1UB3A

Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
211
structure length
211
Chain Sequence
DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Aldolase protein
total genus 85
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ub3A00
3HGSA 3QMTA 1ZY9A 3KVKA 1KBJA 2NZLA 3NPWA 3PG9A 3W1LA 2Z2UA 3CLMA 3CIWA 4NJJA 3NG3A 1TJRA 3GDMA 4ZVJA 4ZQMA 1H1ZA 4FXSA 3FOKA 3FLUA 4MFDA 3Q2DA 1XBZA 2JGQA 4BF9A 3DAQA 5DCEA 4YWIA 5I3KA 1I2OA 3OVPA 1YPIA 3UD6A 2ISWA 2C14A 5LGZA 4O12A 3MO7A 3C2EA 2R8WA 4M5PA 2BLEA 1AMKA 1YXDA 1WBJA 4AXKA 5AC6A 4ZZ9A 3TA6A 5AHNA 2Q8LA 1H7WA 1M5WA 1Q6QA 4NZJA 1HG3A 2J88A 1VYPX 4JICA 1T99A 4M7TA 1B3OA 3MWAA 4I7WA 1CW2A 5AOUA 5KSWA 3M41A 1RZMA 2YW4A 1LLWA 2DP3A 1GOXA 4GBUA 1FCQA 3C52A 1WOAA 3UY8A 4FNRA 3W7CA 4YL2A 1DBTA 4G1KA 4MLJA 4FNQA 3TIMA 3W2LA 4Z1AA 1ICPA 3LLDA 5E1QA 5C54A 3GR7A 2QCFA 5G5IA 4CNPA 3B04A 3OVRA 2Y89A 5F2LA 3W76A 3IIPA 3OHIA 5FEZA 3KVMA 1B9BA 2J6XA 2WQPA 4DO5A 3HPXA 3W70A 6ALDA 1OK4A 3BVJA 1H7OA 3W85A 3GXNA 4O17A 1TB3A 5BMXA 3MBDA 3G0UA 3W7OA 4O28A 2E5CA 4DO6A 4MZ8A 1UBSA 3HG3A 1ALDA 1K7XA 1YYAA 3PBVA 2ZZ7A 3SGUA 1TPWA 2QCNA 4HPXA 1KBIA 3HG4A 2QEZA 2W0UA 4GXMA 5K9DA 2RFGA 4O13A 3G3MA 2CLMA 5K2ZA 4U28A 2I1OA 4LV4A 4HNVA 3GYEA 5CPNA 3L5MA 3G8EA 3EXRA 1TTPA 1MZHA 1Q6LA 3TV8A 5DXXA 1VYRA 3W72A 2NX3A 3WK2A 3RK8A 2KZHA 5J5DA 5D33A 4MJMA 5DELA 3LGEA 5BW6A 1IXQA 5U4NA 2WPBA 5I3GA 1EP2A 2YSWA 4DF2A 3GDKA 1PIIA 3TR2A 5D09A 3DZ1A 1XI3A 4Y6GA 2G5WA 2GVLA 3M5YA 5KINA 1NF0A 3P8JA 3VE7A 3N73A 4O10A 3HQ1A 4M6VA 4P2VA 2B0MA 2B7NA 2P0OA 1SW7A 3UXDA 1QOPA 1FWNA 1L6YA 1W5QA 4N6EA 1J2WA 4CCEA 2YPIA 3T78A 3A22A 3KFTA 4Z1CA 3G1SA 3M9YA 1GQNA 3SGZA 5D32A 3S1VA 2YYUA 4X9SA 5FEXA 1RR2A 3PSVA 2RHGA 1EX5A 3TXZA 1L6SA 1SZEA 3EX2A 1GG0A 3CEUA 5CPLA 3BGGA 3LHWA 3EWZA 1H50A 4Z1BA 1KM0A 3VE9A 1OX6A 5EYWA 4ZQPA 3TX9A 3LOTA 1DJNA 3V1PA 2Q3OA 1SFLA 4ZQOA 8TIMA 5LSMA 1JULA 2ZRWA 5F2MA 3KRSA 3LCHA 1O5KA 2E5BA 3HGJA 4B5NA 1A5CA 3USBA 4CQ8A 4JEQA 1HO4A 2E6FA 1NAL1 3WJXA 3UWQA 2OCZA 1GVSA 2QCHA 1H62A 3L0NA 3UWUA 2C6QA 2DZWA 2QUVA 3MYPA 3IGSA 5KZEA 1CX9A 4JTIA 2NXHA 2Z1BA 1FWWA 3NQCA 4UTTA 1K3UA 3O16A 1KFJA 2YZRA 2PC4A 1I2NA 3WJWA 4OWGA 3IGXA 2BX7A 1QMLA 3BLEA 1LRNA 2DORA 1TPDA 4O53A 3GR8A 2A1YA 3ABSA 5FI8A 3L0GA 4XWUA 4AWUA 3HMJG 1VH7A 3W88A 5E93A 4Y8FA 2XFWA 1VJIA 1KM4A 3KRZA 3R5EA 4RX0A 3G22A 3W7NA 4N02A 1R47A 5EBUA 2QJHA 1H7NA 3EWXA 3LHUA 1SO6A 2FPTA 3NL2A 2Y63A 3W86A 4FIQA 4NXSA 4MOZA 3L9CA 5HWJA 5CZSA 4BI6A 1ZFJA 3GLCA 1A5SA 1OX4A 1Q6RA 4FXRA 3SJ3A 1SO4A 2OT0A 2I9EA 2A7PA 2H90A 3W1MA 1JCMP 4CNNA 4CNOA 2A2IA 4UFLA 1K7FA 5F2IA 2TSYA 4RZ4A 3NQMA 1KFCA 3NQVA 3M16A 4KWVA 1EIXA 4KFOA 5F1VA 1THFD 4UFJA 4MIMA 4FO4A 3A24A 1PHWA 3PB0A 4P61A 4MYAA 4QNWA 4TMCA 3M6YA 1FDYA 3A21A 4YLWA 5FF4A 1H1YA 2BWGA 1M7PA 2QCDA 1FBAA 3EB2A 5LZLA 1SO5A 1TQJA 4OV9A 2R94A 3LI1A 3SFKA 2NV1A 3W1PA 5FEWA 3DH7A 4IUOA 2B7OA 1U5JA 4OGZA 3IVUA 3Q94A 1YPFA 1FWSA 5HQEA 4UIOA 1JCYA 3SW6A 3L67A 4FNTA 2GVGA 1TIMA 2NUXA 4LU0A 5CZ0A 3GDLA 1ZCOA 3LLFA 3R13A 3W2KA 1QOQA 3W2NA 2A7RA 1PCWA 3FYPA 4ADUA 3E49A 3EXSA 5KITA 1XL9A 3W7EA 2CZEA 5ABTA 1IIGA 1TRDA 4OQVA 3I7QA 3PY2A 5F4XA 2GQ9A 4E38A 2V2DA 1FQ0A 4FX6M 4IJBA 3LM7A 4LRTA 4FNSA 3S42A 2QJGA 4IX0A 4UCGA 5BMWA 1DOSA 2J24A 4JYEA 4UMBA 3O8AA 3MI2A 2VFGA 1SO3A 3G1FA 1W5NA 1BWKA 2XN2A 4WOQA 3FFSA 1F5ZA 1C29A 3TK7A 4LW7A 3LCXA 4FB7A 3F1QA 3HIJA 1D3HA 3DHDA 4O57A 5L6UA 3STFA 2PRMA 4GUHA 3LTYA 1QAPA 3NQ2A 4I7VA 2VXNA 4O0ZA 1LCOA 1ML1A 2ZQ0A 4Y90A 2Q8ZA 3HGOA 4GJ1A 3OVQA 4TR9A 3PBUA 3U2OA 2C19A 2FPVA 2ALDA 5D2YA 3TW6A 3QPZA 5I3IA 1Q3NA 2NLIA 3L66A 1XDLA 1YADA 1DHPA 3KAOA 3BGJA 3JR2A 3IRDA 2ZRUA 1WV2A 4HNTA 2ZCGA 3M47A 1BEUA 3FIGA 4GE8A 1W3TA 4UTLA 3TJLA 1O60A 4K6AA 1K8XA 4JGDA 1JCXA 4QM1A 5G1YA 1DQWA 4XBSA 4IMGA 1XC4A 3O05A 4RV8A 3W1XA 4L4MA 3FA5A 1VPXA 1TV8A 4Z1DA 3W7PA 4TMBA 4U4MA 4N4QA 1I45A 3RLVA 3GDRA 4GUGA 3TAKA 3VFLA 1UB3A 4QAIA 4ONVA 3NR0A 3NQ6A 3MHUA 2PE4A 4HNUA 2O7SA 3F4NA 4IPIA 3W9ZA 5CSRA 4WZHA 1H63A 1WOBA 1J4EA 3HG5A 4JTFA 3DI0A 3CEPA 4YMZA 4RZ5A 5D04C 3VKJA 1F2JA 1S5VA 2ZBTA 5EA9A 2VFIA 1G7VA 3W7GA 5AC7A 1FXPA 4L4LA 4O14A 3TH6A 5G4WA 3W22A 1ME9A 3LERA 5TQLA 4C1LA 3LRMA 3EWWA 4KKXA 1VZWA 3QMSA 3PUDA 2A7NA 1X6UA 1D9EA 1U83A 4PL1A 4FEZA 3QSTA 4R53A 1QO2A 3PSWA 1QPRA 2BSLA 1JR1A 1RPXA 3TC7A 3C61A 1HO1A 4FNPA 3ZWTA 4UNKA 5K9CA 5AYYA 2JKEA 3A23A 3DFOA 1XXXA 5I3HA 3NO5A 3DBPA 1X1ZA 4AHPA 1I2PA 1QR7A 1I8JA 1FUYA 4IMFA 4HN4A 1D3GA 4MKNA 2QDGA 1OVDA 4M6PA 1MEIA 5AHIA 7TIMA 1BTMA 4C1KA 5FF2A 3G1VA 4LS2A 1F76A 3U8GA 3T4CA 3LX9A 5LHFA 1DORA 4JXCA 4BWLA 5IBXA 1LROA 2ZZ4A 3TUUA 1LZOA 4RZ6A 4WUIA 3LI0A 1K7EA 1HTIA 3LV5A 3FEMA 2DZPA 3R8RA 4UTUA 1TMHA 1WBHA 2AGKA 4ZQCA 1QPNA 3TDFA 1OYBA 4ZMGA 4LS0A 4GWEA 1VGAA 3SIZA 1FXQA 4LVGA 4DELA 5G2IA 1W37A 5FEPA 1JJKA 4UTHA 2VELA 1NSJA 3C4UA 4RXFA 1K02A 2A85A 3T40A 1EUNA 4E2DA 2P1FA 3IIXA 2C18A 2BTMA 3NQ7A 5FESA 1G69A 1H5YA 3T44A 2CFFA 1PS9A 2QAFA 2GPTA 2ZZ2A 3ABQA 4QQ3A 5AHLA 4A2RA 4UMCA 3GB6A 1N7KA 3G1XA 3NXFA 4YCPA 1F73A 4MPQA 3GAYA 4XZ9A 4A22A 3PG8A 