4FAMA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with 3-((3,4-dihydroisoquinolin-2(1h)-yl)sulfonyl)benzoic acid (17)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 121
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4famA00
1S1RA 2FZ8A 3U2CA 3R43A 4EXBA 1IEIA 5HNTA 1X96A 4Q7BA 2PDLA 2IKGA 4YU1A 3V0UA 5M2FX 3P2VA 2I16A 1YE4A 3R94A 4PUUA 1ZQ5A 5C7HA 4I5XA 3GHTA 4JQAA 4LBRA 4PR4A 4FAMA 3QKZA 3ONBA 2HVNA 4JTRA 3N6QA 1EF3A 2DV0A 2INEA 2HV5A 1A80A 1FRBA 1XF0A 2PDKA 4H7CA 4LAUA 4PRRA 2HE5A 4JQ2A 2IQDA 1EKOA 3UWEA 4JTCA 4JIIX 1RY8A 3CASA 4DBWA 3H4GA 1SM9A 4GCAA 2INZA 2DUXA 3UZZA 1K8CA 4XO7A 2FZ9A 3EB3A 4LB4A 2HEJA 1AH0A 4XZIA 4L1XA 3GUGA 3EB4A 5HNUA 4DBSA 3M4HA 4DZ5A 2IKIA 1HQTA 4LAZA 1J96A 3UZXA 3WG6A 1PWMA 3ERPA 1S2CA 3N2TA 4EXAA 2ISFA 4WGHA 2PDXA 2J8TA 4ZFCA 4WRHA 3LZ5A 4FALA 2PDQA 3UYIA 4QX4A 3UG8A 2PDWA 3NTYA 3RX4A 2HE8A 1VBJA 4XAPA 4GA8A 2PDMA 4MHBA 3CAQA 1M9HA 2FGBA 2PDBA 3G5EA 1AH3A 1X97A 3WCZA 1LWIA 3GHRA 4JTQA 4GQ0A 5JH2A 4XO6A 2BP1A 5KETA 3M0IA 2IPFA 3ONCA 4XZLX 4XZMX 4JQ4A 4WDXA 4HMNA 2PD5A 1GVEA 1PYFA 3O3RA 3V0SA 2PZNA 4XZHA 1YNPA 1UR3M 4FA3A 2HVOA 5AZ1A 3D3FA 2IKHA 5LIYX 1X98A 3LEPA 4NKCA 4AUBA 1JEZA 3LQLA 1AZ2A 3WBXA 2R24A 2FZDA 1YE6A 4L1WA 5LIXX 2PDGA 4PMJA 2PDFA 3F7JA 1PZ1A 1Z3NA 1Q13A 1PZ0A 1HW6A 1PWLA 4JQ1A 5DANA 2NVCA 1AH4A 3M64A 1YNQA 3CV7A 1MRQA 1S2AA 4LBSA 1ZGDA 2ACSA 3H7UA 4RPQA 1RALA 4ICCX 3H7RA 1IHIA 3LENA 2IQ0A 2IPJA 4JTAA 3WBYA 4PUWA 1MZRA 2PFHA 3COTA 3LUTA 1EXBA 3O0KA 4XZNX 4IJRA 3UZWA 1QWKA 2ACQA 1EL3A 3BURA 2PDNA 3V35A 2NVDA 3Q67A 3LD5A 2C91A 4OTKA 3LNMA 2PDHA 2FZBA 3R6IA 4WDTA 2ACUA 4QXIA 4YS1A 3V0TA 1T40A 4YVXA 3LN3A 4JIRA 5AZ0A 1US0A 2WZMA 4G5DA 1T41A 5LIWX 2CLPA 3R8GA 3C3UA 1Q5MA 4XVEA 3BCJA 1Z9AA 3UGRA 3B3DA 2I17A 2AGTA 5LIUX 2PDCA 3GHUA 3UZYA 2DUZA 4GABA 1OG6A 3DN5A 3LQGA 5LIKX 3WBWA 3MB9A 4YVPA 2PD9A 3KRBA 4ASTA 2PDIA 2WZTA 3R58A 4IGSA 3R8HA 2VDGA 3RX3A 1S1PA 4JIHA 3V36A 2PDPA 4GACA 3GHSA 2ALRA 4PRTA 1ADSA 2ACRA 1C9WA 4GIEA 2F2KA 2FVLA 4XK2A 1Z8AA 3Q65A 2P5NA 3G1RA 1RY0A 4WDWA 4Q3MA 4FZIA 2IS7A 4HBKA 2F38A 4F40A 3BUVA 3UFYA 4YVVA 3EAUA 4LB3A 4IJCA 2IPWA 3VXGA 3RX2A 2R9RA 3FX4A 4GQGA 4JTDA 1XGDA 3FJNA 3CAVA 2PDJA 2HDJA 1XJBA 3CV6A 2IPGA 4WEVX 4WDUA 1QRQA 3UP8A 3T42A 1ZUAX 2IKJA 2BGSA 2A79A 3S3GA 2QXWA 5JH1A 1R38A 1LQAA 4QBXA 3LBOA 1MI3A 1AFSA 2PDUA 3CMFA 2PDYA 1AZ1A 3DOPA 4JQ3A 1VP5A 3BV7A 1ZSXA 4H8NA 3R7MA 4XVDA 1Z89A 4DBUA 3LZ3A 2BGQA 2PF8A 4R9OA 4QR6A 3MC5A 5HA7A 2PEVA
chains in the Genus database with same CATH superfamily
4JFVA 3FIGA 1CI1A 3FSUA 2PB1A 3MSRA 1X6NA 4GQQA 1B57A 4CEUC 3P61A 1OYBA 4IF2A 1HJXA 3H2EA 2B7OA 3PBWA 4X0VA 3Q4DA 2DSUA 3GTIA 4GG9A 5C7HA 4ZGYA 3GHTA 3H2OA 1HTIA 3OQ8A 3URAA 3UG4A 3B0VC 3W53A 4KCVA 5I77A 3M1ZA 2VELA 3UERA 4EWJA 4B9ZA 3OG2A 4IFRA 4Q8UA 2DT3A 3BDKA 4G2DA 5ABTA 2WBGA 3LXAA 3B8SA 4J28A 3O1NA 2R1MA 3CC1A 3PZIA 1EHAA 1XRSA 2QCMA 3UQNA 4HK5A 3W7PA 1VRXA 1G9HA 1LLWA 2CERA 2QJGA 2OYMA 3GU9A 4LTSA 1RCQA 3B06A 2YL5A 3GTFA 4I9TA 1FHVA 4I8DA 3N17A 2OEKA 1TJRA 3M0XA 4CN6A 5H1WA 4QDPA 4W5UA 3ARSA 3CBWA 3H22A 1IE7C 4XUGA 5AB3A 2VZTA 3CIWA 1V0NA 1HGYA 2GJNA 4S3BA 1LG2A 2EF9A 2W61A 3C0QA 4DJED 5FI8A 3TK7A 1UIOA 1J11A 5A6TC 3WLOA 4MLJA 4ZMGA 2Y0FA 4M0XA 3A47A 1QK2A 1ZRQA 3VIJA 1I9CB 5DELA 3LZ5A 3UWWA 4IIGA 3IACA 4QJ4B 5TAOA 5AC7A 1GUVA 1DQWA 3GVVA 1DXEA 4GA8A 1VGAA 4IJBA 1XX1A 3QW4B 1UWIA 3AHTA 4QE4A 4WHBA 4LFYA 5CSUA 4J27A 3MMWA 4CGTA 1T0OA 3LLDA 4N4PA 4O4WA 3P81A 4DO4A 3KLLA 2PI6A 4XZLX 4B4HA 1TFVA 4HP5A 4KRUA 1WUFA 3W1TA 2V9DA 2FJKA 1UBPC 4NYYA 2VFHA 4US5D 1J2BA 4GE8A 1YNPA 5D8WA 5LNWA 4NU7A 1W5OA 1YXYA 1W1TA 1TR1A 1YDVA 3NO3A 3GFYA 3PPCA 4XB3A 2VYOA 1TTJA 3GXDA 2YBUA 1C8VA 4QG6A 1MFUA 4Z1YA 1V6WA 3S2JA 2W92A 4FLRA 1B3VA 4PMJA 5D03A 3F7JA 3M43A 4MNKA 2VRKA 3MW7A 2OU4A 2QMJA 2PGRA 4K38A 1VYRA 1CLVA 4FNSA 2QT3A 2H8ZA 3UCDA 3SDOA 4B3KA 2XJ7A 1RCXB 1Q6GA 4MY9A 2GSJA 2H90A 3H7UA 3WDIA 1RALA 1NDWA 1D8WA 3LRMA 3HA1A 2XH4A 1N82A 1LOQA 1YPXA 4HJFA 4A3HA 5CZTA 4EACA 2EGZA 3MDUA 1JULA 2X09A 3PBMA 1QWKA 3HV9A 5JBEA 2AKZA 3QV6A 1LBLA 1GZJA 3RLUA 4IMFA 2ZRVA 2C91A 3W1PA 3OLIA 3L2MA 1V08A 3LNMA 4LUJA 1SFJA 2ZQ0A 1E3ZA 4TO8A 7TIMA 2XGIA 3CL7A 1G1YA 3BMXA 2Z24A 3QN3A 1JQXA 1T40A 3RM4A 3K8LA 1MYRA 4P7QA 1A3HA 3CTTA 1QBBA 5CXPA 3NAVA 3CL6A 3AIQA 3EOUA 2YLLA 1P1MA 3QR1A 2NWSA 2CBUA 1UWSA 3SN0A 2ISSA 1TE1A 1ZCOA 2J9ZA 5FJUA 3F1QA 2XN0A 1K70A 3BANA 4JAWA 3RR1A 2X1IA 1DTNA 3GDKA 1X1OA 4F79A 3G0SA 4AZGA 4DAIA 4WY0A 4NZ1A 4WGXA 1BVZA 2QNEA 3F4NA 3H7VA 3L67A 1UHVA 5AC6A 3BG5A 4MPQA 3SCNA 1DJIA 3TJXA 4Q32A 4H8HA 1WDPA 2BASA 4J2PA 3MP5A 4GZJA 3A21A 2NLIA 2VVSA 4AD4A 5D2XA 1EB3A 4AX7A 2W9MA 3CUHA 1XUZA 2Z29A 4B5TA 3H23A 2ZZ6A 2C7FA 4HBKA 3STPA 2F38A 2DVXA 2ZUSA 4DX3A 4NJJA 1GHRA 3T09A 4CU6A 2R9RA 3BAYA 4EOUA 2C1HA 3ES7A 2QLYA 3ZIZA 3DKJA 1UWUA 4RDWA 4HNNA 1BSLA 5EPDA 4R33A 2YX0A 3R79A 4B92A 3VPLA 1FUYA 1W37A 1BYBA 2CLMA 2VHLA 4HZ6A 2NV1A 2D0HA 4ZR8A 2V2CA 1W8GA 1XLFA 1Q6QA 1TRDA 2JEPA 4F4RA 3EXRA 3VVGA 5IM51 3T0TA 3C2RA 2CW6A 2RAGA 3QR3A 1ONWA 