGA 1TCDA 2QDGA 3DFOA 1WDWA 3LI1A 1N8FA 1B57A 1YPFA 3G0XA 4GNJA 5EBUA 4GUIA 3W7GA 4UTTA 3NVTA 2EAWA 2X16A 1LLZA 3THQA 3DENA 1VGAA 2CZFA 3VCRA 1ZNNA 4CQ8A 4O57A 5BNKA 1XUUA 1QFEA 4WY0F 5E93A 4M6QA 3NPXA 3DGRA 1S5WA 4Z1AA 2FPVA 3W7EA 3W1NA 4QSHA 3ABRA 4WY0B 1SZNA 2PRHA 3W2UA 3CHVA 3NQVA 2A85A 1GPWA 4N4PA 4O15A 2NXIA 4A2SA 4IPJA 3OVPA 3GDLA 2Q3RA 4HSOA 1W56A 3W7JA 2QEZA 3O6DA 1WOAA 3UY8A 2QCLA 4JTTA 3W76A 3W85A 1O60A 4FF7A 1RQHA 3PUEA 4MUZA 1JCMP 5AHFA 3IVSA 1XBZA 4ZQMA 1JRCA 3CM4A 3CB8A 1ZJIA 4O54A 2NZLA 5D05A 3NL5A 2FB2A 3C2RA 1CI1A 4MFEA 3BV4A 3STCA 1SO6A 2Z6IA 5L9FA 3W83A 1I2OA 3TSDA 1JCXA 1OFBA 1YTKA 3HF3A 1OFRA 3F4NA 3CT7A 3W7OA 5K9DA 3GNNA 4LS2A 2Y89A 3P74A 4JEQA 1WXJA 1EB3A 4LTSA 3T7VA 5T26A 3STGA 2Z0IA 2JK2A 2ZRVA 5HWNA 3LCIA 4IXXA 3IGXA 3CIWA 3UWQA 3HBLA 5AHIA 1TPFA 3MI6A 3W07A 3FIGA 3WK3A 1GJPA 3W2LA 2C0AA 3BLFA 3W86A 4MY8A 4HIBA 1DVJA 2X1TA 3W1TA 2WKJA 4JTUA 4LWWA 1BWLA 2DZSA 1AK5A 1TPB1 4NJJA 4HPJA 1MXSA 3L65A 4ML9A 2NUYA 4O13A 1V5XA 5F1UA 3NM3A 1DHPA 4NVTA 5DXYA 1DJQA 1I2RA 4AAJA 2YCEA 1VRDA 1SU5A 1LLWA 2PE4A 4NX5A 1GYLA 2WNZA 5DELA 1KLYA 2VFHA 1DJNA 3PBVA 5D38A 4CNOA 3KRUA 3Q37A 4ADUA 1PCWA 1G4PA 3R12A 3W75A 4K7YA 3QMRA 1H1YA 4FNRA 3PR2A 3EKLA 3TCEA 2ZYFA 1I2QA 3LHVA 3TW7A 2XFWA 2O7SA 1H60A 1N55A 2H6RA 3DH7A 4WY0A 5AHMA 1UJPA 1M5WA 1EEPA 1SW3A 3GX9A 1C8VA 4U28A 1OFOA 2ZRUA 1FBAA 2EKCA 2ZRYA 4O28A 3NQFA 1S3HA 4OQVA 5LHFA 1TB3A 4QIUA 4FNPA 1LYXA 3SECA 3Q58A 3PC0A 2V0TA 4OGZA 5D03A 1GVOA 3GNDA 3GXPA 3WJZA 4LVFA 1LOQA 3HG5A 3EX1A 1XBXA 4ZZ9A 1JQXA 3NQ7A 3M0ZA 3OG3A 2A21A 3W71A 1O4UA 2J9XA 3P61A 4K38A 2QUUA 3W7NA 2E77A 4Z1DA 3G24A 4Q32A 4X2RA 2Y70A 2C13A 4KFOA 4CNPA 3BW3A 4EF8A 1ICSA 1I45A 1KTNA 3QQ0A 5DCBA 1SUXA 3W6YA 3EX4A 2OMAA 2NX9A 4MJMA 1ICQA 2R8WA 3S0CA 1QPRA 1VC4A 1W0MA 2GQAA 2QCHA 3B03A 3O63A 1KFKA 3UZ5A 1XCFA 2QCNA 4AF0B 4K36A 2D73A 5DXXA 1KA9F 2X1SA 4UTKA 3PF3A 1X8FA 2JKEA 1M6JA 2YXGA 3UWUA 3A22A 2C15A 4R34A 3T78A 2VEMA 4DO5A 2ZFAA 3Q2DA 3PB0A 2A2IA 1G4SA 2ABBA 2E6FA 3GR7A 5CZ0A 3NXFA 2ISVA 4JN6A 1SQ7A 2ZRWA 1OG0A 1XL9A 2O7QA 3TMQA 5G2HA 3SZ8A 3GXNA 1N7KA 5K4XA 4OU1A 5CZTA 4IWWA 4XQ6A 4IOTA 1QO5A 1JQVA 1EX5A 1I4NA 3G8RA 2ZZ4A 3PULA 3I65A 4FNTA 2CZEA 3MHFA 3PG8A 1TTPA 1UUOA 2B7OA 2WJZA 4FX8A 5DCDA 1OK6A 2FDSA 4QM1A 4DF2A 1TV5A 3LGEA 2ZA2A 3W1XA 1NFBA 1FWWA 3G22A 1AMKA 4A29A 5CGQA 2ZZ5A 3SIZA 1H7OA 1DBTA 2R94A 1P0NA 3TXZA 5BOOA 4H3DA 4TX9A 4QISA 3KAOA 2QCEA 4AHPA 4O4VA 1R2SA 5K9XA 3OVRA 2ATSA 5F4SA 3NGJA 2V2HA 1Z44A 3G1XA 3G1FA 3ABOA 1X1OA 1QPQA 1R2RA 3PB2A 2DZPA 2HMCA 1QR7A 5KZEA 2YW3A 3SW6A 1TQJA 4JTSA 5A5WA 5LNWA 4NQ1A 2VOMA 2CLIA 4FX6M 1P5BA 3BO9A 2NLIA 1KBJA 2OZ0A 2WPBA 1NF7A 3UWVA 2B7QA 3TIMA 1UB3A 3W9ZA 1VPXA 4JICA 1XBVA 1BKSA 3NQCA 2BLEA 4LOCA 4JX6A 2GVGA 3HGJA 3IVUA 4OHQA 4Y96A 2QCMA 1K7EA 2YPIA 3LTYA 4KFNA 5I3FA 3PBYA 3LHUA 2V82A 2DZTA 3I7QA 2A7NA 1ZENA 1OFQA 3VE9A 3FYPA 2GVJA 2QCFA 4HSNA 3NA8A 4WOQA 2QAPA 3W2JA 2DZUA 5KSWA 1VHNA 5D32A 2NX3A 1IXOA 4UNKA 4O18A 4JTEA 5FF0A 3S5ZA 3FKKA 1CW2A 5EKYA 3TDFA 1F6PA 4XBSA 3DFTA 1R47A 5DN1A 2HTMA 1CX9A 2PRLA 2R14A 1KLZA 3QC3A 1PCKA 3LRKA 4JTIA 4UTIA 2ZZ6A 4HT3A 2NUWA 2Y88A 4J9JA 1K7FA 5LNRA 2E5BA 4LRTA 4LS1A 4O17A 1RQBA 1K8YA 4RKAA 3DI1A 1KFEA 5IBXC 5F4XA 4IMFA 2FPYA 4JTKA 2FTPA 1B4EA 3QW3A 2CW6A 1YXDA 3OIXA 2FIQA 3W7CA 1LBMA 4M19A 2ZTJA 1H50A 5C5YA 2ZZ3A 3R8RA 3GAKA 4NJIA 3NL2A 4HPXA 3SGUA 3TROA 5HWJA 1FQ0A 2EHHA 4O0KA 3W2NA 4K8HA 3TSMA 4BI7A 1TPVA 1UUMA 4MVAA 1TJPA 3R13A 2X30A 4L4MA 5CKSA 3GK0A 3UYCA 2QKFA 4UTTC 4DBDA 3FYOA 5A8GA 4QAIA 1VHCA 1RVGA 5U4NA 4K7VA 4LC6A 5U7SA 5C2XA 3GDKA 2CU0A 1R30A 4PA8A 1I2NA 3NNTA 2I1OA 3HJZA 4RZ4A 2XN0A 3CC1A 3LXAA 1LRNA 3CPRA 3DI0A 1G4EA 5CZJA 5HULA 4JTJA 4MZYA 3HG4A 4JY9A 1OHLA 3STEA 1H7XA 1F73A 4A2RA 1T8XA 5TIMA 1XXXA 3RU6A 1FCUA 5GVJA 1QAPA 2A6NA 3TSBA 3LHZA 4MZ8A 5CPMA 4UTMA 4OV9A 3TW6A 4EVZA 3H53A 1HL2A 3MI3A 4JIPA 1Q6OA 3BW2A 3E49A 3RK8A 2OX1A 1OFPA 2A7PA 1ZCOA 3DKLA 3L5LA 1ME7A 1FWRA 4G1KA 4Z0SA 2E6YA 3VE7A 3N3MA 2DU2A 4RXFA 3LCXA 4AWUA 2BWGA 2W79A 3T4CA 3GDMA 2NV2A 1FCVA 3B0VC 4UMCA 1G6CA 1SO5A 1LRTA 1YDOA 3QJAA 3IIPA 2GPTA 3IRDA 4CQAA 3M41A 4KFPA 4MYXA 1UCWA 4DBEA 4I7UA 3MW7A 4IGHA 3BGJA 1YPIA 3LV6A 1ZAHA 5LSMA 1W54A 3E0IA 3N9RA 1PL9A 2YSWA 4Z0JA 2I9EA 5D2VA 2XN1A 1ICPA 5HWMA 2JKAA 3TFXA 2H8XA 1L6WA 2AQWA 3TC6A 4AXKA 4O53A 1NVMA 3L5MA 1J2WA 4ALDA 2Y62A 3STFA 3HB9A 4N9EA 4FIQA 5FF7A 1T96A 1X1ZA 6TIMA 4GWEA 4NJHA 3KHJA 3HGSA 4K37A 2JKPA 1D3HA 5FF2A 