1G6CA 1KFKA 2ZRXA 1OYCA 5LNWA 3P5YA 4UR8A 4UC5A 2A21A 4AB4A 3LCIA 5DLCA 2RDWA 3W83A 2CZFA 4LS1A 5HUOA 3LB0A 4NXKA 4JX4A 1IXPA 2PCQA 3IEBA 1C8VA 2X1TA 3DKLA 5I3JA 3KX6A 4GRSA 1SR9A 3QZEA 5I3FA 1X7FA 4LUIA 4NX0A 2WSRA 3GAKA 2FB3A 1GVQA 1YDNA 1EPXA 4GUJA 3WJZA 1TTIA 3O6YX 1HFBA 1C9DA 1OFRA 2QAPA 3I65A 1RV8A 2BZNA 3HB9A 4LTSA 4ML9A 1TQXA 4PH6A 1QDSA 1EEPA 2ZZ3A 1OHLA 3I6RA 1FWRA 4O16A 2AAMA 1PCKA 4AWTA 5G4EA 2Y62A 3YPIA 5F1UA 1FDJA 2R14A 4UFHA 3G0XA 4JX6A 3W3OA 1VLWA 3S5YA 3PBYA 3C2FA 5D2TA 5TBOA 4AAJA 2ZRVA 3M0ZA 3UQNA 3T7VA 1OFOA 2TRSA 3BARA 3HOJA 4MUZA 1GEQA 2V30A 1AK5A 3SSJA 5D03A 4PCFA 1RD5A 2J27A 4BK9A 3QPYA 2QF7A 4HKPA 3EKLA 4XTIA 3G1HA 3SECA 1ZJIA 1LTDA 1PE1A 1LDCA 3IIZA 3PUOA 2QJIA 3BLIA 4UMAA 1OFBA 2C0AA 5HMSA 3BK0A 2VFFA 4IOTA 4KFPA 2QCDB 3TQ0A 2ZRYA 1G4EA 4WY0F 3G18A 1W31A 3IIOA 4UNLA 4AHQA 1ZNNA 5TIMA 4HSOA 4FIRA 3PBWA 3TCEA 2WSQA 1B4KA 2VKZG 3H53A 4N9EA 3NPXA 3SI9A 4N2YA 4IWWA 2CLFA 2DZUA 4FF7A 2WO5A 3W6YA 1UASA 4IQLA 2X30A 1SUXA 1SPQA 2WNNA 3N9SA 3HPZA 5D2VA 1P0KA 4OBTA 5BRBA 5F4SA 3KXQA 1UCWA 4M6QA 1OYAA 2YDAA 4ZQNA 1SW0A 2YFNA 4XKYB 3W07A 1R30A 5H91A 2FJKA 4OHQA 1VQTA 2WOQA 3PR2A 3E96A 4GUIA 1OX5A 1H61A 2C13A 4UXDA 3NQAA 4QISA 3DHFA 3HJZA 3MI3A 3GKAA 2VENA 4DBEA 4S2BA 1GG1A 1G4TA 3PB2A 3W1UA 1GZGA 3B0PA 4EVZA 1PHQA 3HPSA 1AW2A 1KFEA 3LCGA 4WY0A 4JS3A 1J5TA 5HINA 1Y0EA 1TCDA 3G24A 1RQBA 2ZTJA 4JYFA 5DN1A 3N19B 4XKYA 3TW7A 2YR1A 4ICNA 3LBMA 4JR5A 2Y88A 3QYQA 2FQIA 3B0UX 4M19A 1KM3A 4LVFA 3PULA 1T8XA 4OE7A 5K7JA 1GVRA 3B0VC 1LLZA 4DEFA 2EGZA 3NA8A 3VCRA 3F4WA 4D2JA 3INPA 1AL8A 4Z08A 1XBYA 3HO8A 1GPWA 2C1HA 3O6CA 1NFBA 2H8XA 3W74A 4I9AA 2ATSA 2D73A 4OU1A 2V9DA 1W5OA 3WFAA 5FF3A 5J5RA 3WK0A 4UTWC 1GJPA 1AW1A 2HMCA 3M1ZA 3NZ1A 1LYXA 2V2HA 1W8SA 2Y7DA 2Y7EA 1YLVA 3GNNA 4Z0JA 1UJPA 4MVAA 3MYOA 3MI6A 1MEHA 1NEYA 1F05A 4AHOA 3RF9A 1V7YA 3NQEA 4JDBA 1QPOA 4E0CA 1WXJA 4R34A 1EWEA 1O4UA 4TX9A 1L2UA 3NL5A 3RLUA 3O63A 3S1XA 3P82A 3P67A 3STEA 1SW3A 3OEXA 1S5WA 3B03A 1YTEA 1TV7A 3N3MA 3O15A 3B05A 4LV9A 2FTPA 2GJNA 1R2RA 4K7YA 2ZRZA 3NNTA 2H3DA 3ABOA 2AQWA 3S1WA 3P74A 1FCUA 3MW7A 3UY7A 1XBVA 5HUPA 1YTDA 1ONRA 3E02A 1UUOA 2TYSA 3WJYA 1LOSA 2HTMA 3IVTA 3BG9A 3C0JA 4EIVA 3CIXA 1B4EA 1RQHA 4IXHA 1G7UA 3T55A 1B57A 5EY5A 4LVDA 1SZNA 1VCFA 1LOQA 3G8RA 4M7SA 3UNDA 2XN1A 4MFEA 1OK6A 1NF7A 1XM3A 4O1AA 5KZDA 4ZL1A 3R89A 3FJ6A 3PAJA 5L9FA 2W6RA 1IF2A 4RCXA 1OG0A 4DXVA 4LNYA 3HF3A 5F4WA 1VYSX 4E2BA 1P0NA 3S5NA 3AO0A 4MLRA 1AG1O 3S9YA 3GVGA 3GX9A 5C2XA 3NOEA 2ATMA 2E68A 5K9XA 2VFDA 1SSDA 5C6MA 1TPUA 1R2TA 2J9YA 1KM2A 3DFSA 1VRDA 1P4CA 1QO5A 4I7UA 1FX6A 1L9WA 2V5BA 2WV8A 3CC1A 2YXGA 2EHHA 5U7SA 4DQWA 4LOCA 2G97A 3W7MA 1A53A 3UPBA 3CWOX 3N9RA 3C8FA 1P5BA 3NDOA 1F74A 4JN6A 1VC4A 1SSGA 1TJPA 4Z0SA 1GTHA 5LHEA 2F7FA 3W7LA 1OFPA 4EOUA 2NUYA 4KFNA 2P10A 1Z44A 1QPQA 3BW4A 5DCBA 3G3DA 4UTWA 4YCOA 5AFDA 1EP3A 1JQXA 4JTEA 3L21A 3M5VA 3RFAA 1TREA 4XQ6A 3B4UA 2X16A 2ZZ1A 3GNDA 4K8EA 5LNRA 2PRLA 4O15A 1LRQA 3L2IA 3ATZA 3TSMA 2G95A 5EMUA 2DU2A 2FPYA 2A6LA 3NQ8A 3SY5A 3QFEA 5T26A 3CB8A 3NQFA 4UR7A 3N14A 2X1UA 1TO3A 3C3NA 1XUUA 3TQKA 1I2QA 2R91A 2ZTKA 2H3BA 2ZZ5A 1XBXA 2CWNA 2Y61A 1QFEA 4IGHA 3W1RA 3I7RA 3NEVA 1BWLA 1SZGA 4QIUA 1T0OA 5DBUA 2H6RA 3UZ5A 3UWWA 1JRCA 3QW4B 1KLZA 5K3VA 3ZFHA 3NAVA 1W1ZA 4QITA 3WK1A 3LXAA 1BKSA 2CW6A 4ADTA 3EKZA 1YDVA 2H8ZA 3NM1A 4R33A 4Q32A 5DBTA 1VR6A 5DY2A 1MEWA 3N2MA 3S5ZA 4NZFA 2Y70A 3CPRA 2NV2A 2V81A 1QNVA 3I68A 4JTUA 3NM3A 3TFXA 1O95A 3WK3A 5KMYA 1OFQA 4K38A 2NX1A 5D30A 3FKKA 2RDUA 1ME8A 4EWND 5HWMA 4XUGA 4Q33A 3STCA 1IXOA 4JTGA 4A3UA 1EWDA 4JIPA 5A5WA 4LT9A 4EF8A 3MP4A 3JS3A 1JCJA 1M7OA 4XTDA 4FX8A 3O06A 2VEIA 3DGRA 5LGXA 4NNCA 3FKRA 1KA9F 3ABRA 2G96A 4MY9A 5CSSA 2VEMA 3UXAA 4LVAA 3S5OA 3PS7A 1GYNA 2V5LA 3N2XA 4RLIA 5D2XA 4AEOA 4UTJA 4JYDA 1ZAIA 1OABA 4UTMA 1P1XA 2NX9A 4UTIA 3ATYA 3KVLA 3W1QA 3W1AA 3NQDA 4O52A 1O94A 2ZFAA 3OBKA 3LHYA 4PTNA 4K7VA 1XDMA 3AJXA 1MSSA 4K8HA 2E6AA 5D05A 4LY8A 1PL9A 1ZAJA 1KTCA 3DKJA 2CZDA 2NWSA 4LC6A 3WJSA 2HS8A 3O1NA 4EF9A 1WAUA 5DCDA 3C56A 5K4XA 1IXNA 1TPEA 2HS6A 1Q45A 2YGYA 3DXIA 4N6FA 3UYCA 3L5LA 1VLIA 2YW3A 1KM1A 5AC8A 5HR7A 4IMDA 2QKFA 3E9AA 3ELFA 4LRSA 3TQVA 3ZS4A 2DZSA 3LXBA 3M7WA 4O11A 3NPVA 5G2HA 2DJLA 3EX1A 1I4NA 3TSBA 3LCWA 1A5BA 3GXTA 3GIYA 3MP5A 4FNUA 3A5FA 5CZTA 3P60A 1W5MA 4CCDA 1KM5A 3UWYA 3W2JA 3W7RA 1IGSA 1TPFA 4MJZA 4ALDA 4NJKA 4NX5A 4DF0A 3M44A 2VFHA 3GKFA 1H60A 1TV5A 4IXXA 3CQ0A 3B8DA 1FCVA 1V5XA 4J9JA 1YXCA 3LTSA 4BFAA 4CQAA 2E6DA 1GYLA 1F6KA 1AL7A 3MMTA 6TIMA 1PVNA 3LCLA 1GVFA 3HGRA 5LKYA 5EL1A 4DF1A 3FJLA 1SZFA 4HIBA 5LNUA 2IQTA 3SR7A 3TKFA 3TE9A 2X2GA 1ME7A 3HBLA 4NUWA 2EPHA 4LVBA 4GUFA 1DJQA 1O5XA 2QUUA 3BG5A 4N9DA 1TPB1 4K36A 4DPPA 4IX2A 1ADOA 5K4ZA 3H55A 3VNDA 5AHEA 1W3NA 2YCEA 2RDTA 2BXVA 3QM3A 1DL3A 3TJXA 4WOZA 3DFQA 2LLEA 3EX4A 3G0SA 1KLYA 2PRHA 4UFIA 4HNNA 4LUJA 5D38A 4GFSA 2A0NA 2Z6IA 4BI5A 3DI1A 1KV8A 4X22A 3RU6A 3QMRA 3TNOA 1CI1A 5FF7A 4PL2A 2V0TA 1DV7A 3M5ZA 3A5VA 3W1NA 4CQ9A 5HJLA 3M43A 3W7IA 4N9BA 5AYZA 4HHPA 1EUAA 3C2RA 2QCMA 