4FAMA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with 3-((3,4-dihydroisoquinolin-2(1h)-yl)sulfonyl)benzoic acid (17)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 121
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4famA00
4EXBA 4JQ2A 2PDIA 3LQGA 3CAQA 2IKGA 4YS1A 4WRHA 3DN5A 3GHUA 4XK2A 4XVEA 1AH4A 4DZ5A 4XZNX 1OG6A 3UFYA 3LNMA 4EXAA 2R24A 3P2VA 2FZ8A 2NVCA 1PZ1A 4XO6A 4XAPA 5LIYX 5C7HA 1X96A 2F2KA 3V0SA 4L1XA 2ISFA 2ACUA 1J96A 3LZ5A 1VP5A 3V0UA 4LB4A 3WBXA 1AFSA 4JQ3A 1MI3A 3BUVA 3Q67A 4OTKA 1ZQ5A 5DANA 1PYFA 4PRRA 4L1WA 2PDXA 1UR3M 2FZ9A 3V36A 3BURA 5LIXX 1FRBA 2HVNA 4JTAA 3COTA 2BGSA 3RX3A 3CMFA 4LB3A 4FA3A 1AH0A 3R6IA 1LQAA 2PD5A 4ASTA 3UZYA 2PF8A 4NKCA 3UYIA 4GCAA 3EB4A 1RY8A 4IGSA 2VDGA 2PZNA 1IHIA 4GQ0A 2ACSA 3G1RA 3LZ3A 2BP1A 1HW6A 3H7UA 3UP8A 4DBWA 1XF0A 2HE8A 2HVOA 2I17A 3R58A 5HNTA 4H8NA 4LAZA 4GQGA 5LIUX 3WCZA 3GHSA 1MZRA 2ACRA 2INZA 3D3FA 3EB3A 1A80A 1R38A 3R43A 4WEVX 4PUUA 4YVPA 2CLPA 2PDPA 1Q5MA 1Z9AA 2QXWA 1HQTA 3M64A 2PFHA 4ICCX 3LENA 2HEJA 2INEA 2PDLA 2BGQA 2PDWA 3R8HA 3LEPA 1Z89A 4ZFCA 1S2CA 2IKHA 1YNQA 4HMNA 4Q3MA 1T41A 2PDMA 1ZUAX 4LBSA 3R94A 1JEZA 5AZ1A 2DUXA 4GIEA 3GHTA 3CV7A 4JTQA 2FZDA 3WBWA 2PDBA 3C3UA 1K8CA 4QX4A 2HE5A 1EXBA 2IPFA 4I5XA 1Q13A 4JQ4A 3O0KA 3LUTA 2PDFA 2P5NA 4IJCA 3V0TA 2PDCA 4MHBA 3F7JA 4R9OA 1S2AA 4DBSA 3KRBA 3FX4A 1MRQA 3R8GA 3UZZA 2PEVA 1ZSXA 4FAMA 2PDKA 3R7MA 3WG6A 3NTYA 3B3DA 3LD5A 2IQ0A 1US0A 1X98A 3LN3A 1EF3A 2PD9A 1ZGDA 3H7RA 4WDTA 3GHRA 1ADSA 1GVEA 2IKIA 4LBRA 3CV6A 5JH1A 2R9RA 1RALA 4JTRA 3CAVA 4QBXA 4YVXA 4WDWA 1S1PA 5HA7A 3M4HA 4H7CA 1PZ0A 4XO7A 3O3RA 5AZ0A 1IEIA 2HV5A 4WDXA 3WBYA 3GUGA 2DUZA 5LIKX 2PDHA 4QXIA 1C9WA 1AZ2A 1QWKA 1AH3A 5HNUA 3U2CA 4JQAA 4XZMX 5JH2A 4XZHA 3S3GA 1YE6A 3ONBA 2IS7A 4XZLX 4PRTA 3EAUA 3FJNA 1EKOA 5KETA 2J8TA 2A79A 2IKJA 3UZWA 3UWEA 1SM9A 3RX2A 1S1RA 2ACQA 4G5DA 3CASA 1Z8AA 3N2TA 2WZMA 2FZBA 1EL3A 2C91A 3LBOA 4JIHA 4F40A 3UG8A 3Q65A 2I16A 4YU1A 2FGBA 4PR4A 4LAUA 4XZIA 4RPQA 3MC5A 3G5EA 4FALA 1YNPA 4WDUA 4Q7BA 2PDJA 3BV7A 4JIIX 4JIRA 3UGRA 3RX4A 4PMJA 3ERPA 1M9HA 2F38A 1XGDA 4GABA 2IQDA 3BCJA 2PDYA 3H4GA 3V35A 1T40A 4JTCA 4JQ1A 1PWMA 1RY0A 3DOPA 2WZTA 2ALRA 1Z3NA 2IPGA 2FVLA 2PDUA 4HBKA 2IPWA 3QKZA 4XVDA 1AZ1A 1YE4A 3MB9A 3M0IA 3UZXA 2PDQA 1LWIA 4PUWA 4JTDA 3LQLA 1XJBA 4WGHA 2IPJA 4QR6A 2PDNA 4GA8A 5M2FX 2HDJA 1PWLA 2PDGA 2DV0A 3T42A 1QRQA 4FZIA 4GACA 1VBJA 3ONCA 3VXGA 2AGTA 3N6QA 4IJRA 1X97A 2NVDA 4YVVA 5LIWX 4DBUA 4AUBA
chains in the Genus database with same CATH superfamily
3WMSA 4RDWA 3FDKA 1K03A 1XR2A 2JKEA 2QPUA 4GOAA 3FVDA 4YS1A 4NILA 2WC7A 1TQXA 1L6YA 3GH5A 4O8RA 3L67A 3NG3A 3UT0A 4HYRA 1W9DM 2QYGA 4HMDA 1RBAA 4YMZA 4O15A 4R88A 4RR4A 3RILA 4DWSC 3NXFA 4GO8A 4NIRA 3UA3A 3ARPA 1QO2A 2VC7A 3JRKA 4P8WA 2HCVA 3TOYA 4HHHA 4FP1A 3K2GA 1BPLB 3G2GA 4JQ3A 1VFOA 4Z42C 5CJMA 3ARRA 4RNFA 4UBPC 3MI2A 1N8WA 1JZ5A 1E9YB 3GC4A 4K8EA 1NJJA 3H2AA 3PTDA 3VU2A 1EA9C 2X8RA 3RU8X 1HX0A 3ZXWA 3R6IA 1RVKA 2VVSA 4UCFA 2X1UA 3SCRA 3MPGA 3QYQA 3M1ZA 1F3WA 2ACSA 4D6EA 3GR7A 4AF0A 2XM1A 2V81A 4XZ9A 4DO7A 1C92A 3HFTA 2B7QA 5I06A 3H8AA 2VZOA 1HN1A 3V5FA 3C2OA 5M1TA 4Q4RA 3WLSA 3DI1A 1JJKA 3DENA 1CLKA 3LHZA 8A3HA 1KWGA 1QNSA 3OVRA 1FWGC 1FOBA 2RJGA 4AIEA 2A3EA 2ANUA 3VIJA 1R2TA 1IT0A 3T07A 1WX0A 4GBUA 1XICA 3E02A 3C0LA 4ZCWA 4DUOA 1E9LA 4E4UA 5EFFA 1IZKA 3BW2A 3RIKA 4NF7A 4BI7A 1NWTA 4TOQA 2A6LA 3MWAA 2AL2B 3GXIA 2DVTA 1XS2A 1EWEA 2EPHA 3T6CA 5DFAA 1TWWA 4EOUA 2XFWA 3C0QA 5KZDA 1R7AA 2DFAA 5D9NA 4G1NA 2WK2A 2ASHA 1XFCA 5C70A 2GVJA 1KFWA 4D2JA 3NVDA 4HPGA 4JYEA 5LHEA 2VFHA 3TYEA 1HUVA 1EHAA 4M56A 3KBMA 2BY3A 2QJJA 3IVSA 3BAIA 4K39A 1QT1A 3FKKA 3ZVIA 3M7SA 3E9AA 3HQNA 1BWVA 2GJXA 3F7JA 4F0MA 2XGIA 1Q4NX 3LG3A 4IGMA 2EHHA 2J6XA 3ZJ6A 4DBSA 1O94A 2EPLX 4DNHA 3WL0A 1PEZA 4WZHA 5CBJA 2VCAA 3QR1A 4HK5A 4DM2A 3MO4A 3VX0A 7A3HA 3WLJA 1GTHA 5CZTA 3DKLA 5I3KA 3RMEA 3W7LA 1LWJA 5A6LA 4ONVA 3ARYA 1R47A 3GTFA 4KQNA 2FH6A 2V5KA 4HNLA 2GVGA 4NY2A 3GHRA 4W8BA 4J3TA 3GR8A 2J24A 4QJ1A 5E0CA 1PL9A 5I79A 5I02A 1Q3NA 3GY1A 4WDWA 3UQNA 4TTGA 5HOSA 3S8HA 2GJLA 2IQTA 4NZFA 2V9DA 1MMFA 4C6IA 4CU7A 3EX4A 4D6HA 1D3HA 2NW0A 3OGRA 4YLWA 1KFBA 4QXIA 2OOGA 1VFLA 4NX5A 4CD5A 4R53A 1WXZA 2GQ9A 4XV0A 4KCWA 1XIJA 4E2OA 4KPLA 4LWWA 2R91A 3NQ2A 4J40A 2EPKX 4Q4MA 5DF0A 4KKXA 2BASA 1NVMA 4XWUA 3RX2A 3VUSA 3E6EA 4G5DA 1Z8AA 2VFIA 3I10A 3JU2A 4NNAA 2VX5A 3ARUA 3AIQA 1W1VA 3O0FA 1U1UA 2I16A 4ZOEA 3L4UA 1L0PA 4LY4A 2E5BA 3I6RA 4KFOA 5F4SA 4DJED 4GG9A 3W01A 4LVAA 3UXAA 4ZO8A 2BFGA 5K9XA 2A3AA 3B8WA 3WK1A 2VURA 4PYSA 1JDCA 3WF3A 4REQB 3VDAA 1FFRA 1LLOA 4E5TA 3M0KA 3CQHA 1XV8A 1M9HA 1S2UA 2Y8KA 3REQA 4L4MA 3GVGA 3AMKA 4MJ2A 1KD0A 4J4KA 4XIAA 4JNZA 1GKQA 3BCJA 1OCQA 1CGWA 3NOEA 1ME7A 4KCVA 2DZXA 5BOFA 2UZ9A 1FWBC 2J62A 1Z44A 3HMJG 1PWMA 4UQEA 3W86A 3CTTA 4JCMA 1QI2A 3DOPA 1PUDA 2D2OA 1TMHA 2XWEA 1DOSA 4FLRA 3VOGA 3TU9A 1KKOA 3E5PA 1JUKA 4LS1A 4CLMA 4JEJA 2D1ZA 3W4RA 1F61A 1HJUA 2O55A 4LF2A 3HG3A 2GZXA 1L2UA 3LI0A 4R9XA 3VK5A 3C2RA 2DSZA 1DWGM 1JDAA 3D46A 5F2IA 