1UB3A

Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
211
structure length
211
Chain Sequence
DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Aldolase protein
total genus 85
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ub3A00
5AHMA 1DBTA 1B4KA 4XUGA 2ZFAA 1FDYA 3L66A 1YDOA 4PA8A 3NDOA 4UIOA 1VZWA 4UTIA 4CNPA 4FX7A 2NUXA 1JUEA 4PC8A 2H6RA 4OV4A 1JCYA 2QUVA 4MY1A 4UTKA 1FCVA 3DH7A 4IX2A 3UY7A 1AG1O 4JD4A 3GNNA 5HWNA 1JUKA 1LYXA 2C18A 5EY5A 3E49A 3S1XA 1KLYA 2X30A 4BR1A 1X1OA 4POCA 2EF9A 2J6XA 2QCLA 5F4XA 3PUEA 1H63A 1XXXA 4TO8A 4R33A 1TJRA 3N9SA 4O19A 3NQEA 2PE4A 1VS1A 4O54A 5AHLA 1OG0A 3GXPA 5C54A 3QMRA 2QJIA 3NQVA 3T78A 3Q94A 2QCFA 1CW2A 5A8GA 3L5MA 5F2IA 3F4WA 2A7RA 4FX6M 2CLLA 3C52A 2WSRA 3L21A 4JX4A 3N3MA 3C2FA 4NT0A 3LTPA 3LXBA 2VFHA 2BX7A 3MI3A 1FXQA 3MW7A 1R47A 4MY9A 1TO3A 4I7WA 1S5WA 1JVNA 1VCFA 1O4UA 4UTTC 2CLHA 1W3TA 1K7EA 4RJEA 3IGUA 1QMLA 3UZJA 2G95A 3FKRA 3W74A 1JQVA 3P60A 3LCWA 1EB3A 1SUXA 2NV2A 1AL7A 4MIMA 3ZWSA 3M0ZA 2QDHA 3S42A 5AYYA 5FF2A 3TIMA 3N14A 3TXZA 2YFNA 3FA5A 3QF0A 2X1SA 2V2HA 4AVFA 2G5WA 3TROA 2Y7EA 5F2LA 3M47A 4NX0A 4ZQMA 4IMGA 2WSQA 3W7NA 3KVKA 3W9ZA 2YR1A 4IWWA 1FWWA 1F73A 2PURA 4I9AA 4CQAA 3OBKA 3KOFA 4CLMA 3EEGA 5FEXA 1G4PA 2C15A 4FO4A 3C4UA 3FYOA 1R46A 4NJGA 3LCLA 1TTQA 1IXPA 1AW2A 3GKAA 2RHGA 4UTUA 4JIPA 1DKWA 2VEPA 3LLFA 3HPZA 3QMTA 3NQ7A 3LHWA 1WAUA 3OVQA 1VYPX 5D33A 4ZQOA 3NQ2A 4UR7A 1TRIA 2H3DA 1YDVA 1TTPA 1K8XA 2J88A 5IM51 3EWXA 3W7KA 1IXOA 1H50A 4IGHA 1OF6A 4BFAA 2ZZ7A 1KW1A 3ZFHA 3G1YA 3I65A 4NZFA 5H91A 1LROA 3PS7A 2FDSA 3TJLA 1J5TA 5FEWA 2GJNA 1LORA 3NQMA 1Q3NA 5KMYA 4G1KA 2DJXA 3DHDA 1YDNA 3BG5A 4UMBA 1G4SA 1L6WA 4OT7A 3EX1A 4K36A 3TSBA 1WBHA 4IUOA 3GAKA 2NXGA 4OQVA 4DO6A 4MYXA 3VNDA 3PSWA 1NF0A 3TQKA 4N4QA 1LBMA 3LCHA 4NVTA 2JBMA 5HQEA 2PRMA 3NGJA 5KTLA 4HKPA 2A1YA 3W1LA 2E6FA 2DU2A 1SSDA 3VE9A 1W5MA 3G24A 5C5YA 1PHWA 4UFLA 1U5JA 1H5YA 1W31A 5BOOA 3SGUA 2P10A 1FDZA 3VKJA 1AK5A 1RR2A 1X7FA 3HGOA 4U28A 3GKFA 1FCQA 3HG5A 2CZ5A 3CM4A 5E0KA 4UFJA 1HUVA 3P5ZA 1JCXA 1L9WA 1IXQA 3NL3A 1WV2A 1QO2A 3NQ8A 1HG3A 3HMJG 5GVJA 1VHCA 3NO5A 2ZRVA 4ORMA 1A53A 4LVFA 4R53A 3UZ5A 2AGKA 1OX5A 4HPJA 2A2IA 3HGRA 3LBCA 3S1WA 3G3MA 3O8AA 1H1ZA 1SFLA 3P80A 1ZAJA 2E5CA 4JN6A 3W1TA 3L65A 3G1VA 3LDVA 1OFQA 3ZR4A 1V7YA 3G1SA 4NJIA 1GOXA 1J4EA 3NQDA 3YPIA 4XTDA 3TU9A 2FTPA 3P8JA 1XUUA 2FLIA 3A24A 4ONVA 2EPHA 3E0IA 4K39A 1EP1A 2FJKA 3STCA 4HHPA 1OFOA 1SZFA 3ABOA 1RV8A 1ONRA 1Q45A 4NXSA 1UCWA 2C6QA 1H7PA 5DY2A 3BK0A 4Q33A 1JQXA 3B4UA 3AJXA 2A5HA 2X2GA 4YL2A 3TV8A 4D2JA 3SGZA 3W07A 4WY0F 3UY8A 3M16A 2JK2A 2LLEA 2JKAA 2BXVA 2ZCGA 4YMZA 3LI1A 1S3HA 1SR9A 5HR6A 3QPYA 3R8RA 3DAQA 3FFSA 3SJ3A 1L6SA 3GXNA 3HOJA 5F4WA 3W23A 4M6PA 1I2OA 2FPVA 3NPVA 1ICPA 3MP4A 3BG9A 3UPWA 1H7XA 4RKAA 3B05A 5K2ZA 4KFOA 5I3GA 3PR2A 3UWYA 2NUYA 1F6KA 4DF0A 1AW1A 2W6RA 4O10A 2YW4A 3WK3A 3GIYA 4K38A 5H2ZA 1N8FA 3PF3A 4RK8A 5C2XA 5FF0A 5CZTA 1FCUA 1SW3A 1SSGA 1DQWA 4R34A 1X8FA 3L5LA 4JTHA 2XN0A 2OX1A 2I1OA 3B06A 4NJKA 1G7UA 3MJYA 5SWUA 1L6YA 1ZALA 1SQ7A 2NLIA 3HGJA 3LRMA 4LUIA 4UNLA 1A5AA 3TQ0A 3NPWA 3W1RA 5DCBA 3WJSA 3QW3A 2WNNA 3LERA 2B4GA 4YLWA 1OK6A 1C29A 4AHQA 1VC4A 4WY0B 4HSOA 1G4TA 3BLIA 3DFQA 5KSWA 4JTUA 3QFEA 2VOMA 3S9YA 2PRLA 1AMKA 4A3UA 1ZNNA 3CIXA 3BVJA 1S5VA 2Z6IA 3MUXA 5D32A 2ZZ3A 3W7OA 5IBXA 3R89A 5AFDA 1H62A 1HFBA 3ELFA 3UPBA 4QISA 1XDMA 1Q6RA 5LGXA 3LCFA 4K8HA 1VGAA 1BWLA 4GUGA 1WOBA 2YPIA 1QCWA 4PL1A 3QH2A 2NZLA 3IV3A 2ATSA 2ZRUA 2XN2A 1Z41A 3EXSA 5KZEA 4A2SA 3PWAA 1F7BA 3W7LA 4GE8A 2R91A 3S5ZA 3TJXA 1VCGA 2ZYFA 4ZL1A 1KFJA 1I45A 3GNDA 4GNJA 4IJBA 1TPWA 3CC1A 5J5RA 3IIZA 1Q6OA 4JY9A 1CX9A 1RQHA 4QAIA 2CLFA 1RVGA 1TJPA 4KWWA 4RV8A 2R8WA 2QUTA 4N02A 3HIJA 2B7NA 2X16A 1OFEA 1BKSA 1KTBA 1VYSX 4N2YA 3NPUA 4MJZA 4O1CA 1VQTA 4DPQA 3N73A 2B7PA 3GZ3A 4QNWA 2OT1A 3BW4A 3NM1A 2YDAA 4JDYA 2HTMA 1AL8A 4ML9A 2ZQ0A 4WXZA 1ZENA 3MHGA 3GX9A 3ABSA 3CWNA 3HJZA 1H60A 3KRUA 3W6YA 3T44A 1DJQA 4JS3A 5LNVA 2ABBA 5CSRA 4Z08A 2TSYA 4UTWC 3O16A 1ALDA 3KVLA 4CCEA 5TIMA 3W7GA 1FDJA 1Z48A 1KTCA 3KVMA 1RPXA 3TSDA 1ME7A 3STEA 5CZ0A 1ZCOA 3BGGA 3GK0A 1L2UA 3WJZA 1EEPA 2QCCA 1SW7A 4N9BA 1EWEA 3DZ1A 2P1FA 4MZ8A 1TREA 3QW4B 2Y85A 3U8GA 3PSVA 4FNTA 1LRTA 1TV7A 4O28A 1HO4A 3P74A 3TMLA 4UTWA 4UTMA 1FX6A 1ZAHA 3GYEA 1YTEA 3NZRA 5D02A 2J9YA 1F5ZA 4TR9A 3KX6A 5BW6A 5HNRA 5LZLA 3SR7A 1TPUA 3NM3A 4IMFA 5ABTA 3UXDA 4WOQA 4OHQA 4LVAA 3I7RA 2TPSA 4WXYA 2E5BA 5I3HA 3BG3A 1KM2A 2VFIA 3DI0A 4CCCA 2ISVA 3DHFA 4S1FA 2QCDB 4NX5A 3SY5A 3RLUA 2TYSA 3ABQA 3OIXA 1B3OA 3W88A 2Y6ZA 1M5WA 1ZY9A 1D9EA 4JNMA 1RZMA 3EKZA 4GRSA 5I3IA 2CZFA 2VEMA 5F1UA 4UXDA 2C13A 4LS1A 1TTIA 4O16A 5K4ZA 1K8ZA 5DLCA 3ABRA 3RU6A 1UJPA 3C2RA 2ALDA 1QFEA 2B7QA 3R12A 3BW2A 2B7OA 3W7QA 3CEUA 3MYOA 5K9CA 3MBFA 2E77A 5D04C 1I2NA 1NAL1 3Q2DA 5EYWA 2QUUA 4EOUA 1GZGA 1FWNA 3L67A 3EX6A 1QR7A 2ATMA 3TSMA 2VKZG 2DORA 3RMJA 1WA3A 4E2DA 5DBTA 3EX3A 3PUOA 2RKXA 3G3DA 3THQA 4LV4A 4MVAA 1T8XA 5BRBA 2X1TA 2QR6A 4UTTA 4E38A 2DZVA 2HMCA 5DCDA 2CLOA 4DF2A 4NNCA 1GYLA 2NX9A 