1UB3A

Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
211
structure length
211
Chain Sequence
b'DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldolase protein
publication title Structure of aldolase from Thermus thermophilus HB8 showing the contribution of oligomeric state to thermostability.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 85
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ub3A00
3NZRA 2DU2A 2Y63A 7TIMA 3F1QA 4IQLA 4WD0A 1UCWA 4DELA 2FB3A 1W5PA 2NX3A 1ZCOA 4CQ8A 2XN1A 5HR6A 1R2RA 1YPFA 3DHDA 3M1ZA 3D0CA 3MP4A 3NQAA 4O18A 2DZVA 3FYPA 1EUNA 4BK9A 1SO3A 1YDOA 4K36A 1GJPA 1F6KA 2YYUA 3UPWA 5FESA 3GKAA 4MLJA 3BG5A 3NQMA 3S6DA 1ZAHA 2OT0A 1Z48A 2KZHA 3QPYA 2EPHA 5G2HA 4LVGA 4O0ZA 1AL7A 3QPZA 4N6EA 4YWIA 2FFCA 1SSGA 1C29A 3UPBA 1FCQA 3B0VC 4JICA 1ICSA 3W7DA 4Y90A 3WJWA 3DAQA 4J9JA 1DHPA 4N9EA 1XBXA 4HSOA 3ZS4A 5AFDA 2E5CA 1LYXA 1OK4A 1ZALA 3TROA 1O5KA 3C8FA 4WQ6A 3PBYA 3P62A 1TMHA 4M7TA 5G2IA 1F7BA 2PE4A 3W7JA 3EWUA 1YXCA 3Q94A 3EWZA 4LV4A 3OIXA 1KM1A 4UR7A 3NL3A 1TPUA 4TIMA 1GWJA 2FQIA 1TB3A 4NZFA 3B0PA 3CWNA 5J5DA 2ISSA 1MEIA 2QCFA 3GDTA 5FF3A 3C52A 4ORIA 3G1SA 3GAYA 4AXKA 5J5RA 2AGKA 2DORA 3P61A 3PR2A 4ADUA 3NDOA 5F1VA 1O4UA 5U7SA 3QQ1A 4ADTA 2EF9A 3NPWA 4BI6A 4M6VA 3P8IA 3OBKA 1TPDA 1L2UA 1SSDA 3DENA 4PL1A 4TX9A 3BO9A 4PC8A 1Q6RA 4OQVA 5CPOA 3MYPA 3MHGA 2J27A 2LLEA 4PEKA 3W71A 1DVJA 1TJRA 2TPSA 2CLKA 4KFPA 4MFDA 1RD5A 4PFMA 1KFCA 3EEGA 1N7KA 3EXRA 1GZGA 2PC4A 3USBA 1JQVA 1SUXA 1B4KA 2DZTA 2ZZ6A 4ICNA 1XUZA 3A24A 3NQ6A 3SY5A 1OFAA 1KFLA 2ZFAA 2QR6A 1EA0A 3S5NA 3L5LA 2V81A 1H62A 4X22A 4MZ1A 5CPLA 4AWSA 3TXVA 1ZFJA 3G1DA 2I1OA 3ATZA 1A5SA 2J9XA 4QSHA 5FF2A 3AO0A 1SO5A 2B7QA 3GAKA 5BNKA 1H51A 4LTSA 1K8ZA 4Z08A 4DPQA 3BGGA 2P0OA 1K8YA 3W7MA 3WJZA 4PL2A 1A50A 3ABQA 3LCIA 1F74A 1S3HA 5CPNA 2QCHA 4N9CA 1X6UA 4ZMGA 3MUXA 4UXDA 3STGA 4XTIA 1TO3A 1LLWA 2X1TA 3BVJA 1IXQA 4JYDA 1GPWA 1LRTA 5CZJA 4FF7A 4JTGA 3L2IA 4OV9A 3HF3A 3GNNA 1GEQA 1R47A 3ZWSA 4FNQA 2GQ9A 3HIJA 2TMDA 3KX6A 4GFSA 1N8FA 4UFHA 4EF8A 4UTTA 3QW3A 4K6AA 1YXYA 3DHFA 3KRSA 3G0XA 4JYFA 3MBFA 1LDCA 3IVSA 3M7WA 5LGZA 3P5YA 3S5ZA 3S1WA 3LB0A 3DFPA 4HSNA 3UYCA 5HUOA 2R14A 1D9EA 4HT3A 4A2SA 4A22A 4FB7A 4XWUA 2GQAA 3KOFA 4RLIA 3W1MA 5AYZA 1EUAA 4P61A 4GWEA 4UTTC 1S5TA 3S8HA 2CZEA 3M5ZA 1PHWA 3TSDA 3MWAA 4NT0A 3OVQA 3PG8A 1QR7A 1VYPX 1OX5A 2CLHA 1W8SA 3N34A 5FF7A 3FS2A 1XFBA 3QSTA 2PRMA 2QDHA 1FCBA 4LU0A 1VQTA 3NG3A 2VEIA 3QQ0A 5FEZA 2Y88A 4AHOA 3P7YA 4JY8A 3EXTA 2QCLA 4R33A 4Y96A 4ZQMA 5KITA 2Q8LA 2QEZA 2OZ0A 4DF0A 1K3UA 4IPJA 3LCXA 3A21A 1QO5A 4FNRA 1J5TA 5FEWA 1UB3A 3W07A 3N3MA 3GYEA 1EP1A 5D37A 2JBMA 3PVFA 3S42A 4YLWA 3S0CA 3L0NA 1F76A 4AAJA 5F2MA 2J24A 2OMAA 3W7OA 3C2RA 3DFTA 3EWYA 3N73A 3QEZA 1OFBA 3EWBX 4QQ3A 5FF4A 3W7RA 4DO4A 4W9TA 1HUVA 1KM2A 3THQA 4FIRA 1KM6A 1ZY9A 5LNVA 4KKXA 4JYEA 5EBUA 4N4PA 1ME7A 2QCMA 4M6QA 5K9DA 3QMSA 1OFEA 1FDJA 3DFSA 3SJ3A 3TQKA 3I68A 3SFKA 5G4EA 2NWSA 4BI7A 2F84A 6TIMA 3FA5A 2ATSA 5C54A 3HMJG 2WSQA 3I65A 5D2TA 4PCFA 1DORA 1FWRA 1HL2A 5DCEA 2Q3RA 4JTLA 2VFEA 2Z6IA 1HTIA 1YTEA 3PBUA 1QPQA 2GPTA 3W1UA 4NNAA 3IGUA 3JS3A 1QO2A 2ZRVA 3VE7A 4FEZA 1W37A 3IVTA 4MZYA 2VOMA 3OG3A 2Z6JA 2G96A 1VZWA 1LORA 5A5WA 2W0UA 1J4EA 4KWVA 4MZ8A 1NF0A 3CEPA 1K8XA 4GRSA 2C6QA 5CG7A 1TPC1 1W5MA 3NM3A 4DO6A 2A85A 3E96A 4UMAA 4UTJA 3MHFA 3ABRA 1LBFA 1PE1A 1TTPA 2H90A 2GVGA 2ZRWA 4MKNA 1OFQA 2DZPA 3IVUA 4LOCA 4NZJA 3BW2A 3F4WA 3KRUA 4A21A 5KZDA 2WOQA 8TIMA 1ZAJA 5I3HA 4AVFA 1JR1A 4QISA 3GXNA 2Y89A 3H55A 2YW4A 1LOSA 3NEVA 3LHVA 3NQEA 3W1QA 3P5ZA 5HR7A 3EXSA 1RV8A 3MW7A 2BWGA 3LERA 2WSRA 3DFQA 5ABTA 1G4PA 3DI1A 1YPIA 3PC0A 5D38A 1RQBA 3HQ1A 3GVGA 2YX0A 4JN6A 4MY1A 4LVDA 3MI6A 3W1RA 3T4CA 5LNSA 4HPJA 3W7NA 1WOAA 5DN1A 4QITA 5DLCA 1JCYA 3RK8A 4AF0A 1VLIA 3R2GA 6ALDA 3NOEA 3NNTA 2YYTA 3EX6A 2A6LA 5E93A 5D04C 3G1XA 3IIVA 4LY8A 3NPXA 3HG3A 4O14A 4PA8A 1EWDA 3W74A 4IXHA 1EX5A 4LV9A 1QPOA 2A7RA 4IWWA 1S5VA 4RKAA 4GE8A 4UFLA 4FIQA 4UMBA 3W23A 1KFJA 1OYAA 3IIXA 3HOJA 3PULA 1W3IA 1DJQA 3G3DA 3GDRA 2GJNA 5LNRA 2ZBTA 3KFTA 3W1PA 1FCUA 5I3KA 3TIMA 4CLMA 4FNTA 2QCDA 5G2WA 3GKFA 1TREA 1FQ0A 1XL9A 3MMTA 1U5JA 3N2MA 4LVFA 1OFDA 3W7HA 1AW1A 1P0NA 1IF2A 1MEHA 1SZEA 2ZRUA 3IGSA 2TRSA 4JTKA 3P67A 2A5HA 2RHGA 4GUGA 4XZ9A 3O05A 3TXZA 2OX1A 4NU7A 2H8XA 4X9SA 2FDSA 4XBSA 3UWQA 2YFOA 3TKFA 1RQHA 2VFIA 1O94A 3GLCA 4Y6GA 1ADOA 4KFNA 1AW5A 4FX7A 1KTBA 3HGOA 1KFKA 1SQ7A 3IV3A 3NQDA 4RV8A 5AC6A 4C1LA 3FLUA 3GXPA 2BZNA 1KBIA 4N6FA 2ZRXA 4LUJA 5MHBA 3LCLA 4B5NA 4AF0B 2V2CA 4LC8A 2ZQ0A 1KM3A 3W2NA 3W72A 2Z1BA 2CLOA 2V82A 4OU1A 1I2NA 4AH7A 2HTMA 4WY0B 3O1NA 1L9WA 1GYLA 5F4SA 4FO4A 5CZ0A 2J88A 2V2DA 4WUIA 1NAL1 4NVTA 3BLFA 3NQ7A 5D03A 3T40A 4QIUA 3E49A 2A6NA 2ABAA 1A5CA 3RU6A 3QSRA 1WX0A 4K7VA 2ZZ3A 1MXSA 2ALDA 3M16A 3VI2A 2HS8A 1GVRA 3LHYA 4ALDA 5I3JA 5LGXA 1FWSA 1P0KA 3LCHA 3W9ZA 4EF9A 3LGEA 2YXGA 3UZJA 1Q45A 2QCDB 1TPWA 1HO1A 1ZJIA 5L9FA 1VC4A 3HPZA 1T8XA 3L0GA 2J9ZA 1O60A 1X1OA 3W7GA 2CZFA 3NO5A 3BARA 3R8RA 4MUZA 1IGSA 4XBKA 1FCVA 1LM1A 3PM6A 3W2JA 1GVQA 1FWTA 