1UB3A

Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
211
structure length
211
Chain Sequence
b'DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldolase protein
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 85
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ub3A00
4K6AA 1W8SA 5EBUA 4AWSA 3LHTA 2JKEA 2Z2UA 3P81A 4WJEA 1MXSA 2E6YA 1F6KA 2AQWA 2FIQA 4NNCA 1TRDA 2DZUA 1KM2A 3NQ6A 3MHFA 3UWUA 3DI0A 1XKYA 5CPMA 1VYRA 1K03A 3P67A 5AFDA 2YFNA 4DO4A 1L6WA 1KM6A 3MBDA 3HF3A 5U4NA 4BFAA 1DVJA 1SZFA 4UTUA 2BSLA 2YDAA 4ZQNA 1R2SA 1RQBA 3QMSA 2JKPA 1DHPA 3EWWA 3P5ZA 4UFHA 4EF9A 2BX7A 3EKLA 2A4AA 2GVGA 1OG0A 3G1YA 2PCQA 4LUJA 4QISA 4RXFA 2WJZA 3W1NA 3W83A 2E1DA 1OJXA 4R34A 2F7FA 3CIWA 4YWIA 4JIQA 1PHWA 2ZA3A 4JICA 4DO5A 3LGEA 5E1QA 1EP3A 4ORMA 2HSAA 4HNNA 1G4SA 3WK1A 3P5YA 4K39A 4KFOA 4BI6A 1EUAA 1S5VA 2Y7FA 4W9TA 5BNKA 4IMFA 3G0UA 4HSOA 5G1TA 4QITA 1ICPA 2BLEA 3T4CA 2YYUA 2GJLA 2I1OA 1EP1A 4YLWA 4M6VA 1XL9A 3B03A 3WK2A 2TMDA 1PCWA 3TQVA 1M5WA 2B7PA 4JYDA 4BR1A 1SW7A 2A7NA 3LTPA 4IPIA 4DBDA 2CLLA 1DJNA 5D33A 4OV9A 3BG9A 1TPUA 1H50A 1FX6A 1GYNA 1DORA 1XUZA 5HUPA 5IM51 1I45A 3TU9A 5KZEA 3CLMA 1HO1A 5KTLA 3W7CA 2XN1A 2YZRA 3GAYA 3TIMA 2FB3A 1LOQA 4LT9A 5LGXA 1FCUA 1TRIA 1MEWA 4O1AA 2P10A 1TV8A 2H6RA 5SWUA 3AO0A 3CC1A 1Q6QA 4GNJA 1AW1A 2WNNA 4E2DA 4IMGA 1KBIA 1UASA 1T8XA 1Y0EA 3NQ2A 2FPYA 3IIVA 1VS1A 1OX5A 2XN2A 3NZ1A 1RZMA 4JEQA 3VI2A 3HB9A 4DF2A 3NQ8A 4Z0JA 4Z1DA 3TAOA 4PL2A 1PV8A 3UPWA 4NQ1A 4TU1A 4DPQA 4BK9A 4Y96A 2A2IA 3W2LA 4XQ6A 3PBWA 4GJ1A 3Q58A 3QW4B 2C13A 3G22A 4IJBA 1LZOA 1ME9A 3PG8A 1VYPX 4WOQA 2DU2A 4LVFA 2DZSA 1TPWA 3M9YA 5I3KA 2QCDB 1SW3A 4O12A 1WDWA 4UTWC 4UFIA 3TC7A 1G4PA 2OCZA 3PC0A 4LVBA 4NJHA 3PF3A 3B0VC 4KWVA 3LCHA 3BPWA 1G4TA 1H61A 1IIHA 3MYPA 1ZHAA 4H3DA 4YXGA 1B57A 2B4GA 3LCWA 2CZDA 4UNKA 3SFKA 3EX3A 4CQAA 3UPBA 4JX6A 5FI8A 4NJGA 4LS1A 5K9DA 3BGJA 2QAFA 3ZS4A 4JTGA 1T99A 1ZALA 2O7QA 2OMAA 2NXHA 3W1MA 4FEZA 3W7HA 1VLWA 3W87A 4D2JA 5F4XA 4PH6A 3UNDA 1W5OA 1H7NA 3GX9A 2DZWA 4OHQA 2G95A 3MHGA 1QOPA 1ME8A 1GVSA 1NEYA 3EWXA 1SUXA 3GKFA 3W7RA 4DXVA 2V2CA 2Y70A 3N2MA 2J9YA 4LNYA 3RF9A 1RVGA 5U7SA 1TPEA 4N9BA 3W7JA 3W88A 2H90A 2Z1BA 4CNNA 4FNTA 3MP3A 1MEIA 1OYAA 1YXDA 3TROA 4LS2A 4O57A 4FO4A 6TIMA 4MY9A 4K8EA 1WBHA 4FXRA 3NYZA 3UWWA 2JK2A 3QF0A 4O4VA 1P4CA 2PRMA 4RCXA 5G2WA 3PY2A 2Y7GA 1V7YA 1H7WA 1JUEA 2X1RA 3I65A 1DL3A 1BKSA 2C1HA 1LRNA 4JR5A 4RXGA 3A9IA 3NPWA 2VC6A 4TO8A 4MLJA 3W1RA 2EKCA 3TUUA 5CZ0A 4O54A 3L66A 5C55A 1EIXA 2G97A 5ABTA 5EPDA 2E68A 2DZXA 1QO5A 1UUOA 4UIOA 4HPXA 1OYBA 3M43A 3PUDA 4N6EA 2I14A 3QSTA 3MWAA 3MMTA 3NQVA 3PUEA 4XZ9A 2C3ZA 2NUWA 2EGZA 2QCNA 2HS8A 2I9EA 3UWQA 4IMCA 3TE9A 4OGZA 1VLIA 3KVJA 3KHJA 4NVTA 5AHIA 2QCGA 1SO5A 1JCJA 3BW4A 3TH6A 3H53A 3FYOA 3LRMA 3EX2A 1GJPA 3RFAA 2TPSA 4NT0A 3LXCA 4HNTA 1QDSA 1LRQA 2DZVA 3G1FA 4HN4A 3THQA 2PRLA 4I7VA 2ZA2A 2Y85A 3T40A 1UBSA 2C19A 5D30A 1JR1A 3W1AA 5EKYA 4IWWA 1F76A 1XC4A 4MJMA 5CKSA 1U5JA 3W2KA 3OIXA 3GNDA 4JS3A 1R30A 4XUGA 3LHWA 3WK0A 4AXKA 5KITA 3CPRA 1BEUA 1K02A 3T78A 3LHVA 2Y7DA 4UFKA 2A6LA 5F1UA 4IX0A 3TW6A 2XN0A 3LDVA 3NOEA 2WO5A 3QYQA 4UTMA 2CZFA 1PVNA 2QCLA 4ML9A 1LOLA 2WPBA 2YSWA 3THAA 4K7VA 1AMKA 1UCWA 5AYYA 1SFJA 4ZVJA 2QDGA 5HR7A 3JS3A 1SR9A 4N9DA 4JYFA 1THFD 1G6CA 3Q37A 1KFKA 1Z41A 3HG5A 4NJJA 4U4MA 4GRSA 3W2JA 4MLRA 1O95A 5DCBA 1JUBA 4IX2A 1T0OA 4JX4A 3W7GA 4GFSA 3WJZA 1JRBA 2ABAA 5HR6A 1LLWA 4TR9A 2VFGA 4GUGA 3LXBA 3LCGA 2BWGA 5BW6A 2NV1A 3W1XA 1N8FA 3BLEA 3O07A 3QW3A 3C61A 4CCCA 3TK7A 2Q3RA 3EWYA 3W70A 3MI2A 5A5WA 3E12A 2VELA 1JCNA 4LRTA 4UC5A 3S5YA 4MUZA 4GE8A 5C2XA 2QCCA 1Q6OA 3P80A 4N2YA 2ALDA 1VR6A 1P5BA 3LCXA 4YCOA 4WUIA 2BZNA 3HIJA 3MHUA 1W3TA 1JCYA 1XDLA 2A7PA 2ISSA 3G0XA 3DBPA 4WXZA 1QWGA 4Y6GA 5K9XA 1RQEA 2A7RA 1W37A 2V8ZA 3FJ6A 3QPYA 4CNPA 3LRLA 4LVGA 1H7RA 1VCFA 5HMSA 1HUVA 1FCVA 4UTIA 2V2HA 1M6JA 4Z08A 3EWZA 5IBXA 1OFEA 4HNVA 4KFPA 4AWTA 2RKXA 3GXNA 3STEA 1HG3A 2WV8A 2VFEA 1D9EA 1QPNA 5L6UA 4JTUA 1O5XA 1LP6A 1TPC1 5FESA 5I3JA 1H7OA 1XDMA 5AYZA 1SW0A 2E5DA 3TSDA 2QR6A 1VGAA 1WYIA 3MP4A 4XBSA 2Z0IA 1B4EA 2QCDA 5BRBA 3UWZA 5D02A 1OFQA 2RDTA 1KM0A 3W2MA 1K7FA 1H60A 3SR7A 1IXQA 2CLMA 4DO6A 4GC4A 4R33A 1S5WA 2YGYA 1OYCA 1JULA 1XUUA 3V1PA 3PSVA 1QPOA 2FTPA 1ZAJA 3VKJA 1NF0A 4Y8FA 4HKPA 5F2LA 4O13A 1W56A 3L67A 5FF4A 1ICQA 4N4PA 1KA9F 5HUOA 1O4UA 4DEFA 3QH2A 4RV8A 4LV9A 2Y89A 5G5IA 3SGZA 2H8ZA 3R8RA 2FPTA 1YLVA 3UY8A 2H8XA 4O53A 4IXHA 3R2GA 5KMYA 2QF7A 3EWBX 3EKZA 3GZ3A 4OT7A 3GAKA 3O6YX 1KTNA 4GBUA 1HTIA 3PM6A 3F4WA 3IIXA 4FX7A 1LDCA 3LCLA 3DZ1A 3B0UX 2NUXA 3G1AA 1KFBA 3CEUA 3P62A 1TMHA 1LYXA 3UXDA 4UTJA 1WQ5A 3HG4A 2LLEA 1OABA 4GUFA 4ZQRA 3YPIA 3NQAA 1KM5A 4Q33A 1TPVA 1W5PA 1WOAA 4LC6A 4FNUA 3NL2A 3W1LA 1QFEA 3E96A 3CTLA 4FX8A 2ZTJA 3PVFA 3GYEA 4K37A 4QAIA 3H54A 3K30A 2PE4A 3HO8A 3LV6A 4TMCA 4YMZA 4MFEA 4FF7A 2UV8G 2ATMA 1CX9A 4PTNA 4GUJA 5LNVA 4JTHA 5LZLA 4X3ZA 1ZY9A 2RFGA 3TMLA 3N9RA 1SSGA 3QQ0A 3IIPA 3DH7A 2GQ8A 3BLFA 4I9AA 4WY0F 3HGSA 4N6FA 5D37A 1W5QA 4KKXA 4ZQOA 4K36A 4XWUA 1V5XA 