3N9RA 4QITA 1NEYA 2BWGA 3C3NA 1FQ0A 2HS8A 5I3KA 2YCEA 3HG4A 3M7WA 1PV8A 4LC6A 3T4CA 3SECA 4DQWA 2VFEA 2UV8G 2QDGA 2WV8A 3HPSA 3NEVA 4JICA 1VHNA 2QF7A 1OYAA 3PG9A 3LXCA 4BI7A 3NOEA 3TKFA 4C1LA 1TQXA 1GTHA 1YLVA 3TMQA 1QO5A 1LRQA 3NL5A 3W70A 3C56A 1OX4A 3PG8A 5K9DA 2DZTA 1WXJA 5FF7A 3W2MA 4YCOA 3CHVA 5D2TA 2J9XA 5DELA 4UTHA 4B5NA 1EP3A 5G4WA 3R13A 3PB0A 1GVQA 4QQ3A 1VLWA 4DPPA 2VEIA 1KM1A 1WQ5A 3LX9A 4A29A 3IIOA 3W2UA 3W3OA 5BNKA 2DZXA 2Z0IA 1O95A 2VFDA 1GG0A 3W2LA 3DKLA 1LOSA 1XBYA 1H7OA 1FWSA 8TIMA 4Z1BA 5L9FA 3RFAA 3RLVA 1ZAIA 4GWEA 4Y96A 1PIIA 3M5YA 4WUIA 1XC4A 3G8RA 1JUBA 3C2VA 1P4CA 4HSNA 5F2GA 4WZHA 4XBSA 5KINA 2GVLA 1GVSA 1TMHA 5CG7A 1WBJA 3DGRA 4DEFA 3JS3A 1TQJA 4PEKA 4K37A 3UYCA 4YWIA 1YXCA 3NQFA 1R2RA 4ZVJA 1C8VA 2QCEA 5FEPA 4O57A 4H6KA 4UTLA 4H3DA 1XM3A 3CPRA 3MP5A 2OJPA 1PVNA 1ME8A 2FFCA 1LCOA 3Q58A 2BTMA 4O14A 2HSAA 4I7VA 3EXTA 1JCMP 5HJLA 1H7WA 1XKYA 2C16A 2V2CA 3EXRA 3M44A 3FEMA 1M7OA 2WOQA 1JULA 4N6FA 3FS2A 5MHBA 4NNAA 5KZDA 2P0OA 4ZZ9A 4LY8A 3S6DA 1PL9A 1W3NA 1G69A 4LNYA 3TDFA 2H8ZA 1R30A 2C14A 2ZA3A 3N2XA 1W1ZA 5AYXA 3G1AA 4N9CA 1I2QA 2DZWA 3EKLA 3LTYA 3LGEA 4O13A 5F2MA 1KM6A 3F4NA 1KA9F 5L6UA 4Q4KA 3LHTA 2QCNA 3SZ8A 5D2YA 4FNPA 4QM1A 1NSJA 1J2WA 1K7FA 1OX4B 4LV9A 3PBYA 4UUIA 4JEQA 3H55A 4NZJA 4O15A 3SIZA 4RCXA 3SFKA 1UB3A 2YXGA 5LHEA 1SW0A 4XQ6A 3ZWTA 1Z42A 1JRCA 3QYQA 2JKEA 1R2SA 2QCGA 4KWVA 4YXGA 2KZHA 3LRLA 4FIRA 3CEPA 3NAVA 1QOPA 3FKKA 2ZZ5A 1YTDA 4KFPA 4HNTA 2DJLA 4JYEA 5G2WA 2CLKA 1YPFA 4MOZA 1LOLA 1Q6LA 1PCKA 3UXAA 2G97A 1G67A 5TQLA 5AHNA 3IRDA 3U2OA 3O6YX 1F05A 3PAJA 1G7VA 2A6LA 2I14A 3NA8A 5I3FA 4IQLA 3O07A 4LVDA 4O52A 1ADOA 3QM3A 3W75A 5AC6A 4O17A 2G96A 2ZDRA 3E9AA 1LLWA 4JGDA 4CQ9A 4PH6A 5G5IA 2CU0A 1T0OA 3MHUA 4H4IA 4Y8FA 1PE1A 1KV5A 3DFOA 1D3HA 2WJZA 5CSSA 5D37A 3TC6A 3EX2A 2J9ZA 1OK4A 3M43A 3TUUA 2R14A 4UCGA 1M6JA 1QPNA 4C1KA 3VCRA 1OX6A 1KFKA 1KM4A 3QPZA 4S2CA 1JR1A 4ORIA 1TPEA 3H54A 4K7VA 5KZMA 3IGSA 3QC3A 3CU2A 2CW6A 1ICQA 2ISWA 2A4AA 1YTKA 1H61A 3STGA 3LHVA 3T7VA 1SU5A 1KBIA 1EX5A 2D73A 5K3VA 5LNWA 3CQ0A 1VR6A 3USBA 5K4XA 1UUMA 4N6EA 4YCPA 4DBDA 4Y9AA 2EHHA 1IIGA 4M7SA 1RQBA 1GG1A 1ICSA 3P82A 4LVBA 4MPQA 4Z1CA 3TAOA 1W5QA 3W87A 4N4PA 2Q3RA 3I7QA 3WK1A 1QWGA 3INPA 4AHPA 2YYTA 3W1MA 4LVGA 4NQ1A 1BTMA 3QQ0A 3B8DA 3MP3A 1HL2A 3G1HA 1TV8A 1DL3A 3KAOA 1IGSA 4A22A 4PCFA 3DFPA 3GB6A 2CLEA 3MWAA 4OBTA 2CLIA 4GUJA 3N19B 1THFD 2ZRYA 1EUNA 4PODA 3KXQA 4Z0SA 4EIVA 4AB4A 4FXSA 3D0CA 2GVJA 5U7SA 1XDLA 3P67A 4DF1A 3STFA 1S5TA 1QPRA 1SO5A 1M7PA 1LBFA 5DY3A 5DCEA 3TXVA 1T99A 3RF9A 4EF8A 4JDBA 1WYIA 2QKFA 4LTSA 4Y90A 1SPQA 1XBXA 5CZSA 1KM0A 5G1YA 3O6CA 4IXHA 4MKNA 1TB3A 3UWVA 4AXKA 3NL6A 3W1PA 4BI5A 1RD5A 2E6DA 1VCVA 3AO0A 2ZZ1A 5CPNA 1KFLA 4GFSA 4FEZA 2XN1A 2A85A 4LRSA 2WO5A 3LB0A 1GWJA 2NV1A 1EIXA 3NZ1A 4O0ZA 3QQ1A 4HNNA 2CFFA 2YX0A 3BV4A 4M19A 5HINA 3UWUA 1K8YA 4E2BA 5EA9A 1GEQA 5D2WA 3BGJA 4IX0A 4NJJA 4MFDA 4DXVA 3UWQA 4NXKA 4FXRA 5HULA 2QCHA 3HG3A 4A21A 2EAWA 4LUJA 3W73A 1LP6A 1FCBA 2WNQA 3W86A 2BZNA 4XZ9A 1N7KA 3E12A 2A0NA 4GBUA 4MZYA 3CT7A 3DENA 3JR2A 2WNZA 3P84A 5TBOA 2E6AA 1WOAA 1NVMA 1Q6QA 1TPH1 2VENA 1TSIA 5LHFA 3BPWA 2OT0A 1OFBA 1OFDA 3KRZA 1GT8A 2ABAA 4GJ1A 2Y7FA 1D3GA 1GVRA 1XBVA 5KITA 6ALDA 3G0XA 3W72A 1CI1A 1FWTA 3PB2A 1ME9A 4RLIA 2JKPA 1W5PA 3E96A 2GQ8A 3PVFA 2ZTJA 1DVJA 3O05A 5K7JA 5LSMA 2F84A 2ZRWA 3FJ6A 3QEZA 3W1AA 3W76A 3FOKA 3IIPA 5IBXC 2E6YA 5HUPA 1GVOA 2VELA 3NYZA 3B0VC 4AMAA 3EWWA 1I2PA 5D09A 4TMBA 4LS0A 3W1UA 3LOTA 2X1UA 1A5CA 4MLRA 2E1DA 1W3IA 4LC8A 4ZQRA 3W85A 2Q8LA 1ZHAA 1MEIA 1UBSA 1W37A 2RDUA 2CZEA 1F76A 6TIMA 2WSYA 3W7RA 4I7UA 4MYAA 4ZQPA 1P5BA 5LNSA 3TX9A 1WX0A 4O18A 1B57A 3C61A 3PULA 3PBVA 4CCDA 3CTLA 3P5YA 1EUAA 2RFGA 3NQAA 5DBUA 2FIQA 2VFFA 4MJMA 4IPJA 5CPOA 3QRHA 3W7JA 1DHPA 5C55A 2OZ0A 1TPDA 4MZ1A 3A5FA 4LRTA 2V2DA 3QZEA 5EL1A 1B9BA 2YYUA 3G0UA 5DXYA 3LHUA 5E93A 3NL2A 2GUUA 1VYRA 3W84A 4FF7A 3S5OA 3OVPA 1Z44A 1SZEA 2F7FA 4OWGA 3TW6A 1KM3A 3TA6A 5CPLA 4PTNA 1GTEA 4IPIA 4OE7A 1BWKA 1JRBA 1YXDA 2H3BA 3ATYA 3RK8A 1XFBA 4ADTA 3C2OA 4JX5A 4TMCA 2VC6A 3LV6A 2QJGA 1DOSA 1OABA 2O7SA 4OU1A 1H51A 1LZOA 4MLJA 2O7QA 4FNSA 1TCDA 4AWUA 3M41A 3TAKA 3QMSA 4JX6A 3IGXA 4M6QA 4HNVA 4RZ4A 3G1XA 4JTFA 4OGZA 4MUZA 3NQCA 3H53A 2CZDA 3MMTA 4J9JA 2W79A 4R7JA 3E02A 3ATZA 7TIMA 5LNUA 3BW3A 2FQIA 2V0TA 3W2KA 3EWYA 5A5WA 5HMSA 1GYNA 4WJEA 3NXFA 2B0MA 3LM7A 1E51A 1HO1A 2JGQA 2NWRA 2YSWA 4ZQNA 4FB7A 1VPXA 4JY8A 4M6VA 2Y88A 1UASA 1W5OA 4P61A 2Y61A 3QSRA 1O60A 1X1ZA 5AC8A 3UWWA 3BO9A 1I8JA 2QAPA 4AHOA 1TPC1 3DFSA 3IVSA 3L2IA 4W9TA 4IMDA 2R94A 4UNKA 2E09A 4JR5A 1MZHA 1TRDA 1GJPA 1R2TA 4L4MA 3UQNA 1I4NA 4FIQA 2Y7GA 3S5YA 4KKXA 2V8ZA 2X1RA 3V1PA 2Q3OA 5DN1A 3BARA 1KTNA 1OFRA 3NQGA 3S8HA 2ZBTA 5I3JA 1FXPA 4JTTA 1JCLA 3IIXA 4JTEA 2NX3A 3MI2A 2IQTA 3HB9A 2ZTKA 3DI1A 2NUWA 4GUFA 1ML1A 3FIGA 4WX2A 5FEZA 2VEKA 4UMCA 2A21A 2TRSA 3W7DA 2Y62A 1XBZA 2QCDA 4O8RA 1EPXA 1QPOA 3GDTA 2WKJA 3LI0A 4XTIA 2XFWA 1T96A 3L9CA 1MEHA 2OMAA 1LRNA 4WY0A 3LCGA 3FLUA 1H7RA 2V82A 1TPFA 2DZUA 5HUOA 3TE9A 