3L0KA 3OVPA 5DBUA 1SW0A 3QC3A 3NXFA 1JCLA 2NX1A 3LRMA 3LTPA 4M7SA 3NL2A 1IXPA 2NV1A 4XKYB 3FYOA 2CZDA 1QPNA 4N02A 1NSJA 2C16A 1OFOA 4IGHA 2DJXA 5E1QA 3T7VA 1FXQA 2PCQA 1RZMA 3CM4A 1LOQA 3TC7A 1I45A 4ORMA 4NJJA 1LRNA 3CLMA 4N2YA 4LVAA 3DH7A 4JGDA 4OGZA 5HQEA 2R94A 3G1FA 4S1FA 4RZ5A 3T55A 1RPXA 2VENA 3UWYA 4M6PA 4AEOA 3GZ3A 3TE9A 3AJXA 2NXGA 3SI9A 5C6MA 4WY0F 1TPH1 1B4EA 4K8EA 3DKJA 4DBEA 1GVSA 5D32A 2QUTA 2Q3OA 1YYAA 1TJPA 1LBMA 2E6YA 2TSYA 2BTMA 4R34A 3PUDA 4LNYA 2VFFA 1V7YA 5C5YA 3W2UA 1EEPA 3TX9A 3W1NA 5TQLA 4Y8FA 2V0TA 1QOPA 5A8GA 5LHEA 2H6RA 3LCFA 1QDSA 3LOTA 5G4WA 2OJPA 4Q4KA 1JCXA 3QF0A 1QMLA 3R5EA 2JKAA 3EX2A 3M47A 3C3NA 1FWWA 2CWNA 4QNEA 3W76A 1XDMA 2CLFA 3RLUA 4MIMA 3HG5A 3LHWA 4HNTA 3S9YA 4MY8A 1TPVA 4KFOA 1PIIA 3EKZA 1XXXA 4LWWA 1K7EA 2C15A 2OT1A 3NL5A 5K9CA 2YR1A 3QJAA 1OABA 2JKEA 2VFDA 3S5OA 2A21A 3W2MA 4L4MA 2EAWA 1FDYA 1AK5A 1H7RA 4JXCA 4XQ6A 1OVDA 1UASA 3QH2A 4JS3A 4Z1CA 3PG9A 3GDKA 3OHIA 4IMDA 1H7OA 5EKYA 2RDTA 2F7FA 3IGXA 1SW7A 3A5FA 1GT8A 1Y0EA 4O4VA 4UCGA 4JIPA 3L5MA 2O7SA 1F6PA 1Q6OA 3NZ1A 3SECA 4RXFA 1IIGA 2QUUA 3UY8A 3CHVA 2QCGA 2P1FA 2NUWA 4CQAA 3TFCA 4O16A 4Z0JA 2DZWA 4NQ1A 1I2OA 3F03K 5DY2A 3WJYA 1DQWA 1XM3A 4HNVA 3QRHA 1WDWA 1LBLA 2QAFA 3WK3A 2ZA1A 3ATYA 4TU1A 3O07A 3OVRA 3UWWA 5K4ZA 3HJZA 3N2XA 4N9DA 3TW7A 3W6YA 1LOLA 4UUIA 1XBVA 3SW6A 3FKRA 1M5WA 3G22A 2JGYA 2X1UA 3P82A 1W3TA 1PL9A 2WO5A 3DBPA 1FWNA 2A1YA 1VCGA 3KHJA 2E09A 3P81A 5D2VA 4LUIA 3TSMA 4L4LA 1TSIA 1SR9A 1KV8A 2YGYA 3Q58A 4K8HA 3W75A 4FNPA 3V1PA 5F4WA 2HS6A 1XBZA 3NYZA 1KBJA 4TO8A 5D2XA 3BG3A 3NPUA 1WBHA 2NUXA 3F4NA 1KW1A 5AYXA 1SFJA 1BTMA 2QJHA 2W6RA 4P2VA 5HWJA 1B3OA 1G4EA 1H60A 4A2RA 4RCXA 3CU2A 4BI5A 3THAA 5H91A 2JKPA 4YCPA 3L68A 1PHQA 4O12A 2CFFA 3TC6A 1XCFA 3W7CA 3U2OA 2BX7A 3W1TA 4O11A 1GOXA 4M19A 4K38A 4QM1A 2PURA 1QNVA 4O52A 3W7PA 5IM51 3TQVA 4HHPA 1M6JA 2ZTJA 3K30A 2C1HA 1M7OA 1T0OA 3OA3A 3KVKA 3GIYA 3UXAA 1W1ZA 3EB2A 3G0SA 2X1RA 3BGJA 1P1XA 5K3VA 4UTIA 1Q6LA 2DP3A 3V75A 1H1ZA 3B05A 3C2VA 1ALDA 2FTPA 5KMYA 5BOOA 3LBMA 3ZR4A 5TIMA 3W70A 1DQXA 3N19B 5HUPA 1CX9A 5BW6A 4O1CA 3PWAA 3W7KA 2Y61A 5AN7A 1K03A 4O53A 1A53A 4DXVA 1NEYA 3W1XA 1MEWA 5HWMA 2R8WA 4E2BA 4RXGA 2E68A 1ONRA 3G1YA 3MP5A 3O6YX 4JDBA 2DJLA 4GUIA 1VGAA 3O6DA 3BV4A 4Q32A 3TA6A 1YTKA 2Y6ZA 3KXQA 3A23A 3GR8A 1YXDA 3LXCA 4S2CA 2NUYA 2UV8G 1KLZA 1WAUA 3B03A 4RJEA 3GX9A 4UNLA 3WFAA 2AAMA 5F2GA 3UNDA 2RDUA 4AWUA 2QCNA 3C6CA 4LT9A 5HWNA 2QAPA 3IIPA 2FLIA 3FFSA 1N55A 4CCEA 3L9CA 3UXDA 2B0MA 2HMCA 2QCEA 5HINA 1H7WA 1C8VA 4S2BA 3WK2A 3RLVA 1GG1A 3HB9A 3O63A 3VNDA 2RH9A 4ZL1A 3PUEA 2Z0IA 3S5YA 1YDVA 2WNZA 1K02A 4CNNA 3VKJA 1ME9A 3E9AA 3SGZA 2XN2A 2BLEA 3VE9A 4UTUA 5F1UA 4Q33A 3PS7A 5DXXA 4MOZA 1R46A 3CC1A 1SU5A 3LI0A 4NNCA 3VFLA 1B9BA 1AMKA 3TMLA 3LXBA 3C4UA 2WNQA 3BLIA 4JIQA 2CLEA 5D09A 3LHUA 5CGQA 1G69A 3NR0A 1G7UA 3A5VA 4MY9A 3TAKA 4U28A 4JX6A 5BRBA 3T78A 2C0AA 3INPA 1OX4A 2V8ZA 1U83A 4Z1AA 1K7XA 4K7YA 2ZYFA 3DGRA 3R89A 1VH7A 5EPDA 5EA9A 1EP3A 1WQ5A 3B04A 1NFBA 3R12A 3ZWTA 4G1KA 3O8AA 4X3ZA 2J9YA 2ZZ4A 3MI3A 2E6FA 3C0JA 3LI1A 1VYRA 3CB8A 2NX9A 3IEBA 2E5DA 2IQTA 1NVMA 4TMCA 1K7FA 5CSSA 1IXOA 4FX6M 4JTSA 2NXIA 2VFHA 1F73A 1HFBA 1JQXA 4OT7A 5LZLA 3DFOA 3LLFA 5F4XA 1H7PA 5CKSA 2O7QA 2ZA3A 4HN4A 3LDVA 5CZSA 3UWZA 1OX6A 3TU9A 1SZFA 2X1SA 4LRTA 4UR8A 3TAOA 4MJMA 3G24A 4R53A 2A7PA 4CCDA 1PV8A 4TR9A 4QNWA 1G4SA 5D02A 3MHUA 3T44A 4NXSA 2YPIA 4I7VA 3L5AA 1ZNNA 3I6RA 2GJLA 1KV5A 1TV8A 3NL6A 4ONVA 1X7FA 1JRCA 5AHNA 4RZ4A 1KFEA 1LLZA 1JULA 4O1DA 1BKSA 4GXMA 4AMAA 4RX0A 2RFGA 2A4AA 3LTSA 1QWGA 3B4UA 2A2IA 4GJ1A 1OX4B 4UTLA 5F2LA 1TTJA 4ZQCA 3C2OA 5DCDA 1I2QA 2CLMA 3P84A 2VC6A 2XN0A 3MJYA 5AC8A 1TPFA 2E6DA 1XBYA 3NA8A 3LTYA 2BSLA 1TTQA 1Z42A 2JGQA 5CZTA 4WOZA 4AHPA 2G95A 1YADA 1ZHAA 2TYSA 1EPXA 3B06A 4UC5A 4BFAA 3ABSA 1O5XA 4NJKA 3SSJA 3NGJA 3UZ5A 3M41A 3P8JA 2YSWA 3BG9A 1G4TA 2E6AA 1BEUA 1WXJA 2ISWA 3S1UA 3L67A 4QAIA 1QFEA 4O8RA 1UBSA 2VXNA 4NX5A 4O1BA 4PH6A 5EY5A 3JRKA 3M5VA 4AHQA 3BW4A 1ME8A 4OE7A 4OBTA 3STEA 3PF3A 5I3IA 4JD4A 1XKYA 3HBLA 3P80A 2Z2UA 2YFNA 1T99A 3GNDA 1J2WA 1VRDA 5CPMA 4HPXA 4MVAA 2I14A 1B57A 2XFWA 1GQNA 4C1KA 5KSWA 4ZQRA 2CZ5A 3E12A 5FF0A 2FIQA 3C56A 4NJGA 4YXGA 3FJ6A 3HGSA 1EB3A 4N9BA 1PS9A 3HO8A 3G8RA 1Q6QA 3NQCA 1BWKA 2WPBA 1KTCA 4H3DA 1RR2A 1R2TA 5IBXA 1OF8A 4JTIA 4XTDA 4WZHA 4CQ9A 3PBWA 1CI1A 3PAJA 1SO4A 3EWWA 1PVNA 3MI2A 3W86A 3IIOA 2GOUA 3KVMA 4JTJA 2FPTA 1DBTA 3LXAA 4JTEA 2QUVA 3Q2DA 3UWVA 1QPRA 3FEMA 5L6UA 3W7IA 1SO6A 3M5YA 5EL1A 1KA9F 3W1AA 4UFMA 1W5QA 1A5BA 3FIGA 1TCDA 3NQFA 5LKYA 4UTMA 5IBXC 4IUOA 4WXYA 4KWWA 1IIHA 1OF6A 2PRLA 2NLIA 3PB2A 1PCWA 1KTNA 2QDGA 3E0IA 1W3NA 4UTHA 3LBCA 3TK7A 3ZFHA 3GR7A 3C2EA 1ICPA 1JUBA 3LRKA 3CWOX 3G1AA 4JX4A 1SFLA 3STCA 2VEKA 1GTEA 5AHFA 1OYBA 3TJXA 4RR4A 1H1YA 3NQ8A 2FPYA 2EGZA 1YLVA 3E02A 1OJXA 3M6YA 1EP2A 1G67A 4FXSA 2Q8ZA 4NNBA 3A9IA 5D33A 3W3OA 4WJEA 1JCJA 1MZHA 3TV8A 1F5ZA 3M44A 1TRIA 1DL3A 1W0MA 4O57A 3IRDA 1OFPA 3SR7A 3MO7A 4HNNA 2B7PA 5D2WA 1V5XA 5AOUA 2AQWA 2WJZA 4EWND 4JEQA 4NX0A 4UNKA 1IXNA 2B4GA 2EHHA 