3EX2A 5I3GA 3WJYA 2CZDA 3B4UA 1L6YA 3IV3A 3HPSA 4NNCA 4GFSA 3G1HA 3UY7A 2Z6JA 3MYPA 4JXCA 5HR7A 3DHDA 1PIIA 4FXSA 1KM4A 4WJEA 1KBIA 3TR2A 4HNTA 5FI8A 5AC8A 4MFDA 4RJEA 3LBMA 4YL2A 1L9WA 4JGDA 3HGRA 3EX3A 4TIMA 1H7NA 3NPVA 4UCGA 3ZS4A 2OCZA 4KWWA 1W3NA 2BXVA 4S2CA 4IJBA 3KVMA 3B0UX 1LM1A 5AB3A 3L0GA 2H3DA 3LCFA 5EMUA 1H7WA 2A6LA 2DZXA 4EIVA 1K8ZA 1KM2A 3I68A 3UD6A 3UXDA 3G1VA 5G4WA 1WA3A 4QNWA 4DF0A 5K9CA 4PFMA 2V2DA 4O1DA 3M6YA 1F6KA 3PWAA 3PBWA 2PC4A 3NAVA 1LORA 1H63A 3UPBA 2B4GA 1TPWA 5HINA 5DLCA 4JTGA 4N4QA 3HOJA 3KFTA 3AJXA 1H7RA 1A5SA 1OF8A 3SFKA 4DEFA 2CLOA 1PE1A 1TTQA 2GJLA 3S1UA 3WK1A 3A5VA 1HUVA 4BWLA 2NXHA 3ELFA 4ZVJA 3MHGA 3THAA 1MSSA 1H1ZA 3TH6A 4N2YA 3W7IA 3O16A 3N2MA 1GWJA 1F2JA 5EA9A 4M7TA 1F76A 1OFEA 1YTEA 1VH7A 1IXNA 3BGGA 1XDMA 2QR6A 4RV8A 3PUOA 4UUIA 2P0OA 3OA3A 3K30A 3M7WA 4HNNA 4IX0A 4RR4A 3USBA 4UXDA 1GOXA 3GR8A 1SPQA 4X3ZA 3M1ZA 3FA5A 2WNNA 4JTLA 4UTHA 3FJLA 3W22A 1LTDA 2ZBTA 4QITA 2BZNA 5G5IA 4OBTA 2ZCGA 2CLEA 1U5JA 2VFDA 3ZFHA 3IIVA 1P4CA 1EP2A 1VR6A 4AH7A 5HUOA 3HG3A 3P81A 5CSSA 4CNNA 4ZMGA 3TAOA 2YR1A 4W9TA 2A4AA 3S8HA 4RK8A 3H55A 1YXYA 3FKRA 3LB0A 5MHBA 3QPYA 3W70A 2GQ9A 3NQ8A 3W87A 2R91A 1ME9A 3P5YA 1F74A 1Q6QA 3S1XA 3ZR4A 3TJXA 1GVFA 2EPHA 2G95A 2J88A 2CWNA 5FEZA 3PUDA 2P1FA 4GC4A 3GDRA 3M9YA 1FCQA 1O95A 2RH9A 4EOUA 5K7JA 1HO1A 1KFBA 4ZL1A 1LROA 4N6FA 5EY5A 4DPQA 2NXGA 2YYUA 4ZQRA 3LTPA 4AWTA 3G1DA 3NR0A 1PV8A 3VI2A 3TMLA 5EL1A 3C61A 2ZZ7A 4OE7A 4N9BA 1VCFA 3W7DA 2RDUA 3S1WA 3N14A 1G7UA 4NZFA 5FEWA 4RX0A 4LW7A 4TU1A 1VS1A 3LOTA 4B5NA 5J5RA 4UTUA 4M5PA 4UFMA 1QPNA 4JTFA 1PHWA 5AN7A 3PY2A 2Y7DA 1A5BA 3W73A 4KWVA 4AB4A 1MO0A 3M5YA 3LCHA 5BMXA 1A5CA 3KVLA 4OV4A 1FXQA 3M47A 3NQEA 3P60A 2Y6ZA 1HFBA 2G97A 3GLCA 2J27A 4IPIA 1FY6A 4K39A 1K3UA 1ZAJA 5DBTA 5D2TA 4YLWA 4Y9AA 2OJPA 4GE8A 1JCLA 4XBKA 2OT0A 1WX0A 3CWOX 1RPXA 2X1UA 3TJLA 4JIQA 3BPWA 3HPXA 4O19A 1TQXA 3EWZA 4JR5A 4LUJA 1H7PA 1TV7A 1Q45A 3PSVA 4S2BA 4O52A 1RD5A 4MY1A 2Y7FA 3B05A 3L68A 4JNMA 3GXTA 1HG3A 1B4KA 1A5AA 1QMLA 2H8ZA 3MP5A 1KFJA 1I2PA 3ANYA 4M6VA 1TPUA 2ZQ0A 3QZEA 3JR2A 2WSQA 3C52A 4RCXA 4DQWA 1XBYA 4FHAA 4X9SA 5F2GA 2DORA 3UNDA 4GBUA 4Z1CA 4WXZA 1S5VA 1G4TA 1VLWA 2ZZ2A 2W6RA 5DBUA 4HNUA 1LP6A 3BK0A 3W1QA 3NEVA 3N2XA 1VYPX 3L2IA 5I3KA 4EF9A 4UC5A 3P8IA 5K4ZA 1B9BA 4IQLA 2B0MA 4XTDA 3A24A 5AHNA 4IUOA 1G67A 2QJIA 1JCJA 1KFCA 3B04A 4OT7A 5BRBA 3G0SA 1SZGA 5G2WA 4BF9A 3L67A 1P0KA 3EWUA 2DZWA 4POCA 1SO3A 3TUUA 5HQEA 3P82A 3C2FA 3QYQA 3GIYA 5D30A 3FEMA 2WO5A 4ICNA 3NQAA 1QWGA 1XC4A 5C54A 4JYFA 5CPOA 1TPDA 4K6AA 3GKFA 3PBUA 3O6YX 4WZHA 2DJXA 1L2UA 3LDVA 3D0CA 6ALDA 3MJYA 4UMAA 2FPTA 3W23A 4UR8A 3T55A 3OBKA 1MEIA 5LZLA 4ZQNA 1M7PA 1A50A 3ATZA 2ZDRA 3G3MA 1TRDA 1W37A 2HSAA 4XWUA 3QW4B 4K8EA 4NZJA 1KM5A 3AO0A 8TIMA 5D2XA 5KZMA 1RR2A 1TSIA 2QDHA 3B06A 4O1AA 4MLJA 1Z48A 2J9YA 2YFNA 5EYWA 4FB7A 3I7SA 4PEKA 3EXSA 1SFJA 4JX4A 4LVAA 4Z1BA 3NZ1A 1WAUA 4JY8A 4AF0A 1PVNA 1VCGA 2NWSA 4QQ3A 1TRIA 1YDVA 1KTCA 5G2IA 2Q8ZA 1GG1A 1WV2A 5C6MA 2G96A 4N9CA 5LKYA 1OX4B 1QOPA 3W1AA 4Q33A 2GUUA 3EX6A 5TQLA 2NV1A 3NPWA 5F2IA 2X1RA 3NL3A 1NEYA 3OVQA 2WSRA 4UTLA 5IM51 3YPIA 2OT1A 2VC6A 1LDCA 1S5TA 3M16A 4PL2A 3IEBA 3FOKA 3TX9A 3L5AA 1WYIA 2F7FA 4JD4A 1ALDA 1ZHAA 3P62A 3PG9A 4D2JA 1ZFJA 2P10A 1V7YA 1IXPA 3IIXA 3L0KA 3QMSA 4NNAA 5CPLA 4BK9A 1W5OA 3SJ3A 1Z42A 1LOLA 1BEUA 2ZZ1A 3GDTA 2ABAA 4ONVA 1E51A 4PODA 2V5LA 4C1LA 3EWBX 3QPZA 3RMJA 3L9CA 4LVDA 2H3BA 3QFEA 4UTWA 2TPSA 3R5EA 4ADSA 2YGYA 1VYSX 4BFAA 4O50A 5HNRA 3MI2A 3M5ZA 1RZMA 2C16A 5CG7A 3O05A 3ABQA 4JYDA 1JR1A 3C2EA 4A21A 3T40A 2VEKA 1F5ZA 1EP1A 1WOBA 1TIMA 2JGQA 3LXCA 3RF9A 4UFJA 4E2DA 2FJKA 1OVDA 1ZALA 2HS6A 1EA0A 1LOSA 3KRSA 2H90A 3W7KA 1W5QA 1XUZA 4IMCA 2Y61A 2PCQA 2PURA 4NJKA 5I3JA 3HO8A 1VYRA 1H61A 1FCBA 1K7XA 1WQ5A 3S42A 3PVFA 3W88A 1SO4A 2CLLA 1UASA 3HPZA 3PM6A 3S5NA 4UFLA 2J24A 3E9AA 5DY3A 2VELA 2E5DA 3KVKA 1KFLA 3RLUA 3MBFA 3KX6A 4PL1A 2GQ8A 2YFOA 3W1MA 5FEPA 1IF2A 2GOUA 4N9DA 3F03K 4DPPA 2YYTA 3G3DA 1A53A 1EWDA 2Q3OA 4MYAA 3QSRA 1XDLA 5CZSA 4FXRA 4YCOA 5G1TA 3I6RA 1OX4A 1J4EA 4ZQPA 3DKJA 1RV8A 1XFBA 4OWGA 4FEZA 3P80A 1ADOA 3GKAA 3EXTA 1TPC1 3C56A 4A3UA 2ZRZA 3S5OA 4ORMA 5HJLA 2WSYA 4BWLC 3TU9A 3QM3A 1QCWA 4MIMA 1SSGA 4LV4A 3NQMA 5SWUA 4TO8A 1OX5A 1L6SA 1QPOA 1X6UA 3IGSA 1W5MA 1TPEA 3LXBA 1O5XA 1W5NA 3TA6A 3TAKA 3W2KA 2ISWA 4FIRA 4UTJA 5FEXA 4JX5A 3I7RA 3C4UA 3A21A 4M6PA 1DL3A 3WK2A 2CLHA 2C18A 3GVGA 5I3IA 4LUIA 3W3OA 4AHQA 3EWYA 4X22A 1O94A 3CEPA 2X2GA 2QUTA 3BLIA 4O4WA 3NG3A 5G4EA 2A7RA 1THFD 4AWSA 1JUBA 1R2TA 1QDSA 4IX2A 2E5CA 1MEWA 3O6CA