3LCXA 1LBLA 2VXNA 1W5NA 4O4WA 3LLDA 4JTGA 4LOCA 5D2XA 4O1BA 3W7EA 1F74A 4TU1A 2PCQA 4FX8A 2FPTA 3NQ6A 4AEOA 4O50A 2ZRXA 2YW3A 4Q32A 3EWBX 1K7XA 3K30A 2EKCA 4UFIA 1VJIA 2YFOA 2QCMA 3WFAA 5FESA 4IMEA 2C19A 4TX9A 1TIMA 1W54A 5G2HA 4AF0A 2BLEA 1KV8A 3I68A 3DFNA 1PCWA 4OV9A 3S1UA 4BWLA 3ANYA 4ICNA 3TFCA 2V5LA 2HS6A 4XWUA 1MO0A 3GDMA 4O53A 1SO6A 5D30A 4AWSA 2RDTA 4RXFA 5D2VA 5AB3A 5G1TA 2Y70A 3CLMA 1GVFA 4DBEA 3L68A 3LXAA 2QJHA 4L4LA 1JJKA 1EP2A 2DZPA 5HWMA 4GC4A 1Y0EA 3TW7A 2Z6JA 1IXNA 3TK7A 2DZSA 3W2JA 3TC7A 4BF9A 1FY6A 3TCEA 1IIHA 1DV7A 4FNRA 3WJXA 4PFMA 2QAFA 1NFBA 1P0NA 3NPXA 4JIQA 4O4VA 2GOUA 3DU0A 4O0KA 3KRSA 3M1ZA 1YYAA 1VRDA 2VFGA 4XBKA 3BLEA 3L0GA 3VE7A 3G1DA 3JRKA 2WPBA 3GAYA 3MBDA 1TPVA 3NNTA 1JCNA 4X22A 4X9SA 5K9XA 3W1QA 4AF0B 4MFEA 1OF8A 2Y89A 3L5AA 4M5PA 4JTLA 3W7PA 3HGSA 2NX1A 4LU0A 3FJLA 1O5XA 1AW5A 4FNUA 1MXSA 3P8IA 3G18A 2WQPA 3LTSA 3LRKA 4LW7A 1W8SA 5HWJA 3UWZA 2PRHA 3LCIA 2A7PA 5AHIA 5CKSA 4IXXA 2AQWA 2GJLA 3M9YA 4UFMA 3SSJA 4S2BA 1TYGA 3PM6A 2GQAA 1KBJA 3WJYA 3A21A 4ADUA 4ZQCA 3HG2A 4LT9A 3DBPA 4UTJA 1LOQA 3MI6A 5DXXA 3PUDA 5HR7A 4FNQA 3P62A 3KFTA 2DP3A 3TFXA 3SI9A 2A6NA 1GQNA 3U6WA 4O12A 4ALDA 2Y63A 1U83A 2YZRA 3I6RA 2V5BA 4CNOA 1QAPA 4JTSA 3O06A 4RX0A 3GDRA 1A50A 1OFPA 1X6UA 1G4EA 2FB2A 5FF3A 1OYBA 4EF9A 3GXTA 1SZNA 4A2RA 5AHFA 4KFNA 4QSHA 3R2GA 2RH9A 1KFEA 3EWZA 2W0UA 3A22A 3QSTA 5AC7A 4XKYA 1B4EA 3F1QA 1LDCA 5EMUA 2V30A 5EKYA 3WJWA 5LNRA 3W1NA 1MSSA 5G2IA 3W7IA 4WOZA 3CWOX 3N34A 1W56A 2YGYA 2RDWA 1MEWA 3M5XA 3G22A 1DORA 3W2NA 2ZA2A 3THAA 4P2VA 1O5KA 4Y6GA 1YXYA 3A9IA 4WQ6A 4ADSA 3BLFA 1OYCA 4FHAA 5FI8A 1KFCA 4LS2A 1O94A 1LTDA 2E68A 2OCZA 2H90A 4HN4A 2V81A 2NXIA 1LM1A 3I7SA 3FYPA 1ZJIA 1QDSA 1ZFJA 2Z2UA 3OHIA 4IMCA 3TR2A 4AH7A 3MYPA 3OEXA 5T26A 1K03A 1WDWA 4EVZA 3GR8A 3W7MA 4RZ6A 3LHYA 3TQVA 5AN7A 1H1YA 1KM5A 3S5NA 1OHLA 4NU7A 5CZJA 3ZS4A 1C9DA 4DO4A 3B0PA 3C6CA 1HTIA 1QNVA 3HF3A 3MO7A 2QEZA 2JGYA 4UMAA 1K3UA 3T40A 4Z1AA 1EA0A 1SO4A 2GPTA 2ISSA 4NNBA 5AOUA 3PY2A 3HBLA 3A23A 2A7NA 3LBMA 1XUZA 4U4MA 2Q8ZA 4HPXA 3O1NA 2E5DA 3IIVA 4K7YA 1XL9A 5AYZA 3O6DA 3SW6A 1SZGA 3B03A 3NG3A 2V9DA 4Z0JA 1GPWA 1QPQA 4NJHA 1P1XA 3KVJA 3WK2A 2ZZ4A 3OVRA 4N9DA 1I2RA 3F03K 4TIMA 4O11A 4JYFA 3EWUA 3G8EA 3R5EA 1FUYA 3M5ZA 5EPDA 5BMWA 3TH6A 3OA3A 4IOTA 3B04A 3W22A 2BSLA 4UFHA 5C6MA 5D03A 3QJAA 4QIUA 1RQEA 4JTJA 4BI6A 1UUOA 1KLZA 3C2EA 4UFKA 1W0MA 1FWRA 1SO3A 1H7NA 4Z1DA 3Q37A 1IF2A 4QNEA 1XCFA 4JYDA 4WD0A 3UD6A 4AAJA 2J27A 5CPMA 3PBUA 5D38A 2PC4A 2Y7DA 4GUHA 2ZRZA 1XI3A 3DFTA 3O63A 3W1XA 3GVGA 4BK9A 1SFJA 4N9EA 5J5DA 5E1QA 2Z1BA 3GR7A 4UC5A 3W83A 1EWDA 3NVTA 4M7TA 3W7CA 4GUIA 2ZZ6A 3S1VA 3TNOA 3M6YA 2FPYA 3DXIA 1TPB1 4MY8A 2I9EA 1TV5A 1LLZA 1V5XA 1DJNA 1JCJA 4QJ1A 2ZA1A 3P7YA 1VH7A 3WK0A 4X2RA 2CWNA 4UR8A 4CQ8A 5U4NA 1TTJA 3HQ1A 4JXCA 4HIBA 3OG3A 4DO5A 4HNUA 3LV5A 3T55A 2FB3A 3C8FA 4ZMGA 3GLCA 1A5BA 4XKYB 1N55A 3MHFA 3IVTA 5CGQA 1FBAA 3VI2A 3B0UX 3W7HA 4EWND 1VLIA 3W71A 5LKYA 2GVGA 4AWTA 3LHZA 2ZZ2A 3O15A 1PS9A 3HPXA 3VFLA 4HT3A 3PBWA 4NUWA 4O1DA 4RR4A 3CIWA 5F4SA 3UNDA 1QOQA 1PHQA 3EX4A 3P61A 2NXHA 3IVUA 3PC0A 3DKJA 3HO8A 5F1VA 3GDLA 3RNDA 1F6PA 1F2JA 5G4EA 1OJXA 2J24A 2C0AA 5BMXA 5EBUA 1NF7A 3A5VA 3EB2A 2CLMA 3GDKA 1P0KA 3C0JA 3M5VA 4BWLC 3V75A 4O1AA 3S0CA 2C1HA 4K6AA 5D05A 3G1FA 3G0SA 2AAMA 4X3ZA 4GXMA 2GQ9A 2C3ZA 4PL2A 3P81A 4E0CA 3IEBA 3KHJA 2H8XA 4JTIA 3CB8A 5FF4A 5AHEA 4RXGA 2NWSA 4JTKA 4CNNA 1OFAA 1YADA 3NR0A 1BEUA 3N2MA 1A5SA 4RZ5A 1K02A 2TMDA 1OVDA 3L0NA 4K8EA 1DQXA 4DELA 1G6CA 1KFBA 5LGZA 4LWWA 3L0KA 2EGZA 1YPIA
chains in the Genus database with same CATH superfamily
5AHMA 2R1PA 4IJRA 3BV7A 5DF0A 3NDOA 4DYJA 4UIOA 3L2LA 4CNPA 2PGFA 1JUEA 3SDOA 3HQOA 3RJYA 4KCVA 3UY7A 1EJXC 4JD4A 1LWJA 4L7ZA 1WB0A 4E4UA 3EEZA 1ZS2A 3VDAA 1ZJBA 4BR1A 3GE7A 1DWHM 2QCLA 1RJPA 4ZE5A 3M0KA 1SYTA 1TMQA 2W9MA 1XYFA 4LX4A 1Q6EA 4O54A 2VC5A 5C54A 3NQVA 3SUTA 2H9AA 4R27A 3F4WA 4EPEC 2CLLA 2DSUA 2WWDA 2WSRA 3C2FA 1JPMA 4JFTA 3SUUA 2RGMA 2YB4A 3CH0A 3E74A 2C8NA 3LXBA 3R8GA 2VFHA 2OSXA 1KR1A 3F4CA 3AS0A 1R47A 2WW5A 2Y8KA 3C0LA 4ZB0A 4YJ5A 2J77A 3VD7A 4UTTC 4ZOCA 1W3TA 1XLKA 3IGUA 3UZJA 1U5VA 3WEZA 1AD4A 1ZZMA 2BP1A 2KX9A 1SUXA 3SGGA 1NM9A 2GVEA 2XU2A 1TZ7A 1QI3A 3N14A 1DJZA 3OLIA 4NL1A 2DT1A 1XSIA 1Y5VA 2WVVB 3QKEA 5F2LA 2WSQA 1ONEA 4IWWA 3SN1A 1FWWA 3K2GA 1F73A 2ACQA 2PURA 4CQAA 1M41A 4CLMA 1G4PA 3C4UA 4L1GA 3FYOA 3WNMA 5D4YA 1TTQA 2QVHA 2VR5A 1XIMA 3LLFA 3QMTA 2HBVA 3AHYA 3LHWA 4C6IA 1WAUA 4DNMA 5M1TA 3NQ2A 2WK2A 3H2CA 3WH8A 1K8XA 5DO8A 3W7KA 1H50A 2GUBA 3XINA 4PMVA 4ZTYA 2I7GA 1DXFA 4WKFA 4IQEA 2FDSA 3TJLA 3TJIA 4FP1A 5CSUA 4DBWA 1UG6A 1Q3NA 2V6AA 3TN4A 2D0GA 3DHDA 2J4GA 2HVOA 4RL3A 1JD7A 1Z69A 2ZXBA 3BG5A 1HQTA 1L6WA 3BJTA 3EX1A 4IUOA 3GAKA 2OWCA 3GHUA 4AXNA 4C6CA 1F3EA 4N4QA 4NVTA 5CZKA 3IAQA 5HQEA 3UPMA 3VIHA 1K9EA 1K9TA 3NGJA 3EPMA 2A1YA 2YL8A 4M81A 1SSDA 4A4AA 2PDIA 4UFLA 1SVDA 5BOOA 2PDFA 2EPOA 2P10A 3OPSA 1DJWA 2YA2A 1AK5A 3VCNA 1RR2A 4U28A 3UCDA 3HG5A 4Q4PA 4UFJA 3TNBA 4TV6A 4K2SA 1L9WA 3NQ8A 3EBVA 3G6LA 