2EPHA 2QEZA 3GR8A 1YTEA 4TIMA 5TIMA 3DXIA 2IQTA 2Q3OA 4CQ8A 2J24A 4M19A 4MYAA 5K7JA 3TFCA 4MVAA 3UYCA 3GDRA 4N02A 1G69A 3QQ1A 3TKFA 4PL1A 3TQKA 2ZRUA 2ZRYA 1Z48A 3NGJA 2J9XA 5MHBA 2Y7EA 3G1DA 4A2RA 4LY8A 2NZLA 2VKZG 3EX1A 3BK0A 3N73A 2QJHA 3LTYA 1BWKA 1AW2A 4JTJA 3NM3A 3S1XA 1SZEA 2NXIA 5HNRA 1EX5A 4RK8A 4QM1A 2YW4A 3TFXA 3GK0A 1JJKA 5D09A 1E51A 1K8YA 3HPSA 1GG1A 2X1UA 1H63A 4Z1AA 1HFBA 1P0NA 3BARA 2GPTA 4UCGA 3FLUA 2TRSA 4AVFA 2ZFAA 1L9WA 1I2NA 3L65A 1IF2A 4AF0B 4Q4KA 2YYTA 2KZHA 4MZYA 3W75A 3M5YA 4MZ1A 1KFJA 3G1XA 4FNPA 1EP2A 4JNMA 5DN1A 1F7BA 2X16A 3U6WA 3P8JA 5FEPA 1I2OA 3B06A 3CWNA 1LM1A 1K8ZA 4OQVA 4YL2A 2ZZ7A 1GYLA 5HULA 1OFRA 2A1YA 2ZZ1A 3VE7A 1GVFA 3MUXA 3STCA 3BG3A 3O6DA 3W7LA 1YDOA 3LCFA 2ZBTA 1KBJA 3M5XA 2JBMA 5D2WA 2JKAA 4JD4A 1TJRA 4QNWA 3IVTA 4ZL1A 1Z44A 3D0CA 5K4ZA 5F4SA 3NNTA 1FUYA 4BI5A 4NZJA 4LC8A 3W9ZA 4ADTA 1F73A 3B8DA 3QMTA 4MFDA 4WD0A 3S42A 1IGSA 3NL3A 2GVJA 3TCEA 3PB0A 3TAKA 3RMJA 4NNAA 3W2UA 3EXSA 3NPVA 5IBXC 3C52A 3TMQA 2CLKA 3E0IA 3E02A 5G4WA 3CQ0A 1MZHA 1VC4A 1ZAHA 2DZTA 1SFLA 2QUTA 1YPIA 4EWND 3I7SA 5EMUA 5D2YA 5H2ZA 1YADA 1KM3A 5J5DA 5KZDA 4JN6A 1N7KA 4Z0SA 4Z1CA 2QKFA 3ELFA 3IV3A 4LUIA 4DELA 1OVDA 1ALDA 3M6YA 3LOTA 4U28A 2Y63A 3KVLA 4RX0A 3DFPA 2WOQA 4JTKA 1QAPA 3GDMA 3FOKA 3HBLA 3PSWA 5E93A 1HL2A 1YDNA 3PB2A 3G1HA 5C54A 3KAOA 3TJXA 1H5YA 1X8FA 3QFEA 4C1LA 4JTTA 1T96A 4ALDA 4LVAA 3A5VA 3TSBA 2ZQ0A 3LI0A 1EPXA 1LBLA 3VFLA 3W73A 3ABRA 3W6YA 3DFQA 4LOCA 3UY7A 3O8AA 1LOSA 4JX5A 2X30A 4UFJA 3PBVA 3NA8A 1LROA 3ABQA 3A22A 1QNVA 3N2XA 3KVMA 3O63A 5LNUA 4ZZ9A 2V81A 3HOJA 1GEQA 1LBFA 5FF3A 3FS2A 5LSMA 3TV8A 5FF0A 1K7EA 2CLHA 3MI3A 2YW3A 2VXNA 2ATSA 3C56A 2QCFA 4R7JA 1FBAA 1KTCA 1TO3A 5AC8A 3O16A 5KINA 2EF9A 2C0AA 3LHYA 5AHFA 4O4WA 3DKLA 5EL1A 2W0UA 4O1BA 5LNRA 3E9AA 3MW7A 4AHQA 1DQWA 1OFBA 3L2IA 3WJSA 5DXYA 4MY8A 3OVPA 3HG3A 3G1VA 3LERA 5G2IA 3UQNA 4UNLA 3GB6A 4H6KA 1K8XA 1ZNNA 1OK4A 4M7TA 4LTSA 4RZ6A 1JUKA 3L0KA 3O6CA 1FCQA 1SO4A 2WNZA 1OFAA 1TTIA 2WSYA 1WX0A 3HPXA 1KM4A 2A0NA 4O10A 3B04A 5CZSA 1RPXA 4ZMGA 5CZTA 2DJXA 3NQDA 1F74A 5CG7A 3B0PA 1ML1A 1DV7A 4HNUA 4X2RA 4WY0B 1K3UA 5F4WA 3QRHA 1A5AA 2CZEA 1C9DA 3BV4A 1JQVA 3FFSA 5AHNA 3EB2A 1VYSX 2NLIA 4FNSA 2QUUA 5CZJA 5D03A 1A5BA 1GTHA 1SZGA 4X9SA 1L6YA 3FKRA 1TQXA 5TQLA 1BWLA 3DHFA 3OA3A 3WJYA 3LHZA 2V5LA 4WQ6A 3NQEA 1OF6A 3EWUA 5BMWA 2PURA 4O1DA 3TW7A 3SJ3A 2NWSA 3FYPA 1FXPA 4PODA 2FJKA 3FA5A 1OF8A 4CCDA 3OBKA 2NX1A 1SO3A 4IGHA 4N9CA 4NZFA 5LGZA 3OVRA 1ZFJA 3P60A 5T26A 2Y61A 3R12A 4GWEA 3P84A 4DF0A 5DELA 4JDYA 2J6XA 1LCOA 1YXCA 3T7VA 2FFCA 2WSRA 5AHEA 3B4UA 1EA0A 3W07A 2A21A 5TBOA 1CI1A 1FDZA 2VENA 5AHLA 3S9YA 3A21A 3L5LA 4ZQCA 2J27A 3EXTA 5C6MA 3PR2A 3PBYA 2FDSA 3DFNA 4JDBA 3G8RA 3NL5A 4L4LA 2NWRA 1X1OA 2V30A 3C2FA 5LHFA 4RLIA 1MEHA 2Y6ZA 3OG3A 1LRTA 1TTQA 2A5HA 3LM7A 4DF1A 1ZCOA 2RDUA 3CM4A 1TSIA 1OFPA 1H51A 5DXXA 4E2BA 1TTPA 2HS6A 2W6RA 1B4KA 4EIVA 2CLFA 4AF0A 1UB3A 5CGQA 4B5NA 3QM3A 5G1YA 2RDWA 5HQEA 4ZQMA 1KTBA 3P82A 1FCBA 1DJQA 2NV2A 3M7WA 1W5NA 3RNDA 3QSRA 2E6FA 3L5MA 2ZTKA 2CFFA 3LV5A 4HIBA 4UTHA 4I7WA 3TQ0A 1IXNA 4X22A 5EYWA 3AJXA 3M16A 2BTMA 1KV8A 1GZGA 2EAWA 2VEKA 5DY3A 3W7IA 3V75A 5FF2A 1JQXA 4I7UA 5HJLA 3R89A 1TTJA 1AL8A 1YXYA 2GVLA 2HMCA 3BG5A 8TIMA 2OZ0A 2DJLA 1CW2A 2C15A 1OX4B 2QCEA 5DCDA 2E5BA 5HINA 1XI3A 5G2HA 4HHPA 4MY1A 2WQPA 3IEBA 2X2GA 2VEIA 3NL6A 4NJIA 1C8VA 4UUIA 5AC6A 3M1ZA 2Z6IA 1TYGA 1VPXA 2QAPA 3C8FA 3F1QA 2V5BA 3TNOA 1H1ZA 3NVTA 3LCIA 3L5AA 4XKYB 1GOXA 2Q8LA 4NJKA 5K4XA 3LBCA 2QUVA 4DQWA 4RZ5A 1YYAA 3TA6A 5LNSA 3DKJA 2C16A 1ICSA 2PC4A 3PWAA 4UTWA 3LXAA 3OHIA 3SECA 5L9FA 5C5YA 3ZWTA 3NPUA 3L0NA 5BMXA 1Q3NA 3LI1A 1G7VA 4M5PA 3HGRA 1YPFA 4GXMA 3RK8A 1SO6A 3KX6A 2GUUA 3C2EA 4LVDA 3NDOA 4NX0A 3W2NA 3M5VA 3UZJA 1LBMA 3N34A 3GDLA 2NXGA 2TSYA 1SSDA 3BGGA 3W1QA 3UWVA 1WA3A 3C2OA 1U83A 1XXXA 3N19B 4RZ4A 2CZ5A 3OEXA 3NR0A 3DHDA 5FF7A 1IXOA 5K2ZA 3CB8A 2HTMA 3DFTA 4AB4A 1ADOA 2A6NA 4PEKA 3UXAA 4O52A 4NX5A 4CNOA 5F1VA 3TDFA 3WFAA 4UTTA 3PG9A 3S5NA 2CW6A 3JR2A 4NU7A 4O18A 4UMBA 4K8HA 4AHPA 3NPXA 4AH7A 2GQAA 5AB3A 4K7YA 4OBTA 3DFSA 3M44A 3S6DA 3MBFA 1WBJA 2ZRZA 3QMRA 1QR7A 1IXPA 1VH7A 1PS9A 3NQ7A 2C14A 1H7XA 2X1SA 1UUMA 4BI7A 4JTLA 1DOSA 1LLZA 2V9DA 3FEMA 3LLFA 5DY2A 4YCPA 4CCEA 1W54A 2CLIA 3NEVA 5I3IA 3DFOA 3NQCA 3W22A 3O15A 3H55A 3LTSA 4WXYA 3GIYA 1KW1A 3C2RA 3W23A 1GT8A 3NG3A 4M6PA 4NNBA 5F2IA 5A8GA 4OU1A 1XBZA 1I2PA 3G8EA 4O8RA 2V0TA 3LRKA 1TPFA 1QPQA 5LKYA 4E0CA 3W7OA 3W85A 3Q94A 5EA9A 1AG1O 1O94A 3EX6A 2GOUA 3TC6A 3KXQA 1FWRA 2ZYFA 1O60A 1KFCA 2G5WA 4NUWA 1AL7A 1DQXA 4WY0A 4UMAA 4FNRA 1NSJA 3MO7A 2C6QA 1R2TA 2R8WA 4JY9A 1R2RA 3I6RA 2Z6JA 1PCKA 1HO4A 4HT3A 5D2VA 3O05A 1UJPA 4AWUA 3VCRA 3CEPA 4S2CA 2O7SA 1W3IA 3ABSA 3W7QA 4MJZA 3G18A 3ZWSA 3NAVA 4AMAA 3QC3A 4IOTA 1B9BA 4RR4A 3BLIA 3ATZA 4JYEA 1OK6A 2Y62A 1M7PA 1Q45A 4AHOA 4RJEA 3S5ZA 4LW7A 4M7SA 4R53A 1VJIA 2ZRVA 3QPZA 3NM1A 2QDHA 2AAMA 3C4UA 1Q6RA 4OV4A 2ISVA 4JIPA 1ZJIA 3IGSA 2YX0A 4K38A 4BF9A 3IGUA 4TMBA 5CSSA 3SSJA 2QJGA 4O28A 1TIMA 3PBUA 3GLCA 3BW3A 2GJNA 