3BZGA 2PWUA 3PY2A 4UMCA 1KBJA 1LDCA 4D8LA 3ZS4A 3BAJA 2XTKA 5EMUA 4W8BA 3FYOA 4LY4A 1BPLB 2PP1A 4KFNA 4XKMA 1A0DA 3W37A 3U2CA 1TX0A 2ZRWA 4QTGA 3GBDA 1BLIA 1FDYA 1KXVA 4XAYA 3NZ1A 5G4EA 1VFMA 4LRTA 1YEYA 3EDFA 3U5YA 2H6RA 1R5YA 3QKZA 2P1FA 3GO2A 3I6EA 4H01A 2BODX 4Z2JA 3QGAC 3N6JA 4OHQA 5F2GA 4HVXA 3TH6A 5ABHA 2NX1A 2BY0A 3CS2A 3NZRA 4XUYA 1B5TA 3QEZA 2J7BA 4O14A 4JQ2A 5CBJA 1OFBA 3LGDA 4HHLA 4D6GA 2PLCA 1W3KA 1G6CA 3G3MA 3L0GA 3ZR5A 3BW3A 4C6BA 3W00A 2GQ9A 1CB2A 4QP0A 4MJMA 4NF7A 4XSLA 4JICA 2ALDA 4GJ1A 4JTHA 3APYA 3OOQA 1UUMA 5C9ZA 3TYUA 1AJ0A 2BVDA 2DUXA 4MY1A 3UZZA 4MNMA 1SMDA 1KC7A 4DJFA 4JKMA 4B16A 2H8XA 3VKKA 1C9DA 3CNYA 1JCMP 4J9JA 1EUAA 4XZIA 3EB4A 4QG8A 2V3GA 2Z28A 1G4SA 1Q6CA 1ZPTA 1FVPA 4DJFC 3MV01 4YN5A 5FSDC 4JTKA 5AOUA 3FA5A 2ZDSA 2Y2WA 1X7IA 1WO2A 1MXDA 1R47A 4HU3A 1S38A 3OJGA 4JIEA 4TIMA 1M04A 4A35A 1FH9A 2ZRUA 1U30A 2NXGA 3MUAA 3WY1A 1O6IA 3DG6A 4G9PA 3HZ3A 3DEQA 2X0SA 1VZWA 2NWRA 3W84A 3W7MA 3MWAA 2PS2A 1XDJA 4AHOA 4XAPA 2FMNA 2OPJA 1P43A 1PKMA 2YIHA 3W1MA 3N15A 4DZHA 4PYSA 1M9HA 2FGBA 4PCSA 4P8UA 1XI3A 2QULA 3BLEA 3FA3A 1XG4A 3UYCA 3STGA 2TYSA 2WVVB 3EB2A 2E3ZA 3DX5A 3AUOA 3IIVA 5CJ5A 1TPDA 3R11A 5FAJA 2VTFA 3PZOA 4MDOA 3ONCA 4X9SA 5LNVA 3WD2A 3NWRA 1H09A 4PMZA 2OQYA 1B3ZA 1ITCA 4O19A 2PZNA 3TYDA 4IL0A 3PB2A 1WP6A 2GYIA 2ZC8A 3W26A 3JW7A 1RBLA 3PWAA 1JCLA 4IIEA 3OYZA 3SURA 2OO6A 3S4TA 1OFEA 3F5JA 2XIMA 2PCEA 3EEGA 1O60A 3E49A 3NYZA 5DFAA 3CIVA 4MZ8A 4UZSA 3SY1A 1NSJA 4Z2LA 3TDFA 1KRCC 4ZXOA 3V4BA 2DZAA 5I78A 2ESCA 2GJRA 5E0KA 5DY3A 5H8UA 4L4OA 3LCFA 3Q45A 2OZ3A 3J7HA 5AHMA 1ECQA 1IT7A 1J6OA 3BLIA 2J7EA 4LEFA 3CZKA 4EANA 3WJSA 4LV9A 1OSEA 4DM2A 3QOKA 2RH9A 3FKRA 3TNOA 2PDNA 4G7EB 2A1YA 2DQWA 3U3HA 4L9YA 4GFSA 4MMWA 2RUSA 2GVJA 1UZHA 3B8VA 4IP5A 1D3HA 1JCXA 1CXIA 1GPWA 5IDZA 1AA1B 3VGFA 1O5KA 4HTYA 2KZHA 1W5QA 3GY1A 3M6YA 1BTCA 1ONEA 4HYWA 1U1HA 2WKLA 2XFWA 1V03A 4UR9A 2QCEA 3TN6A 4JIRA 1GVYA 3W2LA 4LXFA 1Q8JA 4I3GA 2ODOA 4Z1BA 7CGTA 1Q5MA 4AY8A 1KFJA 2CC0A 1WZMA 3B3DA 3WLMA 5E5CA 4XBKA 4RK8A 1UH3A 1XFBA 1VBRA 3F4DA 3LCLA 1EQCA 1CDGA 3WO8A 2YL8A 3TA6A 3NL5A 3C0JA 1XCFA 3P8JA 1WOBA 3KTSA 5I3IA 2G95A 3DGBA 1L6GA 1BG9A 3PWGA 1R9ZA 4IUOA 4IX2A 3T78A 2NVAA 5AHEA 3MMTA 1XYAA 2G8ZA 2IXUA 3WLLA 5BU9A 3H55A 3OGRA 2FHFA 2VR2A 5T26A 3WNOA 1W1ZA 1F8MA 2Z2BA 1LG1A 5CSSA 4LB3A 4IJCA 4WX2A 2YB4A 1UBSA 1JCJA 4ML9A 2O9RA 4PUEA 4IIBA 4JCLA 4UWMA 4LCSA 4HN4A 1O1HA 4IUGA 4I8YA 3G1FA 9XIMA 2F2HA 2P0IA 4GH3A 4JR5A 3CV6A 4A4AA 4CD4A 3V18A 4UQBA 4KIEA 4MB3A 4UQAA 3W85A 2QAFA 3E02A 1XIDA 3CUJA 1HFBA 1UMYA 1QHPA 3BG3A 4IT1A 3C0LA 3LOTA 1TJ0A 3KL0A 3DXIA 3A4XA 5D32A 3L4YA 2CZFA 1V51A 1SYTA 1VCVA 2PDYA 3URQA 1GKPA 5HWJA 3IAQA 1SO4A 3AIRA 3BV7A 3UXDA 1EEPA 1Q6FA 5A8OA 3LPPA 3O05A 2GGHA 1MNZA 1W3IA 5GJMA 6A3HA 1VFSA 2Z25A 3FXYA 3UD6A 2J7DA 4BQ2A 4CVUA 5BW6A 2NV2A 4M24A 3W7JA 1MEHA 3N34A 1EYWA 4O1CA 4GYFA 2OT1A 2BDQA 1E73M 4CQ9A 1HG3A 4U10A 4JKKA 4M7TA 2O9TA 1W3HA 4LNYA 4AF0B 4LVBA 4L80A 3VYLA 1UZDA 3MCOA 2VURA 2WNNA 3DFNA 4DWSD 2ZWZA 1XGZA 4NZCA 2ZC1A 3SCWA 4DRSA 4LYPA 3BGGA 4ZQCA 1OX6A 4H7CA 1QOXA 4LCQA 3GNOA 4MTVA 4ZEPA 1V02A 4MJ4A 1B4KA 4LVDA 4J3XA 4KGJA 1RY8A 3BJTA 1GYLA 3UNDA 1Q66A 2YOCA 3PAOA 1RBAA 1J18A 5C5YA 4UXDA 4DUXA 4UR8A 1EZWA 5HR7A 3IANA 1CZ1A 1DWJM 1AJ2A 4GNVA 1XYCA 4P5UA 3BLLA 2YDSA 4C91A 1I8JA 2X42A 1SJDA 2X0HA 2XG9A 3TN5A 4DO7A 1XP3A 3R5EA 4B5XA 2SFPA 1T8XA 4XD6A 1R3RA 3GUGA 1ZALA 3AMGA 1MW0A 3DFQA 2ZX7A 1BFNA 4WD0A 1JZ7A 2QPSA 3FSTA 2CWNA 3ARWA 3MY9A 1RD6A 1CTNA 3LPFA 2R91A 5HMSA 4AD3A 4EF8A 5BZAA 3QJAA 3W7QA 3ARXA 5K4ZA 1PWMA 1KM2A 2BXYA 3C2OA 2A2IA 4PCPA 4W9TA 5BCAA 5I03A 1XC4A 2V5KA 3BW4A 3N2TA 4UNIA 2OYLA 3GXFA 2VZOA 4RZ6A 4PL2A 1VIZA 2VC5A 3LCXA 2OEMA 1EGVA 1RLDA 1KQYA 2WMKA 3PAJA 3BJFA 5C2GA 4H6KA 2PDQA 1XLAA 2OGJA 4GK8A 4L6OA 1T96A 3FEMA 3HU7A 3MKCA 2OQHA 3VOJA 1F3WA 2D3NA 2FKPA 4H3DA 3LB0A 3TW9A 1SZRA 3AC0A 3KHDA 5BXPA 3LK6A 1KFBA 4FSAA 1J5SA 3VGHA 1NM9A 3L21A 1CXFA 2E6FA 1GGOA 4JTQA 4KWUA 2NSXA 4DLMA 1PTAA 1IZKA 4XX6A 1FWIC 2JF6A 3ME3A 1FCUA 1PYFA 5C9RA 4MLRA 3UPMA 2ADAA 1WOAA 2OQLA 5TD4A 3YPIA 2H3DA 3M7SA 5FKYA 1CT5A 1GW1A 3CUZA 3OG3A 3PBYA 1F6YA 4PMUA 4AUBA 4LU0A 5FEXA 2DH2A 1TMLA 3WQ4A 1I2QA 1TTPA 5I02A 1Z3NA 2BHUA 3CB3A 4QISA 3L65A 1AH4A 1O66A 2OLAA 2EJ1A 3W75A 1W3NA 3CV7A 1S2AA 4LX4A 1TV7A 4Q6JA 5DMLA 5FJPA 2BTMA 1ECEA 2ACSA 3TMLA 4GIAA 1ZJHA 4AISA 2JE8A 1IHIA 3SCVA 4WOQA 4XBJA 4CLMA 1TB3A 1K3UA 3WBYA 3BZJA 3S47A 3T40A 3EKZA 1FWAC 3VKJA 1CGXA 3GQYA 3QH2A 4JTLA 1EGMA 1V93A 3O0KA 4ONVA 2DZXA 2TSYA 1V3MA 3EDJA 1JNEA 4Y90A 5DCDA 3OP2A 3DFYA 3LHWA 3RILA 2A7PA 5IFPA 2VENA 2A7RA 4J3VA 3S5SA 4KEUA 1OC5A 5G1YA 2PDHA 4CN4A 1B3XA 1KCZA 2ZVIA 3GD6A 2EBNA 3W1QA 4E2BA 5CG7A 1HNYA 3C8NA 1NWUA 4Q7NA 5DXXA 1AW2A 4LAOA 4WXZA 1XIHA 2PP3A 3QFWA 4HPHA 4E2DA 4O53A 3TJ4A 2VUYA 4X63A 5BOFA 1C7TA 1RJRA 2VEFA 3ZJ6A 7XIMA 2ZCGA 4HMEA 7TAAA 4S3FA 3EMZA 2DEPA 2EJAA 2RJGA 4ZOAA 2A6NA 4FK9A 4TUFA 4LEQA 2FFCA 3EGJA 2ZX5A 4EPDC 3PANA 4Y9MA 2GSEA 3OVQA 3S1UA 2F7FA 3PR2A 1MDRA 2W79A 4L4PA 1MQRA 1I2PA 