1UB3A

Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
211
structure length
211
Chain Sequence
DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aldolase protein
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 85
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ub3A00
3OIXA 3W1UA 3W1MA 4PODA 3WK3A 2JKPA 1KTNA 2VEPA 4MIMA 4OV4A 5D2XA 1KLYA 1OX4B 1DVJA 3PSWA 2V5LA 3A22A 2BXVA 1T0OA 3W2UA 1G4EA 1L9WA 1FDYA 5AOUA 3P8JA 4MYAA 4WUIA 3KHJA 4AXKA 5TQLA 4MJZA 1JCLA 4JNMA 3T40A 1PHQA 3LCHA 2A7NA 5FEWA 2GQAA 2ATMA 1JRBA 2ZDRA 4FIQA 3IRDA 4PFMA 5CZ0A 3W1AA 5D02A 5HUOA 4CCEA 3QMTA 2VENA 1GQNA 1M5WA 2YFOA 2ATSA 2EHHA 5HNRA 3O6YX 4R34A 3L5MA 3G1SA 3M5XA 4MY8A 1KV8A 3LRKA 2Y7EA 3UZ5A 1KM4A 3B0VC 1WAUA 3MI2A 3DAQA 3KRSA 4IPIA 5G2WA 3M47A 3USBA 2Q8ZA 4O10A 3MBDA 4GC4A 4ZQPA 1F6KA 5HWJA 4NZFA 3T44A 1ICPA 1AL8A 1FXPA 1P4CA 3DI1A 4OQVA 5ABTA 1QO5A 5D2YA 3DHDA 3STEA 4JTLA 1EPXA 1CW2A 2QCMA 3BW2A 3WK2A 3O6DA 2B7NA 2NUXA 3F03K 1W3TA 1UB3A 3S1VA 3DFPA 1R2TA 3L67A 3QYQA 3WFAA 1X1OA 1Q6LA 3NAVA 2E5DA 4PL2A 3B04A 1WV2A 4LUIA 1FWWA 1RPXA 3QFEA 3SI9A 5E0KA 5DY2A 2ZZ5A 1VRDA 1RQBA 4R7JA 3HF3A 1VJIA 3PBUA 4NQ1A 3NQGA 3W87A 1TV5A 1QPQA 2V5BA 1SW0A 5TBOA 1TREA 4IMCA 3L0GA 3SSJA 3NL5A 1QFEA 3LTSA 2GVGA 1AK5A 2W79A 2Z2UA 1LCOA 1I8JA 4W9TA 1WOBA 4ADTA 4ORIA 2WKJA 4DXVA 2YW4A 2NUYA 2BSLA 1WX0A 3HOJA 4A2SA 3NQAA 4NJIA 1IIHA 4EVZA 4KKXA 3TE9A 5A8GA 5H2ZA 5LSMA 2CZEA 2VELA 1EUAA 4PH6A 3LTYA 4N9EA 2VXNA 1TV7A 1RQHA 1WOAA 1K7EA 2X1RA 3HGRA 2WO5A 5LHFA 4NZJA 3N9RA 4S1FA 4GRSA 3W7GA 3RMJA 2V2CA 1XCFA 1ML1A 1PHWA 2X30A 3IIOA 2WNNA 1F6PA 1OABA 1O5XA 1TMHA 4M6VA 4ZL1A 3BLEA 3GAYA 2W6RA 5AHFA 2G5WA 2Y85A 4RZ4A 3W85A 4OWGA 1SO4A 1KLZA 1MEIA 2FIQA 2QR6A 3CT7A 4MZYA 3BGGA 3LHTA 3C2EA 1XBZA 1SFLA 3W7RA 3C56A 3PBVA 3A9IA 3L65A 3NM1A 5AYZA 4MY1A 4JY9A 4DQWA 4ZQNA 5D09A 4NNCA 4A2RA 3W23A 3N73A 3O63A 1WA3A 4MY9A 1EB3A 1X6UA 3GK0A 3W84A 1HTIA 4ZQCA 3W2JA 3I65A 3C8FA 5TIMA 3UWQA 2FTPA 3CHVA 3UPBA 2A7RA 3PSVA 5C6MA 3ZWSA 3HGOA 1ME8A 3STGA 1X1ZA 2QCHA 5K2ZA 3SY5A 3W2LA 1NFBA 3VKJA 1N55A 4Z0JA 3TNOA 1TRDA 2P0OA 3IGUA 1AG1O 2ZBTA 3PY2A 4FO4A 3MWAA 4UXDA 8TIMA 2Y88A 2J6XA 3VE7A 1H1ZA 4JIQA 3QMSA 1A5AA 3THAA 3QW4B 2CLMA 1FUYA 3HQ1A 1C8VA 3ABOA 4GUGA 4P2VA 3NZRA 1MXSA 5BNKA 3CWOX 3PWAA 3FKRA 2VFDA 1A5CA 2ZZ6A 4O1AA 1QR7A 3G1AA 3ZWTA 4GUFA 5DN1A 4D2JA 2V2HA 2CLHA 3OBKA 3CQ0A 3FIGA 1QMLA 4FXSA 3ZS4A 3W7DA 1UASA 1ZNNA 5AHLA 4O28A 1TIMA 3TW6A 3BV4A 1JUBA 3HBLA 3TMLA 4WD0A 3TCEA 1EP3A 2PRLA 2ALDA 4FNSA 4GUHA 3Q37A 1JJKA 5IBXA 1KFJA 1VS1A 1YTDA 3ZFHA 1JCNA 1JQVA 4DF2A 3T4CA 3LXAA 5DXXA 1VH7A 1GWJA 4DPQA 3GXPA 4JYFA 5DY3A 5HINA 1QPRA 2Y89A 4UTWC 4ONVA 1OF8A 3EWYA 3WJZA 3QRHA 4KFOA 4LVAA 4BR1A 3BW3A 1FWTA 5I3IA 1H7RA 4LVBA 5AFDA 4K38A 3OA3A 2FB2A 3P80A 1H50A 1FCQA 4NJJA 1ONRA 2JGYA 4DO4A 3PC0A 4JS3A 4JTEA 1LOLA 4FEZA 4UNLA 3DBPA 3K30A 2QUUA 3N3MA 3KOFA 4AWTA 1LZOA 1H5YA 4MOZA 2QAFA 5C2XA 2DJLA 1QO2A 3MP3A 3P61A 3GNNA 4I7WA 1EEPA 3AJXA 4IX2A 4DEFA 1QWGA 3MYPA 3HGJA 4FNTA 5EBUA 1YXCA 3N2MA 4MVAA 1H60A 2ZTJA 3G18A 1EP2A 3DFSA 2DJXA 5DCEA 3C61A 1IGSA 3HMJG 3NQFA 4RXFA 2ZA1A 4KWVA 4CLMA 3PR2A 4XUGA 1R30A 2C6QA 3IIPA 2ZCGA 3NPVA 1JR1A 3IIVA 1PS9A 1FY6A 2ZZ4A 2BZNA 4CNOA 1R2RA 4HNTA 1DJQA 5AC8A 3QF0A 1GEQA 1PCWA 4NX0A 2VC6A 3H53A 5F4WA 4MJMA 2XN2A 2DZXA 1W5PA 3ATZA 5EMUA 3IGSA 3KVLA 2RDTA 2QCNA 1NVMA 3RLVA 3W74A 1KV5A 1OG0A 4E2BA 5FESA 4NUWA 1ME7A 1TSIA 2TSYA 2QCDA 4S2BA 1OFEA 3QPZA 1OFAA 1VCVA 1VYRA 3C3NA 5K4ZA 3HPZA 4O15A 1GT8A 3GLCA 3F4WA 3PAJA 5I3GA 3QW3A 1YXYA 3SIZA 1CX9A 1EIXA 3OEXA 2E5CA 2PRMA 3UXAA 3VI2A 3W75A 5KZEA 3C2RA 2H3BA 3QSTA 3LHYA 2QCDB 1I4NA 5D03A 1GTEA 4DO6A 3G3DA 2R94A 1HFBA 3DGRA 3DFOA 4HIBA 1MSSA 2CW6A 5FF3A 1BTMA 4AEOA 3G0SA 3TC7A 4K37A 3TH6A 3W7CA 2P1FA 4J9JA 4K39A 4JYEA 1X8FA 1QOQA 5K4XA 1OYBA 3LCWA 1PV8A 1JCJA 2FQIA 1SUXA 2KZHA 4FNPA 2YCEA 3P8IA 2EAWA 2ZZ1A 3W7IA 4JTUA 1LYXA 3NYZA 4K36A 4UTMA 5J5RA 2WSYA 4EF9A 1SZGA 3W9ZA 3HG4A 5L9FA 4XTIA 4AH7A 4M7SA 3FA5A 3ABRA 3LX9A 4IQLA 5K9CA 3R12A 3HPSA 5D37A 2G96A 2Z0IA 4OHQA 1V5XA 1VZWA 2V8ZA 1GZGA 2C16A 4K8HA 3BK0A 3A24A 1TPUA 5I3KA 1DBTA 3QEZA 3NL3A 2X1TA 4GE8A 2FPVA 3LXBA 3NG3A 3W7KA 1IF2A 2XFWA 3HJZA 4XQ6A 3W83A 4RV8A 4X9SA 1BKSA 1Q6RA 1XFBA 3W1PA 4LT9A 4JGDA 3GVGA 2FFCA 4GWEA 5D2TA 3LLFA 2H6RA 5D38A 2HS8A 3PG9A 4LVFA 3TDFA 1MZHA 1OFPA 4IOTA 2FPTA 4AHQA 4YMZA 5K9XA 4IMFA 3GR8A 2QDGA 5LGZA 1KFKA 1DOSA 4JR5A 3CIXA 2VEKA 4M19A 4Q4KA 3TJXA 1R47A 1TTJA 1GVFA 4RCXA 2Y7FA 2E6DA 5HWNA 4UIOA 3EWBX 3S9YA 4LY8A 4JTTA 1KTCA 4YXGA 5GVJA 1W37A 1YPFA 1TQJA 1VYSX 4X22A 4AMAA 4Z0SA 3C6CA 3C2OA 3EX1A 4HNUA 4U28A 5D30A 2G95A 2GJNA 4OE7A 1VLIA 5J5DA 4C1KA 3BVJA 3P5ZA 3LCGA 1KFBA 3C0JA 3M44A 4MZ1A 1FCBA 3RK8A 2A0NA 1MO0A 5C55A 4NJGA 1J5TA 2X2GA 2VFEA 4UFIA 4O4VA 1XUUA 2E6FA 1RVGA 4Y8FA 5AC6A 4XTDA 1IXOA 1A50A 3L0NA 3W1LA 5G2HA 4ZQRA 1G7VA 4H4IA 3P84A 2A6LA 4R33A 3DHFA 1HO1A 4WXZA 1K7FA 2I14A 4DF0A 3B8DA 4R53A 4Z08A 1YXDA 4GXMA 1TPEA 2TPSA 3U2OA 4DF1A 1TPB1 4DPPA 3YPIA 4PEKA 3A5FA 3M5ZA 3TROA 1FCUA 1FDZA 