1GZJA 1QK2A 2G50A 3T81A 3GFYA 2QUUA 3WLPA 3CHCA 5LSMA 2YBVA 3LBCA 1BVZA 4RLIA 1UWRA 3U4FA 1NWUA 3SCUA 1TRDA 3CV1A 1IT7A 2FQIA 4WF7A 1V0MA 4ZVJA 4MJ4A 3LPFA 4MPQA 3QOMA 4N4PA 3KHJA 4MNLA 1KLZA 2P0IA 1OHLA 3AOFA 3V75A 2CITA 1Q66A 1VEPA 4PA8A 3CEPA 3DN5A 2XINA 3VFCA 2WANA 4FLSA 3CHEA 5CZSA 2IXVA 4IP7A 3WJZA 3N6HA 3QN3A 1YNYA 2INFA 4O12A 3G24A 2Y0FA 1JCJA 2OB3A 4I9JA 3RR1A 4LC6A 2QV5A 2DZBA 3B8IA 4I6KA 1DJWA 3K4DA 2VEKA 1P7TA 1NH6A 2B0MA 4KGJA 7ODCA 3RCNA 1FP8A 1SW0A 1ONRA 2NLYA 7CGTA 3MI3A 3LZ5A 2VEPA 4NRRA 3FHQA 3BUVA 1HKVA 1TX2A 3W1MA 1GORA 5M5DA 2OQHA 2WM1A 3VZXA 2GDQA 4C1LA 3CWOX 4AD0A 4MWAE 4HNNA 3E0LA 3BURA 3H53A 4KERA 3ARZA 3OJGA 3TMQA 2D20A 3ZLGA 3P61A 5D8WA 2Y5SA 2AMXA 2AOSA 3L4XA 2PC4A 3GKAA 4FA3A 4A8IA 5BOEA 3W53A 2D69A 5HWJA 2PD5A 1B57A 2QJMA 2YZRA 3N2XA 3QF0A 3TAKA 3UD6A 3O06A 5D9OA 3N15A 4GJ1A 1WOAA 4EWND 3LZ3A 4QNEA 1AD4A 2NV2A 1P43A 4HSOA 4LAZA 1B3XA 3LPOA 1CXHA 1KFKA 1GJWA 2ZXQA 1N7KA 2BVDA 2FYMA 4MAZA 2XIBA 4J3VA 2HBVA 4ACZB 1BWKA 2WKJA 1H2JA 4GX8A 2VQTA 3L23A 4DJDD 1LTDA 3KM8A 1Q7ZA 4RCXA 3H70A 2VNCA 4H9TA 2PP3A 4P2VA 4RZ6A 2E67A 1VPQA 5CEWA 1PJ9A 3HIJA 1JZ4A 4CVUA 5DQPA 2FZMA 3WMBA 3MKVA 5AYIA 2VWSA 1QOPA 2IW0A 4CD8A 2VFDA 2E5CA 3G3MA 1LOQA 4Z1CA 2W91A 3U5YA 4V2XA 1KM2A 2AGKA 1EC7A 3NPUA 1VJZA 2J7GA 1EQPA 3AIVA 3GIYA 1V3HA 4B5TA 3NQFA 1NWRA 3P74A 4PCPA 5JU6A 1UZHA 4TV6A 3CUXA 3WBAA 1IWPA 2VEFA 2E9LA 4AWSA 3V0TA 1DV7A 3VD4A 4JCLA 2XVKA 2PWHA 2C6QA 3NWRA 1A5NC 3FLUA 1M1BA 1WAUA 2OGYA 5HWMA 3PWAA 1H1ZA 3LI1A 2OWCA 3RYSA 3ITXA 1NQKA 4O1EA 1TPUA 1XG3A 1E0UA 1LQ2A 2YYUA 1UQYA 5AHFA 4WSHA 3I68A 4ZO7A 4HPNA 2D73A 4MIMA 3AS0A 2XN0A 5JQ9A 4F0RA 4YYFA 1HFBA 3BSGA 3QC3A 1JI2A 2A4AA 4WDTA 3NQMA 3S5OA 4E4PA 2HS6A 3W1QA 1I4NA 5F2MA 1UWIA 4LBRA 3SQMA 2E8YA 1JYXA 6TIMA 3LMYA 1R3TA 4LUTA 4QROA 5AYXA 1IWAA 4LGXA 2WLYA 4H7CA 4NI8A 3AAMA 3KCJA 5A6JA 1LRNA 1KM5A 3MDUA 3QRHA 3A3XA 1NOUA 1E73M 1BG4A 4XBSA 3C2EA 3BG5A 3U2CA 1IWBA 1EC9A 2XVLA 3BDKA 4Y9AA 3CUIA 1YE6A 3GTIA 3ONBA 5LXEA 3K1GA 1JZ7A 4FXRA 1AW5A 1TUXA 1XLFA 3FJNA 4HK6A 4YCOA 5G5IA 2IXUA 1K7FA 4QEHA 3D47A 5DO8A 1ZPTA 3LSCA 3LX9A 1FDZA 4ILSA 3EWYA 3E38A 4S3FA 4HYVA 3Q4DA 5DELA 1H63A 3N2TA 3UPMA 5DRCA 1EL3A 4M6UA 3LBOA 3WLIA 4F40A 4Y6GA 4IFKA 1XGEA 1WKDA 3Q58A 9CGTA 2AKMA 5I3FA 2WCSA 2YLLA 3V1HA 3UNDA 1XKYA 1F76A 5JVLA 4CEXC 4BR1A 2EG6A 4N9BA 1HJQA 5A8NA 3BLKA 2AQVA 3S1XA 2X1IA 1K9EA 3L2MA 4S3EA 3BZGA 4AWUA 3OG3A 4IQLA 3VVGA 3NOYA 2JEPA 2CZDA 4UQBA 3P0XA 1W32A 2D2GA 1I45A 2NQZA 3TCSA 1GGOA 4NJKA 5LNRA 1G67A 1ADOA 1XCFA 3S9YA 3CUGA 1YPIA 3E0IA 5I0DA 4O1DA 1W3JA 3C56A 4GQRA 4GK8A 5FJIA 3ABRA 3ITVA 4GYPA 3L4VA 4UC5A 3VIIA 4NT0A 3RR4A 3HG2A 1ECQA 3UZXA 1EO7A 1X8CA 4GRSA 1UQZA 4TVCA 3LQLA 3TE9A 5LHFA 2OLHA 1QDSA 4A3YA 4MFDA 1J0YA 2CESA 2OYMA 1HKJA 2VJXA 3GDKA 1HTIA 3TZFA 2X40A 1MW3A 4UXDA 2HQAA 2VC6A 4MB1A 3NL6A 4PMDA 2FPVA 1XYZA 4D6IA 1PWLA 3W22A 1WDQA 4U5IA 1POJA 3M0MA 1UKOA 3IIPA 3PPCA 4C6NA 1HJVA 1I1WA 4HU0A 1X97A 1H1YA 1MQQA 3LOTA 3NO5A 5CXPA 4O1FA 3N1AA 2W5FA 3WJYA 2PDIA 3WLRA 1EGZA 2DW6A 3ITGA 5CG7A 1SO4A 1UB3A 4HK7A 2WMFA 3PZOA 1H7OA 3CV2A 3VNDA 3HJEA 5CBIA 4AY1A 3TYBA 5BW6A 3IS4A 3AIUA 4ZTYA 1R6WA 1AODA 3WUBA 4C5ZA 4XAZA 4EXAA 3P2VA 1KBBA 2Y5JA 1FCUA 3V5OA 4BCEA 2VO5A 3NGJA 4PTVA 2C1GA 3LTYA 4LAKA 1XLGA 4DN1A 1L6GA 3N73A 3V0UA 1UR1A 1KGUA 3P62A 2VOTA 3DI0A 5CQ1A 1OF6A 2ZCGA 4HJFA 2YW3A 4IQDA 3T8QA 3PNUA 5LNWA 1PCKA 1UR3M 2XH2A 3C2VA 3WX7A 2WKGA 4XAFA 3V4BA 3BOLA 1E6QM 1CEOA 1PTGA 3GBEA 4S3DA 2BXZA 2ATMA 1XXXA 5CSYA 1JCLA 3MBFA 4A35A 2ESCA 4FR1A 1JZ8A 3WEOA 2PF8A 4IM4A 3A3HA 2FVMA 4RE0A 4U31A 4P8UA 2EJAA 2ZXBA 1WCGA 5FF0A 1KXTA 2PZNA 4X9YA 3G3DA 1TZ9A 2DSUA 5CG0A 3S2CA 4C6EA 1R3QA 1EBHA 2BLEA 1NARA 2GFTA 1ECEA 1EYWA 1TWSA 2WMHA 1QFEA 3BGJA 3QMRA 3MV01 3KWSA 4JFVA 3KX6A 1QBBA 4LCRA 1LROA 3CH0A 1WKYA 4QE5A 3MUZ1 1C90A 4GKTA 3ZJKA 2CLPA 1IGWA 2A6NA 2GWGA 4Q8MA 1OFQA 1JDDA 2X30A 3GDBA 4NZ1A 1JZ2A 2CC0A 3S1WA 3WQEA 3WFLA 2XSBA 2G3JA 3U57A 2C79A 2UY4A 4QSHA 3RJXA 3WD3A 1VIZA 2VENA 4CN6A 1AG1O 3W23A 4Q8OA 1ZUAX 2V6AA 3LRLA 5BCAA 3A9BA 4RZ4A 1OJXA 3WBWA 5GJNA 1E9IA 3EXTA 3FSTA 4JFTA 3DFNA 2OTDA 4JIPA 4RXGA 4ZE4A 3RDKA 2HE5A 3L0KA 4FNTA 4LV4A 5BU6A 1KM1A 4QLJA 3RPDA 1W0MA 4ERAA 4I5XA 3GDTA 3N3MA 4GY7A 4PULA 5EB8A 4XKYB 2ZA1A 3PN8A 3TEVA 1F3TA 4NZ5A 3MQTA 3II1A 1P4CA 1WYIA 1W1B1 3L7RA 3M6YA 5FJJA 3BOXA 2QULA 3WH7A 2E5DA 1FDJA 3BSHA 3SUVA 4R9OA 2ZZ5A 1XIIA 4ZSUA 3KRBA 4IMDA 2DT2A 3BAWA 3QQWA 2ZYFA 3UBPC 3NTYA 1PDZA 3WDPP 4YYCA 1MW1A 3LM7A 4ZODA 2Q09A 4OOUA 1JZ6A 4Y9PA 4QEEA 1L6FA 3JUGA 1A49A 1H62A 3L68A 3TXVA 2XIOA 2P10A 3WEMA 2GJNA 4D8AA 2AQWA 2V5JA 4K7YA 4WD0A 4S3AA 6TAAA 3EX2A 5XIMA 3W7MA 3S5ZA 4IL2A 3N2BA 3WKZA 4PBEA 3P8IA 1XD1A 1OF8A 3VOJA 1C91A 1WDDA 3AZSA 1KCXA 3GH4A 2C13A 5FL0A 1HF6A 1GVQA 4ERIA 3WNPA 2P8CA 1MW2A 3UNTA 1PSCA 3T08A 5JH2A 4G7EB 2BY1A 1IXPA 2P53A 4OOZA 4WR3A 1AUSL 3M0HA 2JKAA 2OEMA 3NL3A 4K1GA 3LV6A 4IIDA 2Z26A 3PAJA 3HPZA 4EAMA 1ELSA 4ZBCA 3WH9A 5JBFA 2R82A 1B3YA 3OZMA 4GFIA 3BGAA 2ZXDA 1YPXA 5GJMA 6CGTA 3Q65A 3NM1A 4DLMA 