chains in the Genus database with same CATH superfamily
1ZJAA 4WLCA 6REQA 4I3GA 3Q67A 1DJYA 4YIWA 1FVPA 1QW7A 3SY8A 1OADA 1VF8A 2TYSA 1I1WA 3THDA 3KVJA 1E0WA 2G5WA 4MAVA 1A0CA 1G7VA 4D1IA 3NEHA 1I8JA 4KIRA 3ZLHA 5JBEA 2GJXB 3L2LA 4Y9OA 4W7UA 1K8XA 5CLTA 3S5YA 3NM1A 4J3TA 4GX9A 1UKSA 2W91A 1KM1A 1JULA 4W7WA 4UTFA 2DVUA 1DIKA 1LBLA 1ITQA 4DELA 2WVTA 4CLMA 4PGLA 2YA1A 5EGRA 1TV8A 2EBNA 2VEPA 2F84A 1OYAA 3L4WA 3CS2A 3PPGA 5G1YA 1UKOA 5FF4A 3SGZA 4X0NA 5KETA 2W66A 4MPKA 3LPOA 3O7UA 3CLMA 4DJED 3K4DA 1V3IA 3UWWA 3W1RA 3AIEA 2ZADA 7CGTA 2YZRA 3DERA 4FNSA 5DMNA 1JDCA 4UBPC 4FA3A 2E9LA 4C1KA 3KEHA 4LEQA 1R85A 5B7YA 1W31A 4Q8VA 1MVYA 2O9PA 4PMJA 7TIMA 3O07A 4IT1A 4NAEA 5LHEA 2X09A 2ALRA 2PGFA 5CCZA 2IMRA 4KH2A 4WKFA 2X7WA 3BW4A 2GGIA 2E3ZA 1QPKA 1XRFA 3WH7A 1KKRA 5D02A 3NZRA 3BSGA 3REQA 5AYYA 4LY8A 3S6DA 1A3HA 3UU0A 1VBHA 1W1IE 2QCCA 1KGUA 4S3GA 2QGHA 1W3TA 5ABFA 3ZMRA 2C1HA 2JIWA 3LD5A 2B7PA 3GUGA 1NM9A 3E5BA 4BHYA 3NPUA 2VZUA 2BTMA 2BHYA 3T81A 1V0MA 1UD4A 3WDIA 3BSHA 4FF5A 1MMFA 4GXMA 3TNBA 3SUWA 2HS8A 3DHFA 1P0BA 4S23A 5TBOA 3SY5A 2FH8A 4Q4PA 2J6VA 1TREA 2V3EA 3FEQA 2CZVA 3O0KA 3SRKA 2E67A 2ZXAA 1BVNP 1ZY9A 5F4WA 1R6WA 1GEQA 3GY1A 4E3VA 3ANVA 1HGYA 1NOUA 3L4UA 4JDYA 5L6UA 3GG1A 4Y6GA 5IDIA 3UXAA 3TC7A 2DV0A 3QV9A 5FF3A 3VGGA 3KXQA 5TF0A 4LQ1A 1LWIA 3GU9A 3TQVA 5D9NA 3ATYA 4ZQOA 3QMTA 2E68A 3CTTA 3H21A 1GVYA 3UETA 1KTBA 2QF7A 2PDJA 3FS2A 2V9DA 2YDSA 4DAIA 3LLFA 3ARRA 3HFTA 3A64A 5K2ZA 3INPA 4QEHA 4AZGA 2ZXQA 3GUWA 5LA2A 3WLKX 4ZO8A 5JMUA 3W1PA 3GZAA 5H8PA 3A3XA 1J6OA 1NSJA 3B9DA 1P0EA 3QSTA 4UOZA 1KGXA 1KNWA 4JHOA 3CUFA 3HIJA 3AMCA 2WQPA 1EC8A 3WF4A 1VLIA 2CLFA 1ZAIA 3QOMA 3WUFA 5E0FA 2QUVA 3QRHA 3C86A 2QJGA 2F8QA 1UKPA 2Y85A 2EKGA 3BMVA 2XINA 3F4WA 3R89A 2VC5A 3BG5A 4L56A 2VFFA 1FWSA 1TTIA 3EMQA 1ONRA 4DY1A 3TKFA 3PHAA 1UR0A 1X1NA 2A1YA 1XKYA 2Z2BA 1JUEA 1Q6RA 3JW7A 1GOIA 3ZXWA 4KGJA 1KM0A 1J0ZA 4US5A 4QRNA 4YTSA 3MSGA 3W7HA 5ECVA 1ZTVA 1CECA 1Y5WA 2WSKA 4WGHA 1HN1A 3DFNA 3CL6A 1K1DA 1XYZA 1K4HA 5CBJA 5GNXA 1ML1A 3E12A 4XIMA 1P7TB 4M3PA 4MB1A 2OEKA 2VEIA 1QOXA 4RE2A 3LI0A 4H9VA 2Z2UA 1EL3A 3BC9A 3EB2A 2VGIA 2Y7GA 3W2MA 3W25A 2DUZA 1EOKA 1A0DA 2IPGA 4DJDA 3LM7A 3VDBA 4LV9A 3EWXA 1NWTA 1GVQA 1OK4A 1XH2A 4W8BA 5E09A 3O2LA 1E6PA 1FHVA 4NXKA 3FCPA 1E40A 4JTAA 1K03A 4DM2A 1IGSA 3LV5A 5TD4A 4YHGA 3G77A 1XPYA 3PPCA 4L4LA 4H6RA 3JVAA 1TMLA 2OX4A 3CIXA 4J5NA 3B8TA 2QQ6A 4PMOA 1DHKA 4F0MA 4YS1A 4IMDA 4MDPA 1AW5A 1OC7A 5DT7A 1NWRA 1DORA 1XQKA 4C60A 1QI3A 4CCDA 2AGKA 3MP4A 3M0MA 3SI9A 3TQ0A 3CUJA 2D23A 4JNYA 3VKDA 2V81A 3P84A 5BOEA 2FVKA 1JDEA 1GTEA 1QXLA 3WQGA 4QG8A 4D8AA 3CQ0A 2XJ7A 1JUKA 1B3VA 3CUZA 5AHEA 4B9YA 8XIMA 1XYAA 2WMJA 2E09A 3DG3A 3TZFA 1I9CB 3U8GA 1VD6A 1W2VA 3LBCA 5JQ9A 4O16A 2W62A 1ZJHA 2J4GA 4AEFA 3WQEA 4NX0A 1KXHA 4UQBA 3E02A 3N19B 2ALDA 3PZUA 4A8IA 2YX0A 3V0TA 1QHPA 3BAKA 2UZ9A 1DJHA 1SFLA 4ZTYA 5J5DA 3BL3A 1DIEA 4E4UA 2EPMX 3G18A 4XD4A 2XN2A 1XRTA 4UNLA 1DQXA 3P67A 1XYCA 4HKPA 2DW7A 3AUJA 4H8HA 1SW7A 3G1YA 5C71A 4NNBA 3W6MA 3B8DA 3EOUA 4I8DA 4LVBA 1VAHA 3QF0A 4OZOA 4GVHA 3TXVA 4Q3MA 3BV7A 1T0OA 3SRHA 3V0UA 2EG7A 4DIAA 4M8UA 1YYAA 2RDWA 3NOYA 1CYGA 4PMVA 1UQYA 1M68A 3BLEA 4GJ1A 2JFEX 1VFHA 4LUSA 1XHGA 3CAQA 4DZHA 3QOKA 4ATLA 4YVPA 2PEVA 1UZHA 1FTXA 2VFGA 4A22A 1UHVA 4NZ3A 1POJA 3G1SA 1Q3NA 2DSUA 3QPEA 4WXYA 3QQ1A 4CEUC 4GK8A 3BTNA 2Z1XA 4XZHA 3KCJA 1X6LA 1OQFA 4NL1A 4H2HA 3R6IA 3SRDA 1Z9AA 4UCFA 1B9ZA 5FAJA 1YPFA 2VD8A 3FGCB 3G0XA 4GNJA 2ZUTA 1PTAA 2O92A 4Q22A 3OVGA 4GUIA 3NVTA 1WZKA 2EAWA 1A0EA 3THQA 2XH4A 2PWGA 1XLGA 2VP8A 1EPVA 1MFVA 3PZGA 3H8AA 4O57A 3NCOA 3PWGA 4D9PA 4WY0F 4JQAA 4D6HA 1FWBC 4Q8PA 1S2VA 3OYXA 3NPXA 1S5WA 1JXKA 1XG3A 3M0VA 4Y2WA 1TFVA 3AYTA 1W1PA 3MANA 3ITYA 1SZNA 1A5UA 1ITXA 3GTXA 1K6WA 5T8GA 4A2SA 1UH4A 3CMFA 2WCSA 3GDLA 3ZSTA 4S3EA 5DRIA 3W7JA 2QEZA 3USZA 3W76A 4LB4A 3W85A 3VD7A 5I09A 3PUEA 1Z3NA 4HHHA 2PS2A 1XBZA 1P6BA 1YE4A 1ZJIA 1U2YA 3NL5A 1R3SA 3HU7A 3C2RA 1CI1A 1IV8A 2DT2A 1C3FA 2AQOA 2OGJA 1PKLA 1TIWA 1JCXA 1YTKA 3F4NA 2ZUVA 5K9DA 5XIAA 3AS0A 3CUGA 3GNNA 2OOGA 4EXAA 4CNUA 1IHIA 2J7CA 3STGA 2Z0IA 2ZRVA 7XIMA 4QDWA 1AQFA 5LIKX 3IGXA 3AC0A 4IISA 2DPEA 5AHIA 3KWXA 2QIIA 4DYEA 3GHTA 1GJPA 1UPMB 1KKOA 3BLLA 2WKJA 1BQGA 4LWWA 1BWLA 3NJ3A 4LANA 1LWHA 1TPB1 5FACA 2IKIA 1XLAA 1QNOA 1ISWA 2A3BA 2D20A 3CWHA 3SCNA 5FJUA 5HANA 1DJQA 2FGBA 