4FAMA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with 3-((3,4-dihydroisoquinolin-2(1h)-yl)sulfonyl)benzoic acid (17)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4famA00
3B3DA 1MZRA 2PDQA 3M0IA 3UG8A 1X96A 1MRQA 1T40A 1AH3A 4LAUA 2IPWA 3LD5A 2R24A 2FZDA 2PDMA 1Q13A 3UP8A 1LQAA 2PEVA 2IQDA 3F7JA 2F38A 2ALRA 4QR6A 1RY0A 4FZIA 4YVXA 5LIYX 4PUWA 1YE6A 2BGSA 1SM9A 2HE5A 4XO7A 4DBSA 1A80A 2IQ0A 3CV6A 1R38A 1YNQA 1S1PA 5AZ0A 3LENA 1MI3A 3R7MA 1OG6A 4MHBA 3O3RA 4IJRA 1ADSA 3KRBA 1EF3A 3RX2A 3Q67A 5LIUX 4QX4A 2PFHA 2PDXA 3M4HA 1T41A 4IGSA 2DUXA 4FALA 1IEIA 3WG6A 3H7RA 2ACSA 1JEZA 2ACUA 4XZLX 2P5NA 3DOPA 2BP1A 4HBKA 5JH2A 1X98A 4LAZA 2I17A 3MB9A 3C3UA 2CLPA 4AUBA 3QKZA 4EXAA 2IPJA 4L1XA 1Z3NA 4YU1A 2PDYA 3V0UA 3CAVA 3WBYA 2PDBA 4XVDA 3V35A 1EKOA 2ACQA 3UGRA 3DN5A 4DZ5A 4XVEA 2HDJA 2HVNA 1YE4A 3FJNA 1EXBA 3LNMA 1XF0A 4WDTA 3R58A 3BV7A 2PDPA 1HW6A 4ICCX 4JTAA 1PYFA 5JH1A 3EAUA 3N6QA 2FVLA 4G5DA 3BCJA 3GHUA 4OTKA 5HA7A 3RX3A 4LB4A 1X97A 1VBJA 1K8CA 3RX4A 4WDWA 3D3FA 3Q65A 1US0A 4LB3A 3U2CA 4H8NA 1HQTA 2F2KA 4IJCA 4L1WA 2A79A 3UWEA 4JIRA 2PDJA 1Z8AA 2FZBA 3COTA 3LZ3A 3P2VA 5DANA 2AGTA 4JTDA 4GIEA 1PWMA 2PDCA 2HE8A 1AFSA 4ZFCA 4PUUA 2HV5A 5LIXX 3R94A 3CV7A 2VDGA 4FA3A 1PZ0A 1EL3A 3VXGA 4LBRA 5AZ1A 2INEA 4ASTA 5KETA 2IKIA 4FAMA 1YNPA 2HEJA 3O0KA 1FRBA 3LUTA 3GUGA 2IKGA 4XZIA 4PRRA 3UYIA 3BUVA 2PDNA 1Z89A 3CASA 1ZQ5A 1IHIA 4WDXA 4JQAA 1QRQA 3T42A 3WCZA 1AH0A 4YS1A 3R8HA 3ONBA 2J8TA 3WBXA 1RALA 1S2AA 2HVOA 2PZNA 3LQGA 3MC5A 4JIHA 5HNUA 1S1RA 1LWIA 4WEVX 1AH4A 5HNTA 4WRHA 4YVPA 1PZ1A 1C9WA 4HMNA 3GHTA 3ONCA 3H7UA 4GCAA 3R43A 2PDHA 4JTCA 3G5EA 2R9RA 3H4GA 4GQ0A 4XZHA 3R6IA 2PDKA 2PDFA 3BURA 3UZXA 3CMFA 3G1RA 1QWKA 4QBXA 2PDUA 2BGQA 4XZNX 2INZA 3CAQA 2FZ8A 4JIIX 4JQ3A 4PR4A 4JQ1A 3LZ5A 4PMJA 3ERPA 2I16A 2NVDA 4XK2A 3EB3A 4XZMX 4JTRA 2FGBA 4EXBA 4Q3MA 5M2FX 1Z9AA 1AZ2A 3FX4A 2IS7A 2ISFA 1ZGDA 2WZTA 3S3GA 2FZ9A 3NTYA 4Q7BA 1ZUAX 3R8GA 4WGHA 2PD5A 1RY8A 1Q5MA 3EB4A 2PDGA 1XGDA 3V36A 2ACRA 1VP5A 2PDIA 2PDWA 5C7HA 4DBWA 1ZSXA 