2RGLA 1EH9A 2Z6IA 3WDRA 1SO6A 1IIGA 4PFMA 3RFAA 4EF9A 4YTQA 4UOZA 2W79A 1ZP3A 3KBJA 4US5A 2WHMA 2QF7A 3VD3A 3W7GA 2Y8VA 1CXLA 2CFFA 3E74A 1S3TC 3N19B 1H4PA 3PSWA 3POHA 3CU2A 3LXBA 4PMOA 3GS6A 3WMLA 1PDYA 2IQDA 2F61A 3H55A 3QOKA 4L4OA 4NZJA 1S5NA 4RNHA 3CC1A 4GI4A 1W9UA 4DWSA 2V2HA 1UG6A 4DIAA 4AU0A 1MNZA 1U1HA 2YCEA 3PWGA 3M5XA 3LCHA 3GD6A 3UJFA 4O17A 1A4MA 2WXDM 2FJKA 3BG3A 2EXOA 3WQ5A 4IP4A 1O68A 5EYWA 1E6SM 1M68A 4LEQA 1YDVA 1DQUA 3GNRA 3NVTA 2PDQA 1F07A 2JFEX 4P61A 1XJBA 4O0ZA 1R3WA 3W27A 4KW2A 1AMYA 1CI1A 2WHKA 3P8JA 1BXNA 3HGOA 2GQAA 5F7UA 1B90A 1TMLA 2CHNA 3EDJA 3BG9A 3UWVA 3EEZA 2DV0A 1QNQA 2J79A 4CUCA 4EE9A 1Q6DA 1V77A 3UCCA 3UYCA 4JAWA 1GVIA 2NVDA 3L0NA 4ZE5A 4M5PA 3VDGA 3SM0A 1CGUA 2VFFA 2FTYA 5CPQA 3OBAA 1V02E 4US5D 5D4YA 1PO9A 3WK0A 2NX9A 1VPYA 1KCZA 1W2PA 3W0KA 5BMWA 2J9XA 1OGGA 2XIQA 4A21A 4RZ5A 3V7PA 3HURA 2NVCA 2PBOA 4H04A 1AD1A 3CUZA 1G0CA 3L2IA 2VC9A 4C6JA 2FMNA 2PTWA 3AMGA 4Z2JA 1RR2A 3W7KA 4DWSD 2J7FA 4L1XA 2DZVA 5EMKA 4JIQA 2H9AA 1KRCC 4AD4A 2WMIA 4H83A 4UTLA 4C6DA 2W4XA 4L65A 1WNOA 4DBEA 1I2NA 4QS5A 3WNLA 5C7VA 3DU0A 3BZJA 1A5SA 4FNRA 5FEXA 1GVOA 4DF2A 5T8GA 4FNQA 4FOUA 5KZ6A 4C7GA 3QFEA 2Y4SA 1H09A 3OP2A 3TJXA 3SUSA 5GPRA 4C6LA 4PBFA 3TJLA 2DH2A 1YW1A 3ZWTA 1KRBC 4Q4SA 4IXXA 4IMEA 1A47A 4KEMA 3G1RA 4FO4A 2OG9A 3QXBA 3W02A 4WY0A 1QPNA 1LBMA 2WAGA 1XIHA 3EDEA 3BMXA 1HNYA 3G1SA 4MNJA 3ZFHA 4QAWA 3D3FA 5FSEC 5F4XA 3DFYA 3UCQA 5FJOA 4IX2A 4UTWA 4BA0A 2V5CA 4CCZA 4AEOA 1I9CB 3E96A 2GVYA 3CNYA 2Y1HA 4NZCA 3IAQA 3N2CA 3G0SA 4AC1X 3IIVA 4KFNA 4LW7A 4AHOA 1RK6A 1OY0A 1LLWA 1WO2A 2D24A 5K4ZA 2Z0IA 3PR2A 1IEVA 2V8ZA 3TW7A 1IV8A 1B3VA 3TK7A 3AS3A 2C8NA 1N2VA 4NJIA 3A47A 3CV7A 2RDTA 2NXIA 3RF9A 1XDMA 4L4LA 1V6WA 3FSUA 4TU1A 3TC6A 4J9JA 3VNIA 4X60A 2BZNA 1KBJA 3BAXA 4CCEA 1OFEA 1E0XA 2VFEA 1SW3A 2UY5A 1QI0A 1S3HA 2HTMA 3O0KA 3GFXA 3IUDA 4J5NA 2NXHA 4OVXA 3WF2A 4HU4A 3L12A 3SRFA 1DJIA 3ANVA 5LNUA 4M19A 3AICA 3NDOA 4O54A 3AHXA 4HA0A 3A21A 4FAMA 3CPRA 4RDVA 2ISWA 3WF4A 4N9CA 2PTDA 4HA3A 1F5ZA 3MO7A 3OOQA 1F3XA 3VOIA 2XYLA 4D9PA 1EO5A 2J88A 2G97A 2ICSA 3PUEA 1NDYA 2PA6A 4MY9A 1QCWA 2QAFA 4ZQMA 1CX9A 2WQPA 1J10A 1RD5A 4G8TA 3UG5A 1EF2A 4MZ1A 1GVEA 1PIIA 2ZDRA 1E70M 2RH9A 2Y7DA 4R5EA 4QDWA 3CAVA 2W63A 1FDYA 1AA1B 4X3ZA 4UTFA 4XUYA 4KCUA 1XKJA 5AZ0A 1FQ0A 1ZAHA 3GXPA 4W5ZA 3WDIA 2PDHA 3OO2A 4EPDC 7REQB 3TSDA 3LPGA 3W72A 3PWIA 3QTPA 4S3CA 3LHUA 4IH3A 2G3NA 3BW3A 3WY1A 1W3TA 2GSJA 1R9ZA 3P3BA 3L66A 2O56A 2QEZA 1ENUA 4PMNA 1TO3A 3MUCA 2V3GA 3UZWA 3BQ5A 8TIMA 1OQFA 3MMTA 5I78A 5CPOA 2PLCA 1S1RA 2ACQA 1VLWA 1G4TA 5DX7A 4W4QA 3GVWA 3DG3A 3L4YA 2C91A 3ABOA 2FPYA 3KEHA 5BXPA 4B3LA 4YCPA 5ABEA 4LAUA 2JIEA 1KW1A 4NNCA 1C8QA 4XZIA 5IBXA 1UR4A 4UZUA 4J3SA 4IPNB 4Q33A 3DC8A 3W7CA 1QNRA 3BV7A 2YCLA 2ZX5A 1L9WA 2D2HA 1DYSA 2TMDA 4AX7A 1OFBA 2BXYA 1K3UA 3EEGA 3LLXA 3AWOA 3S2LA 1PX8A 3W6LA 5AHLA 2ZA3A 4IP5A 2VQUA 2REQB 2DPEA 2WLZA 3NM3A 1H61A 2V3EA 3GXFA 2QR6A 3AZRA 1GTEA 4DAIA 4GGHA 3M0XA 1OX4A 4Z2GA 3FDGA 1UKTA 5C8BB 1A5MC 1SGJA 3U6WA 1E15A 2RJHA 1E4MM 3C8NA 1LRTA 5FL1A 3WLMA 2EKCA 3W83A 3GH7A 3QR3A 2Y7EA 4QR6A 5ABFB 3ZMRA 1PKNA 4ZR8A 4AD1A 2DZPA 1F9CA 3LNPA 1UC4A 3AXXA 2QCGA 3C52A 4E2VA 3MCMA 5KMYA 3EXSA 2DIEA 3QV7A 3E49A 1VBJA 1Y7VA 4UNIA 2VGFA 3NA8A 2G3IA 4GXPA 3N6QA 3GNDA 1BGGA 1BF2A 1DPMA 1E1FA 3RMJA 3M46A 2ZOXA 3C86A 4HT3A 1B30A 2PGRA 4G7FA 2ZADA 4WJXA 2E9BA 3DH7A 3WLKX 1XL9A 1EWDA 5I3GA 5F2LA 4LJ3A 1OG6A 3MVIA 3IPWA 1W1IE 1DEDA 4HCHA 4DYKA 4J27A 4HZ7A 3NQCA 1A0EA 1ICPA 3TSMA 5AHEA 3UWUA 3T40A 3ABQA 4IPIA 1HP4A 2VR5A 3MI6A 4ZTXA 4PBGA 4RNIA 4JTLA 1PX3A 3GU2A 1ZQ5A 1C29A 2QHAA 3QC0A 4LNYA 5IFPA 2CLEA 2UV8G 1MUWA 3STCA 5CJ5A 4DBDA 1PYFA 4JX4A 3O16A 4B9YA 1GJPA 5D2TA 1XYMA 3L2LA 2C3ZA 4JTAA 4Q22A 4JOMA 1BTCA 3MY9A 4J3XA 4AF0B 4LB3A 2ZUNA 1NU5A 4XAYA 2QVHA 3QGKC 1PHWA 3KCLA 4NKCA 4I3GA 3EB4A 2Y70A 4UFKA 3DGRA 2VGIA 3QHNA 4GQ0A 3ALGA 5A2BA 3H12A 4IMGA 3N29A 2E9MA 5CLTA 2I17A 1FCVA 5A6AA 2EKGA 4FXJA 3TR9A 1TYGA 4HIBA 3CHVA 2I7GA 3H2MA 5FAJA 3VCRA 2O9PA 1R3YA 1HXJA 4AZ7A 3GUWA 5D09A 2Y89A 4LPCA 4MB4A 4HOXA 3VC6A 2QPXA 3C4UA 1FHLA 3KS5A 3R1ZA 2NQJA 3NZGA 1NFGA 3W82A 2H3BA 2G95A 4JTGA 3QLDA 1GNXA 1RVGA 3R5EA 2INEA 3ME3A 5A6BD 2Q3OA 3ATYA 4G6CA 3GBDA 3URBA 3SW6A 1X6NA 2YCIX 3PPFA 4ZFCA 1Q7MA 2W67A 3ARQA 4PMXA 4RUBA 4XG1A 1LBLA 5AVNA 4D1JA 2PDMA 4H6RA 4IT1A 5HNRA 2DZSA 2Z27A 5E0KA 2YB1A 1W91A 3FJ6A 4XD5A 1ZJHA 3BW4A 1MQRA 1UP3A 3NQBA 1H5YA 3EA1A 5T9BG 1S39A 2GJXB 1XH1A 1HVXA 2A3BA 2XVGA 3IJ7A 1W5NA 4DJEC 3AIRA 3KBWA 3I3EA 5FOOA 1TPB1 3I3DA 4UNKA 1DP0A 3MUAA 1TJ2A 1J8VA 4JQ4A 3SGZA 3CT7A 1E6PA 2I9EA 5D2WA 3SURA 2H3DA 2O92A 5EMUA 4X9SA 1VCVA 4LFYA 1YADA 4B90A 1DL3A 4LS2A 3URNA 1FHVA 1KRAC 3EPOA 1K7XA 5XIAA 1J12A 4A29A 4DXKA 1OG0A 2PDKA 3CK5A 1H7PA 2CWNA 3PUGA 4QCEA 1BYBA 4DF1A 2B7PA 4HGXA 4QIUA 1SSDA 4JKMA 2G3FA 3OYXA 3B9EA 4PMZA 3W73A 1L8PA 5DXYA 3SB0A 4GZEA 1YPFA 1SQ7A 4B5UA 2Y7FA 3ANUA 5KSWA 3LMZA 2ZUWA 1IQ8A 3T0CA 1RALA 2WNNA 1OIMA 3QSRA 5C9XA 3QKEA 4C6CA 1PZ0A 5A8OA 4CQCA 1J2WA 2DVUA 3WBYA 1WZLA 5HPCA 3FXGA 