3ANYA 1A5BA 3SB0A 3AXIA 3W72A 3NQ8A 2WZTA 2GGGA 2V5DA 3B8UA 1WB0A 8RUCA 1JD7A 4Q33A 4UNLA 1A0EA 2I9UA 2NX3A 3RRXA 2PDPA 4GZ7A 2RDWA 2JALA 1R3YA 1IEVA 4OBRA 4DELA 5L6UA 3R13A 3Q65A 3N2OA 4OV4A 1DXIA 3G1RA 1E1CB 3TEVA 1KM1A 3B8IA 4XTIA 3DFOA 1M53A 3T08A 1AMYA 3S9YA 3FYYA 3PNUA 2Z4GA 2J78A 3KXQA 1M7PA 1H1ZA 3V1HA 1E6RA 1GQNA 4GUIA 4O1BA 3GW3A 2PDJA 3I65A 2OXNA 2DQXA 2OOGA 3UG3A 1KXQA 1US3A 2GJXA 3P60A 1NEYA 1CGUA 3T42A 4HHHA 3QPYA 3E2RA 3GIPA 3ELFA 4D1JA 3FVDA 3MO7A 4MKNA 1W5NA 4KFPA 4PH6A 3I6TA 2OO0A 1EX1A 2VWSA 5E1QA 2Q09A 6XIMA 2VX4A 3ZMRA 4FP1A 3LHUA 3E9AA 4E4FA 5HMDA 2JKPA 2EPNA 7ENLA 4YPJA 3M0ZA 2DJLA 1BRLA 4DBUA 3AXHA 4OU1A 3CPUA 3PZNA 2G50A 4PA8A 3MC5A 4C7DA 4B5UA 5SWUA 5DT5A 2CLOA 3SSZA 4ZO9A 1LL4A 3ARZA 4Y7EA 4EXBA 2FH6A 4V33A 2UBPC 3TA9A 3WN6A 1N7KA 2C1IA 3W83A 3KHJA 4IMCA 4LY8A 1P7TB 5BOOA 5M1TA 4RLIA 2CXGA 3H70A 1EC7A 3N1AA 1UC5A 5T9CE 1P1XA 3VUPA 3O6AA 5AN7A 2Q8ZA 3AJXA 1KFKA 2VEGA 4PB4A 5I23A 2JEQA 6PTDA 2PTDA 3C2VA 3WK1A 4HU4A 1JF5A 4OV9A 3QY8A 3DHDA 1US2A 3UNTA 3TIMA 1EA0A 3L68A 1VIWA 5LKYA 4RR4A 1ONXA 1TQJA 4DNMA 4PMXA 3I6RA 3PZVA 2G41A 3JUGA 4ZB2A 4HYVA 3QXBA 1XW8A 1PX4A 3VIIA 1K4GA 1PPIA 4A21A 4L1XA 2GUUA 1R8LA 1UWQA 3W28A 5A94A 3N9KA 2WAGA 1CECA 1WXZA 3ARUA 4P8XA 5JU6A 1RH9A 1BYAA 4ADSA 3RM9A 1OFQA 4DJEA 4QAIA 2E28A 2XGZA 1FWHC 2PWFA 1K7EA 4QCFA 1TZZA 4C7FA 2Y5JA 1RK5A 1ZTVA 4P7RA 4DJEC 1BXCA 3BCDA 3RX4A 4AD1A 1C91A 4PBFA 3U6WA 4AQLA 1QNOA 4MGGA 2FPYA 2P8BA 3CAQA 3VI2A 4KS0A 1PO9A 1WYIA 4G6CA 2QZRA 2QJIA 2UY4A 3GHRA 2VXNA 5KETA 3K1DA 3M0IA 3W1UA 4NX5A 2GQ3A 5D05A 3LCGA 2WBKA 1CGYA 3GXNA 1AD1A 2UZ9A 3PJTA 3KRSA 1RA0A 3LXBA 4FNPA 1HF6A 3CLMA 4H41A 1G7UA 2Z26A 2ZVRA 3BLOA 2QR6A 2QCFA 4JEJA 4IFKB 1WPCA 4GUFA 2PBGA 4DM1A 5AZ1A 4LC6A 4AY1A 1W56A 4N4QA 2VVNA 3U8GA 1XIMA 1X98A 3LEPA 4MDPA 1RA5A 1R9YA 1GZGA 1JI1A 4NAFB 4IQJA 3OLEA 3KBJA 4BQ5A 4UC5A 1XH0A 1CLXA 4GH1A 3T44A 5DANA 2CLFA 1TE6A 3MBDA 1RBOB 3E96A 2Y24A 3KOZA 1NQKA 4CCEA 2WV8A 3NQ7A 3T2QA 3QHMA 1H7RA 2WJZA 5HNRA 2I57A 2C0HA 5FACA 3SECA 1ZBWA 2B7NA 1KV5A 3W01A 3V5FA 4LJ3A 3LHYA 4C6FA 4ICMA 4DZAA 1UKSA 2EPLX 1VRDA 3GVRA 3CQ0A 3HPAA 4JEQA 3S9IA 1E55A 3NG3A 1JDFA 1B90A 2YXXA 3QV8A 4BF5A 5D02A 3V35A 1RSCA 2VRJA 4JY8A 5LNSA 3LGEA 5G4WA 3GBEA 1EOMA 2G96A 1TVNA 2X7VA 5CPMA 1XKJA 4IM4A 3GG0A 2J13A 3VABA 2EKCA 2DSVA 1GW9A 3FS2A 3ISIX 1GEQA 1RHCA 3D6NA 3SFWA 3AISA 3I7SA 3EWXA 4JYFA 2E40A 1H1NA 3N3TA 1AQFA 1W2VA 1SQ7A 1DJHA 3TW7A 2PAJA 3AALA 1GWJA 2HZGA 5LIUX 1PAMA 2FDSA 3UZYA 4YXGA 3DFPA 3GKFA 3TP4A 4O15A 3BW2A 3RJXA 3EKGA 3DG7A 3JR2A 1WQ5A 4NYUA 1PKLA 2HROA 4F0LA 3THAA 5BXRA 3MB9A 1XDLA 2V3EA 3PUDA 3KRBA 4ASTA 2C16A 5F2MA 1OBAA 4QS6A 4RDZA 2KX9A 4OECA 3EWDA 4HT3A 4RV3A 2AMGA 2E5DA 5MKGB 2FB3A 1Z8AA 3IJIA 3VDGA 2E9BA 4S2CA 3MUZ1 3IIOA 2OZ0A 4GGHA 2PWDA 2ZUTA 1TPWA 2DT0A 1FWNA 3LGGA 5BWFA 4PSPA 2I7GA 4R27A 3HG5A 1F7BA 2OFJA 3IJDA 4O8AA 2QCCA 2XVPA 1LOLA 3ITOA 1E4MM 2FIQA 1XGDA 1I45A 4KH2A 2PTYA 3N3MA 3QTPA 1NY1A 2UY5A 1RAKA 3O9NA 2WW5A 2HBVA 4IMAA 2IPGA 1DJGA 1TPH1 3S42A 1GJUA 2BGSA 1DL3A 4LUSB 2XWDA 1UOZA 1WDWA 3VD3A 3CGTA 1KFCA 2E9LA 4ACYA 3N19B 2OWCA 4O50A 2ZUNA 5A8MA 3BLPX 1OINA 3VOHA 2NQJA 3WK3A 2Y5EA 1DHKA 2CESA 2GGEA 3MHFA 2PGWA 3U2EA 4N9EA 2AL1A 1WX0A 2VOMA 3RXZA 3V5OA 3MTWA 3I7RA 4TV6A 2W0UA 4F2BA 1TTQA 4A3QA 2A0NA 4RW5A 4KIRA 4YYFA 4DI8A 5A8PA 1IEIA 3E6EA 3CJPA 4CN1A 2XFYA 5M2FX 1SVDA 3P2VA 4TX9A 1TJPA 1W1YA 2QDHA 2V38A 1F5ZA 1AL8A 2E6DA 4N0RA 2DY3A 2PTXA 2V5JA 4AX6A 4BS0A 4CQCA 2TAAA 2G3MA 1WZAA 2W63A 2WK2A 1EYEA 2HVNA 4KKXA 2ASHA 1DP0A 4JTRA 3N6QA 5F4SA 3SRFA 1DOSA 3GFXA 1CXLA 1DIDA 1XLEA 3OBKA 5EKYA 1GOMA 2VEKA 4PRWA 4D6FA 4F0KA 3CXOA 1CXKA 2O4QA 3K13A 3R1ZA 4D2JA 3BH4A 2VQTA 2GDVA 1EKOA 3UWEA 1KTBA 3T07A 1G4TA 3VIKA 1H0IA 1OX4B 5HQLA 5XIMA 1K77A 5REQB 3ARPA 4PMRA 1XLCA 3MT1A 3CMJA 2J7FA 2CLKA 2H9AB 3IRDA 3PFMA 1R85A 4PCTA 4GYKA 1TUXA 4HCDA 3BLFA 4E8DA 4AXNA 3E3HA 1LLOA 4K2SA 4M29A 4NZ4A 5BOEA 1TZ7A 4IFOA 4L9ZA 1NOFA 4HTBA 4IX0A 4NVTA 2ZOXA 1T8QA 1VD6A 1TRIA 2G37A 3ZZ1A 3DHPA 3G0UA 4D6DA 1ELSA 1M41A 4ZOBA 3ALFA 3ZR4A 2Z1WA 4DYJA 3OW1A 5I0DA 4MKSA 4AD2A 2WVVA 3RHGA 3QQ1A 1VBJA 4MPKA 2VGGA 3EDDA 4LC8A 3NGFA 2E8ZA 1W9BM 4AHQA 1AH3A 1H2JA 5AYXA 3HF3A 5E0CA 3NL6A 2BGNE 3WNLA 3MBFA 3TYCA 3STCA 1B3OA 4D9PA 3EYPA 3SY5A 3AHXA 1QO5A 2HXTA 3T8QA 4MB1A 2QYGA 1EDTA 1YRRA 4I7UA 4HCLA 5CPLA 2X8RA 2ZA1A 1TPUA 1TPEA 1V5XA 2V3FA 3DI0A 3SY8A 3TAKA 4S39A 1XIGA 3WFLA 3LSCA 2FVKA 5IDIA 3INPA 1EP1A 1P0DA 3T9PA 3UW6A 2VZVA 1L8NA 4PMDA 3WJZA 5DN1A 1QHZA 2E1DA 4RXGA 2IMRA 2PDFA 3SCSA 4GXMA 3LLXA 1QOQA 4XV0A 3T2OA 3ZT7A 1A3WA 2FQIA 1XBXA 2XVLA 3GNRA 5BROA 5A6JA 2W66A 4BQ3A 2EPKX 4EF9A 3TLLA 4DUWA 2R94A 3LENA 1KRBC 1PZ2A 1TMQA 3F4VA 3PK7A 4MSSA 5B7ZA 4OKDA 2J27A 4UUIA 3NURA 4J3ZA 4W86A 2PU0A 6REQB 3SQLA 2ZX8A 2HCVA 1UZ1A 4LPCA 4ORIA 2ACQA 3CAWA 4S3AA 3CK5A 3P84A 5GNYA 4AIUA 2CNCA 3WKZA 5A6BD 4E3VA 4DF1A 3CHVA 1JNDA 1I1WA 1K1DA 4DY1A 2VC9A 3G22A 2CCRA 3H2AA 3WH8A 4REQA 1LTDA 2XISA 1PKNA 3QLDA 1F4AA 4UNKA 3SJNA 2I5QA 4BHYA 4QXIA 3VKAA 3WD4A 3SM0A 1Z69A 