5D37A 4PEKA 1LRTA 1FWTA 4DPQA 2V82A 1F6PA 2YFOA 4UTTC 2Y85A 2CZ5A 2UV8G 4NU7A 3W2UA 4O1CA 3DU0A 3NZRA 1S3HA 3TU9A 3S8HA 3NPUA 3EWBX 2A5HA 1Q6OA 2ZA3A 4MY8A 3FS2A 1EB3A 1OJXA 1H7XA 2A6NA 2WNQA 1IIHA 1OX4B 1Z42A 4ZQRA 3THAA 3W7JA 1ICQA 3LXCA 4WY0B 1W0MA 4AVFA 1Z48A 3PM6A 5HULA 3P62A 1GWJA 3P84A 5HNRA 4AWSA 1M6JA 1LORA 5E0KA 5EKYA 4RJEA 3W2MA 4KWWA 3FYOA 1H7RA 1X1OA 1FY6A 1YXYA 4TO8A 4N9CA 1X8FA 2ZA1A 4OT7A 1RQEA 3LDVA 1KW1A 2WJZA 5G2WA 3W75A 3D0CA 3MUXA 4UTKA 5SWUA 1WYIA 3C2VA 3ANYA 4QJ1A 4FHAA 3LHVA 4R7JA 1OFEA 2YYTA 2FB2A 3UWZA 3CHVA 2NXIA 3MHFA 2FDSA 1SFJA 4A29A 1SU5A 2FFCA 4JY9A 4NNAA 2OJPA 4N4PA 5IM51 1EP1A 2QUTA 1A5AA 2CLHA 2Z0IA 3ZR4A 4UFKA 2B7PA 3EWYA 1RVGA 5D2WA 2ABBA 3SZ8A 4JD4A 3S1UA 3H54A 4WQ6A 1HL2A 5CKSA 3BO9A 2J9XA 3IVSA 5MHBA 3NVTA 1NVMA 4AH7A 3EXTA 1XKYA 2OZ0A 1OFAA 3TMQA 3MP3A 4PODA 5C55A 5CPOA 3QEZA 3K30A 1MO0A 3R12A 3CWNA 2EAWA 1JUEA 4NT0A 4A21A 4BI7A 2GQ8A 2ZYFA 2JKPA 4Y9AA 4QNEA 2ZA2A 1G4PA 3LHTA 3GDTA 4X3ZA 1TRIA 5CPMA 1TYGA 2JGYA 3DENA 1FDZA 2NWRA 3UWVA 1XUZA 5BOOA 3R2GA 2FLIA 3UZJA 1GVOA 2VEPA 3L0KA 4DBDA 2E5DA 3TROA 3O6DA 1OF8A 4JTKA 3E0IA 3QJAA 3OIXA 4NQ1A 4NNBA 2X1RA 5CG7A 5AHFA 3L68A 1TPVA 1VHNA 1PV8A 4PFMA 4H3DA 4FX7A 3DFTA 4BWLC 4H4IA 3C6CA 2C16A 3U6WA 3NL6A 3G1YA 2DJXA 1FCBA 3QC3A 1W5PA 2GOUA 2EF9A 1JRBA 1ZALA 3IV3A 3P5ZA 3B06A 3TSDA 3TXVA 3W87A 1N8FA 1K8YA 2Z6JA 1TTJA 2XN0A 4O0KA 4YXGA 5G1TA 1TPH1 3CU2A 1VCVA 5F2GA 3C2OA 4UFMA 3HG2A 4MZYA 1QCWA 1K03A 2QCGA 3Q58A 1KM6A 3S0CA 2Y6ZA 1JQVA 4JX5A 2HSAA 2JKAA 4NVTA 1ZAHA 3KOFA 2I14A 1K8ZA 1E51A 3L65A 4NJIA 3L5AA 3LV6A 5AB3A 1H51A 1W56A 2ZZ6A 2VC6A 2QCCA 5CGQA 2CLIA 2VFEA 1XFBA 4TIMA 1VHCA 1VS1A 2NXGA 1WX0A 4HPJA 3JRKA 2VEKA 2CLKA 1WA3A 4RR4A 4GNJA 2WSYA 2CU0A 2QCEA 4JY8A 3MJYA 1JCNA 4WJEA 3BLFA 5H2ZA 2E1DA 3A9IA 3PC0A 3EWUA 1ZHAA 3BV4A 4HSNA 4WD0A 3NQGA 3W84A 2YX0A 1YTKA 2B4GA 5KZMA 4O1BA 3P8IA 4IPJA 1DQXA 2TPSA 3QRHA 5AHMA 4Q4KA 2A4AA 4O50A 1R46A 3G1AA 5LNSA 3IGUA 3Q37A 2OX1A 4JTSA 3DFPA 2VOMA 5AN7A 5C5YA 4K37A 2QDHA 1WDWA 2ISVA 3CTLA 4XBKA 1VCGA 3GXPA 5KTLA 3NL3A 2EKCA 2GUUA 3LRKA 1ZENA 3GZ3A 5A8GA 4WX2A 3CM4A 2JBMA 5DY3A 2Y7GA 3OG3A 1ICSA 4WXZA 2C15A 4QSHA 5HR6A 3O07A 4NJHA 3W71A 2B7QA 3TAOA 3GK0A 4MZ1A 4AMAA 4A2SA 3E12A 2TMDA 4W9TA 3S6DA 3KVJA 3LHZA 3W7HA 4HT3A 5EPDA 4IMEA 3LTPA 4Y96A 1GT8A 4WXYA 3G1DA 3LRLA 1JUKA 2QR6A 3EX6A 4MYXA 5IBXC 5CZJA 2E6YA 1KFBA 2OT1A 4JTJA 4K39A 5FF0A 3IIVA 1W3IA 1WQ5A 3F03K 5DXYA 2ABAA 3P81A 2CLEA 3LBCA 3TC6A 4BR1A 4ORIA 3V75A 3KRUA 2Y7FA 3LCFA 4DO4A 4PA8A 1KTNA 1OF6A 2X1SA 4O19A 4LWWA 2Q3RA 4JTHA 1MXSA 2DZTA 3W23A 3QQ1A 3QQ0A 5BNKA 5LNVA 3NYZA 3BG3A 1LBMA 1YDOA 4O4WA 4GC4A 4UUIA 1KV5A 4RK8A 2W79A 1N55A 3QF0A 2RKXA 2F84A 3TMLA 3W7DA 1Z41A 2E77A 3PF3A 1DVJA 1T96A 4MY1A 4ADSA 4NJGA 2FIQA 3W1TA 4S2CA 1L6WA 2CLLA 3NGJA 4AF0A 3KHJA 1I2RA 3RNDA 1SQ7A 4H6KA 1S5TA 3BW3A 1XCFA 3BPWA 4JIQA 2E09A 1A50A 1LBFA 5GVJA 2RH9A 4PC8A 2DZXA 4RXGA 1EA0A 1R2SA 3ZWSA 3W73A 2C3ZA 3P7YA 4AF0B 4OV4A 2CLOA 3N34A 3QH2A 4JTLA 3CT7A 2NUWA 2OMAA 3UPWA 1KTBA 4JTTA 1TPC1 4IMCA 1LBLA 3QW3A 1DKWA 3OA3A 4S1FA 1H7PA 3P61A 2ZDRA 4JDYA 4O4VA 1AW5A 4O54A 4X2RA 3PUEA 5AYXA 4POCA 4O18A 1QWGA 4O1DA 4O8RA 1JCLA 2ISSA 4CLMA 3W7KA 1KFLA 2WNZA 4RKAA 1OFDA 3EEGA 4ORMA 1GTEA 3RMJA 1F7BA 1JUBA 2J9ZA 3EX3A 5HWNA 2GVJA 2QCLA 1W54A 2GQAA 5D02A 1HUVA 2DZVA 3M5XA 3PWAA 4LC8A 1G4SA 2WKJA 2O7QA 1UUMA 1G67A 1TSIA 3BW2A 2PURA 1LP6A 4CCCA 3VI2A 3TFCA 1TTQA 3I7SA 1JVNA 3THQA 3W7QA 4TU1A 3MHGA 3STGA 3DFNA 1LOLA 2JK2A 2V8ZA 1LM1A 3MBFA 4JNMA 3QSRA 2V2CA 3PVFA 2GJLA 3P80A
chains in the Genus database with same CATH superfamily
4NSBA 3KW3A 4Y9MA 4MNLA 3KVKA 3ITYA 3NPWA 3PG9A 1OY0A 2PUZA 1REQB 2Z2UA 1R9XA 1BPLB 3NG3A 5LA0A 4ZVJA 4GNKB 1H1ZA 3SCTA 3MB9A 3D3AA 3Q2DA 1NWUA 1XBZA 3HQNA 5DCEA 3WQ8A 5I3KA 3OVPA 4L1GA 2R8WA 3K4DA 4XSLA 3AXKA 3PTMA 2W67A 4W89A 4GYFA 4NYYA 3WLJA 3TA6A 1QI4A 3UJFA 2INEA 1Q6QA 1HG3A 1W9DM 1VBHA 3QHOA 4M7TA 1MW2A 3MWAA 4PMYA 1CW2A 1VFFA 5AOUA 5A3HA 4QE5A 1EO5A 3WF1A 1GOXA 4GBUA 3C52A 2ZXBA 3SY1A 2WVUA 2X40A 3CBWA 3TIMA 3SB0A 3W53A 1KGUA 5E1QA 1E4MM 1P6CA 5G5IA 3OVRA 2XH0A 5I09A 1UZHA 3RLGA 2J6XA 2WQPA 1GORA 1Z32X 3HPXA 1E43A 6ALDA 2J6VA 3CV2A 1H7OA 3I3EA 3GXNA 3MBDA 2XIOA 3CUZA 3ZSTA 4O28A 1UBSA 3V36A 1ALDA 4DHGA 2ZUVA 5EMYA 3RLHA 3S9ZA 5I77A 5DT7A 2R9RA 3HG4A 4GXMA 4O13A 2CLMA 1JZ4A 2IS7A 3A64A 1LG1A 4WLCA 5M03A 1B0IA 1R3SA 5CPNA 3G8EA 3W37A 3EXRA 1QJWA 2IKIA 3G6LA 3H2AA 1O7AA 4QFUA 2NSOA 1WKEA 2F2KA 3MZ2A 2NX3A 3RK8A 5J5DA 1N8IA 3EPMA 3LNPA 2VDGA 3AS0A 1IXQA 5U4NA 2WPBA 3MKKA 1T5AA 1FH8A 1EP2A 3QBUA 5I3GA 4JTAA 3LZ5A 3JU2A 4H9MA 1NDWA 2GVLA 2D3NA 2WC3A 1NF0A 1TR1A 3TJIA 4DWDA 4N6EA 3T78A 4ZXOA 2X7WA 5FEXA 3UWEA 3PSVA 1EX5A 4U10A 1ITUA 3LD5A 3EX2A 4INFA 5CPLA 3VC6A 2J13A 3LHWA 3VE9A 2D2OA 1OWQA 3FEQA 5CZKA 5CGMA 1SFLA 8TIMA 1JULA 2W27A 2GSJA 4B5NA 1JDCA 1C93A 4JEQA 3STPA 3U7VA 3WJXA 4GQ0A 3FW6A 1H62A 1ZL1A 2QNEA 5FJTA 5FJRA 2DZWA 2XUCA 2QUVA 1EQCA 3PJUA 4JFUA 4ZB5A 2WB5A 4JTIA 3DN5A 1F8MA 2NXHA 1FWWA 1CBGA 5C9WA 4Z2LA 2Y1HA 