4AAJA 1DIDA 4LH8A 4EAMA 3B8WA 3FA3A 1RJQA 1SU5A 1YMYA 3CMGA 2PE4A 4NX5A 1KLYA 3ZJ6A 1LUCB 3VIOA 2REQA 3Q37A 2CITA 4H9XA 4AW7A 3VNYA 1XSIA 1TWDA 3EAUA 1RA5A 3D6NA 3BLDA 3LHVA 2DVTA 1FWCC 1H60A 4WY0A 2FZ9A 1EEPA 4C91A 4QFUA 1OSEA 1C8VA 1OINA 3BLOA 2EKCA 1US2A 1S3HA 2ODOA 3IGHX 4D6IA 2HK1A 4FNPA 4HK7A 3PC0A 4C6EA 3GNDA 1O66A 2CCRA 3UT0A 4LVFA 1IEQA 4WDUA 1XBXA 3TYCA 2Q01A 1HJWA 3VGEA 4K38A 2QUUA 1B5TA 2IQDA 4Q32A 2Y70A 1ZSXA 2C13A 4EF8A 3SFWA 3W6YA 3MKCA 3EX4A 1W1YA 2NX9A 1GQIA 4DJDC 1MUWA 1I0DA 1XIIA 1GYMA 4W84A 2BXYA 3B03A 2HROA 2Z25A 1E73M 3GE7A 2IUZA 2NV9A 1GHSA 2D73A 3VC6A 3PF3A 1M6JA 2YXGA 3DIPA 3R1ZA 2DVXA 3RG6A 3AHZA 3V4BA 5EMYA 4M24A 3KCOA 3NQBA 2ABBA 4DUVA 2RJHA 3GR7A 4A6GA 2ISVA 2NQHA 2E25A 1GQLA 1XL9A 1HP4A 2BASA 2Q02A 4LPCA 4OU1A 3UXLA 3DOPA 3PULA 1PTGA 1M53A 5JBDA 1UYQA 1J0KA 5EMLA 1TA3A 1R5YA 3MHFA 4REQA 1EQCA 4XVDA 2B7OA 2BOGX 5CH9A 4DF2A 3KBJA 5HA7A 2PP3A 3SY1A 5FJOA 3R8GA 2PDIA 5CGQA 2ZZ5A 3ONBA 4AD1A 3TXZA 2ZXDA 2P76A 3ZVHA 1S46A 4B5SA 4RW3A 2X41A 1TV2A 1R86A 1KGWA 3OVRA 5F4SA 3SADA 1NIUA 4LCQA 4L1XA 3ABOA 4LAOA 1GORA 1X1OA 1QPQA 3OGVA 2HMCA 3NO3A 4IL2A 5A5WA 4OOZA 2CLIA 4FX6M 4O1EA 3TWAA 2FH6A 2OZ0A 2WPBA 1NF7A 3UWVA 3S4TA 2HQAA 4EXQA 4LYQA 3W9ZA 1VPXA 4NIRA 1M01A 3KTCA 2ZX6A 1BKSA 3NQCA 2PP1A 4LOCA 3IVUA 3RRAA 2EXOA 4Y96A 1GUVA 5A2AA 3PBYA 1ZBVA 3EPMA 4I5XA 1UR3M 1V79A 2DZTA 2J7EA 2O56A 3T8QA 1SYTA 3I7QA 2V5DA 1WKFA 3BJFA 2CPUA 3VE9A 2EPOA 3U5YA 3T0TA 3DECA 1M03A 2Z4GA 1F8MA 1G1YA 2QAPA 2FZBA 4UQEA 2CXGA 4IJCA 5F7UA 4O18A 4JTEA 3ZJ8A 7ENLA 4R85A 1CW2A 4XBSA 2PRLA 3ARVA 3QC3A 1PCKA 3WY1A 1KBKA 3OW1A 4PUWA 1K7FA 4HPHA 4LS1A 1UD2A 2VHLA 2BY0A 5F4XA 3LQLA 1B4EA 3QW3A 2CW6A 3OIXA 4Q8UA 1CDGA 2FIQA 4Y9MA 2OFJA 3W7CA 2FZDA 1SMAA 1X96A 4NJIA 4TQTA 3SSZA 1FQ0A 4R9XA 3C5QA 1SJBA 1H3GA 1UKQA 1OZMA 4LCSA 1XINA 1ZCCA 1JGIA 4HNLA 3LQGA 4MVAA 3R13A 4ZB2A 2G4JA 3TN5A 3FYOA 1IYXA 5A8GA 4QAIA 2PDKA 1VHCA 4LC6A 3GDKA 2X05A 3WQ8A 1I2NA 2I1OA 4RZ4A 3B97A 1RBOB 4JTJA 3SUUA 4MZYA 2WBGA 4JY9A 3STEA 1H7XA 1QRQA 4FR1A 1GCYA 2P3EA 1DP0A 5CC6A 1QAPA 1HIZA 3UEQA 1DQUA 1ESWA 5A8PA 3RM8A 4HB7A 3AS3A 1NELA 1XIHA 4RDVA 4EVZA 4A3YA 1HL2A 2O4MA 2VX5A 1PAMA 5I07A 1OFPA 2A7PA 3L5LA 2YA2A 2ZX9A 5A8OA 2UY4A 3II1A 4JKKA 4L4PA 1XYBA 3RCMA 1F07A 1G6CA 1SO5A 1YDOA 3QJAA 3IIPA 2GPTA 3IRDA 2OSYA 4YYFA 2DUXA 1EJVC 3VDGA 1JI1A 1VFSA 1KCXA 4DHGA 1I0BA 3MW7A 3ALGA 5CC3A 4Q4SA 3CZJA 1YPIA 4JPGA 1PIGA 3MJMA 1PL9A 1TZ9A 2D3LA 1ICPA 2PGEA 2H8XA 3KW3A 4C6FA 4UZSA 3BCFA 4AXKA 1E15A 1NVMA 7REQB 1J2WA 2WSPA 4J28A 1NU5A 3STFA 2INZA 4N9EA 1P43A 4FIQA 1X1ZA 1PO9A 3ABXA 1QNQA 4ACZA 5I3GA 1CXIA 1JYXA 1BXNA 2WC3A 2OPJA 1SFTA 4I9TA 5RUBA 3G1HA 1RK6A 4G8TA 5FA5A 4FXSA 3OPSA 3RLHA 1KM4A 1JPMA 4F2TA 4MB4A 4WJEA 3TR2A 5FI8A 1HT6A 3GHSA 1U1HA 4MFDA 5HPCA 4RJEA 2PDUA 5FKYA 3OLIA 3S1GA 4IGNA 3ZS4A 2OCZA 2WMKA 4KWWA 1OCNA 3VGFA 1EZWA 4A05A 3T4WA 3LEPA 1UA3A 3M0YA 3M46A 3L0GA 3NFUA 5IDZA 1J79A 2PPGA 5EMUA 4P7LA 1XICA 2E40A 1PDZA 1KM2A 3UD6A 4QJ3B 5G4WA 4DF0A 5K9CA 5CPTA 2V2DA 4FLRA 1F6KA 3PBWA 1RAKA 3W4RA 1LORA 4JIHA 3UVAA 5DLCA 4JTGA 2PWEA 3KFTA 3CZKA 2OXNA 3SFKA 4G6CA 1XR2A 3FAXA 1TTQA 3MWCA 2DT1A 2E9MA 4F0RA 1HUVA 3ELFA 3EDDA 3THAA 1H1ZA 1FRBA 4NASA 3HJEA 3VNJA 1JI2A 4MWAA 2WK2A 2QT3A 1F2JA 3QLDA 5EA9A 1YTEA 3UJSA 2J47A 4PMZA 4DWSD 1XDMA 1YW1A 2QR6A 4RV8A 1Z32X 4HNNA 3M7WA 3A47A 2BS9A 3USBA 4UXDA 1KXQA 4IIGA 2GYIA 4OIFA 4AYGA 3HPFA 1JZ2A 1AZ1A 1XC6A 4UTHA 3W22A 1LTDA 4O1FA 1OIFA 1NP0A 2VFDA 2F2HA 4AH7A 3CQJA 3HG3A 3FAWA 1MW3A 2NVAA 3H2OA 3BLKA 4BY3A 3S8HA 4RK8A 1H41A 4CU6A 1YXYA 3FKRA 3AFBA 5MHBA 2DH3A 3E3HA 3AYRA 3OGSA 3PZTA 3B3DA 3WBYA 5ECUA 3NQ8A 3W87A 3DC0A 4IG2A 1ME9A 2XPKA 4C1NA 1F3TA 4OVXA 3GHRA 4ICMA 3ZR4A 3TJXA 3AWOA 3BXWA 2D24A 1VPQA 4GQGA 3QHMA 3GDRA 1XLCA 3AXMA 1VRXA 3ZR6A 4D1JA 2J74A 4ZQRA 4E4FA 4AWTA 3VI2A 3NR0A 3C61A 2GSJA 4OE7A 1Q4NX 5MKGA 3P2VA 2BGSA 4NZFA 5FEWA 2OKTA 4E2VA 4RX0A 5HXMA 4DXKA 4GMEA 3MMDA 2QVHA 3LOTA 2ZX8A 1O5QA 4M5PA 5BYWA 4AB4A 1AH4A 3LCHA 3KVLA 1FP9A 3N2CA 2G97A 4DN1A 1FKWA 3GLCA 3K2GA 4HN8A 5CEWA 4LNCA 2NSXA 4L61A 4X0VA 4YLWA 1SFSA 3T05A 4GE8A 1JCLA 1DYSA 4P5UA 1OGBA 4URIA 5DFAA 3ITOA 4IP7A 3SDOA 1G0CA 3HPXA 4WEVX 3RGTA 5A69A 1H7PA 3E0FA 1Q7ZA 2WMHA 4IFRA 4CUCA 2XIOA 3N4EA 2Y7FA 3PP7A 5CLWA 3B05A 4JNMA 1NOWA 3GSMA 1HG3A 3UCCA 2H8ZA 2R82A 5CBBA 1A5KC 1S5NA 1TPUA 3QZEA 3NYDA 4HCDA 3C52A 3KUMA 1YBQB 1XBYA 3DX5A 3HZ3A 4F8XA 1FH8A 1QU4A 4Z1CA 1S5VA 1VLWA 2W3ZA 3M7SA 4LJ3A 