3C2FA 3EX3A 1H51A 3O8AA 1OFRA 3W7EA 3T7VA 3M1ZA 1EWEA 3G22A 1QOPA 2ABAA 4UMCA 1IXQA 1A5BA 2WOQA 4HKPA 1I2PA 1XBYA 1JULA 4YL2A 1H7OA 4O11A 2YYTA 3U8GA 1LLZA 3G3MA 3KAOA 4MFEA 4FNRA 3B06A 3NPXA 1F76A 2ZQ0A 3F1QA 4M7TA 3UD6A 3MHFA 2ZYFA 1KBJA 4PCFA 5D2WA 1KM0A 1WYIA 2RHGA 4UFLA 2I9EA 3R8RA 1L6SA 2NUWA 3PULA 2WPBA 1HG3A 1AL7A 2GQ9A 1SZNA 4LS1A 4N6EA 1B3OA 5LHEA 3G1FA 1FXQA 2R8WA 1LTDA 1DQXA 2WSRA 4JTSA 1WBHA 2NLIA 1P0NA 3QPYA 4MUZA 1Z44A 5F1VA 3EWXA 5CGQA 5AN7A 1L6WA 4O8RA 2H8XA 1BEUA 4O53A 3INPA 2B4GA 3TQ0A 3G24A 3CEUA 1ZAHA 1VCFA 3LLDA 3LDVA 2VEMA 3BPWA 3S42A 4X2RA 3M5VA 3TR2A 1G4PA 3UWWA 1T96A 3PS7A 2Z6JA 3QJAA 3QQ1A 2V2DA 2RKXA 1M7PA 1QPOA 1K02A 2Q3RA 3MO7A 3MW7A 4QIUA 2J88A 3LB0A 4LV4A 4NNAA 3DKLA 3ATYA 5HMSA 4X3ZA 1SZFA 1W5MA 2JKAA 2AQWA 3TAOA 3GB6A 4CCCA 4JDBA 2C13A 3O06A 5FF7A 3NVTA 4C1LA 4HSNA 1N8FA 4JTJA 4AVFA 3Q58A 5DBTA 1G69A 3LTPA 4RKAA 3NQEA 2H3DA 2PC4A 2J9YA 2ZFAA 4RLIA 1JVNA 3RF9A 3C2VA 3PF3A 4QQ3A 3THQA 1DHPA 5F2GA 4EOUA 4ZVJA 2J9XA 4UTLA 3WK0A 2X1SA 3WJWA 2R14A 4LTSA 5LGXA 4O1CA 3EX6A 1DL3A 1SW3A 1H7WA 1OFOA 2QCEA 1GOXA 2Y6ZA 4A29A 3DENA 3PB2A 2ZRZA 5FEXA 3W7LA 3E96A 2E1DA 1K8ZA 1L2UA 4UTHA 3I7RA 5D05A 5HUPA 1O95A 2RDWA 3W1TA 1LDCA 5F1UA 4O12A 3E12A 1F73A 1RQEA 4FX6M 2AGKA 3C52A 3NEVA 1TRIA 4OT7A 5DLCA 5KITA 1LM1A 5CSSA 3W73A 5DXYA 1GG1A 4Y6GA 5U4NA 1XBVA 3FYPA 3LCIA 3EXSA 1A5SA 4A22A 1KFEA 1AW2A 2BWGA 3MJYA 4HSOA 3EKLA 4WY0A 1KM6A 1W54A 1YDOA 3F4NA 2DZSA 3IIXA 5HULA 3JS3A 1SSGA 3CM4A 1ZHAA 4IMGA 2QCGA 1ME9A 4G1KA 1ICQA 3L5LA 2OCZA 4WY0B 4H6KA 1ZENA 4MFDA 3I7QA 1Y0EA 3QQ0A 4GNJA 3O16A 3G1YA 1S5VA 3O1NA 2NWRA 1I2OA 1XC4A 3KFTA 3P7YA 5LZLA 5CG7A 1SO6A 1TPVA 5LNVA 4GFSA 1ZAJA 2CLEA 1R46A 1WQ5A 2HS6A 1CI1A 1G6CA 1XBXA 3UWZA 3ANYA 5BMXA 1JUKA 1O4UA 5DBUA 2BX7A 1I45A 3CPRA 1EA0A 1AMKA 2NV1A 2E5BA 4ZQOA 4HT3A 5EY5A 1Q6QA 1TQXA 2JKEA 3BG5A 4NVTA 2DZVA 2VFIA 4I7UA 4O18A 3NQDA 4ALDA 1F7BA 3TC6A 1XXXA 3N14A 3HGSA 4UTTA 3NR0A 1K8XA 3KVMA 5IBXC 3UXDA 1PL9A 1ZALA 5CZJA 4CQAA 1EUNA 5G5IA 5D2VA 3CLMA 4IXXA 3LCXA 5D04C 4FB7A 1H61A 1VC4A 1JQXA 3OVRA 1PIIA 3W2KA 1VPXA 4Q33A 3STFA 3TW7A 4RZ5A 3NQCA 1W5OA 5G4EA 3OG3A 4WZHA 3LHZA 1E51A 1OYCA 2CLKA 1LORA 4AAJA 4QNWA 4N9CA 2YX0A 3LM7A 4IPJA 4N02A 3SGUA 5HR7A 3PBYA 5KSWA 3B4UA 4PC8A 3UY7A 4UMAA 2OMAA 1KW1A 1Q45A 4ADUA 5E93A 4NNBA 1I2NA 4UUIA 3TUUA 4LS0A 1Q6OA 2H8ZA 3GZ3A 5DCDA 5KMYA 1XL9A 1H1YA 3FOKA 3FYOA 4AF0B 1YPIA 4LS2A 3MP4A 4YLWA 3EEGA 1TTIA 3CC1A 3DFNA 4DBDA 3NL6A 4UTJA 1LBMA 4POCA 6ALDA 2OZ0A 3EWUA 3KX6A 3WJYA 5MHBA 4O1BA 3ABSA 3TAKA 4Z1CA 4JTGA 3TU9A 1SPQA 1UCWA 3KRUA 2E6YA 4JEQA 1JRCA 1OJXA 3W72A 5LNWA 3W70A 1J4EA 1KA9F 2EF9A 3TXVA 3HIJA 3LERA 5EA9A 1I2RA 1YLVA 3MUXA 1EP1A 4LU0A 1NEYA 3TMQA 3MP5A 3O15A 3SR7A 3HG2A 5F2IA 1Z48A 1GG0A 2A2IA 5BOOA 3B05A 3NPWA 5F2MA 1TPFA 1XM3A 5AHEA 3P5YA 1GVSA 1NF0A 4ZMGA 1VYPX 5KZDA 4AB4A 4YWIA 1TPC1 3H54A 2WNQA 1SQ7A 3M0ZA 4N4PA 1OK4A 2NX9A 3I68A 1T99A 4O14A 2ISVA 3LHVA 4XBSA 2QKFA 3SZ8A 2ZRWA 1TPWA 3W7OA 1GJPA 1K3UA 1W56A 4KFPA 3M6YA 3W7MA 3S0CA 3LHWA 1GTHA 3E0IA 3EX4A 5G1TA 1F74A 2LLEA 3GIYA 3ZR4A 3LI1A 2C1HA 3U6WA 4B5NA 1TO3A 2V82A 3QM3A 2B7QA 3E9AA 3FS2A 3SFKA 2I1OA 2YSWA 5LNUA 3LRMA 4WQ6A 4E38A 4CNPA 3Q2DA 4JN6A 4OGZA 3KVKA 3NZ1A 3W22A 4QAIA 4E2DA 3LBMA 3S5ZA 3UY8A 4UC5A 3JR2A 4OU1A 3DI0A 4WY0F 4BI7A 1GVRA 2FDSA 5KINA 1THFD 4QISA 1G7UA 1H7PA 4TX9A 2TRSA 2GPTA 1G4TA 2QCCA 5F2LA 1XI3A 5BRBA 3CEPA 4WJEA 1LOSA 5FEZA 2OT0A 4UNKA 4WOQA 2DZPA 1XDLA 2AAMA 1W3IA 3BLIA 2O7QA 3FJLA 2F84A 2NX1A 3M9YA 4P61A 5C5YA 4FHAA 5C54A 1SO5A 4Y90A 3BO9A 3VCRA 1TTPA 4DELA 3GKFA 3IV3A 4N4QA 4BF9A 3GXNA 3WK1A 1L6YA 3GKAA 4IMEA 2ZRXA 1DKWA 1G67A 3NL2A 4JDYA 2VFFA 2WNZA 2NXGA 5EYWA 3GNDA 4BWLA 3TJLA 3JRKA 2WSQA 1QNVA 3HO8A 4FX8A 5BMWA 3RFAA 3FFSA 5HWMA 4DO5A 1Z42A 3NQ8A 2C0AA 3PB0A 4O17A 3NA8A 3M7WA 1N7KA 4AHPA 4A3UA 2TMDA 4KFNA 2ZRVA 2BTMA 4HNNA 1H7NA 5D32A 3NOEA 1LP6A 2WQPA 1P5BA 1F5ZA 2FLIA 4TIMA 4UFHA 2D73A 1TV8A 3W7JA 4LC6A 3BG3A 2V9DA 4BFAA 1KM1A 2OT1A 3W1QA 2E09A 4JY8A 4K8EA 2QCFA 2ISSA 4RZ6A 4RX0A 3DU0A 2ZRUA 3I7SA 3QSRA 4O0KA 3LGEA 3A23A 1TYGA 3I6RA 3GDLA 2A5HA 4CNNA 1ZJIA 2QDHA 1LBLA 3IGXA 2CZ5A 2Y70A 4HHPA 3ABQA 3W88A 3LBCA 5HJLA 5SWUA 4LRSA 1GVQA 2ZTKA 4ZQMA 5G2IA 1DV7A 5KZMA 3DXIA 4Y9AA 1ZCOA 4IWWA 2Y63A 1OFBA 3UZJA 5LNSA 4GJ1A 1VQTA 4O4WA 1ALDA 3W1XA 1K7XA 4UMBA 3BGJA 2RFGA 3L21A 1FWRA 3PM6A 3TK7A 3DKJA 4MZ8A 4IUOA 3RU6A 4EF8A 1UJPA 1YADA 4JX4A 1R2SA 3NQMA 4BK9A 2GVJA 2YDAA 3W71A 4A21A 2HTMA 4JTIA 1RV8A 3TXZA 4NJHA 1J2WA 1OYAA 1PVNA 3S1UA 1VHNA 4M6QA 3TX9A 5K9DA 2NXIA 4AWSA 4FXRA 3MHUA 2Z1BA 2WJZA 1UUOA 3BARA 5A5WA 1LBFA 1UUMA 4CQ8A 5HR6A 3DZ1A 2V81A 3GYEA 4UFJA 1W8SA 2Z6IA 1YTKA 3EWZA 6TIMA 3L68A 1DORA 3C4UA 3S5OA 5DELA 3P74A 3W1RA 4N2YA 3E02A 2YW3A 5D33A 2RDUA 2G97A 3S6DA 1A53A 1RD5A 1PCKA 4LNYA 4N6FA 3NNTA 2QUVA 4IMDA 2GQ8A 4JX6A 2A7PA 2EGZA 2X16A 4GBUA 3UPWA 1YDVA 3IIZA 2Y61A 2CLIA 3SECA 3QH2A 5FEPA 3S8HA 4UTKA 3IVUA 3L0KA 1SFJA 4O1DA 3NO5A 3T55A 5HQEA 5K3VA 3GDKA 2TYSA 2Y7GA 1EWDA 3TIMA 3CIWA 5F4XA 3VNDA 3TFCA 4MKNA 4JTHA 