1W54A 4ZQNA 3G18A 2RKXA 2V30A 1QCWA 3TDFA 1ICQA 3LM7A 4OV4A 4ZVJA 4DPPA 3FOKA 1I8JA 1LRQA 2CLLA 2Y62A 3RF9A 3STFA 1X1ZA 3FKKA 2ZA2A 1THFD 1D3HA 2P10A 2H3DA 3Q37A 1O95A 5DXYA 5LHFA 4O54A 5KZEA 1I2PA 4EOUA 1FXPA 3CIWA 5TBOA 3TCEA 5SWUA 1DV7A 4CNOA 4YL2A 3CT7A 4YMZA 1TRDA 5AC7A 4UTWA 4XUGA 4NUWA 1WV2A 4POCA 2ZDRA 2X16A 2B7NA 1MO0A 3CIXA 3UWUA 3W7EA 3LX9A 1D3GA 1GVOA 5C2XA 4E38A 3ANYA 1JUKA 4LS1A 3W87A 3IIZA 3WK0A 5C55A 4UTWC 2GVJA 1PCKA 3KVJA 4O50A 2V2HA 5KTLA 1VHCA 5D05A 2NWRA 2ZZ5A 1TV7A 1XDLA 3CPRA 3UD6A 3O15A 4O0KA 3HGJA 2A7NA 3HGRA 1KM5A 3DU0A 3VCRA 5I3FA 2H3BA 1LZOA 1F05A 3W7LA 2QKFA 1S5WA 1C9DA 4ZQOA 1JVNA 3LHZA 3RNDA 3SZ8A 4HNUA 5LNWA 3DI0A 2CW6A 5AHLA 3L66A 2JK2A 4WOQA 3N14A 3QYQA 4E2DA 1YDNA 3LHTA 1X8FA 3NM1A 4Y9AA 3HG2A 4OHQA 2X2GA 5H2ZA 2Y7DA 1H7NA 1FY6A 4LVBA 3G1VA 4LW7A 2D73A 3BW3A 4AWTA 2DZXA 4E0CA 4NJIA 1GVFA 2YCEA 3L21A 3TUUA 3WK1A 2HSAA 1VCFA 4GBUA 5D2YA 4RZ6A 3I7SA 3W22A 5LNUA 2ZZ1A 1H63A 4H6KA 4N4QA 4EIVA 1F2JA 5FEXA 4X2RA 5AHIA 1BWLA 4O28A 3TJLA 4LRSA 3R13A 1FX6A 5HMSA 2VKZG 3QMTA 5K2ZA 2CLIA 4YCOA 5FEPA 2G5WA 3I7RA 5EYWA 5FI8A 1EWEA 1VR6A 1WOBA 5DBTA 4IX0A 1ML1A 1VPXA 2NV2A 4O19A 3B8DA 3W73A 3M43A 4DQWA 1AG1O 3NQGA 4PODA 2C14A 5I3GA 1L6SA 1SZGA 4Z0SA 1TTIA 1G7VA 2DZUA 1ZAIA 2ZTKA 1FDZA 2ZZ7A 3NPVA 4O17A 1OK6A 1QAPA 3LLDA 3U8GA 4LS2A 1Q3NA 1TYGA 3JR2A 3W88A 1WA3A 4PTNA 5AHMA 4IXXA 4JX5A 2VEPA 3HPXA 4RK8A 4QJ1A 1SPQA 4U4MA 4DEFA 4H4IA 3TH6A 2Y70A 3QMRA 3ABOA 1M7PA 3MYOA 2WKJA 1TIMA 2QJIA 2OCZA 3W84A 3OEXA 1P4CA 3BLEA 1FBAA 4FX8A 4NXKA 2NZLA 2R91A 1I4NA 5BMWA 3RFAA 1YTDA 2G97A 3EKLA 3QFEA 5K9XA 5AB3A 1E51A 3O16A 4BWLA 4ML9A 2VELA 1SZNA 4WXZA 1LROA 3M9YA 1VS1A 3M5XA 1XI3A 3KRZA 4FXRA 4AB4A 3G0UA 3PY2A 4HKPA 3W85A 3PSWA 3CEUA 5GVJA 5G5IA 4BWLC 3NQ2A 1ZENA 1KM4A 4FNUA 5DY3A 3PUOA 1HG3A 2H8ZA 2QF7A 4DBDA 1SW3A 4M5PA 3DZ1A 4K37A 4O4WA 2Y7FA 1G6CA 1EIXA 3U6WA 2V5LA 1OG0A 2ZCGA 1GYNA 1OFRA 1T96A 1TV5A 3PSVA 2EKCA 5U4NA 5E0KA 1R30A 3TNOA 3QZEA 3GB6A 3ELFA 3RMJA 1TQXA 2V9DA 3W7QA 4TMBA 4O15A 3BK0A 1AW2A 4UFKA 2YDAA 3QM3A 1QOQA 4MYAA 1RVGA 4IJBA 4I9AA 1GG0A 1A5AA 5T26A 4UFIA 1WYIA 1W31A 1VJIA 1CW2A 4Z1DA 2W79A 3W1LA 3W83A 5K4XA 3GDLA 4JTHA 1LP6A 3CTLA 1LTDA 3SGUA 4UTKA 2WV8A 1TPB1 3MP3A 3GDMA 4MPQA 2I9EA 3LCWA 2GVLA 4DO5A 4D2JA 2B7OA 4BR1A 4IMCA 4EVZA 2VEMA 3TMQA 3LV6A 5K7JA 5AYYA 1W5NA 4O10A 3W2KA 2ABBA 1LCOA 1XC4A 4IX2A 3NAVA 4WX2A 4JNMA 4MJZA 2ISVA 1VYSX 2FPVA 2C3ZA 1Z41A 1I2RA 4GNJA 4GC4A 3TQ0A 1W56A 4GUHA 4ADSA 2VFGA 5KINA 1L6YA 3L65A 3A22A 5HJLA 4R7JA 4K39A 4IOTA 3O06A 1VHNA 3HPSA 4O13A 1OYCA 2Y7EA 4IMFA 1P5BA 1UUMA 4ZQPA 1VLWA 2DZSA 2WQPA 3C61A 3KAOA 3LV5A 1OHLA 5HNRA 4IPIA 4A29A 1RQEA 3EX3A 4HIBA 3HG4A 3EWXA 2Y7GA 3TSBA 5LSMA 2GQ8A 3GXTA 4JR5A 2A0NA 3UY7A 3WJXA 5CSRA 2J6XA 4I7UA 4FHAA 1JUEA 1DKWA 3WJSA 4Z1BA 4WY0A 4MLRA 1R2SA 3W2LA 2C18A 3DXIA 4IMEA 4DF1A 1H5YA 2QCCA 2ZRZA 1JCMP 1Z44A 4BF9A 4UIOA 2WSYA 3TFXA 3B0UX 1H50A 2WNNA 3O6CA 2E1DA 1W5OA 1VCVA 3TR2A 4JTTA 4UMCA 1DJNA 1DOSA 4IMGA 4LS0A 2FJKA 3SIZA 3H53A 4JTFA 3DFNA 2BXVA 3N9RA 1FUYA 4OWGA 1H61A 2PRHA 3I7QA 2E77A 3G3MA 1KM0A 3P74A 2RDWA 3PB0A 3QW4B 3S1XA 3KVLA 3M0ZA 2CU0A 3EX4A 4O1AA 2YZRA 2E5BA 1TPEA 2Y85A 1GTHA 2ATMA 3LRLA 1UUOA 2C13A 3MBDA 3N9SA 3YPIA 3DKLA 3C2FA 4MYXA 5EMUA 5G1TA 5DCBA 4XKYA 1KFBA 5F2IA 5HULA 1MSSA 2NXHA 4JY9A 2C19A 4ZZ9A 1AL8A 5AHEA 3P60A 4I7WA 5G1YA 1JRBA 5DELA 2FB2A 3H54A 4DF2A 4GUJA 1XUUA 3CQ0A 3BPWA 3FJLA 3NQVA 3GK0A 3PBVA 1JJKA 1JCNA 2ZZ2A 5D30A 1NF7A 3LCGA 1UJPA 1L6WA 4JTUA 4NJHA 2GUUA 4GUFA 4CNPA 1TQJA 1HO4A 2V5BA 2ZRYA 3G1HA 3UQNA 4A3UA 3TW6A 2X30A 4UFJA 4CCCA 1H7XA 4MFEA 5KZMA 2YW3A 3G8EA 3NVTA 2QJGA 3EX1A 4JDYA 1KLYA 4LC6A 3S1VA 1WBJA 5BMXA 4FNSA
chains in the Genus database with same CATH superfamily
2VYOA 3NZRA 4WD0A 3KOZA 1OY0A 2NQHA 2NX3A 4B5VA 4CQ8A 4GNKB 1PKNA 4IP4A 5HR6A 2WHLA 3D0CA 3MP4A 1I1XA 4BK9A 2O92A 1YDOA 3HA1A 3CPGA 1EQPA 1F6KA 2VI0A 3F2CA 3F2DA 3BG5A 3NQMA 3S6DA 2OT0A 2KZHA 2IPWA 2DVTA 3QPZA 4YWIA 2FFCA 5JUVA 1C29A 1EO5A 3UPBA 3RCMA 1Z6KA 3W7DA 4AY8A 3WJWA 5A8OA 1DHPA 4HSOA 3AAMA 2QULA 3AWOA 2E5CA 1A3XA 1OK4A 3L4VA 1PO9A 3TROA 3ENLA 1DXIA 2DVUA 3W7JA 3UA3A 3OIXA 1E9LA 4JKMA 4UR7A 1TB3A 4DNMA 5AVHA 5J5DA 3R0KA 3CIVA 2J79A 3UESA 4XIAA 3ANUA 4X9YA 3AIWA 3GC5A 1E6ZA 4NAFB 2DORA 4WSHA 4D9PA 3PR2A 4DIAA 3AU2A 4PMRA 3NDOA 5GNZA 1O4UA 5U7SA 4CEUC 1YX1A 1Q85A 1TPDA 1L2UA 1IEVA 1SSDA 3DENA 4M24A 4PL1A 1IHIA 1PTGA 1KBBA 3VD4A 1H49A 3KOWA 3VOHA 1W9VA 1Q6GA 2DPEA 2QGYA 3VD5A 4KFPA 4MFDA 1RD5A 2CXEA 3EEGA 3KW3A 3VO0A 2PC4A 2C0HA 3USBA 3MUAA 2XM2A 3WF1A 5D9NA 3SY5A 3VD7A 2BVYA 1KFLA 2ZFAA 3OGSA 1P48A 4YTUA 1H5VA 2QT3A 1RH9A 5FL0A 4F0KA 3THUA 4HNLA 4CGTA 5CPLA 3OHMB 3UXKA 4Q8NA 2VWSA 4HU4A 2V5CA 4AIBA 2X1IA 3VIHA 3EDEA 4HQVA 3VA8A 2J9XA 1IEQA 2WNWA 1HJVA 4LTSA 2VDIA 3WQEA 1MUCA 3BGGA 3BZJA 3AWNA 2ZXQA 3GH4A 3HM7A 1S3HA 3K4AA 3QY6A 4ZMGA 1KBKA 2DGAA 5D9PA 3KLLA 3GW3A 3FHQA 4GY0A 2X1TA 4CVUA 3BVJA 2YDQA 2IQDA 5ABEA 1CGXA 4B5TA 5JIWA 1R47A 1XLEA 2V67A 4ZE4A 4JN8A 4IGSA 3AIRA 1GVYA 1VD6A 3HV9A 4OBRA 4UTTA 4K6AA 1VBRA 