1IV8A 5I3FA 3G3DA 4PMQA 3GTXA 4LH8A 4BY3A 1HJUA 3DYOA 4QCEA 3N73A 4L56A 4R85A 2JKEA 3ICJA 3MKVA 3EOLA 3E2SA 4NAEB 1CENA 4DI9A 1JPMA 5HR6A 1BVNP 1CYGA 4AMAA 1KFWA 3QLLA 2NUXA 5CEWA 3EWCA 3BSHA 3OBAA 3C86A 2WJEA 3KVKA 1KTCA 3RDKA 2A6LA 3RN6A 1JR1A 2J74A 5HQMA 2OJPA 2Z1VA 3ZLHA 1WDRA 3VIGA 4X22A 4PBGA 1QPOA 1HKKA 2F2KA 4N6FA 3B05A 3GH7A 3Q94A 3R25A 3VCNA 2VEIA 3PG8A 3ZM8A 2JBMA 1NU5A 4H83A 4O0KA 3N2XA 1B9BA 3K46A 4TQTA 4LV4A 4GNKB 1VF8A 3KTXA 4GFIA 1UD4A 2Y7EA 1RZMA 4GRSA 3NQGA 2WZEA 4JTJA 4QS5A 3SGUA 4GI6A 5CZSA 1Q7ZA 3FX4A 3FCPA 2WYSA 3T1GA 3U0HA 4QHRA 2DORA 2J25A 1XSIA 3S1WA 3NJ3A 3WZ0E 3LPOA 1GVFA 1Q65A 1FFQA 1CGTA 4GXPA 3L66A 3ZWTA 1QO2A 3LBMA 4JY9A 4W88A 2X2YA 4PN2A 1WZKA 1TUFA 3ZJ8A 3B9NA 3GUWA 3QKEA 3DOPA 4E38A 3VZXA 1B0IA 1UIPA 2OG9A 3GDLA 3BPWA 3ABRA 2BGQA 1NOWA 5TF0A 4AF0A 4R9OA 4BA0A 3EWUA 1A5NC 4ZO6A 2E09A 3K2GA 4XZBA 1XFCA 4GD0A 3PN8A 1HO4A 5F1VA 3W38A 3SADA 1X96A 4CUCA 4D71A 2ZTJA 4H4IA 1GQIA 1YX1A 1YHTA 4X0NA 4H7VA 3HMJG 1H41A 1XQLA 5DX7A 3R94A 5FJIA 3QFEA 4NASA 2D0FA 3RGTA 2PRHA 1ZAHA 4XD5A 3II1A 4A8LA 4N6EA 4H7ZA 5BU6A 1GJWA 1ISYA 3IGHX 5FF7A 2ATMA 3M0JA 1FRBA 2QVNA 5LHEA 4HB7A 5ECVA 2AMXA 3LXCA 1UA7A 4PRRA 3W29A 5D9NA 4JIIX 1W17A 3CASA 3TYBA 1BWKA 2WJDA 1CLKA 3E0LA 3F5LA 3G1DA 4ZQNA 1YDYA 5I07A 3L4TA 3HPZA 3WH7A 3UETA 3BJSA 2QF7A 2GOUA 1ME7A 1MQQA 4QQ3A 5DMMA 1E0TA 2I5GA 2XM1A 3QTGA 4F66A 3L4XA 3PUOA 1IXQA 5C70A 5CCZA 1YKWA 4A6GA 1E4NA 4OBSA 1AH0A 3A12A 1CB7B 4HA3A 2V5CA 4XIAA 4DBSA 3EMQA 4O10A 3DIPA 2FGZA 4FNTA 1EC9A 1AQ0A 2YW4A 5C8BB 4M51A 4NQ1A 3UZXA 1P0KA 3WG6A 4U2ZA 3TR9A 2QCGA 4EXQA 3E0IA 3L23A 1S2CA 4DBDA 1L2UA 1RP9A 3ZSSA 2X2GA 1NTHA 1WBJA 4GYPA 1JXKA 1HKWA 5RUBA 1GQKA 4O0ZA 2ZUUA 4UQCA 2WM1A 1FWDC 1OHLA 3M7WA 3ITVA 3IK2A 2E5CA 4FXJA 1TWSA 4GYPC 5EBAA 5FL0A 5EMYA 3H2NA 3G1VA 5HAOA 3A5VA 1XISA 4TTGA 1MUCA 1NQ6A 2D0GA 2OR2A 4S1FA 4C7GA 3TW6A 3VNIA 3ZVHB 3PTDA 4RCXA 3UXIA 2NQLA 2VCAA 3IRSA 1J4EA 2F6UA 2QHAA 1V02E 3O6YX 2CLHA 4QJ1A 3MUIA 1WKYA 2RKXA 3GAKA 3SCQA 5CC7A 4PGLA 5K2ZA 3H53A 4C65A 3TC3A 3TNBA 4DAFA 2R14A 4BEQA 3B04A 1E56A 3N11A 5A3HA 4Z2KA 3RLVA 1ZBVA 1WXYA 3WIJA 2R24A 1DYSA 4ATDA 1KBIA 4AEOA 1VBHA 2D23A 4K8HA 4GVIA 4LSBA 3N2CA 2CZVA 2ZFAA 3VX0A 3KCJA 1IIGA 4O11A 2BVYA 3GU1A 1QNVA 4GX9A 5HUPA 3CQJA 3FGCB 4K3ZA 4UOZA 2Y88A 3LX9A 2DJXA 3VKBA 4DPQA 1OGBA 2YXOA 4H8VA 4C6MA 3ATYA 3P6LA 3F2CA 1XM3A 5BNKA 3I3DA 1P6WA 4Y9NA 3C2EA 4XZNX 3SFKA 1IT8A 7REQB 2KAUC 3WMBA 1XG3A 3FW6A 3THDA 1B3YA 5I79A 2ZTKA 3A3HA 4K39A 4UTFA 3PWIA 5C9WA 4WY0F 3L9CA 4DUOA 1WZLA 2W5FA 1T99A 4JTEA 5MF5A 4YVXA 1MW3A 4BKNA 3WQFA 4YHEA 4E8GA 4PCFA 1K9DA 4ZENA 4O1AA 3A4WA 4MFDA 1T41A 3LRLA 3GW0A 5LIWX 1K6WA 3C3UA 3WLSA 2A5HA 3K8MA 1ZAIA 1HJQA 2G3IA 3HPSA 1IEXA 5GJPA 4D6CA 1Q6EA 4N42A 1S2UA 1PB0A 2PRLA 5KZDA 4EVZA 2PBOA 2CPUA 2QIWA 2VR5A 2J77A 2BHZA 4EX4A 1VCFA 4A3UA 5AYZA 1W9XA 1VFFA 4LVAA 1XCXA 1MW1A 4TV5A 4EPBC 1UR4A 3MVIA 2WCGA 1L0PA 2HK1A 3AS0A 2FFIA 2O7SA 3D5HA 1E1CA 3B8DA 4WZHA 4UMAA 2DGAA 3L0NA 5BRQA 1T6MA 1FWSA 4O0QA 4B2DA 3UJ2A 3EA1A 4QROA 2FTWA 2PC4A 3UWQA 1V3IA 3AS3A 4F9DA 3KRZA 3ARQA 4FZIA 1R7AA 1JDEA 1KBKA 3A9BA 2DT1A 1JPIA 4DXKA 1GOOA 1BEUA 1REQB 4UIOA 4FO4A 4KEZA 1R9XA 4U5KA 1SW7A 3HGSA 1GCYA 1E6SM 2PURA 4H6QA 3U48A 1JGIA 1EGZA 3R0DA 4AYGA 1V3KA 3L5LA 4Q4KA 1ZAJA 4AMCA 5CBBA 1YQ2A 3FJ6A 1OX5A 4TVDA 1M7OA 1MI3A 2BB0A 1LRNA 1UP3A 2ZICA 2GDUA 3EEZA 3W88A 1ZSXA 4H8NA 3GIQA 4GY0A 3WENA 6TAAA 1S5NA 1W3LA 1ZHAA 2PWGA 2F84A 3O8AA 5AC4A 5KITA 4RV8A 4Q8QA 3DDMA 1NWRA 2PF8A 4M8UA 4BCEA 1AD4A 5D9MA 3VA8A 4GY1A 2XIBA 3GC2A 2TMDA 1R2RA 5G4HC 4FF5A 3EOSA 5F4WA 1L8PA 2DUAA 4GBDA 4Z2GA 5GPRA 1P7TA 4V28A 1R30A 3FDGA 3DAQA 4L4LA 2Z1XA 3UPBA 1DJNA 3MDWA 2QKFA 3VE9A 2GWNA 4B3ZA 1LWJA 2C18A 3ZLGA 3KS6A 4TVUA 1Q6OA 3OZPA 4MNJA 1W1A1 2DV0A 4R7WA 2INEA 1A80A 1A5CA 4QITA 5EMLA 4MYXA 2DPEA 3WLRA 1HXJA 1NIUA 3WUBA 1XV8A 1KQZA 2OT0A 4F0RA 3H8AA 1U83A 3AYTA 1A5AA 2WVTA 3TVAA 1H4PA 4CCDA 1JIBA 2X1UA 3W7CA 2DT2A 5AYIA 5AVHA 4HMDA 3OLGA 2G4FA 3W27A 1UP0A 1FWEC 3RYSA 4EWND 1JDAA 4W84A 4CEXC 4KMQA 5TIMA 3WF2A 4M56A 1EC8A 4I6KA 1WKFA 2QDGA 2A85A 1NFPA 2V82A 3ZO9A 3XINA 1KBLA 5CG0A 1LT8A 2NQ9A 4KETA 4JTTA 2ZKMX 4OT7A 1LORA 1IWAA 3HJZA 5HNUA 1IWBA 2OKTA 2CFFA 3S2NA 1Z44A 3T8LA 1H1YA 1EPXA 2ZDRA 4ATWA 1B1YA 1YXCA 3AMLA 1OK4A 3H4WA 1Q7QA 1XIIA 2I1OA 3TZFA 3VUSA 4U28A 2WSQA 4QG9A 2E67A 1X6UA 1E9LA 1X6LA 2J8TA 4P8VA 3WD1A 2YR1A 4H6EA 3S5YA 3NTYA 3K1GA 4P7LA 5M5DA 2ZXDA 5AVNA 3ZWSA 4ZSUA 3UR7A 3LS9A 4UQDA 1X97A 4NT0A 4XIMA 3WCZA 5JIPA 1Q8AA 2WC4A 4I6VA 3AICA 1GVIA 3QOMA 5ABEA 3UY8A 3BXWA 4JQ4A 1J0IA 4HMNA 4TU1A 1QFEA 3ITGA 3QZEA 3O3RA 4W7VA 3FV9A 4NAFA 1BKSA 2F61A 4XZHA 4ALDA 2X1RA 2VC6A 4ZE4A 4C5ZA 4O57A 2QMKA 1E71M 4EK7A 5A8GA 3BV4A 4RPPA 4UCFA 2IKHA 3ITXA 4DF0A 3W1AA 5BRBA 1VFHA 4XSMA 1YPFA 1S2TA 4B5SA 3CZLA 2WXDM 1PZ1A 1Q85A 4YCOA 4UR7A 3FA4A 2YL9A 3QC3A 5HWNA 4PMOA 2VL4A 1NAL1 3JS3A 1PUDA 2AKMA 2FGLA 4C6KA 4WJEA 4RPQA 3TXVA 3W7RA 1ICPA 2WSKA 4KPLA 1UD2A 4N7QA 4P8WA 3BTNA 1SW3A 1S3TC 2VZUA 3P0XA 3VCRA 3W3OA 3EKLA 2NX9A 