4E0CA 4IJBA 1OFDA 5E1QA 3HG5A 2CWNA 4Z1AA 4ICNA 5DCBA 3QC3A 3ELFA 5KTLA 5BW6A 1YDNA 1O5KA 1O94A 3MBFA 5CZSA 3V1PA 3SW6A 5L6UA 2RH9A 1RZMA 1FWSA 1EX5A 1BWLA 2DZUA 4WX2A 3PUDA 1VR6A 3WJSA 3R89A 3M41A 4M5PA 5LNRA 3W7QA 2Y7DA 4K7VA 3GAKA 4JICA 3WJXA 4O19A 1HL2A 1SO3A 3KRZA 2PE4A 4TMBA 4QNEA 4RK8A 3MI3A 1TJRA 5CSRA 1OK6A 2C19A 3P82A 3QMRA 4Q32A 1D3HA 4NU7A 2Q3OA 1BWKA 1OHLA 5T26A 5AC7A 2PURA 5IM51 1JCYA 2ISWA 1GYNA 4QITA 4TR9A 3P67A 1QAPA 2CU0A 4O54A 3NQVA 4UCGA 1WDWA 4FX7A 4CQ9A 4N9DA 1ICSA 2Q8LA 5CPOA 1KBIA 1TB3A 3LI0A 4O50A 4PA8A 1NF7A 2YR1A 3GX9A 4MLJA 3SJ3A 2BLEA 4LUJA 1D9EA 4BI5A 2ZA2A 4JTKA 5AHMA 5CKSA 1K03A 3NPUA 2E68A 4TO8A 1S5WA 1AW5A 3HG3A 1KFCA 3OVQA 3G1XA 2A85A 2YYUA 2YZRA 3STCA 3W3OA 1ZAIA 2OJPA 2YPIA 3H55A 4NT0A 4H3DA 1TCDA 4TU1A 1KM3A 4WXYA 3EXTA 2FPYA 3FJ6A 1TPH1 4HNVA 4Z1DA 3G1DA 4OV9A 1D3GA 5G1YA 4XWUA 1LRNA 2QUTA 1H63A 2DP3A 4JX5A 4S2CA 3FEMA 4EWND 5I3JA 1W5NA 2NZLA 2QCLA 4WOZA 2NX3A 4UFKA 2J24A 3PUEA 4IGHA 4UTTC 3DFQA 1LROA 4LWWA 3LXCA 4IXHA 3UNDA 2NWSA 3A21A 4ML9A 2PRHA 4HPJA 4MPQA 1SU5A 1XKYA 3P60A 1IXPA 3SGZA 4JXCA 3PUOA 3L2IA 4MYXA 4AWUA 2GUUA 3P81A 4O0ZA 1FWNA 5G4WA 3W1NA 1GYLA 1Q3NA 2EPHA 2QJGA 3IVSA 3W2MA 2VEIA 1IXNA 2A4AA 3LCFA 3MMTA 1C29A 2ZZ2A 1VGAA 1MEHA 3B03A 3TFXA 2OX1A 4CCDA 4IX0A 2H90A 2DORA 3R2GA 3W7PA 3RLUA 1DQWA 1SW7A 3FLUA 1NAL1 3TQKA 4UR8A 3PVFA 1H62A 2VKZG 1W31A 3LV5A 1SSDA 2YFNA 3EX2A 3LHUA 3FKKA 2VOMA 3TSDA 3V75A 4UTIA 1K8YA 3GR7A 4AF0A 2CLOA 4ADSA 1XUZA 1W1ZA 1OX5A 1KM5A 4O52A 3UWYA 2GVLA 2XN1A 1M6JA 1MEWA 3GDTA 5F4SA 2EKCA 1HO4A 3GDRA 1B9BA 1I2QA 3R13A 1LOQA 4NXKA 4YCPA 4DBEA 1IIGA 5AHIA 2QAPA 3NGJA 5CPNA 3GXTA 4BI6A 1SZEA 3S5YA 3O05A 3S1WA 1U83A 2W0UA 2V0TA 1YTEA 2JBMA 1LLWA 4UTWA 3DFTA 7TIMA 3TQVA 2R91A 3W2NA 2J9ZA 1V7YA 3EXRA 3TSMA 1YYAA 4RR4A 3UYCA 4LVGA 1S3HA 3DH7A 3Q94A 5I3FA 5H91A 2ZZ7A 3HB9A 3OVPA 3NQ7A 4FNUA 2B0MA 1P1XA 1ZFJA 2YGYA 1O60A 1TTQA 3M43A 3N34A 3LOTA 3NXFA 5AYYA 3LV6A 3CB8A 4MLRA 3EWWA 4JD4A 4I7VA 3PG8A 1FBAA 1QDSA 1F05A 3W07A 3BLFA 4LV9A 3IEBA 3LRLA 4NXSA 4ZZ9A 1SR9A 3T78A 1KM2A 3M5YA 1QCWA 1VLWA 3G1VA 3MHGA 3IVTA 2QJHA 4TMCA 2CZDA 2HMCA 1OFQA 2A21A 1B4KA 2X1UA 1OVDA 3AO0A 3LCLA 2ZZ3A 1TJPA 1DJNA 2ZA3A 3L5AA 5EPDA 1W0MA 3GDMA 2CFFA 3UQNA 4LC8A 4M6PA 2E77A 2QJIA 3O07A 4HPXA 4QJ1A 4NX5A 3N19B 1S5TA 3W6YA 4UR7A 3A5VA 4LW7A 4JYDA 4QSHA 4UTUA 4GUIA 3N2XA 5EL1A 4PL1A 2Y62A 3G0UA 1B57A 1M7OA 1VHCA 2WV8A 4Z1BA 2C15A 4K6AA 3S5NA 3EKZA 4LVDA 2C3ZA 4K7YA 5FF0A 5CPMA 4O57A 3CTLA 2DZTA 4LRTA 5AYXA 2P10A 3L66A 1Z41A 3W7NA 3S1XA 4XBKA 3QZEA 1GPWA 4OBTA 3M16A 5LKYA 2A6NA 1G4SA 3MYOA 3B0PA 4YCOA 4FF7A 2NV2A 4RJEA 1QPNA 2V30A 5FF2A 3UWVA 2FJKA 4FIRA 2J27A 1W3NA 3NQ2A 2E6AA 1ADOA 2XN0A 3KXQA 4QM1A 3KVJA 4BWLC 1FCVA 4L4MA 2B7PA 2O7SA 5I3HA 3VE9A 5CPLA 3MI6A 3NQ6A 3UWUA 1RR2A 1B4EA 3NM3A 4XZ9A 3VFLA 3R5EA 3BW4A 4UFMA 1JUEA 1JCMP 1ZY9A 2JK2A 2UV8G 2DZWA 2CZFA 3D0CA 1FX6A 4XKYA 3CWNA 4I9AA 3HPXA 3EB2A 2NXHA 3P62A 3G8RA 4O13A 2CLLA 1AW1A 3TA6A 4KWWA 3TV8A 4FNQA 2DU2A 4N9BA 4LOCA 2GOUA 1FDJA 2VFGA 5FF4A 1C9DA 2IQTA 2B7OA 3E49A 4XKYB 4AHOA 1UBSA 2C14A 4Y96A 3W86A 3G8EA 5CZTA 4HN4A 3W7HA 2HSAA 1OX6A 3W76A 1P0KA 1WBJA 3PBWA 5K7JA 3L9CA 1WXJA 1HUVA 3CU2A 3OHIA 4GUJA 1VCGA 3B0UX 2GJLA 4O16A 2YXGA 2QEZA 4ORMA 3NDOA 3TSBA 1LRQA 1XDMA 1U5JA 1PE1A 3G1HA 2ABBA 3RNDA 1KFLA 2ZRYA 3O6CA 4JTFA 4RXGA 1FQ0A 3G0XA 1NSJA 5U7SA 1X7FA 1OF6A 1T8XA 1W5QA 2QF7A 4EIVA 2A1YA 1TPDA 1F2JA 1JCXA 1LRTA 1KTBA 2JGQA 3TKFA 2F7FA 1GVOA 2CLFA 5AHNA 1OX4A 2PCQA 4L4LA 4PTNA 3BG9A 3N9SA 5FI8A 2C18A 4U4MA 4JIPA 4NJKA 5EKYA 2FB3A 5AB3A 1H7XA 2VFHA
chains in the Genus database with same CATH superfamily
1E6QM 2VMFA 3EOSA 3W1UA 3W1MA 4PODA 3WK3A 4EKJA 1QI4A 3T0AA 3DBNA 1OCJA 4KGJA 1Y8BA 2EJ1A 3PSWA 2BXVA 3MDUA 1L9WA 3MMDA 8CGTA 4RW3A 3P8JA 2ISDA 4PMZA 4AXKA 4PMRA 4UB9A 5TQLA 3DYMA 4W86A 4K1GA 3UFYA 1W9BM 2GQAA 3IWPA 2ATMA 2PDCA 3ECQA 4CN1A 1V0NA 4QS6A 2PLCA 4YWSA 4ZA0A 1GQNA 3RG6A 1QBAA 2EHHA 1S5NA 2GK1A 4R34A 2B81A 4IP4A 2WVTA 3G1SA 3UZ5A 1KV8A 1GOQA 4EK7A 3KRSA 4G7FA 1LUCA 3USBA 4O10A 3MBDA 4GC4A 1MDRA 2Z28A 1ICPA 1P4CA 3DI1A 3BSGA 1QO5A 4GI9A 1LUCB 2V3FA 1UA3A 1J11A 1RJPA 3THUA 2EQDA 1AQMA 3WK2A 3SY1A 2B7NA 3DIPA 3F03K 2DFAA 1GVEA 1UB3A 4H2CA 1R2TA 2J8FA 3TZFA 3WFAA 1X1OA 2OR2A 4XIMA 2E5DA 1WV2A 4CD4A 3CZGA 1RPXA 5DQPA 1TE6A 4J2MA 4R88A 5E0KA 1VAHA 1VJIA 5I09A 1QPQA 4Y9PA 3HMCA 1SW0A 1QJWA 4D6CA 4QG8A 3WQ6A 1XYMA 3NL5A 2DH3A 1QFEA 2GVGA 4XSLA 1GORA 4W9TA 2XM1A 2IPGA 3DUGA 2YW4A 4V27A 4KQNA 3NQAA 2XSBA 2VGGA 4CVUA 2QIIA 3AXIA 4N9EA 3USZA 1TV7A 1EPVA 1I6NA 1NIUA 2WO5A 5LHFA 4F0SA 3N1AA 4S1FA 4GRSA 3TWAA 1QRQA 1TVLA 2DT0A 2PDKA 4QE5A 3HQOA 1Q4NX 4RDZA 4UZSA 4MMWA 4JNYA 1OABA 4ZL1A 3GAYA 2ZVRA 2EO7A 1W1YA 2G5WA 1KLZA 3B8UA 5G4HC 1W9PA 1TKKA 1VPYA 2C91A 1FH7A 3C2EA 2WJEA 1XBZA 1JYNA 4AUBA 3C56A 3Q65A 2PGFA 5AYZA 5GNYA 5D09A 4NNCA 2JEQA 3W23A 5JH2A 1VEOA 1GZJA 2J25A 2ZICA 4FXJA 3RR1A 4AEFA 4MY9A 4JQ4A 3CIVA 3GK0A 3WF3A 1NWTA 3K4WA 1C7TA 2DGAA 3C8FA 1M04A 2G3NA 5TIMA 3LMZA 2FDMA 3NWRA 1Y5WA 4ZBCA 2XSAA 