3WBWA 4R9OA 1M9HA 4PRTA 5LIKX 4YVVA 2DV0A 2NVCA 3V0SA 4LBSA 1GVEA 4GABA 2IKHA 4GACA 3N2TA 4JQ2A 1UR3M 2IKJA 4JQ4A 4DBUA 4RPQA 3V0TA 2PDLA 4JTQA 3GHRA 1PWLA 3M64A 2PD9A 3LBOA 4WDUA 3UZYA 4GA8A 3UZWA 4H7CA 2WZMA 3LQLA 4QXIA 3GHSA 3UFYA 4I5XA 2DUZA 3LEPA 4NKCA 2PF8A 4F40A 2C91A 1J96A 2IPGA 2QXWA 4XO6A 2IPFA 3UZZA 5LIWX 4XAPA 4GQGA 3LN3A 1XJBA 1AZ1A 1S2CA
chains in the Genus database with same CATH superfamily
1TV3A 3OLIA 4U3CA 3W87A 4AD3A 1ISZA 1IXQA 2YCLA 3GC5A 3FCPA 1XQLA 3N19B 2C1IA 1B5TA 4GUJA 3KHJA 4JHOA 1UMYA 5E09A 5C55A 3AHZA 3A3WA 3UWVA 5A6JA 1W9BM 1W1ZA 2NZLA 5DQPA 3OHIA 3A5FA 2XH7A 5CKSA 1H09A 2Z1VA 2O4MA 5FEWA 1Q63A 3L67A 1H60A 3E38A 4LYKA 3KE0A 1FH9A 2AAMA 2B7OA 5A8GA 2R8WA 2Z1WA 3PZMA 1QPOA 2BS9A 4QJ3B 3SQSA 3O9NA 3CV6A 4ZSUA 4QAIA 3URAA 2QAFA 1VYSX 2E4TA 3GG0A 5E0CA 2W61A 1Q7MA 4MG4A 3LMYA 2DJLA 5C0QA 3O3RA 2P0IA 4MWAD 2E6DA 2J8GA 3UVAA 2YYTA 4JY9A 1EA9C 4GIAA 5GPRA 1R9YA 1U1HA 4D6EA 1JR1A 3ARWA 2JGYA 2ZA1A 1L2QA 4UMBA 3VMNA 2OYLA 3ITCA 1MUMA 4MPQA 4HPXA 3QV8A 3VUSA 3W86A 4CLMA 3DAQA 2ACUA 1GOXA 4KRTA 2E8YA 5CZSA 3SSJA 4LJ3A 2PRLA 3A5VA 3SY8A 3LOTA 1DIOA 3PJUA 5K7JA 1FCBA 1E6RA 2BX7A 1CECA 3RLHA 3LBMA 2IPJA 3W1LA 1Z42A 3EWXA 4GBUA 3Q94A 1CXKA 1GWJA 3AS3A 5E1QA 1DQXA 3LPOA 5D8ZA 3TYBA 1CLVA 1YYAA 3LX9A 3W1TA 3PB0A 1JNDA 2HVNA 3P7YA 1DXIA 3AZTA 1Q6FA 1UR0A 3RDKA 3R79A 2HXUA 1R7OA 4IICA 4DO4A 4TQTA 3EBVA 1E1FA 3AROA 4TU1A 3TSDA 5BOOA 4K39A 5A2AA 2J62A 2PE4A 1LT7A 3AHTA 1VYPX 2E77A 3RMEA 2CYGA 1J0IA 1QNPA 1DQUA 1ZALA 3V3WA 3VI2A 2GGHA 3THDA 4ERAA 2EAWA 2OFJA 3EMZA 3TDFA 1TRIA 1JPHA 5J04A 2JFEX 3S1WA 1R3VA 4H8NA 3AMLA 3N3MA 4JR5A 3UWEA 1W8SA 3KRUA 1XP3A 3GR7A 4L9XA 3E2VA 4R53A 5DANA 1ZTVA 3R11A 5CPNA 5DEZA 1BGAA 4F0SA 1I0DA 4QNWA 1VZWA 3K46A 1XCXA 3KX6A 4IT1A 3QMRA 1K9EA 6XIMA 3GU1A 3GKFA 4ZFCA 3KP1A 3WUEA 2NLYA 4GGBA 4FLSA 1VKFA 2YYUA 3ZR5A 4DBEA 4E8GA 3PULA 4A21A 2J66A 1FX6A 3C2OA 4UBPC 2OSXA 2DU2A 3OLGA 5DMYA 4F0MA 2CITA 4RNJA 4IFKA 4OVXA 2VRKA 4KRZA 3TTEA 2OJPA 1SZRA 3T4WA 4D6HA 2UV8G 1EZWA 4ACYA 2JBMA 4OBRA 