5I7GA 4LANA 2P3EA 2V2DA 2V81A 4IJRA 3UZWA 5CZ0A 1XH1A 5HDRA 1EJTC 2PTWA 5AYBA 3VNMA 5G2IA 3MS8A 2VOTA 2YYTA 1O95A 1QNRA 4RX0A 5F7UA 1XLIA 3MO4A 1J01A 1I0DA 2P0OA 3E0VA 4MJZA 3WMLA 3WF4A 1IWPA 5KZMA 3AMKA 2DP3A 2PWEA 1MDLA 3VMNA 3V0TA 1E5NA 4D8ZA 4G5DA 1UPPA 1R2TA 1DORA 4ZQPA 3ENLA 4H19A 1GORA 2Z7KA 2CZEA 1CPUA 2I17A 3ZLFA 5HJYA 2PDCA 3GHUA 2RDTA 4JGDA 3WNPA 3O63A 1BGGA 2DUZA 2PLJA 2TPSA 1OG6A 1Q2RA 1WXJA 4XAFA 4PB5A 3LMYA 3I4KA 2BXVA 4PUDA 2NQHA 3IEBA 4H9MA 4QJ3B 2PD9A 3KUMA 3V7PA 4V1YA 3B97A 4E2VA 3MMDA 1YTDA 4F2TA 4WSKA 4Y8EA 3GH4A 3GHSA 2BBFA 3VC5A 1Z48A 2GFTA 2ACRA 1GOKA 4NNBA 1BHGA 1GNXA 2WLYA 1EWEA 1FHDA 3ARTA 3OZOA 3S1XA 1PX3A 3FVMA 2HS8A 4DNHA 5EY5A 3OTRA 3GM8A 3FHQA 4YVVA 3POCA 2CBJA 2PU1A 1G4PA 3RX2A 1JZ6A 3DENA 4ZQMA 3NGJA 2Y63A 5C2CA 4JFTA 2P53A 3AYSA 2J6VA 4LUSA 1RXOB 4IQLA 1KFLA 3N14A 2VO5A 1MQPA 3DHFA 1QR7A 2WSYA 2YCEA 4IGMA 3KM8A 5A2AA 3ARRA 2NLYA 3AXMA 1QCWA 2Z00A 3U9IA 4O1EA 3TXZA 3UVIA 2QGYA 4QNWA 2WHLA 1JZ2A 2PDUA 4NY2A 4AZIA 3G77A 4LGXA 1MUMA 1HL2A 3VIPA 1RVKA 1KXHA 1UD3A 1G69A 1UH4A 2O7QA 1Z89A 4HNVA 1XYBA 2REQB 1J93A 3STEA 4K6AA 1JCTA 3EXSA 4UTJA 3GG1A 5G2WA 4IQEA 4QDWA 1S1RA 3AO0A 1IEWA 4W5ZA 3M44A 3TSMA 5I6SA 4US6A 1N8FA 5CLTA 2DZBA 1DJYA 5EU9A 1PTGA 3HOJA 3VD7A 3JZEA 4IIHA 4K8EA 1ZQ5A 4FIQA 1FA2A 3TCEA 2Q8XA 3DECA 3RCNA 4KBXA 3PB0A 3WL0A 1T7LA 1FWRA 1DVJA 1OX4A 1R0MA 5FSEC 4DJDA 3S6DA 2CLLA 3N18A 1WE5A 5REQA 1M6JA 5HK4A 4ZVJA 2VGIA 1CNVA 3CV1A 2H9AA 4AB4A 5EBUA 2DH3A 3BE7A 4DJDC 2NUWA 3H4GA 1H49A 2WPGA 3RRAA 1A5UA 4FR6A 3W7HA 3QMTA 3E74A 3MQTA 2BNJA 3LU2A 3VNKA 2ZYFA 2C3ZA 5EFDA 1TQXA 4R7OA 1FCBA 1W6TA 2HEJA 2D20A 1TWWA 3ZXWA 5FL1A 3IS4A 1NOUA 1NWSA 1LL7A 1TV4A 2R82A 3ORWA 4GZIA 4L9XA 1TREA 3NPWA 5C55A 5EA9A 4Q8WA 4AWSA 4YIWA 4PUNA 1QUMA 3C4UA 1OM0A 2I5IA 4AU0A 3ZJ7A 4LUIA 1DJZA 5E09A 4WRHA 1FWFC 1DE6A 2C19A 4FALA 4CD6A 3EPOA 3MU7A 3OVPA 4QE1A 1MMFA 2ONEA 1HL9A 3N25A 3NA8A 1W91A 4ACZA 4FXSA 2ZIDA 1ENUA 4Q8VA 3VU2A 3WDJA 4HNUA 4YWIA 4HQVA 1E6QM 1UASA 3PZUA 2J7GA 4HNOA 5EB8A 4E3TA 3WNNA 4WDXA 1Y0EA 1AW5A 3IV8A 4MWAD 5I3HA 5I3JA 2HQAA 2VKZG 3H2FA 2HISA 3EX2A 4FA3A 5CSRA 4JX6A 1C93A 1Q4WA 1V6VA 4V1XA 3W1RA 3WFAA 1Y5XA 4GVGA 4WKFA 3WLTA 2WVSA 4BFAA 1K7FA 2FZDA 4MWAB 4ZTXA 1VS1A 2RDXA 1IZJA 3DERA 4JQ1A 1OF8A 2Z2UA 1FTXA 3N12A 3P5ZA 3U2OA 1VFUA 2PP0A 1Z41A 1XRVA 3VD9A 5C9UA 5AHIA 4ZB0A 3RF9A 4K37A 6REQA 3SUSA 3B9OA 3W6MA 1RR2A 3FJLA 4XQ6A 2YJQA 2E6AA 5D37A 3UJEA 4J3WA 2J79A 2QJHA 3VDAA 2ZRZA 2YZ5A 1JCYA 3LI1A 2I14A 3UWVA 5FA5A 4JOMA 1WA3A 3IIPA 3EA3A 3M07A 2AL2B 3E2QA 2XDFA 3WDRA 2XWEA 3DYPA 1H5YA 5CGMA 2UWFA 1MXSA 1LLZA 5A6BA 1OCNA 2V30A 3KDNA 2C14A 4H6RA 2QW5A 2YA0A 4NRSA 1ADDA 5AZ0A 5D9PA 2VX7A 3GR8A 1L6FA 3TTEA 4MB4A 3BMWA 4FXFA 1D3GA 3DCPA 4F8XA 3GE7A 5LA2A 5FF4A 2HBXA 5ABFB 3S6OA 4CCZA 4M80A 3DN5A 2R1KA 1UOKA 3WBWA 3U5UA 2VFGA 1P6CA 2ZXQA 4H04A 3W73A 2FMOA 5DQPA 3W7KA 2QCHA 4IGSA 2I9EA 2X16A 4ZL1A 3QVQA 1ZY9A 3DESA 3KW3A 3OA3A 3HBLA 2HMCA 1QPNA 2A3HA 2ABBA 2WKJA 4OIFA 2QDEA 3H26A 3W24A 3M46A 3P74A 3LTYA 4K8GA 3HQ1A 2P3ZA 5D33A 2DZUA 3C2YA 4C6NA 3TN3A 3OIXA 3WNKA 3UXAA 3PNZA 4AZHA 1LJYA 3XIMA 2Y1HA 3AIUA 1E0VA 3POHA 2VM8A 3AOFA 4Z0SA 5E6YA 3MYPA 2ZUWA 4LS1A 1ESWA 2VDHA 3FJNA 2POZA 3OVGA 1JF6A 3EMCA 1FKWA 3ANUA 3GU2A 3AJ7A 2ON3A 4IMEA 1AQHA 2VWTA 3BVJA 5LGXA 3U4FA 2GJLA 2A3AA 2WC7A 3UP8A 4NNCA 3IARA 3A6OA 2IKJA 4JS3A 3E38A 3AXKA 1BWVA 3A64A 4KQNA 4AFYA 2E7FA 3VX1A 4QGCA 2D2HA 3LI0A 4AD5A 3IUIA 4ATLA 4RUBA 2WWCA 1Z32X 3IGXA 4MG4A 2WNWA 3GDBA 3VDHA 4GINA 3W2KA 1XUUA 3NO5A 1X8CA 3R7MA 3WX7A 4XVDA 3SRKA 5KZEA 3I3EA 3FFSA 2QCDB 1A49A 5GVJA 2WCAA 1G4EA 4KRZA 3QV7A 1VPQA 3MUXA 2OWWA 2B7QA 1OK6A 3FAWA 1QXLA 1SZGA 5AC8A 4AAJA 3RMJA 1YLVA 1Y8BA 2Z0IA 3V75A 2C79A 4IIFA 2E9MA 3V0UA 2DIEA 4IISA 3SI9A 3NEVA 4GY7A 1YE4A 2QV4A 2RHGA 4M5PA 3NVTA 2WNZA 5DBTA 5FF2A 3K5XA 3RPMA 4GI4A 4CCCA 2VX6A 1YBQB 1EF3A 1D2KA 4RNJA 1VJIA 4AYSA 4Z08A 3P62A 1EJVC 3AUJA 3C61A 3DFHA 3QBUA 1TWZA 3TE9A 2ZRXA 4QIUA 4HPNA 4LAUA 4F2UA 1WAUA 2RJHA 3PF3A 2BG5A 3BAXA 5CLWA 2YSWA 3VGEA 4ZA0A 2YBVA 1EJ7L 2YGYA 4RE0A 7PTDA 3GRIA 4GOAA 1WNOA 4JBRA 1XPYA 1PDZA 4MUPA 4OGZA 4JTSA 1J0JA 4HA1A 4S3CA 5FJOA 3SBFA 2P50A 1UKOA 4C6PA 2INZA 3GXMA 4PEKA 1UJQA 3A23A 4L5ZA 4WSHA 3GXPA 1FWTA 1VPYA 3UR8A 2C8NA 3EWZA 1QPRA 2FZ9A 3C56A 3WJYA 1JZ5A 2D24A 2OSWA 4PZVA 3QYQA 4LB4A 5IBXA 1KLZA 4WIWA 1VEPA 4GCXA 4XTDA 2Y62A 4F0SA 3VNJA 3TCSA 3NYDA 3F2DA 1B54A 3A4JA 4YTRA 2X05A 1KCKA 2JGYA 2NT1A 4DZ5A 2IKIA 3GNDA 5IBXC 2CYGA 3C8FA 1M7JA 1PE1A 3F4CA 3L4ZA 2PGFA 4HNCA 3SIZA 1C29A 5G1MA 4YYCA 1UR2A 1XYLA 4GBUA 2PRMA 3CHFA 5TQLA 5D09A 2PDXA 5C0QA 3WDPP 2HWGA 3AROA 4WK9A 3AS2A 1QNSA 2PDWA 2OGYA 4ZFMA 1MXGA 3VNYA 4BWLA 2Y7GA 2PDBA 3G5EA 1D8CA 1YNYA 3FOKA 1J12A 4BI5A 4C6OA 2XFRA 2EKGA 1SZEA 4JZ5A 5JH2A 4XO6A 4JTGA 4FF7A 2EG6A 5E6ZA 4BWLC 1OQFA 3L5MA 4B3LA 3GDRA 2JKAA 3W9ZA 2VP8A 1P4CA 3UY7A 5MHBA 2CHRA 3RU8X 2QCNA 3CPRA 1KB3A 4HCHA 1KWGA 4L1GA 2Y5SA 4E5TA 1DWFM 2GK1B 3K30A 3BSMA 5LIYX 3HJEA 4NKCA 1ZLPA 3WLQA 3TONA 3VOCA 3VNDA 4L6DA 3FGCA 2XZ7A 