1ZTVA 5J04A 3SN4A 3HGOA 1ME8A 3W2LA 2WKLA 3TNOA 1TRDA 3VDBA 3T81A 1E9YB 1Z69A 5EFFA 1V6UA 1M41A 3RMEA 3QMSA 3P0XA 5A6BA 2IS7A 2E9MA 2BHYA 5FJPA 4AQLA 2CLMA 5DMNA 2GL5A 1GKPA 3MSDA 3NZRA 1MI3A 3B0YA 3FKRA 5CQ1A 2VFDA 1A5CA 5FJUA 2DSZA 1ZZMA 4RDYA 1E0UA 2A3LA 1L6FA 1KWGA 1IT8A 1IR1A 2HV5A 2V2HA 3CQ0A 4FXSA 3ZS4A 3SCRA 5JXQA 1UASA 1VPQA 4O28A 3HBLA 2HVNA 2WHMA 2NV9A 4UOQA 4XZBA 4GUHA 1XLLA 4B16A 2E1WA 5IBXA 4C5ZA 1JQVA 2WCGA 4DF2A 3WKZA 3WUFA 4GVGA 3GXPA 4JYFA 3LG3A 4AXNA 2A3CA 4ONVA 3LGGA 1YW1A 3NIYA 1UP0A 5D8ZA 4HZMA 3EWYA 4ZR8A 4KFOA 4LVAA 1Z9AA 4BR1A 1FWTA 2R1NA 5I3IA 4I9JA 5AFDA 1VJSA 2J77A 4DI9A 2FB2A 2VCCA 3PNZA 2IPWA 2XVKA 5BXSA 3ZR6A 1H50A 1HJUA 4NJJA 4YU1A 2O9PA 3F4CA 4JTEA 3EWCA 1XRFA 3N3MA 3KOFA 4AWTA 2OX4A 1HX0A 4M0XA 2QAFA 2INEA 3MP3A 5D8WA 1MRAA 3UR8A 1UMYA 3AJXA 4DEFA 4EWJA 3MYPA 1JYWA 3P0WA 2J66A 3DG3A 3OGRA 2PDMA 3W81A 3TNBA 2ZTJA 3UJFA 3DFSA 4LANA 4EACA 3ONBA 1R38A 4Z2IA 2ZA1A 4KWVA 2YLAA 1XWYA 4PMQA 4W4QA 1R30A 2C6QA 2W62A 3NPVA 4ES4A 3E2QA 1FY6A 4CNOA 2BZNA 3MS8A 1UWQA 3QF0A 5BXRA 4NX0A 1S1PA 3BAKA 4HMNA 1UR8A 5F4WA 3GS6A 4KEUA 3ATZA 5EMUA 3W74A 3RLVA 1NVMA 1KV5A 4M3PA 1ME7A 3KL3A 1OFAA 2HXUA 4J3SA 1D3CA 1X6LA 1YXYA 3SIZA 1CX9A 1XLMA 3OEXA 3AIRA 2PRMA 3UXAA 3C2RA 2H3BA 3QSTA 2RAGA 5BRPA 3KW3A 1LL6A 3PPCA 4V1XA 1P7TA 1I4NA 2GGIA 4LYPA 1SJDA 4DO6A 1W1B1 2CYGA 3DGRA 5I06A 3DFOA 1EC7A 5BOFA 3GG8A 3VD9A 3SO7A 4DLFA 4JFTA 3HPAA 3TC7A 3VKKA 3GXMA 1P7TB 3W7CA 4IPLA 3GUGA 1UZHA 2AAAA 3R0UA 3WSUA 1CIUA 4PCPA 4D6EA 4QTGA 1PUDA 3R7MA 2KZHA 3AFBA 1V6TA 4LBUA 1MXGA 1PX4A 3TQPA 2VZSA 1SZGA 3W9ZA 4AH7A 1BLIA 4M7SA 3QY8A 3UZWA 3VPLA 1OZQA 4B2DA 2V8ZA 1GZGA 3UBPC 3A24A 3EB3A 1R85A 1WUEA 3L4VA 2AGTA 3NG3A 2EPNA 3GBEA 2V38A 1FHVA 4US5A 1SFSA 2Y24A 4XQ6A 3W83A 5HQMA 3W1PA 1DWAM 4JGDA 1Q6EA 1TX0A 1R3SA 3AU6A 3K1GA 2HS8A 3PG9A 1P6BA 2HROA 3H4XA 2WHKA 4IMFA 3GR8A 2BDQA 4JR5A 1W17A 2P0IA 3G6LA 1UP2A 4CU6A 2UY2A 4M19A 2PGRA 5HXMA 1R47A 1TTJA 2Y7FA 2E6DA 3C8NA 4GHRA 3EWBX 3MKCA 6REQA 3TVAA 1KTCA 4EPBC 4S23A 5GVJA 1BD0A 3E2VA 1W37A 1JZ7A 1CEOA 3MVTA 3C2OA 3L4XA 4HNUA 1J12A 5J5DA 4C1KA 3BVJA 3P5ZA 3C0JA 3M44A 6REQB 1FCBA 5HPCA 1OG6A 1VFHA 1RVGA 5BRQA 1ESWA 1GVYA 4Y8FA 1I9CB 4HK6A 1IXOA 4ZQRA 1A5LC 4XVDA 4E4PA 2DT2A 4WXZA 4AY1A 1XGEA 2I14A 5CC3A 3ARRA 1R5YA 2ZWZA 4JCMA 5XIAA 1PX3A 1XIIA 3PJUA 3M5ZA 4KESA 3QQWA 1FCUA 1C91A 1FDZA 2VWTA 3T7VA 1OWQA 1IXQA 4GO8A 4HKPA 2BODX 4AY8A 5I02A 2BY0A 1SMAA 2RGMA 2YYTA 4CUCA 4MFEA 3B06A 1I60A 4EAMA 3W53A 4M7TA 4IHCA 1BAGA 4MTVA 3RJXA 4DJED 3I6TA 4ICCX 5D2WA 2ZX8A 1V03A 2I9EA 3SGGA 2D2JA 1X39A 3PULA 4WJXA 1I0DA 4PYSA 4NY2A 1HKMA 1KKOA 4WKFA 4S3KA 4N6EA 4DVOA 2J7BA 5LHEA 1FXQA 2R8WA 1LTDA 3W29A 5A8MA 6A3HA 4MGGA 4WCJA 4MB5A 2NLIA 5ECUA 2IUZA 3PK7A 2QYGA 4MUZA 4QDWA 3LY0A 4PMXA 1FWFC 3INPA 4YTUA 4E4FA 5C7HA 1ZAHA 5TF0A 1IYXA 3LDVA 4IISA 3BPWA 1HVXA 5T8GA 4X2RA 4QGCA 1T96A 2VVNA 2Z6JA 3MTWA 3AMGA 5BU9A 1M7PA 4PUWA 1WZKA 3K8KA 4PUEA 1NDYA 2FZNA 2FZBA 3MW7A 1DEDA 4LV4A 3N12A 3KL5A 2PU0A 1SZFA 2BVWA 2NT0A 4AZHA 1JNDA 1N8FA 1SYTA 1PIFA 4AVFA 3Q58A 2EPOA 1UD5A 3B8SA 4ERIA 2OEMA 2PC4A 4MWAA 5CC5A 1LQ2A 1Y7VA 2ZFAA 4RLIA 1JVNA 4DJDA 3ITCA 2WZMA 3THQA 2J9XA 2R9RA 2ZUNA 4ZODA 3AHXA 4MWAB 5DRIA 3EX6A 3KEHA 1SW3A 2QCEA 2OKTA 1UWTA 1GQLA 2GJRA 2ZRZA 1EEXA 2AKZA 4CNTA 3U2EA 4QFUA 2E1DA 1UKOA 5I2UA 2Z7GA 3EDKA 3GG1A 2AGKA 4NAFA 4PTMA 5KITA 4S3DA 4ZGYA 5U4NA 1K9DA 3FYPA 1HKIA 3UZXA 2GFTA 1UQZA 4H9UA 1VFSA 4A22A 1XLDA 1AW2A 2BWGA 1EJUC 2EG7A 4HSOA 3GTIA 3ZXWA 1KM6A 1Z7AA 3UGRA 1MUWA 2DZSA 4MF4A 3JS3A 2OYKA 1ZHAA 2AKMA 2AMGA 1ICQA 3L5LA 1XICA 3ARYA 1K9EA 4H6KA 1T8QA 1ZENA 4FLSA 2Q09A 1Y0EA 4DNMA 4OOZA 3VMPA 3CTTA 2CWXA 3VVGA 3G1YA 3NDZA 1XC4A 3UG8A 3P7YA 5LZLA 3OO2A 5CG7A 4GFSA 3PWIA 4DXXA 2DT1A 2YKKA 1R46A 1CI1A 4M51A 2PDLA 3OB8A 1EA0A 2CKRA 3IANA 2YCKX 2YBUA 4ZCWA 2X0HA 5EY5A 1Q6QA 1TQXA 3GNRA 1KGUA 2PDXA 2D23A 5EB8A 3WH8A 3BLLA 2VRKA 1F7BA 1XSIA 3CL8A 3N14A 4GQQA 4CN4A 3RGTA 3GZAA 4D6FA 4CQAA 3WNMA 5G5IA 2IPFA 3V5OA 1A3WA 5D2VA 2OWWA 1H61A 1VC4A 3RM9A 3CO8A 1QNRA 4BEQA 1EDGA 2R1LA 3CAQA 3RILA 3STFA 1BWVA 3ZYZA 3TW7A 1XLKA 1XDJA 2RDXA 4ZOAA 1F07A 2KAUC 5HA7A 4WZHA 4PUJA 3LM7A 2PDHA 3APTA 4N02A 2ZX6A 3B4UA 1KW1A 4ADUA 3FHQA 3B3DA 3NOYA 1Q6OA 1R3QA 3JW7A 5DCDA 5KMYA 1XL9A 1TZZA 5JVLA 1YPIA 4YLWA 3EEGA 3DG6A 1FWBC 1TTIA 3CC1A 1GJWA 4CKQA 3BJTA 9XIAA 2VCBA 3DFNA 4DBDA 1LBMA 3EWUA 1UH3A 2XIOA 3KX6A 5MHBA 5BOEA 4P8VA 3TAKA 1WXYA 3T8QA 2V6AA 4JTGA 3GTHA 4ATWA 3TYAA 3VIHA 4YIWA 1LL4A 3WLKX 3W72A 4ERGA 1KRBC 3W6LA 4MDOA 1TMLA 2Y5EA 5C9RA 3GUWA 1JFHA 1BXBA 3GC5A 2Z2AA 1EP1A 3R43A 1XIEA 1NOUA 1XJBA 4W5ZA 4FI4A 2GDUA 2QDDA 3MP5A 3OGSA 3SQSA 4A05A 3O15A 4PBEA 1A5KC 3WLHA 2XGZA 2IKGA 3S6OA 1GG0A 1S5MA 5F2MA 1TPFA 3FX4A 1PAMA 3QN3A 3P5YA 1UKTA 1NF0A 2CERA 2J7HA 3A4AA 3DYPA 1JD9A 4YWIA 5I0DA 1MZRA 3H54A 1SQ7A 3RLGA 3E5BA 4N4PA 1OK4A 5C9WA 2ISVA 2DUAA 4HCLA 2W4XA 3PANA 1ZRQA 4KT2A 1K3UA 3LHWA 4IMAA 5G1TA 1AUSL 3GIYA 3ZR4A 3BQ5A 3VAVA 2C1HA 2V82A 3E9AA 1J0IA 5E9AA 1B3XA 2YSWA 1ISXA 1LQ0A 4E38A 3QKEA 1XPYA 