5I78A 1G0CA 1JYXA 3N4FA 3A6OA 5FF0A 2XIBA 4O1EA 1AH0A 4QROA 3XIMA 1T8XA 4Z17A 3TYZA 4PL2A 2GSEA 4EWJA 2Z26A 3H4WA 3UCQA 3R8RA 4PCSA 3W7JA 1R3QA 1Q66A 1GPFA 4WEVX 5HNTA 3WF4A 3AOFA 4YCOA 2WSRA 5E0FA 3BZJA 4YVPA 2VRQA 1S2UA 2VR5A 5GNYA 1VJSA 3LRLA 5LNRA 2E9LA 3TJLA 3FYPA 2C13A 3ONCA 1W3TA 4IJBA 2V3EA 1WB0A 2YBVA 3MQTA 1GNXA 4GQ0A 4U33A 5HOSA 2B7QA 1QI4A 1EJRC 4JL2A 2PDFA 2QCCA 3ARVA 1S5TA 3M43A 3TTOA 1KLYA 3TC7A 2Q6ZA 2AOSA 3R10A 1JZ8A 4K36A 3BPWA 2G5WA 3MHUA 2XTKA 1JF6A 2PDUA 4OV4A 1JD7A 3QXBA 1XYBA 3DHPA 3FEQA 4QEHA 5I3IA 4GIYA 1Q6LA 1N2VA 3UY8A 4QLLA 4W86A 1OHLA 4MDPA 3ZVIA 4EVZA 3FY1A 4D71A 3VIOA 3H2FA 4D6FA 3WX7A 1FWWA 4RLIA 3PZTA 4FNPA 7ODCA 3ANUA 4BA0A 1QNOA 2WMIA 1FWSA 5DMLA 4Q7BA 4AZIA 2ZZ3A 3IV3A 3H21A 1WZMA 3VDBA 1RY8A 1E9YB 3M0ZA 1RZMA 3HG2A 2QV5A 3WH7A 4PN2A 4CQBA 1H61A 5BU9A 4MB3A 3GTIA 4HNUA 3K2GA 1WO2A 2CWNA 3CUZA 4Q8PA 3EOEA 5G4WA 4ZQOA 3HV8A 1MUWA 4J3SA 1EUNA 2FHBA 3CV1A 2IKHA 4ZOAA 1A5NC 2QCNA 3EXRA 1UR3M 1G5AA 3N9RA 1WZKA 2PWVA 1FCVA 2FHFA 4FIRA 4G56A 4YWSA 2DT0A 4IIDA 2OG9A 3QV7A 3LQLA 3S6OA 3ALFA 3G1AA 4B92A 1O5XA 3JR2A 4KEUA 3WH8A 2PF8A 2GVJA 3E5BA 1QI5A 2CZEA 1V03A 2PGWA 4A29A 3HFYA 3JVAA 1E0XA 1W9VA 5FJPA 3LB0A 4M5PA 1W0MA 3LCHA 4JYEA 3LERA 2GJXB 2R1KA 3THQA 5A6SA 3UERA 3KBJA 3QPYA 2YCKX 4LUTB 2CU0A 3P3BA 2FZDA 1VF8A 1TPB1 4AZ6A 4GYKA 5I06A 2Q02A 1A5LC 3VOGA 4H6EA 2DVUA 2ALRA 1V0MA 2REQA 2ZXQA 3OO2A 1YPXA 1P0BA 3WLQA 2EGZA 3RLUA 4CD5A 5J5DA 4QRNA 3VFLA 2OSYA 3MDWA 1OBAA 2G3NA 3T9PA 4EP8C 3WK0A 1DEDA 1HJVA 3TW6A 4HOZA 1HX0A 3GDKA 3BGJA 2VEMA 3W83A 1PB0A 1YADA 3IVUA 3UXIA 4RUBA 3W2JA 2BGNE 1JYNA 1W3KA 1XCWA 4GJ1A 3QC3A 2A3LA 3ZLFA 1UWSA 3S2LA 3L5AA 3OZOA 5HQLA 4AH7A 4XD3A 2QCDB 2D0FA 1XKYA 2OX4A 3E96A 3JUGA 4L4LA 3LHZA 3KVMA 4HA1A 4HD5A 4A2RA 1B57A 4DBDA 3VYLA 1H7NA 1NY1A 2YBUA 3GVWA 3FS2A 1EP1A 4GMEA 3VD4A 3NIYA 4V33A 4GYPC 4AXKA 2P5NA 4JFTA 4DYKA 1I9CB 4Z2JA 4AD5A 3A47A 1PIGA 4DF2A 1LLOA 1IQ8A 1OGBA 1JNEA 3WJSA 1O5QA 4PB4A 2J7DA 5CZ0A 2PDBA 2UY3A 4X60A 3LSCA 3RFAA 4Y6GA 4XWUA 4LEFA 5D02A 2RJHA 3UWUA 