4NHVA 2TODA 1EJXC 4LYRA 4PEEA 1PV8A 4IICA 1O4UA 1ZBKA 3A5FA 5FJTA 5HOSA 2Q01A 3GC4A 1KGWA 4W93A 4E2OA 2IUZA 2WHKA 3HPFA 5HUOA 4A2RA 3BO9A 3SCUA 4XG1A 5JBDA 1FWWA 4LBUA 1TKKA 3PM6A 4LBSA 2PE4A 4I9JA 2G3FA 1FOBA 7REQA 1JI2A 4GUJA 1OFAA 4NL1A 2IQ0A 5EYWA 1UUQA 3AQUA 5FOOA 2BFGA 4A8IA 2PFHA 2OOFA 4GKTA 1XIFA 4YTTA 3K4DA 4GYJA 5I06A 3KVLA 3PBGA 1EL3A 1PYMA 3AIVA 3PG9A 1TTIA 2JIEA 1NDYA 3L4WA 1I60A 2B7PA 1E0UA 2MANA 2WJFA 3T05A 3W1XA 1EEXA 4JX4A 2D2OA 4Z1CA 4FMVA 1VH7A 2BV9A 2JIWA 3VCCA 1EDQA 3BOLA 2YB1A 1K7XA 3TR2A 5A1AA 4CD8A 1SJBA 4TR9A 8CGTA 2A3EA 2Y8UA 3G6LA 1E5JA 1ZS2A 1C8XA 4NILA 3U2ZA 3WYZA 3BAWA 4HGXA 5LYRA 3UGRA 1FP8A 3GLCA 4BJHA 4HU8A 1L2QA 4XWUA 2AQWA 1TELA 4TXEA 3GYEA 1SO3A 4GABA 1UKQA 3OGSA 1DHPA 4H1ZA 3IVSA 1CWYA 3WMCA 1SPQA 1JDCA 2OSXA 4C1LA 4KWWA 3KTCA 2ZADA 1K9TA 4QM1A 3B40A 3VE7A 4EAYA 2PDIA 1B31A 3GXIA 3LCWA 3STFA 1OZQA 2QAPA 3W86A 4CNUA 1YIXA 2QUVA 4FOUA 3TSBA 1MWOA 3NCOA 5FCZA 4JIHA 4RNIA 4Q22A 4JX5A 4UB9A 3B0XA 2VX5A 2FVLA 3G8EA 3BCFA 1QNQA 3RK8A 1REQA 3ANVA 3ITLA 3BK0A 3EX4A 2IS7A 1UKTA 3B0UX 1NVMA 2XVKA 3MANA 4ZOEA 1W9UA 4AVOA 2QJMA 5KTLA 4QRNA 4G56A 3HO8A 4M19A 3KP1A 5GNXA 4HZ7A 3QPZA 1RUSA 3QPEA 2ZRYA 1H62A 4ZZ9A 1F73A 5HQEA 3W7NA 3WUFA 2NXHA 3H2CA 1BSIA 2WCSA 4N9BA 4A8RA 1KM5A 5H6HA 1M03A 4P2VA 4K7YA 1UR9A 3RCYA 3W81A 4CNOA 3LRKA 5D9OA 3KRUA 1E6ZA 1NH6A 3CMFA 1A5SA 1RK6A 2WQPA 4WF7A 1OG0A 1V3HA 4N9DA 4Q4SA 5CKSA 3RLHA 1EJSC 3W2MA 3G2GA 1VHCA 4QEHA 5I24A 4BI6A 1HX0A 1VFTA 1PVNA 2VFDA 4PL1A 1VEMA 1W1PA 1I2RA 4FOKA 2NUYA 3R43A 4LS2A 3R89A 5HNTA 2FLIA 5AHFA 5K7JA 3T0CA 2CHNA 1HJWA 5DXYA 4RKAA 1FWCC 1OFPA 3SQMA 3R12A 5D2TA 4JYEA 1H5VA 4AZ7A 4NXKA 3ONBA 4R88A 4K1GA 3EWYA 2XSAA 4MZYA 3DUGA 3ZYZA 4LT9A 2O4MA 3L2IA 3TTOA 2YFOA 2DVTA 1SFLA 1RPKA 1PZ3A 3N9SA 2ZBTA 3OODA 3VKDA 1J79A 2YDQA 1JPKA 3IGSA 1PS9A 4OOZA 3AIBA 1GQLA 1ML1A 3LNPA 1OT1A 2ZA3A 4HD5A 2VFIA 9RUBA 1J0YA 2YCLB 5LA1A 3MHUA 5KZ6A 4BZYA 1D7FA 4QDMA 4Y8FA 1K8CA 3U7VA 4V15A 1SSDA 4AD0A 2O92A 3CZJA 2WWDA 4DN1A 4CNSA 1HIZA 4PMYA 3HG3A 4KFOA 4W8LA 3UWYA 1R6WA 4MFEA 4ERIA 3CEPA 3PZ9A 3VKCA 3VIHA 3P8IA 4AWTA 3GZAA 5F2LA 2X30A 4TOQA 1RJPA 2QV5A 2P8CA 3I4EA 3WUEA 4JHMA 2X1SA 4X61A 3M5ZA 3NSXA 1P0NA 4H2CA 4H9UA 1HKJA 1TJ1A 1X1ZA 2A3CA 4UZUA 1BRLB 3T4CA 1JUEA 5G5IA 3QY6A 4GZEA 4GQ0A 4K1WA 2XH0A 1H61A 2BP1A 4RZBA 1W1IE 3CU2A 3OVRA 4OZOA 4IOTA 2BS9A 4IG2A 4BF9A 1ZU8A 4PTMA 3HURA 3PPGA 1UA3A 4NP7A 2WB5A 3D3FA 3JZUA 1M3UA 3GWQA 3CWOX 4DO5A 1WKEA 3P0WA 3P7YA 5TNVA 5A69A 3AU6A 1UZ4A 1OT2A 1SZFA 1TPVA 4Q4MA 2E77A 4B2DD 2Z7GA 3A9IA 5D04C 2WHMA 1E70M 2XIJA 3GK0A 2OZTA 1OCQA 4DEFA 3DBPA 3CUXA 2XVNA 5C2XA 4FI4A 4GVHA 3WQWA 4NJHA 2JFEX 1PKYA 1UQZA 3GDTA 3PVFA 5D2VA 4WVXA 3M0YA 3COTA 1WAWA 3BGJA 1RV8A 1EXBA 4YHGA 3EWWA 3W1LA 1C92A 3BURA 3MI3A 2ZE3A 3BICA 4S2BA 2AOSA 1QI4A 3W74A 3LD5A 3CM4A 3EOOA 3KBNA 3NEHA 3R0KA 4B5NA 3KVJA 3LHTA 3VM7A 3LCHA 5DO8A 4HMCA 2RFGA 1O5XA 2Z2AA 4ORMA 3UJFA 1XL9A 3WELA 4DWDA 5ENLA 4YS1A 3GX9A 5FD0A 3DH7A 1NF0A 3JRKA 2FTYA 3LN3A 5T9BG 2CHOA 1XLMA 4KEMA 1GKQA 3KCOA 4C6EA 3SCPA 2AGTA 4KEVA 3IJ6A 1LQ2A 4GX8A 3VIFA 1OC6A 3Q2DA 1NDZA 1TCMA 4K36A 3IUDA 5M03A 3Q37A 3W82A 1ITXA 2J75A 3S5OA 4QSHA 1KRAC 3W6YA 2HTMA 4O16A 4YVPA 3RR4A 2F6KA 1R3SA 4WR3A 4PE8A 2W3ZA 4QJ5B 3M0HA 3WNMA 2HPIA 1G94A 2WLZA 3QZAA 4CQAA 5M17A 3VMOA 4TMBA 4XBSA 3G1XA 1E15A 2NQZA 1TCDA 4IH3A 3KDOA 1QT1A 3GVGA 1UYQA 4DBEA 3NQAA 1GYMA 4Y9OA 3BGAA 5GNZA 1C9WA 4FHAA 4XK2A 4E4UA 1HKVA 3PULA 1B4EA 3FDKA 3GR4A 3CYJA 1ZJAA 3UCCA 1K9EA 1GOIA 3WH5A 4F40A 3UFYA 4ZOCA 3M5XA 3L7RA 1TV8A 1UD6A 4W7UA 2Z6IA 2YCKX 4GQGA 2XFFA 4GI9A 4JFWA 4QEEA 1OFRA 2OLHA 5FJRA 2PUZA 1OCJA 3CLWA 4XAGA 1V6YA 4QLJA 4DYEA 3B9EA 2ZX6A 1QRQA 1IF2A 3KBVA 5LNUA 4PTWA 3ZSTA 1GOXA 5A6LA 2Y8VA 4BK9A 2XIOA 1W3TA 1F4HA 2GPTA 5I2UA 1M7XA 3CIXA 2REQA 3UBPC 3RCMA 4YCPA 1AZ1A 2XU2A 3CTLA 1B3WA 1VP5A 3BQ6A 1R7OA 1MO0A 1U5VA 2V67A 1LL6A 1S39A 3CO4A 3W0KA 4AZCB 3VINA 3IUHA 3UU0A 3TWAA 5C6MA 3QHNA 2NQ5A 1FBAA 4AEEA 4CNNA 2F9RA 4AIBA 2ZUVA 1XBYA 4LRSA 1QMLA 3O6CA 4IGNA 5JUVA 2ZXBA 3G1HA 2FZ8A 1OWQA 1JAKA 1J0ZA 3DHUA 3ITTA 3OZMA 1WV2A 2QPXA 4GPNA 4YU1A 2R8WA 2BY3A 3VO0A 2E0PA 2A21A 1FWBC 4EKJA 2L5HA 1ISZA 3PBUA 4PR4A 3VDCA 1BQCA 5E9XA 1FFRA 4LOCA 2HV5A 1XF0A 3KVMA 1FHLA 3PUGA 4AWUA 3PTKA 3GNPA 3EXTA 1HGWA 3HQOA 2J6XA 3N4AA 4GUGA 3CV2A 3N6HA 4JNYA 1AG1O 6XIAA 5EFFA 5D2WA 2POTA 4MADA 1XC6A 1RPXA 1TR9A 1XSJA 4IXHA 3UT0A 3VGGA 1G7VA 2V0TA 1PDYA 5BYWA 3OYXA 2HRWA 1R2SA 4UTMA 1EZ2A 3EB3A 3W7EA 3NR0A 1OFDA 4JHZA 3BAIA 1UD8A 1W5MA 3ZR6A 1U1UA 4J4KA 3NO1A 3SCTA 5KMYA 1XR2A 4ZO8A 1F76A 3GZ3A 1XLKA 4O13A 2ZXAA 1HQTA 1JQVA 1SMAA 5AHLA 1Q6DA 1NARA 1QPKA 2Y85A 3MV11 4FNQA 4C6CA 5HMEA 3G1YA 5AY7A 3TZNA 4LW7A 3V3WA 4UOQA 1VFLA 1V3JA 4Z0JA 3C0SA 3NQEA 4M1BA 4AVFA 3OHIA 1LBMA 4WJ8A 2WMHA 1WDSA 4RXFA 1A5OC 5AKQA 3WBAA 4MAZA 5D2YA 2PDMA 1F6KA 3H12A 3R10A 1W9DM 2ZWYA 2XPKA 5A6AA 5D4YA 3CWHA 4RE3A 4UFLA 2W62A 1BF2A 3LDVA 4ZXLA 1QATA 3GTHA 5CPQA 2WMFA 4EAMA 2ZZ4A 2QF8A 5C9XA 4L6HA 3NL3A 1QOPA 3MPGA 2WZIA 3P14A 2PD5A 2PZ0A 3WQPA 