5FSEC 1VHCA 4WIWA 4LVFA 2PTYA 2WLYA 1OX5A 5I2UA 4D1IA 3HGRA 1JAEA 5B7ZA 1V79A 1T8QA 4JN6A 2PPGA 3G1VA 1HJXA 1DWFM 3ZR4A 4E8DA 1V7YA 4GZIA 2GSEA 4XKMA 3W24A 3TU9A 1VFTA 2V3FA 4LCRA 2FLIA 3MANA 1UZDA 2OQYA 2B81A 2J62A 1SZFA 1F6YA 1NOUA 4NXSA 1UCWA 2C6QA 2VGGA 4EPDC 4E8CA 3BK0A 3W00A 3AJXA 4JKMA 1FWCC 4YL2A 4JZ5A 3TV8A 4D2JA 3LPGA 3W07A 2P50A 2W61A 3UY8A 4GYPC 4F48A 4B15A 1SR9A 1UA7A 3QPYA 2GJXA 1PDYA 1L6SA 3WCZA 3W23A 2UZ9A 4DJEC 3MP4A 3BG9A 1XICA 3UPWA 3T9PA 1H7XA 3V4BA 5M03A 2ADAA 3VNLA 2V3GA 4QJ3B 5I3GA 2Y5EA 4C1NB 1M04A 1F6KA 1UJQA 2W6RA 4O10A 5E9XA 1H5VA 4I5XA 3UJFA 3GIYA 5H2ZA 2BY3A 2C79A 3WLPA 2F8QA 3NCOA 3WH6A 4NYUA 1EQCA 5E6YA 4QAWA 5FF0A 1R9XA 4AD5A 4F8XA 1TIWA 1SSGA 2OEJA 4R34A 3L5LA 1A0DA 1DHKA 1TX2A 1VPQA 2OX1A 3B06A 4C6LA 5SWUA 4H8UA 3HMCA 2VP8A 5GNXA 2WSKA 1AZ2A 1A5AA 3KRBA 1QJWA 3NPWA 5FJJA 2BGNE 4ZODA 2D0HA 2B4GA 4PUUA 1ISVA 4AHQA 1G4TA 3DFQA 4MHBA 4W93A 4DUVA 2FGZA 1JFHA 1TWIA 1XS2A 2ZZ3A 3R89A 4LALA 3ELFA 2JF7A 5A6MA 1Q6RA 2DDXA 1VGAA 4QR6A 5LIKX 4Z2IA 3DYOA 1OC6A 2YPIA 2VZVA 1QCWA 1B5TA 4N42A 2FGBA 2NZLA 1NY1A 3IV3A 2ZRUA 3BSGA 3VC5A 1GUVA 3EDEA 5KZEA 3PWAA 3W7LA 1MVYA 1E0XA 1UROA 4UQDA 3LZ3A 3UJRA 3VNMA 4NF7A 4IP5A 4KETA 2J7BA 3V3WA 3AIEA 4AIBA 2E0PA 4JFUA 4NAEB 1JYNA 4IIBA 3CC1A 4AZCA 4PR4A 4KWWA 1XINA 2ESCA 4ZB2A 5FJIA 3HIJA 1BKSA 1KTBA 1BYBA 1D2KA 3NPUA 2QVNA 3N15A 3N73A 1KBBA 2B7PA 3GZ3A 4AC1X 1JZ5A 4W7VA 1AH4A 2BY2A 3R6IA 3SO7A 5A8NA 1CXKA 2ZQ0A 3A4XA 3CUGA 4F2UA 3ABSA 3KOWA 4YVXA 1NFGA 4DUWA 3WLQA 3KRUA 3S6OA 3T44A 1BXBA 1ISXA 2NV9A 5LNVA 3CQIA 3S2MA 4ACZB 1TV2A 2XFFA 4W7UA 4UQEA 4XK2A 2TSYA 4UTWC 2HVNA 3L2MA 5TIMA 4MWAB 3UGVA 1Z48A 1V6UA 3UETA 2UBPC 2GGJA 3KVMA 1RPXA 5C9UA 1ME7A 4IFRA 1E6QM 3STEA 3GVVA 3OZOA 3WJZA 1E0VA 2IMRA 1O7AA 1SW7A 3DZ1A 4TVCA 4REQB 1TREA 5I0DA 3PSVA 1DWIM 1XLAA 4TVDA 2PDKA 4UTWA 4UTMA 2DT2A 1X1NA 5D02A 1YTEA 1RLCL 3NZRA 3SUSA 2J9YA 1F5ZA 1VJSA 3II1A 3KX6A 3KZSA 1MFUA 2VDGA 1E9ZB 4Q8OA 3BG3A 1KM2A 2VFIA 1Z7AA 2ISVA 4S1FA 2QCDB 2WNWA 3IJQA 4Q4OA 3HJEA 2TYSA 3OIXA 4RE4A 2HCVA 4OKDA 3W88A 2OPJA 1ZJAA 3BMWA 5A6LA 4JNMA 1RZMA 1C7TA 2PWFA 4UXDA 4O16A 1TTIA 3PP7A 3ABRA 1UJPA 1MNZA 3PJWA 2B7QA 3R12A 1V3IA 3P0WA 3W7QA 3CEUA 1UD3A 2VDIA 5BXSA 5K9CA 4GY7A 3GTNA 1CIUA 4CU8A 3IJ8A 1I2NA 2RJGA 3Q2DA 3G1RA 1ITUA 3NZQA 2V5JA 4F0HA 1Q8AA 3W6LA 4EP8C 3TONA 3TSMA 1HIZA 5F7UA 1PKMA 3QC0A 5DBTA 3EX3A 3PUOA 3THQA 1HXJA 3JW7A 2G3MA 1T8XA 1PTGA 3MDUA 2CLOA 4GD0A 1V6YA 2NX9A 4QITA 4L65A 3T4CA 2OO0A 4J3UA 3NEVA 4JICA 1F3WA 3MO4A 4RNFA 3VABA 2QF7A 1NWTA 5ECVA 3LXCA 2RUSA 4XISA 1R7AA 2Y5SA 1TQXA 1GTHA 1VFHA 2PBOA 4Y9MA 1WXJA 3L12A 3W2MA 4Z2LA 2J9XA 2FZDA 1QNOA 1YMYA 4XZIA 4HU8A 4QQ3A 1VLWA 4JCMA 3PHAA 1FWDC 3VNZA 3W3OA 4HNLA 1O95A 1HKWA 3LYEA 3KBJA 1LOSA 3UZXA 4XSMA 4Z1BA 4B16A 4TTUA 1ZAIA 3NDZA 1PIIA 1JUBA 1S5NA 3CAQA 5KINA 1XIIA 1GVSA 5CG7A 4P8VA 1WBJA 5I7GA 3IGHX 3JS3A 3HURA 4PEKA 2VR2A 3IANA 4ZVJA 1C8VA 3RG6A 1A4MA 4O57A 2CITA 3VIJA 4DJDA 5JUVA 4UTLA 3NOYA 4XZMX 1XM3A 1BFNA 4BJHA 1CXFA 1ME8A 1PZ2A 4GISA 2WZTA 4DX3A 2BTMA 4O14A 1HW6A 2ZUWA 2HSAA 2PD5A 1FA2A 4NRRA 1CGYA 2C16A 3M44A 2NVDA 3EB4A 3FSTA 1M7OA 1XIDA 1TCMA 3FS2A 1RCXB 1MXGA 2P0OA 4CUCA 1ISZA 4S39A 1CEOA 4LB4A 1MRQA 2C14A 3SCWA 3H2FA 2WHKA 4AD0A 3V7PA 3G1AA 4N9CA 5A8PA 5FKYA 4GJIA 2DZWA 3LTYA 4O13A 4O1EA 3IARA 4FR1A 2QIIA 1J10A 5L6UA 2QCNA 4D6FA 4FNPA 1J9YA 1J2WA 1OX4B 1LL7A 4NZJA 3SIZA 3Q4DA 3SFKA 1AQ0A 3WL1A 3OBAA 4GMEA 1JRCA 3MMDA 3QYQA 1V0LA 1BVZA 4F9JA 2PDMA 4FIRA 4HJWA 3PZGA 1QOPA 3BOLA 2ZZ5A 1A80A 4KFPA 5G2WA 2CLKA 1YPFA 1LOLA 5E9AA 3UXAA 3ARQA 3MTWA 5TQLA 1EJVC 3ZSSA 2A6LA 2I14A 3NZGA 5AC6A 1X6LA 1PO9A 4Q4SA 1VD6A 2C71A 2ZDRA 1LLWA 1WZLA 2EG8A 2XVPA 4PH6A 4MJ2A 4AIEA 3CO8A 3DFOA 3FDKA 1D3HA 4QG6A 9CGTA 3VILA 3EX2A 4V1YA 3MUAA 1WCGA 2XSBA 3TUUA 4UCGA 1J0HA 2HQAA 1H09A 1M6JA 4H9ZA 1EYEA 1Q13A 1QPNA 4C1KA 1OX6A 1GHRA 1KM4A 3OZYA 4MNJA 2E28A 4ORIA 5CPSA 3SFWA 1G0CA 4GQRA 1R9YA 3WG6A 2XZ7A 3HA1A 1FFRA 3CU2A 1KGWA 1O12A 3WBAA 4PFHA 5JBDA 1ICQA 1YTKA 1VBGA 2Z7KA 1OINA 2D73A 5LNWA 1VR6A 2GVYA 1UUMA 5T9CE 4N6EA 5I23A 4YCPA 2CESA 1MRAA 1RQBA 1TV3A 2YKKA 2O0TA 4HHLA 3EOSA 1BAGA 4LAUA 3QGVA 2Q3RA 4XG1A 3ERPA 4AHPA 4LVGA 4NQ1A 3ITOA 5CPQA 1EXPA 1NWSA 1IGSA 3H12A 3GB6A 4W5UA 2CLEA 2ZIDA 2TAAA 1SJBA 3N19B 2HBXA 4G5DA 8XIMA 5A8MA 4EIVA 4AB4A 2EPKX 4GCAA 3TQPA 1BGAA 4ZB5A 2WHLA 2W62A 3LS9A 4NRSA 5U7SA 1QW9A 1XDLA 3ALGA 3FJNA 3P67A 3SRKA 2CBVA 3W81A 1S5TA 2X7WA 3F5JA 1DJXA 3RF9A 1I9CB 2PWVA 5IHRA 1PZ1A 2QKFA 1NDZA 3BCDA 1RCQA 2WCAA 5HQLA 3O6CA 1HL8A 3M6DA 4D6GA 4XAPA 3M4HA 2ZZ1A 5CPNA 4FEZA 2XN1A 3QV8A 2A85A 4LRSA 4XO6A 4H6EA 3SY1A 1DE5A 1P6BA 4GNVA 3EKGA 1Q2SA 1OZMA 3QQ1A 4PUDA 1JFXA 3NIYA 3H21A 3MA8A 2XFYA 3URAA 4NJJA 4MFDA 4DXVA 2ZUUA 3SN0A 4NXKA 4FXRA 5HULA 3HG3A 1EIBA 4XV0A 2QULA 1F8MA 1FCBA 1SFSA 1N7KA 1U33A 1OWQA 2A0NA 4GBUA 2IXUA 3AZTA 3QV7A 3JR2A 2DH3A 1E1CA 1TG7A 5TBOA 3BAYA 2E6AA 2OGYA 1C9WA 1NVMA 4GIEA 2WPGA 3F2DA 1KCKA 3VIIA 1D3GA 4NKCA 1I6NA 3CL8A 3G0XA 4A3QA 1E71M 1FWTA 3V1HA 2V5CA 1TZ9A 2JKPA 3D47A 3M0LA 