3SZ8A 4ONVA 4HPJA 3LHUA 1FQ0A 5D04C 5I3HA 4MPQA 6ALDA 2DP3A 3L68A 3NZRA 4BWLA 1RQHA 3KRSA 3P7YA 1FWTA 3W86A 2FB2A 2FLIA 3QEZA 2B7NA 5D32A 4A22A 4IMEA 1K7XA 3C6CA 3L0GA 1F2JA 1FDYA 2ZCGA 2Y88A 5HWJA 3GVGA 4PC8A 3NQFA 3UZ5A 3LBMA 2QCHA 4O19A 3UWYA 2J88A 3NXFA 2G96A 1TREA 2WKJA 1SPQA 1A53A 2FPVA 1FWWA 1J5TA 2VOMA 3P8IA 4N4QA 1I2QA 1YTKA 4FX6M 3S1UA 3VNDA 1N55A 1GVQA 2CLEA 1G67A 2V82A 1KV5A 1TV5A 3IIZA 1I8JA 3BW2A 3EXRA 3G24A 1ZENA 1D3GA 2YCEA 3ANYA 3STGA 3UD6A 3F03K 4UTLA 3U2OA 1J2WA 1VCVA 3IGXA 4UR7A 5I3FA 4O11A 2FQIA 1VZWA 3KRUA 3R5EA 2QJIA 4QSHA 5D38A 4DBEA 3IRDA 4IXXA 1OX4A 2OX1A 3MYOA 1MO0A 3ATYA 1FWNA 2R91A 4O17A 3STFA 1TB3A 2VFDA 4QIUA 3N14A 4HSNA 3C3NA 1ME7A 4FIRA 2RHGA 5DBUA 3TX9A 2ZZ5A 4O1CA 3N3MA 3RLUA 1SU5A 3KFTA 3E49A 1LORA 3W71A 4L4MA 4XKYA 5I3GA 5DLCA 3DI1A 1W3NA 2E6AA 1VRDA 2B7QA 4UTTC 5CPLA 2PRHA 1PE1A 3S5OA 4IPJA 4JXCA 2ZA1A 3W7NA 4AAJA 4GUHA 3S1VA 3HMJG 1VCGA 3M47A 4O0ZA 5H91A 1L2UA 4TX9A 5DCEA 3MI6A 1VHCA 4POCA 3W3OA 1WV2A 4UXDA 5AN7A 3ABOA 5KZMA 1A50A 5HWNA 1PIIA 3B05A 3INPA 1X7FA 3EEGA 2CWNA 1KLZA 4P61A 4O0KA 3CT7A 2ZDRA 4RKAA 3S8HA 3CHVA 4NXKA 1D3HA 3SW6A 3I7QA 1EEPA 4FXSA 4IMDA 1OX6A 1VQTA 3WJXA 5E0KA 1R46A 1DBTA 3O06A 2JGQA 3M0ZA 4GUIA 1QCWA 1GG0A 1WXJA 2ZZ4A 1OHLA 4WOZA 1XBYA 1EUNA 1G7UA 3LX9A 1W31A 3GDTA 2DZPA 4M6QA 5K9CA 1KFLA 5J5RA 1TPH1 3DU0A 4LS0A 1TPB1 4FHAA 3L9CA 1O5KA 2H3BA 3M5ZA 3KRZA 3W1PA 5G4EA 5HWMA 1IIGA 3HQ1A 4MYXA 3G1SA 1LTDA 3S0CA 2VFHA 3M41A 5D2TA 1JCXA 1KFEA 1R47A 3TXVA 4ADSA 4JGDA 1W1ZA 2ZRXA 1NVMA 2TYSA 3LB0A 4LU0A 3NQMA 4WZHA 1P1XA 4ORIA 1QMLA 2V2DA 4EOUA 2F84A 1YDVA 1WOBA 1GTEA 1AK5A 3KOFA 1TV7A 5BOOA 3N9SA 3VE9A 4JTFA 2B0MA 1EWDA 2J9ZA 4JTSA 4PFMA 3DENA 4ICNA 4NXSA 4A3UA 1JVNA 4CQ9A 1W0MA 3IVSA 2C18A 1JRCA 4LRSA 5F2MA 4DPPA 1C29A 3KVKA 1EWEA 4UFLA 3CIXA 1P0KA 5D05A 2EHHA 3TXZA 2OT0A 4UR8A 3RLVA 1XBXA 4XTDA 1GVRA 1NAL1 3FKKA 2YPIA 4S2BA 3WK3A 2Q8ZA 1GPWA 1TQJA 3MP5A 5CPOA 3MJYA 1PL9A 2RH9A 3NQGA 1PHQA 1JCMP 4LWWA 2ISWA 1XFBA 4ADUA 3W7PA 5AHMA 3ZR4A 2CLOA 4UMCA 4EF8A 3HJZA 1KM1A 1A5CA 1M7OA 1X6UA 4H4IA 2R94A 4N9EA 3SIZA 1XBVA 4J9JA 1SZNA 3W76A 1FY6A 4O15A 2JGYA 3QZEA 4UTKA 4LV4A 3ZFHA 4BWLC 1L6SA 4CLMA 2A85A 1Q6LA 3HGOA 4QNEA 4JTIA 1ZAIA 1GWJA 5FEXA 2XFWA 4A29A 3W84A 4O14A 5LHEA 3S1WA 4Z1BA 2D73A 2E09A 4ZQPA 3IIOA 3R13A 3U8GA 3CWOX 1RV8A 4XTIA 3QJAA 2OT1A 3BVJA 2WSQA 4P2VA 4E38A 3IVUA 3FIGA 5CPNA 1H1YA 4QJ1A 2VEPA 3PS7A 4JTEA 3TR2A 3GKAA 3BO9A 2B7OA 4MOZA 4PA8A 2YR1A 2YFOA 3RU6A 1J4EA 1ONRA 2ZZ6A 3GXPA 2P0OA 1AW5A 1S5TA 4G1KA 3W1UA 1G4EA 5CSRA 3G3MA 3JRKA 3W7EA 1KLYA 2QCMA 3SY5A 1Z42A 3LLDA 3W7DA 4UFMA 5FEWA 2OJPA 3NO5A 2ABBA 1H7PA 3GNNA 2H3DA 2W79A 3GDKA 3GXTA 4IUOA 5AC7A 1JCLA 3P61A 2ZZ3A 3SGUA 4FIQA 2ZRWA 4Q32A 1FXQA 1TCDA 4A2SA 1BTMA 3HG2A 4WX2A 2NUYA 2NX9A 1F6PA 1OFOA 1VHNA 4XBKA 1DKWA 5AYXA 5FEZA 3CU2A 1XCFA 2VEMA 1H62A 2R14A 7TIMA 4KFNA 4OE7A 3I68A 3C2VA 3C0JA 2AGKA 5DBTA 3Q2DA 1TJPA 2DORA 3T55A 4PCFA 2E6DA 3DGRA 4O50A 3W72A 1QO2A 3G0SA 1RD5A 1NFBA 3PUOA 3A5FA 1WAUA 1QPRA 1QOQA 2CU0A 2NX3A 5AOUA 1F5ZA 1X1ZA 2VFFA 3USBA 5K3VA 1RR2A 2GQ9A 1A5SA 4Y90A 3OVQA 3SI9A 1GVOA 2YXGA 1XM3A 2E77A 3I7RA 1B3OA 5GVJA 2VFIA 3TSMA 4EVZA 1I4NA 2X1TA 3W1TA 1FDJA 1FWSA 5KSWA 3G3DA 1GQNA 4OWGA 4QQ3A 4IQLA 1SQ7A 4FB7A 3W7KA 5EY5A 1OFDA 2ZZ2A 3T44A 3HGJA 4MIMA 1TPDA 1W5MA 3L21A 1I2RA 4MZ8A 3A24A 3F4NA 4FNQA 3TJLA 3W7MA 2BXVA 4C1KA 4MKNA 3PAJA 3A23A 3P74A 4S1FA 2E5CA 1MSSA 2P1FA 4JY8A 3GR7A 3W74A 2WNQA 3DAQA 4KWWA 5D2XA 4Y9AA 1YTDA 3FJLA 1S3HA 4O16A 5F2GA 1NF7A 5LNWA 3HPZA 3EX4A 3O1NA 3PULA 1EB3A 3WJWA 4A21A 1F05A 4AEOA
chains in the Genus database with same CATH superfamily
1W8SA 4CN4A 1VFTA 1DTUA 3W53A 1SJCA 2JKEA 2Z2UA 1BYDA 4GZJA 2XH2A 4P7QA 1MXSA 1F6KA 1ADDA 4KS0A 2HZGA 3M46A 3HTWA 2OLHA 2ZXQA 4MDPA 3NQ6A 1XKYA 3CV7A 1OGBA 3KTCA 3AQUA 2W61A 5CSUA 1WKYA 4FF5A 3RGTA 1H3GA 5EMKA 7XIMA 3ZLHA 4I5UA 3UCQA 3P5ZA 4K1GA 3VPLA 3VC5A 1V8EA 4ZE5A 2DIJA 3AMCA 2E1DA 4H8VA 2ACQA 5FAGA 3ZO9A 3W37A 2ZA3A 4JICA 3VKAA 2EO7A 3LGEA 4LXFA 3QV6A 1EP3A 4HPGA 2J7BA 2HSAA 1E15A 1G4SA 3VNKA 3WK1A 4K39A 5T9CE 2VMFA 2YIHA 1NDZA 1EUAA 6XIAA 4ZTXA 5BNKA 2PZNA 3WNOA 3G0UA 3PZQA 4QITA 2BLEA 2I5QA 5C9RA 1EJSC 2YYUA 4ENLA 2I1OA 1EP1A 4M6VA 4H01A 2B7PA 4NG3A 1GQLA 4JYDA 4V15A 1CWYA 3LTPA 4DBDA 4D6JA 1DJNA 4OV9A 3BG9A 3S2MA 3JVAA 1GYNA 4GQ0A 1DORA 1VEPA 1GOQA 4IJRA 1MRAA 5IM51 5I06A 4L80A 2P0IA 4F0SA 3W7CA 2XN1A 1UKPA 3A3HA 2J78A 3GAYA 3TIMA 4LBUA 4ASTA 1LOQA 5BXTA 1A5OC 1MXDA 1A5NC 5SWUA 1Q6QA 2WNNA 1UASA 1T8XA 3SN1A 1Y0EA 3NQ2A 3NYDA 2HCVA 3NZ1A 4Z1DA 1O1HA 3TAOA 1PV8A 3REQA 1VFHA 4DB7A 3BMVA 4TU1A 1TVLA 1HT6A 4GI8A 4DPQA 1FWHC 3ARPA 3PP7A 3W2LA 1V3IA 3KWXA 1JGMA 1VIWA 3Q58A 3XISA 3AU2A 3G5EA 4PE8A 4C91A 3UJSA 3OYXA 1S46A 2HE5A 3MS8A 4C6JA 3M9YA 4O12A 1G4PA 2OCZA 3PC0A 3DYOA 3GY1A 1NWRA 3GVQA 3VM7A 4FZIA 5FJRA 2PLCA 1XICA 1KBKA 4HK7A 2B4GA 5CG0A 4JX6A 3BE7A 3DECA 4NJGA 3Q4DA 4RW5A 1IZJA 3B9OA 3CHFA 3GYCA 4C6LA 4MF4A 3IWPA 2AL2B 1XIBA 2FH6A 3UNDA 1RXOB 4IPLA 4RE0A 4JQAA 3NQBA 2ACRA 1GHSA 1SFSA 4AY1A 