6REQA 1C8XA 4XAGA 4GVIA 1AH3A 3BMWA 3WH5A 3EPNA 3VPLA 4XZLX 3FN9A 4K68A 3H22A 2AQOA 1UPMB 4J3UA 4O0KA 3UPBA 1NP0A 1LBFA 4DUVA 3N6JA 3S5SA 3VZYA 1M03A 4S3GA 1XW8A 1WPCA 4H9ZA 1IXNA 1UW9A 1YQ2A 1GT8A 4JIHA 3W29A 5G2HA 4IIHA 2HSAA 4PL2A 4AAJA 3REQB 4JL2A 2NX1A 1V3LA 3MP5A 3WK2A 3RLVA 1H0GA 1Z41A 4F66A 1EUNA 1DWAM 3W1AA 3CPUA 1HG3A 1I2RA 2BY0A 3ANYA 2P0OA 2V3DA 1PVNA 3OA3A 2G37A 2OELA 4IPJA 4L80A 1SJBA 5D30A 1U22A 3VUPA 1TX0A 1F8MA 3A6OA 3S2NA 4FSAA 1AJ0A 4LC8A 3H2NA 3KP0A 2WV8A 3GB6A 1B3ZA 2X2YA 4JQ1A 3FK4A 2PMQA 3B40A 2WZTA 2CLOA 1WV2A 2XZ7A 5AN7A 4QJ4B 3N9KA 2PDUA 3MT1A 2V38A 3P7YA 3WFAA 1DE5A 5HMFA 1X1OA 5BYWA 3FJLA 3M43A 5FSDC 1XQLA 4GNJA 1D3GA 3GKFA 2IPJA 3NPVA 1GUVA 4J7RA 3AXKA 3THQA 3EWUA 1FH9A 2HDJA 3ZR4A 3PTMA 4OIFA 2Q8LA 4O8AA 1VQTA 3MYPA 3YPIA 4R33A 1JUEA 4DJDC 2AGTA 1OC6A 3WQCA 1UUOA 3B0XA 3XINA 3RPMA 3GRIA 1MXGA 1GOWA 1PYMA 1P0EA 3CM4A 2PS2A 1UASA 2CZFA 4Q7NA 3CAQA 4JHOA 1P7TB 1Q7QA 3N34A 3JZUA 3WFZA 3GZAA 1A5AA 4EPEC 2YCKX 1H5VA 2J74A 3KTSA 1UH2A 1DWIM 4MG4A 4LVDA 4AZ5A 4XO6A 1UHVA 1GQKA 1TA3A 3STGA 1GZGA 4LUSA 4ZQOA 1M65A 3V0SA 3URAA 3KBVA 2ACUA 1P5BA 1DVJA 2CPUA 1X39A 2PTYA 4DZIA 2ISVA 4HNVA 2BODX 4C1KA 1U1JA 3PZMA 3CXOA 4ZZ9A 2PCEA 3BLIA 5DY3A 4K37A 3ZO9A 2PE4A 2J9ZA 1BTMA 3RX3A 1TV2A 4U2YA 1CENA 3W1LA 4NAFA 5F1UA 1QWGA 1C8YA 5KITA 4FLQA 4Y96A 1WZKA 1Z48A 2CETA 3UPWA 4AVOA 3OODA 2WM0A 4N0RA 1EUAA 5L9FA 4DLFA 5EFDA 1W3HA 2Z24A 3WJXA 3WELA 4CCDA 2QLYA 3ABSA 4Q6JA 3EX3A 1I75A 1RD6A 4KS0A 2FGZA 4GIAA 4RV3A 3VOFA 5I3HA 4CNUA 2XIMA 4UTTC 1MZRA 4FXFA 5FA5A 3IGHX 4Q8QA 4AXKA 2HBXA 3DFQA 3OBKA 3CMJA 3WD4A 3SY1A 1BXCA 5I5RA 2CIPA 3DYMA 4B4FA 4ICCX 3GQYA 4OE7A 1E6NA 3R8HA 2NWRA 1FWDC 2VUNA 2ZXAA 4BEUA 4QQ3A 1XDJA 1SR0A 1S2CA 1S2TA 2WW5A 1SPQA 5CC3A 2ABAA 4JS3A 3NQVA 4CVWA 4JFUA 2G4FA 7TAAA 2A3LA 3W7DA 5EKYA 3SGGA 3VGHA 4F48A 1R8LA 1G7VA 1GCYA 4HQVA 5BXTA 5AHIA 4U4MA 4NASA 3N17A 2YDSA 3GZ3A 1YX1A 1SJCA 4A4AA 1S5TA 1T0OA 2FB3A 3WN6A 3TUUA 1F4AA 3W7EA 2KX9A 3ZLHA 3O6CA 2XJ7A 2JBMA 1OCNA 3T0AA 2Y85A 1EP3A 4KIEA 1RJQA 1L6WA 3AIEA 2OXNA 4UQ9A 3Q37A 4Y9OA 4GC3A 2C1IA 3QR0A 4MDPA 3TIMA 1ZSXA 1M04A 2OZ8A 1E6RA 2P88A 4GE8A 1B9BA 5A8PA 3CIVA 3G1AA 3U48A 1O66A 2CXEA 3R7MA 4D1IA 4LUTB 2CLHA 2JK2A 1RZMA 3G1DA 4WJEA 2OFJA 4DUXA 1TZZA 1T5AA 3F4NA 3I4KA 1QR7A 3LBMA 4BI5A 2PRHA 1ZBKA 3OHIA 4M7TA 1DE6A 3UESA 7PTDA 3W7OA 3UWZA 4JTRA 1XYLA 3KVJA 1NSJA 4Q8WA 3VIHA 3M4HA 3RNDA 1IEQA 5H8PA 4R34A 4WKAA 3U2ZA 2QUNA 4WDXA 1VFMA 4AZBA 5TQLA 4AYGA 3GUGA 2DUAA 3GAYA 4DHGA 1K1DA 2FHCA 4YWIA 1A4LA 3USZA 2C71A 1GOOA 1QWKA 2OT0A 4MFEA 1EJTC 3VNZA 1KTBA 1T96A 2R14A 1ITQA 4C6MA 5J5DA 1HO1A 4ZOBA 3VNKA 4IFKB 4N9EA 1E4NA 2AAMA 2FHBA 4TVDA 1UP2A 5EBAA 2J8TA 5LYRA 4H41A 3IVUA 4CQDA 3XISA 2R1PA 3GM8A 4UFLA 1Q85A 1XP3A 4E38A 2OQLA 3K4WA 3D5HA 2EJ1A 5GQBA 3BLPX 1OABA 4N6EA 2CHRA 2QGHA 2GYIA 3EDFA 3KDOA 4OUEA 4IX0A 4D6DA 1UR0A 3CZKA 4W84A 2A3CA 1YNPA 3NDZA 2PDJA 2PGFA 2QJNA 1K7EA 2E6DA 3B8DA 4KWSA 1X1ZA 4K1WA 1XBZA 2GGEA 2O0TA 1OSEA 4HJWA 4AZ6A 4GYPC 5IHRA 5LKYA 1PTDA 2FDMA 4KWVA 1BEUA 4Q4KA 4W5UA 3V3WA 4BF9A 2QV4A 4IMAA 4UFMA 1OT2A 1EP1A 1T6MA 4O57A 3T8LA 5A8MA 2CWXA 5CSUA 3LY0A 4JDYA 2YX0A 3B9OA 4UUIA 4J2PA 1EYEA 4XISA 5FJRA 3SADA 3OGSA 2Z4GA 1OFDA 2ZRYA 3SFKA 3WD2A 3MB9A 1LWIA 1I60A 2XVPA 1E9ZB 3G1XA 1ZRQA 3N12A 3W1TA 1XRFA 5J5RA 5FD0A 1FWIC 3TWBA 1OX5A 4GA8A 4GY0A 1DTUA 3CO8A 4Q8TA 1SZRA 2Z6JA 3LGDA 3LERA 1SVDA 5JIPA 5TAOA 3MVTA 4O53A 3LXCA 3CPGA 2OT1A 4HZ8A 3TYZA 2R8WA 4KWOA 4H6KA 2AAAA 2VUYA 4JQ2A 3ITCA 3ZIZA 4PODA 3LHYA 1OCBA 3LCXA 3EMZA 2OZTA 1CBGA 1V6XA 3HMCA 1EPXA 3SJNA 3H6OA 1YYAA 3IIXA 3CHFA 5C9RA 1NIUA 1AH4A 2VZSA 3VMNA 4BQ3A 1UIOA 1KBIA 1JD7A 4URIA 3UFYA 2HVMA 2WPBA 3QFWA 4PTXA 1SJAA 1PZ1A 1LL6A 2BSLA 5J8LA 2CLMA 3HU7A 3B8SA 4CCCA 4LCSA 4V1XA 4RE2A 4NI3A 2ISFA 1UR2A 5G2IA 4ZGYA 3SRKA 1ESWA 1VP5A 3VI2A 3G0XA 4BF7A 2NQ9A 3STFA 1XRTA 3K4AA 4QDPA 2BV9A 1DJZA 1DJGA 5ECUA 4ALDA 3FA5A 3BC9A 1MW0A 4L1WA 2Z1XA 3NEHA 1ZJBA 1RXOB 1ZHAA 4OV9A 1TTJA 1JRCA 5K9DA 1O60A 3C3NA 3UETA 1FH7A 4RW3A 4TQTA 2WZEA 2ZZ3A 3MMWA 4KWUA 4HN4A 1XC4A 4AY7A 2H8XA 4AZGA 4I8DA 2JALA 1YKWA 3BANA 5FCZA 2ZZ4A 3AHYA 1QW7A 1KGXA 3W38A 5E0FA 5HINA 4E8DA 2WHLA 4LVGA 3S6TA 2QCHA 1JCNA 4EACA 1N82A 5D33A 2HXTA 3LGEA 3W88A 4PUUA 4MNMA 4ZEPA 3MHFA 3ARTA 1ZCOA 1SFSA 3VKKA 2WSRA 2X1TA 3M64A 3IGSA 5PTDA 4O11A 3WLHA 2JEQA 4KGLA 4ICMA 1GOKA 2PDWA 1S5WA 4D6JA 1K9FA 1P1MA 5DMMA 9XIAA 3A9IA 1NM9A 1WA3A 4Q3MA 4ICNA 1P1XA 4ROPA 2ZZ6A 2V68A 3QH2A 2VGBA 5HQMA 5DMNA 2XM2A 4AIBA 4BS0A 3HF3A 3DESA 5GNYA 5ABTA 4QE4A 2EO7A 1SSGA 1J5SA 4N02A 3BV4A 2VCCA 3I7QA 1V7YA 2PU0A 2XU2A 2H8ZA 4FI4A 4XZBA 3BLDA 1FH8A 4JYFA 4LAMA 3HQ1A 3RLHA 1W3KA 1GVRA 1W6TA 3KHDA 1TVNA 2C19A 3FA4A 4KRZA 1OINA 4B3ZA 3WD1A 2F6KA 2ZA2A 2RDWA 3SRDA 3U3HA 4E8GA 5HQEA 1LQ0A 5SWUA 4O18A 4R85A 3UR2A 3EX6A 1FWNA 2Z7GA 3WQVA 4F0KA 5A94A 3TR2A 3TQ0A 3DG6A 3G6LA 4H9MA 4HVXA 4ZA0A 3F1QA 1A3HA 2WZHA 1U5VA 3N4AA 3N2OA 2JIWA 1GVSA 1VJIA 1AW2A 2Q71A 1KCLA 5GJPA 1AJZA 4C5YA 4QLKA 1V0NA 3MSGA 3EDKA 4EPKA 1ADSA 1XLHA 3TA6A 