2XDFA 4JYFA 2V3FA 4GIEA 3M7WA 1TA3B 3S5ZA 3LB0A 4HSNA 2XH2A 2R14A 1DIDA 4AG0A 2ZVRA 2PS2A 2PF0A 1GEHA 5AYZA 3EWCA 4GWEA 3EB4A 1S5TA 2WKLA 2CZEA 2I5IA 1W3HA 3QGKC 4ZTYA 1PHWA 4JPGA 2IS7A 5E9AA 1L8PA 5ABFA 3MWAA 1QR7A 1OX5A 2CLHA 3N34A 3EDJA 3ZT5A 1JGIA 1UA7A 3QSTA 4GABA 1BSLA 2CHOA 4LU0A 1MUMA 3QQ0A 2Y88A 3FYYA 4AHOA 2IPJA 1PIGA 4JY8A 1E40A 1W3LA 2QCLA 4D6JA 4KT2A 4ZQMA 2QEZA 1V6TA 1K3UA 4L56A 3AXHA 3ARXA 4FNRA 4MNLA 1XKJA 1J5TA 1E56A 3GYEA 4YLWA 4B91A 3L0NA 2WWCA 1Y8BA 4IF2A 2RGLA 2XSAA 4CD6A 3EWYA 3EWBX 1X38A 4QQ3A 3ANVA 3SIMA 4F0SA 3KZPA 3THQA 4DJEC 5LNVA 1WDPA 3MUIA 1UQZA 1XH0A 1ITQA 6TAAA 2EPLX 1MW2A 3M64A 1VBJA 1XRTA 4N4PA 1FKXA 1ME7A 2QCMA 1YNPA 4GLEA 1I1WA 1E9YB 3KTCA 7PTDA 3E2RA 5HQLA 5G4EA 4KEZA 2ZDSA 3FJ4A 3EDDA 1B0IA 1AQMA 2WSQA 4PCFA 5CPQA 1HL2A 4RNFA 3SO7A 4AZ5A 4S3AA 4E3TA 2PDUA 2YIHA 4DY1A 2ZRVA 1W37A 2Z7KA 4L6DA 4BQ4A 5HQMA 2Z6JA 3R94A 1VZWA 5A5WA 2W0UA 1J4EA 5HOSA 1QATA 4H9ZA 1NF0A 3U2CA 1K8XA 1PUDA 3GM8A 4AQLA 2PBGA 2C6QA 1J96A 3KE0A 3OPSA 3V16A 3MHFA 3ABRA 3VVGA 5A6LA 4Q8MA 2W67A 3H2FA 3WF4A 1FKWA 3IVUA 4LOCA 4NZJA 3F4WA 3KRUA 4LCRA 1E5JA 4ECLA 4KGJA 3RN6A 1SJDA 4AVFA 2JFEX 3VKKA 3H55A 1MW3A 5A6TC 2VCBA 4PRRA 1RUSA 3AMGA 1GQJA 3NQEA 3TYDA 2WMJA 2PODA 3EXSA 5HR7A 1RV8A 3MW7A 5HPOA 4DHGA 5A8QA 2BWGA 3QR0A 3TN5A 1J18A 3A3WA 1JDAA 3WH8A 1DIKA 4F8XA 4HNCA 2J66A 2YX0A 1XIBA 4FR1A 1KQZA 1WNOA 1X6LA 2FVKA 1E0UA 4MY1A 4LVDA 3MI6A 1GZJA 3W1RA 2Z28A 3T4CA 3URNA 5LNSA 3MSYA 2OYKA 3W7NA 1WDDA 8XIAA 4IG2A 4MB1A 3EDFA 1JCYA 3EOLA 6REQB 6ALDA 1CGYA 2YYTA 4C1NB 1UWTA 3N15A 2A6LA 5E93A 3RDKA 4HYRA 4G6CA 3HG3A 4O14A 4PA8A 4IXHA 1ZTVA 1QPOA 4IWWA 3OZOA 4RKAA 4GE8A 1W9PA 4UFLA 1US3A 1UKSA 1V77A 3W23A 2EPKX 1EIBA 2BHZA 2GJNA 2ZBTA 3FSTA 4IM4A 1EYEA 4HD5A 1FQ0A 1XL9A 1LL7A 4LVFA 3EZ4A 1P0NA 2BVTA 5B7ZA 2TRSA 3AISA 1ITUA 2RHGA 5CC7A 4GUGA 3WDJA 4XZ9A 3TXZA 1GQIA 1W9XA 3CXOA 4XBSA 3WQGA 3N13A 1RQHA 2F6XA 2J7DA 4H6QA 3GLCA 2OLSA 1JCTA 2Y8KA 4L80A 3WQ8A 4UZSA 1OC5A 1AW5A 3VD9A 2VTFA 4KRUA 3M0VA 3IV3A 4ACZA 3RJXA 3QLLA 3WD0A 3RGTA 4N6FA 1U33A 1VFLA 2ZRXA 3LCLA 3CZJA 4AF0B 1KM3A 2QIWA 2CLOA 1R8LA 3O1NA 1L9WA 2E1WA 5F4SA 2BS9A 3KBWA 4ES4A 3VMNA 1SJAA 2ZKMX 1JNEA 3NQ7A 3GRIA 2NSXA 1OD8A 2VZVA 3RU6A 3GTIA 2ZZ3A 2QNEA 2ALDA 4ALDA 3DG6A 1FWJC 1P0KA 5C9UA 4DZAA 2OO6A 2GYIA 3UZJA 3WD1A 2YA1A 1CPUA 1TPWA 2GWNA 2PTYA 2V3EA 3XISA 4L5ZA 1OM0A 1O60A 3UR8A 3ZZ1A 2X7VA 2ZWZA 2CZFA 3NO5A 3K5XA 3R8RA 3WH7A 4CU8A 1R87A 1UROA 3U7BA 2VZOA 4QDPA 2VDGA 1WZLA 4W7UA 2AQVA 1PYMA 1VIZA 1S2TA 4XKYB 1QPNA 1UR9A 1LT7A 3N6HA 4IIGA 2C16A 4ZOEA 1IE7C 3EMZA 4IGHA 1TV2A 3SADA 3QY7A 2O9RA 4HNOA 5EU9A 4PMJA 1OIFA 1LOQA 1L8NA 1QHPA 3GVVA 1LRNA 3CLMA 3DEQA 5HQEA 2R94A 4RZ5A 1RPXA 3K8KA 4AEOA 3DFYA 5EBAA 3AJXA 3SI9A 4J1OA 1TPH1 4J4KA 5I06A 1QTWA 1HJQA 1GVSA 1UD8A 1AA1B 2QUTA 3TP4A 5BRQA 3WNLA 2PDPA 3L4YA 3KWSA 3N04A 3EMCA 2XGBA 4R34A 5FOOA 1R3TA 1Q65A 1GOOA 3W2UA 4GC3A 3TX9A 3ECQA 2V0TA 5A8GA 2H6RA 4GG9A 1PKLA 1FWCC 3LOTA 2OJPA 4Q4KA 2JKAA 3EX2A 4MWAA 4OZOA 3M47A 1J79A 1FWWA 3C3NA 1EKOA 2ZX8A 3VGEA 1Z69A 1H3GA 3RLUA 2Z00A 4MIMA 3CHFA 3LHWA 1LUCB 4MY8A 4KFOA 2EPNA 1V0NA 3QJAA 1OABA 2Y5SA 4DZHA 2JKEA 3K4WA 4E4UA 2P8BA 3W2MA 4L4MA 4TX6A 1YBQA 1SVDA 1MRQA 1FDYA 1AK5A 1H7RA 3M0YA 4XAZA 4Z1CA 3PG9A 3GDKA 3RR4A 1EGVA 1F07A 2F7FA 2PWEA 3IGXA 3L5MA 2O7SA 3ZJ6A 4ZXOA 1F6PA 2D3NA 4Y9NA 3SSZA 3UY8A 3CHVA 2QCGA 3TFCA 2I56A 4O16A 4PMZA 4NQ1A 1I2OA 2WJFA 3F03K 4XZBA 3SCUA 1JDEA 3WJYA 1KD0A 3XIMA 1LBLA 1NTHA 3CAQA 2ZXBA 4CUCA 3UWWA 1A3WA 4LYRA 2YLAA 1U22A 1JYNA 4N9DA 1JPDX 3HFTA 3TW7A 1TX0A 4UUIA 3FKRA 1WDQA 3WH9A 2JGYA 3VFCA 4QE4A 3POCA 1X8CA 4M80A 2WO5A 3DBPA 2A1YA 2OEMA 4XSMA 4R9XA 2E09A 3P81A 3TYAA 1Y5VA 1XGEA 2BXYA 4L4LA 1F8IA 1TSIA 4AC7C 1REQB 1KV8A 2GUYA 3BXWA 1WXZA 2HS6A 3SDOA 3MV01 4TO8A 5D2XA 3NPUA 3GH5A 4P2VA 4FI4A 5M1TA 4NZ1A 1KWGA 4IFKA 1B3OA 4UQBA 3CQKA 4O12A 1JZ3A 1XCFA 4KBXA 3B9OA 2OSWA 3U2OA 3W1TA 3AROA 4M19A 4KRZA 2ZXDA 4I8DA 2OTDA 5IM51 2E3ZA 4DAFA 1ZLPA 1M6JA 2YXOA 1OCNA 3AIVA 3LMYA 3WF3A 4PBFA 1OB0A 2C1HA 1T0OA 4EX4A 2XHYA 1I9CB 1UD4A 1HN1A 3B8WA 2X1RA 3T0DA 1P1XA 1W1TA 3GG0A 2V3DA 4HPGA 4PBEA 1KGWA 2DP3A 1QW7A 1CZ1A 4NIRA 3VU2A 2CCRA 5KMYA 3VIKA 2XWDA 3LBMA 4C5YA 2OZTA 3IAQA 5TIMA 2OLAA 4F0RA 5HUPA 1CX9A 5BW6A 1WDSA 5LXXA 4PMOA 2Y61A 1VPYA 2XUCA 3B0XA 1E1FA 1K03A 4W8AA 4O53A 1E0XA 1UP3A 3GDBA 5I6SA 1E4MM 4DXVA 4L7ZA 3IPWA 1MEWA 2R8WA 4PRTA 3WX7A 1CGWA 2DJLA 4GUIA 1BYBA 1VGAA 4K8GA 3BV4A 2DSKA 4PMQA 2Y6ZA 3KXQA 3A23A 2UV8G 1ESWA 2E28A 1U5VA 2WANA 3GX9A 4E8DA 5HANA 1XYMA 3RIKA 5T9CE 4FLQA 4HYWA 1YNQA 4REQA 3DYPA 4JN7A 2RDUA 1TV4A 5C0QA 3IIPA 1B9ZA 3QR3A 3FFSA 1N55A 3OG2A 3O7UA 4XISA 3L9CA 1W91A 4F79A 2B0MA 3V5OA 4HVXA 4S2BA 2W5FA 3WK2A 3CV7A 3HB9A 3VNDA 4ZL1A 1JI1A 3BAWA 2WNZA 3QGVA 2BLEA 4MOZA 1R46A 2OXNA 2E40A 3TTEA 1SU5A 4NNCA 1UWAA 3KRBA 1AMKA 4NF7A 3LXBA 1K9FA 2RJHA 3OODA 4Y8EA 3AXMA 4NZ4A 4ZBCA 2FH8A 4RW5A 2GSJA 4MY9A 4U28A 3DN5A 1FWFC 3E2VA 3A12A 1XYAA 3UJFA 3VIGA 2GOKA 3L23A 3OZMA 3DGRA 5EPDA 2VC7A 1EP3A 1EZ2A 1KGUA 3UG8A 2JIEA 4D6HA 4AZ6A 3C0JA 