1NEYA 3UBPC 3DGBA 5JH2A 4LNYA 1RVGA 4ZOCA 4N9BA 2H90A 2Z1BA 2QV4A 2Y2WA 3MP3A 4CCZA 1MEIA 1OYAA 1UZ4A 3A9BA 4L9ZA 2YBVA 4J3UA 2BXZA 4H1ZA 4MY9A 2DW6A 3N1AA 4G7FA 4K8EA 1ZP4A 2YBTA 5ECVA 3QF0A 1R0MA 1DWAM 3I6EA 4AC1X 2X1RA 1DP0A 1BKSA 1LRNA 3DBNA 3A9IA 3NPWA 2VC6A 1QK0A 3W1RA 3S2CA 4O54A 1E9ZB 1EIXA 4H9VA 1WDDA 4UIOA 5A95A 5I6SA 5HBFA 4NRSA 3KBJA 2BASA 3MDUA 2I14A 3QSTA 3TYAA 4QG9A 3MMTA 4CD7A 2C3ZA 2EGZA 3QOKA 1XIMA 5H8MA 3WF2A 4IMCA 3QZ6A 3KVJA 4CD4A 5HQLA 4JBRA 4KCTA 2QCGA 2NT0A 1B31A 4FXFA 1LL7A 1ZBWA 3LRMA 3EX2A 3RFAA 2W67A 3QKZA 1KRCC 1XLMA 2PWFA 4AW7A 4XIMA 1I60A 2POTA 2PDUA 2V67A 3VOJA 3L4YA 1UBSA 2C19A 4XB3A 3USZA 3W1AA 2EPMX 2VVNA 1GOIA 3OW1A 4JS3A 4XUGA 2XTKA 5JBEA 5KITA 1W9VA 3LHVA 4IICA 1SM9A 2A6LA 4IX0A 3CH9A 3S83A 2XN0A 4HCDA 4OUIA 3SRHA 2WO5A 4PTMA 5C2GA 4IZGA 1U33A 3DFHA 2WPBA 2YSWA 3W28A 4W7WA 5E6ZA 3KZPA 5G1MA 5AYYA 4IIEA 3L4TA 1F8MA 1SR9A 1OQFA 2ZX9A 4F4RA 1G6CA 3FA4A 1KFKA 1Z41A 1NWSA 2YL8A 1AMYA 1OBAA 3PTDA 3A12A 3WMSA 1GYMA 2PDPA 3ZLGA 1JDEA 2ZUTA 3POHA 3EMZA 4TR9A 1W9UA 3KDNA 2QT3A 3LXBA 2BWGA 1K9FA 4DM2A 3BLEA 1B90A 3T0AA 2HV5A 3APYA 4QAWA 2EPOA 4KWUA 4JCLA 3GNPA 3S5YA 1JCNA 3C0SA 1JD7A 1J0IA 1C7TA 1UR3M 3P80A 2WMJA 1WDRA 4YCOA 3AMLA 3RO8A 2BZNA 2QJNA 2ISSA 2XH7A 3KHDA 3LMYA 1XC6A 3DBPA 4Y6GA 4DUXA 4IPNB 5K9XA 2WCSA 1RQEA 4G7EA 1W37A 3FJ6A 1MFVA 3LRLA 4H9YA 3SJNA 4HTBA 1R3QA 4H83A 2RGLA 1FCVA 3L4XA 2CBJA 2GUYA 4Z08A 4PMDA 1NQ6A 5IBXA 2OZTA 4IGMA 4HNVA 2WJEA 4RNHA 1JPMA 3KBMA 3CK5A 2VFEA 3SCWA 1QPNA 1O5XA 2VRKA 3UG3A 1LP6A 5FESA 1RK6A 1VP5A 1XDMA 1UMLA 3CHEA 1SW0A 2CLPA 4W8BA 3FAWA 2Z0IA 4XBSA 2VO5A 1B4EA 2QCDA 2DT1A 1K7FA 1WDSA 4IP7A 2O0TA 4X61A 3WUFA 3SN0A 3K4DA 1HP4A 3BXWA 4ZOAA 4GVIA 4HKPA 1VFUA 3OYZA 4E4PA 1W56A 3L67A 4N4PA 1YBQB 1OCQA 3OB8A 1OC6A 1O4UA 3QH2A 2H8ZA 1KR1A 2H8XA 1LG1A 3FAXA 3HPAA 3EKZA 4YS1A 2IPGA 1SMAA 1JYNA 1KTNA 1TIWA 1HTIA 1MW3A 5EFFA 3AIBA 3LCLA 3DZ1A 4IQJA 3B0UX 3G1AA 2VDHA 1F3WA 3P62A 4H7CA 2Q09A 1TMHA 1ZCCA 4R5EA 1OG6A 3VNJA 4UTJA 1QK2A 3W29A 5HK4A 1OABA 4ZQRA 2PGWA 1KM5A 4Q33A 3TJIA 3IPWA 1V3JA 3WL1A 4M82A 1GVEA 4XIAA 4MAVA 3GTXA 4QAIA 3HO8A 3CYJA 3SUTA 4YMZA 5EU9A 1HN1A 1KBBA 2ATMA 4GUJA 9CGTA 3I3DA 3TMLA 1SSGA 5CC3A 3GNOA 4V28A 6PTDA 4WY0F 1QXLA 5D37A 1UKOA 4ZQOA 4XWUA 1V5XA 2QEZA 4TOQA 3N2CA 3MUZ1 1YNPA 4H8NA 4FR6A 1TJ1A 4HU8A 3NZGA 2IQTA 2WCGA 2J24A 3FSTA 4M19A 3TFCA 3IJ8A 1CXIA 3QQ1A 1YDYA 2OGJA 4PL1A 2ZRUA 3BZGA 4U2ZA 3ZMRA 3NGJA 2OTDA 3LN3A 2XFYA 3G1DA 2VZTA 2NZLA 4I9MA 1RCQA 3EX1A 2YCLA 4J1OA 1JZ5A 3GBEA 1J8VA 7PTDA 1AW2A 4GI6A 3P2VA 1Q6EA 4GIRA 4YTSA 2V5DA 2C8NA 1WUFA 3TFXA 2UY3A 1JJKA 1E51A 2PA6A 1K8YA 4CQDA 2GJXA 1GOOA 1QNRA 2ACUA 4UCGA 4GOAA 4AVFA 2ZFAA 3L65A 1OC7A 5T8GA 1Z89A 4MZYA 2QW5A 5HAOA 3G1XA 4FNPA 4JNMA 5DN1A 1BKHA 3VKDA 2WBKA 4KRUA 2FFIA 2OU4A 3B06A 4INFA 3CWNA 4DJED 4JKLA 1R3VA 4AC7C 1GYLA 1W6TA 2A1YA 4AIOA 4HZ6A 4QDMA 3ZT5A 4IIGA 2WKGA 3O6DA 3W7LA 2IQ0A 4YHGA 1ZL1A 3ZR6A 4C6FA 4GLEA 1SJDA 4TXEA 1EO7A 3E2SA 3A64A 1JNEA 2P3EA 4HPNA 3QTPA 4ZL1A 2FVMA 3D0CA 3WQWA 3NNTA 4NZJA 5A8QA 4LC8A 1F73A 4WD0A 1IGSA 2WZHA 3CV2A 3NL3A 2NV9A 3E3HA 3PB0A 3S6TA 3W2UA 4NNAA 3VNZA 3NPVA 5FIPA 4IUGA 2CLKA 3E0IA 1VBRA 1AODA 1VAHA 4UCFA 1YPIA 1WDQA 5H2ZA 4YN5A 3ONBA 2J66A 1KM3A 3VINA 4JN6A 3W26A 4B5XA 2OSXA 1JCTA 1XRTA 3GIPA 1BWVA 4LUIA 1CBGA 3NZQA 3WDHA 3M6YA 4MWAC 5A6BD 1XF0A 4JTKA 4EP8C 2OOGA 3GDMA 4ATWA 1IZKA 3HBLA 2WK2A 3WH7A 1TWSA 1KR0A 3FDGA 1EX1A 5DANA 5C54A 1H5YA 3QFEA 4LUSB 3VNIA 4B5SA 4ALDA 4LVAA 3R6IA 3LI0A 1FHLA 3T0TA 4E8DA 2WZIA 3ABRA 3DFQA 4LOCA 3QR1A 2OYMA 1DIOA 1F4AA 1Y5XA 4JX5A 4UFJA 1CB2A 1J0YA 3O63A 2WZTA 4GISA 1GEQA 1LBFA 3WBEA 4KT2A 4FP1A 4XBJA 5FF0A 1K7EA 4LCRA 1T8QA 1UYQA 2YW3A 2VXNA 4PUMA 1HJWA 2QCFA 5ABFB 4H2HA 4R7JA 3NSMA 4JHOA 1K6WA 1BRLB 5KINA 4G2DA 1PIGA 3VD5A 1EDQA 4J28A 5RUBA 1FWAC 4O1BA 1E1FA 4BQ5A 2D2OA 4HK5A 4Q8UA 3HG3A 5CC5A 4FK9A 4HZ7A 3GO2A 3ARUA 2WC4A 1I75A 2DZAA 3MMWA 1IT7A 2D20A 1WB0A 4LGXA 3EGJA 2E8YA 3I10A 2AMXA 2EXOA 4PUEA 3APTA 2ZXDA 3H2CA 4I6VA 1ML1A 4HNUA 3CQHA 1QI3A 4CQCA 4G5DA 2J7EA 3RDKA 2V5JA 1FWCC 3S3GA 2XUCA 3UW6A 4JQ3A 2FZ8A 1UWUA 1DIEA 1FA2A 1TQXA 5TQLA 1T5AA 3DHFA 4TTUA 1XRVA 5H8PA 2DSUA 2V5LA 1Z7AA 1PYMA 1OF6A 3TTSA 2X42A 2VCAA 4HYRA 4MNKA 3TW7A 1E5JA 2NWSA 2AQOA 3FYPA 4PODA 3HPFA 4U5KA 2FJKA 3FA5A 1OF8A 3FY1A 5A6JA 2VEFA 3FN9A 2ZC8A 2FGLA 3MUIA 2Z28A 4NZFA 4UWMA 2ISDA 5FJOA 2GWNA 3P84A 5ABGA 5DELA 4OUEA 1E4IA 1HKJA 1W1IE 5M5DA 2PDLA 2Z1XA 3G77A 2XH0A 1YEYA 4PB3A 4JZ5A 3AIWA 1EA0A 2A21A 4B5VA 1CI1A 1UP2A 3S9YA 5C2CA 1F3TA 1G0CA 4ZQCA 2VP8A 4GVFA 2DQXA 5C6MA 1AQFA 3PBYA 4MB3A 5BU9A 1Q6FA 5DFAA 4JDBA 5LHFA 2NWRA 3C2FA 3BLOA 4RLIA 2WMGA 2CETA 3LPOA 3OG3A 3TYEA 3GH5A 3WLPA 4O8AA 4OBRA 2RDUA 2WC7A 3LBOA 2HS6A 2E7FA 4EXBA 4ICCX 2DSWA 1W3KA 3AZTA 4AZGA 2E4TA 3PZTA 5BYWA 3M7WA 3ALGA 4XAGA 2PBOA 1IXNA 4X22A 5BZAA 3LPGA 3WBYA 2YOCA 1PB0A 2UWFA 4I7UA 3BG5A 4YVXA 2OZ0A 2DJLA 5JBDA 2C15A 3GC2A 4CU6A 2QCEA 5DCDA 3WNLA 5G2HA 3VIPA 4HGXA 3MCOA 1G9HA 4A3HA 2WAGA 2XVPA 3BQ6A 3VGFA 2WQPA 1IEWA 3VMNA 1N8WA 