3Q2DA 4KH2A 2GZXA 4OGZA 1A0DA 3VIIA 5E70A 4UC5A 3JR2A 1XHGA 3DI0A 4OU1A 1GVRA 3AYSA 5KINA 1THFD 4QISA 2GJXA 5B80A 2CHRA 4MPKA 1H5VA 4B3LA 4RE0A 2GPTA 1G4TA 2QCCA 5F2LA 6XIMA 3CEPA 1RPKA 2GSHA 4IT1A 4UNKA 1S2UA 3BZJA 4A4AA 2XGBA 4J1OA 2F84A 3UJEA 4CN6A 3A4JA 1TMQA 3IK4A 1AFSA 3A9BA 3WDPP 4DWSA 4DELA 2VHLA 1N8WA 4MUPA 1L6YA 1ZPTA 4I9MA 4L9ZA 4FALA 4JDYA 2VFFA 3ARZA 4LEFA 1EC8A 3JRKA 1BG4A 1CLXA 1AH4A 5HWMA 4DWSB 4U33A 1U1JA 2C0AA 1QI5A 2PPGA 3NVDA 1ONEA 3M7WA 5MKGA 1FP9A 1J18A 1JDCA 4AHPA 1M7XA 2TMDA 1R3VA 4LBRA 2J7EA 1OGBA 6TAAA 5D32A 3M0KA 3LPPA 3UG4A 2YL8A 4UFHA 2PP0A 1TV8A 2Z1WA 5MKGB 4C6PA 2OT1A 3W1QA 3WNLA 3E0LA 1K70A 1V93A 4BY3A 5AY7A 4RZ6A 3NDYA 2PD5A 3CUHA 2PWVA 4LUTA 4EANA 2A5HA 6ENLA 4B91A 3B8TA 4HHPA 3OW1A 3N6QA 4RW5A 4DJEA 1AD4A 5HJLA 5DEZA 3GIQA 1BYBA 5G2IA 4LUTB 5KZMA 3WQPA 1XV8A 4Y9AA 1OFBA 3IJQA 1XF0A 1VQTA 2WZTA 3AIVA 5I79A 3W1XA 1K7XA 4XZLX 1C9WA 3VABA 2NQHA 3PM6A 3BURA 4GZIA 3NGFA 4IUOA 3QR0A 4JX4A 4JIHA 3NQMA 2YDAA 4MB1A 2C79A 3TCSA 2VM8A 4NJHA 1J2WA 4Z2JA 4RPQA 2ZKMX 4M6QA 3GXFA 1JYVA 4JFUA 1EZ2A 3MHUA 5A5WA 4Q4PA 2GVEA 5EMLA 1UKPA 4CQ8A 2W61A 3WLJA 3CUJA 3DZ1A 4IZGA 2V81A 3GYEA 1W8SA 3NUKA 2HVMA 3LM3A 2QHAA 3EWZA 3TLQA 6TIMA 5DELA 3UXIA 4JL2A 7A3HA 2A3EA 2OKOA 2VWSA 3PZNA 1V3JA 2J7FA 4ZE4A 4D6DA 4A35A 2EPKX 1RD5A 1U1UA 4GIAA 3ZJ8A 4ATLA 4AZCA 3WLLA 1BFNA 1MXDA 4IMDA 5T9CE 1XG3A 3HU7A 4QDMA 2OPJA 3UA4A 2VCAA 3QH2A 5FEPA 2E8YA 4UTKA 3EB4A 2NSOA 4PFHA 2BB0A 3TIMA 3VNDA 1GJUA 2ZDSA 4XIAA 3ZVIA 2CIPA 4N42A 3MUY1 3TW9A 1E73M 2BFGA 2CWNA 3QC3A 3S2LA 5KTLA 1EH9A 1O5KA 3HA1A 5L6UA 1OD0A 2RH9A 1FWSA 1XFCA 5KZ6A 2WMHA 4HJWA 4IF2A 1VR6A 2OSXA 3R89A 4M82A 3M41A 4M5PA 5LNRA 2XH0A 3W7QA 2Z00A 2Y7DA 1TX2A 3GVVA 1J0ZA 4A3RA 3WJXA 4LAUA 1HL2A 4JQ1A 5FL0A 5CAHA 2PE4A 3EDFA 4F8XA 3LUTA 4LYRA 1X96A 3GVRA 4IL2A 2C19A 1PSCA 3V7PA 1XIMA 4PUDA 3UNTA 3BAJA 3QMRA 1Y5VA 2I16A 4E8CA 3UCDA 2PURA 3OLIA 4PMVA 1F4AA 4QITA 1CXHA 2DSVA 2GWNA 3S2CA 1FWIC 2NQJA 4Y9MA 2Q8LA 1YHTA 4O50A 3PZMA 4PA8A 1NF7A 4PCTA 1F8MA 3V3WA 4MLJA 3F5JA 1QXLA 1I0BA 2F6UA 3HG3A 4CD5A 2A85A 2YYUA 1W1TA 2YZRA 1BSLA 2WCAA 2OJPA 2OQYA 3H55A 4H3DA 1QHOA 3WX7A 4DX3A 3UW6A 3EXTA 5CBIA 1TPH1 1IHIA 3WLMA 1W1PA 5CJMA 2D69A 5KETA 3SFWA 1LRNA 3CQJA 1VFFA 1E3XA 4F0HA 3VKAA 1NJJA 4S2CA 3N4FA 4E8GA 1YE6A 1W5NA 3VOCA 2NX3A 3VKBA 4UFKA 4IGHA 3ORWA 1TCMA 1LROA 5CPQA 3A21A 4ML9A 1VBGA 4MPQA 3VGHA 3PZUA 1XKYA 3VOFA 3P60A 2IQ0A 1IXPA 2OGJA 4JXCA 4KCTA 5CH9A 4ZO9A 1FWNA 3BC9A 4GQ0A 2DIKA 2JQXA 2OU4A 3VNJA 3IVSA 3RX3A 1E9IA 5HMDA 1B1YA 2A4AA 3MMTA 1O66A 1CXLA 2BVYA 4NF7A 1QW7A 1R9YA 1VGAA 3NZQA 1GW1A 3TLLA 1IEVA 4Q4SA 4GK8A 3W7PA 1CXFA 1OBAA 1SW7A 3FLUA 1NAL1 3DC8A 4GI4A 3PVFA 1FWAC 3OZMA 4K8GA 3K2GA 3MQTA 1D7FA 2BG5A 3FKKA 3L2LA 1EZWA 4PMNA 3OG2A 1J0KA 3TSDA 3V75A 3C0SA 3GU9A 3UERA 2CLOA 4W8AA 1W1ZA 1PPIA 3WZ0E 4X2PA 4NZ5A 2GVLA 1PXGA 4WVXA 1GK8A 1W1IE 2Q01A 3GDTA 5F4SA 3R13A 1LOQA 4NXKA 1IIGA 5AHIA 1W3LA 1NP2A 2XVNA 1V51A 1KXQA 1LLWA 2GQ3A 2QUNA 1EF3A 2XFYA 4JQ3A 3W2NA 3UCQA 3AYVA 1PJ9A 1YYAA 2DQXA 3PFRA 2XVGA 3G6MA 3SRFA 3DH7A 1CPUA 4AZ6A 1UUQA 3OVPA 5CCZA 3NQ7A 4NZ4A 2O9OA 1TWIA 1E3ZA 4NRSA 1P1XA 2XSXA 1O60A 3M43A 3WG6A 3LOTA 5AYYA 2FTWA 4E3TA 1HQTA 1I75A 1FBAA 3BLFA 4LV9A 3IEBA 3LRLA 1ISYA 4QG9A 4ZZ9A 1SR9A 4DUOA 5GQBA 1EBGA 1B3VA 2WHJA 1DYSA 1T6MA 2HMCA 1OFQA 5LXEA 3ZT5A 1OVDA 3AO0A 2ZZ3A 1C8QA 1DJNA 2YJQA 2ZA3A 4DAIA 4NIRA 2W66A 1O1ZA 4LAMA 3EZ4A 4AD2A 1KFWA 3M64A 4ICMA 4AIBA 1HXJA 4EPKA 2WC7A 1S5TA 4P7LA 1H11A 4UTUA 3FNDA 4H9MA 1MDLA 1V6XA 3N2XA 5EL1A 4WRHA 2WJDA 4PL1A 4KETA 1WP6A 3U57A 4MAVA 3C86A 3S5NA 4ZFCA 3EKZA 3GHUA 2C3ZA 5REQA 2BVTA 4GZ7A 3SCTA 2FKPA 3ALFA 1J79A 3CTLA 2ACRA 3CBWA 2V3DA 4GY7A 2GGEA 4R85A 3N18A 1VEMA 1E4IA 2VX5A 1XCWA 4XBKA 3WYZA 2ZVIA 4OBTA 1M53A 3UG3A 4PRRA 1EJRC 3OQEA 1G4SA 3BLOA 1FRBA 3CT2A 1DJIA 4YCOA 3VKDA 4RJEA 3UWVA 2V30A 2HK1A 6CGTA 2ZWYA 3H2CA 2WHLA 2V5JA 1G1YA 1H3GA 2DIJA 2XN0A 5J8LA 3THDA 2WSKA 3KXQA 3BAXA 2OLHA 3KVJA 4BWLC 1FCVA 4TX6A 3MI6A 4Q8QA 1B9ZA 3NM3A 1V3LA 4XZ9A 3VFLA 3BW4A 5CJNA 1ZY9A 3TJ4A 2UV8G 2DZWA 4OUEA 1VD6A 4RV3A 4XKYA 2QMJA 4WGXA 1E56A 5XINA 3P62A 1S38A 1Q2RA 4N9BA 2GOUA 3VXGA 2GDVA 3PTMA 4XKYB 1UBSA 4P5UA 3W86A 3L23A 4HN4A 3NJ3A 3CQHA 1ELSA 2WVUA 1JZ5A 3MUAA 3PBWA 1WXJA 3VDHA 3WO8A 1HUVA 2PWHA 2DY3A 1DXFA 1KCXA 3B0UX 5HJYA 3CZ8A 1U5HA 3VCNA 3EDEA 5A6KA 3GHSA 1ITUA 3TSBA 4U3CA 1XIJA 1LRQA 1XDMA 4JHZA 4B5XA 2VOTA 3RNDA 2ZRYA 1HJVA 4GGHA 2I5GA 3VNIA 4F2BA 1FQ0A 1X7FA 2IKHA 1T8XA 1KB3A 1J0YA 1TPDA 1JCXA 3VUSA 7PTDA 2G0WA 1NM9A 5AHNA 4PTNA 4L4LA 3QHMA 3BOFA 3MUZ1 5FJTA 5AB3A 2VFHA 3ZMRA 4A8NA 3QXBA 3OIXA 1K4HA 2CC0A 4ATDA 2VTFA 4OV4A 1T0OA 3IRSA 5AOUA 2VRQA 3R58A 4MJZA 4JNMA 3T40A 2A7NA 5FEWA 1QNSA 3MZ2A 1MW1A 5JIWA 3AS0A 3W1AA 4FIQA 3QV6A 5CZ0A 1QT1A 1B30A 4CCEA 3QMTA 4CCZA 3VIJA 2NQZA 4HB7A 3TYZA 3URQA 1M5WA 1MFVA 3AMKA 3L5MA 3M5XA 4MY8A 3K4AA 3B0VC 1JGIA 4IP7A 4JTRA 4LCQA 1AH0A 5G2WA 4IPIA 4RNFA 2Q8ZA 1D2KA 4ZQPA 1F6KA 2WCSA 3VOJA 3AS3A 4NZFA 4C6DA 1AL8A 1FXPA 5CPSA 3STEA 4JTLA 4E8DA 5C0QA 1DXEA 1UQYA 