2PC4A 1LRNA 3GVQA 3ONBA 3ABSA 5FI8A 4XWUA 2VGBA 4Y8FA 1KM4A 3R5EA 1N8WA 4V15A 4BQ4A 3G22A 3G5EA 3PFMA 3LHUA 1SO6A 1CT5A 1AJ0A 3NZGA 4FIQA 3HU7A 4NXSA 4IL2A 4MOZA 3L9CA 1XIBA 3CXOA 4OOZA 4CN1A 1A5SA 1OX4A 3SJ3A 1SO4A 2H90A 4J3VA 3W1MA 1JCMP 4HYVA 2A2IA 4BQ2A 1UKQA 4H7CA 1HP4A 1KFCA 3CYJA 2PCEA 4KWVA 1EIXA 4KFOA 3S3GA 3MWCA 1M53A 4F9DA 1D2KA 3LEPA 1VFHA 1DXIA 1KCZA 1YE4A 1FDYA 1V6WA 2PDMA 2G0WA 5HK4A 5IHRA 2BWGA 2FHFA 1M7PA 3WLQA 5T9BG 1FKXA 1ECQA 4OV9A 3LGDA 5BU6A 3ARXA 3SFKA 4PSPA 1S5NA 2NV1A 4H9TA 1XWYA 1XINA 4C5ZA 3CH0A 4DB7A 3Q94A 1CXEA 4QGCA 1LUCA 3ZVIA 3SW6A 4FNTA 3L4YA 2NUXA 3WY1A 2DUZA 1ZP4A 2BVWA 3R13A 1UWIA 1FWHC 2A7RA 3PNUA 3I4KA 1Q7MA 3U7BA 4P8XA 2FH8A 3CUJA 3FV9A 1BVZA 3L4ZA 1FQ0A 4H8HA 4IQEA 4IJBA 3LM7A 4LRTA 1LQ2A 3GU9A 1E71M 4FNSA 4D6JA 1I9CB 4B3ZA 3CUIA 3PZNA 5BMWA 2PDHA 3WQPA 1XKJA 2IPWA 3O8AA 1W1IE 1RH9A 4Q4SA 2XN2A 4V1XA 1B90A 1DWGM 1F5ZA 2NVAA 3AJ7A 1C29A 1YDYA 5M17A 5E6ZA 3LCXA 4FB7A 3IARA 3F1QA 1ZTVA 3CZLA 3DHDA 5L6UA 3WCZA 2PRMA 4YTSA 5DX7A 1QAPA 3Q67A 2FDMA 1CNVA 4JTRA 2WHLA 3WUGA 3FX4A 2FPVA 2ALDA 4XB3A 1JCTA 3GU2A 5I3IA 2QYGA 5IOBA 1EJVC 3HV8A 3L66A 2EBNA 4JNZA 3RX3A 3JR2A 1B3VA 1WV2A 2ZRUA 3RAOA 3PANA 1J9YA 2PP0A 1DIKA 1UR2A 2J74A 4GE8A 1XLGA 3KBJA 5H8PA 1BXNA 4K6AA 2ZE0A 3GXIA 3P0XA 1M03A 1DXEA 3W1XA 4JFVA 2XIQA 3F5KA 1VPXA 4GOAA 4Z1DA 3UGVA 3W7PA 4N4QA 3GDRA 4J1OA 2O7SA 2VDIA 4LUSA 3W9ZA 5CSRA 5FJOA 1L8NA 3WEMA 3HG5A 3TONA 1XQKA 1FWJC 3L2MA 1F2JA 1KXQA 3T0TA 4DIAA 3RUBL 2FZ9A 5HNUA 4NF7A 5HATA 1FXPA 1QTWA 5HNTA 2VWSA 3EWWA 5C9UA 3FXGA 1WXZA 3QMSA 1X6UA 4C65A 2AAAA 4FEZA 3UR2A 2HRWA 1XV8A 3DBNA 2OU4A 3WBAA 4IT1A 4U31A 5K9CA 5AYYA 3B8TA 3E0LA 1ZQ5A 4AHPA 1I2PA 2X05A 1KQYA 2BBFA 1CCWB 2QDGA 1JI1A 1MEIA 1IE7C 1MW3A 4H6EA 4P8WA 5EGRA 1OCQA 4LS2A 1HL9A 4MTVA 4FXFA 2O92A 3G6MA 3KOXA 4J3XA 4CQCA 1LROA 3R0DA 1T8QA 1LZOA 1Q66A 4R7OA 4WUIA 2WZMA 3SCVA 3R8RA 4GI9A 1VEMA 3ENLA 4RW5A 4UTUA 2FZMA 3LU2A 4JIHA 3ZJ6A 4HU3A 1A49A 3BMWA 1F07A 4ZTYA 1W37A 5FEPA 5KETA 2VELA 2PWUA 3BLPX 2V3GA 2CWXA 1K02A 2P1FA 2QXWA 3CTTA 2BTMA 1JPKA 4WK9A 4FZIA 3NQ7A 4IP7A 1G69A 3T44A 2CFFA 5E9AA 3NWRA 8XIMA 4K1WA 3BOFA 2GPTA 2ZZ2A 5BXPA 4RE0A 1XISA 2VYOA 3GB6A 2P3ZA 1F73A 3C0LA 4GX9A 2PWHA 1OYCA 4DJDC 2DVXA 4UR8A 4AB4A 2CZFA 3GY1A 2QGHA 1SR0A 4NXKA 1IXPA 1VFTA 1EDTA 3B8SA 4LF2A 3AIUA 2GJRA 7REQB 3S9IA 2VVNA 1J0IA 3R8GA 3E38A 5CJNA 4NX0A 1GOWA 3GAKA 4LYPA 1EPXA 3UG3A 3K4WA 2DY3A 3QGVA 1OZMA 2WCAA 1RV8A 1TQXA 3U48A 4RDYA 3WSUA 4JZ5A 4LAUA 2AAMA 5DFAA 4H8UA 3ZO9A 1PCKA 4AWTA 1NFPA 5HPOA 2Y62A 3APGA 2EPNA 4HGXA 1FDJA 2R14A 3G0XA 3V3WA 3RDKA 1F3XA 4JX6A 2J75A 3GH4A 1VLWA 3IRSA 5D2TA 5TBOA 3WN6A 4AAJA 3D5HA 4ROPA 1OFOA 1RBLA 2PGFA 3VD4A 3LYEA 3SSJA 1L0PA 2ZDSA 1W3HA 3V18A 3WKZA 2QF7A 3UW6A 2SFPA 3MQTA 3MMDA 1ZJIA 1LTDA 1PE1A 1DJYA 3IIZA 1TJ2A 5A1AA 2QJIA 3MUIA 1BYBA 4KGJA 2C0AA 5EFFA 4IL0A 2G4FA 2OLAA 2VZOA 2E0PA 4F66A 4I90A 5DMYA 1S2VA 4M51A 4UNLA 4DBSA 3CHCA 1ZNNA 5TIMA 4HSOA 3PBWA 5JIPA 5IDIA 3TCEA 3GG7A 2WSQA 3QR3A 4N9EA 3SI9A 4ZOCA 2I5IA 4IWWA 4FF7A 2WO5A 4MB4A 1JEZA 3W6YA 1UASA 2ZUMA 1IEQA 3RPDA 3CPUA 4ERAA 2X30A 1S2TA 2UBPC 2WNNA 2GVYA 2XDFA 4OBTA 4US5D 2WYSA 2FMOA 1SMAA 5F4SA 2YDAA 1TMLA 3COTA 1WAWA 2FJKA 2R1PA 2V67A 8CGTA 4AZCA 5FA5A 4A4AA 2OKTA 1G0CA 1E5JA 3EBVA 4QISA 4X61A 5FOOA 3HMCA 4HOXA 1GG1A 1G4TA 3CS2A 4MMWA 1AH3A 4EVZA 1PHQA 4H9YA 2J8TA 3AAMA 1PJ9A 1QASA 4GC3A 3QXBA 4KIRA 5DQPA 3V5FA 2INZA 4WY0A 3QY6A 5HINA 3ARRA 1TCDA 1OGBA 1R9YA 2HZGA 1NJJA 1XP3A 4QP0A 4AD4A 3VGGA 5B7YA 4JYFA 1IGWA 4FAMA 2H9AB 2DQXA 3KP0A 1FWIC 3U4AA 2BHUA 2Y88A 3BMXA 2OSXA 4MJ4A 4QTGA 3RX2A 3QYQA 4UNIA 4M19A 3F4DA 4LVFA 2GDUA 4NY2A 1F3TA 1V0LA 4PTVA 4A8RA 3ZJ8A 4K1GA 4KPLA 4Z08A 4QE4A 1XBYA 4FPSA 1GPWA 1XGZA 1UD5A 1QI2A 1ODZA 3W74A 5AVNA 2GLKA 4I9AA 4DXKA 2WKGA 4OU1A 3WFAA 3WMLA 3WK0A 4F2UA 3UCCA 3M1ZA 4GY1A 2Y7DA 2Y7EA 1UJPA 3MYOA 3MT1A 4J3SA 1F05A 3SSZA 2PTYA 2F6XA 4JDBA 1WDRA 1QPOA 4E0CA 1WPCA 1O4UA 4WSJA 2E4TA 3RLUA 4EE9A 5GJMA 3SCNA 3B03A 1ZRQA 1TWDA 4H6QA 1R2RA 3R10A 2J7GA 1TJ0A 2OZ3A 4GLEA 1XBVA 5HXMA 2FGBA 4PMXA 5XINA 2HTMA 1KCXA 2VX7A 3IVTA 3B0XA 3BG9A 1GZ1A 4K8GA 4EIVA 3EDFA 3CIXA 4IXHA 4P8UA 3XISA 3AXXA 1MRQA 4IGSA 4M81A 4MFEA 3ZIZA 1NF7A 3MZNA 4R5EA 3WNOA 2BOFX 4GZEA 3ID7A 3BANA 3R89A 3K8KA 5L9FA 1IF2A 3WLRA 4E2BA 3PPFA 3TQPA 1XLIA 1AG1O 4ZO9A 5C2XA 2ZX9A 5K9XA 3VIPA 4ZENA 3SCRA 1UROA 3DCPA 1HKVA 1VRDA 3RRXA 4I7UA 1A0CA 1W1A1 2XHYA 2WV8A 2DGAA 5U7SA 2EHHA 4IIEA 3V16A 4DQWA 4JNYA 3G77A 1NARA 5JQ9A 1UQYA 1JAEA 3ICJA 1ZBCA 1P5BA 1CGXA 2J7FA 3AUOA 1KRAC 3IJ9A 1EKOA 1XYAA 5I7GA 4NIRA 3LSCA 3N1AA 4X63A 1P7TB 4C7FA 4DUWA 1XLAA 1J0HA 5C9XA 5DCBA 4EXQA 2G4JA 3G3DA 5JBFA 2CYGA 4GYKA 3U9IA 3RFAA 4HJWA 5LIWX 3B4UA 1F4HA 1UP3A 2X16A 3UG5A 5E09A 4W88A 1QNRA 1QPKA 3L2IA 4OZOA 3N13A 4HU0A 1W1YA 3UEQA 4LEQA 4DZ5A 2FPYA 2A6LA 1EF2A 1HX0A 2WSKA 4E5TA 3SY5A 3QFEA 4A8NA 3ZLFA 3TZNA 4KWUA 1KBBA 2PDCA 5H6HA 3C3NA 5E5CA 3TVAA 3T09A 4QRNA 4JQ2A 2CWNA 3U3HA 1CB2A 1SZGA 4QIUA 1T0OA 4AZBA 3UZ5A 3GHRA 1JRCA 4XAPA 5K3VA 3ZFHA 2VMFA 3N6JA 