3MSGA 4X63A 1IEXA 2PFHA 4H00A 1EBGA 1K7FA 5CSSA 1IXOA 4JEJA 4JTSA 1ZQ5A 4ZTXA 2NXIA 2YB4A 4OT7A 2INEA 4MKSA 3QV8A 5F4XA 1H7PA 2J7GA 4HN4A 3KHDA 3LDVA 1OGGA 1SZFA 4UR8A 1KQYA 1ZB5A 4MGGA 5MKGB 3T08A 2OWCA 4AZCB 2DEPA 1HNYA 2A7PA 3MHUA 1UG6A 1O5QA 1EHNA 4NXSA 2GSEA 3T44A 1RBOB 3GBDA 1C93A 4TV6A 1VBHA 2ISFA 2YPIA 2BY3A 2VEGA 4ERGA 3I6RA 1KV5A 3NL6A 4JHZA 4HHMA 1DXFA 4DJDC 2GVEA 4XK2A 2VM8A 2DSZA 4CU6A 3JZUA 4AMAA 4YS1A 1QWGA 3B4UA 4V1YA 1OX4B 4GZIA 3QGAC 3V35A 3Q65A 4ZQCA 3C2OA 2VEFA 1O5RA 2BVWA 4FR6A 1XIJA 3MJYA 1VKFA 3LTYA 2BSLA 1Z42A 4WSKA 3GVRA 4GMEA 1ZHAA 3DECA 4IL0A 2R1MA 3MCMA 3TTSA 4YIWA 4NSBA 3NGJA 3UZ5A 2D2JA 1M1BA 2R1PA 1QFEA 2OQYA 1GQLA 2VXNA 4UOQA 3ZO9A 2CEQA 3BW4A 2VX5A 4AZBA 3DHUA 4XVEA 4JD4A 2VO5A 3HBLA 3P80A 5CBJA 2AGTA 1JFXA 1T99A 3A3HA 1J2WA 4ZSUA 1TJ0A 4LB4A 1VRDA 5CPMA 4YTQA 1B57A 5CSUA 1RK5A 4RE3A 4S38A 1JDFA 5KSWA 1AODA 1XIDA 2PTWA 2FIQA 1V6VA 3C56A 2BNJA 1EDGA 3MANA 1EB3A 3HO8A 3D3FA 4TTUA 1IT8A 1GQKA 3NQCA 2GZXA 4O1EA 5M5DA 2CESA 1R2TA 3RXZA 5IBXA 1OF8A 2FYMA 3LMZA 4D6IA 1UBPC 3N6JA 2OWXA 2NQ5A 1NQKA 4NAFA 1PVNA 2QGHA 4HZ8A 2FPTA 4DNHA 2QUVA 1NP0A 3FEMA 5L6UA 1SMAA 1KA9F 2HEJA 5AECA 3ERPA 3R58A 1E1CA 3NQFA 5LKYA 4UTMA 1RY8A 2NLIA 3NUKA 4ZR8A 4IMAA 5FJPA 3EOSA 2J7CA 3EPOA 1FTXA 4ZA0A 3VC6A 4LYPA 3IV8A 3WZ0E 3GR7A 3LLXA 1ZCCA 2PTXA 3CWOX 3PJUA 3G1AA 4JX4A 1WKDA 2A3CA 3BJTA 1GTEA 1OYBA 1K1DA 2O4QA 1H1YA 2EGZA 5CBBA 4HPNA 3B9EA 1YLVA 1PPIA 3E02A 3L4UA 1XISA 1G67A 3B8SA 3FJNA 1K9TA 2WXDM 1ONWA 1TR9A 2VR4A 3OGRA 1MZHA 3TV8A 3U2EA 2RUSA 4O57A 2INFA 2B7PA 4PB5A 1RSCA 1K8CA 1W3KA 1JNDA 3R6IA 5AOUA 2WJZA 1IWBA 1A80A 2WQDA 3ZLFA 1U1UA 4EWND 5H8UA 4JTQA 3G18A 5JXQA 2RKXA 4BF7A 3SY1A 2DUAA 2QLYA 2AL2B 4D6GA 2XM1A 2Y5JA 1I8JA 1LRQA 2Y62A 3STFA 1TUXA 3FKKA 3N2TA 1D3HA 1XG4A 2P10A 5FACA 2NW0A 1FXPA 4LBRA 1YHTA 3CIWA 5TBOA 1E70M 1B3ZA 2AQOA 3VOIA 1FWHC 5SWUA 1BG4A 1QNSA 1QPKA 4YMZA 5AC7A 1TA3A 3U2ZA 1O1HA 3KTXA 2BB0A 1WPCA 4TVCA 4PCSA 1MO0A 4OTKA 1UKOA 5C2XA 2HISA 1Q6FA 2W91A 2YCJA 2I9UA 5H8MA 3KVJA 4UBPC 2V2HA 3T09A 3TZFA 4XUYA 3O15A 2QYGA 3CUXA 2KAUC 1JYXA 2EPMX 3HGJA 1BXNA 2A7NA 2YDRA 1OT1A 5CPSA 4WGHA 1RP8A 3TYUA 2XZ7A 4ZQOA 4HNUA 2Y1HA 3IK4A 3N14A 2PI6A 4E2DA 1YDNA 1QHZA 3LHTA 2I7GA 2QPUA 4L4PA 3VPLA 3NM1A 2C1GA 3WL1A 4HK7A 2WMKA 2YCEA 2D23A 3L21A 3GHTA 2PDNA 2YCLB 3WQPA 3N4AA 4HK6A 3PTQA 3I7SA 2YB1A 4C6QA 1UYQA 4XG1A 1OT2A 5FEXA 1ONXA 4QQUA 4AD1A 2FJUB 2G4FA 5AHIA 4O28A 1EC9A 3E2QA 5K2ZA 2CLIA 2OB3A 3I7RA 4KWUA 4QXIA 1BG9A 2XTKA 1WKYA 2VQTA 2FZMA 2GGHA 2OU4A 3VZZA 1HP5A 1I0DA 3GVQA 5I3GA 4GI8A 1TMLA 2C91A 1L6SA 1JF5A 2DZUA 3CS2A 2ZTKA 3S1GA 4CN1A 2HZGA 1BGGA 3D47A 1OK6A 1Q4WA 5CAKA 4CN6A 3TQPA 3U8GA 1Q3NA 3WYZA 3M0LA 4C65A 1WA3A 4L9XA 4PTNA 3RMEA 4IXXA 4GQBA 4U4MA 4DEFA 4H4IA 3TH6A 3QMRA 3E5PA 3MYOA 2WKJA 4XD6A 1BF2A 3IJ6A 1UP2A 5E6YA 1P4CA 4DUOA 3BLEA 2WLYA 4F2TA 2XGZA 4I9MA 1O6IA 3RFAA 3W81A 4DWDA 4O0QA 4ZCWA 3WBAA 4BWLA 2BXZA 2WPGA 4WXZA 2CZVA 5JVLA 2Z1SA 2JF7A 1ECQA 1RBLA 4EKJA 1QASA 3V0UA 3D6NA 4HKPA 4P8VA 1XIFA 1BFNA 5DMYA 3PSWA 3M0MA 1PYFA 1WP6A 3W01A 3BMVA 4U5KA 4LF1A 5DY3A 1HG3A 1SW3A 1IZCA 4YTSA 4HP5A 8CGTA 4V15A 5I78A 1QRQA 4S3CA 1EIXA 1QWKA 2HBXA 3FEQA 1OG0A 2ZCGA 1B3VA 3KLKA 1YNYA 1QI4A 4C1NA 5A6BA 3ARYA 3H2CA 2OGYA 3KCJA 3AHXA 4IPLA 3QZEA 5A6KA 3IUDA 4UQCA 3ELFA 3XINA 1POKA 5M2FX 2DT1A 4UFKA 4MYAA 2E4TA 5HDRA 3T2QA 1A5AA 2QIIA 4DWSD 3TOPA 2WM1A 4PUNA 4JTCA 4HPHA 1F4HA 5K4XA 5J04A 4IFRA 3CTLA 3PZTA 3SGUA 1CBGA 4UTKA 5I07A 1TPB1 3UG5A 4ATDA 3TJ4A 1ZBVA 4X0VA 4IMCA 4RE2A 2VEMA 4EVZA 3GU1A 3H22A 2BHUA 5K7JA 4G1NA 1W5NA 3GYCA 2ABBA 1LCOA 1XC4A 3R1ZA 5GJPA 4B16A 4MJZA 3TTQA 2NT0A 1D8CA 1UZ4A 2WB5A 3AIBA 2GK1B 2QHAA 1VYSX 1B30A 4I6VA 1W56A 4ADSA 4U5IA 5KINA 4R7JA 3T1GA 2DZBA 4O13A 2VUYA 1TVLA 5REQB 1PXGA 3FV9A 4AZHA 3Q45A 3O6AA 3C61A 1QI5A 5C7VA 4LGXA 5BWAA 3EWXA 2Y7GA 2HK0A 3GXIA 1FH9A 3UNTA 2AAAA 1ZJHA 2HBVA 3S46A 3WBEA 2DV0A 3DXIA 3S6TA 1QK0A 2W92A 2XVLA 1P0EA 1JXKA 4PMVA 5H8PA 3Q67A 4QRNA 2JF6A 1XD0A 2E1DA 1UMYA 3U3HA 3OQ8A 1ZS2A 3TR2A 1P0BA 1ZP3A 4RL3A 5C2CA 1MVYA 2OKOA 1DJNA 4UWMA 4LS0A 1XLLA 1NH6A 3DFNA 2NVCA 2XPKA 2YL9A 4UR9A 1JG9A 1EOKA 2RDWA 3M0ZA 3AS0A 1UIPA 2ATMA 3CO8A 4EAYA 2X40A 3LRLA 3DKLA 3CB3A 2NT1A 1PB0A 5DCBA 4XKYA 5F2IA 4IUGA 5EGRA 2D22A 1TIWA 2YCKX 4GIYA 1MSSA 4JY9A 1GW9A 2P5NA 1AL8A 3PUGA 1MXGA 4C5ZA 4I7WA 4JIHA 2DQXA 5DELA 4P8WA 1F3TA 3CQ0A 4FS9A 1PEZA 1JCNA 1XJBA 3DIPA 5BXRA 5BXSA 1VENA 3GFZA 3LCGA 1IT0A 3U5UA 1L6WA 4JTUA 3VIFA 1E6PA 2WCGA 1HO4A 2V5BA 2ZRYA 1VJSA 3WDHA 4CQDA 3G1HA 4J3XA 2P3EA 1OSEA 5HMEA 2X30A 1H7XA 4MFEA 3TN6A 3CWHA 2WMHA 3CQHA 2WM0A 3UR5A 2QJGA 3EX1A 3J7HA 1KLYA 4D1JA 3MO4A 2ZC1A 1WBJA 5BMXA 4FNSA 2G3FA 2WVTA 4M6UA 3F1QA 4GH3A 3W6LA 4DELA 2FB3A 1CXHA 1V3MA 3VNIA 2PLMA 4ROQA 4QCFA 3DHDA 2R1KA 4D72A 2F2HA 3ES8A 1LUCA 3FYPA 3WQFA 1EUNA 4B5WA 3RUBL 1PWMA 1SO3A 4XZLX 1GJPA 3V18A 2YYUA 5FESA 5E0FA 4MLJA 2YJQA 4C7FA 3QPYA 3E2SA 3I6EA 4DBWA 1AL7A 4XD4A 4JICA 1ICSA 4IP5A 4Y90A 3VKDA 3M46A 2VDHA 4Z2IA 4J9JA 3V0SA 4FOJA 2WHJA 4N9EA 4IICA 5AFDA 3KS6A 3E3HA 1HGYA 