1ZUAX 2ZTJA 1DVJA 5ABEA 5K7JA 5LSMA 2QS8A 4QLLA 4HQVA 3QEZA 3UEQA 3IIPA 3LM3A 2OELA 2OU4A 3S5SA 5IBXC 5HUPA 2VRQA 3B0VC 3NYZA 3EWWA 1I2PA 5D09A 1GVYA 2OKOA 3RILA 3W1UA 2C0HA 1A5CA 4UWMA 2E1DA 4DVOA 5CBIA 2I5GA 3RIKA 2PP3A 2X41A 1PWLA 3ARYA 2Q8LA 3UR2A 4G7FA 2CZEA 2OX4A 1F76A 1R3QA 3AS1A 4GVGA 1ZBKA 3D5HA 1H49A 3O2LA 3WMBA 4ZQPA 2YCLA 1P5BA 3WYZA 3GXFA 1WX0A 1ITCA 1EHNA 4GKLA 2YDQA 3S1GA 3W02A 1W1YA 3CTLA 1KCZA 3AIRA 5CPOA 3QRHA 2R6OA 2OZ0A 4MZ1A 3A5FA 3SSZA 4JTCA 4LRTA 4WKAA 1UD2A 5I79A 4JHOA 1J18A 3IPWA 1J12A 5HANA 3K4WA 1KO0A 4ERAA 1B54A 5E93A 1VYRA 4FF7A 2BNJA 2NQHA 1BXCA 1Z44A 3LEPA 4R5EA 3PZMA 3VAVA 3WF0A 5CPLA 4PTNA 1GTEA 4IPIA 3UXIA 1YXDA 4GK8A 4S3GA 4KH2A 4JX5A 1R3WA 2J78A 2J6VA 1DJGA 3ZMRA 1B3ZA 2O7SA 1UQZA 1QBBA 7REQA 1E43A 4D6EA 4MDOA 4JN8A 1OT2A 3TAKA 2IQDA 4GOAA 3IGXA 4M6QA 1HL9A 2FVLA 3MMTA 4J9JA 2W79A 4CD7A 3CB3A 1DJIA 3E02A 7TIMA 5LNUA 2FQIA 4H83A 3T1GA 2V0TA 1R0MA 5A5WA 1GYNA 3UR7A 4DBUA 1PTAA 4ZQNA 4FB7A 4M6VA 4MDPA 1UASA 4GC3A 3BAXA 1X98A 1W5OA 3LK6A 4HCHA 4CD4A 4HHMA 5HJXA 1O60A 3BZGA 3WL0A 1IT0A 1J2BA 2QAPA 4AHOA 2D69A 3KS5A 3L2IA 4K68A 2Y8VA 1TE6A 2PFHA 1WDQA 4JR5A 3KBSA 1SR0A 3CZJA 3OVGA 3UW6A 1UZHA 4KKXA 4H9VA 2V8ZA 2Q3OA 3PK7A 1OFRA 1ADSA 4G8TA 1FXPA 4RPQA 4QROA 3IIXA 2NX3A 2IQTA 4UB9A 3HB9A 2ZTKA 1JI1A 4UOJA 4KIRA 2V3EA 3U7VA 2INZA 4GO8A 4O8RA 2RDXA 2R9RA 2W66A 2WKJA 2XFWA 2I5IA 4YHEA 3E0VA 4B5VA 1PDZA 1H7RA 3B0XA 1NFPA 1UWRA 3APYA 2QLYA 2VXNA 3QFWA 3QVQA 3GBEA 4O4WA 3LLDA 2BHYA 3ARPA 4DUXA 4LOCA 1H3GA 1TWWA 5M5DA 1A3XA 4W7WA 2FPTA 3OZPA 1ZLPA 2EKCA 1E3ZA 4PUWA 3B8VA 2QCMA 4IMEA 3CK5A 4NASA 1D3CA 1W9UA 2BLEA 1KV8A 4J3SA 3DFNA 4XVDA 3S1UA 2HNEA 3CV7A 1ONXA 2PI6A 2VGBA 4A6GA 1R3TA 3B9NA 1UPPA 3I4KA 1FWJC 1GQIA 2YCLB 1SO6A 1XV8A 2PZ0A 5D30A 3EA1A 2D2OA 1W8GA 3GTHA 4AWSA 2RDTA 4RXFA 5AVNA 1MQPA 3WY1A 4HOWA 1EP2A 4LGXA 1Y0EA 4OFCA 1IXNA 3TK7A 3W2JA 2PAJA 1LT8A 2PLCA 4RPPA 2DSKA 5CQ1A 4RDZA 1OCQA 3WDHA 1IIHA 4KEMA 4AW7A 5E6ZA 3M07A 1NFBA 5CGMA 4YTTA 1XLGA 4O0KA 4E3TA 1YYAA 1X97A 3BLEA 3HFTA 3HPAA 2WPBA 3ZVHB 1TPVA 5K9XA 1Q6CA 1JCNA 3O9NA 1AZ1A 5B7YA 2Y89A 4BEUA 2P88A 3GU9A 4FOUA 3WF1A 3OLGA 2O9RA 4GYFA 1MXSA 2W27A 5BU6A 1QK2A 3BC9A 3BMVA 1VEPA 3LTSA 3LRKA 3ZZ1A 4NILA 3UWZA 2QPUA 1EXBA 1J0KA 3LCIA 2A7PA 1GQKA 1EF3A 2PTDA 1C7SA 2AQWA 2GJLA 3M9YA 2ZADA 3PM6A 2E9LA 4CVUA 1EJUC 3BCJA 2I57A 5C2GA 3RR4A 4ZQCA 4QJ5B 4URIA 4UTJA 3AXKA 4JEJA 5DXXA 2OQLA 3PUDA 3LNPA 3VGEA 3S2NA 3SI9A 1XRSA 4PMNA 2Z26A 2UY4A 3CZEA 3BLLA 1CGTA 2OTDA 3HFYA 2Y63A 3MVIA 3ITLA 4GI6A 4CNOA 1A5UA 4JTSA 3DUGA 1XYMA 1XH1A 1XH0A 4A2RA 4KFNA 3HZ3A 3S2LA 4WDWA 3R2GA 4AZGA 3EWZA 4C1NA 9RUBA 3EA3A 4ZOBA 1QT1A 3A22A 4MAVA 3FEQA 4ROPA 3P3BA 1EJWC 5AKQA 2V30A 3WJWA 3BOFA 1J96A 2VWTA 3BLKA 5KZ6A 4GFIA 1MSSA 5G2IA 4HMNA 4WOZA 4QE5A 3WLHA 1W56A 2YGYA 1MEWA 3M5XA 3W2NA 4WQ6A 3J7HA 4DWSC 4M51A 1B3VA 1GQLA 1KFCA 4LS2A 5JH1A 2E68A 1LM1A 4ZFCA 1ZJIA 2JF6A 1QDSA 1EGVA 4DJED 4NZ3A 3TR2A 5LXEA 4J2MA 4F2BA 1K03A 2VX5A 4EVZA 5AYIA 3A3HA 3QKZA 4XD6A 3LHYA 3MKCA 1DWGM 4R9OA 1EZ2A 3T42A 5AN7A 1H1YA 3VGFA 4NU7A 1C9DA 1E6SM 2QV4A 3I6TA 3MVTA 1Y65A 4DO4A 3B0PA 3C6CA 4NI8A 1YKWA 3MO7A 5CAHA 1P1MA 4UMAA 1NTHA 4UQCA 2Z1VA 2XIMA 2E40A 4C7DA 1EDGA 1VFUA 2A7NA 1GOOA 1G01A 1C92A 4KQNA 2Q8ZA 1KBLA 3DFHA 3B03A 2J7HA 3VD5A 4Z0JA 1QPQA 3N12A 5HOSA 4LAZA 1YDYA 3V5OA 2IXVA 4CCZA 5J8LA 3OVRA 4FZIA 1GVIA 3F03K 3W27A 4LEQA 3EWUA 3ARSA 3RLHA 3R5EA 1FUYA 5EPDA 1TWDA 2Z1SA 3OW1A 2J7EA 5C6MA 3QJAA 2PDCA 3EWDA 5DMNA 1KLZA 3W37A 3E0WA 1SO3A 1H7NA 3UXKA 4QG8A 5A95A 2QMKA 1OQFA 5C9WA 4JYDA 4AAJA 4WD0A 2J27A 2OEKA 3PBUA 2ZUTA 2Y7DA 1F9CA 3ARXA 2FZBA 3GIQA 1PKLA 2W4XA 4HZ6A 4YTSA 2CCRA 2P8BA 3BL3A 3O63A 1KBKA 2Z1BA 3GR7A 4UC5A 3NVTA 1WZAA 3WKZA 2QDDA 4AY8A 2Q09A 3DXIA 4MY8A 4DY1A 1TV5A 1LLZA 1DJNA 1ISWA 1LUCA 2VDHA 4FOKA 4ERIA 1JF5A 2ZA1A 1V8EA 3PNZA 4DI8A 3WK0A 1GHSA 4UR8A 4CQ8A 3VOHA 1TTJA 2XWEA 4HIBA 1E1EA 3T55A 3KCLA 1PB0A 1A5BA 3L23A 1UW9A 1FBAA 2BOFX 2WQDA 3GNRA 3W7HA 3UR8A 1AODA 1LQ0A 3WMLA 4LYKA 2ZZ2A 3U9IA 1PS9A 4H2CA 2PLMA 3PBWA 4A8LA 1JZ7A 4HTYA 3EA2A 2WCSA 4RR4A 4MM1A 5FJTA 3SAZA 3LQLA 3IVUA 1TJ1A 3HO8A 4C6OA 5E0FA 3DHPA 4US6A 3OO2A 1CZ1A 1QNRA 1F6PA 1F2JA 4PB3A 1OJXA 3A5VA 5ABFA 2X0SA 3M5VA 1XLIA 1QXLA 5C9RA 2BY0A 4GXMA 4PL2A 3P81A 4PMJA 1WDSA 4JTIA 3CB8A 5AHEA 1B3XA 2ZUVA 4RXGA 4I5RA 4JTKA 4PB4A 4DM2A 2F9RA 3N2MA 1K02A 2TMDA 1OVDA 4L1XA 2ZC1A 2Q71A 3VIGA 5LGZA 5JMUA 5G1MA 3VX0A 3VIFA 5HK4A 5IDZA 3L0KA 4L6DA 3S9IA 4Q8VA 5FOOA 3MPGA 3OODA 3WH9A 3L66A 1VZWA 2D0FA 1UD5A 1IEIA 3B0YA 1L2QA 1XLLA 3KL5A 4OV4A 2D24A 2J8TA 1PKYA 3GO2A 1JCYA 2QUVA 4UTKA 1EJTC 3UG3A 4IMAA 3GNNA 4MPKA 3KL3A 3AZSA 2C18A 2AMGA 5EY5A 3SBFA 4HN8A 4POCA 2EF9A 4LF1A 4Z2HA 5F4XA 3PUEA 1H63A 2ACSA 3AYTA 3GHRA 4R33A 2CHNA 1S3TC 7REQB 2PE4A 1XIEA 4REQA 1XG3A 3AS3A 1A4LA 4JIRA 2O9OA 5AHLA 3BDKA 2WZHA 3QMRA 2QJIA 1CW2A 4IF2A 3L5MA 5F2IA 2PGRA 1NIUA 1UR3M 1EL3A 2PU1A 3N3MA 4KEUA 4D6IA 3I3EA 2BX7A 1GKRA 3MI3A 5BXTA 1ISYA 2CWXA 4F66A 1K6WA 3R0DA 4XZLX 4MY9A 1TO3A 4I7WA 1J79A 3AHVA 1JVNA 