4K68A 4PULA 1H0GA 2BSLA 4Q8MA 4MWAA 3PJUA 4JIPA 4HPXA 1DJQA 2HVOA 8XIMA 3GXTA 3G18A 1EF2A 2X7WA 4AH7A 4H2HA 3THQA 5IFTA 5IXEA 4F0HA 1SFTA 3CZGA 1JEZA 4MWAC 4X9YA 1EJRC 5DMNA 1RP8A 5F4XA 1DWAM 4L1WA 3KCLA 2B4GA 2VUNA 4KT2A 5DY2A 1IYXA 3DU0A 1GG1A 1PWLA 1PZ0A 3CUFA 3I68A 2ABAA 3TQPA 2ZZ7A 2NVCA 3M64A 1EFZA 3JU2A 1GVSA 1E4IA 2R1NA 3ZJKA 3HIJA 4QLKA 1ZGDA 2AL2A 3QMSA 2X40A 4LUTB 4MOZA 4PTXA 2PC8A 1FP9A 3KBSA 3AXXA 4C6LA 4JTAA 1GK8A 3ABXA 1MZRA 3WF1A 3VOFA 4UTKA 2VD8A 4U4MA 2YLAA 3IJ9A 2VT0A 2CKRA 2Y8KA 4N02A 4TX8A 3EZ4A 1UJPA 2CZDA 2OKOA 4DF2A 3NPUA 2OCZA 3TQVA 4C1NB 4UFJA 3AMCA 1PHWA 3ZFHA 1JFHA 1XLDA 2EG8A 4JDYA 2V5BA 3LPGA 2D2GA 1DTUA 4Z1AA 1OJXA 2ACUA 1MVYA 4FLSA 4J5NA 3T6CA 1R3QA 1IGWA 3ARYA 3WLNA 3WD3A 5ABFA 3MWCA 1IZCA 3W87A 2GDQA 2WZMA 4ICNA 3IV3A 3URBA 2XN1A 2VZSA 1FH8A 1VPXA 3M5VA 3BCJA 3GYCA 4W89A 5HMFA 2WPBA 4S23A 1L6SA 1CEOA 2G97A 2R1PA 3IVTA 1ODUA 1MEIA 5CC6A 1H7OA 3HB9A 3S46A 3WQCA 3P93A 5FEZA 1IXPA 5ABGA 3R8RA 4DHGA 1UR8A 4HHPA 3GAYA 1YW1A 4OQVA 3WH9A 2CITA 1K9FA 4DXXA 5C7VA 1VKFA 4IP7A 3APTA 3KLKA 1O5QA 2Q02A 1SJAA 2ALRA 1ALDA 1W3JA 4DJDD 4LS0A 4JDBA 2X0YA 1ZP3A 5I3GA 1TVLA 3QM3A 3W07A 3CMGA 4RE2A 4OJYA 5HJXA 4PFHA 1KLYA 2EAWA 2VEMA 2VCCA 2HVMA 5BMWA 3VXGA 4UQ9A 3QGVA 2YXGA 2J88A 4Q4QA 5HULA 3NOYA 1EQPA 3NXFA 2MNRA 3K8KA 1I0BA 1JL8A 1XJBA 4Q8PA 2J8FA 4R9XA 2Q8LA 2FH8A 1WUEA 3G1SA 3SO7A 1KWKA 3HG4A 3S3GA 3KL3A 4TVCA 1L9WA 4O18A 2QXWA 4UTWA 4XKYB 1R38A 2QCDA 3THUA 1GG0A 2VMFA 4IWWA 4OVXA 3SCRA 5DRCA 3WQ8A 3BG9A 3MYOA 3LBOA 3RFAA 4AVNA 4AXKA 2QS8A 3WLKX 3OZYA 4H00A 5DLCA 1XLLA 1AL7A 1TVPA 4UTWC 3AHYA 1NELA 1RD5A 1HVQA 2GQ8A 3T0AA 3GB6A 2A3BA 4REQB 3IPWA 3CAKA 4O1DA 3HGJA 3A3XA 4M6PA 3MSGA 3NM3A 5FEWA 4JTFA 4W85A 3SZ8A 3WSUA 1QI3A 2E25A 4LCRA 1BKHA 3ABSA 2I56A 2B31A 3O15A 4ADUA 1YBQA 2WM0A 2G4JA 2FHCA 1TIWA 1EA9C 1LUCB 2HNEA 5ECUA 2CIPA 2I16A 1AW1A 4ZCWA 5CGQA 1GKRA 1KA9F 3P82A 4I5XA 3EPMA 2W4XA 2AQVA 2PSNA 3PSVA 3NSMA 1HKMA 3PJWA 1C3FA 1N2VA 1QWGA 4YTSA 1UC4A 3NZPA 4ERGA 1JUBA 4DIAA 5AECA 3VDBA 2ZZ5A 1C8YA 2O56A 5A95A 2VGBA 1XRFA 3SRHA 4ZE5A 4JTCA 4PTNA 2HS6A 2YYUA 4A29A 3NQ6A 3N9RA 4NZ3A 1WDDA 4GQRA 3FJ4A 3MI6A 2VRQA 3N2MA 4PFMA 2D73A 1LROA 1DEDA 1AUSL 3F03K 1HT6A 3THCA 3W22A 1PHQA 1Q63A 4IP4A 4CNTA 2Q3OA 3TYZA 4J1OA 2VC7A 3B8TA 4DVOA 1GOQA 4G7EA 4GWEA 2X1TA 1GJPA 4OBTA 5FESA 2FJUB 3NPXA 3TQ0A 2XIQA 3UZJA 3ATZA 2WSRA 1S5MA 2OLSA 2V5LA 1SJCA 1JRCA 1OZMA 4TX6A 1E9ZB 1EIBA 5EL1A 2YCIX 1KXTA 5HATA 4ZQOA 3N04A 4L64A 1UB3A 3PTMA 4JHOA 4WSJA 2GGIA 4TTUA 1XPGA 2V69A 1TV2A 3CQKA 3GR7A 3SAZA 4ADTA 3UG5A 4H8UA 1GVRA 2WZHA 2CWXA 5DRIA 1W32A 1P0BA 2G0WA 2WSPA 2D22A 4PTVA 3AAMA 1ISXA 1QNPA 5A6MA 1LWIA 1R46A 3HFYA 4Q8TA 3TX9A 1H7PA 1LP6A 1XBZA 4J3UA 1YTKA 1BYCA 5J8LA 1F74A 2IPFA 1JPDX 4IGHA 4B91A 2GK1A 5LA0A 3BWWA 1GVEA 3VGBA 1Q6LA 3LMZA 4JN8A 2OELA 3ABOA 5CZJA 5J5DA 1OYAA 3KBMA 5DEZA 2QVHA 1PIFA 1S3HA 5J5RA 3VNZA 1YYAA 2HJPA 3EA2A 4DWSB 1XD1A 2J9XA 3WBXA 2EQDA 4ES4A 2TRSA 4FNUA 1VEOA 3VC6A 1KR0A 2AAMA 2DSZA 3W1NA 1RLCL 2PDGA 2GUYA 3AIEA 1IXOA 1NFGA 2WHJA 4CU8A 4D6IA 3A3WA 2BZNA 4M81A 3WQDA 3ID7A 4UFMA 1FWGC 2UY2A 1M5WA 3LSBA 1E9YB 3UESA 4HK7A 3S1GA 3TTYA 3N4EA 5E70A 2J24A 3H7RA 1DQXA 4A2SA 3T4WA 9CGTA 2IPJA 4FS9A 4I9AA 4KGLA 1W0MA 1VENA 1JZ4A 5LXEA 1K6AA 2J66A 4XD3A 9XIAA 3BC9A 3KBWA 4QAWA 1V6XA 3DFTA 3UA3A 1E51A 3KX6A 2ISWA 1TPB1 4WQ6A 5JQ9A 8TIMA 2BXZA 4MZ1A 3VD4A 1MEWA 1S46A 1UD5A 4O8RA 3MVTA 5HANA 4NSBA 3WEOA 4R3UA 2YKKA 1KD0A 4GKLA 4LAMA 3KP0A 1R86A 3C2FA 1J0KA 4LYQA 4DUVA 1F2JA 1WDQA 1E0XA 1YPIA 1US0A 1JGMA 1C90A 3QR0A 3PZQA 3VIOA 3RO6A 4X2PA 3RU6A 4C90A 1SR9A 2J8GA 4S3DA 2GOKA 1Y65A 2JF7A 3QRHA 4IQDA 4LVGA 5D8ZA 2QQ6A 4IHCA 5G1TA 1KKOA 3B9DA 2WMJA 3OPSA 3QV9A 4RJEA 3SSJA 4OE7A 3AZRA 1I6NA 2VGFA 2B81A 2FYMA 1JG9A 3RX3A 2IXVA 3GFZA 1S1PA 2ISVA 3R0UA 4GACA 1DJXA 1R3VA 4C6IA 1EP2A 1KFEA 2E1WA 3BOFA 4IPNB 5U7SA 4FX6M 2ZE0A 2XIIA 4WDWA 4NZJA 3C3NA 3FAXA 3EWBX 3W6LA 3VIMA 5HINA 2ZZ3A 1KR1A 3CWNA 3REQB 4HNTA 3CO8A 3KFTA 3MZNA 3TLQA 1KCXA 1BGAA 1A50A 1VYPX 1VR6A 5LSMA 4LAKA 1BG4A 4BF7A 4WEVX 3MA8A 3RO8A 2J7HA 4MKVA 3ZT5A 4A05A 6ENLA 1U2YA 2NV9A 3TTQA 4O12A 1XXXA 4DLFA 4ECLA 3B0PA 1HL8A 2C6QA 1WBHA 4UTIA 3ZT6A 1QDSA 3LA4A 4Y9AA 3S0CA 3C6CA 3D3AA 4I7VA 3HGOA 2WMIB 2GUBA 3N2BA 3PP7A 1N55A 1H7NA 2WKGA 3NQMA 2E6YA 3RITA 1ICQA 4JD4A 1A53A 1XBVA 4JYDA 2CXEA 4BEUA 3LG3A 1XLBA 3WD0A 5HA7A 2CETA 4QNEA 1GONA 1RQBA 3TFCA 5T91A 4ZO7A 4NNAA 3IJ8A 3N4FA 2D3LA 4GJIA 1TJ2A 3QSRA 2PDLA 5JMUA 1E43A 1QASA 4B5WA 1DXFA 1ADOA 3UWUA 1GQJA 4JQAA 4AZ5A 1ODZA 3GC5A 4RE4A 1P5BA 1JYXA 4GUHA 5JXQA 3OHMB 4I5UA 1XHGA 3O2LA 1THFD 3OGVA 3SJ3A 4JXCA 1BYDA 4XD4A 2YCLA 2IQTA 5E0FA 4QSFA 4YMZA 1EX5A 5A2BA 5IRPA 3UZ5A 3AWOA 2FPVA 3PHAA 4M7SA 1OF6A 1OYCA 2QUTA 4HU0A 4U33A 3TC6A 3VILA 4RNFA 5CC5A 2BWGA 1FXQA 5H8PA 5FAGA 1LQ0A 1GTHA 4GCAA 8XIAA 1YDOA 1GTEA 3AYVA 4RL3A 3PZTA 3VTRA 1JPHA 4XO7A 3W76A 3O6DA 1P0EA 2BVTA 2QJNA 1KM3A 3BL3A 4AZBA 4AIEA 1JUKA 3HMCA 2G5WA 4KWOA 5LXXA 2Z1BA 4J2MA 5EMKA 5LGZA 1G0CA 2QUMA 3EX1A 3ITCA 2FVMA 2HK0A 3VFLA 