3O6DA 4WSKA 1ZBVA 4US6A 3F2DA 2NUXA 4DBWA 1C7SA 3DFPA 4K1WA 1AJ0A 3L67A 1R3TA 4XG1A 1A3XA 2CLPA 3SI9A 1MRQA 1VRDA 5I78A 1UROA 4JHMA 3LK6A 2FHBA 1TV5A 1E5JA 3SM0A 4NAEA 5TBOA 3BJFA 3NSNA 1AK5A 2W79A 4AU0A 1LCOA 2WMJA 1JI1A 3B8WA 2WKJA 1WX0A 2ASHA 2YB4A 1YNYA 1IIHA 4EVZA 4KKXA 3CZEA 3TE9A 4JQAA 2CZEA 3Q45A 1P0DA 4PH6A 2VXNA 4GOAA 4KCWA 1K7EA 3HGRA 2UY4A 3WF2A 3BSMA 1EQPA 1MQPA 2WYSA 2V2CA 9XIMA 2PTYA 2XM2A 4GCXA 4BA0A 4IIFA 4HHLA 4LAZA 4OBSA 4F2UA 2NLYA 2X7WA 4M6VA 2G3IA 1EJWC 4LSBA 1SO4A 2A3AA 1MEIA 4DB7A 3WUBA 3CT7A 4MZYA 3R25A 3KL0A 3W7RA 3TN5A 2XH4A 3A9IA 5HJXA 3NM1A 1Q8JA 3ITTA 4MY1A 4DQWA 1NDWA 3CNYA 4XAPA 3VM5A 3N73A 5LA1A 3O63A 5BXTA 1ITQA 2VUNA 2INZA 2ACSA 2BOFX 3CPGA 4GFIA 1HTIA 4PMDA 3PTKA 4GYJA 3DOPA 2V3GA 3B8IA 4PRTA 2I5IA 3EOOA 3NYDA 4DI8A 3PSVA 4NZCA 3COTA 5C6MA 3AWNA 3OBAA 1FVPA 3STGA 1QK2A 3LQGA 1X1ZA 4ERAA 2PUZA 5FAGA 2E3ZA 1N55A 4GGBA 4L9XA 3LGDA 1AG1O 2ZBTA 8TIMA 2VGFA 2Y88A 4PE8A 4JHOA 3R11A 2J6XA 3SDOA 1K4GA 3VE7A 3CUXA 2QPXA 3THAA 2B31A 3HQ1A 1C8VA 4BQ2A 4GUGA 2O56A 3SCWA 4D6GA 7TAAA 4H83A 4ZOCA 1QR7A 3G1AA 3SIMA 4F2TA 2R1PA 1KRCC 5XIMA 3B9NA 3A47A 1LT7A 3QR3A 3OBKA 3D3FA 3FIGA 4HOZA 4AYSA 4QEEA 1ZNNA 5FOOA 2W92A 3HV9A 3KUMA 3BV4A 1JUBA 3TCEA 3S4TA 2PRLA 1YTDA 4JZ5A 1JCNA 3UF9A 2R24A 4W7WA 4GO9A 4PB3A 1VH7A 4FS9A 4DIAA 3W38A 4RE2A 1E4MM 1XH2A 5HINA 1QPRA 2Y89A 4UTWC 5ABEA 4HZ7A 1LLOA 1JZ2A 1D8CA 3WJZA 3BW3A 1H7RA 4LVBA 4HA1A 3T08A 3URBA 2ZUSA 5A8NA 3V5CA 1S2AA 1FCQA 1UIOA 1ONRA 1NH6A 2JGYA 4DO4A 2QNEA 4O1FA 1QI3A 4JS3A 2MANA 3DBPA 2E25A 4D8LA 4YVVA 4MOZA 1ODZA 4J7RA 2OZ3A 1ITCA 1QO2A 4IX2A 3FJ4A 4FNTA 5EBUA 2QJNA 4JTQA 3SJNA 1BKHA 4H19A 1H60A 3G18A 4WR3A 4S3AA 1KCZA 4BEUA 3JU2A 3C61A 4IIDA 3HMJG 3BSHA 4RXFA 1HL9A 2GLKA 4CLMA 1RJQA 2XZ7A 4XAZA 4XUGA 3IIPA 1JR1A 4FP1A 3H2AA 4C6OA 2ZZ4A 4EXAA 2DSUA 4HNTA 1DJQA 3ICJA 2BY1A 2VC6A 1XLBA 3H53A 4B3KA 2DZXA 4XD3A 1W5PA 1UYQA 1H0GA 3KVLA 2RDTA 3FDKA 1OG0A 1JPHA 2G3FA 3LSCA 4S2BA 4NI3A 1VCVA 3C3NA 3KBNA 3HPZA 3W0KA 5I3GA 3QW3A 3S5SA 4XZIA 3M0IA 2E5CA 3LNMA 5KZEA 1GKQA 4JBRA 1JEZA 5D03A 2PSNA 2Z4GA 4L9YA 3G3DA 5CXPA 3P2VA 5HATA 4KEVA 5FF3A 2HPMA 4K37A 3TH6A 2OFJA 4QXIA 2WLYA 3ARQA 4JYEA 1X8FA 2QVHA 4J40A 5K4XA 1BGGA 1XR2A 1OC6A 5FD0A 1YIXA 2BGSA 4LCSA 5TAOA 1JL8A 2YCEA 4V15A 4K36A 2IKJA 4JNZA 1B54A 5K9CA 1M9HA 5ABGA 3R12A 4H04A 3HPSA 5D37A 1XQKA 2Z0IA 4OHQA 3MPGA 2C16A 1F61A 1ZS2A 3FCPA 1V6WA 1UIPA 3QEZA 2X1TA 3GVWA 3SN0A 4RV8A 1XFBA 5AVNA 3C5QA 2PB1A 3GVGA 4I5RA 5D38A 2BOEX 2PTZA 2FHCA 4LVFA 3TDFA 5IXEA 1QK0A 4AHQA 3MKVA 4IPNB 4W89A 5LGZA 1XS2A 4F3HA 1B90A 1XIHA 1QUMA 1XRTA 4Q22A 1Y5XA 4RCXA 4HQVA 5HWNA 4LALA 5AC4A 3S9YA 1CZ1A 1W2VA 1NDVA 1OZMA 3H12A 4YXGA 5CC7A 3HFTA 4XV0A 4F9DA 3CUIA 3O0KA 1V3MA 1OQFA 1TQJA 1VYSX 4X22A 1Q4WA 5MF5A 3EX1A 3RM8A 3E0VA 2G95A 4R3UA 4OE7A 4XZWA 3LCGA 4Q7NA 1UWSA 3OOQA 1F6YA 3AS2A 1POJA 3ARTA 4UFIA 5B7ZA 1XUUA 5AYIA 2E6FA 1ZJBA 1UPPA 3WMLA 4PUMA 1RA0A 5G2HA 2A6LA 4R33A 4HZ6A 3DHFA 1G5AA 4C6IA 1TWSA 4DF0A 2P76A 1DJWA 3GNPA 4R53A 1YXDA 4GXMA 2TPSA 1UWIA 3YPIA 3H2NA 1AQHA 4I8DA 1KC7A 2VZOA 3AWOA 3C2FA 3EX3A 1H51A 3W7EA 3M1ZA 5T9BG 1QOPA 2VR5A 1UJQA 4OVXA 3S9ZA 5C9UA 3AIBA 2WOQA 1VBRA 4YL2A 2WSPA 1H7OA 3RX2A 2G41A 2VEFA 2XGIA 5HNUA 1PKYA 2PWDA 4FNRA 3NPXA 3WUGA 3F1QA 1Q65A 3CMJA 3QTGA 4PCFA 3MMUA 1WYIA 4UFLA 1A47A 3R8RA 2ZUUA 1HG3A 1AL7A 3GNXA 1WUFA 4LH8A 4LS1A 5H8MA 4G1NA 2YB1A 1ADSA 1DQXA 4UWMA 4K68A 3TJIA 2D2OA 3W37A 3AMLA 1Z44A 3KLLA 4S3FA 3ANVA 3EWXA 5I03A 1L6WA 4O8RA 2H8XA 3SRKA 1BEUA 2A3BA 4A6GA 3EA2A 3ISIX 3KWSA 2PAJA 4Q4RA 1KR0A 4E2VA 3TR2A 1G4PA 3CWHA 2HE5A 3QQ1A 2RKXA 1WDSA 1QPOA 2PS2A 1K02A 4IIBA 4IJRA 2J88A 3LB0A 4NNAA 3ZJ6A 3DKLA 3VIFA 2JKAA 2WLZA 2AQWA 2AQOA 4KMQA 4JDBA 2NSXA 4DJDC 5FF7A 4C1LA 4HSNA 3BUVA 3GBDA 4JTJA 2D3NA 5DBTA 1XYLA 3M6DA 3G77A 2ANUA 4RKAA 2H3DA 2J9YA 4Z1YA 4GD0A 3C2VA 1M01A 4QQ3A 4Q4OA 2PDQA 4ZTXA 1DHPA 3EOEA 5F2GA 4ASTA 3J7HA 4ZVJA 4L6OA 4UTLA 3EPMA 2J8TA 2X1SA 2XVLA 5LGXA 3UCCA 1O12A 3K46A 4EE9A 3GU1A 1OFOA 4A29A 3DENA 5G1MA 3LLXA 2WZIA 5HUPA 1O95A 2RDWA 5F1UA 1TJ0A 4GMEA 2PLJA 2VZVA 4OT7A 3BDKA 1LM1A 5CSSA 4AYGA 4PMOA 3W73A 2PGWA 5DXYA 1GG1A 4JFSA 2WZEA 2DEPA 3O0FA 1BQCA 1YQ2A 4WY0A 1RXOB 3WELA 2HVOA 4OUIA 4HA0A 1YDOA 1EFZA 2ZX9A 3VKCA 3BICA 4JTAA 3I4KA 1SSGA 4ZB0A 1GZ1A 1ME9A 4G1KA 2BS9A 4HNOA 2BY2A 2OCZA 4WY0B 4F0MA 1R9XA 1KGXA 4GNJA 3PBGA 2NWRA 1HP4A 3AUOA 2XINA 2FMNA 5LNVA 3PZIA 1F9CA 1ZAJA 1EHAA 1E9LA 2CLEA 1WQ5A 2HS6A 4ZOBA 3WMCA 5BMXA 1JUKA 5DBUA 1XX1A 1V0MA 3CPRA 5A2BA 2NV1A 1X38A 1E4NA 4HT3A 4DXKA 4URIA 2JKEA 1J93A 3BE7A 3BG5A 4NVTA 4P7OA 2VFIA 4EPEC 1HJQA 3WFLA 3KVMA 3NTYA 5E0CA 4IXXA 4FB7A 3SAZA 3AYRA 3AZTA 4M80A 2I17A 1ZLPA 3JUGA 2Z29A 3W2KA 1VPXA 4GISA 3DERA 2CETA 1S39A 4MWAE 4Q33A 3UVIA 2VL4A 1Z32X 3AYTA 4IJCA 1U33A 2GUYA 2CXGA 3VU2A 1VFUA 5A6TC 1R7AA 3VZYA 3NQCA 4W8BA 1DJZA 3LHZA 3WDJA 4DUXA 1LORA 4AAJA 4QNWA 1PZ2A 4N9CA 1QVBA 4IPJA 4YVPA 5KSWA 3F7JA 4PC8A 4UMAA 1V7AA 2OMAA 1Q45A 2HDJA 5E93A 1I2NA 2ON3A 2VUYA 2XZ9A 1CWYA 4HYVA 3GH4A 1NQ6A 1H1YA 4AF0B 1OY0A 