3BZGA 5BYWA 1TE6A 1O5KA 3UVIA 1KWKA 3TJIA 1FWDC 3CV6A 4H8NA 3P62A 1TMHA 1F7BA 3GHRA 3Q94A 3EWZA 1EBHA 4Q6JA 1KM1A 4JQ2A 4DUVA 4TIMA 4IPPA 1GWJA 2R82A 5CPTA 3B0PA 3O0FA 3CWNA 2G50A 2FH6A 4HMNA 4GVFA 4AXNA 3SQSA 5E6ZA 1XLHA 2CIPA 3MT1A 3C52A 4ORIA 3ID7A 3FX4A 3UT0A 3GIQA 3CUGA 2VRQA 3P61A 1EQCA 3SUTA 5F1VA 1E3XA 3QQ1A 3LPOA 2EF9A 4HMEA 3AS1A 4M6VA 3P8IA 4MHBA 4XD3A 3VIIA 4TX9A 4IIHA 5FJUA 4INFA 4PC8A 4AWEA 3SEPA 1Q6RA 4M8UA 1GOWA 2F8QA 3MHGA 2J27A 4V33A 4D8AA 4EPKA 1BWVA 1DVJA 1E6RA 3LGGA 3B97A 2XWEA 3SRKA 4PFMA 1S46A 1KFCA 3UR2A 1N7KA 3EXRA 1SUXA 4M3PA 1AH4A 1TKKA 4LUTA 4L9YA 3OLDA 2V5JA 1CLKA 3UXLA 4ICNA 3A24A 1OFAA 1IZJA 4P7NA 1AD1A 2PSNA 4O8AA 4AWSA 5ENLA 1V3HA 3T05A 1VFMA 4US6A 1A5SA 5PTDA 1MMFA 4E4FA 2VJXA 1W8GA 4TQTA 4WR3A 4E2OA 3AO0A 2B7QA 1P7TA 4S3EA 3C5QA 4DWSA 4RDYA 3PJTA 1Q2SA 4Z08A 4HZ7A 1EF3A 2P0OA 5C9RA 1D7KA 2XIOA 3LSBA 1IYXA 3WJZA 4H19A 1A50A 5CPNA 1F74A 3ARQA 4QLKA 3NFUA 3W37A 2YKKA 4XZIA 2GDQA 3EDKA 1FFQA 3G2GA 3STGA 4XTIA 1TO3A 1GJUA 4DJFA 2VD8A 2AKZA 1LLWA 4KMQA 1PZ2A 5CZJA 1AQHA 4FF7A 1LL4A 4JTGA 4QHRA 4IL2A 3FSUA 4OV9A 3ZQ9A 4HGXA 2Q09A 4FNQA 4J3VA 3HIJA 2TMDA 1UWRA 4GFSA 3NEHA 1XCWA 4UFHA 1K9EA 3DHFA 3G0XA 3WN6A 2GSHA 1MFVA 3DFPA 4FP1A 5HUOA 4UOJA 3LNMA 2GQAA 3KOFA 3W1MA 1EUAA 1CNVA 4UTTC 1R3WA 4U31A 3S8HA 3M5ZA 1CB2A 3G6LA 3WLQA 1DWAM 3WDPP 4JFUA 1TUFA 4V27A 3MUZ1 3TSDA 4NT0A 3PG8A 1E9IA 1VYPX 4F66A 1NFPA 4CNSA 5FF7A 1EHAA 2BDQA 1E71M 1XFBA 4GQ0A 3KEHA 4PZVA 4BJHA 4ERIA 3KZSA 2QDHA 3UGRA 4B5SA 1VFHA 3NG3A 3LN3A 2VEIA 4IIFA 3P7YA 3S2MA 3EXTA 4CD8A 3RR1A 4R33A 3H6OA 4Y96A 1UKPA 5KITA 2BHYA 3LCXA 3UCQA 3WQ5A 4UTFA 3A21A 1QO5A 1UA3A 1UB3A 3TVAA 3W07A 1RY0A 1WCGA 1JPKA 3PVFA 3S42A 3S0CA 2XVGA 5F2MA 2OMAA 3C2RA 3N73A 4L61A 3QTGA 3M4HA 3W7RA 1VAHA 2QF8A 3H12A 5XIAA 3WBWA 4FIRA 1ZY9A 2J25A 4KKXA 4JYEA 1R6WA 4BY3A 3GVWA 5K9DA 2BASA 3LENA 3N18A 3DFSA 3SJ3A 3K8MA 2NWSA 6TIMA 2ATSA 4GCXA 5C54A 2ZE0A 5HA7A 1MZRA 5HJXA 4FZIA 3HMJG 1DORA 1UC4A 2X09A 4H9UA 4DAIA 3KL5A 4JTLA 5ABFB 2HNHA 2PAJA 4AVNA 3PBUA 4AEFA 1CXEA 1YMYA 2ADAA 2GPTA 1ISZA 1PBGA 3PBGA 4PMNA 3SRFA 3W1UA 1XICA 4NNAA 3IGUA 4L9ZA 4Q4RA 4FEZA 3CUFA 3PANA 2PP0A 2VOMA 3OG3A 4JIEA 3WY1A 2QW5A 3B0YA 2WVVB 2G96A 5MKGA 1CGVA 2VC9A 4KWVA 2A3EA 1E5NA 3CEPA 4GRSA 2G3JA 2VR2A 1H0GA 2CXGA 3NM3A 1E1EA 2A85A 4V1XA 1TTPA 2VHLA 2V6AA 1ZZMA 2I17A 2YBUA 2Z4GA 4A21A 5KZDA 4NHVA 3EA1A 8TIMA 1WXYA 4QISA 2Y89A 1CECA 1PKYA 4W7WA 1NOWA 3AZTA 3LHVA 4NL1A 3FAWA 1E4IA 4KCTA 3LERA 1OC6A 3VDBA 1G4PA 1QW8A 3VMOA 3DI1A 1YPIA 4FPSA 3KL0A 3GVGA 1T41A 1FFRA 4HPJA 1W9DM 3T07A 5DN1A 3CTTA 3SRDA 3BAYA 5DLCA 3CHCA 3EOUA 3RK8A 1LWJA 3R2GA 3NNTA 4GVGA 4D6EA 3NJ3A 3WLNA 3QV7A 1Y7VA 1NDVA 3CO4A 2YOCA 3NZQA 4B2DA 4DLMA 2EEXA 1WKEA 1EWDA 2XFFA 4D6DA 3CUJA 2X0HA 3GS6A 4HB7A 4IFOA 3IIXA 3HOJA 2BGNE 4PMYA 1XP3A 1PIFA 4CLMA 1FH7A 4IQEA 3EPNA 4A3YA 4QLJA 1U5JA 3N2MA 5JBEA 4DJED 2ZXAA 1OFDA 2CYGA 1HIZA 3SCOA 9XIMA 1C7SA 4C6IA 1Q6DA 1TV3A 4PCPA 2UY2A 3UP8A 2A5HA 1MXDA 4LAMA 1C8QA 5FKYA 3O05A 2H8XA 1BYDA 3WELA 3TN4A 3UWQA 1O94A 1KCXA 1VIWA 1ADOA 4N42A 1CGTA 4YHGA 4FX7A 1KFKA 1SQ7A 4ENLA 1RALA 3BSGA 3NQDA 5DMMA 2HDJA 5LIUX 3FLUA 3GXPA 4AZ7A 1M7JA 5D8WA 3URBA 4LUJA 4B5NA 1P6CA 3BSHA 3HU7A 4YN5A 3W2NA 2QPXA 2Z1BA 4HA3A 2V82A 1I2NA 3CGTA 4AH7A 5DEZA 3QTPA 2J88A 1R9XA 4JCLA 2GQ3A 4L1XA 4WVXA 2HWGA 4WUIA 1KO0A 3H23A 3SCRA 1VB9A 3PZNA 5D03A 3FK4A 5IRPA 2A6NA 1A5CA 3QSRA 1WX0A 4K7VA 3VI2A 3M16A 2HS8A 1W1A1 3LHYA 3CZKA 2GGEA 4AYGA 1MQPA 2P0IA 3W9ZA 3LGEA 3M0HA 3DG7A 1Q45A 1OADA 4F4RA 1QVBA 1ZJIA 3HFYA 5L9FA 1QHOA 2J9ZA 1UJQA 5GNXA 3RPMA 4Q4QA 2PGFA 3W7GA 2ESCA 4GIRA 3BARA 3VCNA 3E1F1 4MUZA 4XBKA 1FCVA 1LM1A 3PM6A 3PPHA 3PTMA 1GVQA 3W2JA 4IGMA 3OVPA 2H9AA 3VNKA 3JZEA 2REQA 5IHRA 1JCLA 3LRMA 4KWSA 4I8YA 3NXLA 1JZ4A 3LTPA 1J12A 1W1VA 1IXPA 4QE1A 4XZWA 3VTRA 1T40A 1BHGA 4M1RA 4Q3MA 3QVQA 3AJ7A 1F4AA 1OFOA 2W61A 4ACZB 3QQWA 2AL1A 1FXQA 3AS2A 4DM2A 5I24A 1SM9A 3CM4A 3T42A 4C6FA 2C71A 1I45A 3UJSA 1G01A 4N2YA 3F5JA 1XLCA 4JGDA 3T55A 3B9NA 3G1FA 2OZ3A 4DM1A 3UWYA 1FP8A 4LAKA 3TE9A 1B4EA 3OW1A 2PWVA 3PP7A 4IISA 1Q13A 4S3DA 5D32A 4YYCA 4MPKA 2Q3OA 4G56A 1ISWA 2E6YA 3RM8A 4JZ5A 2BTMA 3U4FA 1DXEA 5ECUA 2BGSA 1S2UA 4A8IA 2OEKA 1EEPA 1I0BA 4P7QA 3ARPA 4Y8FA 3QF0A 5FSDC 1QMLA 2AMGA 4QNEA 3ARZA 1S1RA 1XDMA 2JEPA 3CH0A 3HPFA 3EBVA 1W2PA 1B2YA 4Q22A 3WEZA 1SMDA 3EKZA 1CXKA 1XXXA 4NZ3A 1K7EA 2OT1A 3WFLA 1XIIA 2YCLA 4ZB0A 3BOLA 4X0NA 1W1B1 3KM8A 3S5OA 1T7LA 4YHEA 1EX1A 1UR2A 4H41A 1OVDA 1AVAA 3VIMA 2ODOA 1RJPA 4FF5A 7ENLA 3N6QA 1LL6A 2RDTA 3W0KA 4TTGA 1SW7A 4WEVX 1GT8A 1Y0EA 2WMFA 3VKBA 4JIPA 2YL8A 1IEWA 4RXFA 2PPGA 2NUWA 2ACRA 2DZWA 1M41A 3V36A 4H7CA 3WK3A 3ATYA 2UWFA 3OVRA 3DERA 4C7DA 4JTDA 3VNLA 1JF6A 3S47A 2O9OA 1E43A 2HVOA 5CC3A 2D0FA 1TWIA 4KERA 3C0LA 4TOQA 3ALFA 3G22A 2X1UA 2GJXA 2BY0A 4R27A 2QDEA 3MV11 1R9YA 1J0YA 3FDGA 4EWJA 2PGWA 2PDHA 1YE4A 4MWAB 2XSBA 3HN3A 4C60A 3KHJA 4KS0A 4US5D 1UKQA 5BOFA 5G4HC 2XU2A 1SR9A 3R4IA 3LEPA 4S3BA 1W1IE 4DN1A 1KBJA 2HPMA 4DO7A 3AALA 1WBHA 1HT6A 4A6GA 3CYVA 4UQ9A 3AMLA 5AYXA 2QJHA 