1KWGA 1BKSA 1M01A 2PGRA 1OQFA 4ADTA 3OZYA 3NM1A 5DBTA 2CHRA 3AXHA 1MEWA 2RDXA 3CPRA 1TMQA 4XAGA 4JTUA 1FHVA 2HK0A 3TFXA 1PO9A 5KMYA 4PN2A 2NX1A 4V1YA 4CD6A 3FKKA 2RDUA 1UA7A 1WZMA 4Q33A 1HJVA 3STCA 4A3UA 3GG1A 1UMLA 4JIPA 5A5WA 3LG3A 4CD8A 3FJ4A 1XHGA 1ITQA 3O06A 3T0BA 1XLKA 1MQPA 1YMYA 3WD1A 2G96A 2VC5A 4LVAA 4UTJA 1ZAIA 3QQWA 5E9XA 1P1XA 2AL1A 3APTA 4B90A 3ALGA 2DW7A 3W1QA 1VFMA 4ERGA 2FTWA 2JEQA 5CCZA 3OBKA 3LHYA 4B16A 4AUBA 4LAOA 1E55A 4K7VA 3AJXA 4GYPC 3UERA 4K8HA 3REQB 3PPGA 4LY8A 1TZ7A 2W63A 4D8LA 3O2LA 4WHBA 4ML4A 2HS8A 1WAUA 3POCA 2CXEA 5K4XA 1IXNA 3PZMA 4ACYA 3MVTA 1Q45A 4N6FA 3PTQA 3L5LA 1VLIA 5HR7A 3ELFA 4L4OA 3WQ5A 1I0BA 1GKRA 1ODUA 4LRSA 3ZS4A 4IMAA 3M7WA 4DWSA 4CD7A 3NPVA 3U2CA 4DJDD 1LL7A 3H70A 3O7UA 2DIEA 1SJCA 1W3JA 1IGSA 4MJZA 2E8YA 3P6LA 4HZ8A 1A5MC 2C0HA 3AYRA 3D46A 2VFHA 1V3KA 5C2GA 4UQCA 3B8DA 1BG4A 1FCVA 4A3RA 1EBGA 4BFAA 3MJMA 4CQAA 1GYLA 1AL7A 3MMTA 3THDA 6TIMA 3HGRA 2YKKA 3MDUA 4DF1A 5LNUA 4DWSD 2IQTA 3SR7A 1QNOA 1DJQA 1VJZA 4NAEA 1J0JA 1ADOA 5CLTA 3I3DA 3H23A 2RDTA 3TJXA 1E1FA 2LLEA 4Q7NA 1OC7A 2PRHA 4UFIA 5BU9A 1IEWA 3QKEA 4M1RA 3AS3A 2Z6IA 1WZLA 4X22A 2BY0A 4C6LA 2V0TA 1DV7A 3A5VA 4IIBA 3VM7A 1UD8A 4CQ9A 2OQYA 5HJLA 2BVYA 3M43A 3W7IA 4N9BA 3XIMA 4CVUA 3C2RA 2QCMA 5D37A 5DMNA 1Z3NA 4DPQA 2NLYA 2V82A 2YBUA 4PCSA 3FA4A 4UTTC 2Y85A 5D9PA 1YNQA 4NU7A 3ITCA 2HNHA 2R24A 1JF5A 3TU9A 3BWWA 1SJAA 2A5HA 2H9AA 4FA3A 4MY8A 3FS2A 1UZDA 3BJTA 2R6OA 4L80A 1OX4B 1Z42A 3TN3A 1GK8A 4AVFA 1Z48A 2ASHA 3QTPA 4HA3A 3P62A 5A2BA 1M6JA 1LORA 2P5NA 3W2MA 5C0QA 1EPVA 4GY0A 4OT7A 2ZX5A 1DXFA 1KW1A 3AICA 3MUXA 3C2VA 1Q65A 4H00A 4QJ1A 2NQ5A 2V5KA 1UG6A 1ZJHA 2FDSA 4Y2WA 4NNAA 3VOFA 2NQHA 4N4PA 5IM51 1MQRA 3OTRA 4AIBA 1XFCA 3EKGA 5AYIA 3EWYA 1WKDA 5D2WA 1ZCCA 2YA1A 4JD4A 4B2DD 2WJEA 3H2CA 2OZ8A 3RCMA 4AG0A 3MTWA 3IVSA 2Z1WA 1ZP3A 3SQSA 6ENLA 4A8IA 3TMQA 3VOIA 3K30A 3R12A 1X39A 1IQ8A 3CWNA 1UR8A 3VD9A 3MV01 4PCTA 4J3UA 3UJSA 1FFQA 4BY3A 4JKKA 4ICCX 4BI7A 4AZ7A 3CQIA 3ZYZA 2OG9A 4G7FA 4TV6A 1HP5A 2WPGA 4MB3A 1TRIA 2VOTA 2PGEA 1SZRA 3SCUA 1K6AA 1ONWA 4QBXA 1EGVA 3UWVA 5BOOA 1O68A 1UD4A 2OOGA 4GZIA 5HDRA 4EPDC 1GVOA 1RP9A 2VEPA 2HVMA 3CB3A 4E8DA 3E5PA 3PZOA 1MW0A 1OF8A 3EWCA 4ZBCA 3E0IA 4B4FA 3OIXA 4Q4MA 2X1RA 2QQ6A 4GH1A 1VHNA 4PFMA 1E56A 1ZJAA 4AC1X 4FX7A 4E6MA 2VO5A 6XIMA 3NZPA 4BWLC 3UZYA 3QHMA 4GXPA 1A3XA 4H4IA 1UD2A 4MWAC 4DX3A 3POHA 5ABHA 4IQDA 4W5UA 1TR9A 4RPQA 4DAFA 1PKYA 1S39A 3UESA 2AOSA 3P5ZA 3W87A 4XZLX 4E3TA 2DZAA 2Z6JA 4YXGA 5G1TA 1TPH1 3CU2A 4F8XA 2ZXAA 4AVNA 2PZNA 1XG4A 3RR4A 2QCGA 1BGGA 4DWSC 1JQVA 3II1A 4A8LA 4JX5A 2HSAA 4JFWA 1ZAHA 3IPWA 3OLGA 3KOFA 5LA2A 2I16A 1E51A 4NJIA 1KKRA 3VDAA 1R85A 5FD0A 5A8OA 4E2VA 2OYLA 3GG0A 5DANA 1HT6A 3OLIA 2VWTA 5CGQA 2VFEA 4TIMA 4D71A 5A2AA 4DYEA 3LM3A 5I00A 4D6IA 5A6SA 4ACZA 2VEKA 3VMPA 1RCOB 1E3ZA 4J3TA 3IAPA 3OPSA 2CU0A 2QCEA 3TYDA 1JCNA 4WJEA 5H2ZA 4M80A 3E0VA 3EWUA 6XIAA 1YTKA 1Q6EA 4IPJA 2DDXA 1VEOA 2ALRA 4LUTA 4C6FA 2OX1A 2PSNA 4JTSA 1UUQA 2VOMA 2GGIA 3C86A 2J7CA 5C5YA 1Q8AA 2QDHA 1PTAA 4DZAA 4GD0A 1VCGA 3WMSA 3GZ3A 3N18A 3HN3A 1Z6KA 1ICSA 1Q7QA 3BV7A 3CUHA 4J27A 4QSHA 4MHBA 5HQMA 2B7QA 2XGIA 1A5OC 3TAOA 4MZ1A 1EJ7L 2HNEA 1A5NC 3S6DA 4HT3A 7XIMA 5FAJA 4Y96A 2CKRA 1DEDA 3EX6A 3K5XA 4F0MA 4MAVA 3UFYA 5IBXC 4JTJA 4B9YA 4GGHA 5TF0A 1WQ5A 1UWTA 2ABAA 2CLEA 2W3ZA 3T8QA 2Y7FA 4PA8A 1DIOA 4ATWA 4ZR8A 1RD6A 1E6PA 4LWWA 2Q3RA 4LAZA 4KCVA 4GKLA 4E2OA 3T2OA 5BNKA 2J79A 3NYZA 3PJXA 4UUIA 4RK8A 1N55A 2RKXA 4YYCA 1H0IA 4BQ3A 5REQB 3F2CA 3W82A 1JXJA 1Z41A 2E77A 3PF3A 1DVJA 4ADSA 2FIQA 4ZOAA 3VOHA 4S2CA 3W4RA 1UWQA 1RHCA 2X0HA 3I6TA 3NSMA 4J5NA 2BY3A 4JIQA 1VPQA 4BJHA 1H41A 2RH9A 3WNPA 4GIYA 3W28A 2DZXA 4XSMA 1EA0A 2C3ZA 4AF0B 2XVNA 4P7LA 1BVNP 2W66A 3ERPA 3CT7A 5A6JA 1EC7A 3UPWA 1V3IA 2O9OA 4LCQA 4S1FA 3DYMA 3P61A 4JIIX 4X2RA 5AYXA 4POCA 1R7OA 2PDGA 4O8RA 3AZSA 3EDEA 4HN8A 5BXSA 3EAUA 2ISSA 2PPGA 3W7KA 1GQJA 1GTEA 1UH2A 5GPRA 1QNPA 1UKSA 3S2JA 5EMMA 2DZVA 3T2QA 2Z4GA 3GXFA 3RITA 3BOXA 1O1ZA 1UUMA 1CXKA 1LP6A 4YHEA 4FF5A 3GR4A 1TTQA 2DT2A 3AQUA 3PNZA 1XD1A 3MHGA 3STGA 1TA3B 4FI4A 2PWEA 2PTDA 4EXBA 2V8ZA 4B5XA 1LM1A 4C6NA 4PMZA 1IEXA 3H4GA 3ZXWA 1GEHA 4PEEA 4GJJA 2NZLA 3VIOA 3B0YA 4H8NA 4GACA 3CZ8A 2G37A 2YCLB 3V0TA 2OLSA 1KB3A 3CIWA 2WWDA 4D6CA 5XIAA 4H7ZA 4OFCA 1TJRA 3UXIA 1J0ZA 2ICSA 2ZXDA 1M68A 2PFHA 1I2OA 1AQ0A 2ANUA 1E0WA 3CIVA 2FGLA 3HFYA 1U2YA 2IQ0A 2V38A 3C2EA 2NQZA 3RHGA 5AC4A 3VD7A 4M5PA 1WBJA 3N2BA 3V0UA 2V3DA 3T0DA 3MMWA 3M0JA 5AHNA 2JIEA 2Q8LA 1GONA 1XC6A 4NZJA 3MUCA 2VT0A 3MO4A 1VYPX 1NWSA 2QT3A 4WGXA 3I10A 6REQA 4YIWA 4HMDA 3PTKA 4C6IA 2JEPA 3M41A 2WLYA 3L4VA 4TTGA 3W7CA 1DBTA 3WD3A 5BXTA 3W2LA 2GGHA 2PP1A 3MY9A 4E8GA 3ME3A 3PAOA 1BFNA 1E15A 3GR7A 2PS2A 2Y89A 4OVXA 1N2VA 3KTSA 1B9BA 1XYBA 4R3UA 3TCSA 4DO5A 3W70A 1RCXB 4O1FA 3P3BA 1HXJA 4J2MA 1TUXA 3CV7A 1M7JA 4J40A 3W7OA 4A35A 2Z28A 2EJAA 2E5CA 3VA8A 4DO6A 3U5YA 4G5DA 1T40A 1W9VA 1K7XA 1YYAA 1R86A 4WKAA 2QCNA 4C1NA 1UJQA 5FACA 3WH7A 1EHNA 5K9DA 3G3MA 3KLKA 3EMQA 4GPNA 1XPGA 4G7EB 4P7RA 