1EA0A 1EP2A 4GISA 4I9MA 2L5HA 1D7KA 2FMOA 3H2FA 4X22A 4ATLA 4F9DA 3B4UA 1V6TA 5J04A 4Z0JA 3O15A 4AZHA 4GJJA 1GQJA 5AOUA 1SMAA 4L61A 1XM3A 1E6XM 2QCFA 3HG5A 1AL8A 4H8HA 5CZKA 3RO6A 4ACZA 2PTZA 3ZQ9A 2GGHA 4IG2A 3GG7A 2OSWA 2X05A 2QW5A 1UD4A 2BB0A 2PWFA 2VYOA 4H7ZA 2A79A 2BG5A 4Z1YA 1U30A 5I03A 1TV4A 3M0ZA 1J01A 4JNMA 2PRLA 3P84A 2GK1B 4ZQRA 5C5YA 4IWWA 4M6QA 5E09A 3VM7A 1EBGA 1HP5A 3GNPA 2OX4A 4OZOA 3VC5A 4EK7A 3WF0A 1WXJA 2FGBA 2OQYA 2ON3A 4UFHA 1A3XA 2W9MA 3CLWA 4OKDA 5DEZA 3V5CA 1YEYA 3GSMA 1EX5A 1QATA 4MYAA 4P7RA 3D6NA 1QOQA 1YHTA 3THCA 1IIHA 4DWSB 3OA5A 3UR7A 1VRDA 1KFJA 2VD9A 4TMBA 3IGUA 4AIOA 1TIMA 1M3UA 1A5LC 2E09A 3RO8A 1TFVA 3ZT7A 8XIMA 4HCLA 3HJZA 4GI9A 2WSPA 1BVNP 2Z1VA 1XLJA 3GDRA 3BMVA 4Y9MA 4WHBA 3EOUA 2WSKA 2RDUA 3GWQA 3W71A 4Q8UA 3DFTA 5K9CA 2BBFA 3PG9A 3RM9A 3B97A 3UVIA 1O1HA 3HPFA 5EGRA 4GXWA 3E0WA 3TC7A 2XISA 1KFLA 3W7HA 2ZUVA 4O1BA 4F4RA 3RPTA 3NEVA 3O7UA 4AG0A 1KXVA 3S1GA 2QQ6A 4LH8A 2VMFA 4LYRA 4DZHA 2JF6A 2QCEA 2PDGA 3NSXA 6PTDA 1YTDA 1LCOA 1MEIA 4US6A 4P7OA 4JIEA 3A5VA 3TN6A 1B4KA 5HUPA 4HCDA 4MY1A 2V5LA 1FWEC 2WWCA 3AC0A 3TV8A 1A5OC 5HAOA 5BRPA 3FYOA 1DORA 3NQ8A 1CXEA 3THDA 3PFRA 3W2JA 1VFSA 2F8QA 4D72A 1N55A 1OYBA 2V5DA 4O13A 5CGTA 3SCVA 4MZYA 4U2ZA 1RQHA 2J78A 2H9AB 4XVEA 2WMIB 1LYXA 5AYBA 3WNNA 1XSKA 3PZ9A 4N4QA 1JYWA 3ORWA 3BVJA 1W31A 2E7FA 1AL7A 3MMUA 4ATWA 4M3PA 3MHUA 2E40A 3JVAA 1UJPA 3A64A 4GYKA 4AX6A 5DY2A 1HIZA 4DI9A 4CU6A 3KLKA 4Y9NA 1IR1A 1IYXA 1G5AA 1FRBA 1EJUC 5E6ZA 4M1RA 1LWHA 1CW2A 2BGSA 4DJEA 4WY0B 3JR2A 1LQAA 2NT1A 2HISA 1M01A 2CZEA 4LY8A 5D05A 3EKZA 4UTWC 2WB5A 4MADA 3VMOA 3F2CA 3TDFA 1F8IA 2DDXA 3H7UA 3I65A 2HVOA 2YPIA 3G1YA 2VKZG 3K8MA 2YXGA 3R4IA 5LA1A 4GQGA 1KV8A 3MUXA 1K6WA 1GQNA 5FJPA 1Q63A 3VYLA 3WDJA 4Z2LA 1U5JA 2FDSA 1BSIA 2INZA 1K02A 3R43A 1N8FA 4GUJA 1KQZA 4LVBA 1YDNA 1SZNA 2Q01A 3NQGA 4POCA 1TWDA 1CWYA 4GVGA 1LOSA 3WDHA 3LENA 1VYSX 1RSCA 3LCFA 3SJ3A 3SQSA 3S6DA 3T2PA 4HTBA 3GG8A 4IIGA 2ZC1A 3MP4A 2IKHA 5DMLA 2ZUMA 1T41A 3WH8A 4PTMA 4GIEA 1TZ7A 1QI4A 1XIFA 1YXYA 2GL5A 3CZ8A 2QUVA 1UZ1A 3KDNA 5G2WA 2DEPA 3R25A 3CZJA 3PZIA 2D0HA 3CQKA 3MBDA 2B4GA 3KRZA 1JPDX 2VX6A 1EX1A 2PBGA 1SW7A 1J0IA 3UA4A 4LRSA 3UWYA 3LXAA 3W26A 1PZ3A 1QPRA 3HZ3A 3INPA 4XTIA 4AWTA 1GHSA 1M7XA 4A2SA 4ORMA 2EQDA 1BQGA 3KE0A 1EDQA 4AYSA 2AL1A 4RJEA 1R2RA 1WKFA 3R8GA 2NSXA 4W9TA 2VZUA 4WLCA 2YXOA 3WH6A 3CB8A 3WEZA 2E1WA 3WG6A 3ISIX 1O4UA 2GWNA 2E3ZA 4YTUA 1ISXA 4GWEA 3LD5A 7TIMA 2IQ0A 1PKMA 1V3MA 3OYZA 3LN3A 3O07A 5FF7A 1QK0A 4O4WA 4M29A 4A05A 3NDYA 2PD9A 1ZGDA 4GI6A 3OHMB 1MXSA 3H4XA 5HATA 1LORA 3AHTA 4AD5A 2TAAA 4O16A 1PXGA 6ENLA 4U10A 1X6LA 4P7NA 3G1FA 5JUVA 3IJ6A 3N9RA 2SFPA 2OZ3A 1RP9A 3TNOA 4AZCA 4M6VA 1TPFA 4A8RA 3AMCA 3CLMA 3O6YX 2PSNA 3LSBA 2NSOA 3AJ7A 2YA2A 3HGRA 2VEGA 4S39A 3M5YA 3BE7A 2CZ5A 2YZ5A 3ZT5A 3G22A 4NX0A 3LDVA 1E51A 2A1YA 1EC8A 5IM51 3N11A 5IBXC 4J2MA 4GQQA 4LTSA 3FXYA 1YXCA 4TMCA 1V51A 1VB9A 1QHPA 1A0CA 4DELA 4B91A 3BAKA 1US2A 4HA4A 4UB9A 1O5KA 1JRBA 3CASA 1QI5A 4DY1A 2YCLB 4PTNA 1J11A 4NG3A 3S42A 5BWAA 1EZ2A 3H2EA 3LTPA 3EXRA 4DJDA 2FIQA 2W61A 3KXQA 5H91A 4GVFA 3NAVA 4U28A 3G5EA 1JPMA 2EPNA 1R5YA 3TX9A 1DHKA 5IFTA 5E70A 3UGRA 3GNOA 4PMJA 4MVAA 1RQEA 2FFCA 1DIOA 1OX4B 3VGEA 2B81A 2F38A 1XGDA 4GLEA 5CPNA 3AFBA 1W3NA 2H6RA 4GYFA 3VM5A 4UFIA 3H4GA 1OWQA 1JPHA 1EJVC 2RAGA 3KVKA 2J6VA 1Q6FA 1FY6A 2GDUA 4QTGA 3NSNA 1XDLA 4LOCA 4Z0SA 5FF3A 3T0TA 4JTEA 3MHGA 1JCTA 1W9PA 2Y5EA 3LK6A 3PB0A 5LNVA 1HT6A 4XVDA 4BQ4A 3PB2A 5DRIA 2I14A 2X7WA 4JTDA 1XINA 4I9TA 1GEQA 5HANA 1W3LA 1KCKA 1BRLA 4KF1A 1M7OA 3P60A 2ZX9A 4ZOAA 4NHVA 4ZOCA 1TPEA 1UR9A 1EHNA 1P0KA 3VDHA 4IHCA 1ADDA 2GGJA 1QI3A 3VDCA 1WE5A 5AB3A 3VXGA 4O10A 2BXVA 3VIPA 4NJHA 3SSZA 1S38A 1Q8AA 3PBGA 3CUFA 2Y6ZA 1FWHC 4EXBA 2V2CA 3R79A 4ORIA 1TV8A 1Y5WA 3QZEA 3LM3A 3DGBA 4S38A 4HU8A 1JAKA 3CS2A 1S2VA 1XBXA 4UTTA 4R7WA 1V03A 5I3DA 5KTLA 3TYUA 4MWAA 1ODUA 1H1NA 3HG4A 3DFPA 4PL1A 1XUZA 2MANA 3WUGA 2PRMA 1LDCA 2PF0A 2WYSA 3THAA 1W37A 1OBAA 1GG1A 1SFTA 3C0JA 3FJ4A 2IUZA 1V3KA 3W85A 1LRQA 3L5LA 3KLLA 1AFSA 3IIOA 4GC4A 1MSSA 1JG9A 4FPSA 1DJHA 4YTTA 3A3WA 4O28A 4CN1A 4R7OA 1QUMA 4AHQA 1T99A 2VRJA 2ZRXA 2RGMA 2Y24A 4GZ7A 1O5RA 4W7VA 4PC8A 4UMAA 2DSWA 3TZNA 4DYJA 2NQLA 3W00A 4AHPA 3AWNA 1JF5A 1EFZA 1OEPA 3P5ZA 2PTXA 2ZZ7A 3N4EA 4JFSA 3SDOA 1DWJM 2E28A 4AEFA 4P7QA 1KLYA 1POKA 1J4EA 4JKKA 1VLIA 4AZIA 2XWDA 5A8QA 4GHRA 1VRXA 4TR9A 3UZYA 3UYIA 4L56A 2QCNA 3MSRA 5KINA 3PPHA 4ATDA 2PWVA 1UBSA 5CJNA 3PANA 1T8XA 1HW6A 2Z1SA 4GIRA 3USBA 3WQ4A 4B9ZA 1XI3A 4LAOA 2QNEA 4E3TA 4I6VA 4IZGA 2DVXA 2W0UA 3BCFA 2ZKMX 3OU8A 4ZFMA 1KFEA 2WC4A 5EU9A 1DXIA 4MWAD 4JN8A 2RFGA 1HQTA 2EBNA 4H8UA 5DT5A 3MV11 3TLQA 1ZLPA 1NY1A 4AW7A 4DYEA 5I3JA 1W56A 1EIXA 1SFJA 1LT7A 2PUZA 1DKWA 2OCZA 4MTVA 3QGVA 4MB3A 4ECLA 1KWKA 1ISVA 4Q32A 2Z00A 4HMNA 3ITTA 1VGAA 3RUBL 4RW5A 3P67A 4DPPA 1HZYA 1VBHA 4EP8C 4WSKA 1ZCCA 4WOQA 1PBGA 1W54A 1UZ4A 4IIBA 3F2DA 1ZAIA 5D9PA 4UQDA 4G9PA 4OBSA 3C3UA 3ES7A 3L4ZA 5FEPA 5MKGA 1FTXA 1LL7A 1FA2A 3U0HA 1M6JA 3OZYA 1R0MA 4W89A 