2P50A 5CH9A 1XG3A 1NWUA 1XYLA 5AC6A 3M1ZA 4W7VA 2JE8A 2QAPA 4GY1A 4PMRA 3C8FA 2V5BA 1H1ZA 1HL8A 1EC9A 3ITCA 3AS3A 3A4WA 1J6PA 3DYMA 1P0DA 4FR1A 3ES7A 1SMDA 5AVHA 1YYAA 3WL0A 2Z7GA 2FZMA 4UQ9A 2C16A 1ISWA 3BAKA 3LXAA 3OHIA 3EWDA 4P7LA 5C5YA 4Q7IA 3E0VA 2OWCA 1GGOA 4QDPA 4M5PA 1E9YB 5A8MA 5DMMA 1M3UA 3UG4A 1LL6A 3KX6A 3VVGA 1NIUA 4YU1A 4LVDA 1Q13A 3WF3A 1JZ6A 1E1CA 3W02A 1U5VA 2V3GA 3N34A 2TSYA 1SSDA 1WA3A 4PULA 2CZ5A 5DO8A 2FTYA 2YXXA 1ZUAX 1EJTC 4AB4A 1ADOA 3EB4A 3ECQA 4Q8MA 1V03A 3WFAA 4DBWA 3BQ5A 1IZCA 3S5NA 5GPRA 3JR2A 4O18A 4R9OA 2GQAA 1OGGA 4R27A 5I09A 4I9TA 1WBJA 2ZRZA 2PWGA 1E0WA 3V7PA 2QVHA 4B3LA 3NQ7A 2GLKA 3PANA 3KBWA 4BI7A 1DOSA 2IKJA 3FEMA 2W91A 4DUVA 5D9PA 4XK2A 1CXKA 3IS4A 3DFOA 1W9DM 2JALA 1XPYA 4KEZA 2Q6ZA 1US3A 3GIYA 4PFHA 3C2RA 5T91A 3CBWA 4IPPA 1I2PA 1EGVA 2HISA 3FXYA 1TPFA 4KMQA 4PMXA 4GYPC 2HNEA 2WWDA 5CLTA 3W7OA 3RRXA 1AG1O 1EIBA 1PYFA 3EX6A 3H2AA 2GWGA 2NQ5A 2ZYFA 3M0KA 1DQXA 1NSJA 4CVUA 3SAZA 2R8WA 3OIHA 2YLLA 3IJ9A 3F2CA 2YA2A 3I6RA 1HXJA 2XFRA 2Q71A 2Z6JA 1PCKA 1HO4A 2IUZA 1P48A 4M3PA 1EO5A 3O05A 1FFRA 2OB3A 2O7SA 3NO1A 3O2LA 1D8WA 1WP6A 4URIA 4F9JA 3ATZA 4JYEA 2VD8A 3VIKA 2OEKA 1Q45A 3GG1A 4KESA 5LXXA 1QHOA 4LW7A 3WF0A 1VJIA 1J11A 3CUFA 2QDHA 2AAMA 2CHRA 1QUMA 1B3VA 2OEJA 1C8YA 4TV6A 3RLGA 3RLHA 4CD6A 4C1NB 4BF9A 4TMBA 5CSSA 1TIMA 4ACYA 2DY3A 3SZ8A 2Z1SA 4HPJA 3KOYA 3LHUA 5HMEA 5I3HA 4MPQA 4PMVA 3NZRA 2F2HA 1RQHA 3H4WA 1FWTA 3W86A 2J25A 1OD0A 5D32A 1K7XA 3DG3A 3L0GA 4U2YA 1XIDA 3WD0A 1FDYA 2BY2A 1KB3A 3IAQA 1O66A 2F38A 3UZ5A 3RAOA 2W92A 2PBGA 3N4AA 3LQLA 4JN8A 1TREA 1A53A 2WM1A 2HNHA 2BMBA 1TFVA 4H6EA 4RL3A 4R7WA 4WLCA 4FX6M 1YTKA 1IQ8A 3AWOA 1E6ZA 2PB1A 4KH2A 1KV5A 3R43A 3G24A 4UTFA 1ZENA 2YCEA 4DAFA 3F03K 2GGEA 3NXLA 1J2WA 3IGXA 1W1YA 3R5EA 3GC4A 2GGJA 2BVWA 3A6OA 4LAZA 3H12A 5D38A 4ERGA 2VC5A 1EZWA 3A3XA 4BF7A 1OX4A 3B8TA 1P6CA 3G2GA 3MYOA 3ATYA 1FVPA 1DWFM 1JPDX 1TB3A 3N14A 3ZVHB 3G6LA 3ARSA 4P7NA 1TUXA 1LQAA 3M4HA 4QR6A 1BVNP 3F4CA 3WD4A 3N3MA 1XQLA 2GK1B 4FLRA 4EKJA 5LA0A 4H00A 4F2BA 3EBVA 1GVIA 4XKYA 5I3GA 3AIRA 3TP4A 2E6AA 1VRDA 4LYPA 4AD3A 1Z69A 2PRHA 1PE1A 5AZ0A 4IPJA 4JXCA 3W7NA 3HMJG 3S1VA 4B92A 4WDXA 5H91A 3KBSA 4DWDA 3GUGA 1WV2A 3AMKA 4GZIA 4UXDA 4V1YA 5AC5A 3R11A 1AQMA 1S2TA 3AS0A 4PBFA 3WDQA 5FJTA 3WBAA 1X7FA 2XFFA 2CWNA 3EEGA 4P61A 4AZCB 2VZVA 2ZDRA 4ES4A 4JNZA 3S8HA 1D3HA 3SW6A 1BGGA 4U31A 3ARQA 1MNZA 1LLOA 2IW0A 2XG9A 3GU2A 4PCSA 5E0KA 4DJFC 3M0ZA 2BXYA 3GTFA 2ZZ4A 3PZNA 5C9UA 1KXHA 2DVUA 1W31A 3DC8A 4M6QA 1KFLA 5HNTA 1B0IA 3RX2A 1TPH1 2BODX 4MADA 4LS0A 4ZENA 3K1DA 3UXLA 3L9CA 1O5KA 3WN6A 2H3BA 3M5ZA 2AL1A 1JYVA 3AISA 2PTXA 3GWQA 3S0CA 3IACA 3VIJA 2VFHA 4TTGA 3T1GA 1KQYA 3NWRA 5D2TA 1K9EA 1OEPA 1W1ZA 3NQMA 3I4EA 5HPOA 1ZJAA 1MWOA 1F8IA 5AC4A 2GGGA 1A5UA 3AS1A 4CKQA 3WNKA 1GTEA 4ZA0A 5HNUA 2TODA 5HANA 1SZRA 3M0HA 5A69A 3VE9A 1NDYA 4JTFA 3PZ9A 1BFNA 4HMDA 4J4KA 2D3NA 3FXGA 4ICNA 2CITA 1U2YA 1Y65A 4A3UA 1JVNA 1H41A 1W0MA 3IVSA 4LRSA 1PKLA 4CU7A 1KWKA 1C29A 4UFLA 3H4XA 2PD5A 1H4PA 2OT0A 4UR8A 1V02A 4G1NA 1J12A 1PTDA 5F7UA 2OKOA 4S2BA 2HK1A 2Q8ZA 3EOUA 4DVOA 5CPOA 3CLWA 3U5UA 1PL9A 1A80A 4XD4A 3VUPA 1XFBA 2FDMA 2J8TA 3ZR4A 2BVTA 1E73M 4EF8A 4F9DA 2PDWA 4H4IA 3TN4A 1SZNA 3UETA 4GJJA 1C92A 2QYGA 3C0LA 3M0YA 1MUMA 4LV4A 4W7UA 1L6SA 4M51A 2A85A 4CLMA 4D6CA 3SSZA 2ZUMA 4HHMA 2XFWA 2WBGA 5LHEA 4C6BA 4Z1BA 5M2FX 3G1RA 1KXVA 2E09A 2PDGA 5LIKX 1E40A 2F6KA 3IIOA 3U8GA 1E0TA 1IWBA 3BVJA 5T9BG 5A6MA 1PSCA 3IVUA 5CPNA 4ZTYA 1R3WA 1QI0A 4IH3A 3GZAA 4QJ1A 1R3RA 3GKAA 3IUIA 3W6MA 4B2DD 3SQSA 1RALA 3KBNA 3UF9A 4IP5A 4RNIA 3RU6A 1J4EA 4DXKA 2ZZ6A 3P0XA 1TVPA 8CGTA 4G1KA 4ATLA 5CSRA 1YMYA 3W7EA 2YL5A 3WELA 1CGYA 4GQBA 1QBAA 3LLDA 3L4VA 4DJDC 5JMUA 1C3FA 3XINA 5FEWA 2JF6A 4A8NA 3NO5A 2ABBA 3GNNA 3TZNA 1V3LA 5AC7A 1AH0A 4BZYA 5IDZA 1TCDA 4TVCA 4AZIA 2IMRA 1HKMA 1YIXA 3HG2A 1GQKA 4MUPA 5IFTA 2NUYA 5JXQA 2NX9A 4N0RA 3N6HA 1GW9A 1DKWA 1DYSA 3WX7A 3O6AA 1UQYA 3GNXA 3CU2A 4FS9A 1KKRA 2R14A 4K2SA 4OE7A 3LUTA 4IG2A 3C2VA 4AVOA 1Q65A 2AGKA 2IS7A 4LUTA 3Q2DA 5DBTA 5DT7A 3UCDA 3BTNA 1E6NA 4PCFA 3S46A 3W72A 4HA3A 3N4FA 3G0SA 4FXJA 1IR2A 2I7GA 1WZKA 2CU0A 1IR1A 2NX3A 5AOUA 1OSEA 1RR2A 2Q8XA 4NYUA 3ZYZA 1R9YA 4UBPC 3I7RA 1B3OA 2XISA 3GHUA 5BROA 4QG8A 4GJIA 4XUYA 2XHYA 2HJPA 2PD9A 3VU2A 1FDJA 3CXOA 1EJWC 3KE0A 4QQ3A 1SQ7A 1DIKA 3E2VA 1OFDA 3HGJA 3QY7A 1N82A 1XS2A 3C0QA 3ME3A 4RNFA 1HIZA 3OZYA 3LQGA 1M1BA 4MKNA 4HTYA 2WSKA 3PAJA 4ZB0A 1MSSA 2PDNA 3W74A 1A5LC 2FGZA 5D2XA 2P8CA 1V0KA 2F2KA 4KWSA 2OLAA 4PYSA 1GHRA 1NF7A 1KWGA 3PULA 1TWDA 5LIXX 2HE8A 4PR4A 4Q7NA 4AWSA 2CWXA 3S47A 4DWSB 3VGDA 3MO4A 2VX7A 4IJCA 2E6YA 5HNNA 4US6A 4LEQA 5PTDA 4NNCA 1TRDA 4US5A 1EQCA 3MHFA 5H8UA 3UVAA 3P67A 1CYGA 1L6WA 1KM6A 5HPCA 4BFAA 3VKBA 3M0LA 3U2EA 2BSLA 2BBFA 1VEOA 2VZUA 2D0FA 3H2MA 3QMSA 2JKPA 3EWWA 4ERIA 2BX7A 5A94A 4J5NA 3N15A 3G1YA 4LUJA 4QISA 4RXFA 3W1NA 3W83A 3UEQA 3MKCA 3ZXWA 4PMOA 3M0VA 3CIWA 4RE2A 1PHWA 4F2UA 3QBUA 5E1QA 5IHRA 2VT0A 4NF7A 4ORMA 3L4UA 3P5YA 4BI6A 4KFOA 4DAIA 1KGUA 3CZKA 2NSXA 1JPKA 5G1TA 