3L2IA 5DRCA 4UC5A 3P8IA 5K4ZA 3WNOA 2F6XA 4AZ5A 3A24A 4IUOA 1G67A 2I7GA 4QJ5B 4OT7A 4AVNA 5G2WA 5GNZA 3SCUA 1ZPTA 1P0KA 3EWUA 2DZWA 5FJTA 4XKMA 1XDJA 5HQEA 3C2FA 3NQAA 3PZMA 2PDBA 2A3CA 4WZHA 2DJXA 1XIDA 1NJJA 1L2UA 4PBFA 1UWUA 1GHRA 5A6BA 2XSXA 2D0HA 3WNLA 3T55A 1KQYA 1HKVA 2I5GA 1M7PA 4M56A 2Z1VA 4UQDA 3V35A 1YDYA 4WKHA 1TRDA 1W37A 3QYSA 4M0XA 1TZ7A 1WDPA 3CUIA 1KM5A 3AO0A 8TIMA 4RPQA 5KZMA 3EKGA 1TSIA 2QDHA 4LF2A 2AAAA 4PEKA 1ZL1A 3BOFA 4D6FA 1J11A 4JX4A 3CZEA 3TN6A 1XIMA 2GGGA 1LL6A 5G2IA 1GG1A 5C6MA 1QOPA 2GUUA 1Z7AA 4XZBA 3VO0A 3TN3A 4NP7A 1S3TC 3E1F1 1E3XA 3CAWA 3SCQA 2XISA 1NP2A 2WSRA 5GJNA 3YPIA 3GC2A 4DNHA 1LDCA 1S5TA 3FOKA 3TX9A 1SR0A 4JD4A 1ALDA 1KRMA 5CG0A 1Q7MA 1UH2A 4OBRA 3CQIA 4Z17A 2WHMA 1XLFA 2P10A 1ODZA 3CK5A 2YA0A 4NNAA 5CPLA 3SJ3A 1BEUA 3GDTA 4J3WA 4GY1A 2ABAA 3APGA 1ENUA 1V02E 3RO8A 3WQOA 3L9CA 1VYSX 4FSAA 3ITCA 2NQJA 1LQAA 2QW5A 4ACYA 6REQB 3R11A 1H0IA 3LMYA 1JR1A 3M0XA 1VENA 3RPMA 4S3KA 2Z00A 3LXCA 4NYUA 4E2DA 2FJKA 1ZALA 3KRSA 2HE5A 4L64A 4NJKA 1IZKA 1NFPA 2AGTA 2OYMA 3QBUA 2X0SA 1VYRA 2DFAA 1NOFA 1DJWA 5IFTA 1K7XA 2C1IA 2ZUUA 2CLLA 1EF2A 3U7VA 3FXGA 4F0KA 1I6NA 3N11A 2J24A 3WD3A 5FAGA 4QTGA 4U31A 2R9RA 4HA0A 2E5DA 1CGUA 3TVAA 1J12A 2HPIA 1FHUA 3RLUA 3MCOA 5HATA 2YFOA 5FEPA 4TV6A 5IRPA 2Q3OA 1QWKA 4MYAA 3H7UA 1MW0A 4YCOA 4GY0A 1R8LA 2ADAA 1OX4A 1J4EA 2J8TA 1RV8A 3OIHA 4FEZA 4WF7A 3GKAA 2OR2A 3XISA 4A3UA 3UF9A 2ZRZA 3S5OA 4AFYA 1UROA 1OC5A 4NZ4A 2EPLX 3QM3A 1QCWA 3F7JA 2ESCA 5H6HA 3ONCA 1EC9A 3AQUA 1OX5A 1UMLA 1QPOA 4MWAC 4JQ1A 1W5NA 3TAKA 3ZM8A 3SN1A 5LA0A 1QTWA 1RP8A 4L6DA 1JYVA 2GGEA 2OZ3A 3P6LA 4JX5A 5IXEA 3A21A 1CB7B 4XBJA 4JHZA 2CC0A 4CNSA 4V27A 5I3IA 4BEQA 5CAKA 1PJ9A 2G3MA 4AHQA 4NG3A 4B4FA 2GOKA 4B5UA 4AD2A 1WUEA 2HNEA 4AISA 3W00A 1QDSA 4KQNA 2HE8A 4IX2A 4H9MA 2D3NA 4GXWA 4HU3A 3T8LA 3VFLA 5ABFB 1UR8A 2XVKA 1D3GA 4HBKA 1PDYA 1O6IA 2VXNA 5KINA 5C7HA 1IEIA 2HISA 1CXFA 1O5KA 4F9JA 3CL8A 5BXPA 1OABA 1SJAA 1O1ZA 1OYBA 3VUSA 1OF6A 1XSJA 8CGTA 3EXRA 1V51A 3N2BA 4WUIA 3C0JA 4G5DA 1VP5A 2AKZA 3L21A 1L8NA 1OT1A 3AHTA 5M5DA 3WFLA 4CD7A 5A3HA 3G1AA 2BOFX 2JGYA 4BJHA 1JVNA 4PTWA 3S6OA 3UR8A 1HL9A 5CSRA 1EF3A 3W72A 3FVMA 1NF0A 5ENLA 4OUEA 3AALA 1GQNA 4E3TA 1SZEA 4U2YA 5C2GA 3ICJA 3IVTA 1XLHA 2J6XA 1XCXA 2PC8A 2CZ5A 4W89A 2XZ7A 4JYEA 1P0DA 4QCEA 4AC7C 5A6AA 1DQWA 1I75A 4XUGA 2X0YA 5EMKA 1H5YA 3GAYA 5JUVA 1WE5A 3U4FA 4GD0A 3G6MA 3GBEA 1W5PA 1XYLA 1GKRA 1GKQA 2PZNA 2GVLA 3T0BA 2OWCA 4V1YA 4LU0A 1X38A 1EO5A 3LCLA 1UWIA 3S47A 2CIPA 1EIXA 4S1FA 1XF0A 5HMSA 3VIFA 4MNKA 3CGTA 3I3EA 1UD6A 2OLAA 3B9NA 1DE6A 4GISA 2BB0A 2QV4A 4CQ9A 1N8WA 4P8VA 4A8NA 4I7WA 1AG1O 1FWNA 3CHCA 1CCWB 4CEXC 2YBUA 4MF4A 1W1ZA 3HPAA 1HF6A 4GYFA 1K77A 3SR7A 5FJPA 1M9HA 3URBA 3NVDA 3OZOA 1EDGA 4XSLA 4E5TA 4U5KA 1CLXA 5KZDA 4QLLA 3BG9A 4O12A 3KP0A 3TQKA 1XS2A 3H2CA 1UWAA 2VZOA 2PU0A 3C3NA 2JIEA 1AD4A 4KWSA 1ZLPA 5HPOA 4HCHA 3M5XA 4NZCA 2WHLA 5HNTA 5CJNA 4DLMA 3VILA 4NAFA 1Z6KA 2CXEA 2NX1A 1IR2A 1R9ZA 3CQHA 4ORIA 1VBJA 1K8CA 3L4XA 1NQKA 4QJ1A 1FX6A 4GUHA 1H11A 3F5KA 1XM3A 3VOIA 3VK5A 1HKIA 4BQ3A 5CBIA 1TMHA 3B8VA 4KEZA 1T41A 4JFWA 3RJYA 1VJSA 5C9UA 5HR6A 4YU1A 3ZZ1A 3VNDA 3W7PA 1TX0A 3GH7A 2RGLA 3E2VA 4LALA 3L4VA 1KFWA 2W27A 4LBRA 1B3OA 4H6KA 4KEVA 4P61A 5CJ5A 5KTLA 2E4TA 1HL8A 1B54A 3KL5A 3GD6A 3KS6A 5I3HA 3V18A 2FHFA 1KM3A 2OOFA 3U5UA 4MWAD 2CLMA 4ILSA 1LCOA 4P2VA 1DJXA 1KQZA 3DG6A 3M5VA 3NTYA 2RDXA 2PZ0A 3TN4A 5TNVA 1JZ8A 4J2MA 1JEZA 2ZRXA 5AVNA 2PTDA 4K8GA 3H70A 1R3TA 2VC9A 5A8QA 5DMYA 4YTQA 3HA1A 1WXYA 4JZ5A 1TJRA 3AIWA 4CD6A 3CQKA 4R53A 3QTPA 2DIJA 3UJFA 3QTGA 1FOBA 2GJNA 4Y8FA 3V75A 4Z08A 4AVOA 3ZVIA 1IXQA 3GNOA 3IGUA 3FDKA 2J9ZA 2X42A 2XH7A 2PDFA 3WIJA 5I77A 1FWAC 3WDQA 2ZA1A 3VX0A 3W84A 2O9OA 1MZHA 4JKLA 5C8BB 5C9XA 4FNQA 5GJMA 2ZVIA 4EWJA 3PK7A 1EXBA 3LRLA 1TPH1 4D72A 2CNCA 4R7JA 4XX6A 4PR4A 3MT1A 4C5ZA 1Y0EA 5AC7A 2BSLA 1V6TA 4PMUA 3DZ1A 3S2LA 3VM5A 4GNKB 4LT9A 5LXXA 1DV7A 1VJIA 1HO4A 2ZXBA 2P88A 4HHLA 3O3RA 1ONXA 5FESA 1QOQA 1BTCA 3PTQA 3VZYA 2QJHA 2X2YA 4NSBA 2YW4A 1CENA 3G2GA 3ZLGA 3QQWA 4JBRA 4QDMA 4RDWA 3O1NA 3P7YA 4HU8A 3S46A 3WMLA 2ZX7A 3M0LA 2YDQA 4GIAA 3PZIA 4CCEA 3LNPA 3WMBA 1BTMA 5BMWA 3WDHA 3BLPX 2JBMA 5AYZA 3MKKA 5AECA 3GU1A 2BX7A 4WD0A 3WJSA 1GZGA 2UY2A 5FOOA 2Y24A 5HUPA 4I6VA 3U9IA 2INFA 4JTCA 3IACA 3AS1A 3CB3A 2GZXA 4UOQA 4XZNX 1Q6DA 2ON3A 2X0HA 4D71A 4DWSB 2XTKA 4E0CA 1DTUA 1PXGA 4PCPA 5A2CA 1GVIA 1DIOA 1UC4A 4JFTA 3GG8A 4QAWA 2PWVA 5DMMA 3GFXA 1LG1A 