1S46A 2VURA 1GCYA 4POCA 2OZ0A 1YKWA 3EOUA 4YHGA 3ZM8A 4Z1CA 4QCFA 1UCWA 4S3BA 1IV8A 2E6YA 1JPKA 3T2OA 1ODUA 3WQ4A 1LF1A 1JRCA 4JQ2A 2NQ9A 5A8QA 1BRLA 4HMCA 3W70A 1I1WA 4L1GA 1AODA 2WC4A 3LERA 3APYA 2AQVA 2VQUA 3VMNA 1H1NA 4GZJA 1UZ1A 3A4XA 4LU0A 3S2MA 1NEYA 1BRLB 1CLVA 3SR7A 4DJFA 2ZE3A 3CH0A 1Z48A 4QP0A 3NPWA 3CV7A 1TUXA 4IPPA 3KHDA 1VYPX 5KZDA 3S2NA 1UOZA 2CNCA 4HOXA 3B8VA 4AVNA 3AIEA 3WF0A 2NX9A 4WDUA 4BZYA 3TYUA 2OEKA 4JIIX 4HU0A 1XLEA 2E9BA 2P5NA 2V3EA 3W7OA 4G9PA 2R6OA 3M6YA 4LFYA 3EX4A 5FJJA 3WBXA 1K9TA 3EDDA 2HRWA 3UVAA 3GQYA 4UOZA 2VDHA 2YZ5A 3LI1A 1CGVA 3U6WA 3AMDA 4OBRA 3FS2A 4KWOA 3SFKA 1E55A 3TP4A 1KO0A 4CNPA 3TTYA 3CL6A 5A69A 3KVKA 4E2DA 3LBMA 1XIBA 1VKFA 4BI7A 4WY0F 3CPUA 4TVUA 2WZHA 3VK5A 1H7PA 2TRSA 4KCVA 1XSKA 1QU4A 1CXIA 1XI3A 2D2HA 5HAOA 1OC7A 5FIPA 5FEZA 2OT0A 1NWUA 4PUNA 2DZPA 1K6AA 3IJIA 2OTDA 3O2LA 3NO3A 3BCFA 3BL3A 3M9YA 1QATA 3VIPA 1JXJA 2VX4A 4FHAA 2XYLA 4QS5A 1SO5A 6XIAA 3VCRA 1M3UA 4WF7A 4OJYA 1PKLA 3GXNA 4IMEA 4J27A 3TC3A 2WNZA 5EYWA 3GNDA 4BWLA 3TJLA 2WSQA 3HO8A 4FX8A 4DO5A 4HU3A 3AHTA 2VEGA 1P43A 1Z42A 3NQ8A 3PB0A 3WQOA 1UPMB 5EFDA 1NP0A 1E15A 3VOHA 3W26A 4KEMA 4QEHA 3NO1A 3BWWA 2ZRVA 4XD4A 4S3CA 4QLKA 1ZU8A 2BTMA 2DZBA 4HNNA 1H7NA 3NOEA 2BHUA 2FLIA 1F5ZA 2WQPA 3VZXA 4ZXOA 3WD4A 4LC6A 1E5NA 1S2VA 4BFAA 1KM1A 1UC4A 5IFPA 1FWDC 3XINA 4JY8A 2FMOA 1AMYA 4K8EA 1TR1A 4MB4A 2QCFA 1IGWA 2ISSA 4GNKB 1REQA 3DU0A 1US2A 3I7SA 3WQ5A 3QSRA 2BMBA 1W8GA 4CNNA 2QDHA 2Y70A 5RUBA 4L61A 3N25A 4DNHA 3GSMA 2D2GA 5SWUA 4PUUA 2Y5JA 4HYWA 2ZTKA 1REQB 1DV7A 3DXIA 2OO0A 5D9NA 4M24A 3ZR5A 9RUBA 1JZ3A 1TA3A 4IWWA 2Y63A 3FSUA 1IEXA 3AALA 5LNSA 2QDEA 4GJ1A 4ZFMA 1ALDA 3RR4A 1YPXA 3L21A 4PTXA 4US5D 4D6JA 1TA3B 2TODA 3RU6A 3FAXA 1SJBA 4EF8A 3N4AA 1H0IA 1E43A 4WJ8A 4F79A 1YADA 2QJJA 1AH3A 2GVJA 3LQLA 3ITGA 4GACA 1KBBA 4IQEA 1DWFM 5K9DA 1PZ0A 1FOBA 3SUTA 3DFHA 5EBAA 5BWAA 1LBFA 1TFVA 3VMOA 1PBGA 1RAKA 4HTBA 4UFJA 1WKYA 2Z6IA 2ZXBA 1CDGA 2RUSA 3K1DA 1CENA 1DORA 1U22A 3C4UA 5DFAA 3N6HA 3KBWA 1EGVA 2WK2A 1UWUA 4B15A 1A53A 2Q8XA 1V77A 2GK1B 1ADDA 3AU2A 1UC5A 4N6FA 1WXZA 3NNTA 2QUMA 2V5DA 4U5IA 1V08A 4C6KA 2WMGA 3UPWA 4HCDA 2Y61A 2PTXA 3SECA 3IVUA 5C2CA 4PR4A 1FHDA 3N6JA 2XDFA 5HQEA 3D5HA 4HSHA 3RPDA 3OHMB 3RCNA 2BGQA 3SB0A 3CIWA 5F4XA 3TFCA 4MKNA 3MU7A 3DX5A 1TVNA 3WLTA 4LBSA 3IAPA 1CGWA 4GX9A 3T2PA 4ZSTA 2NVDA 1O94A 5CZSA 2XVPA 5GNZA 3SW6A 1E70M 5DMMA 3VC5A 1RZMA 3AAMA 1EX5A 2PLMA 1RY0A 4U10A 4BS0A 1PO9A 3WJSA 3IGHX 2SFPA 5FA5A 2DV0A 1SJAA 1LJYA 2C1GA 3R0DA 2D3LA 4O19A 3DN5A 4LF2A 3B0XA 1GQJA 4QNEA 1H49A 3KS6A 1TJRA 5CSRA 4GPNA 1CNVA 4ECLA 3ABXA 4S3GA 2VYOA 4AISA 3T09A 2VQTA 3UZYA 1D3HA 3U3HA 4NU7A 1OHLA 5T26A 2XFRA 4L5ZA 1GOOA 1KCKA 5A3HA 1QAPA 4U31A 4KF1A 1OB0A 4FX7A 4XX6A 4U5KA 1KBIA 4C60A 2CBIA 3UU0A 2YR1A 1J01A 4YVXA 1XISA 2BLEA 1MNSA 1LWJA 5D4YA 2DDXA 5CKSA 3D47A 4F0LA 1GOKA 4TO8A 2XIBA 4GVHA 1XLAA 3G1XA 4TQTA 2EPLX 1ZAIA 1CGTA 4R9XA 5HQLA 4KEZA 1EBHA 2FPYA 4E3VA 3UA3A 2ZX5A 2Q71A 4HNVA 3G1DA 2HNEA 4QQUA 4MWAD 2BNJA 1H63A 3I4EA 1WCGA 4WIWA 4DJDD 3GW0A 3FEMA 1DXIA 2NZLA 4EXQA 3NXLA 1TELA 3MMWA 2J24A 5JMUA 3DFQA 4LWWA 3LXCA 4IXHA 3UNDA 3FW6A 3SGZA 4NSBA 2O92A 1K9FA 1E0WA 4AWUA 2PDPA 4DAFA 3W1NA 4CD8A 1RSCA 2EPHA 5JIPA 3W2MA 2VEIA 1DIDA 3GC4A 2ZZ2A 4M8UA 4W87A 3RM4A 2D20A 1ZCCA 1CXKA 5C2GA 3TN3A 1XPGA 2O55A 2DORA 3R2GA 1DQWA 2VRJA 3OGVA 2VVSA 1H62A 1W31A 3QV7A 3LHUA 3RLHA 4QJ4B 3UR2A 2X7VA 4UTIA 4ENLA 1OX5A 3II1A 4X0VA 1DWHM 4IQJA 4GVIA 5HANA 3ZVHA 4W5UA 2E9LA 3KZPA 4S38A 3N9KA 3GDRA 1HO4A 2DSKA 5FJIA 1B9BA 1I2QA 5LIKX 4YCPA 3WLIA 4C91A 4BI6A 3ZVHB 2FVLA 4JIEA 5A6SA 2V0TA 2F6KA 5CBJA 5CC6A 1YTEA 3SRDA 4UTWA 4E5TA 3DFTA 3PZOA 5ABHA 2J9ZA 3T42A 1NQKA 4RR4A 3QY6A 3UYCA 4LVGA 1VIWA 3Q94A 3ENLA 3IJ8A 4KS0A 3FN9A 1CB2A 2B0MA 3H24A 4PSRA 3CMFA 5LIUX 3EWWA 2C71A 2XISA 4JD4A 4LEQA 4I7VA 3T0TA 3W07A 3TYCA 1IEIA 4DRSA 4NXSA 3RPMA 3T78A 1JF5A 1KM2A 3P6LA 2PA6A 4WSHA 3G1VA 3MHGA 1F3XA 2GGGA 4H7CA 1PZ3A 1JI2A 2A21A 1B4KA 2IXVA 2YCLA 5CBBA 1TJPA 3IAQA 4KERA 1W0MA 1J6PA 4GH3A 4GI6A 1BF2A 1U30A 3O07A 1NFGA 4HPXA 4QJ1A 3DECA 2PLKA 1WZAA 4EAYA 4LW7A 4DN1A 2YCLB 1A0CA 4MKSA 2Y62A 3G0UA 3C0LA 1M7OA 1VHCA 2YXXA 1V02A 2XWDA 4K6AA 3DYOA 4LVDA 1JIBA 4K7YA 5FF0A 3V16A 1PWMA 4O57A 2EG6A 3LEPA 2V63A 2DZTA 1G9HA 4Z2HA 1M03A 3W7NA 3FEQA 4I6VA 3S1XA 3V18A 4HZ8A 3EPNA 4UQAA 3GTXA 1E1EA 3BOLA 3VNKA 1HGWA 2A6NA 4XB3A 2ONEA 4LGXA 2E40A 4OECA 2VP8A 3P93A 4F0KA 1UA7A 2NV2A 1QPNA 3W24A 4CU7A 2HQAA 3N15A 3IJDA 2OYLA 1BSIA 3SBFA 3U48A 4HNLA 3CHCA 5CPLA 3CZKA 3P3BA 3NQ6A 4O1EA 1B4EA 2Z25A 5I07A 5BU6A 4L80A 2JK2A 4BF5A 2ADAA 1G01A 4L1XA 3PNUA 2E8ZA 4JTCA 4I3GA 3EB2A 4O13A 3G8RA 3DHPA 2YA2A 1JG9A 3CK5A 1AW1A 2ACQA 4KWWA 3TV8A 3M07A 2VFGA 4D8ZA 2W9MA 3GW3A 4Z17A 2B7OA 1HL8A 3E49A 4GVFA 4C6BA 4BQ4A 4Y96A 5AZ0A 1GHSA 2HSAA 3GNOA 1OX6A 3WH9A 3KP1A 2ZXQA 4NI8A 5K7JA 3PZTA 4J3ZA 3THCA 3WEMA 1N8IA 3KTXA 4GUJA 4IICA 1VCGA 3OJGA 3TYBA 3WQVA 2YXGA 4GY1A 3T1GA 3H2FA 2R1MA 4LJ3A 2ZX7A 2ABBA 3O6CA 5U7SA 3G0XA 3RN6A 3AOFA 2PF0A 1W5QA 2A1YA 4B4HA 1ZB5A 