5HWJA 1WB0A 2O9TA 4KIEA 4A2RA 3CU2A 1OWQA 4Q8PA 3A4JA 3THAA 1T5AA 2WSPA 5FSEC 3U0HA 2PDKA 1FWEC 2VGBA 1RXOB 3W7CA 3QC0A 2PURA 2UBPC 1DWFM 3W7PA 4AD0A 3RM9A 4HHPA 3H4XA 4KEMA 4W93A 3LPPA 1XQKA 3KVKA 1UUQA 3GIYA 4H9XA 3G0SA 4AX6A 3JUGA 2OKTA 5K3VA 4UTIA 1DIOA 4Z42C 2HE5A 1ZU8A 3BDKA 2FTPA 1Z89A 5BOOA 3ZR4A 3N19B 5T9BG 1NWSA 5IXEA 2X8RA 2YCIX 3LZ3A 1V3JA 2HV5A 4HTBA 1RJRA 5EMLA 3RJYA 1NEYA 3W1XA 1DJIA 4W88A 1ISXA 3UWEA 5IHSA 3MP5A 4HA1A 4JDBA 4LAOA 3O6DA 1YTKA 4S2CA 2KX9A 1UOZA 1KLZA 1WAUA 3B03A 4ZO9A 4DI9A 5XINA 1ZBKA 5A8NA 3WFAA 4JIRA 1NDWA 3IJ7A 5F2GA 4KETA 4ROPA 1MDLA 4AWUA 2QCNA 1ISVA 3C6CA 4JKKA 4S3GA 5HWNA 3I4KA 4CCEA 1GPFA 3UXDA 1JFHA 5REQA 1MYRA 3O63A 2J7EA 5EMJA 3P3BA 3CBWA 1J9YA 2Z0IA 4ASTA 3UERA 1ME9A 3A9BA 3PS7A 4IT1A 5DXXA 5BRPA 3GUGA 2D20A 1DJXA 3GXDA 3LI0A 5A2CA 3LD5A 3VFLA 2J7HA 1R7AA 1EOMA 3C4UA 4JIQA 1PX4A 2OVLA 4EP8C 3GFYA 5CGQA 3NR0A 1CIUA 3A5VA 3E74A 4AZIA 1DQUA 1CGUA 2C0AA 3PN8A 3UG4A 4GA8A 4Z1AA 1K7XA 1H2JA 4K7YA 4Q8WA 4XAYA 1F3EA 1XH1A 2VURA 1VH7A 4DBSA 3B04A 3R12A 3ZWTA 2J7BA 3O8AA 4X3ZA 2ZZ4A 4DYKA 2O0TA 3AC0A 3CB8A 1LT8A 2IQTA 3CZGA 4CN4A 4FX6M 1A5LC 3TYZA 1UD2A 1HFBA 2HRWA 1UIOA 1J6OA 3WNPA 1OINA 5CKSA 2O7QA 2CPUA 3SUVA 1E6SM 4NP7A 3TAOA 4MJMA 3G24A 2FZNA 1V0KA 2D0HA 3USZA 4R53A 1PV8A 4DBUA 1VF8A 4CQBA 5D02A 3AYRA 2OQLA 4I7VA 4B3ZA 3SY8A 3PZ9A 1Q7QA 2GJLA 3N11A 1TV8A 4JHMA 2DT2A 4ONVA 4E4PA 3FHAA 1OD0A 5IFTA 2WZTA 4O1DA 3W38A 3VM7A 1HKKA 1FHVA 2IKIA 2RFGA 2A4AA 3II1A 3R11A 3VGGA 4GJ1A 3V5FA 1GUVA 5F2LA 1TTJA 2DSWA 3AI0A 4D6CA 2HROA 2PGRA 2E6DA 1NP2A 4Y2WA 4XAFA 3I3DA 2JGQA 3BQ6A 1AJ2A 4WOZA 2P53A 2G95A 1UHVA 1TG7A 1V3LA 1YADA 2TYSA 3N2CA 3WL0A 4UC5A 3SSJA 3KL3A 3FGCB 1QJWA 3F5LA 4U10A 1WXJA 4KPLA 3S1UA 3L67A 1IWPA 5CEWA 4O1BA 4PH6A 1EJRC 3ICJA 5FCZA 3EMQA 2VX6A 3AHTA 4DRSA 2FDMA 4J40A 1UOKA 2YFNA 3UEQA 4JQ3A 5C70A 3WF2A 3CMJA 3WG6A 3S6OA 3GZAA 2Z1WA 2YL6A 4NJGA 3PZOA 3P0XA 4YXGA 1J8VA 3FJ6A 2ZIDA 1PS9A 1Q6QA 2BOFX 2ZWYA 2WPBA 1WZMA 1KTCA 3W24A 1RR2A 4JTIA 1XYCA 2HXUA 2EPOA 3BAJA 1CI1A 1SO4A 3OGVA 3AXKA 2TAAA 4JTJA 3TTYA 3Q2DA 3W7IA 4QR6A 1SO6A 3M5YA 5EL1A 4R88A 3TYEA 5IBXC 4IUOA 4KWWA 1IIHA 1OF6A 4TXEA 3NIYA 1PCWA 2VCAA 2VZUA 3QKEA 4UTHA 3BMXA 1PX8A 2D2HA 4GI4A 3TK7A 4GPNA 3E0LA 3ZFHA 5I03A 2MNRA 1EFZA 4Q4MA 3DGBA 3KBSA 1SFLA 4J3UA 4S3FA 5AHFA 2WC7A 3TJXA 4RR4A 2PLJA 4R7WA 2FPYA 4QJ4B 5HMFA 1S38A 3BWWA 3BL3A 4RPPA 4LB3A 1JCJA 3A13A 4DJDD 2Y8UA 1W0MA 1OFPA 3SR7A 4M0XA 3ZJ7A 5D2WA 4TX8A 1J11A 2QS8A 4X2PA 3UJRA 5HBFA 3PHAA 1QXLA 4JEQA 3CYJA 1IXNA 2EHHA 5A6SA 3FXGA 1XLJA 1US2A 3PNUA 3QZ6A 1A5KC 2CLLA 3RF9A 1X1ZA 2ZA2A 4V2XA 1EJSC 3Q37A 4O54A 1MNSA 1E1CB 3TA9A 3PWGA 1AQ0A 3TCEA 4CNOA 1TRDA 1XSKA 4XUGA 4NUWA 3FNDA 1JPIA 1WV2A 1FP9A 2B7NA 5FJOA 1EJUC 4IPNB 1JEZA 1UW9A 5DANA 2VZSA 4AW7A 1UQYA 2G4JA 4IHCA 3WK0A 5C55A 3N4EA 3LQLA 2GVJA 4O50A 1XYBA 4HTYA 1VHCA 5D05A 2ZZ5A 5FJIA 3ZLGA 3DBNA 4O0KA 1E6QM 4RDWA 2W62A 1GVIA 3HGRA 3DU0A 3VCRA 3VNZA 1XD1A 5LIWX 5JU6A 1JVNA 3LHZA 1XLAA 3RNDA 3N17A 3SZ8A 4YJ5A 2CW6A 5AHLA 1OCJA 3L66A 1Q7ZA 1HF6A 2GWGA 1EA9C 5I00A 5CLTA 1X8FA 4JNYA 4Y9AA 3G77A 3PNZA 3T81A 3V3WA 5H2ZA 4LVBA 3FA4A 5I7GA 4AWTA 3CNYA 4E0CA 1KRBC 4NJIA 3OTRA 3LNPA 1QK2A 2RJGA 2V68A 4R7OA 5CGTA 1VCFA 4GBUA 4GXWA 1CXLA 4YTTA 5D2YA 4LY4A 4F40A 4YYFA 2GGIA 4G8TA 5H6HA 1O68A 1C92A 4OIFA 1H63A 4H6KA 4EIVA 3OOQA 3GTXA 2I16A 4X2RA 1BWLA 1IT7A 1IGWA 2PDJA 5LXEA 4M29A 3QHMA 4JQAA 4PUKA 2G5WA 5EYWA 5FI8A 1DIEA 4ILSA 1ML1A 2NV2A 3ITXA 2GUBA 3EA3A 1JPHA 1LLOA 3VUPA 4TVDA 4DQWA 3NQGA 1V03A 1IWAA 3CZLA 2ZX7A 2PF8A 3HURA 4Z0SA 3E6EA 4K1GA 1FDZA 2X05A 2ZZ7A 3IJ8A 4O17A 4JL2A 1BPLB 1FWAC 2R6OA 1TYGA 2WVVA 1C3FA 2VEPA 3HPXA 4QJ1A 3MSDA 2Y70A 1DPMA 1W9UA 4BEUA 1K4GA 1QBAA 3ARVA 1DHKA 3KBMA 2UY5A 3OEXA 4GH1A 3T8QA 4FK9A 4QDWA 2Z2BA 1FBAA 4B9YA 2Z1XA 2PBOA 1PZ1A 2IW0A 5FL1A 3EKLA 3E38A 1BSIA 3BJSA 3N12A 3LG3A 3THDA 4MJ2A 3O16A 3NCOA 2VELA 1IR2A 2G3MA 1W2VA 1UMLA 3CQJA 1Z9AA 3M5XA 3PY2A 4PCTA 3UZYA 4Q7IA 3AIUA 3GD6A 5GVJA 4H83A 1QUMA 5G5IA 4BWLC 2NQ9A 1GKQA 5AZ1A 3NO1A 3PUOA 2H8ZA 4DBDA 1D8WA 2ZUUA 4W87A 4O4WA 1VFUA 1JXJA 1VJZA 3W00A 3G1RA 3GB6A 2R1LA 1QU4A 2EO7A 3RMJA 1TQXA 4WDWA 2X0SA 5AYBA 1JZ2A 3QM3A 1EC8A 4AX7A 4IJBA 1R5YA 2QUMA 1GG0A 4GHRA 3ZR6A 5CJMA 4L1GA 3TEVA 4JQ1A 4C6MA 4GXPA 4W7VA 1EH9A 4Z1DA 3ZVHA 3W83A 3ZT7A 1S3TC 4AD3A 1PZ0A 2VC5A 2WV8A 5LA1A 3LCWA 4ZOCA 1KGXA 2B7OA 4PTDA 2FHBA 4EPDC 3TMQA 4J2MA 4AMCA 3N3TA 3KCLA 3W2KA 3OLIA 1NY1A 3BSMA 2PU0A 2XFRA 4DZ5A 3ZLHA 4JNMA 4GBDA 2ISVA 1A3HA 2FPVA 1XLFA 3URQA 1I2RA 2WCAA 4GNJA 1GW1A 2DUXA 4GUHA 3EWDA 1Q7MA 1L6YA 3CH9A 3L65A 4EK7A 4K39A 3V0TA 1VHNA 3HPSA 1P5BA 1VLWA 1E9ZB 3D46A 4ZO8A 1UZ1A 3KAOA 1OHLA 4TV5A 3F2BA 3PZMA 1BRLB 3HG4A 1XIEA 3TSBA 5LSMA 5C9WA 3GU2A 1M53A 1E4NA 4Q4OA 1JUEA 3RCNA 1DKWA 3WJSA 4Z1BA 4F48A 2WHMA 3T0AA 3BLLA 4DF1A 1S39A 3BLPX 1Q66A 4CVWA 3GH7A 3AXIA 4YVPA 1XLGA 4GOAA 1Z44A 2DW6A 4RE0A 4C6OA 4Q4SA 2WSKA 4X61A 1BYCA 3B0UX 4XZNX 4IZGA 4H04A 2WNNA 3O6CA 1VCVA 1MDRA 2WWDA 4FXFA 3TR9A 3QOMA 3MMWA 4AEEA 1DOSA 2FJKA 5FIPA 1J5SA 4C6JA 3AIQA 1FUYA 3LYEA 