2C16A 3ARXA 4Q32A 2XIJA 4BK9A 1I2RA 1KA9F 1BD0A 3VILA 3ABZA 2ZZ6A 3KCOA 2WMGA 2VZTA 5JH1A 3IAQA 2QS8A 1TE6A 1TJRA 3EPNA 3SDOA 1SMAA 3F03K 4K6AA 4JEJA 1UB3A 1KRBC 3PBMA 3RLGA 1IT7A 4NYUA 3PY2A 4QDMA 3WNKA 1R5YA 2X09A 1TZ7A 4O4WA 4ZXOA 3MI6A 4GVGA 3MP4A 3W53A 1MQPA 4L4OA 1QR7A 1OC6A 5CSUA 4QTGA 3PBVA 2DEPA 3SW6A 1I45A 3PAOA 4GIEA 1V79A 2HE8A 3TWBA 1D2KA 1W6TA 5D30A 1UH4A 5EMYA 5ABGA 3RM9A 2X1SA 1YHTA 2RDWA 5FJUA 3CV7A 3VDCA 4NQ1A 5A3HA 3VKJA 4JKLA 4FAMA 4JTFA 3GSMA 2HEJA 2OX1A 1DORA 2DJXA 5FKYA 1MZHA 1VFUA 4E3TA 3W73A 3OA3A 4NU7A 1WDQA 3QQ1A 3K4DA 4FPSA 3SECA 5FEPA 4RE0A 4J5NA 5CPOA 1BEUA 2CZDA 1VJZA 4F79A 1W54A 2FH8A 3TN4A 1OCQA 3QPZA 4LVBA 3DYMA 2H9AA 1FHLA 1RALA 2RDUA 5CXPA 4K68A 4AZCB 2WCSA 2NV2A 3FDGA 3SCSA 4Z0SA 1DJWA 2VEGA 5G1YA 5KEZA 1OEPA 1FCQA 3TCEA 6XIAA 4QLKA 1AJ0A 1PZ1A 4UTWC 4B15A 2IW0A 3PZQA 3VIFA 3F4WA 1Y7VA 3MMTA 4KCTA 1ICQA 4BY3A 4E2BA 1Y65A 1E4NA 3H7UA 1P1XA 4ML9A 1ZJAA 1MUCA 4H3DA 4LCRA 3GS6A 4URIA 3VIKA 4GYPA 2QDGA 3AWNA 3Q4DA 3CUHA 1KR1A 3DESA 4UFHA 4INFA 2L5HA 4NX0A 5BXRA 1PV8A 5CSRA 5AHFA 1FWTA 3LGDA 1DYSA 3K1DA 1JGIA 1Q6DA 4YYFA 1ZL1A 2QJHA 3P5YA 2FGZA 5KZDA 4N02A 4U4MA 2GLKA 3H4XA 2CESA 3ZS4A 3R4IA 4DY1A 2X1TA 2FGBA 3EWZA 2Z24A 3CUFA 5H8MA 2EKCA 1RCOB 2J9ZA 1GYMA 4GI6A 2PP1A 4WR3A 2Z7GA 5CGTA 1BWVA 2WMHA 3LM7A 4BJHA 3FJ4A 2BNJA 1VC4A 4R7WA 1LWJA 3B0PA 3KFTA 2CLIA 4GUFA 3V75A 4KERA 3OBAA 3W28A 4WGHA 1RVKA 1N8IA 1FHUA 4HMEA 3EGJA 1EEPA 1XXXA 3AIVA 4J4KA 1W3HA 1OX4B 1VENA 3RPMA 3DHFA 1G4EA 4ADSA 4GFIA 3MP5A 1A50A 4X61A 3NVDA 1KXVA 1D3CA 4C7DA 3NWRA 4GABA 1P0NA 3PUEA 5F2LA 4NX5A 4FMVA 3H2CA 4JQ2A 1H0GA 1W56A 3A4WA 3SUWA 1BXNA 4EPEC 2PD9A 1HIZA 2TRSA 3IJ9A 4QCEA 3AQUA 4H7CA 1XUZA 3KHDA 3K30A 3QRHA 2VCCA 3OA5A 3RJXA 3PTMA 2P76A 4JTJA 3TQ0A 5CH9A 4W5ZA 5EBUA 2R1LA 1ZP3A 4GNVA 4J35A 4AHQA 4XO6A 2G8ZA 4KIEA 1V02E 3MVTA 3BCDA 1JFHA 2PTZA 3WEMA 1OQFA 2FDMA 2YLAA 2D2HA 4O57A 3GG8A 1XKJA 2GPTA 1BTMA 5JVLA 4KWSA 3CUJA 4UQ9A 4O0QA 2TAAA 1JYWA 2QUUA 2YXGA 2GVGA 2JEPA 1H7OA 2WBKA 4D8AA 2VL4A 4ZZ9A 3INPA 2V9DA 