2QYGA 1VCFA 3MSRA 4RJEA 1NELA 1QMLA 3AISA 2G95A 4DWDA 1VBUA 3FKRA 4PMZA 4QFUA 3WNLA 4IPNB 1JQVA 3P60A 3UESA 1EB3A 5T91A 1GOKA 4MIMA 3M0ZA 2QDHA 4HHHA 4J28A 4IIGA 4F9DA 2J13A 3TXZA 3UYIA 3KLKA 3FA5A 4H9MA 2V2HA 3TROA 5CJMA 4M24A 3QZAA 1Q5MA 4IMGA 4AWEA 3FXYA 3KVKA 3Q45A 2YR1A 2CKRA 3VDHA 2UY2A 3RYSA 3AALA 1MDRA 3OBKA 3WUEA 3KOFA 2JFEX 3FX4A 2V5DA 3CIVA 3WENA 1Q85A 3DDMA 5DRCA 1RJRA 1J0JA 2GK1A 5HNTA 1KRCC 1IXPA 4Q8PA 1AW2A 4E5TA 4UTUA 3W01A 5LA0A 4JIPA 3HPZA 3KEHA 1XLDA 1F4HA 5C70A 2H3DA 3UJSA 1TTPA 4GBDA 1Q6DA 5IM51 1IXOA 4HSHA 4IGHA 4BFAA 1KW1A 4ZO7A 3G1YA 4X9YA 2WMFA 1W1TA 3PS7A 3ARZA 2FHBA 3H7UA 5JIPA 4JPGA 2EEXA 5FEWA 2D2GA 2GJNA 4GGBA 1LORA 4DJFD 4G1KA 1RXOB 4UMBA 2GJXB 4OT7A 4K36A 1WBHA 5JBEA 1V3HA 4OQVA 4L9ZA 1EH9A 4ACZA 5E09A 5BOFA 3LMZA 3PSWA 4DXXA 2VEGA 3CZKA 2XIJA 4ZFMA 4J40A 1OD0A 1POKA 4AZ7A 1HKJA 3EYPA 2AL2B 4QJ4B 2E6FA 2PMQA 3VE9A 3G24A 4Z2JA 1U5JA 1A3WA 6CGTA 4DHGA 3VDBA 3KDOA 1DEDA 1FDZA 4PUJA 2GGEA 2AAAA 1UKSA 2E3ZA 1XKJA 1FCQA 3H70A 2VQUA 2GDUA 3R1ZA 1JCXA 2OR2A 3N4EA 1GONA 1IXQA 3NL3A 1WV2A 1US0A 5A2CA 3HMJG 2ZRVA 2AQVA 4ORMA 1NU5A 3G6MA 3UZ5A 4DBSA 4LYQA 3OGSA 1DJYA 4Q3MA 1R85A 4HPJA 2A2IA 4EXQA 4HU0A 3O8AA 5BU9A 4AD3A 3P80A 2E5CA 3SCRA 3OLEA 1TKKA 1OFQA 4NJIA 1J0IA 2YJQA 3YPIA 4XTDA 3LU2A 5EMYA 3VM7A 2EXOA 2FTPA 2I17A 1CLVA 2WAGA 4QHRA 1XUUA 5IOBA 1J93A 4TXEA 2WVTA 3B9OA 4ONVA 1A0CA 3ZJ6A 1YBQA 4DRSA 5C9XA 3ABOA 4IIDA 1HZYA 4Y9PA 1RH9A 2ZWZA 2DSVA 1MI3A 3B4UA 2PTWA 4QEEA 3S9ZA 1RBOB 5M2FX 5HNUA 1MW1A 2JKAA 3WF3A 1WZMA 2BXVA 2ZCGA 3UXLA 2VVNA 1S3HA 3LBOA 1UR0A 3S2JA 5HR6A 3R8RA 3DAQA 3GTFA 5GJPA 3QGKC 3NPVA 4NG3A 1ICPA 2HXTA 1IZJA 2JALA 3CUFA 3IJDA 4NI3A 5IXEA 4HMCA 1KR0A 3S6TA 4NSBA 5M3WA 2IS7A 1AW1A 3FA3A 3ORWA 3VKDA 4K38A 1GJUA 3SM0A 4I8YA 1QI5A 3CHCA 3SN4A 3E1F1 3K4AA 1FCUA 2IKJA 3I3DA 1DQWA 1RCOB 7TAAA 5FJPA 3I6EA 1Q4NX 3WD3A 3TLQA 3K1GA 2GOKA 1SQ7A 1XR2A 5BYWA 3HGJA 3CMGA 3H8AA 2IUZA 3LRMA 1CXEA 4UNLA 1U2YA 3CYJA 3TQ0A 3W1RA 3OB8A 1HP4A 4KRTA 4FSAA 4YLWA 4IQDA 1R9ZA 4CD8A 4HSOA 4JTUA 2VOMA 3S9YA 1RY0A 4OZOA 2PRLA 1S5VA 3MUXA 3KP1A 1XLFA 4GY0A 2POZA 3SURA 3W7OA 5AFDA 1H62A 1XDMA 1KRAC 3I3BA 1OG6A 1F07A 3NO1A 1TX0A 2Z25A 4C90A 4DXKA 3GXMA 2XN2A 3MZNA 4J3ZA 5BOEA 4M29A 1F7BA 1JXJA 5EMMA 2R91A 2VCCA 3S5ZA 4WGXA 2VX7A 2ZYFA 3VNJA 1I45A 4YWSA 2MNRA 3GNDA 4GNJA 3IIZA 1Q6OA 4JY9A 1V6XA 4ZXLA 1RQHA 4QAIA 1UYQA 1RVGA 2INFA 2R8WA 3O7UA 2DUXA 2JEQA 4WVXA 1VYSX 2GJPA 3WF2A 5JXQA 4MJZA 1PYFA 2W5FA 5FAJA 4ZSUA 4DPQA 4P5UA 4XZHA 2C91A 3TN5A 3PBMA 2VZTA 4PN2A 2YDAA 3PTKA 4A05A 2E4TA 2PDUA 4JDYA 4PMYA 4DJFC 1JNEA 1HKKA 5HNNA 3CWNA 1H60A 5H8PA 3VXGA 4IG2A 3W6YA 1DJQA 1WKFA 1BTCA 1EO5A 1TWSA 5CSRA 4Z08A 5BRPA 1XIFA 4GYJA 1FDJA 4LAOA 3KTXA 2CC0A 3TSDA 5CZ0A 2HRWA 2D2JA 1GCYA 3BGGA 3GK0A 5CGTA 3ZT5A 2PC8A 1F61A 1EWEA 1W1PA 3T0AA 3QW4B 1E70M 1BHGA 1HO4A 3TMLA 2RGLA 4IGMA 1X38A 5BW6A 1TPUA 3H4GA 4IMFA 5ABTA 3UXDA 4OHQA 4LVAA 2TPSA 2E5BA 4R9XA 3AHZA 2CXGA 3DHFA 4AUBA 3RLUA 2NVCA 4FLSA 1N8WA 2Y6ZA 1S1RA 1W9XA 1RHCA 1ZY9A 3EKZA 3R94A 1PTDA 3QR0A 2CZFA 2VEMA 4JIIX 5PTDA 1QU4A 4LS1A 5K4ZA 3TW9A 1K8ZA 4K1GA 1YRRA 1D8CA 4AZ5A 4HJFA 4LUTA 3WD4A 2AOSA 2V5KA 1X7IA 3BW2A 3MYOA 4LYRA 3GRIA 2E77A 3VIKA 4O0QA 5TNVA 1ZBVA 2Y8UA 4AD2A 1NAL1 2QUUA 1WO2A 1FWNA 3L67A 3EX6A 1UD6A 3WDIA 2CZVA 3A6OA 1DTNA 1V3LA 4I3GA 3RMJA 2G4JA 4WK9A 3T0BA 2NT0A 4JNZA 2RKXA 1VFOA 4LV4A 4MVAA 1P0EA 1TJ2A 5BRBA 2QR6A 2DZVA 4AMCA 5DCDA 3WBWA 3APGA 3PJUA 1V77A 3IWPA 1FQ0A 1W3KA 5AY7A 5EB8A 2VFEA 2WV8A 4D6CA 4U3AA 3CPGA 1VHNA 3E0FA 4J4KA 3PG9A 4Q4MA 3ABXA 2O4QA 1UC5A 3FSUA 3NOEA 4C1LA 2FTWA 3EWCA 1HKIA 1QO5A 3W70A 3NL5A 2YA0A 4TUFA 3BWWA 3T8QA 2DZTA 5FF7A 3CHVA 5D2TA 1T7LA 5DELA 3NJ3A 4PULA 1QTWA 1BVNP 3PB0A 4H8HA 2VEIA 1WQ5A 2BY1A 3W2UA 5KETA 4FLQA 3GTXA 1TELA 4YHGA 5BNKA 3OA5A 2Z0IA 1GG0A 4M0XA 1QASA 3CUXA 2Z24A 1W6TA 1VKFA 1XBYA 4AG0A 1FWSA 8TIMA 2FHFA 3V5CA 2OKTA 3RFAA 4GWEA 3ZYZA 4XD5A 3AIUA 3ITYA 3E3HA 1XC4A 3G8RA 3WELA 4HSNA 3BJSA 3VU2A 2YL5A 4RE0A 2F2HA 2CIPA 2GVLA 2UWFA 1TMHA 3EAUA 2WB5A 2GL5A 3BQ5A 1PKNA 1FHDA 3NQFA 2YIHA 1VFLA 3WLIA 1R2RA 3TN6A 3VVGA 3DESA 3CL7A 3VD4A 4H3DA 1EBGA 1CBGA 2P3ZA 1R86A 5CXPA 3WDPP 3Q58A 3EXTA 1JI2A 1H7WA 4QCEA 5DMMA 3HV8A 3EXRA 1U5HA 4JIHA 3KOYA 2PDGA 3AXXA 4ZZ9A 1W3NA 1TWZA 2H8ZA 4Q8WA 2QIWA 1HX0A 3F4VA 5JBFA 2VC7A 2QUNA 4WEVX 4MAZA 2F61A 3EKLA 4B5SA 5F2MA 1KM6A 4GG9A 3RCNA 1KWKA 3F4NA 4FAMA 4LXFA 3SZ8A 3FVMA 1NSJA 4EX4A 3TYDA 4LV9A 4O15A 3AICA 1IZKA 3DGBA 2YXGA 1SW0A 4XQ6A 3ZWTA 4L80A 1Z42A 2A3CA 3QOMA 2JKEA 2VTFA 1R2SA 2E9MA 3AQUA 5IFTA 4YXGA 3CEPA 2DQWA 5GJNA 1PUDA 3GIPA 3FKKA 1LQ2A 5T9BG 4HNTA 3SADA 1Q6LA 1YW1A 1G67A 5AHNA 3IRDA 3U2OA 5I3FA 4IQLA 1RAKA 2IKHA 3W75A 1KXHA 4GO9A 4PTVA 3E9AA 5EGRA 4JGDA 5AYBA 5G5IA 2BBFA 4ICCX 2ZOXA 2CU0A 1SMDA 4H4IA 3DERA 7CGTA 1PE1A 4GXWA 4QGCA 2WJDA 5C9ZA 2FKPA 3WQ6A 5D37A 3VDGA 4HMDA 1OK4A 2EJAA 2VD8A 3M43A 2R14A 4IM4A 1A47A 1KFKA 3QYSA 3GC5A 1X96A 1JR1A 4GY1A 2V63A 3UFYA 4K7VA 5KZMA 4JL1A 1W3JA 2XWDA 3QC3A 4MB4A 4BQ2A 2G3JA 2BASA 2ISWA 4OTKA 2A4AA 1H61A 