5K2ZA 4W85A 3UR7A 3UXKA 3WQDA 1RLCL 4HNVA 3GYEA 3PZGA 1JYXA 5JIWA 1S2UA 1Q6LA 3RN6A 1YBQB 4J3WA 1K70A 3SCOA 1VYRA 3CV6A 5D9MA 3QC0A 8XIAA 1S5MA 2KZHA 1CGWA 5DELA 4Z1YA 4MM1A 5BW6A 3BLOA 4CVWA 3IGHX 1U1HA 3GDKA 3OG2A 4S3EA 3TR2A 1UR4A 2G5WA 4NI8A 4D72A 5BYWA 3VX0A 3P8JA 4O10A 4P2VA 3ZZ1A 2B0MA 2P0OA 2NT0A 1FWNA 1UOZA 1JYVA 2YPIA 4L7ZA 3KFTA 3G1SA 3IJLA 1GQNA 3M9YA 3SGZA 1XIIA 5D32A 2VRJA 1RR2A 1J6OA 2VR4A 3SRFA 4E4FA 2G41A 2WANA 1L6SA 3R7MA 3EWZA 1H50A 1KM0A 5EYWA 3VXGA 3TX9A 2Q3OA 3TLQA 4GI6A 1XCWA 5LSMA 2ZRWA 5F2MA 3KRSA 3HGJA 1FTXA 3GTIA 3KWSA 3OBEA 4MB1A 4I6VA 5RUBA 4MDOA 5BOFA 4QSFA 4RDZA 1DIDA 3UWQA 2OCZA 3ITXA 3MANA 3SQLA 5DRCA 4Z2HA 5C7HA 3UWUA 3EA1A 2PDBA 3ES7A 4FLOA 3MYPA 3IGSA 2OPJA 3LUTA 4IFKB 4QCFA 2Z1BA 4UTTA 1K3UA 3TWBA 3O16A 1YRRA 2YZRA 3WJWA 4OWGA 3IGXA 2DORA 1TPDA 3PPHA 1TA3A 3GR8A 3M46A 3PZUA 3TZFA 3HMJG 5E93A 1KFWA 2XFWA 4H7VA 2QPUA 3N4AA 2BHYA 4KRTA 1TWZA 1S1PA 3IJ8A 4DNMA 1O12A 5EBUA 2QJHA 1H7NA 3EWXA 2FPTA 1EXBA 2FHBA 3NL2A 4XIMA 4P7QA 3W86A 2ZWZA 3S83A 1PYFA 3R79A 4J35A 1WDDA 2A7PA 3W0KA 4CNNA 3VD3A 4GABA 2QPXA 5LIKX 5FL1A 3UVAA 3VILA 2TSYA 3WNLA 3M16A 3BOLA 1XLJA 3TYZA 4HSHA 2AKMA 4FOJA 4P61A 3H6OA 3M6YA 4IPPA 5IDZA 1QWKA 2QLYA 4HZ7A 5LXXA 2W5FA 1GQLA 4S3FA 3M07A 2QCDA 3EB2A 5LZLA 1TQJA 3ANUA 1R3TA 2R94A 3LI1A 1LT8A 3LSBA 4UCFA 5TD4A 1MMFA 5REQA 4IUOA 3TTYA 1VFUA 5FJIA 3K8LA 2VZTA 5H8MA 3L67A 1V0NA 2D20A 3KCJA 4LX4A 4E4PA 4PUEA 1QOQA 4F9JA 3W2NA 4AZ6A 4CN4A 2E25A 2F6UA 1XL9A 3W7EA 5ABTA 4OQVA 3I7QA 3PY2A 5F4XA 3QZAA 2GQ9A 3WG6A 2V2DA 3VIMA 2GDVA 5A8PA 4NAFB 3O3RA 4IX0A 1BF6A 3LPFA 3M0VA 2J24A 4J28A 4JYEA 3SJNA 3G1FA 3RILA 4WOQA 4Q8MA 3FFSA 1RK5A 3ARVA 4PULA 3D3FA 4GY7A 4O57A 3STFA 4GUHA 3LTYA 5HANA 3NQ2A 4I7VA 4LJ3A 1LCOA 1ML1A 4H19A 4Y90A 2Q8ZA 4GJ1A 1UIOA 2QMJA 3MSDA 4GI8A 1N82A 2XFRA 3TW6A 3QPZA 1PZ3A 1XDLA 1YADA 1GVIA 4YN5A 3BGJA 3IRDA 4UTLA 2WMJA 2QJNA 1P7TA 3TJLA 3AC0A 2XIBA 1PB0A 1K8XA 4QLLA 1A4MA 5G1YA 1EEXA 1DQWA 4IMGA 2YL6A 2HPMA 1E6RA 1TV8A 1TVNA 1V02E 3CT2A 4U4MA 1P43A 1I45A 3VFLA 5A95A 4ONVA 3NR0A 1RY0A 3NQ6A 3MHUA 3F4NA 4OJYA 5TAOA 3CEPA 3DC8A 1M9HA 1UR9A 4A3HA 1MZRA 4US6A 1G7VA 3T9PA 3W22A 4Q4PA 3VNLA 3LRMA 4ZB2A 4H8VA 1V02A 2GSHA 3PUDA 2A7NA 3SADA 3QSTA 1QO2A 3QLLA 3HURA 3T0AA 2GWNA 1RPXA 1KGXA 1L6FA 1S2WA 3O0FA 2JKEA 3A23A 3WF2A 3DFOA 4KIEA 1EDQA 1SMDA 4MPKA 1FUYA 3H2OA 4H9VA 4DAIA 2QHAA 3VUPA 4ZEPA 4C1KA 2RGMA 2WZIA 5FF2A 2OYMA 2FZ8A 1F76A 5FJPA 3OZPA 3T4CA 1UWRA 5LHFA 4JXCA 5IBXA 4RZ6A 2Z24A 1K7EA 1HTIA 2JALA 3LV5A 3FEMA 1FWEC 2NW0A 4JQ1A 3DOPA 4ZQCA 4ZE5A 4GWEA 3LK6A 4LF1A 1LL4A 1EJUC 2ZADA 3A4WA 3VCCA 2Q6ZA 1SVDA 3ZR5A 4KCUA 4I5RA 4RXFA 4JKLA 4E2DA 3T40A 1EUNA 3KP1A 1PKMA 2XVPA 1BD0A 1E0UA 3LS9A 3AHXA 3NURA 4KETA 4QS6A 2R1LA 3L4UA 4TQTA 5AHLA 4MADA 5IFPA 2G3FA 2Y0FA 3KBNA 3NXFA 2WZTA 1LLOA 4XZ9A 1XIMA 3PG8A 2ZUWA 2ZRXA 2WHJA 3EB4A 4UC5A 3NSXA 5DLCA 1FWBC 2Q09A 3N12A 3LY0A 1FWGC 1X96A 1X6LA 3LB0A 4JX4A 4LYKA 4MUPA 3AU2A 2NVCA 3KM8A 3IEBA 2YBTA 1F3WA 4HNCA 4Q8UA 4IP5A 4GRSA 3GTNA 1NQKA 4NZCA 4LUIA 4LPCA 1P0DA 4G7EA 3IACA 2HK1A 3K1DA 2WVTA 3F5LA 4UOZA 3WJZA 1DJIA 2IW0A 2Y24A 1OFRA 2QAPA 1TV2A 3I65A 2JIWA 3HB9A 3AYTA 1QDSA 1JFXA 2P76A 2PTXA 1OHLA 3I6RA 1FWRA 1SGJA 5DF0A 4FMVA 1PX4A 3WELA 5G4EA 4AZCB 3NDYA 1RBOB 2Z25A 1VIWA 2QZRA 3S5YA 5CAHA 4KEZA 3UQNA 5EMJA 2Z2AA 4MUZA 2RUSA 2Z1KA 1GEQA 2V30A 4GQGA 1AK5A 2A3LA 3FN9A 5GNZA 4UOJA 4AY8A 2J27A 2YDRA 2G3MA 3VFCA 1LDCA 2E3ZA 3PUOA 1MXGA 2FJUB 1W8GA 2GJXB 4UMAA 2V5JA 4KWOA 4KBXA 2E28A 3SCWA 2VFFA 4S3JA 1ITXA 3S5SA 4PMOA 1G4EA 5GJNA 4LFYA 4FIRA 4WRHA 3H53A 2QGYA 1E0TA 4GJIA 4N2YA 2CLFA 4HTYA 4ZSUA 3WQCA 4IQLA 4Q8VA 4S23A 3N9SA 3TYBA 3KL5A 3HPZA 3TN4A 3QOKA 4WJXA 4M6QA 1T7LA 3CZGA 4C6JA 4ZQNA 1TWIA 4XVDA 2X7VA 1R30A 1WUFA 4IJCA 1PIGA 3L23A 3E96A 4C6KA 1OX5A 1H61A 2C13A 3NQAA 2UZ9A 2XYLA 4S2BA 3VDBA 3PB2A 3ITGA 3W1UA 3DG6A 3GNOA 3N3TA 3UCQA 3HPSA 4J7RA 3GNPA 2QULA 5DT5A 1AJ2A 2XIIA 3FNDA 3UR8A 4JS3A 4PBEA 1DP0A 1LWJA 2G3IA 3SCQA 4EANA 2ZTJA 2OZTA 5DN1A 3AROA 4S3DA 3LBMA 1KQZA 3RM8A 1BYDA 4FK9A 2HJPA 4RW3A 3S2CA 3B0UX 3WLIA 1VBRA 3CMJA 5PTDA 3PULA 1T8XA 1R0MA 4OE7A 3TW9A 1QRQA 1PAMA 2XIMA 2YXXA 1IWBA 3INPA 3GM8A 3TNBA 1FKWA 2J7DA 2H8XA 3NUKA 2BY2A 4IQJA 2ZUSA 2ATSA 1HJSA 1W5OA 1RJRA 5J5RA 2D0HA 1GJPA 1AW1A 2A3AA 1KKOA 1LYXA 2IPFA 3WQFA 4B5VA 2V2HA 3CHEA 4DM2A 4X0VA 3MI6A 5ABFB 1MEHA 1RA5A 1NEYA 4GQQA 4MWAE 2V69A 2DQWA 3B9DA 5A6BA 3RF9A 5A94A 3ZVHB 1WXJA 1NELA 2Z27A 4MSSA 5JMUA 3PPCA 1OT1A 1Q6CA 2E9BA 1C8QA 1PIFA 3P82A 3TYAA 3P67A 1SW3A 3ARYA 3OEXA 1YTEA 1V7AA 3BLLA 1TV7A 3KDNA 3N3MA 2YA0A 3TP4A 2PDYA 2ZRZA 2EG8A 4K3ZA 3DGBA 3P74A 3UY7A 2POZA 4W7VA 3KTXA 3KDOA 2EPOA 1VKFA 4NAFA 3CASA 1B4EA 5T9CE 1K9TA 3T55A 1B57A 4D9PA 3UP8A 1SZNA 4M7SA 1LOQA 3WDJA 4ZOBA 2YL9A 2X0SA 2YCKX 5KZDA 3WLTA 5EMKA 2BV9A 3FJ6A 2W6RA 4ENLA 4RCXA 1OG0A 3SCSA 2Z1VA 3NZQA 3TOYA 1KWKA 3GVGA 2WMHA 3GX9A 3NOEA 2E68A 4HZ6A 2VFDA 2BG5A 1R2TA 4LUTB 3DFSA 1P4CA 2QJMA 4ATLA 2W9MA 3EDJA 4B92A 2YXGA 3W7MA 3V35A 3WL0A 2EG7A 4DUOA 4E4UA 3RPMA 3B8VA 2ZUTA 