1KCLA 2PLMA 1M04A 4XAYA 1REQB 2E8YA 2IXUA 4QNEA 4DBSA 4GVFA 5LGZA 1CXHA 2Z7KA 3PTKA 3WJWA 3QGVA 2J7FA 4RZ6A 3QXBA 4L9YA 1IR1A 4I5UA 3NIYA 3JUGA 4O11A 1NDWA 1GTHA 2CLKA 1R46A 1HGWA 5C0QA 4O1BA 4AU0A 3W37A 2JQXA 4MKNA 4RXGA 4BI5A 4IMGA 2A5HA 3UP8A 6CGTA 3H6OA 2GJRA 2MNRA 3WQWA 3WQ5A 1DJGA 1AL8A 4EWND 1D7FA 4CGTA 4NUWA 5E5CA 3LERA 4L7ZA 3AHVA 2F6UA 1IGWA 3MUZ1 2FLIA 3DU0A 4XTIA 1TCMA 3N73A 4HGXA 2DJLA 3SSJA 4PTDA 3RX2A 4N02A 3F4CA 4Z1YA 1LG2A 2PWDA 1TWZA 4AZHA 1XV8A 4IP4A 1YTDA 1XW8A 2VFIA 4ECLA 1KV5A 3N2OA 4DI9A 4FI4A 1WBJA 3NDOA 5EU9A 2IKHA 3WDPP 4RZ5A 5AC4A 4MZ1A 3UQNA 4ROPA 3AISA 1FXPA 2DZVA 3OO2A 4RL3A 2J75A 3KOXA 1DPMA 1BWKA 4E4PA 4PSPA 4EP8C 4OTKA 3MBDA 4HHMA 4E38A 1TE1A 3WEOA 3UNTA 5I3DA 5ABTA 1K02A 3PJXA 3DFPA 2TAAA 3GBDA 4LUTB 4EACA 2Z2AA 3WN6A 5I06A 1FWHC 1WKDA 3AMLA 5FIPA 1BYDA 3AXKA 2WC7A 3CXOA 1JPHA 4J3VA 4WJXA 1R3WA 4JFSA 1A3XA 4PCFA 1S2UA 3ZT5A 4AEOA 4PRWA 1QO2A 4M81A 4WR3A 3WBEA 2NQLA 3R0KA 3TW9A 4YMZA 1V3MA 1LL7A 1TVNA 2VYOA 2Y8KA 4XKYA 3DBPA 1TCDA 1V0KA 2PMQA 3IJ7A 4GXPA 5EBUA 3EOSA 2HV5A 1ADSA 1TZZA 2CHRA 4WGXA 3QR1A 1KBBA 2W9MA 3KWSA 2VX4A 5AZ0A 3VCRA 1RCXB 4CQ8A 1XH1A 4ASTA 4C7GA 1E6RA 2CHOA 2W5FA 4AC1X 1QFEA 3GNRA 1DXEA 2XM1A 4Z1AA 3QV8A 3W7EA 1V3LA 4KPLA 1ZUAX 3WH5A 3FJ4A 4WY0B 3K1DA 5DT5A 3GDBA 1PWLA 3DGBA 1VJZA 3NQVA 4PUNA 4KEUA 3SO7A 2HWGA 4IPJA 4UQCA 4WSJA 3APYA 3EDKA 4IF2A 3P93A 1WOAA 3UY8A 3GG0A 2QCLA 4ZXLA 2YL8A 4H9ZA 4BS0A 5ABHA 3Q4DA 3VNZA 3PZVA 4ZQMA 1JRCA 1WB0A 2PFHA 4YYCA 5A6SA 3ZR5A 1W3KA 5D05A 4HMEA 4G7EA 2CWXA 3STCA 1SO6A 5L9FA 2VT0A 3EEZA 1I2OA 4GZIA 4MDOA 4DJFD 1CB2A 3RLGA 3W53A 1NY1A 1E70M 1WXJA 4KGLA 5HWNA 1PZ1A 2V6AA 1VFTA 1PWMA 1T7LA 2AKMA 2VTFA 4DI8A 1TPFA 3W07A 3FIGA 3BLFA 1E0VA 4HP5A 3D5HA 4NJJA 1MXSA 2POTA 2NUYA 3W6LA 1V5XA 3UG8A 1TA3B 5DXYA 4REQB 1BYCA 1UW9A 3U48A 4A4AA 1VRDA 3S5SA 1LLWA 1LWJA 3ARZA 1FH7A 1DJNA 2R6OA 5D38A 3WMSA 3NSMA 4AX6A 4ADUA 1PCWA 3S2NA 3R12A 3D3FA 1H1YA 1UUQA 4FNRA 1HJVA 4NRSA 3EKLA 3TCEA 3H2AA 3OYZA 3CT2A 3JZEA 3ZVHB 3AUOA 3QGKC 4GGBA 1UR9A 4C6CA 5CXPA 1M5WA 2BBFA 1SW3A 2BG5A 4O0QA 1JL8A 1OFOA 3AIVA 2VR4A 1BWVA 2ZRYA 4OQVA 5AY7A 2WHKA 3WF3A 3TYBA 1LYXA 1OWQA 1TKKA 3IJ8A 1M41A 1R9YA 3E0WA 1W1TA 1PZ0A 3TTQA 3LSBA 4UWMA 2VDIA 4DZIA 4PUUA 1AA1B 2VR5A 4ZZ9A 1K6AA 3NQ7A 2PDMA 3OG3A 4ZTXA 1QJWA 3EWDA 4PUMA 1O4UA 4Z1DA 4HCLA 3U2ZA 4X2RA 4QE5A 1ICSA 4GQBA 1I45A 1KTNA 3BQ5A 5DCBA 4HU0A 1GOOA 1ICQA 4MJMA 5PTDA 2R8WA 1WUFA 5JH2A 3FXYA 4J3ZA 3DFHA 3N4AA 1NH6A 1UWSA 2AMGA 2IPFA 1A5NC 2PAJA 2QCNA 4AF0B 4K36A 2XIIA 4UTKA 2X1SA 4KEMA 3HV9A 4GI6A 3THCA 1RHCA 3T78A 1I60A 1GQJA 1US0A 2PU1A 2ZFAA 1OD8A 3PB0A 1L0PA 4IIHA 1V0LA 4JN6A 4DX3A 2ZRWA 2INEA 2J7BA 5K4XA 5CZTA 3LNMA 4IWWA 1KD0A 2VC7A 4YTRA 4QDPA 3RO6A 4TX6A 1FWDC 4QE1A 5CGMA 4H7VA 2D2HA 2ACUA 4F2BA 3E38A 3KM8A 3TP4A 2WJZA 1TVPA 1OK6A 2G3JA 2PCEA 4QM1A 1MDRA 2A3EA 2Z28A 2HXTA 1CPUA 3W1XA 1DWIM 1XLJA 3PZOA 4A29A 3KE0A 4W87A 2ZDSA 2P8BA 4FLOA 3SIZA 1H7OA 1DBTA 1P0NA 4ERAA 4TX9A 4QISA 1V93A 3KDOA 4O4VA 3KTSA 2JF6A 3NGJA 4DBUA 3GQYA 2V2HA 2VEGA 4PTMA 3T6CA 2WBKA 3VC5A 3AU6A 2Q8XA 1R2RA 3PB2A 5KZEA 2YW3A 3V16A 1TQJA 1OT2A 3U0HA 1WNOA 4XUYA 4NQ1A 2VOMA 4ZXOA 4F0LA 2YZ5A 5D9OA 2NLIA 1KBJA 1L2QA 4JN8A 1XLLA 4NZ5A 4P7RA 2SFPA 3TIMA 1UB3A 3UA4A 1NDZA 2BNJA 1JAKA 1BVWA 3H26A 2B81A 2FDMA 4IPNB 1E6SM 4TV5A 3UZZA 2QCMA 1K7EA 1E1CB 2EO7A 3WQPA 1W3HA 1V03A 1UG6A 5M3WA 3FN9A 3FYPA 2FMNA 2GVJA 2QCFA 1TUXA 1PKMA 3NA8A 3TR9A 1FHDA 2VGGA 2XIQA 4H8VA 5D32A 4GQRA 2YCJA 1E5JA 4LUYA 4UNKA 5LA1A 2J8GA 3QY8A 1OZQA 3PN8A 5FF0A 2VZSA 3FKKA 3RU8X 1C7TA 1F6PA 2GGHA 3DFTA 3ARTA 5DN1A 3RR1A 2R14A 4XO7A 4JTIA 4HT3A 3OZPA 4CN1A 1G94A 4J9JA 1MUMA 2W67A 4L80A 1VB9A 5LNRA 4HQVA 4O17A 1RQBA 4ZOEA 3ZIZA 3NSNA 4PMXA 4IMFA 2FPYA 1RLCL 2FTPA 3AOFA 1YXDA 3IV8A 2WMGA 5FSEC 1EJTC 1HVQA 4XK2A 5B80A 2ZTJA 3OOQA 4EPBC 3ZT6A 5C5YA 4HPNA 3B8IA 3GAKA 3NL2A 4DB7A 1E9LA 1EBGA 2EHHA 1YRRA 3TSMA 2VRQA 4G2DA 1TPVA 1UKTA 3WQ4A 1UUMA 4W86A 4I9JA 2MUCA 2BVTA 1BLIA 1W9DM 5CKSA 3GK0A 3DHPA 3VNLA 2WZHA 4DBDA 8A3HA 5C2XA 2DW6A 4OFCA 1PTDA 2CU0A 3CZLA 4PA8A 2VD9A 3HJZA 4KERA 1E4NA 2XN0A 3LXAA 1E4IA 1G4EA 5CZJA 4JIIX 4C6MA 1XWYA 4XZLX 1TVLA 1OHLA 1P7TA 3N25A 4A2RA 2FTWA 1XXXA 2OLSA 2D22A 1B2YA 3TSBA 5H8UA 4UTMA 5FCZA 1YE6A 3H53A 3VKKA 1PKYA 3MI3A 4JIPA 3BW2A 3E49A 2XFYA 3RK8A 3GO2A 3UESA 4V28A 2OX1A 7TAAA 1HJUA 1V77A 4GNVA 4G1KA 4S3JA 3VE7A 1XPGA 3SM0A 4Q6XA 4AWUA 2E0PA 2QVNA 3GDMA 4JL2A 1FCVA 2XGZA 4Y9PA 1DEDA 4S39A 