2DPEA 3T7VA 1SU5A 1MW2A 2ODOA 1EX5A 3C3UA 5XIAA 3ZO9A 4DBDA 4JKKA 2Y4SA 1IIGA 4GI9A 3A4AA 1W5QA 1CGUA 3I7QA 3F4DA 3W1MA 1XRTA 4IFKA 3I4EA 1HL2A 1QATA 1TV8A 3KAOA 4YYCA 2DGAA 4WSJA 4E4PA 1GQJA 1GOIA 2PA6A 4A22A 4AC7C 3A47A 2YXXA 1EC8A 2VL4A 1PXGA 4GUJA 5LA1A 2E67A 2NQ5A 3WBXA 1THFD 4FF5A 4PODA 1JNDA 4F0SA 4Z0SA 1XPYA 2FVMA 3GW3A 2ICSA 5CC7A 3D0CA 1XD1A 4W85A 4DN1A 3STFA 3UZZA 1M7PA 2PP0A 4IICA 3URBA 1MUCA 1J01A 4Y90A 1SPQA 1XBXA 5CZSA 1KM0A 2XIOA 1QNPA 2OSYA 4AXKA 3UR5A 4LCSA 1Q6FA 2XG9A 3AO0A 4A8NA 4ZOAA 2WO5A 3TZFA 3LB0A 1Y5XA 1EIXA 1GOMA 2D23A 4A35A 3BV4A 5DT7A 1UKQA 4HGXA 1XLCA 5D2WA 3BGJA 4IX0A 4K3ZA 1EFZA 3UWQA 1U22A 9XIAA 3B40A 2EAWA 3AIQA 3W73A 1JPHA 4B9YA 1RD6A 1DQUA 4ZSTA 3ONCA 4PYSA 3UU0A 1Q7MA 1POJA 3CT7A 3WLOA 1CYGA 3UCQA 1K9FA 2WNZA 2E7FA 3P84A 4H00A 4P7NA 1T6MA 4ZEPA 2VENA 4GI4A 5HA7A 3QLDA 4IFOA 6ALDA 3W72A 3TTYA 4LY4A 1WP6A 1ME9A 1S46A 1MW0A 4C6JA 2OLHA 1UUQA 2IQ0A 4CU7A 3VFCA 3N9KA 2H9AB 3RN6A 3F5LA 4GINA 2DW7A 3D3FA 3W76A 4KEZA 4MNKA 2ZWYA 1UP3A 2VELA 2VD9A 4ENLA 1GPFA 2X1UA 3Q67A 4ZQRA 3OG2A 4Q6JA 4IG2B 4P8UA 2G3IA 3C2YA 4Y7EA 1UBSA 1W37A 4OUIA 4YYFA 1CGWA 4J3WA 4DZIA 5FL1A 4I7UA 4MYAA 4EWJA 7ODCA 3F7JA 3GBDA 1G1YA 2R1LA 2J7FA 3NO3A 3TX9A 3HQNA 3R8HA 4DAIA 2WZEA 3C61A 2EG7A 3PULA 3PBVA 1BG9A 3VUSA 1PPIA 2P3EA 1JPDX 2FIQA 3CMFA 1VBRA 3W7JA 5C55A 3SQMA 3T08A 2DUAA 3IUIA 1EBHA 5EL1A 2JQXA 1V0NA 3G0UA 4ZOEA 3LHUA 2WC7A 1M3UA 2GUUA 2XH7A 3W84A 2FH8A 3S5OA 5ABHA 4H01A 1SZEA 4UZSA 4OWGA 1KM3A 2JIEA 3MMUA 3RK8A 1XFBA 4I9MA 5EMKA 2QJGA 3VKAA 1H51A 3H4XA 1LZOA 2DIKA 2ZX8A 1V6VA 2O7QA 2Z1KA 1M53A 4L6OA 4IFKB 3QMSA 4HNVA 4AX7A 3KP0A 1G94A 1WKDA 3H53A 2CZDA 3OU8A 4OIFA 1TFVA 5D9OA 3WQPA 1DYSA 1AFSA 3W2KA 3EWYA 4WJEA 1BYDA 2B0MA 1XYCA 4KMQA 2JGQA 2YCKX 3ECQA 1VPXA 4JY8A 2Y88A 3OQ8A 3VGHA 4P61A 4G6CA 2Y61A 1VEOA 2ZX7A 1X1ZA 4M80A 4FOJA 4RNHA 4TOQA 4DYKA 1TPC1 4K8GA 1E6NA 3IVSA 3C5QA 3DYPA 1O5QA 4IMDA 1MZHA 4L4MA 2XDFA 3IS4A 3S5YA 1N2VA 3S8HA 4AD4A 2AKZA 1VIWA 2VGIA 2ZBTA 4JTTA 1JCLA 3MUIA 2O4MA 1YHTA 1HKVA 2NUWA 3CNYA 4EK7A 1ML1A 3FIGA 4WX2A 5FEZA 2Y2WA 4V27A 4UR9A 3W7DA 3GH4A 1Z9AA 2QCDA 4JQAA 4ZE4A 1MQRA 1UIPA 2PDJA 3WQVA 4B92A 4ZO8A 4WLCA 1LRNA 3LCGA 5A3HA 1TPFA 1I60A 5JVLA 4XO7A 1FWIC 1LBLA 1VFSA 5FJOA 3QHOA 1W5NA 1UR8A 2D2HA 1Y7VA 3QTPA 5D2XA 2PCQA 4FX8A 3NQ6A 1O5RA 2ZRXA 4O50A 3THUA 1ODUA 5GQBA 2Y0FA 4AZHA 2P0IA 3WFAA 4TX9A 1JD9A 4AF0A 1UBPC 4OV9A 3WIJA 3PTQA 2DQXA 3CLWA 1L6GA 3U4AA 4UOZA 4QP0A 4XWUA 3GDMA 4QXIA 2DUZA 1HJSA 4O53A 1NDVA 3W38A 4R88A 5AB3A 2Y70A 4WCJA 1GVFA 4DBEA 3L68A 3LXAA 5BZAA 2YL6A 2QJHA 4L4LA 2DZPA 4GC4A 3TW7A 1XCWA 3KBWA 4BF9A 3H2AA 2YA1A 3N13A 3COTA 1XD0A 5D8WA 1AUSL 3V0UA 3ARWA 1P0NA 3T07A 4XAYA 3NSXA 1ITQA 4L61A 3GAYA 3MBDA 4AF0B 3N2BA 4H9UA 3OYXA 3SRDA 3VTRA 5I78A 3IV8A 1LWIA 2Z7GA 3LA4A 3M0IA 2A3AA 3HGSA 3RX4A 4OBSA 2YL9A 3TN3A 3WBYA 2WQPA 3P2VA 5CLWA 4B2DD 4KF1A 4QLJA 2NSXA 1IHIA 2PRHA 4I5UA 5CKSA 3TOPA 4YU1A 2I16A 3SSJA 1TYGA 2WBGA 3T09A 1BD0A 2CERA 1SM9A 2A79A 4LT9A 1UC4A 2ZC8A 3QHMA 4FNQA 3KFTA 2OLAA 1MQQA 2A6NA 3WFLA 3F2CA 3BZJA 1X39A 2CLPA 4M1BA 5A2AA 4H9YA 4AY1A 7A3HA 1E4IA 1U83A 3I6RA 1Z6KA 2V5BA 3VKKA 4WJXA 3MB9A 2XVNA 3O06A 4RX0A 4HK5A 1A50A 1OFPA 3IUDA 1DXIA 2FB2A 3S47A 4EF9A 1RPKA 1LQAA 5EBAA 5JQ9A 1CPUA 1KFEA 1OB0A 1XC6A 3AMDA 1A5KC 3QSTA 5AC7A 2PWUA 3SRHA 4CNUA 1E4NA 3R4IA 4UOQA 1EGZA 5I6SA 1AA1B 5EMUA 4MMWA 3S3GA 2ZX5A 1CLXA 4Z1YA 3W7IA 3SEPA 3UWEA 4NIRA 1R5YA 4KRUA 2D22A 4P2VA 1YXYA 4ADSA 1OYCA 1EJRC 1CXHA 3BJFA 2GUYA 5FI8A 1LJYA 1W2PA 1FWEC 1HJVA 3VOIA 4HN4A 1NOFA 2V81A 2XVLA 1BQCA 2Z2UA 4NY2A 1EZWA 3MSDA 2PDQA 3MYPA 1GOWA 4LUYA 1A3HA 1G9HA 1MZRA 3UNTA 5T26A 3AU2A 3AYVA 3VOFA 2XH2A 5I24A 2AL1A 3TQVA 1IEXA 1C91A 1ZU8A 3S5NA 5CZJA 3KTCA 3GZAA 1HTIA 1GW1A 1QNVA 5CC5A 2QEZA 3K4DA 1AJ0A 3GU2A 8XIAA 1K3UA 5TF0A 4A3YA 1EA0A 1QI4A 1RLDA 1FWAC 4ATDA 2GPTA 4PBEA 2ISSA 4NNBA 4GXPA 5LIXX 4HP5A 4IGNA 2V67A 1SJCA 3H23A 5AOUA 3T2PA 4BA0A 3T6CA 3A23A 1EEXA 3U2CA 5A8OA 4KGJA 3V0TA 1TVLA 1PIFA 1XUZA 5LIUX 4U4MA 4LF2A 1JL8A 4K7YA 3O6DA 1SZGA 3A4JA 1W1IE 3NG3A 2B31A 2V9DA 2A3BA 3MC5A 1GPWA 4KWSA 2QJMA 3ME3A 3NQBA 4MWAC 3KVJA 1KD0A 3B8UA 1VAHA 2ZZ4A 2HISA 4N9DA 5HBFA 1I2RA 3L4YA 4JAWA 2WMKA 8CGTA 4JYFA 3G8EA 3FK4A 4IOTA 3W22A 2V69A 5D03A 3FAXA 1YE4A 1CT5A 1RQEA 2VURA 1UP0A 1IT8A 4UFKA 1FWRA 1E4LA 4BCEA 4LFYA 3V5FA 1IF2A 4XAFA 4B5UA 1KXVA 1EJSC 3ABZA 4S23A 1CXLA 3NYDA 3DFTA 1DIOA 3GVGA 3NGFA 3AZRA 4N9EA 4BK9A 6ENLA 2OO6A 4S3JA 3IJ9A 5JIWA 3RPTA 1I1XA 4M7TA 4BEQA 1WUFA 4GUIA 3S1VA 3TNOA 2OVLA 1QWKA 5FJUA 1SJDA 1A49A 4AU0A 3STPA 2C7FA 3SCOA 1E9IA 3VIMA 1EQPA 1VH7A 4DO5A 3VMOA 1OGGA 2FB3A 3GLCA 4XKYB 4IZGA 1PJ9A 2Y5JA 1OCBA 1VLIA 3H2NA 3LHZA 1E1CB 4HT3A 1WZKA 4KCUA 4XD4A 3RMEA 1J0ZA 1EJ7L 1PHQA 3P61A 4DZHA 5D9MA 2NXHA 4JQ1A 7XIMA 1QNSA 2E8YA 3GDLA 3RNDA 2FH6A 2WMJA 2J24A 3KOXA 1CNVA 4EPKA 1P0KA 4O1AA 2ANUA 2UY3A 2C1HA 5D05A 3D3AA 3G0SA 4X3ZA 4MKSA 2C3ZA 4INFA 1NOWA 2PTZA 3IEBA 2GFTA 4B9ZA 2DZAA 2IW0A 3TYEA 3VD3A 1OFAA 1A5SA 3KBMA 4RZ5A 4CNTA 1EKOA 4HMEA 3M0JA 