1D3CA 5C8BB 3V4BA 2WVTA 4GACA 2P5NA 4AFYA 1XL9A 4FOJA 4GH3A 5C9WA 1PCWA 3GFZA 1W17A 1VEMA 3R7MA 2WYSA 4WHBA 1WUEA 2CLLA 5D33A 3UR2A 1H50A 1HGWA 2ZX5A 2CKSA 4C6PA 1V51A 1OCJA 3TU9A 4HHLA 4D71A 1GVYA 5KTLA 3U2ZA 1LT7A 1EYWA 1NFPA 1U1JA 4LT9A 1TRIA 3NDZA 3EEZA 1MEWA 4GC3A 4JTDA 4O1AA 3U5YA 3V16A 2H6RA 2XVKA 3CC1A 4P7OA 4IMGA 1KBIA 3VGBA 1JDDA 1MXGA 2Y4SA 2AOSA 3CUZA 2FPYA 5XIMA 2XN2A 1RZMA 4JEQA 4KIEA 2FGBA 3VI2A 4PL2A 1M7JA 2QNEA 4NQ1A 5A2AA 4J27A 1M01A 1QI5A 3LK6A 4BK9A 6A3HA 4Y96A 2A2IA 3LSCA 4LANA 2DH3A 3O3RA 2OFJA 1MQQA 4GJ1A 1IT0A 1TJ0A 2YB1A 4HK6A 4RNJA 4A05A 2HPMA 4IJBA 3FK4A 1TCMA 4B2DA 3PG8A 2GQ3A 1H09A 1VYPX 3PPFA 1TPWA 3SCVA 2VCCA 1OM0A 4J2MA 5I3KA 3AXKA 2OO6A 4DYJA 4UTWC 1PEZA 3ARTA 5DX7A 3CUXA 4LVBA 3PF3A 5M3WA 4GHRA 3WQVA 3GBDA 4GIAA 4FAMA 1G4TA 5MKGA 1IIHA 1ZHAA 2VM8A 4JKKA 5FJUA 2CZDA 4UNKA 3AYVA 1UROA 4LS1A 2E40A 3ZS4A 4E4FA 2MUCA 2OMAA 5B80A 3LSBA 3W1MA 2ZWZA 3M07A 4D2JA 3MKVA 3ZLFA 4C6DA 1H7NA 4PRRA 2WXDM 3B3DA 3AMGA 4OHQA 2PI6A 4B9ZA 6REQA 1V93A 2V2CA 3QGKC 1TPEA 1U1HA 4CNNA 3ITXA 4FNTA 7TAAA 1TR9A 3AUJA 1J0HA 3THCA 1YXDA 4LS2A 2VNCA 1WKFA 4HP5A 4MGGA 1WBHA 5BRQA 2JK2A 3ZJ8A 2FH8A 5G2WA 3PY2A 1H7WA 4JR5A 4RXGA 1EKOA 1NTHA 4TO8A 3MUY1 4MLJA 3TUUA 3L66A 2HXUA 5C55A 3FV9A 2E68A 2PDCA 4GPNA 4M80A 4HPXA 2R1MA 3PUDA 1YPXA 3SFWA 3MWAA 1XR2A 3FEQA 1P7TB 3KUMA 2OWXA 2WSPA 2WMIA 4DZIA 1A4LA 2YL9A 3GH4A 3PUEA 2NUWA 3GTNA 2I9EA 3PAOA 5CSYA 2CXGA 1ZP3A 5AHIA 2J13A 2BHZA 4JTCA 1TWIA 3H53A 3RILA 3WH5A 3OO2A 4RPQA 1LWHA 1XIFA 2OZ3A 3LXCA 4HNTA 1LRQA 2DZVA 4HN4A 2WHMA 5C70A 3U9IA 2ZA2A 1G01A 1VIZA 2O56A 1JR1A 3LNMA 5EKYA 1XC4A 4MJMA 5CKSA 1U5JA 3OIXA 3GNDA 4DI9A 2PDIA 3VILA 1R30A 4GYPA 1K9DA 3WK0A 3DESA 1K02A 5FD0A 1WXZA 4RE3A 3TW6A 3CV1A 3A3WA 3C5QA 3QYQA 5I2UA 1PVNA 1LOLA 3WQGA 1AMKA 1RBAA 1UCWA 2QDGA 4EK7A 3SUVA 3M64A 4N9DA 1GOMA 3GIQA 2FKPA 1THFD 1VFLA 4NJJA 4U4MA 1UR4A 2FMOA 1IYXA 3ZVIA 4WDWA 1S2AA 1ZGDA 1WCGA 3TCSA 3FVMA 4CNTA 2VRQA 3GR4A 4GFSA 3WJZA 2QJJA 2I57A 2VFGA 2IKIA 3Q65A 5BW6A 4AZ5A 2NV1A 1CENA 4GMEA 3O07A 2OQHA 1GKPA 3ORWA 4HA0A 1XH2A 3IUDA 4A4AA 3W70A 1JDCA 3LPFA 3MB9A 2QCCA 2R1LA 1E6PA 1MUWA 1CLXA 4N2YA 4Q7BA 2ALDA 5I07A 1JCYA 1XDLA 2WKLA 3C2YA 2A7RA 2O4MA 2V8ZA 3S9IA 4GBDA 1VCFA 5HMSA 5LIYX 3MSGA 3TWAA 5XINA 3PZMA 1HUVA 2V2HA 4W4QA 3OBAA 4AWTA 2WV8A 1D9EA 4ZFCA 1DJYA 1W1PA 2J79A 1TPC1 3KWSA 5AYZA 2E5DA 3TSDA 1GJWA 4I5RA 1VGAA 2YCKX 3QGVA 3FJNA 5FJJA 4M6UA 4IIHA 2RDTA 1H60A 3SR7A 1IXQA 2CLMA 4GC4A 4R33A 2YGYA 4OTKA 1OYCA 1V77A 1JULA 2NQHA 3V1PA 1EQPA 1QPOA 5D4YA 3CH0A 4ACZB 1EGZA 1O68A 5H1WA 2FTPA 1ZAJA 1YW1A 5F2LA 4O13A 1GPFA 3E74A 5HUOA 4UOZA 4DEFA 1P0BA 4LV9A 2Y89A 3R8RA 4IXHA 5KMYA 2QF7A 2AL2A 3GZ3A 3O6YX 4GG9A 3DUGA 3CL7A 2EPNA 1QNOA 3VCCA 1V6XA 4JFSA 2W9MA 3CEUA 3EOLA 1KGXA 4R3UA 3UXDA 4IFOA 1DWJM 3TJ4A 1OCBA 2Y5EA 4GUFA 3QFWA 5A2CA 1W5PA 3T0CA 4FNUA 5E0FA 3NL2A 3IAPA 3E96A 3CTLA 2QVNA 1EOMA 3PVFA 4K37A 2G3MA 2Z7KA 3K30A 3QLDA 2YDSA 4F0MA 4J3SA 3B9DA 9XIAA 1C8QA 3WLLA 3U7BA 5LZLA 2RFGA 3DFYA 4MNJA 2X7WA 3AU6A 3IIPA 3B40A 4R88A 2GQ8A 3BLFA 4I9AA 4ZBCA 5HQMA 3GG0A 2V3FA 1TV4A 5CAHA 3GR8A 4E4UA 5TIMA 3BLPX 2BDQA 4CQ8A 4GY7A 2F61A 2V5CA 5K7JA 3GDRA 1V6VA 3T42A 1Z48A 7ODCA 2Y7EA 2VKZG 3BK0A 3N73A 1UWSA 3WLSA 4QBXA 4CD8A 3LTYA 4QQUA 4JTJA 5FAJA 5LIUX 4Z42C 3NJ3A 4HJFA 4F66A 2INZA 4D6FA 4ML4A 4RPPA 3N6JA 4DUWA 3WQFA 5A2BA 2ZWYA 3HPSA 1BD0A 1A4MA 1TG7A 4JIRA 1B3ZA 3ISIX 2JEQA 2GOKA 4Z1AA 1CGTA 4CQBA 2GPTA 1E5NA 1I2NA 2PWEA 2VJXA 4AF0B 1KBLA 4Q4KA 2YYTA 1KFJA 1F7BA 1XD1A 3GU9A 4LAKA 3PUGA 2WMKA 4W88A 1V4YA 2QJMA 1K8ZA 2HROA 4G7EB 2ZZ7A 1RJRA 4E3TA 1EJRC 2VURA 2A79A 2PWUA 1UR0A 3MUXA 1YDOA 3WH8A 3N2TA 4JTQA 8XIMA 5CBIA 4QNWA 3SBFA 2DQWA 3ITVA 1FHUA 2J62A 3B8DA 3QMTA 3VKKA 3S42A 1I9CB 5BWFA 4AEEA 5IBXC 3VD3A 4X2PA 1REQB 4WDUA 4ZO8A 3HV8A 1D8CA 3E02A 3CQ0A 1KFWA 1SFTA 1MZHA 1VC4A 3ARYA 1SFLA 2QUTA 3I7SA 5D2YA 1EJUC 3M0JA 3PJXA 1E72M 2VGIA 2E1WA 5J5DA 4PTXA 5KZDA 1A0CA 1N7KA 2QMKA 4Z0SA 4Z1CA 4K1WA 3F5JA 3PJUA 4WGHA 1FTXA 3IV3A 5CQ1A 4JHZA 4DELA 4U28A 5FSDC 2Y63A 1CPUA 4N7QA 3KVLA 5E09A 2VD9A 4GYKA 4RX0A 3N04A 1QBBA 3ARWA 3WENA 1QAPA 2CYGA 4U3CA 3FOKA 1X6LA 3N2BA 1HL2A 5HMFA 1UPMB 4I8YA 3M0XA 3TSBA 2YCJA 4RE4A 3UY7A 4PEEA 2AKMA 2X30A 5HJYA 3NA8A 3N2XA 3DERA 3HOJA 3AHTA 3FS2A 3KL5A 3CZLA 3EAUA 2VDGA 3H7RA 4ZXOA 5J04A 2FHBA 2ATSA 3C56A 1H0IA 1XSJA 2XIIA 1TO3A 2HBXA 1V79A 1K8CA 2PGFA 4XVDA 5AHFA 1XLAA 3DKLA 1JI1A 4NKCA 3OZOA 3F5KA 3E9AA 1CGUA 5IRPA 4AHQA 1P0EA 3WJSA 1RJPA 4PUNA 2ISFA 4AQLA 1XJBA 5G2IA 1YBQA 4UNLA 1MW1A 1K8XA 1ZNNA 4C90A 4NZ5A 1OK4A 4LTSA 3N12A 1E0VA 4FMVA 4LUYA 2VRJA 4GA8A 1OT1A 1W91A 1SO4A 2WNZA 1OFAA 1TTIA 3OGVA 4NRRA 1M53A 3HPXA 1KM4A 1PKMA 4O10A 1TELA 2PDBA 1FKWA 3KBVA 5CZTA 3NQDA 1F74A 5CG7A 2EG6A 2E9MA 1HJSA 4IISA 3EA1A 1DEDA 4ROPA 4WY0B 1K3UA 4A8IA 1Z32X 3QRHA 5CGTA 1C9DA 3BV4A 1XDJA 4QFUA 3CUHA 4S23A 2WHJA 2NLIA 4MNLA 5A8NA 1MYRA 2E9LA 2QUUA 5D03A 1A5BA 4X9SA 1L6YA 3CS2A 4AWEA 4DRSA 4XKMA 3OA3A 2BV9A 4M29A 2EQDA 2POZA 3KOZA 2J8FA 4FALA 4GYJA 2BHYA 5BMWA 1NP0A 