4GXWA 2YIHA 1F2JA 3A4WA 3TKFA 3WH6A 3GWQA 3WF1A 2CLFA 4DYEA 1J10A 5C71A 3N9SA 5FI8A 4U4MA 4DWSD 1VJZA 1XCXA 2VDIA 5EKYA 2G37A 1MW3A 3VGGA 2AL2A 1CYGA 2VEPA 4MIMA 3AQUA 5D2XA 1KLYA 2ZIDA 4JN7A 3A22A 3W2UA 4HJFA 3S47A 4MYAA 4WUIA 4ZXLA 5T91A 4Q4QA 1PHQA 1IE7C 1FH9A 4AG0A 1B3YA 3WQ8A 1JRBA 3M0HA 5D02A 2OWXA 4Y7EA 2PP1A 5HK4A 1FFRA 4WEVX 5HNRA 3A13A 3O6YX 3LRKA 2Y7EA 3LZ5A 3V5FA 1KM4A 1WAUA 3LN3A 3MI2A 1QHZA 3VC6A 1IWPA 5C9XA 5HWJA 3WNPA 3T9PA 1Q6FA 3CQKA 1RUSA 3T44A 4GC3A 4Q7IA 2OYMA 1NU5A 4OQVA 5ABTA 4AY7A 3D6NA 2ACUA 2WM1A 1JYXA 4D1IA 4MB3A 1EPXA 2QCMA 3WBEA 4IG2A 4AIOA 2WM0A 3MA8A 2E67A 1AVAA 3ERPA 3S1VA 2UZ9A 3QYQA 2DH2A 1Q6LA 1W9XA 2XFFA 1XLIA 3B04A 3B9EA 3QFEA 1P6CA 2ZZ5A 4R7JA 1A4LA 3KBJA 5M2FX 4U2YA 3PBUA 2F8QA 4GJIA 3M0YA 1TREA 4IMCA 3L0GA 3SSJA 2YDQA 3LTSA 4HMEA 1XYFA 2Z2UA 4ZEPA 1JAEA 1I8JA 4QDPA 4AVOA 1UOKA 4KBXA 1WOBA 3ZLHA 4ADTA 1E4LA 2NUYA 2BOGX 2BSLA 3HOJA 4A2SA 3BLKA 4NJIA 4AC1X 2D1ZA 3SCNA 3H4GA 5A8GA 2G3JA 2PGEA 1TG7A 2VELA 5LSMA 1DE6A 3LTYA 1S2WA 3RHGA 1RQHA 1Z3NA 2X1RA 2CCRA 2WPGA 3H2EA 3WD0A 2OEJA 3W7GA 3LU2A 4Q8OA 3QZ6A 4N0RA 1L6GA 3AJ7A 4GG9A 4B5VA 5FAJA 1XCFA 3FHAA 1ML1A 1PHWA 2X30A 4WLCA 4B5WA 1O5XA 3RO8A 4FXFA 3BLEA 3WNNA 1JZ8A 3VO0A 2W6RA 4RZ4A 3W85A 1NOFA 2XHYA 4R9OA 1QI2A 4BF7A 4I6KA 2P8BA 2IXUA 4LY4A 3LHTA 3AHZA 2J7DA 3IUDA 4XVEA 3PBVA 3MV11 1BYAA 4JY9A 4ZQNA 4A2RA 1A5UA 4I90A 2WBKA 2FZ9A 1WA3A 1GOIA 4ACZA 3ES7A 3TTEA 3W84A 4ZQCA 1J9YA 4JKKA 2FTPA 4NAFB 3BMXA 3L12A 1YX1A 3MKKA 1Q8AA 1S2TA 4C6CA 2F61A 3ZWSA 2HWGA 3UXKA 1BVNP 5JUVA 3SY5A 5D9OA 1NFBA 3VKJA 1ISZA 1WZMA 4Z0JA 2GUBA 2X40A 5EMKA 2P0OA 5FL1A 3PUGA 4UXDA 4R7OA 1RCOB 5DRCA 1PKMA 3W6MA 1H1ZA 3MT1A 4JIQA 4UQEA 4TTGA 1FUYA 1X97A 1UHVA 3FGCA 2EG8A 1MXSA 5BNKA 8XIAA 4UQBA 3PWAA 2XIMA 2X1IA 4O1AA 3MY9A 3ZWTA 3BAIA 4J3UA 1DJXA 3R79A 2ZOXA 3FGCB 5DANA 1AQFA 1QMLA 1GW9A 4IFOA 4BQ5A 1QWKA 1EJSC 5AHLA 4TXEA 2UWFA 2YA0A 3ZT7A 3ZT6A 1PTGA 1A80A 4GA8A 3TMLA 4WD0A 4V2XA 1J8VA 3MUCA 4IFRA 4QE4A 2ALDA 4FNSA 4GIYA 1VS1A 3CYVA 1MQRA 4CNUA 4D71A 3LXAA 3VD4A 4JTDA 3AI0A 1GWJA 1SFTA 3K5XA 2JFEX 4DPQA 5E5CA 3JZEA 5DY3A 3IJ6A 3H6OA 1PX8A 3EKGA 1SVDA 1MMFA 1O5RA 1OF8A 3DGBA 3QRHA 2X2YA 4MNJA 3W25A 4RNIA 1E6ZA 2INFA 3PP7A 2DQWA 1LL7A 4K38A 4W7UA 3SCUA 3OA3A 2XJ7A 1IEWA 5B7YA 1BXNA 2FFIA 4MDPA 4KWUA 2CZVA 1LOLA 2I7GA 3BAWA 4FEZA 5ECVA 1E40A 1O7AA 4UNLA 2XH2A 3NZPA 4XAYA 2QUUA 2JEPA 1H5YA 1RA5A 2Z1VA 3RX4A 2DJLA 4ZTYA 3SADA 3P61A 1BPLB 3WH7A 1EEPA 4NYYA 4KIEA 2QVNA 3RRAA 1YXCA 4AZGA 2OSYA 1J6OA 1EJXC 4F4RA 3ITYA 1B2YA 1EP2A 5DCEA 4FSAA 1EJTC 3I3EA 1FFQA 4CU8A 3PR2A 4MADA 2XWEA 2ZCGA 3KCOA 2XPKA 3WD2A 4Q8UA 4Y9NA 3NSMA 2XIIA 3OZYA 4MJMA 2XN2A 2EBNA 1F3TA 3R10A 3IGSA 2QCNA 3A12A 3SSZA 4E2BA 4NUWA 1TSIA 2JF6A 2TSYA 2QCDA 5DMYA 1OFEA 4GABA 3S9IA 3QPZA 1VYRA 5K4ZA 1DWIM 4DWDA 1GT8A 2OSWA 4MNKA 2PBOA 5A8PA 4HYRA 3BTNA 2QJMA 1Z6KA 1MNZA 2BVDA 3LYEA 1GQKA 2QCDB 3LHYA 1RCXB 2OXNA 3GFXA 1UH4A 1GTEA 2R94A 1EO7A 1HFBA 3RXZA 4HIBA 4UNIA 2CPUA 1BTMA 4AEOA 4PMJA 3PZVA 2JF7A 2P1FA 3L4TA 4J9JA 1QOQA 3MCNA 1JCJA 1KBKA 4KRTA 1XD0A 3BOXA 5AKQA 4FNPA 4UQDA 2EAWA 2ZZ1A 3W7IA 1LYXA 5J5RA 4DM1A 4JAWA 5L9FA 2GJXB 1VFLA 2G96A 3AXXA 3GYCA 1RHCA 1V5XA 2BASA 1VZWA 1PKNA 1FTXA 3CHEA 4K8HA 1DJHA 3KP0A 3ZOAA 1TPUA 5H6HA 5I3KA 1DBTA 1GYMA 2HNHA 3NL3A 3AZRA 4C6LA 3LXBA 3W7KA 3WBYA 1EXBA 4FOKA 2XFWA 3HJZA 5DX7A 4X9SA 4YTSA 1HW6A 4GCAA 4LT9A 1AQ0A 2YXOA 3UP8A 4GBDA 3V0TA 2JE8A 3U4FA 4GWEA 4J3TA 2W63A 1HGYA 2BXZA 1F4HA 2CHOA 2FPTA 4IOTA 5LYRA 2BHZA 4YMZA 2QDGA 3C3UA 4YNGA 3EDJA 1DOSA 3CIXA 2W5FA 2DT3A 3VNLA 3TN6A 3TJXA 1GVFA 2X8RA 1MUMA 3VIOA 2F6XA 3EA1A 3CB3A 2C7FA 1UR9A 1AZ1A 1UD6A 1FKXA 3A64A 1FH8A 4ZSUA 3WY1A 1YPFA 3PFMA 4QJ3B 4AMAA 4PB5A 1A0EA 5CGMA 3RK8A 4FZIA 5C55A 2VFEA 4O4VA 2PODA 3VDCA 4K3ZA 1GONA 5AC6A 3GH5A 1A50A 1FWGC 4J2PA 4QCEA 1G7VA 1QI0A 2EXOA 1WAWA 3IPWA 1EOMA 3MB9A 1K7FA 1KGWA 4Z08A 4DF1A 1XIDA 4PEKA 2Z7KA 5PTDA 4E4UA 3G22A 1MQQA 3VYLA 1XBYA 2PFHA 1HZYA 4GXPA 3U8GA 1QOXA 3G3MA 3KAOA 2PZ0A 1F76A 2ZQ0A 3AZSA 1EC9A 3UD6A 1OEPA 1PB0A 2ZYFA 3N04A 4FLQA 2RHGA 1L6SA 2NUWA 2GQ9A 2Q02A 2J6VA 3BANA 1B3OA 3G1FA 4PRWA 1OD8A 1KD0A 3MANA 3ME3A 1F3EA 4JTSA 1WBHA 1K1DA 1P0NA 5F1VA 2QMKA 2FGBA 4O53A 2B4GA 3TQ0A 4AZCB 1VCFA 1V79A 3S42A 3M5VA 5I6SA 3QJAA 1V6YA 4TX8A 2WBGA 2Q3RA 3MO7A 2F2HA 4QIUA 3ATYA 5HMSA 4EXBA 1W5MA 3H22A 3VNMA 3O9NA 1VEPA 2Y2WA 3GFZA 3TAOA 3MDWA 4CCCA 3O06A 4B90A 4OFCA 3NVTA 4HD5A 3TYDA 3HQNA 3LTPA 4IP5A 1EJ7L 2JIWA 5C9ZA 1B3ZA 1RVKA 4Q6JA 1VP5A 2QLYA 3HTWA 3PF3A 4Z2GA 4ACYA 1V4YA 1NDZA 2VJXA 2BXYA 5AZ1A 4NKCA 4EOUA 2UY5A 4DUVA 3WJWA 2R14A 3WEZA 4I5XA 2BP1A 4O1CA 1H7WA 1GOXA 3PJWA 2G3MA 2Y6ZA 3GG0A 4FOJA 4YN5A 3WL1A 5FEXA 3W7LA 3O7UA 3E96A 3RO6A 1CXEA 1K8ZA 4UTHA 3SCSA 3I7RA 5D05A 5TD4A 3KLKA 2QQ6A 3OBEA 3E12A 1F73A 4FX6M 2D0GA 1WZLA 3M0XA 3C52A 1HT6A 1TRIA 1ITXA 5HDRA 5FSDC 3W00A 3DG7A 4Y6GA 1SR0A 1XBVA 1PWLA 3EXSA 1A5SA 3WF4A 5AYBA 2V69A 1MFUA 3EKLA 3WD1A 3KDOA 3QFWA 1WDPA 1W54A 3F4NA 2DPEA 2I57A 3B9DA 5HULA 3ZJKA 4DZIA 1W1VA 3CM4A 4WSJA 3V0UA 4IMGA 2Y4SA