4IMAA 4CQAA 1RK5A 2VVSA 3C0QA 3S3GA 2PWFA 5BRPA 3COTA 4B2DD 4IGHA 2XG9A 3FSUA 3CZGA 3CJPA 3LV6A 3QN3A 1W54A 3E0IA 4MWAB 3VGHA 2I9EA 4D6GA 3T07A 3TFXA 3K4AA 1GOKA 3TC6A 3WMCA 8RUCA 4L4OA 2BDQA 4JL1A 3UA3A 2Y62A 5I2UA 4LAUA 3HB9A 1J0JA 2ISDA 2J62A 2HVMA 2Z1WA 3ZLFA 4IIBA 1KC7A 3N15A 4GWEA 1EDTA 4K37A 2HCVA 3OQ8A 2WHJA 2CZDA 3B4UA 4J27A 4AZ7A 4ZODA 3FDGA 4F66A 4JXCA 3DHDA 1PIIA 4GG9A 1UH3A 3P0WA 4C1NB 4IGSA 1IWBA 1JZ5A 2PODA 4YL2A 4ROQA 1L9WA 1IEXA 5JU6A 3EX3A 3NPVA 1XISA 2OSWA 1EGZA 2BXVA 3EA3A 3WEZA 3WQVA 2HRWA 3LCFA 2WCAA 3UFYA 3B0XA 1EBHA 2A6LA 4PMYA 3PJUA 2DZXA 4EIVA 1K8ZA 1Q6FA 4HK6A 4AZCA 5MKGB 3DDMA 1FWGC 3M6YA 4M6UA 2PC4A 3OBEA 4FR6A 3UPBA 1JGMA 2B4GA 3N9KA 5HINA 3HOJA 3UPMA 1A5SA 3VD9A 3PPFA 4DUXA 1BYBA 1FP8A 4DEFA 3TZNA 1PE1A 1E0XA 2XYLA 1JF6A 2GJLA 2PP0A 4WCJA 4IGMA 3A5VA 4W93A 2ZE3A 4BWLA 2ICSA 4ZVJA 3MHGA 1MSSA 3KCLA 2FZ8A 4YHEA 3N6JA 4M7TA 1F76A 1OFEA 3WNMA 1X98A 3K30A 3OA3A 3VNIA 4RR4A 5LIYX 2VWSA 3LPPA 2ZC1A 3GR8A 1SPQA 4X3ZA 3UR7A 3GFYA 1HJSA 4P8WA 3GIPA 3FJLA 5I02A 3FGCA 4QITA 1KRAC 3E6EA 2BZNA 4WHBA 2ZCGA 2XIMA 1J0HA 1V6YA 5C7VA 1TJ2A 3IIVA 3L4YA 1EP2A 1U22A 1W1A1 4H00A 1ZZMA 5CSSA 4CNNA 3TAOA 4B3LA 3H55A 3V1HA 4PUEA 1Q4WA 2CBIA 3W70A 4FPSA 3MUIA 3SCTA 2OWWA 2R1MA 1HW6A 3T08A 3FNDA 7ODCA 2G95A 2J88A 2QV5A 3PUDA 2HNHA 3THUA 1Y5VA 4GC4A 2WZMA 4IIDA 1OM0A 4EOUA 4L1GA 3GTNA 5K7JA 1HO1A 1SZRA 2GK1A 4ZL1A 2OO0A 1LROA 4FLQA 4N6FA 3UR2A 2NXGA 3VOHA 3TMLA 5EL1A 2YL9A 4HZMA 4H41A 4PB4A 1VFMA 1VCFA 4DAFA 2BXZA 3S1WA 1ZBWA 1V6UA 3K8LA 5H1WA 4H8NA 1VS1A 5J5RA 1EJ7L 4UTUA 3A4AA 1PPIA 1ISVA 2Y7DA 3W73A 5LIUX 3M5YA 5BMXA 1FXQA 1QNRA 4A3RA 1MWOA 2Y6ZA 1PYFA 1HFBA 3DYOA 2J27A 1FY6A 4HA1A 5DBTA 5D2TA 3PAOA 3KBMA 3V0SA 4Y9AA 3TYAA 3UR5A 5BWFA 3TWBA 1WX0A 1O5RA 1J9YA 1GJWA 4HYRA 4KCTA 4JIQA 1QASA 5J8LA 1UR4A 1OIMA 1Q45A 3AIBA 4WK9A 2KX9A 3TTOA 1PB0A 1OD0A 2VJXA 2C8NA 1MI3A 2O4QA 1B4KA 1A5AA 3GFZA 3MP5A 3ANYA 1ELSA 3DUGA 3KBWA 1MNSA 4CD8A 3JR2A 1EYEA 2EJ1A 5FJIA 3W0KA 4JCLA 4RCXA 2PLCA 4DQWA 3EA1A 3PZ9A 3WO8A 4IH3A 3UNDA 4J35A 1G4TA 3DG7A 4P8XA 1P6CA 1W1B1 1LUCA 3NEVA 1LF1A 3WCZA 2WVVA 4XD5A 3QHNA 4AD5A 4PSRA 4C7FA 1WP6A 6XIMA 1E71M 4Q4OA 5T9BG 3G0SA 4XSMA 1J96A 4D6JA 1T8QA 3P82A 3VDCA 5LIWX 5D30A 4X2PA 3FEMA 3QZ6A 1QWGA 5A8MA 4IIFA 4YN5A 2VQUA 5A6JA 4K6AA 4ICCX 1ODUA 1YNYA 3WF1A 1QHZA 1FH9A 3M07A 3OJGA 4NILA 2YCLB 3MJYA 4QQUA 1O1HA 3WLQA 1A80A 1A50A 1JPKA 3B40A 2ZDRA 5I7GA 4M29A 2NW0A 3MU7A 3QW4B 1KB3A 1ZJBA 4HZ8A 3B06A 4O1AA 3L4ZA 5EYWA 1ISYA 1BGGA 3ID7A 1V02A 2PDXA 1IE7C 4QHRA 4Z1BA 4E8CA 1CTNA 5EFDA 3A4XA 3UG4A 2YIHA 5CC5A 1VCGA 3NZQA 4QQ3A 1TRIA 1U1JA 1R3QA 1KO0A 1KTCA 1O68A 3ITVA 2XFRA 4A35A 5LKYA 3V36A 1OX4B 3B9AA 1JD9A 5I03A 1J01A 3ITLA 2J13A 2NV1A 5A2BA 3NL3A 4NKCA 2HVOA 4C5YA 3OTRA 1UBPC 4B9ZA 2VC6A 4XIAA 4PL2A 3IEBA 3UXKA 1WYIA 3N3TA 2WAGA 5C70A 2DT3A 1ZHAA 3EOOA 1BSIA 3N4FA 4GBDA 1V7YA 3PANA 3QMSA 3WBWA 1CZ1A 1W5OA 4PODA 1FWFC 3A9BA 2V5LA 2FVLA 1A5MC 3QPZA 4LVDA 3QFEA 4ADSA 4V33A 1E72M 1CBGA 3HV8A 4GA8A 4LBUA 2YGYA 5BZAA 1Q65A 1PIFA 3VKAA 2QUNA 4JYDA 4QG9A 2L5HA 4GKTA 1EP1A 2JGQA 2WKGA 4UFJA 1OVDA 2HS6A 1LOSA 2H90A 3CNYA 1W5QA 3GVQA 1XUZA 3PJWA 3BAWA 5DO8A 4F0HA 3KLLA 1H61A 1SO4A 3HPZA 1XLEA 3PM6A 1AQHA 3A12A 2VELA 3MSYA 2IPJA 1XIGA 3KVKA 1KFLA 3PJTA 3MBFA 3VYLA 1G5AA 1IF2A 2ZICA 2QYGA 1B3ZA 3G3DA 1A53A 1EWDA 1XRSA 4BKNA 1CGWA 3QSRA 3LYEA 1XDLA 3R43A 4FXRA 1WAWA 5G1TA 1A4LA 1Y5XA 4KESA 1HP5A 2ZKMX 3DKJA 5IHRA 4ERGA 1XFBA 4IQJA 2JEQA 4OWGA 3VMNA 1IEVA 2BVDA 3T2PA 5BWAA 1TPC1 3TTEA 4BQ5A 1S2AA 2XU2A 4BWLC 3TU9A 4MIMA 3ZYZA 4LV4A 2ZWYA 3TYDA 1H4PA 3IGSA 1TPEA 3LXBA 9CGTA 2PWUA 4WSKA 3W2KA 3CUHA 2GWGA 1AH0A 4FIRA 5I23A 1EC7A 3WK2A 3WUBA 2V5JA 3GVGA 4R9OA 4MJ4A 3EWYA 1O94A 4F48A 4LYRA 1THFD 3EDEA 1BPLB 3OGRA 1CLKA 1FFQA 3O6CA 1KR0A 4HTYA 5E1QA 3VGBA 3CV6A 1UBSA 1XI3A 2FYMA 2WV8A 1CGVA 4IXHA 3TV8A 1E4LA 3R0UA 4EX4A 4IMEA 4AIUA 4YXGA 3EEGA 5BXRA 3EOLA 3PUGA 2QHAA 3MTWA 4B5VA 1DWAM 5A8NA 1F3WA 2F9RA 3WZ0E 3CV1A 1BXBA 1JZ7A 2NQZA 4CQDA 2WM1A 3QLLA 4NAFB 3BAIA 2VMFA 1D7KA 1BSLA 3D47A 1WPCA 1OJXA 1IT0A 3LLDA 3RCYA 3SIMA 5HDRA 4E2OA 4U33A 1JYWA 4QS6A 5AYXA 5EBAA 4GCAA 1HTIA 4PMNA 4DO4A 3NQ2A 3M6DA 1K4GA 2V2CA 3SEPA 4AY7A 4WVXA 1UMYA 2ACSA 1BGAA 4ZQCA 1BRLA 2VCBA 3DFQA 1AW2A 2WOQA 2NQ9A 4QS5A 3M4HA 2E8ZA 3OHIA 2QAFA 3P0XA 3PBMA 4G9PA 3MKVA 3VDAA 4AZBA 3STPA 3GZ3A 4GIEA 4GIRA 3UWYA 3LCWA 3VU2A 1OFDA 4LNYA 4U5IA 2FGZA 4PB5A 4XVEA 3LX9A 5A6KA 4PEEA 3AXIA 3FLUA 