1F74A 3H24A 1VC4A 4W8BA 4WDTA 1MUMA 2NV9A 4Z0SA 2HE5A 5LHEA 2F7FA 2UY4A 4Y9OA 3W7LA 3U2EA 1B31A 2PDUA 4GCXA 2NUYA 4KFNA 3FSUA 1Z44A 4D6FA 3BW4A 4F3HA 4FLQA 5AYBA 4YCOA 3DDMA 1EP3A 4JTEA 3M5VA 4AD2A 1F3EA 5IRPA 2ZZ1A 3GNDA 4ZE4A 1P6BA 4PMJA 3THUA 5A6KA 4O15A 3ATZA 3F7JA 1GOOA 2DU2A 2P8CA 3B9NA 3F2BA 2Z7KA 1ISYA 4TX8A 3CB8A 4QAWA 4W86A 3B9EA 1XUUA 3TQKA 2VC7A 2R91A 4GZ7A 2DSUA 3UZZA 5GNXA 3RM9A 3GTFA 2Y61A 4MWAA 4KCTA 3NEVA 2NQLA 3N4FA 1IT7A 3A4XA 2D0FA 1W32A 1VP5A 1ISWA 2H6RA 2W92A 3UWWA 1EFZA 1KLZA 1W1ZA 1CPUA 2ONEA 2IMRA 2CW6A 3MS8A 2H8ZA 4R33A 4GIEA 1ZUAX 3R94A 3E1F1 4QXIA 3N2MA 3WDQA 2DVUA 3R4IA 2NV2A 1D8WA 3I68A 4A6GA 4DI9A 3NM3A 1OFQA 3WF0A 3CUFA 3DC0A 1ME8A 4EWND 1IXOA 3CMFA 4JTGA 4EPKA 4WSKA 4IPNB 3NGFA 5HMDA 1JCJA 3UZXA 2G3JA 2YB4A 3DGRA 3PJWA 1KA9F 4IISA 2J8GA 3M0KA 1MFVA 3S5OA 2DZBA 5D2XA 3N2XA 4RLIA 1V0KA 1OABA 2YBVA 4UTIA 1M7XA 4O52A 1EF3A 5CBBA 2ZFAA 5KZ6A 3KOWA 2R1KA 5C9RA 4QE1A 4KRZA 1JAKA 1MSSA 2E6AA 1PL9A 1VF8A 1U22A 2NWSA 4EF9A 4NP7A 2PZ0A 1EJRC 1VJSA 4US5A 1TPEA 3KS5A 1YPXA 3UYCA 2DT1A 2PAJA 2YW3A 3QV6A 5AC8A 3GC2A 3A4AA 2FVLA 2HCVA 4I8YA 3GBEA 3LXBA 4O11A 2ISDA 4LCSA 3BUVA 5G2HA 4GQBA 1F9CA 3ARQA 3TSBA 1A5BA 3GXTA 4C1NB 3QLDA 4FNUA 4MWAD 3VIKA 4TX6A 1NH6A 3SCPA 1KM5A 5A8QA 3CHFA 4Q7BA 1MQQA 4DF0A 2C79A 5AZ0A 2NVDA 3G1RA 1JZ5A 1R5YA 1W3KA 2DPEA 1JXKA 3LCLA 1GVFA 1WUEA 5EL1A 4ZA0A 4MNMA 3TKFA 1IWAA 3TE9A 1UD3A 3ZMRA 3HBLA 2PEVA 2EPHA 4H01A 4NUWA 4GUFA 2QUUA 4N9DA 4K36A 3PHAA 3C2YA 1OM0A 1EBHA 1HKWA 3PTDA 1X8CA 2BXVA 3QM3A 3VGDA 3WLHA 6REQB 3AU6A 1XLEA 3ZVHA 2O9PA 4AD1A 3DFQA 1EGMA 1Q6FA 4CGTA 1DJZA 2AMGA 5FJUA 3AHZA 5FKYA 4GFSA 4F79A 2A0NA 4BI5A 2PTWA 2XH7A 3DI1A 3HPFA 5ECUA 2E8ZA 3QMRA 2EEXA 4PL2A 3IAQA 4TOQA 2WVSA 1JYWA 1A5KC 4GISA 4GI4A 1TCMA 4HHPA 5M2FX 2J7HA 5I79A 4ATDA 1FWTA 4JEJA 3LNMA 2UV8G 2OSYA 2Z1SA 4O1CA 2YCLA 3DU0A 2NT1A 1Z8AA 2D2JA 3S8HA 1Q6OA 1FHUA 2A6NA 3GUGA 2EPMX 2IPJA 4IIHA 4ZQRA 4GVFA 3W7JA 1XH1A 1GW1A 4U2YA 1W0MA 3EYPA 3P84A 1D8CA 1OC6A 4Y7EA 3AIWA 4KWWA 1X1OA 1FY6A 2F38A 1X8FA 2FVMA 1RQEA 4UQBA 1JPMA 3LDVA 4UTKA 4AD0A 4AEFA 1J12A 4IUGA 3ANYA 1CWYA 1GJUA 4FHAA 1B3WA 2W91A 2YLAA 2D1ZA 3ITOA 2ZKMX 5I02A 2FB2A 3CHVA 1V6YA 3MHFA 1SFJA 4C90A 4JY9A 2FFCA 1H11A 1VD6A 4S3AA 1TFVA 2MANA 1XIEA 3ZR4A 1F4AA 4UFKA 4O8AA 3I3BA 5AZ1A 1UH3A 7CGTA 3H54A 4KMQA 4XV0A 4E3VA 5CKSA 2Y8UA 2J9XA 3BO9A 1CGYA 3F4VA 2Z2BA 3NVTA 1NVMA 4W5ZA 1EJSC 1XKYA 1OFAA 3REQA 1SFSA 2YZ5A 5C55A 5CPOA 1BVWA 4OTKA 1Z9AA 5CSYA 4H1ZA 1XIJA 1OT2A 2CKSA 1F8IA 2MNRA 2ZYFA 3MKVA 4PRTA 3VZYA 2JKPA 4Y9AA 3B3DA 3EZ4A 3GDTA 4X3ZA 3CZEA 1TYGA 4NZ4A 3VGEA 3S4TA 4CEUC 1FDZA 2NWRA 1XUZA 3TJ4A 1V08A 3GHTA 3R2GA 2FLIA 1XX1A 1X6NA 2HVOA 4GQRA 1X7IA 1XLLA 3CH9A 1NY1A 4DBDA 4FSAA 2E5DA 3V5OA 3TROA 3RMEA 2WM0A 3QJAA 2VL4A 3E2SA 2XZ9A 4Z2GA 3U57A 1PZ1A 2PTZA 5JVLA 4H3DA 2HPIA 1V03A 2VZVA 3UU0A 5CBJA 4PTXA 3G1YA 2DJXA 2OWXA 3CPGA 2CERA 1W5PA 2IKGA 1DTNA 1PKNA 1JRBA 1ZALA 3E0FA 2Z1XA 3QN3A 3TSDA 3TXVA 4O0KA 4GYJA 3OW1A 1XPYA 3WLKX 1VCVA 3C2OA 4UFMA 3NSNA 4B2DA 4K68A 1W9PA 4P7OA 5AC5A 1KM6A 3S0CA 3M0MA 3KOYA 2X1IA 4S39A 2JKAA 5EMLA 2ODOA 4LCRA 4NVTA 2PDQA 2I14A 4OIFA 1K8ZA 1RK6A 1HNYA 4ASTA 1RAKA 1H51A 1ONXA 2VC6A 3A13A 1JF6A 3WF3A 1EJXC 1TZZA 1VS1A 2NXGA 1GKQA 3N29A 1CIUA 4EXAA 3JRKA 2DH3A 5BROA 4XO6A 5IXEA 3OGVA 4JBRA 4B4HA 2WBKA 1EGZA 3QV7A 1Q7ZA 2OEJA 1S46A 3A9IA 1AZ1A 1EZWA 1ZHAA 1KRBC 1MDLA 3WL1A 2B4GA 5KZMA 1DQXA 3ARWA 5AHMA 2OTDA 3A12A 3ZT5A 4O50A 3G1AA 4HNLA 3LENA 3DHPA 3IGUA 3Q37A 1W9XA 4HMEA 3GH7A 4YTQA 3DFPA 3PZ9A 4ECLA 1ISZA 5EU9A 1ZB5A 4O1EA 2ISVA 2DT3A 3B4YA 4D8AA 2XH2A 1AJZA 3GXPA 2V5DA 5KTLA 3CQJA 4QROA 5HA7A 1GW9A 4GKTA 3QFWA 9CGTA 3H2EA 3FA3A 2VRQA 4LBUA 2ON3A 2J77A 4RV3A 1RXOB 1DYSA 4NJHA 1H4PA 1OG6A 1TZ9A 3C0QA 3IUIA 4AMAA 3E12A 2TMDA 4W9TA 2YL5A 3CJPA 6TAAA 4C91A 1MRAA 3LTPA 4EAYA 3G1DA 1W2VA 2QR6A 3KS6A 4MYXA 3WLOA 2DSZA 4IG2A 2P8BA 5CZJA 2E6YA 2L5HA 4L6OA 1CZ1A 3N25A 5DXYA 3A47A 3P81A 4CD4A 2ZOXA 1V3JA 3WFZA 4IIGA 3V75A 3LCFA 4DO4A 2OYKA 4FR6A 3ONCA 1KTNA 7A3HA 1V3HA 4TVCA 3OHMB 1E73M 1MXSA 5D9OA 1NDVA 3LZ3A 1HIZA 1VPYA 3LPPA 2QVHA 1AA1B 3UR5A 4H9UA 5ABEA 3EPOA 1KRCC 5HMFA 2CZVA 1KV5A 3QF0A 3M0YA 2X8RA 3OB8A 4DYKA 1L6WA 2CLLA 4IGNA 3UG4A 2GFTA 1I2RA 1W3LA 4DJDA 3GUWA 5CXPA 4HU8A 3H7VA 1XIFA 1JZ8A 1C3FA 3N34A 3QH2A 1A0EA 5ENLA 5CLWA 2NUWA 2OMAA 1QHPA 1KTBA 4JTTA 1TPC1 1LBLA 3AIQA 3UPMA 3OA3A 3C8NA 3W29A 4AQLA 2V3EA 3VDCA 1OINA 3EA3A 4GIAA 3S46A 1DJHA 4U2ZA 2VGGA 4FALA 1GQIA 1V77A 3MPGA 1HF6A 2OLHA 4PB3A 1F7BA 2GVJA 4YYFA 2QCLA 2Y2WA 4BEQA 2BGNE 4PE8A 5JH2A 3CO4A 4C6CA 2WLZA 1UH4A 1G67A 1TSIA 1TKKA 4CCCA 5HOSA 5I2UA 1E6NA 1XICA 1UP2A 4FP1A 4HQVA 5D4YA 3I7SA 5GQBA 3TYCA 3DFNA 2PWVA 4M1BA 4C6QA 2JK2A 2ACQA 4JNMA 4PUDA 4UQAA 3RXZA 4PUJA 3PVFA 2GJLA 3L7RA 3PN8A 1HGYA 3QMTA 2E67A 4MNJA 3GHUA 4REQA 4C6MA 3IJ7A 1DTUA 3BAWA 2BMBA 1WKYA 3GDMA 1IR1A 1ZPTA 3DG3A 4FXSA 3FOKA 3ARSA 4MFDA 4AC7C 2JGQA 3WDRA 3K8MA 4YWIA 1V0MA 2I9UA 2G8ZA 4WVXA 3ES8A 4JFTA 1YPIA 2C14A 4O12A 5ABFA 3MO7A 1TIWA 1AMKA 3DYPA 3R11A 