1ZENA 4EXAA 5CJMA 4WGHA 4XZ9A 1F07A 1B9ZA 4Z1DA 4AC1X 2OB3A 4HOZA 4C1KA 5XIAA 5FJJA 1W9VA 3W7GA 5AYYA 2DSKA 2YDAA 4GO9A 3IAPA 1G01A 1H7WA 4HZ8A 5IHSA 1KKRA 4GNJA 3W02A 1CIUA 4UTLA 1F6PA 4E6MA 2O9OA 3TV8A 2QCLA 3QQ0A 1EO7A 3E2VA 1UPMB 3F4WA 1N8IA 3VZYA 5CPTA 4HOXA 1AODA 1LRQA 3TMQA 3WFZA 4NZFA 3HG2A 5BXTA 5HNNA 2O9PA 3FN9A 5CBIA 1BAGA 3P67A 3ES8A 1I75A 1V7AA 1ZJIA 2INFA 4S3JA 1ZZMA 3KZSA 4Q4PA 3RAOA 4L7ZA 4GMEA 3G8RA 3TYEA 2FTPA 4DB7A 3BMVA 4BR1A 4J40A 1Q13A 1HW6A 3MMUA 1TIMA 1JYWA 3P5YA 3VZZA 1XYZA 3SEPA 4M6QA 3O16A 1UROA 4ICCX 2XN2A 2A3LA 3IGUA 1ITQA 3S83A 3MZ2A 4ZQRA 3S2CA 4M6VA 1E40A 3O07A 1AMKA 2PLKA 5DBUA 4HOWA 3MP3A 3IJ7A 3LV5A 4E0CA 4MIMA 3GIYA 4KWSA 1UP2A 2D69A 3LY0A 1YDNA 3M6DA 4IMDA 4EPEC 3CT7A 1Q3NA 4MM1A 1SUXA 4UMBA 3APGA 5CC3A 1A3XA 4O17A 1X38A 1CW2A 1JJKA 1LT7A 1DJWA 1A5KC 1SW0A 2EEXA 4AHPA 1PCWA 3CHEA 1V0KA 2VJXA 4QFUA 1E9IA 1OCBA 3MUY1 1M68A 4BI7A 2YA1A 2DU2A 4FX8A 4F3HA 3ITYA 3O06A 1KNWA 2EHHA 2C13A 1MSSA 1Z9AA 2ATSA 3IJLA 5JBFA 1CX9A 1UG6A 2J4GA 5HJLA 4GC3A 2F6XA 1R3TA 1HJSA 3E1F1 3W2UA 3TUUA 3BSGA 3C5QA 5LIKX 3S2MA 1EH9A 4US5A 4WOZA 2Q71A 3T2PA 3K4AA 1FXPA 1A4MA 4KW2A 3R8HA 2VDGA 4PODA 4P7OA 4GGBA 1QBAA 1TV3A 2RDUA 1ADSA 3W25A 3AYRA 3T55A 4G1NA 4PTDA 3M16A 3BAKA 2XGBA 2W27A 1QI2A 3W2JA 1ICSA 5L9FA 4Q3MA 3MP4A 2NSOA 3A22A 4WLCA 1VYSX 2PODA 1XGEA 1EUNA 3GNXA 2Z1SA 4O4VA 1DPMA 2MUCA 1K4HA 3BLKA 4J35A 3UCQA 3KOXA 3SN4A 5CPSA 1WCGA 1EWDA 1VAHA 4G8TA 1XQKA 5T8GA 2HDJA 4B90A 1HP4A 3M0MA 3E0FA 4MVAA 5I3KA 4Q8OA 1UQYA 4P7NA 1E4LA 1Y5VA 1UWRA 3P80A 3TSDA 2XYLA 5U4NA 3DGRA 3S5NA 1U22A 4MJ2A 2QIIA 2XVGA 4AZCA 2Y61A 1DKWA 4KCWA 4QBXA 4PUKA 1X39A 2G3NA 3KWSA 3OQEA 2ZZ1A 1OB0A 3GVWA 3D46A 1PIIA 4H9XA 4O28A 3H54A 2QUNA 1POKA 1W8SA 4ZTYA 3MSDA 1GYNA 2JK2A 5CQ1A 2GSHA 1GVQA 4R7JA 4C6JA 4DYKA 1F8IA 1CXHA 1GOWA 3ABQA 3MCNA 1JYNA 4JN6A 1W54A 1AQMA 7A3HA 1XIBA 1CGWA 2CKSA 2H3BA 4D72A 3TU9A 4Q7BA 2BOGX 1TA3B 1SO6A 2NT0A 4FLQA 1KM4A 3W70A 3TTSA 2JQXA 1F3TA 4IFKA 3AHVA 3BARA 1YMYA 1RQEA 3UJSA 5CGTA 5TBOA 2FHBA 4CU7A 4HHMA 1O68A 4LBRA 2EPMX 4FAMA 1S2VA 3O7UA 4PSRA 3SUVA 1R87A 2D2JA 1IXNA 4PUJA 4GXWA 3V16A 2OODA 1S2WA 1J2WA 4ENLA 1O5RA 1QHOA 1Q2SA 1S5TA 3DZ1A 3U7BA 4OWGA 2C71A 1GEHA 2QPUA 4FLOA 4UFIA 3PUEA 5JIWA 2Y70A 3NUKA 3KEHA 2Y7DA 1P48A 3UR5A 3DYMA 3AU2A 1BVWA 4G7FA 4HK6A 1SM9A 2LLEA 3ALGA 3H6OA 4X3ZA 1H51A 4CQDA 2DW6A 2XHYA 2YZRA 4Y6GA 2DZSA 3DC0A 3PSWA 1NF7A 4JPGA 1RQHA 3LBCA 1IR2A 4QQUA 1D9EA 1GPFA 4LWWA 1XIJA 4C60A 1XRTA 1NJJA 5F2IA 4KRTA 2DZPA 3F5KA 3PC0A 1JAEA 1W31A 1NWTA 4OOUA 1XCWA 4CNPA 3AFBA 3VAVA 4NUWA 2EO7A 3TYAA 4LAZA 1RJQA 1TV5A 4V27A 5FEPA 2PWVA 2QEZA 1IEQA 7ODCA 1EOKA 5IOBA 3H2MA 4JTIA 4NJIA 5BRPA 3E0WA 5C71A 1LZOA 3WLIA 3W23A 4C5YA 3FXGA 2XH2A 3A13A 3PZMA 5I00A 3VD5A 2FPTA 3UYIA 3DKLA 4QX4A 3UG8A 2HE8A 1GHSA 1Z42A 4FNRA 4MHBA 4H9TA 3OU8A 4KERA 1ISWA 5DCBA 4B4FA 1E3XA 2Q3RA 3CB8A 4IL2A 2A7NA 4GI8A 5CH9A 1UWTA 2CZ5A 2CBVA 1J9YA 1MUWA 3DBNA 2CU0A 1JD9A 2OYKA 2UV8G 4V2XA 2Y4SA 2YPIA 1IIHA 2WOQA 2JGQA 5A2CA 1Q4NX 3W7DA 1V4YA 1ZP4A 3XISA 5AFDA 3CYVA 5HXMA 1MW2A 2C0AA 1IR1A 3W7IA 5MKGA 4PUMA 3NFUA 4U31A 1EDGA 3LQLA 4OFCA 1W1B1 4HSOA 3AHZA 1YE6A 2DSWA 5LIXX 2ZUMA 4UFHA 5I5RA 2CLIA 4IZGA 3EPNA 3LM7A 3IVUA 4LUTA 3NZGA 3WK0A 2YFNA 3W7LA 1UKPA 1MRQA 1HUVA 3S5ZA 3WJWA 1I1XA 2J9YA 1T5AA 3W7OA 4YL2A 2PA6A 1V77A 4GISA 3SCOA 5GQBA 3NM1A 3O0FA 5H91A 4HSHA 4LVFA 4PMNA 4C1NA 3D0CA 1Q45A 3QMRA 3V5CA 1XKYA 2XUCA 4HPJA 1HP5A 1VCGA 3LUTA 3QYSA 3LHZA 3RLGA 2NZLA 2J7CA 4W8AA 3WQ5A 3UF9A 5CAKA 3QSTA 2NVDA 5A5WA 4A3YA 1VHNA 1H63A 1M01A 4JKLA 5DCEA 3E12A 2V3DA 3GTNA 3CUGA 2OMAA 3EBVA 4M3PA 3R4IA 3L12A 1XLJA 3RG6A 3NNTA 5FF0A 2PLMA 3M9YA 3WEZA 1QI5A 4RZ5A 5K3VA 5H8MA 3CUIA 4Y2WA 4JFUA 3NDYA 3WF0A 4XISA 1WKDA 3R8GA 4MWAE 2AAAA 5LNRA 4D6JA 1PSCA 1SGJA 3BOXA 3UGVA 3NOEA 1QK0A 4ACZB 3H21A 3AMDA 4JN7A 4B9YA 1TYGA 1QPQA 2CLEA 4AW7A 3KE0A 2EXOA 3W4RA 2ZA2A 2V2HA 4HIBA 5D30A 4LALA 1J5TA 4J3TA 4HKPA 1V7YA 3UA4A 4PB3A 1SSGA 1SU5A 4U5IA 1G67A 5HPCA 1W5PA 4INFA 3V36A 1GZ1A 3L4VA 3PZGA 4YTQA 3S8HA 4MY8A 4WY0B 3HFTA 2VR4A 1KGXA 3HPXA 2DIKA 1UCWA 2OZ8A 4HSNA 3QHOA 1KGUA 2YCJA 3WH6A 2FB2A 1RY0A 1UWAA 3UXKA 1HJVA 3EAUA 1OVDA 4M6UA 2IPWA 2WQDA 3TJLA 1XINA 2PF0A 2J62A 5BMXA 1NP0A 2YA2A 1ZBCA 4JTDA 4EPKA 3ECQA 3FYPA 2Y89A 3CAVA 4XKYA 3GG7A 4MAVA 3B4YA 1J10A 3CHCA 4Z2IA 1H7XA 1OIMA 3LV6A 1Y5WA 5CPNA 1SFSA 2ZZ2A 1EP3A 1Q6RA 3WQVA 2E68A 4YLWA 3TKFA 1ZB5A 4HYRA 4C6QA 2E8YA 4IPPA 1XYMA 1LQAA 2VCBA 1BQGA 1J6PA 1CBGA 1EIXA 3KOWA 3VGDA 1TSIA 3RPTA 3EDKA 1FY6A 4E8CA 2OX4A 2XH7A 3L5AA 3GSMA 4M1RA 4FX7A 2GJPA 4Y96A 2PPGA 3G6MA 4AG0A 3T81A 3LZ3A 4R34A 1HZYA 1QJWA 4LNCA 3AI0A 4OUEA 1LUCA 4FEZA 1POJA 3SRDA 3P3BA 4HA4A 1P6BA 3OIHA 2PEVA 2O55A 4YNGA 3M0LA 4EIVA 3CPGA 4U3AA 2ZX9A 3HTWA 2IKGA 5JVLA 1F9CA 1I2NA 1FDZA 1U33A 4JCMA 4HJWA 1JDDA 3OB8A 1I4NA 2DW7A 1XLHA 2XM2A 1LRTA 1TWIA 2W6RA 4PUUA 2ISDA 1CXEA 1UH2A 1E1FA 4NIRA 2HNHA 4KF1A 3A4AA 1DIOA 1NFBA 3B9AA 1XIEA 3DI1A 5CSYA 3NQBA 3M47A 4GQBA 3OO2A 4GC4A 1IQ8A 5KEZA 3RIKA 4F0MA 1QI0A 1G5AA