3WBEA 1DWIM 3CEUA 1J9YA 3GH7A 1WZAA 4UTWA 3E2QA 1R85A 4QSHA 1IR1A 4M3PA 1XC4A 4O1DA 4EACA 5F7UA 2HE5A 2Z2UA 1PX4A 2FPTA 8XIMA 4X3ZA 3GXPA 4DO7A 3S9IA 3RHGA 1AQHA 1QHPA 2CKSA 5LA1A 1OT1A 3PZUA 2AMXA 4IX2A 1G7UA 1K7FA 3T4CA 2VQUA 3S2CA 1OCNA 3B8UA 3R5EA 3HM7A 4Q33A 3BDKA 1UUQA 1H7RA 3GTNA 5HR7A 2WJFA 4IGSA 3TFXA 5CPTA 4L61A 2V38A 3AC0A 2DZXA 3ARUA 3B0YA 5FAGA 3HIJA 4XZLX 3RK8A 2WC3A 1IEXA 1K70A 3SCQA 4BF9A 4F3HA 1XM3A 3CPRA 3VD5A 1FQ0A 2DSZA 4B5WA 1KV5A 4QEEA 1O4UA 3CHCA 2D22A 3W1MA 3UPWA 4B4HA 1P0EA 4RNIA 4BI5A 2OLHA 3OB8A 3ID7A 4I7WA 2A6LA 4G2DA 4XVEA 4AX7A 5EMUA 3E12A 3M46A 3NR0A 4HMCA 2E5BA 1DHPA 4M56A 4O0ZA 4Y96A 3WQ4A 4L6HA 3SIMA 4Q8UA 4HHPA 4YL2A 5A6AA 1R8LA 4IM4A 1HW6A 5ABFB 5JU6A 4LVGA 4AQLA 3I7QA 3S1XA 3H54A 4AVNA 1VPXA 3ZOAA 3AAMA 3VCCA 1GZJA 4GY7A 3GHUA 3DI1A 2GJPA 1KFWA 1JRCA 2QUNA 3S8HA 8TIMA 1VBJA 4YTTA 3CIXA 4B5XA 1S5MA 4GISA 1O1ZA 3ENLA 3GFYA 3NL6A 3ABQA 3ARZA 4PRWA 2PU0A 3LMZA 2E25A 4KFNA 4LUIA 1GVOA 3VIPA 2PU1A 3K8KA 1JFXA 5JBEA 1E72M 1WYIA 1ZZMA 2Q8ZA 2PRHA 4XD6A 2ZE3A 1D3HA 2CKRA 4J3UA 4QE1A 3N12A 4MTVA 4NZ1A 1IEQA 2OZ3A 4PUUA 4R7JA 1I8JA 1PJ9A 2GK1B 2E7FA 1ZLPA 3NL5A 1SO5A 3ZR4A 1J5SA 3SY1A 3OZMA 2ZQ0A 5KETA 1QTWA 1YNPA 1D9EA 1WDDA 1SR0A 1JCXA 1V4YA 4XUYA 1HGWA 2DVTA 3LRKA 3MO7A 2PDNA 5CEWA 5MF5A 4LAKA 3VGDA 1IZCA 4K8GA 2CLMA 4BS0A 1E9ZB 1L2UA 3ABOA 4M19A 4DJEC 4O54A 4JKMA 4L56A 1JPDX 1Q7QA 1VGAA 4AZBA 3M7SA 1HKMA 4TVCA 3LGGA 4K7VA 1E9IA 4C5ZA 3C0SA 4GD0A 1AH4A 2VC9A 3CWNA 3IS4A 1XLBA 4H7VA 3BG9A 4NI3A 5F2MA 3I10A 1VEMA 1PX8A 3BOXA 3IANA 2V5JA 1UR4A 3BE7A 3L12A 1N55A 4ONVA 1TR1A 3W26A 4GX9A 1VYRA 1QWKA 1BQGA 1D8CA 3LHVA 1Q65A 1LLZA 1O7AA 5DRIA 1CW2A 4FX6M 3MI2A 3P60A 5IDIA 3I68A 3QSTA 3KW3A 1UPPA 3UCDA 3HO8A 1FDZA 3VMOA 4UQEA 4XK2A 2X2YA 1TCDA 1QPNA 2DZVA 4Q7NA 2Y8VA 2FPYA 5LYRA 3S3GA 1GOMA 3NTYA 3GDBA 1KR0A 2OZ8A 3TSBA 2RJGA 4FIQA 3KAOA 4IX0A 3BV4A 1Q2RA 1Q5MA 3RNDA 2B31A 1AL7A 3AIWA 3G0SA 2O92A 4AVOA 3N17A 1IGWA 2XM2A 4U28A 4HMDA 5I3DA 5K4XA 4V27A 2ATSA 3W81A 3A4JA 3O8AA 1O12A 3IJ8A 1RBLA 2OMAA 