2OELA 3DX5A 4UTFA 3E2RA 1MI3A 4WDWA 4AWEA 4Q22A 4PZVA 2J88A 4JICA 1T99A 1B3OA 3ZJKA 1UC4A 2POTA 2DP3A 5CAKA 2GYIA 4QLKA 5AKQA 3K2GA 1WOAA 4FNRA 1V6TA 2WC7A 2DUAA 1CXIA 4GVGA 3BAJA 4FNQA 7TAAA 1UOKA 1C9WA 3WZ0E 2ZUNA 3MCNA 5C54A 3WQ6A 4CNPA 3B04A 3H12A 5F2LA 3W76A 3OHIA 5FEZA 3KVMA 1UIPA 2JE8A 5B80A 1GVYA 1PYMA 1QHOA 1CLKA 3VPLA 5CC5A 3VU2A 3PBVA 1XG3A 2ZZ7A 1LJYA 1UWAA 1E9ZB 3CK5A 3JUGA 1TPWA 1T41A 2OX4A 4GFIA 3VAVA 2ZUUA 4HPXA 1W6TA 2PF8A 4D6DA 1KBIA 2EKGA 3P2VA 2Z7GA 2VJXA 2RFGA 3QY8A 1CLXA 3MCMA 3UG8A 4U28A 4BA0A 2OWCA 2I1OA 4DWSB 1IEIA 3S6TA 3WEZA 3TWAA 7REQA 3BAYA 3OZOA 2IQDA 1H0GA 1MZHA 1KR1A 1K77A 1V3MA 3TV8A 5CPQA 3AHYA 1E1CA 2HROA 5LIYX 3W72A 5I03A 3KZPA 5D33A 4N0RA 3VGHA 4MJMA 5BZAA 3LGEA 4ZGYA 4DF2A 2YSWA 3ZT7A 4UR9A 1EOMA 1PIIA 5D09A 3T2PA 3DZ1A 1XI3A 1YQ2A 3PUGA 4LQ1A 1B30A 3VE7A 3SUVA 3HQ1A 3VZZA 2GDQA 1L6YA 1W5QA 1TVLA 2Y5SA 1J2WA 4CCEA 4NL1A 3A22A 4B3KA 2BDQA 3EWDA 5A6TC 4KH2A 2YYUA 5GJPA 1NTHA 4PMDA 5LIXX 4X9SA 1C7TA 1OEPA 5H1WA 1DWFM 4RNFA 4XAYA 1SZEA 4BF5A 3CEUA 1G9HA 2E40A 1R3QA 3GC4A 2PDKA 4Z1BA 1OX6A 3V1PA 4D1IA 1AQMA 3LCHA 1O5KA 3S1GA 1A5CA 7ENLA 1HO4A 2XINA 4JHMA 3N9KA 4JOMA 1E9YB 2G50A 1AD4A 1HVQA 1XRFA 1DPMA 3AWNA 5KZEA 2PDFA 2VQUA 1AFSA 2J7EA 4QS5A 2MUCA 4XD3A 2FZNA 1KFJA 1I2NA 1NWRA 4W87A 4QJ3B 2JF6A 3KHDA 4AWUA 4DJFC 1E1EA 3WLMA 1VJIA 2RAGA 4L9YA 7PTDA 1XIHA 4XIAA 4CD5A 3W7NA 3FY1A 4N02A 1O6IA 1PDYA 3OOQA 1R47A 1QW8A 2Y63A 2A3BA 1E6QM 3GBDA 1PX8A 4IF2A 4J2PA 4BI6A 1E5NA 5CZSA 5A6MA 3AZRA 4ZXLA 2I9EA 1IZCA 1OCNA 1QU4A 3HPAA 4CNOA 4UFLA 2DIKA 3WQVA 3I6EA 2FHCA 3NQMA 2Z29A 1DE5A 3TTQA 3HZ3A 3GXMA 5F1VA 1THFD 4F0HA 4MIMA 4FO4A 3PB0A 1HZYA 1PHWA 4MYAA 4TMCA 2PU0A 1JZ6A 3GVWA 3QZ6A 4XG1A 4BKNA 2O0TA 3A21A 3IUHA 4YLWA 5FF4A 1QNSA 4XZWA 4W8AA 3WLLA 4W84A 1C8YA 4W4QA 3GIPA 4LGXA 5B7ZA 1OZQA 4KEUA 1A80A 4XK2A 2R1MA 3VINA 3W1PA 1SJBA 5FEWA 1UBPC 3T1GA 2AQVA 3DH7A 1U5JA 3PJTA 3IVUA 4JL1A 2D69A 1FWSA 3BDKA 3HTWA 3V0SA 3CHDA 4UIOA 1JCYA 3K4AA 3RYSA 3GDLA 1ZCOA 1XW8A 3W2KA 3GTXA 3EA2A 2E9MA 2PDNA 1PCWA 3FYPA 3OU8A 4ADUA 3EXSA 5KITA 2ZX7A 4W7WA 1IIGA 1TRDA 2XIJA 4DJED 4E38A 4FX6M 4UZSA 3S42A 4UCGA 2XWDA 2GQ3A 2DSVA 3IWPA 1DOSA 3MI2A 2VFGA 2D2GA 1W5NA 3W01A 2VP8A 1UKOA 4DLMA 4RE3A 3TK7A 4MKVA 1GKPA 4F0KA 3H7UA 3OQEA 1OB0A 4RZBA 4PCNA 2VXNA 4O0ZA 3CAWA 3GXDA 2ZQ0A 1DQUA 3LA4A 3PBUA 3U2OA 2C19A 3BTNA 5D2YA 3VIIA 1Q3NA 2NLIA 2J47A 3A3HA 3KBMA 1L2QA 4LBRA 3F2DA 2WK2A 1XH2A 3QVQA 1LUCB 4HNTA 3BSHA 3M47A 1BEUA 2Y8VA 4ZFCA 3M6DA 1W3TA 3RM4A 1V51A 1O60A 1RLDA 4I9JA 5HBFA 4GVIA 3E0WA 3FA5A 1CEOA 4TMBA 4XBJA 4PTMA 4GUGA 2VGFA 1UB3A 2XSXA 4LEFA 3R43A 2FZDA 4C60A 3FVDA 1PSCA 3F5JA 4IPIA 3RCNA 3VMOA 2CBVA 4JTFA 3DI0A 2REQB 3NIYA 4DBUA 4QJ4B 1XLMA 2YCJA 2BHZA 5D8ZA 2ZBTA 4V2XA 4CEXC 5EA9A 3VKBA 2VFIA 1JDFA 1EJWC 2DT0A 5G4WA 2ACSA 1HKJA 1ME9A 3ITVA 5TQLA 2HEJA 4B5SA 4KKXA 1VZWA 3RR1A 4KQNA 4TUFA 1U83A 4PL1A 2GWGA 3UA3A 4R53A 3PSWA 1QPRA 2BSLA 1JR1A 2D0GA 2GK1A 3TC7A 3C61A 4FNPA 2ZWYA 3ZWTA 3DECA 5E6YA 3VKCA 1H2JA 4ILSA 5JH1A 1XXXA 1B1YA 1X1ZA 1QR7A 1I8JA 1OC5A 4IMFA 4MKNA 1D3GA 3GRIA 1OVDA 4M6PA 1TWWA 5AHIA 2Q8XA 5C71A 3G1VA 3U8GA 4EPEC 3OO2A 1WCGA 5A69A 4NRRA 3TUUA 2VD9A 3LI0A 1R7AA 2DZPA 3SFWA 2AGKA 2WMIA 4ZMGA 1FFRA 1US2A 1TWSA 2XGBA 1VGAA 1D7KA 2UY5A 3SGGA 4DELA 5G2IA 2REQA 2ACUA 1JJKA 4NYUA 4UTHA 2CC0A 1NSJA 3VOCA 4HTBA 1U5HA 3IIXA 2C18A 1WE5A 4QG8A 1MXDA 1KBKA 2PA6A 3MU7A 1EJTC 1UWUA 2QAFA 4C6BA 3ABQA 4G6CA 4QQ3A 3RPTA 2VR2A 4A2RA 4UMCA 4FOUA 3G1XA 1NQ6A 1JPDX 4YCPA 4G56A 1QT1A 3LQGA 1G6CA 2HXTA 3P5YA 1BXBA 4GHRA 3UGRA 3W83A 4B9ZA 4LS1A 2ZE3A 1EOKA 2WXDM 1E1CB 3A3XA 1GHSA 4JCLA 4WF7A 4HOZA 2PCQA 1S2AA 1CXFA 1C8VA 4U3CA 3GS6A 5I3JA 1SR9A 1YE6A 1A0DA 2V63A 1X7FA 2OODA 4Q7IA 2FB3A 1HGWA 4QCEA 4L1XA 1O66A 4L65A 1C9DA 1EL3A 3EDDA 1HQTA 1I6NA 2BZNA 4LTSA 4ML9A 4MJ2A 4B5WA 4PH6A 4H41A 1R38A 1BYCA 2HV5A 3LGGA 5F1UA 4KERA 2CIPA 4UFHA 1HW6A 3R1ZA 4PTDA 3W3OA 4C6DA 3PBYA 2VZSA 2VM8A 3ECQA 1LF1A 2YDSA 2TRSA 1FVPA 3GG8A 3BCDA 1UW9A 1JPIA 1IT8A 4V27A 3NDZA 3QPYA 2X09A 1UQZA 2O4QA 2UY2A 2HDJA 3G1HA 3CO8A 1K9FA 3UJRA 3P14A 3FXYA 3MKCA 3BK0A 2WVVB 4ZFMA 2GJXA 3N04A 4IOTA 4KFPA 1GOQA 3DEQA 3MSYA 3EMZA 3G18A 1W31A 4B5TA 4AHQA 2VZUA 1ESWA 3W27A 4P8VA 3SQMA 1ENUA 1YNPA 2VKZG 1P48A 3WX7A 3H4XA 1SM9A 2DZUA 3A9BA 3VIFA 3QR1A 1X38A 1NM9A 3RU8X 1AUSL 1OSEA 1P0KA 5D2VA 2WCSA 4NILA 3KXQA 1UCWA 3BMVA 2YFNA 1EHAA 1YBQA 2VCBA 3K13A 1VQTA 1MNSA 1M65A 2P0IA 3PR2A 4U3AA 3GFZA 2QW5A 3ZQ9A 3HJZA 2VENA 2PDXA 1CDGA 2XM1A 2NQ9A 4JFSA 1TJ1A 2O55A 1E40A 4A3YA 1GOIA 4EWJA 1AW2A 4JPGA 4LALA 1TV4A 4V28A 1XYFA 1XLBA 1KFEA 2Y4SA 4YVVA 2J62A 4HK6A 1J5TA 1Y0EA 1RQBA 4JTCA 3N2TA 1XD0A 3N19B 4ICNA 4AZGA 3KL0A 2PD5A 3IV8A 5FJJA 2FQIA 1QBBA 1XSIA 1FH9A 2WMFA 3VDHA 3WEOA 1KM3A 2PWGA 2PB1A 5HMEA 1GVRA 3B0VC 1LLZA 2E1WA 2EGZA 4DEFA 4D2JA 1AL8A 1IV8A 4DZIA 4AZIA 2C1HA 3O6CA 4M82A 4MGGA 1U1JA 2D73A 4ERIA 1QI3A 5FF3A 1OD0A 3V7PA 2PU1A 3NZ1A 5CC6A 2WVVA 2QPSA 1LT7A 1S3TC 3IJQA 1W8SA 1S2CA 1ZGDA 1YLVA 4Z0JA 3VK5A 4RDWA 3FJNA 5M3WA 4X60A 4AHOA 1Y65A