2ONEA 1WZAA 2PAJA 2GGHA 1E1EA 5C0QA 3OBKA 2GVYA 3CUIA 4UOQA 1V02E 3GHTA 3URBA 4N9CA 2BY0A 1M41A 2J6XA 5D8WA 4R9XA 2FFCA 5AHEA 3B4UA 1ITCA 1FDZA 2VENA 3A21A 5LA1A 3L5LA 3R1ZA 2GSJA 2J27A 2BVYA 4QGCA 5C9XA 3R10A 5DMNA 4TUFA 3AXIA 4L4LA 1K70A 1EXBA 3CMFA 3NL5A 1MEHA 2Y6ZA 1LRTA 1O7AA 2G4JA 1PZ1A 1EYEA 1M9HA 4DF1A 1YNYA 2OODA 1OFPA 1GNXA 1H51A 4NYYA 2W6RA 1B4KA 4J3VA 1UB3A 1N8IA 4X63A 3WZ0E 3QM3A 4B5NA 5G1YA 4ZQMA 3VD9A 3EOEA 5HMDA 2HEJA 2ZICA 1W5NA 1A3HA 3RNDA 2E6FA 3L5MA 1OGSA 3LV5A 3VX1A 4GGHA 3CAQA 3EDDA 3ZJ6A 5EYWA 3MCNA 3AJXA 3M16A 2BTMA 2I5GA 2O9OA 1KV8A 1GZGA 1MZRA 2EAWA 5FF2A 2PDJA 2OZ8A 1YXYA 4GKLA 8TIMA 2W62A 4MB1A 1M03A 1QT1A 3VMPA 1CW2A 2BY3A 1PJ9A 2OG9A 3PNUA 1OIMA 2E5BA 1XPGA 1XI3A 1W1VA 4MY1A 4J2PA 1JF6A 2FHFA 5FA5A 2VEIA 4Z2KA 3LLXA 2Z6IA 3RITA 1VPXA 3SCUA 1CLKA 2PDQA 4EPBC 1UUQA 4HYVA 2Q8LA 4Q4SA 5K4XA 4QLKA 3N9KA 4C6OA 4GK8A 5LNSA 4H2CA 3E2QA 1BVZA 2PC4A 3UJFA 4C6MA 3B4YA 4UTWA 4M81A 3SECA 1ZTVA 4FLSA 3UERA 3NPUA 5BMXA 3HFTA 2OSWA 3WQDA 2J7DA 4QLJA 3IV8A 1G7VA 1YPFA 4GXMA 3SM0A 4PMQA 3N11A 1I6NA 4B5WA 4H9MA 3RK8A 1SO6A 2GUUA 3NDOA 3A47A 4LUSA 2AKZA 2FZ9A 3W2NA 1EPVA 3UZJA 3QR0A 1XLHA 3W1QA 1XV8A 4AIBA 4NSBA 3OEXA 3NR0A 3QC0A 4Q4RA 3DFTA 2A6NA 4PEKA 5FJPA 3UXAA 4O52A 4NX5A 1NH6A 3BJSA 3R0DA 4UTTA 3PG9A 3PTMA 4L9XA 4NU7A 4BJHA 3SCSA 4AH7A 3NPXA 1R9XA 1E6SM 3ZJKA 4K7YA 3CGTA 4OBTA 3WUEA 3HU7A 4KQNA 1V6UA 4UQCA 3S6DA 5ABFA 4KCWA 3QMRA 1QR7A 3BSGA 2CPUA 1BRLA 3WCZA 2VYOA 1PS9A 3WD1A 1UUMA 2HVMA 2G4FA 4JTLA 1LLZA 2V9DA 1XP3A 3LLFA 1J10A 4DXXA 1HGYA 1Q85A 3TTOA 5TNVA 4NZCA 1ISYA 1TX0A 4AU0A 3GTIA 3LNPA 6CGTA 5I3IA 1YNQA 1JXKA 3WMCA 3NTYA 3LTSA 4FLOA 3D5HA 4IQDA 4G56A 1GT8A 4EWJA 5F2IA 4HU4A 5A8GA 1TMQA 4OU1A 2ODOA 3K8LA 4O8RA 4WSJA 1E0XA 3LRKA 2WVSA 1XIHA 1QPQA 5LKYA 1CDGA 3DC0A 4O0QA 2JFEX 4JFTA 4CNUA 2JQXA 1UKTA 4EANA 1O94A 1UG6A 1FWRA 1MQPA 1O60A 4UMAA 3MO7A 4MJ4A 1R2TA 4C5ZA 4JY9A 4JL2A 1R2RA 2EPLX 4ZCWA 5I03A 3CEPA 2ZXBA 4S2CA 3W7QA 1UH2A 4MJZA 3ZWSA 4IOTA 5GJMA 4RR4A 3VOCA 1RBLA 1OK6A 3UXIA 3MPGA 3AHVA 1KXTA 1C8XA 4DBUA 4RJEA 3RM4A 4R53A 2ZRVA 3QPZA 4XAPA 1RHCA 4HHHA 4JIPA 2IXUA 4Z17A 3NURA 4K38A 2R6OA 1BYCA 3PBUA 4DJEC 3GLCA 3KZSA 4HVXA 2YDRA 3MT1A 2WCAA 5CCZA 1FQ0A 1EC8A 2OELA 4BWLA 3QV8A 3CJPA 3KRSA 2HVOA 4LYKA 1EJVC 2ACSA 4CN6A 3C6CA 3F4DA 1F2JA 1QHZA 2ZCGA 4A3RA 2Y88A 3GVGA 4PC8A 3NQFA 4JOMA 4O19A 3UWYA 4E2OA 3VD7A 3V18A 4LJ3A 3NXFA 1UKQA 2G96A 1SPQA 3LYEA 5CPQA 1HF6A 2VOMA 1GW1A 4N4QA 1K4GA 1I2QA 4QE4A 1JIBA 3GXMA 3HV9A 1QASA 3HMCA 4IQEA 2V82A 3IIZA 1I8JA 4GQGA 4C7FA 3EXRA 3MV01 4HJWA 2VQTA 2D2GA 1D3GA 3STGA 4PBGA 2DUXA 4L9YA 3MVTA 3EA2A 1V0NA 4CGTA 3U2OA 2YL6A 5I3FA 4O11A 4IFRA 3KRUA 1BTCA 3GXIA 2DW7A 1VD6A 2VX4A 4EPKA 4I5XA 3RUBL 3A4AA 1UJQA 2OX1A 1DJGA 3A4XA 1BG4A 3PZVA 3STFA 2PF0A 4FIRA 2ANUA 2DDXA 1QW9A 1J0KA 3WBXA 2RHGA 4DN1A 3TX9A 4C6QA 4O1CA 4EXAA 1M65A 1XLGA 3CV6A 1SU5A 4GD0A 3RLUA 2UY2A 4L4MA 3R8HA 2DSZA 5CPLA 5EB8A 3WDRA 4UQBA 1AD1A 1RCOB 4S3GA 4KF1A 3T0BA 4O0ZA 3SRFA 1JNDA 4TX9A 1DJHA 3MI6A 1VHCA 3B8WA 3W3OA 3ABOA 1A50A 3OQEA 3PPGA 1PIIA 2PGRA 3VDCA 2ZE3A 3ZZ1A 1KLZA 2ON3A 4HMCA 3CT7A 4D6DA 1HVQA 3CHVA 4NXKA 3R8GA 3LM3A 4WJ8A 4Y8EA 3U7VA 2PSNA 1EEPA 2HK0A 1A3XA 3PN8A 4D6EA 1JXJA 4IMDA 1JFHA 3W27A 1KRBC 3VM5A 2WVVB 5AYIA 4GUIA 1QCWA 1PX3A 3U3HA 1VPQA 1OHLA 1EUNA 4MDOA 3TEVA 3LX9A 3RIKA 1K6AA 1AVAA 3WKZA 5J5RA 3WUBA 2W3ZA 4FHAA 1E3XA 3RCMA 3KRZA 3W1PA 5G4EA 3VYLA 1V08A 3G1SA 4GIEA 3MDWA 3M41A 3ENLA 1VPYA 4ADSA 1KFEA 1R47A 3CQKA 2BS9A 3JZEA 4AD5A 3UT0A 5ABHA 1XWYA 3UG8A 2ZUUA 4LU0A 1XG4A 1J18A 4WZHA 3VCNA 4LF1A 1NP2A 1NOWA 1QMLA 3DG7A 4K3ZA 3GQYA 4HOWA 3FHAA 1HW6A 3MANA 3MTWA 3H23A 3KOFA 4PUDA 4D72A 3N9SA 2J4GA 1EWDA 2J9ZA 3K5XA 3DENA 1XYMA 1DHKA 2ZXAA 4DPPA 2YXOA 1P0KA 2EHHA 3RLVA 1DE5A 4I9JA 1M7XA 3K8KA 1GVRA 1NAL1 3KEHA 2X2YA 3FKKA 3WK3A 1TQJA 3MJYA 4DYEA 1OZMA 2RAGA 1PHQA 4PRTA 4ADUA 3W7PA 1UZDA 1XLEA 2CLOA 6XIMA 1XRFA 1KM1A 4PMUA 1O5QA 3TTEA 1TX2A 2R94A 4GCAA 4S3JA 1XBVA 4J9JA 3W76A 1FY6A 4GZEA 2CBUA 1LT8A 3ZFHA 1AQHA 1U22A 4QRNA 4RUBA 4QNEA 3WH6A 3BAJA 4JTIA 1GWJA 5FEXA 1DJIA 4A29A 2BP1A 3W84A 1XINA 3PK7A 1V3HA 2MNRA 2BNJA 2G37A 3R13A 3TYDA 2E3ZA 1LUCB 3PJWA 3NGFA 4XTIA 3QJAA 3ERPA 2WSQA 4P2VA 4E38A 3OG2A 1RCXB 1H1YA 2VEPA 3TR2A 1OT2A 4C1NA 7REQB 2YR1A 2YFOA 3WYZA 1WDPA 1ONRA 1BXBA 2Y8VA 3H21A 2OYKA 3G3MA 1NQKA 3JRKA 4O1EA 4UQAA 1IWPA 1KLYA 1PUDA 4HN8A 1OCNA 3NOYA 2PDHA 3W7DA 3BAWA 3VOFA 2H3DA 2I56A 5B7ZA 1W3LA 4MKSA 3P61A 4LCSA 4H8HA 4FIQA 4CNSA 1NFGA 4M0XA 1FXQA 5G4HC 1BTMA 5GQBA 4JCMA 3IJ6A 1XH0A 3L4WA 4WX2A 1ODUA 3GHRA 3TOPA 1V0MA 3RPMA 4U3AA 4NHVA 2XSBA 4W93A 1XCFA 4JPGA 1WZLA 7TIMA 1XLCA 1DWGM 3PWGA 4M1BA 2DORA 3V5CA 3CB3A 3TN6A 2X41A 3CNYA 3B8UA 2J75A 5K3VA 1DE6A 1A5SA 3T8QA 4ATDA 3OVQA 1GVOA 1IWAA 1F07A 1UWIA 2YXGA 4IFKB 1U30A 2E77A 3URNA 4AIEA 1VENA 2INFA 4QEHA 5FL0A 3W1TA 1L8NA 4P5UA 4JHMA 1BQCA 3G3DA 3ZVHA 1CCWB 1W9BM 2PFHA 2E8ZA 3VDBA 5EY5A 1TPDA 1KCXA 3A24A 3IGHX 3G6MA 4FNQA 1UZ1A 4XISA 3A23A 3P74A 2EKGA 3UZZA 4PUUA 4JY8A 4JQ2A 3DOPA 5A6TC 4Y9AA 