1XLCA 1CXLA 3QV6A 1JULA 3SUTA 4JQ4A 1BSLA 3V0TA 3TFCA 2X7WA 2PGEA 3JS3A 3BXWA 3UZYA 1OIFA 3UGVA 2VNCA 3P8JA 3SZ8A 2QJIA 1F3XA 4LPCA 3HMCA 4KQNA 3S5SA 4IISA 3LSBA 4JCMA 1PZ3A 4LALA 3W7NA 3N9SA 1ML1A 4IIEA 3ZVHA 1MMFA 2Y7FA 2ZXDA 1UD4A 4P5UA 3UZZA 2VURA 4PBGA 1UKPA 4RK8A 4E5TA 4G7EA 1ONXA 3MYOA 2G37A 1UUOA 3G8RA 4DAFA 3G18A 3PZVA 1E70M 2H8ZA 3HG4A 2XGBA 3KP0A 4B2DA 4YTQA 4GRSA 3WQDA 1GJUA 3IPWA 1B3YA 2OEKA 1C8XA 1RK5A 1LQAA 3CAKA 2D3LA 1K1DA 5E93A 1KBIA 5DX7A 3TQKA 3CM4A 5BXSA 1FWDC 4QR6A 2RDTA 1VEOA 1M41A 1P0KA 2BVYA 2HBVA 2IXVA 3KS6A 4DPQA 4H00A 1F73A 3PS7A 3GNNA 3NDOA 1DHKA 2HRWA 3ZO9A 3ZSSA 3S42A 2PF0A 4UQDA 3PJWA 3CZLA 4LS0A 5DT7A 1OC7A 1V3MA 4P8WA 3WEOA 1X7IA 1AQMA 4XD5A 3OVRA 2QUVA 3PWIA 1VIZA 4AEFA 1FUYA 3KEHA 2F84A 3M9YA 4O52A 1EQCA 4OE7A 3G1DA 1GQIA 4JNZA 4IIFA 2V63A 3BK0A 4NRSA 5D9OA 3M4HA 3W22A 3GLCA 4UWMA 1OK6A 3UR2A 3C2EA 3OOQA 3UXDA 3WH5A 1IEIA 4Z1DA 2CCRA 3NQEA 1JVNA 1GONA 5HUPA 2VC5A 4H8VA 2C0AA 4XIAA 3WLPA 5DFAA 3WK2A 1W9DM 3F4NA 3CMGA 2P3ZA 4M6UA 4LAZA 3W7EA 4B3ZA 1XBVA 1GVIA 5JMUA 4ACZA 3EX3A 1N7KA 4Y8EA 4CCCA 2R82A 4HZ8A 1IXNA 4RV3A 4BKNA 2NWRA 1QK0A 2OQHA 5EMLA 2QMJA 2V5BA 3PUOA 5IRPA 4ZBCA 1GTHA 1UHVA 4QITA 4C6LA 4AU0A 4WHBA 1R2RA 3SB0A 2OKOA 3W88A 1GQNA 2PDPA 1EP2A 4L1GA 3DBNA 3F2DA 4NJJA 1XRFA 1WXYA 1FH8A 4H9UA 1GYNA 2XFRA 4AWEA 3T8QA 1V93A 2Y5JA 3LHYA 3E0IA 3Q2DA 3MKKA 1A49A 5G4HC 2AKZA 4B4FA 4JFSA 4CD8A 1W37A 4QCFA 3T0BA 3WF0A 3WLJA 1KV8A 1KRMA 4MZ1A 4WY0F 1FWAC 3KCJA 2ISDA 2VZUA 2FIQA 2JK2A 1JQXA 4MNLA 4IL0A 3N3TA 1J0HA 1ADDA 4S3GA 5EKYA 3TQPA 1C93A 3B8VA 4HB7A 4ERGA 1PE1A 1FXPA 1J01A 7TAAA 1VFOA 2PDCA 2VD9A 2DZUA 1PIFA 2DPEA 4YNGA 3QGVA 4ZE4A 5IFTA 1ALDA 3W00A 1J18A 3ZWTA 3LS9A 3PTDA 2NT0A 3AHYA 2F2HA 1QXLA 3N04A 2QLYA 1JG9A 2YDAA 4ASTA 3PBGA 4JTEA 2VJXA 3VGEA 3O0KA 3VKDA 3WLMA 1MDRA 1LBFA 5TBOA 1NWUA 3H2NA 1H51A 4HCLA 8RUCA 4O12A 3KZSA 1MWOA 1BTCA 1FWCC 3ZMRA 1CGYA 3Q45A 3VNKA 1EJTC 2VXNA 3VK5A 3GBEA 4D2JA 3LV5A 5AHMA 4PGLA 2WJEA 4O53A 2DP3A 1U1JA 5HNUA 1QATA 3O05A 2VX6A 3H2OA 1LBMA 3HGOA 3GDRA 