5H1WA 5C55A 3FA3A 4Z17A 2J8GA 4H3DA 3T2OA 1R7OA 4LF1A 2WC3A 2QCMA 3SRHA 3M47A 3S0CA 1NP2A 3OZPA 1H49A 3H4WA 4LEFA 4H7VA 3SGUA 1CECA 1NQ6A 4K8GA 1Z32X 4CNSA 5B80A 3VMPA 4HKPA 4Y2WA 2X7VA 3RRAA 4IL0A 1RPKA 4B4HA 3GYCA 1FCQA 2CERA 1XLIA 1WQ5A 2PCQA 3UZ5A 3V16A 2G96A 3UY7A 3AMDA 2YL5A 4IFOA 5DXXA 6REQB 3ABZA 1XX1A 3IV8A 3HPXA 5JH1A 2R9RA 3RM4A 3N4FA 4XBJA 2FB2A 4H9VA 1B54A 1B9ZA 1KV5A 1FHDA 1UD3A 3FKRA 4HNTA 4Y7EA 2DUZA 2OYLA 1W3IA 4MKSA 1FWSA 4WVXA 1JI1A 2NX3A 4JQAA 4XZMX 2FZNA 4MKNA 2D3LA 1ZY9A 4DEFA 1BAGA 2EPOA 3M5VA 1EKOA 1WDRA 3UWWA 5A2AA 3VABA 3ZSTA 5CLWA 1DQWA 4KWWA 4ACYA 4WSJA 3NZ1A 1PKYA 4XTDA 3OQ8A 1XGZA 3B0UX 1MNSA 4A3UA 5F1VA 1KM3A 5I07A 4CN4A 2NUXA 4PR4A 3FIGA 3W28A 1X8FA 3PBMA 3EOLA 3BQ6A 1ISYA 2D23A 3SO7A 1JNEA 3PZNA 4BKNA 1S5MA 5LA2A 2ZRWA 3WQDA 3N3TA 3WQFA 1DIKA 3LRKA 1ZBVA 4AISA 4PRWA 1C9DA 1PV8A 3UJRA 3B9DA 1E55A 1K4HA 2PLJA 4GH3A 4GABA 4TO8A 1GOMA 1XWYA 2PWUA 4UMCA 3S83A 5M03A 3GNNA 1FWWA 1OFPA 2QGYA 5AC7A 2BHUA 3SUUA 3PP7A 1C8VA 4GZIA 2GJRA 4XUGA 3AU2A 2FVLA 6XIMA 3O2LA 5FI8A 4E0CA 4KMQA 3R13A 3PBYA 3CZLA 3ARWA 1FP9A 5FKYA 5IDZA 1HO4A 1ONWA 3HQOA 4JTIA 3M16A 4XZWA 5T9CE 3GXMA 3AS2A 4WX2A 1ZJIA 3KW3A 2PDNA 2XVNA 1T7LA 4PUNA 1HGYA 1CXIA 1OFAA 2Q02A 3W7IA 4CU8A 4YNGA 1WOBA 2GJPA 4DO4A 1UWTA 4GACA 1RHCA 1REQA 3T55A 1VENA 3QY8A 2YXXA 4DJFA 3BCDA 1V93A 4A3RA 2ZVIA 2HNEA 1DHPA 3TFCA 2YW4A 1NEYA 1W1YA 4RDZA 1ZFJA 1IZCA 2DH3A 3W1NA 3CUJA 3GG0A 3TTOA 4TVUA 1BKHA 1R3RA 4R3UA 1VHNA 4LUSB 5CPMA 1J6PA 3EZ4A 4JHZA 5JXQA 3AISA 1XPGA 1OC7A 5U7SA 4HNUA 2QJGA 3SCNA 5FEZA 3WQWA 2E25A 2KAUC 2GUBA 2VFGA 1E6ZA 3LNMA 2I5GA 3HOJA 1EB3A 2QDEA 1KBLA 4B5WA 5REQA 1U33A 4KRTA 4OECA 1GZ1A 2X1RA 2XPKA 1KA9F 2Q8ZA 2VR2A 1W9XA 2JQXA 1I2QA 3Q67A 4NAFB 4OTKA 4G2DA 4TX9A 1FXQA 1LUCA 3HPSA 2BS9A 4NP7A 2PLKA 1BVWA 3R0KA 3FS2A 3F4CA 3LLDA 2B31A 1PIGA 2VM8A 2X41A 2NV9A 4LS0A 3AIWA 1ZBCA 4B92A 3RCYA 1X7FA 4ASTA 3B05A 3FAWA 4M1BA 4S3JA 3VGBA 5C71A 2EPMX 4JNYA 1XLMA 4PUDA 2J7EA 2V3FA 1HL9A 4QISA 1YBQA 2QDHA 3UP8A 3PJTA 4DJFD 3ZR5A 1WZAA 3PM6A 3W3OA 4QRNA 2OSYA 4G1KA 1JXKA 1KXHA 3KRSA 3PULA 3BSMA 3HBLA 1ZP4A 2CHOA 4IICA 3TQKA 1A80A 1R38A 2UY2A 4YVPA 5AC4A 4ROQA 4FX7A 3CQIA 3W9ZA 3POCA 3TYDA 3TP4A 2PFHA 5LZLA 1NF0A 2BGQA 8CGTA 3UXLA 5H6HA 2XH0A 4MUPA 3DKJA 2Y8UA 3FY1A 4JYDA 4E8CA 4LU0A 3NL2A 3GW3A 4EF8A 4D6FA 4HHLA 4F0SA 4A8NA 1KO0A 5EA9A 4J1OA 3AYTA 1K8CA 2OO0A 4ZO9A 3B03A 1JDEA 3LCLA 3RN6A 4UTUA 1X7IA 1PB0A 5CC5A 1HL8A 3C61A 4FIQA 5K4XA 2GDVA 2QPSA 1S5VA 5HULA 4CQBA 4INFA 4W93A 3VIGA 4JTTA 2OSXA 2RHGA 3I3BA 3ALFA 3LUTA 5TIMA 2PDCA 3P14A 3PBWA 3HGJA 1J0JA 2CBVA 1ITCA 2ZDSA 2Z2AA 4X61A 5CCZA 2OR2A 2DZAA 2PZ0A 1FCBA 1MRQA 3B8VA 4RKAA 1Q65A 4XBKA 4WOZA 3B0YA 2ZZ1A 2YB4A 1E4IA 3E2SA 3NUKA 3L4TA 1GK8A 2VRQA 1US0A 4MKVA 1E0WA 1K77A 3MANA 3NL5A 1QTWA 3GYEA 3H7RA 4L4PA 4O1CA 1FVPA 1GW9A 4GQBA 4U33A 2EG8A 3QEZA 1NDWA 1S2WA 2J27A 3T05A 1XSJA 3O63A 4PTWA 1ZJAA 1QW8A 3UG3A 1QOXA 4X0VA 1TTPA 3PF3A 4LANA 2WCGA 4D71A 3R2GA 2I56A 4M82A 1P0DA 1QNVA 2YCJA 4JHMA 1UKSA 1SR9A 5C6MA 3WNMA 2ZX6A 3H26A 1AZ2A 4W8LA 3NURA 3C6CA 2VWTA 5LNSA 5AHNA 4E2BA 1BYCA 2AMGA 4IQJA 3BK0A 3EWCA 3QW3A 1VJSA 1EPVA 1AVAA 1P6BA 1B3OA 2UY3A 9RUBA 3WSUA 3Q94A 4WXYA 3FGCA 1G94A 5CPSA 3SCTA 4GD0A 4H9XA 1MXDA 2OJPA 2WCAA 1H41A 4EX4A 2FGLA 3TYAA 2W27A 4H1ZA 2VT0A 4FIRA 2PAJA 3IJIA 3DHFA 1VCFA 3GE7A 3W25A 4WIWA 1W17A 5C0QA 1G4SA 3T09A 2NUYA 4YIWA 4CD6A 1EJ7L 1TCDA 2QAPA 3CIWA 5E9AA 4C1NA 4Y8EA 3CAWA 3RX4A 1K6AA 1A5BA 2PB1A 4QJ5B 4LALA 4TV5A 1LM1A 4G56A 3JZEA 2QUTA 3VGDA 1EGMA 2VC5A 1YTEA 2Q6ZA 3VCCA 1HGWA 3LTSA 3R89A 5CAHA 1UPPA 3WLOA 3DBPA 1MDLA 2PDYA 1YMYA 1IZJA 3S2JA 2BOGX 4PMYA 4ES4A 3GK0A 2R6OA 1KR1A 2G8ZA 3EOSA 1UUMA 3CL8A 5I7GA 4W87A 4M7SA 4OBRA 3W2MA 5CPLA 1TVPA 1ZENA 4GBDA 8XIAA 2IPWA 3Q2DA 3B0VC 2WMKA 2V69A 1D2KA 2Q8XA 1MRAA 3TW6A 2C7FA 3FV9A 1XBVA 1V02A 5FESA 3V18A 3RLGA 3E5BA 4PUJA 1EJSC 1RP8A 3ENLA 1VFUA 1GYMA 4FR6A 3P5YA 2DZUA 1GVFA 3H24A 2WSQA 5BZAA 1M7JA 3M6DA 2VDHA 4DX3A 2A7RA 4NAEA 3AI0A 4F8XA 2PURA 3IJLA 2POZA 4DBUA 5LIWX 1JDFA 1EIBA 1CLVA 1VEMA 7ENLA 1IGSA 1TR9A 1ODZA 1J0KA 5E1QA 3A4XA 3GAKA 2HPIA 1Q4WA 1XUUA 3B04A 4IOTA 1XYAA 2CBJA 1RLDA 4WKHA 2R24A 4QITA 2ZE3A 1W9VA 4OHQA 4DUWA 1BLIA 1VHCA 3GR4A 3WDQA 1HJXA 1WDSA 1EZWA 1GG0A 1X96A 1VYPX 1OZMA 4EKJA 1W5MA 3CQJA 1PHQA 3O6DA 5AY7A 2O7QA 5FEWA 3C2YA 4L9XA 3ZS4A 1V7AA 2CLIA 4W86A 1V6VA 4R27A 1JF6A 3AROA 4GVHA 1ITUA 3PHAA 4PUMA 1UA3A 3LHVA 3WENA 2QKFA 1VD6A 2HVNA 3CQ0A 1G9HA 4GUFA 3J7HA 4H2HA 3COTA 5BXRA 3AXIA 2BOFX 1D3CA 3NR0A 2YDRA 3RGTA 2NZLA 2XSXA 2HZGA 4KRUA 4U5KA 1E1CA 4DNMA 4QHRA 1VPXA 3L21A 4IGHA 4BQ2A 2EGZA 1WUFA 1BXBA 4LBUA 3W2LA 1L2QA 2HXUA 2X09A 2I5IA 3AMLA 4YXGA 1LZOA 4NNBA 1SMDA 5CBBA 2FTWA 4Q8PA 1B2YA 2E6FA 1IE7C 1CGVA 4JKLA 3FEQA 1JPKA 2QZRA 3BOFA 5DMYA 4RK8A 1TV7A 3W2UA 1KGWA 4UTMA 4Q8NA 3PJXA 3W1UA 4YPJA 3E2QA 1QASA 1KM0A 1KR0A 1OIFA 2JGQA 5A8GA 1DXFA 1NAL1 3DECA 2X42A 4C90A 5C9ZA 2RDXA 3EWXA 4YJ5A 5D8ZA 3NSMA 4P7LA 3R94A 1JEZA 4GYJA 3CEUA 5AZ1A 2A7NA 3LCGA 4JTQA 3AO0A 3GIPA 1W9BM 