3P93A 3OBAA 5CCZA 3PB0A 3S1XA 3EX4A 4O1AA 3U9IA 1A5UA 1FWIC 1DJHA 4XKMA 2EJAA 1J93A 3N9SA 2J6VA 5EFDA 3C2FA 4H7VA 3UZXA 2HJPA 3KOYA 3RM4A 5DMNA 3BURA 5HULA 7A3HA 3IANA 2C19A 4ZZ9A 3B8UA 5AHEA 3A3XA 5M03A 1K70A 3BCJA 4RZBA 1JRBA 1RJQA 3AS3A 3H7RA 3K13A 2FB2A 3CAKA 1XUUA 5I3DA 3L4XA 2X7WA 4C7GA 1R3VA 3S9IA 1B1YA 2ZZ2A 4UCFA 1XDJA 1D3CA 1NF7A 4HHLA 1UJPA 1Y65A 1PDYA 4NJHA 2YA0A 1ZSXA 2GUUA 3LQGA 4GUFA 1TQJA 4LEFA 3GNXA 4A3UA 3NSMA 1LF1A 4GQQA 3G8EA 1XPGA 4MDOA 4GZ7A 4ZSTA 4JDYA 3KP1A 2Z27A 9RUBA 1CWYA 2R24A 1MW0A 2Y63A 1YW1A 2FMOA 4LPCA 2X42A 1UCWA 1Q5MA 4XV0A 1W5PA 3H4GA 3PPGA 3GE7A 6ENLA 3ME3A 2QJNA 2PDBA 4MG4A 2XN1A 2POZA 3UF9A 2BY2A 1YPFA 4O18A 1BLIA 2DZVA 3WLRA 3WQ4A 2FZBA 3M07A 4KGLA 4K36A 4E8GA 3GKAA 4HK5A 1RVKA 2E9LA 5I09A 1Z48A 3BQ5A 2EPHA 3VGBA 3ITOA 4UNIA 1FCQA 3B0VC 1KCKA 2FVMA 3UU0A 1EZWA 1XBXA 3M6DA 4Z2JA 1LYXA 2HE8A 4B92A 2F61A 4S3JA 4WQ6A 3PBYA 4M7TA 5G2IA 3H8AA 3EWUA 1YXCA 4HMCA 4LV4A 4M56A 4ATWA 3QPEA 2PP1A 3NL3A 2O9PA 1TPUA 2DIKA 1Z8AA 4DX3A 4CQCA 1PWLA 3AIEA 2QCFA 3GDTA 5FF3A 1TX2A 3S2LA 2QPSA 4ERAA 3G1SA 2ZUNA 4Z2LA 3GAYA 4AXKA 1PTDA 2AGKA 1NWRA 2QV4A 3BC9A 1E3ZA 3MB9A 3OBKA 3UA4A 1W1PA 2Y4SA 3M0XA 3ORWA 5HAOA 1AH3A 5CPOA 2BOEX 2LLEA 1XRSA 1A4LA 1TJRA 4NYUA 2CLKA 5AZ0A 3JU2A 1GZGA 1JQVA 2DZTA 4LCQA 4JOMA 3LPGA 1XUZA 3NQ6A 3MMDA 4GINA 4LUYA 2HXTA 3ZYZA 1EA0A 2V81A 1H62A 4MZ1A 3MVTA 3TXVA 3AICA 3QV6A 2NQLA 2I1OA 4CD7A 4IH3A 1TFVA 4LSBA 3GAKA 1EDTA 4GY1A 1H51A 5BNKA 3GHUA 4W5ZA 1PSCA 1VEPA 5D9MA 4QCEA 1U1JA 3W7MA 4PL2A 3ABQA 4KWOA 2QCHA 1X6UA 2XZ9A 3MUXA 3KWXA 4UXDA 1NWTA 2XYLA 2J78A 2Q6ZA 1V93A 1GKPA 1IXQA 4JYDA 4I5XA 1GGOA 4B4HA 4Y9MA 3CLWA 4ZB2A 2GQ9A 3GQYA 1N8FA 4GD0A 4GYPC 4EF8A 2ANUA 1YXYA 5CXPA 4DJFC 3LM3A 3MBFA 2CITA 3PZUA 1GCYA 4Q8QA 5LGZA 1H1NA 3P5YA 3UYCA 3OJGA 4OKDA 1UR8A 4A22A 3WDQA 3C2YA 1EJWC 3WD3A 1VFOA 4LUTB 2AOSA 2JQXA 4AVOA 3B3DA 2DSVA 4AY1A 4A8LA 3O3RA 4Q4PA 3OVQA 4ZFMA 4JKLA 4PSPA 4N0RA 4CU7A 3FW6A 3PWIA 3TWBA 4GNVA 1LQ0A 3GO2A 1FCBA 5D8ZA 1P7TB 4DWSB 2ACUA 4AD5A 4RDZA 4ML4A 5IFPA 3RX2A 2Q8LA 1Q2RA 2OZ0A 4DF0A 4IPJA 3AU6A 4QJ5B 4XIMA 1ZJAA 3B9AA 5FEWA 3T9PA 2ZVIA 1UP0A 4FOUA 1EP1A 5D37A 2JBMA 4GISA 4C6PA 2J24A 3DFTA 1OFBA 3QZAA 4HCDA 1I60A 4C6DA 5FF4A 4MNMA 3L7RA 1DJWA 4HCHA 4W9TA 3I4EA 1HUVA 1KM2A 3PZIA 5BXPA 1KM6A 3SQLA 2HCVA 3VNYA 3V4BA 1X7IA 4AISA 1A5MC 5EBUA 1UH3A 4IQDA 3QMSA 1OFEA 2Q02A 4J2PA 1FDJA 3TQKA 4XZHA 3SFKA 1XIMA 4BI7A 2FHCA 2VRKA 3FA5A 4CKQA 4QLLA 2ZOXA 5D2TA 1FWRA 4E5TA 2J4GA 2ZX6A 3WQVA 3RG6A 4LQ1A 5DCEA 2V63A 2FVLA 1DJZA 1HTIA 1YTEA 3VZYA 1QPQA 4OECA 3VXGA 4GYKA 3VE7A 1XRVA 4W8BA 3ALGA 4MZYA 2FGBA 1LORA 1V02E 2JIWA 2OYLA 1A0EA 2PLKA 3WQDA 4LAUA 4L65A 3F5KA 2DQWA 4ZEPA 3OP2A 1V3KA 4UMAA 1A0CA 3ONBA 4QBXA 3WMLA 4J3WA 2H90A 2ZRWA 1F3WA 4MKNA 3OB8A 4NYYA 1OFQA 2DZPA 1KFWA 1XH2A 3KP0A 3BW2A 4BZYA 1M01A 1ZBCA 2WOQA 1O66A 2DUZA 4UOZA 3ZJ8A 5I3HA 1JR1A 3NSNA 2WCSA 2WVUA 3GC4A 2YW4A 3O2LA 4JFWA 1LOSA 2PLCA 4DVOA 3UG3A 1FOBA 3W1QA 4H8HA 1UH2A 3RAOA 3P5ZA 1TVPA 1B90A 1JZ7A 3AUOA 1JGMA 2WSRA 1CTNA 1A49A 3QYSA 3LS9A 3RITA 1RQBA 3M0JA 2PP3A 4JN6A 3W27A 1GVEA 3FGCA 1ONEA 3IUIA 5IDZA 2VX7A 3MZ2A 1HZYA 1LQ2A 3S83A 3NOEA 4HBKA 2OQHA 2Z7GA 3EX6A 1G5AA 5D04C 1EGZA 4FMVA 3G1XA 1F6YA 3IIVA 3NPXA 1A4MA 4UQAA 2ZADA 2FZ9A 1RCOB 1X96A 1S2WA 1XGZA 1EX5A 4QG8A 1JZ5A 1F9CA 3LPFA 3WNKA 2WZHA 2J74A 3MSRA 4DI8A 3PULA 1W3IA 3GDRA 1NDZA 3KFTA 3W1PA 1FCUA 4P8UA 1J01A 3TIMA 4FNTA 5KZ6A 4GI6A 2IPFA 2QCDA 2DDXA 1OBAA 1HX0A 5FD0A 3MTWA 3W7HA 4H9MA 4GGHA 1IF2A 1MEHA 1SZEA 2IMRA 2ZRUA 3IGSA 5CQ1A 2PDGA 3P67A 2P76A 4H9VA 4XD5A 3NO3A 5CLWA 3OLEA 4WKAA 4WDTA 2OX1A 3ITYA 3W6MA 1BXCA 4X9SA 3VINA 3ES7A 3VMPA 3TKFA 2XIMA 1FWBC 2VFIA 1BD0A 3GNOA 4Y6GA 2J7FA 4KFNA 1XLIA 1UR4A 3V5CA 3HGOA 4EE9A 1OC7A 1YEYA 1YKWA 2WMIA 4WF7A 2BOGX 1MUWA 3MU7A 4C1LA 1DEDA 4Q8OA 2BZNA 1KBIA 1TZZA 5ECVA 2V2CA 2ZQ0A 3GY1A 1NJJA 2V3GA 1BVWA 2IKGA 1GYLA 2RDXA 1ZP4A 4FO4A 3RLGA 2E0PA 1NAL1 4NVTA 4AZGA 3BLFA 1BGAA 1N82A 3T40A 1EEXA 2ABAA 3LU2A 1MXSA 2F2KA 4MJ4A 4ZODA 1R86A 3REQA 4B3KA 1FWSA 3FVMA 1ZBWA 3LCHA 2WJDA 2YXGA 4G7EA 4AY7A 3H24A 1DWGM 3R8GA 3A64A 1VC4A 3HPZA 3L0GA 4LEQA 3MDUA 1TWDA 3WF0A 1R0MA 5XIMA 3T2PA 3E0WA 3QOKA 3L0KA 5DBUA 4B5UA 2J8GA 1SW0A 2NX1A 3MQTA 5A69A 4J28A 4M7SA 3ZIZA 5GQBA 3FYOA 4N02A 1NSJA 4DUWA 3A4WA 5E1QA 3T7VA 3CUZA 6XIMA 2PCQA 1W17A 3QFWA 1RZMA 2OGJA 3KCOA 4ORMA 2VGIA 1C91A 4AD4A 2OODA 3TYBA 4RNIA 3GZ3A 3BV7A 4K8EA 2FGLA 3SM0A 3DKJA 1P6WA 4LALA 4B90A 3KBJA 3RHGA 1H0IA 2Q8XA 1Q8AA 2TSYA 4QEHA 2G3IA 1X97A 1AMYA 4WJXA 2VFFA 3SCSA 1B31A 1Q6EA 5TF0A 5TAOA 5TQLA 2DT3A 1QOPA 5LHEA 3LCFA 1T8QA 1QDSA 3T6CA 5G4WA 1JCXA 5LA0A 4BA0A 2CWNA 2HK1A 1HGWA 2DSUA 2CLFA 3GUWA 3WMBA 3UCCA 4OVXA 3S9YA 1TPVA 4LWWA 2H9AB 2C15A 2REQB 3N29A 2VWTA 3VDHA 4IJRA 3IGHX 4KCVA 3AOFA 2OLHA 2A21A 2QV5A 2P88A 3RO6A 4JAWA 4JXCA 2A79A 2OZ8A 4XQ6A 4UQEA 2XJ7A 3QH2A 4LFYA 3OHIA 1H7OA 3DYOA 1TMQA 5A8PA 3BTNA 3A5FA 2IPGA 1AZ1A 3ABZA 4O4VA 5HK4A 1G9HA 1UWUA 3NZ1A 1C7TA 3SECA 2GGGA 2QMJA 4CQAA 1UZHA 2ACSA 4ACYA 3LZ5A 1S5MA 4LCSA 1KNWA 1XM3A 4HNVA