2Y1HA 2Y8UA 1D7FA 2V69A 1YTDA 1S3HA 4BCEA 3VIIA 5F2GA 5LNWA 3HPZA 4IF2A 3O1NA 1X96A 3WJWA 3EOOA 1F05A 3CUGA 3SCPA 1XLLA 1FP8A 1LWJA 1WKEA 3WFLA 3OGSA 3P81A 4EXQA 3DHUA 4AZCA 2VR5A 2AQWA 2FIQA 3AZRA 3TTQA 4LBRA 4DWSD 1KM2A 4PCTA 3WLKX 1XLJA 4M56A 1QHPA 4EACA 4Z1YA 1K03A 5AFDA 1WAWA 3N18A 3SADA 3MBDA 1EFZA 5U4NA 3AI0A 1DVJA 3OTRA 3UCCA 4JNYA 4PMNA 1V3MA 5A1AA 1RK5A 4UFHA 4EF9A 1L6FA 1BHGA 3OLGA 4LAMA 3EKLA 2A3HA 1OWQA 2A4AA 1QW8A 1OG0A 3VMOA 2PCQA 1TE6A 1FOBA 1A0EA 4ZSTA 4R34A 2F7FA 3W4RA 4JIQA 2D69A 2X09A 3BSMA 3CHCA 3HN3A 2YZ5A 4DO5A 2C71A 2G3JA 4LH8A 9RUBA 3UJ2A 4D9PA 1V0LA 4NZ3A 3TLLA 4NZ4A 2XPKA 1X1NA 1S1PA 2Y7FA 3BOLA 4HSOA 1XIGA 1WO2A 1FHVA 4DHGA 4REQB 2GJLA 4PMYA 2YA0A 4YLWA 4FOKA 3B03A 3WK2A 3TQVA 4ZODA 1M5WA 2Z00A 4YVPA 4BR1A 1SW7A 2A7NA 4PTDA 4HBKA 1DQUA 1HKKA 1FX6A 1EXPA 1I45A 3VZZA 1TA3B 2OQYA 5KZEA 3CLMA 2PCEA 4NIRA 1QTWA 2FB3A 1XFCA 4GINA 4LF2A 4GNJA 3BAXA 1GK8A 4Z2LA 4F2TA 4S3BA 1VS1A 4OVXA 8RUCA 3PTKA 5DQPA 1U1UA 3HB9A 3NQ8A 3DIPA 4PB4A 4MJ2A 5CPSA 4AZ7A 1C91A 4XQ6A 3UU0A 3PBWA 4LYQA 3RHGA 4XZMX 1PZ0A 3G22A 2PTWA 1LZOA 3PZIA 4LUTB 4WOQA 3BSHA 2ZUSA 2VTFA 4LVFA 4W86A 4GQRA 4JAWA 1XYCA 2WLZA 3TC7A 2E67A 2NVDA 4MWAB 1XISA 2XIQA 2MANA 1UD3A 4KWVA 3IUHA 3BPWA 4U5IA 4H3DA 4YXGA 1B57A 3T05A 2PTDA 2FMNA 1KC7A 5E70A 3SFKA 3EX3A 4CQAA 3UPBA 1ZU8A 1GZJA 2A3AA 4IT1A 5FI8A 4KRZA 3M0MA 1AJ2A 3BGJA 5K9DA 3L2MA 4HNCA 3TC3A 3IK4A 3TVAA 4JTGA 1T99A 1ZALA 4L56A 1VLWA 3K8MA 4CEUC 3GU1A 2GJRA 3W87A 2WNWA 5F4XA 3TN5A 4IIFA 3GX9A 2DZWA 1VFFA 1Y5VA 2CBIA 4PSRA 5A8OA 3BGAA 2ASHA 3GNRA 3W25A 4IIDA 1QOPA 1GVSA 3H6OA 3EWXA 2VR2A 3GKFA 3N2MA 4Q8VA 3RF9A 4ZSUA 3W7JA 1J0ZA 4PTVA 1ECEA 5IOBA 2CBVA 6TIMA 3EYPA 1Q2RA 2P88A 4WCJA 1S2VA 4FXRA 4WR3A 3D47A 3SUSA 4O4VA 1P4CA 3NCOA 4XD6A 2PRMA 4RCXA 2E9BA 1ESWA 2D2JA 4A6GA 1JUEA 3I65A 1DL3A 3CAWA 2C1HA 2XWEA 2Q02A 3BH4A 2FZNA 5CZ0A 5ABTA 5EPDA 4A8LA 3ID7A 5CXPA 1QO5A 1UUOA 3FA3A 3UR5A 3CQJA 2GYIA 4KCVA 2QULA 5GNYA 3M43A 3MV11 4NASA 4C6EA 2PLMA 5CJMA 5TF0A 1XCXA 1H5VA 1Q63A 1AA1B 1QU4A 2D24A 2PDMA 2JIWA 2V6AA 3T4WA 3T2OA 3KTXA 2HS8A 4E8GA 1POKA 1Z9AA 4AXNA 2NSOA 3UWQA 1VLIA 2PLJA 3PFMA 4UZSA 1KCLA 1SO5A 1JCJA 4W85A 2OXNA 1JG9A 3BW4A 3TH6A 3VNMA 1AH3A 1GJPA 3J7HA 4NT0A 4DWSA 4B9YA 2J7GA 5HATA 1QDSA 3G1FA 4IIBA 1KCKA 4H8UA 4GX9A 4QXIA 4X0NA 2Y85A 3T40A 3S2NA 4DUOA 2PDKA 1ONWA 2Z4GA 4IWWA 5FJIA 1LG2A 3W2KA 2NW0A 1P43A 3UA3A 2INEA 3T78A 4W5UA 2Y7DA 1MDLA 4ZGYA 3LDVA 1GQJA 1J96A 2EEXA 1LWIA 1ZZMA 4UTMA 3TLQA 3MCMA 3QLLA 2QCLA 3AFBA 3EPNA 4LPCA 2E25A 4K7VA 4U33A 1I1XA 1Q7QA 1SFJA 4ZVJA 3CZ8A 2X05A 5HR7A 3JS3A 1IEIA 2QGYA 2I9UA 1S3TC 3B8VA 4OJYA 3Q37A 3C3UA 2ZVIA 3W2JA 2XIMA 1BQGA 4PUJA 3NUKA 4MLRA 4DZ5A 1XW8A 2PUZA 4IX2A 3AIQA 4YWSA 3LU2A 3W7GA 2ABAA 5HR6A 1LLWA 3BC9A 2BFGA 3QV9A 4GUGA 4PZVA 3LCGA 3UA4A 2O9RA 4HQVA 3RMEA 3W1XA 2DSVA 1J01A 3C61A 3S2LA 3MZ2A 4LX4A 4F8XA 5A5WA 1AQ0A 3E12A 2VELA 3FGCB 4MUZA 2OWWA 2VUYA 1FP9A 1YE4A 4DJEA 1P5BA 3LCXA 1ZBKA 5REQB 4WXZA 4DBSA 1RY8A 3QPYA 3RM9A 4BA0A 4LVGA 5D9MA 1H7RA 3MJMA 3O0KA 2DUZA 3UR7A 3DG6A 3DEQA 4UTIA 1M6JA 3KOWA 4WRHA 1OFEA 2X8RA 4KFPA 3RCNA 2OYLA 2X40A 3GXNA 3MMDA 3LY0A 1AZ1A 4OKDA 4D8AA 4QE5A 4L6DA 1PX4A 2PDXA 3TYUA 5L6UA 4QEEA 4GH1A 1C9WA 1R3SA 4MHBA 4V2XA 5I3JA 1H7OA 2WM0A 3EA3A 1WYIA 4F0HA 1Q4NX 4IGNA 4LFYA 3UWZA 1EH9A 1MFUA 1KM0A 4D6IA 1KRAC 3A13A 4Y9MA 2WWCA 2QPXA 1UH4A 4S3AA 5A6BA 1NF0A 4Y8FA 1ITXA 3I3BA 3NO3A 5FF4A 4F3HA 1KA9F 1X38A 3RU8X 4EAMA 4NP7A 5G5IA 2EJAA 2PWHA 1XSKA 2FPTA 1YLVA 3UY8A 3R2GA 3EWBX 2CEQA 4B3ZA 4OOZA 4QCFA 2ZX8A 1EDTA 4GBUA 4QJ4B 1LDCA 1F4HA 2XVNA 4B91A 3WDJA 4AY8A 1WQ5A 3UJEA 2LLEA 1ISVA 3NQAA 1TPVA 1WOAA 1UOZA 1ECQA 1ZJBA 3THDA 2Y0FA 2XWDA 3B8SA 3GYEA 1BXNA 3MZNA 2PS2A 3WQ4A 1Q8AA 3LV6A 4TMCA 1CX9A 4PTNA 4AZHA 1BYAA 1NDWA 3ARVA 3PBGA 4HB7A 3LD5A 4L61A 3NDYA 2NLYA 3DH7A 2CCRA 3RN6A 5I24A 4N6FA 1PDZA 1L6GA 3OJGA 2EPHA 1YTEA 1CECA 1W32A 5DEZA 4MB5A 3DXIA 4X60A 1J2BA 2Q3OA 3RO6A 3IJQA 4PB5A 3SQLA 1Z6KA 4MVAA 3UYCA 4N02A 4NY2A 3NSXA 2E28A 1P7TA 1YX1A 1TZ9A 2AAAA 2J9XA 4A2RA 3VUSA 1CXFA 3T6CA 1UA7A 1EDGA 3Q45A 3AZSA 3P0WA 4PMJA 4XO7A 4ZO7A 2QJHA 2JIEA 1Z3NA 4MG4A 1BWKA 5HNRA 2BOEX 3V0UA 4RK8A 2W4XA 4QM1A 2O55A 2YW4A 4P8VA 1X6NA 4H7ZA 1EJXC 3GK0A 3N25A 4KRTA 5D09A 4AZ6A 1CNVA 1EOKA 3E5BA 3PBMA 1KCZA 1HFBA 1P0NA 1AZ2A 3PWIA 2TRSA 1AUSL 1SR0A 4AD1A 1Q2SA 3AHYA 1IF2A 4F0KA 4ILSA 3VA8A 1W8GA 4DZAA 1BAGA 3BLLA 3M5YA 4MZ1A 1UW9A 1EP2A 1XKJA 1KQZA 4H7VA 4XZIA 3EB3A 1B9ZA 3P8JA 2R1PA 1LM1A 3IJDA 4PUWA 3AJ7A 4YL2A 2DV0A 2ZZ1A 3MY9A 3VE7A 1GVFA 2C0HA 3NIYA 4NAEB 1W1A1 2O4QA 3BG3A 3STCA 3GD6A 4S38A 1UZHA 2DGAA 3ARRA 2JBMA 5D2WA 3LZ3A 3AOFA 1A0DA 5A6SA 4JD4A 1TJRA 3GFYA 3IVTA 3RJXA 2G41A 1UOKA 3WSUA 3OODA 2Z24A 5K4ZA 5F4SA 3KL3A 1FUYA 4BI5A 2VZOA 2DVXA 3L2LA 2VR4A 3TAKA 3EXSA 3C52A 4GZ7A 1R7AA 1TKKA 1ZAHA 4KCUA 4QTGA 4F48A 4EWND 5EMUA 3V0TA 5DT5A 2C91A 4RW3A 1AJZA 3PPHA 2VZSA 3N4EA 1IGWA 4L1XA 3CL8A 4AYGA 1AH4A 1ALDA 1C93A 3LOTA 5I5RA 4HNOA 3H22A 5JIWA 3MA8A 3B8IA 3EZ4A 2QXWA 1EEXA 1W2VA 3ARZA 3T2PA 5E93A 4W84A 4A35A