2GSEA 2TYSA 2HS8A 4FF5A 4JX6A 1XIEA 1JAEA 1ZZMA 1NFBA 4ZENA 4H00A 3KAOA 1I2PA 1H0IA 2F7FA 4JBRA 3CL7A 5EPDA 4ZXOA 5RUBA 1OFOA 2YA0A 4GUHA 1G4EA 2PDFA 5C2XA 3KZPA 2MUCA 2GOUA 4K2SA 2ZICA 3ABXA 3HV8A 3DFHA 2Z25A 2F6XA 1LL4A 1XLKA 1DJQA 3JW7A 2VR4A 2BWGA 2PEVA 4UR9A 1TJ1A 3L4WA 3IUIA 3PBVA 3OPSA 3TJ4A 1V3JA 3VILA 3NFUA 4MOZA 1QPKA 1FWJC 4B5XA 3EBVA 2BTMA 4FF7A 4BI6A 1Y8BA 2O7SA 3B8TA 1AQFA 1GYNA 3NQ6A 4JZ5A 2V5BA 2NT0A 3W1PA 3AUJA 1RCXB 4I7WA 1P6CA 2DSVA 5D32A 4FOKA 1UMLA 2GLKA 4XO7A 1XLDA 4IG2B 2HV5A 4JEQA 3WYZA 3NZQA 4JPGA 2HMCA 4ENLA 2VELA 5EMYA 1EQCA 1BYAA 4IPLA 5HNUA 4QM1A 3AUOA 3PUDA 4X63A 1V3IA 4XZHA 5E5CA 2YLAA 4JTJA 3GNXA 1UD2A 5G4EA 3WZ0E 3QM3A 2D22A 1OYAA 1EOMA 2OLAA 5HJLA 4CNOA 1CCWB 2DT1A 1JULA 5D2YA 1TG7A 4GZJA 1OYCA 3EOEA 1NOWA 1P0NA 2D0GA 3BLFA 4S3KA 2WVTA 4RX0A 4P8VA 3TVAA 1JZ3A 2A21A 4LYPA 2P3ZA 2A3HA 1R9XA 4YU1A 3BJSA 4TUFA 4M81A 4OQVA 4RPQA 2R1NA 3AHVA 2VX7A 5A6BA 1J0HA 1J9YA 4O4VA 3SEPA 4LUIA 3RJYA 1IXOA 4LUJA 1A5KC 2OODA 3EA3A 1KQYA 4L6HA 3OB8A 2O4MA 3ERPA 1K9TA 5C54A 1MO0A 2DW7A 1QNPA 3WJWA 5A2CA 5FACA 1RLCL 1K8XA 3SI9A 4K38A 4MDOA 2Z1BA 1H7WA 5IDIA 3UZJA 3I4EA 3CUHA 1M41A 2CBIA 1OM0A 2D0FA 4JTCA 2C18A 4ZQPA 2ZBTA 3R0UA 3DXIA 2G4JA 1CB7B 4XSMA 3ZVHA 4HBKA 1YTKA 2X1SA 3U9IA 2VVNA 5I2UA 5HMDA 2ZVRA 1TTQA 4B16A 1XIBA 5CZJA 3WQ8A 4FX6M 4GNVA 1QNOA 5LGXA 4M51A 5HXMA 2BGNE 2Y88A 3KZSA 3UR8A 2Z29A 1E0TA 3NQAA 1KKRA 2F6UA 3MW7A 1EDGA 5E93A 3NO1A 2EG7A 3A22A 3IJQA 4LT9A 4BZYA 1W2VA 1GQLA 2EEXA 2XN1A 5D38A 1UZDA 3EKLA 3C0SA 4V33A 2NWSA 4Q8VA 3T44A 2GUUA 1JXJA 2ZRUA 3VGGA 3W74A 2QUMA 2G3MA 1Z6KA 1VEOA 3GXDA 5JBDA 4AUBA 3F4WA 4HSNA 3BL3A 4XD4A 3KOWA 2P8BA 3PZQA 4ERGA 3L5AA 3VOCA 2EAWA 5T26A 1CGYA 1CLXA 1EEPA 4IUGA 3SCOA 3G77A 3APGA 4QG9A 4UZSA 2XFYA 4GI8A 5DCEA 3FYPA 4CD7A 2DIKA 4O14A 3LLFA 4IMCA 3TKFA 1ZAJA 4PMQA 4HOWA 2A85A 2Z2BA 1UD6A 5H8UA 3DERA 3MMDA 2F2KA 1JQVA 1H60A 3OVGA 3ARXA 3NZPA 3NZRA 3TW9A 3UR5A 3W1XA 1GEHA 2VL4A 2YFNA 3WBXA 3STPA 4N42A 3TN4A 3W6YA 4UWMA 2WVVA 1WXYA 2GGGA 3OLDA 3QV6A 2PDXA 3V36A 4DO6A 4FLOA 3S4TA 1VFTA 4UMBA 5EL1A 1XH0A 3PVFA 1DJXA 2C16A 1QHZA 4CNNA 1SO3A 3C8FA 4K6AA 2QCCA 3W75A 3T2QA 4CKQA 2BNJA 1TPH1 2CLFA 3IEBA 3KBNA 3FVMA 2VHLA 3QTGA 1JVNA 3HQPA 1XG4A 1BD0A 3CBWA 1HVQA 3DHUA 3VGFA 3CYJA 1I1XA 4F0LA 5D9MA 3MUY1 1D8WA 4O50A 2ZRVA 3RAOA 1MEHA 2I9UA 2BP1A 4XB3A 4KETA 1PZ2A 2HE8A 5BROA 3QZAA 1XHGA 4MJZA 3R58A 1EEXA 4HPJA 1VBRA 1OVDA 3ZYZA 1CPUA 1NDVA 4H8NA 1TR1A 1RA5A 3GHSA 1A50A 1H51A 1I0DA 2QCDA 5BXSA 3R10A 3L5MA 3MCOA 1U83A 5B7YA 2E6YA 3L65A 2WJDA 4PMUA 5DBTA 1JPIA 1F05A 4B5VA 2ZFAA 1B3WA 1TVLA 2A2IA 3P6LA 2F84A 3N18A 2CBUA 2PDLA 2VX4A 3UW6A 2XSAA 4I7UA 3TH6A 4UTIA 4ML4A 2J66A 1Z89A 1FKWA 1V0KA 5CC7A 4RXFA 3THUA 5L6UA 3ARVA 1ZBWA 4J3ZA 3DX5A 1TMQA 4AC7C 5HWNA 1SO5A 2XFFA 2AKZA 4I5UA 3PG8A 2A7PA 2FJUB 5DCBA 1K4GA 2VCBA 3KVLA 3G0UA 2Y62A 3AQUA 4CQAA 3FEMA 1UWQA 4Q4OA 1Q2SA 4LQ1A 5EMJA 4PMVA 1XIDA 2YJQA 1Q13A 4TX8A 1UBPC 3KTXA 3EWWA 1OCJA 2XDFA 4IJCA 2NVAA 4KEVA 4AVFA 3SQLA 1RJRA 3DIPA 1S2AA 1UH3A 2DQXA 2OMAA 3LV5A 3UG4A 3K1DA 3DBNA 2C14A 3VIFA 5CZ0A 4OWGA 4FK9A 4I5RA 2OPJA 3OW1A 4L9ZA 4ZQCA 1V08A 3WL1A 4C7FA 5C9WA 3BXWA 4UTJA 1F6KA 3I7SA 3IK4A 1VBGA 4AZCB 3T0DA 5HPOA 2YBTA 3PJUA 3VKBA 1E72M 1J6OA 1SZFA 4NSBA 2PWGA 1G4PA 4CQ9A 4QQUA 4F2TA 4CEUC 1TPWA 2V30A 1S1PA 1R87A 3ZLFA 1DJNA 3VE7A 3ELFA 2ODOA 4X2PA 3ITOA 1Q6LA 3KOZA 1GOXA 3FCPA 2WBKA 3G6MA 4M24A 1SZEA 3SIZA 3HV9A 2P76A 2OWXA 1QVBA 3IRSA 4AWEA 4J28A 2Q3RA 4LRTA 2WMGA 1XYBA 3ZZ1A 5HQLA 4EVZA 1PE1A 1NTHA 1WKEA 4I90A 3EAUA 3W2NA 1KTCA 2ZRZA 2C0AA 3WLNA 4AVNA 3GDLA 4NU7A 1QXLA 3UWEA 1IEWA 2Y63A 3VTRA 3GVVA 1TQJA 3LPPA 4ADUA 4JTSA 3IRDA 4MMWA 3QW4B 1Q6GA 1E71M 3I6TA 3S5NA 4RE4A 3URQA 4AXNA 3EKGA 3F5LA 1OB0A 1QJWA 1Z7AA 3MC5A 4EIVA 2FTPA 2E8ZA 4FNPA 4FXSA 2X0YA 5K2ZA 4NZ4A 5C2CA 4RDYA 1XBYA 3PTKA 4MYXA 4JIIX 4NXKA 2EF9A 1JIBA 2WVSA 1CB2A 1B0IA 2WHJA 1KB3A 3SCQA 3O6AA 3TQPA 2XIJA 4UCGA 2BVYA 5ABGA 4AD3A 2ZUTA 1RUSA 1WP6A 2BVWA 4GJIA 1QHOA 2HRWA 3IGXA 3ITLA 4L6OA 4O52A 3MKCA 5FIPA 1T40A 4GINA 3GU9A 4L64A 1BRLB 5CAKA 2XG9A 4O0QA 5CSSA 2ALRA 3TWAA 4B3KA 1MVYA 1WAWA 2E4TA 4PH6A 1Y5VA 3TTEA 1G7UA 4HSHA 3CJPA 4PZVA 2PU1A 4W8AA 3KL3A 1G69A 4F0HA 1AZ1A 2QCLA 2FVKA 1C93A 5MHBA 2O4QA 3GXTA 3VD5A 3W2KA 1E3ZA 3ECQA 5ECVA 3MCNA 4JTUA 1SYTA 5JBEA 1AQ0A 3F03K 3QHOA 1R86A 1VF8A 5AYZA 3NCOA 2J7CA 4TIMA 4ZQNA 2HNHA 3ZJ7A 5D2VA 3CT2A 4KBXA 4PGLA 1V6YA 4MZ8A 5AFDA 1KFCA 1WBHA 4WK9A 3QJAA 4MWAC 1R30A 2BDQA 1MDRA 3U2EA 4BK9A 1ML1A 2YYTA 4MWAB 1FUYA 1LG1A 4BEQA 2CNCA 1U2YA 1JFXA 3V1PA 4YVVA 1GW1A 4MNKA 4QAIA 3F4VA 4JN6A 4MSSA 1VC4A 2IKGA 4HPXA 3ZJ8A 1SZGA 4TXEA 2P1FA 4NRSA 4N2YA 3LRMA 2DORA 3GDMA 3RCMA 5G1MA 5K7JA 4QLLA 2ZUSA 2ADAA 3SN1A 1JGMA 2QT3A 3QQ1A 2OKOA 1JD9A 4QFUA 1J93A 3UEQA 1AW1A 2GSHA 1TTIA 1QU4A 2UBPC 1OT1A 2GK1A 1A3WA 5H8MA 1F74A 3WQPA 2YDQA 3ARSA 2NQHA 4R7JA 5I00A 1VYRA 3NQEA 4LB4A 1SUXA 2BHZA 3CAKA 4JX5A 1XRSA 2DZTA 4HYWA 3W1RA 3R11A 4KT2A 2FZ9A 3ZSSA 3H21A 2V67A 5LIXX 3DAQA 1GKPA 3QZ6A 3CL6A 2W3ZA 4M8UA 1AJ2A 3DYPA 