4H9MA 1LL4A 2GDUA 2ZCGA 2XVKA 2VFEA 1GVFA 2G3FA 4LAMA 2C3ZA 1K3UA 1QOQA 4GX8A 3CUGA 2RUSA 2PDHA 5CAHA 1HP4A 3WDQA 1TV7A 1RR2A 3WFAA 2I9EA 2G41A 1XIFA 3CMFA 1X1ZA 3CHEA 3P61A 4GYFA 4PMZA 4PFHA 3FGCB 4FLRA 2OELA 4HKPA 1NF0A 5KSWA 1POJA 3LLFA 3NDYA 4RZ4A 1B2YA 3VNYA 2ZXBA 4WX2A 1ODUA 3U4AA 1E15A 1AW5A 4H1ZA 3L0NA 4XV0A 4C6NA 5A1AA 1KFLA 3EYPA 3EOUA 2JF6A 1CNVA 3T81A 2W4XA 5M17A 1AZ2A 3NZRA 1LL6A 3BGGA 2OWWA 5I3JA 4IG2A 3LDVA 4EANA 4JHZA 1DVJA 1FWJC 5T91A 3L2MA 2VEKA 3VNDA 1KTCA 1M1BA 3PC0A 1I2QA 4WJEA 1ZUAX 4H2CA 5M3WA 4I5RA 1QW9A 1Q6GA 4A8LA 1TWZA 2PD5A 4QG8A 3W1QA 2DSVA 1ZNNA 3RIKA 4OT7A 3QLDA 3V36A 1Q6OA 2QNEA 1JZ7A 3QC0A 5G4EA 2VGBA 2QQ6A 4L65A 4G7FA 2VX5A 3SJNA 5HMSA 1DPMA 5XIAA 4W7WA 2CLKA 3LPPA 4ES4A 4W7VA 1TPWA 4R9XA 4LY8A 3A9IA 2OQYA 3KWSA 3GHRA 2OODA 4JX5A 2EJAA 4A8NA 9XIAA 3XINA 1PXGA 4LRTA 1UJPA 3CGTA 3WQPA 5U4NA 4QG6A 4IQDA 2BFGA 1YDOA 3UFYA 1DXEA 1VBRA 4W84A 2OR2A 4NY2A 2NLIA 5A95A 3SUSA 4KGJA 2J6XA 3LNPA 2GJNA 2QCFA 1KM5A 4FOUA 3SCVA 3W07A 3NO1A 6TAAA 3C0LA 1LTDA 5LIWX 1UQYA 1ME8A 3QV9A 2PSNA 2WNQA 1XJBA 3VZYA 1V0KA 4ZB0A 3UG8A 3CB3A 1VS1A 1EDTA 1TX2A 1E5NA 3GZAA 3AICA 4HN8A 4EAYA 4TO8A 5FF2A 3V4BA 3W02A 2PDMA 3LTPA 3TVAA 3AI0A 1OC5A 4XG1A 1EDQA 4FR6A 5AHIA 4PUWA 2ONEA 4LYQA 1UH2A 1GEHA 4LQ1A 3OIHA 1F6KA 1ISVA 4W89A 4HGXA 4IMGA 4NZ3A 4AYSA 4I9MA 4LSBA 4GO9A 3KRZA 1HJXA 1XYAA 3H55A 4D72A 3EX6A 2X1IA 1BF2A 3APGA 4AF0A 1QASA 4XB3A 2C7FA 2FQIA 2O9TA 3L5MA 3D3AA 2FMNA 1XYLA 3LYEA 4O1AA 4TOQA 4AMAA 3KOXA 5LIUX 5DT5A 1PKLA 5C9WA 3MUAA 2IMRA 2BDQA 2C1GA 2PFHA 3D46A 3TN5A 2VEIA 5FIPA 5LNSA 1JAEA 2BVDA 4ZB5A 3JU2A 1J4EA 1OY0A 1DJHA 5A2CA 1WQ5A 1LROA 5AYXA 4LOCA 4R34A 3HMJG 3F5LA 2J7BA 4AY7A 3QKZA 1Y0EA 1BRLB 4JICA 4IUOA 5GNZA 3L5LA 3V0UA 1GT8A 5D32A 3WBYA 3HPSA 1H2JA 4F66A 5CQ1A 5I79A 6CGTA 4OECA 1G9HA 3PWAA 2NSXA 3GFXA 2E1DA 4CEUC 1CGXA 2H8XA 2WOQA 3FJNA 3BSHA 5FF3A 4UCGA 4AZ5A 1XSJA 3AJXA 3KDOA 3B9DA 3RJYA 3QLLA 4H9ZA 3KOZA 2O9RA 2A7PA 1UMLA 1L8NA 3UG4A 1FHVA 4Q8WA 2GFTA 3NSXA 3NQGA 5IFPA 2OXNA 2Y61A 3SCNA 1H49A 