3QLLA 4K8EA 1G6CA 3MCNA 3UF9A 4D1JA 4M6PA 2EGZA 1DBTA 1FDYA 4V15A 4H8VA 4HVXA 1I0BA 4FX7A 2NUXA 2H6RA 3L4VA 1H0GA 4HBKA 2XJ7A 3PN8A 5DRIA 1FCVA 5EFFA 3CQKA 4C6EA 1JUKA 3VPLA 1E56A 1LYXA 1XHGA 4IH3A 3MUY1 3S4TA 1TJ0A 3E49A 3N18A 3PANA 1UIOA 2PUZA 3S1XA 3U5UA 4D6JA 2Z00A 1KLYA 1ZP4A 2X30A 1X1OA 4MF4A 3TR9A 1Q2RA 4PMRA 3VM5A 2GWGA 5A1AA 8A3HA 1XXXA 4H6QA 2VO5A 3OGRA 4ILSA 1TJRA 3N9SA 4O19A 2VX4A 3NQEA 5AECA 2OZ3A 1S2TA 1IV8A 5A8QA 3GXPA 2OGJA 5E5CA 3T78A 3Q94A 2QCFA 3GC2A 5A8GA 3SCSA 3PPHA 2O9TA 2P53A 4FX6M 3L21A 4JX4A 3P6LA 3RUBL 4NT0A 2X2YA 3V18A 2ZVRA 3LTPA 2HPMA 2DVTA 4KIEA 2F38A 3ARUA 1HJQA 3OOQA 2QPSA 3MW7A 4B3KA 4J3TA 1JEZA 2PWEA 2CLHA 3M7SA 4U31A 3LGDA 3MMWA 3W74A 4J35A 1MNSA 2GWNA 5DMYA 3UJEA 4E6MA 3ZWSA 3S42A 5FF2A 4J7RA 3TIMA 3QF0A 2J7DA 4AVFA 2G5WA 4NX0A 4ZQMA 5I77A 3WX7A 4CQDA 3W7NA 3W9ZA 3N25A 2DVXA 4L1WA 4YS1A 3EEGA 1KRBC 5FEXA 3NSMA 3GH7A 4FO4A 1R46A 1B3WA 4NJGA 3LCLA 3MDWA 2Z1XA 1XGDA 3UZWA 4F3HA 3QPEA 3NQ7A 4P8WA 4EAYA 1JDDA 1BVWA 1VYPX 3OVQA 3VK5A 4ZQOA 2J74A 1TRIA 1YDVA 4GA8A 2J88A 3SCVA 3EWXA 4C6PA 2ZZ7A 4PCNA 3R0UA 3UG8A 1W9PA 2DT3A 4LYPA 1FKWA 4HA3A 1I75A 2VCBA 3VGDA 3TEVA 1IWAA 4UNIA 1CGXA 3AIWA 9XIMA 2E1WA 3SUVA 2VUYA 1IWPA 3N2CA 4XVEA 4DO6A 4MYXA 3GVRA 1HGWA 3VNDA 4ZXOA 3L4ZA 1R3YA 2J66A 4YN5A 4MSSA 1LBMA 6A3HA 3EPOA 4R7WA 4US5D 2PRMA 4X0NA 5KTLA 3W1LA 4YVPA 1P7TB 2DZBA 2DU2A 3AMCA 4KWOA 5C5YA 1H5YA 3SGUA 3BCFA 3RO6A 2Q6ZA 3L4TA 1TUFA 4RDWA 3VKJA 5CC3A 4PUNA 4UZUA 1R3SA 4PMUA 2CZ5A 3BH4A 5E0KA 3WDQA 4AYGA 3WFZA 1M01A 5T8GA 1M7XA 1JZ3A 1QO2A 5GVJA 3O0KA 1XLMA 1A53A 4R53A 2AGKA 5C8BB 3LBCA 3S1WA 3E5BA 1Y8BA 1SFLA 1ZAJA 2ZUNA 3BQ6A 3LDVA 3G1SA 1GOXA 4WSHA 4EPBC 1UMYA 3SRFA 5LA2A 4C5ZA 2PDPA 4C91A 2ZX9A 2XPKA 3A24A 2EPHA 3E0IA 4HOZA 1EP1A 1KXTA 2QXWA 3VZYA 3STCA 4HHPA 1OFOA 3AROA 4GYPA 1QNQA 1RV8A 1ONRA 1Q45A 2OFJA 1KCXA 1H7PA 5DY2A 1ZJHA 3IJ6A 2VCAA 3TLLA 2G0WA 2X2GA 1QBAA 1XYZA 3CL6A 2HPIA 1IR1A 3RCYA 4YMZA 1XQKA 3FFSA 3SJ3A 3HOJA 5F4WA 4A3HA 1I2OA 2FPVA 3K8LA 1BYAA 2MUCA 1BSLA 4PTXA 2HVMA 4KFOA 4QDMA 3MCMA 4FI4A 1O68A 4HZ7A 2NUYA 1Q7QA 1O6IA 1YEYA 4DF0A 3GD6A 2WJEA 3WK3A 3B97A 1FH7A 3WEMA 3PZUA 1N8FA 3FA4A 1L8PA 3K46A 3PPGA 3PJXA 4RK8A 4HK6A 5CZTA 1XQLA 1HT6A 2YCIX 1XJBA 5RUBA 1NP0A 3EZ4A 2I1OA 1G7UA 3FGCA 1K8CA 1RUSA 3N4AA 4LUIA 2XSAA 3EOOA 3TYZA 5ENLA 1KC7A 3QW3A 2WNNA 3LERA 5LIYX 1C29A 1JAKA 4Q8NA 5KSWA 1RP8A 3QFEA 5CH9A 1AMKA 1ZNNA 3CIXA 3PNUA 5D32A 4QCFA 4W88A 1ZSXA 3AHXA 1XH2A 4QISA 4K8HA 2HWGA 1BWLA 4GUGA 6REQB 3QH2A 3QTGA 2ATSA 4MG4A 3VMPA 3VGBA 2PS2A 4FS9A 3EXSA 4CEUC 4A2SA 1KWGA 4GE8A 2HEJA 4GNKB 4NZ5A 3TJXA 1VCGA 1ZCCA 4ZL1A 4PRRA 4E2OA 4R7OA 3GFYA 4AVOA 1TPWA 1S38A 3E6EA 2FHCA 3WMSA 3WQFA 3WZ0E 1CX9A 1DPMA 2V68A 2WKLA 1TJPA 3G77A 1CLKA 3QGAC 4EXAA 3U57A 4I6KA 1OT1A 2J47A 1G5AA 1VFMA 4KS0A 3ITCA 1UKTA 2X16A 1OFEA 3RXZA 3KL0A 4N2YA 3CUZA 1VBHA 4JTAA 4O1CA 2HROA 2XGBA 2FJUB 7ENLA 1PZ0A 3CQJA 3M0YA 3VNYA 4WR3A 3BW4A 3NM1A 3MJMA 4AZBA 4LAMA 1AL8A 1FHUA 4PUKA 4WXZA 1ZENA 3MHGA 2QT3A 2ZVIA 3GX9A 4WF7A 5HPOA 4JS3A 4MWAE 2ABBA 1UKPA 2QDEA 4ZO9A 3O16A 1ALDA 2X7VA 4QLKA 3O6AA 4GKTA 4F4RA 4KCTA 2PWHA 3OZMA 1L2UA 3RM8A 2QF8A 1UWTA 4QE4A 3SCPA 2VQTA 1P6CA 5GJMA 5EMLA 2PF0A 4MZ8A 1M68A 3GVWA 1GW9A 3FN9A 4L56A 3U8GA 4FNTA 3UGRA 3P0XA 1CTNA 1UOKA 4AEEA 1OGSA 2GLKA 1FX6A 1ZAHA 4HA0A 3GYEA 3AJ7A 4M56A 1UZ4A 4TR9A 4JFVA 5LZLA 1EDQA 2FZ8A 1QHOA 3NFUA 3ZJKA 4C6KA 5MKGA 3BLPX 2ZUMA 4WOQA 3RO8A 3I7RA 2FZNA 4WXYA 1E6ZA 5I3HA 4PTWA 2PLKA 2HE5A 1IGWA 4NX5A 3SY5A 4AVNA 1E9YB 1J8VA 1B3OA 3AOFA 3GUGA 4U3CA 2WHJA 1M5WA 3WH7A 4AZCB 2NW0A 2XZ9A 4GRSA 5I3IA 1Q6GA 2BVTA 1TA3A 4YNGA 5A6TC 3RU6A 2TODA 5HQMA 1QPKA 3TTSA 1QFEA 3WQDA 3S46A 2B7OA 1CB2A 3PFRA 4R3UA 4XZWA 3MBFA 5FJRA 5D04C 2A3LA 4YIWA 4P7QA 4YTUA 6XIAA 1BPLB 2DH2A 5EYWA 1GZGA 2REQB 3GXDA 2OSWA 3N6QA 4KCWA 5GPRA 3N6JA 2ATMA 1V08A 2DORA 4L4OA 2I5QA 1WAWA 1RBLA 4KESA 4ZO6A 1EOKA 5HMDA 3WSUA 4WHBA 4UTTA 2HMCA 4DF2A 4NNCA 4PTDA 3PUGA 3N9RA 1A5NC 2BWGA 3C3NA 1E9LA 4HYVA 2YCEA 3M7WA 1PV8A 3LPOA 3SECA 2UV8G 4D6DA 1WNOA 1YQ2A 2VZOA 3CH9A 1OZQA 1YNPA 1EYWA 3TKFA 3TMQA 3FAWA 4W8LA 3C56A 1OX4A 3ZT6A 2BOEX 4LH8A 4YCOA 2BXYA 1C8QA 4UTHA 3ZQ9A 1EX1A 1VB9A 5G4WA 3R13A 1GVQA 4DPPA 3RGTA 1KM1A 4A29A 3IIOA 1M9HA 3OYZA 2ACRA 1JCTA 2O92A 3H24A 4GZ7A 2DZXA 2G8ZA 4N7QA 1YIXA 2VFDA 2DSWA 4GVFA 3DKLA 1H7OA 4EANA 4CD6A 5L9FA 2PWDA 2PDHA 4MB5A 4Q22A 3DN5A 2VZUA 1EA9C 1E72M 4Y96A 1TMLA 1BF2A 3PZIA 4WUIA 1E73M 5F2GA 1UWSA 4EKJA 4FPSA 3PJTA 3DGRA 4HYRA 4DEFA 1CENA 4JHMA 3H2OA 4ZGYA 4K37A 1AQFA 3OBEA 1R38A 2CHRA 4E8GA 1BF6A 2PDBA 4RZBA 1V6TA 5FEPA 4DM1A 4OUEA 2HV5A 2AL2A 3CPRA 4JFSA 1IEQA 1BRLA 3UG5A 4B2DA 3MCOA 2G50A 2FFCA 1IR2A 1B2YA 4I7VA 3FCPA 2V2CA 1V3JA 4Q4QA 3FEMA 1JULA 4Y8EA 3TC3A 5MHBA 4NNAA 5KZDA 4B5WA 4M3PA 4B4HA 1AH0A 1PL9A 3FDGA 1G69A 1ZBCA 3WQ4A 5KEZA 1W1ZA 3U5YA 4LANA 4RDVA 3GXIA 2QNEA 3T0DA 3LGEA 5I06A 4HNOA 1KA9F 4Q4KA 3LHTA 1M1BA 5D2YA 1H4PA 2WVSA 1PX3A 3PBYA 4UUIA 4JEQA 3H55A 4RCXA 2GYIA 4LJ3A 2WBKA 1UB3A 5CCZA 2QMJA 4AIOA 3KWXA 1JZ4A 2BHUA 3QY6A