4FS9A 2CLLA 3WD0A 3NO3A 1AH0A 2DQWA 2Z1KA 1GJUA 1KRMA 3TFXA 1QBAA 3B0PA 4DWDA 3NJ3A 1RY8A 2DP3A 1MEWA 2GPTA 5B7ZA 1ITXA 1VKFA 4FX8A 3TCEA 4I9AA 5TF0A 1YRRA 2R94A 3A24A 3WCZA 3H2CA 4YTSA 2YSWA 3SZ8A 3VAVA 3SSJA 3VKJA 4V1YA 4EANA 3AXHA 5G1YA 4WEVX 4ZSTA 2PDPA 4DRSA 3WQ6A 3DEQA 4MM1A 3O1NA 3VCNA 3KS6A 3BJFA 4LSBA 2YKKA 2VZVA 5E6YA 4TTUA 3FFSA 4WKFA 4HMEA 1GONA 4NYYA 3EMCA 1DIDA 4K3ZA 3KOYA 5MKGB 5C9UA 2CEQA 1DWFM 1Z42A 3T4WA 4YHGA 3TOPA 4H4IA 4AFYA 1H7XA 1HKKA 2DSKA 1XPYA 3WUEA 1WB0A 3N9SA 2FZDA 4K36A 4KIRA 2OYKA 4A2RA 1LT8A 4A3HA 1UOZA 1E3XA 3M0VA 4UQAA 4QX4A 5HDRA 3IIZA 2AL2A 2ISSA 4V28A 3IACA 1CTNA 1J18A 5I6SA 2CCRA 2YGYA 3DG7A 5BU9A 1US3A 5CSRA 2IPFA 3QYSA 3U4AA 1ISWA 1YDOA 2J7BA 3CH9A 1M7PA 3OIXA 4MHBA 4PFHA 5CPTA 1UR8A 3MDWA 1K9DA 2XGZA 2FKPA 4BY3A 1PCWA 3AALA 5EY5A 2J8FA 2J7HA 3SUWA 3RITA 5AC6A 1TE6A 2BX7A 4MY8A 3DFOA 1VFFA 1JQXA 1Y5XA 3B3DA 2ZQ0A 4I8YA 3KFTA 3WO8A 4IMFA 1X98A 2XGBA 3S47A 3W87A 2C15A 3MYOA 1E4LA 1EF3A 4B5SA 3ICJA 4CNTA 4BQ5A 3CO4A 5DCDA 3AU6A 3PZGA 3GC5A 3NQDA 3SBFA 4XX6A 1SU5A 2OWWA 2VP8A 4QBXA 5D03A 3DDMA 5HA7A 1PAMA 5G1TA 3BWWA 4JD4A 4F2BA 1VFHA 2X16A 3FNDA 2VEMA 1UCWA 3M0JA 4UFJA 4HNOA 5LIKX 3C5QA 2HPMA 3W07A 3VKDA 2ZX8A 4PUKA 3PUOA 1IXQA 2GVLA 2VZTA 3Q45A 2OU4A 3EA2A 3LU2A 3S3GA 2IS7A 5CC6A 2GQ8A 3CB3A 3SN0A 3DCPA 1E0VA 1ONEA 5KETA 3MJYA 1W1ZA 3W84A 2IKJA 4S3BA 5FJTA 3PZUA 1GQIA 1KC7A 1F6YA 3EMQA 4J35A 3VD7A 4LXFA 1TPC1 4Q7IA 1W8GA 1BWLA 2WZMA 2FZBA 3U7BA 4KESA 5TD4A 1S46A 3KL0A 4H01A 4HB7A 4ZO6A 1DTNA 1ME9A 5A3HA 4DAFA 4W7UA 3P80A 5TNVA 1HJSA 4KH2A 2CW6A 3UERA 1GVYA 5AKQA 4FALA 1XFBA 3EYPA 1AK5A 3HN3A 2GVEA 3B9NA 4PUEA 1MFUA 4JIRA 3IWPA 4GUGA 1Y0EA 1CXFA 1VS1A 2WOQA 3PTQA 4UQCA 4H9YA 4DZAA 3KP1A 1F73A 2JGYA 4IGNA 1Y65A 2HK1A 3LS9A 2OGJA 3LCIA 2PLMA 2ALDA 4Q6XA 3KUMA 2XZ9A 4K8HA 4REQA 3UJ2A 4LYKA 3BICA 1D8CA 4RNJA 1LF1A 2ABBA 5DN1A 3NNTA 1RY0A 1U5HA 3FHAA 4UIOA 4QG8A 4OJYA 4J3WA 1IEXA 3S5YA 1TJPA 1XCXA 3QKZA 2B7OA 4PB4A 3K30A 2NLIA 4DXVA 4DJFC 1REQB 3OTRA 4LX4A 4DXXA 4L1GA 2J13A 5HMEA 3MWCA 2WJEA 3KVMA 4GO9A 1O6IA 3PFMA 4BWLC 1N8IA 1E5NA 1F3EA 1WDWA 4HHPA 3NYDA 5HR7A 2YIHA 1QRQA 1A5UA 1Q6OA 1W5QA 1UMYA 3HPAA 3ONCA 1GHRA 3A4JA 5BRBA 1WUEA 4IJRA 5I23A 4MLJA 2H90A 1FWRA 3TONA 5G4HC 3SCSA 1XIMA 5AHMA 4Z1BA 3NYZA 3L0GA 5REQB 5BMXA 3AHZA 3LQGA 3AZTA 4XK2A 1O95A 3ZR6A 3S9ZA 3TN3A 2Y2WA 4KEUA 1OD8A 1IF2A 4DZ5A 3GLCA 1TWZA 4QCFA 3SFWA 4XZNX 4OV4A 3TQVA 2QJIA 2FZ8A 3SY8A 1PTAA 2IMRA 2PP1A 1LUCB 2O9OA 5C7HA 1QPOA 2DY3A 2I5QA 2ZX7A 1JGIA 1F6PA 4IFRA 1XYCA 1JCYA 1J96A 3NQ7A 3P0WA 4MPKA 1UYQA 1MI3A 1VAHA 3VZZA 7XIMA 2VD8A 3K8LA 3QY7A 5DANA 3MZNA 1XLBA 2NUWA 4BFAA 5EMLA 2CKRA 5HR6A 4HP5A 2CXGA 4PRRA 3LB0A 4YN5A 3F5JA 5A6TC 1YBQB 2ZE0A 3VIMA 4N6FA 3UXIA 1RK5A 3TXZA 3GX9A 3UF9A 4LNCA 5HMSA 3IJ8A 2QMJA 3GVQA 1DIEA 3W7RA 1FKXA 5HK4A 1IHIA 5ABHA 4U3AA 1KM6A 1I2OA 3UCDA 2OEJA 1UKQA 3EX1A 1FHUA 4Z1DA 2QJHA 5G4WA 4LUYA 3EB3A 3OG2A 3W7QA 1K8YA 3VE9A 5AYYA 1YXDA 4JGDA 2HJPA 1L8NA 1OC5A 4NXSA 4P5UA 2VXNA 1A5CA 1EDTA 2HEJA 1FXPA 4JICA 2VI0A 4B5NA 3B8UA 1K8ZA 1FFQA 1MZHA 1FWFC 2Z2UA 3BTNA 3LEPA 3SCWA 4C91A 1ZTVA 1E1EA 3MKKA 1Q6CA 4S2BA 3SY5A 1E43A 4ZB0A 2CKSA 4LBSA 5CGQA 3I6EA 4OU1A 3KOXA 4EWJA 3SR7A 3PS7A 3GHTA 1OD0A 3HFYA 1TUFA 1UH4A 5A6MA 1UC5A 2CYGA 1R2SA 4F9JA 3U8GA 2X0SA 3QGAC 3MJMA 4X2RA 1RQBA 1KNWA 1V6UA 3VINA 3MU7A 2BOEX 1EXBA 1XLCA 4HNCA 2J25A 1WBJA 3BLLA 4PCFA 4H6QA 2P5NA 1R9YA 2WJFA 3MP3A 1UWAA 3VIOA 1QMLA 3TSBA 4MJMA 3KTCA 1H7NA 1MFVA 1TB3A 4PN2A 4M6PA 1BQCA 4RZBA 1UP0A 3BH4A 3A5FA 2Z1WA 1TIWA 1RBLA 3TTQA 2E1DA 3MUIA 1TPDA 4OGZA 3AS1A 2A0NA 3K5XA 4FOJA 1C7TA 3HO8A 1THFD 4GX9A 1PS9A 4DO5A 1F4HA 1F7BA 3GXNA 2DJLA 4K7VA 4XKMA 5GNZA 1B31A 4NUWA 1R46A 3PPGA 3G8EA 4CNPA 4QGCA 4ADSA 1W5OA 2VGGA 3RXZA 1JUBA 4MGGA 4HTYA 1ZB5A 4PEEA 3CV6A 3T9PA 3EGJA 4QSFA 4DF0A 4ZL1A 3D3AA 3O3RA 4XD6A 1IEIA 3R8RA 5FAGA 2LLEA 5LA0A 1EJWC 3FAXA 4E2DA 1X6UA 3M9YA 4Q4PA 3WUFA 5HJYA 4V27A 3UXDA 3FGCB 3KBSA 4QP0A 3UVAA 3UY8A 2JF7A 1ZALA 1P6WA 4GGBA 2MNRA 4F2UA 1XC6A 5E9XA 1H7RA 2QDGA 5DLCA 1KTNA 4IQEA 1IT8A 1UUQA 4X0NA 4L7ZA 5GNXA 2WNWA 3U5UA 4C1NB 1R3SA 3AXMA 2J75A 3M0YA 1OGBA 4ADTA 4PSPA 3FYYA 3E2VA 3A13A 5CGMA 2YDAA 5BWFA 2WSYA 2CU0A 3AYSA 3VKAA 3LCWA 2YL9A 4IPPA 5D04C 1R3VA 2VEIA 3SUTA 1H11A 4Q4QA 3H23A 2C0HA 1O12A 1TJ0A 5IRPA 1ISZA 3GO2A 3KCOA 3P82A 3O05A 1GYLA 1RA0A 1PKLA 2WWDA 3QPZA 5T91A 2WJZA 3V35A 1W1A1 4Y90A 3LHWA 2BY2A 2XN2A 3K8KA 2V82A 2CZVA 2HROA 4GIYA 1XISA 2WKLA 4D8LA 3CZGA 5XINA 2ISDA 1Q2RA 3AJXA 2WQDA 4LCQA 3R0DA 2GQ3A 3BLEA 4PUWA 1GKRA 4OFCA 4UTKA 3WNOA 1TRIA 3W7JA 4NYUA 4GH1A 1CGTA 1WZMA 3WQOA 2I57A 4NAEB 3T78A 2DT0A 4E6MA 5M2FX 4PCNA 1XLEA 1LP6A 2QVNA 3GU1A 3T42A 3LHTA 3WMCA 3KL5A 4FZIA 3S1UA 3W70A 3PZVA 5ENLA 3HGSA 3PAOA 2J9YA 2D2JA 3OGVA 4D6GA 1E56A 3DC0A 2ZC8A 5HNNA 1UKPA 3S9IA 3WJSA 3TC3A 3H2OA 3N04A 4IIEA 1NDZA 4IJBA 4YHEA 3GHUA 3QPEA 4XD3A 1MUMA 3E0VA 1BSLA 2HWGA 4PEKA 1NWSA 1TE1A 3E3HA 1FWCC 3WF1A 4RL3A 2YR1A 1G1YA 1YLVA 1P0BA 4XAPA 3RG6A 3U2OA 4FNUA 1ONXA 3TA9A 3H54A 1Q8JA 3WQGA