4GLEA 4O10A 2D2OA 4GOAA 1EO7A 1JZ6A 1LBFA 1GVSA 5CPNA 4JNZA 3BARA 3O06A 3M44A 1GG0A 4QG6A 4MSSA 3UGVA 2F61A 3NZPA 2FB3A 4I9AA 4C6BA 3V7PA 4LYPA 2PF8A 2VFEA 5BW6A 2Z1KA 4H9YA 4S3BA 4MMWA 3LG3A 1QATA 1GGOA 2XVGA 1VBGA 4MM1A 3UZJA 2YLAA 4LRSA 4H9TA 3EWWA 3WFZA 3WLMA 4BA0A 3NQ6A 1AD1A 3R4IA 5D33A 4L9XA 2BP1A 1V3KA 3HMJG 3BMXA 5FJRA 2E6AA 4MTVA 3AYVA 3C2OA 4GI8A 3VOGA 2ZTKA 1AL7A 5IFPA 3CL7A 3GVRA 1CGYA 4IICA 3WLNA 3HTWA 1KRCC 3MCNA 1YPXA 3XINA 4MNJA 2ZX5A 3W1UA 4GUJA 4JTRA 3NDYA 3DC8A 3MUAA 3NDZA 1DKWA 3ALFA 3IJ9A 1T5AA 5H91A 3S9YA 1DXIA 2J7HA 4GGHA 3WQFA 5I00A 3Q94A 4Q8TA 1X7FA 3SCVA 2WLZA 2VCAA 4IL0A 4GUGA 3LPGA 4A3QA 5F2MA 1GW1A 1FUYA 3H4XA 3VIHA 4HHPA 3IUIA 1IEWA 2EG6A 4B91A 4NU7A 3SQMA 3WUEA 1CXKA 1E6QM 2O55A 1D3CA 1A4MA 2ZC8A 4NXSA 2FQIA 3E2QA 5LNSA 2DP3A 1J93A 1VQTA 1RA0A 2I5IA 1E5NA 2IQTA 3CTLA 3RM9A 1EUNA 1GOMA 1TYGA 4XAZA 5AVHA 1T40A 3RR4A 3U4AA 4R33A 1RQEA 4L6OA 3TYUA 1GYNA 1DOSA 3LRMA 1BYAA 2W92A 1V6XA 1CLVA 4Y7EA 3TNOA 1P1MA 2EQDA 3H12A 1D8CA 4JS3A 2IPWA 3KHDA 2P53A 3N17A 1QNVA 3MHUA 3AYSA 1Q6LA 4K1GA 3DEQA 3UPWA 3UJ2A 3T44A 2E6DA 3GVVA 4LC8A 1IZJA 4K3ZA 1W8SA 5HMFA 2TMDA 3I4KA 3PS7A 1FDYA 2FZMA 2E28A 1WZAA 3WENA 3K1GA 1CGTA 3WNKA 3KOFA 3GYEA 1OX6A 1YLVA 3GVWA 3FK4A 3MMWA 4NT0A 5D2WA 1PZ3A 4MUPA 4CU7A 2UY3A 1AQ0A 3JRKA 4LYKA 1EUAA 1FDJA 2QCDA 5C55A 4WOZA 3MP3A 2O0TA 2PSNA 3V1PA 3N34A 2DSWA 3LS9A 4BI6A 5KITA 1EJWC 1OFAA 2IKGA 5BU6A 3RMEA 3GH5A 1IQ8A 2A79A 1V4YA 3RCNA 7A3HA 3WL0A 3EYPA 4Z2LA 2EJAA 2PGWA 1XGZA 4YPJA 1TUFA 3TFCA 3VOFA 3MUXA 1B3XA 3CV7A 4DXXA 4GRSA 2H9AA 2AAMA 1YXCA 3IWPA 4UFHA 1AW1A 1X8CA 4LS0A 2E1DA 3F1QA 4GUFA 3WK0A 3C0SA 4FP1A 1BAGA 1S1PA 2GVYA 4FO4A 1KBLA 4PMDA 2NSOA 3H23A 4TR9A 4QBXA 2Y7EA 2FFCA 3F4VA 2D0FA 2EEXA 1YADA 3A3WA 2QCGA 4UIOA 3VX1A 3ZJ7A 1ZQ5A 5K3VA 1KM6A 2OSXA 2RDTA 1DJIA 3GB6A 4HMNA 1EEXA 3FJ6A 3VKBA 1W2PA 1JNEA 3KBSA 3NOEA 3C0LA 3ABSA 1YBQA 3HMCA 2V5BA 1JFXA 3HGOA 1H51A 1JJKA 1RH9A 3FX4A 1WO2A 2CBVA 4LVGA 1F05A 2RHGA 4I7VA 3R79A 4KCVA 4B3KA 4MJ2A 3KTXA 3UCDA 1UIPA 4XKYB 3O15A 5REQB 3H2EA 1XD1A 1Q8AA 3V5OA 1Y8BA 1L6GA 2C6QA 4AIEA 3MWAA 1X6NA 1CGXA 2A0NA 1ME8A 9XIMA 2DSZA 3LTSA 3P5ZA 4AX7A 1PX4A 1WDSA 4Q7IA 3SUVA 4UQAA 3M0HA 4Y9NA 2OU4A 3ERPA 1NAL1 5DY2A 5FL1A 4EK7A 4US5D 3NO5A 3MMTA 4MPQA 4OKDA 1JZ4A 1KV8A 3ITGA 4PZVA 3U6WA 3TE9A 3C2VA 2ZUWA 3LHTA 3EPOA 4ZSTA 4YCPA 2CERA 3C8NA 3RNDA 2Z29A 2Y5JA 1F7BA 3PPHA 4FS9A 3RUBL 3HG2A 2ZOXA 1PKNA 1W3JA 4MOZA 2V69A 1WXZA 2Z1BA 3CWNA 1AZ2A 1J0IA 3IANA 3ARYA 4J3XA 3DXIA 1R0MA 1MEHA 1K70A 3NYZA 3IS4A 2OGYA 5J04A 2VKZG 1WBHA 3IUDA 3HQ1A 3MO7A 2KZHA 4DJDD 2EG8A 1TV3A 3QC0A 3OODA 2BY1A 4DUOA 3W02A 5D37A 3E96A 3OB8A 3ARSA 1C29A 1DXFA 1TR1A 3QV7A 2I56A 1GKPA 2NWRA 1J10A 5D04C 4G7EB 3IK4A 5C9ZA 3L0NA 2UV8G 1GZJA 3W74A 5D2YA 3P3BA 2XWEA 2EGZA 2V30A 1TO3A 1JF5A 1AQMA 4U3AA 2XIJA 5IBXA 4MNMA 2BY2A 1MXDA 2PTYA 4TX8A 3BJSA 3FW6A 4PH6A 4DLFA 3ZWTA 4F3HA 3UWZA 1J5TA 1T99A 2G50A 3BAYA 1OGGA 4XZIA 3AIQA 2RKXA 1U83A 4Q8WA 3W7QA 1HKKA 4QX4A 1V3HA 3MB9A 4NHVA 3BQ6A 3POHA 1N8FA 1B57A 2P8CA 1QI2A 3PTMA 2KAUC 1DE5A 3P14A 3ME3A 4GFIA 4C6IA 1LLZA 3DENA 1G9HA 1ZS2A 3OHMB 1ZNNA 1EFZA 4PBEA 5BNKA 5A6LA 2VX6A 4QJ4B 2E9BA 2NT0A 4M6QA 2FPVA 3VTRA 2I16A 2PI6A 4UZUA 4QSHA 2C71A 1N82A 3IJIA 1VIZA 4RE3A 4JTDA 2CKSA 4DO7A 1X39A 2PRHA 4XO6A 3WLLA 3W2UA 4N4PA 5CGTA 2I5QA 3WLJA 4HNCA 3OVPA 2HPMA 4PMRA 1W56A 3EBVA 4JTTA 3QZAA 2VM8A 1RQHA 4D6CA 1EJXC 3RHGA 2VDHA 3IVSA 3CM4A 1YQ2A 3O0FA 1LQ2A 3LN3A 3KL0A 2A3HA 2NZLA 3TEVA 4UR9A 2FB2A 2P3ZA 5HNUA 2OQLA 3WBXA 1H1NA 1QBBA 3TSDA 1OFBA 4AD3A 3HF3A 4AWEA 4XB3A 1DWFM 4LS2A 2Y89A 3P74A 4JEQA 1EA9C 1Q7QA 4LTSA 3WBAA 3T7VA 3TTSA 1XLKA 3CAKA 1RP9A 3LCIA 2BVYA 5E9XA 3AIRA 3UWQA 1EHAA 3VD4A 3QHOA 3WK3A 3W2LA 2C0AA 1A5OC 4MY8A 4HIBA 1S2CA 1DVJA 4JTUA 1D8WA 1AK5A 3FHQA 3L65A 4RZBA 4ML9A 1VFUA 3V5CA 3NM3A 2WNWA 4NVTA 1ZGDA 2XIBA 5GNYA 2QZRA 1GYLA 3WH6A 4CNOA 3KRUA 5CJMA 5JH1A 2QF8A 2POZA 3BAXA 4K7YA 5LIXX 1E1FA 4MB5A 5HOSA 1GOQA 3GTHA 4DYKA 4C6PA 3VIPA 3TW7A 2O7SA 3CIVA 1N55A 2H6RA 3DH7A 5AHMA 1UJPA 4KRZA 3SAZA 5KEZA 3GX9A 1FBAA 4O28A 2B31A 3FVDA 3WH8A 1TB3A 4GO8A 3SECA 3Q58A 4OGZA 1WDRA 1GVOA 3GXPA 3WELA 1U5HA 1VFLA 3HG5A 2YXOA 2BHZA 2PWHA 1W17A 3WG6A 3P61A 3W7NA 5C9WA 2E77A 3G24A 7PTDA 2XSAA 1E43A 2F6KA 3A3HA 2WJDA 2OMAA 1V0NA 3S0CA 4GVGA 1QPRA 3TYEA 4CQBA 2GQAA 4ZE4A 1JD7A 1NDYA 2IW0A 2HBXA 3O63A 3UZ5A 1MW1A 1XCFA 4FOKA 4EE9A 4LX4A 3A13A 3UWUA 4QLJA 2YBTA 5HMDA 4PRTA 3KOWA 2C15A 4R34A