1TZ9A 4PSRA 4R7OA 3WQOA 4UTKA 5DXXA 2QJGA 4DYEA 3ITOA 2CBJA 3RX4A 4JIEA 2X8RA 4C5YA 3UJ2A 2GWNA 4FO4A 6A3HA 3PUGA 4AWSA 1X6NA 3NPVA 3OGRA 4QE4A 3GU9A 3P80A 5EL1A 3OZPA 3ZIZA 3UR5A 1AFSA 1PAMA 2VUYA 3M16A 3DX5A 3QY6A 1ECQA 4WY0B 2Q8XA 3AIQA 3SCTA 4PUKA 5I24A 3VVGA 3TONA 2WZIA 3WF3A 4H6QA 1O5RA 4F0KA 3N1AA 1W1B1 5LNUA 5AZ1A 2A7RA 1UIOA 1R3WA 2J25A 3MU7A 2WVSA 4Q6XA 5AKQA 2PGRA 1TVPA 3SCOA 3SCUA 3AMDA 4AZGA 2F6XA 2J7FA 1KM2A 2C6QA 4N7QA 4W93A 1BVNP 2POTA 2JKEA 4A35A 4WDXA 2W9MA 3EOOA 1OFBA 1UG6A 1F5ZA 1V7YA 1LRTA 1X8FA 4B3LA 2VI0A 1UZDA 1ADOA 3BZGA 3LPFA 3L2IA 5ABHA 2R6OA 4A3HA 1EBHA 3HG5A 2ZVRA 1CB2A 4PMQA 1S2WA 1KM0A 2YKKA 4H01A 3W2UA 9XIMA 3GO2A 4HK5A 7CGTA 2XH2A 1TPVA 4JEQA 1GJWA 1IIGA 3JZUA 4UMAA 4OWGA 5J8LA 1WDSA 5EB8A 3W24A 2QGHA 4Z1YA 2E68A 3FV9A 4CGTA 5J5RA 5KZEA 4DNMA 4NXSA 1W1VA 1OZMA 4JIQA 5FEXA 3THAA 3WJYA 5I77A 1JDCA 3PP7A 2WSKA 3W7RA 3FHQA 1WA3A 3M0JA 3LZ5A 3WNNA 4BCEA 4Z2GA 3TJ4A 4Q4KA 4TTUA 1KCXA 4EE9A 4MJ2A 4FI4A 4Q3MA 2QCEA 2FDSA 2CXGA 3B40A 1GKPA 4V1XA 4WKFA 2WZTA 4UNIA 3UJSA 1M3UA 1UA7A 4KEZA 1TUXA 1KWGA 1DKWA 2WNZA 5FCZA 2EPLX 3R8GA 3PN8A 1TX0A 4JTUA 1M6JA 3NQ7A 2QIIA 3GZ3A 3W7GA 1SFTA 2OEMA 2PPGA 5JUVA 3MWCA 5AVNA 3OVGA 2W62A 2AGKA 4NXKA 4QGCA 5AY7A 4DQWA 4YVVA 3S83A 3THUA 5JIWA 3WEZA 1QVBA 3C6CA 2W63A 3MZNA 3WD2A 4ZO8A 3G22A 1S3HA 1POKA 2PDLA 4G1KA 1ESWA 1I0BA 1FFRA 4S39A 3ZLGA 1BYDA 4XKYB 3IUIA 5SWUA 8CGTA 3UZJA 4MYAA 4NAEA 2E6FA 1VIWA 1X7FA 4HZ7A 3WD1A 2X30A 5DN1A 3QVQA 1J12A 4RNHA 4TR9A 3DG3A 4Z2HA 2NQ9A 3TROA 2G96A 4BR1A 4CQDA 2J7HA 2PTWA 1A47A 4H83A 3W7DA 2R14A 4L9ZA 4RCXA 3B9EA 1RK6A 1G94A 3BW2A 4LTSA 2AAAA 4PTDA 4LAUA 4ZA0A 3CLMA 2H6RA 3UWWA 5BZAA 4YYCA 1K8YA 1WKYA 1UWQA 1AODA 2DW7A 3CBWA 3ITVA 2ZX8A 2IQDA 5CPMA 3HPFA 2D0HA 1WKFA 1UZHA 2G3IA 2W6RA 4FZIA 3N9KA 2G3JA 5ABEA 1E43A 1BF6A 1BKSA 2E3ZA 3TJXA 3EMQA 3E6EA 1Q6RA 2GZXA 1A80A 1JYVA 3VZZA 3ZFHA 4GQBA 4Q4SA 1TELA 1DJZA 4NZFA 4J7RA 4O13A 1K6WA 1S5WA 3C2FA 2DT3A 2RFGA 4GQQA 3MANA 3NZ1A 5DCEA 4EF9A 2BLEA 1JPKA 2DZWA 4IIBA 3CT2A 2V2DA 3AMCA 4PCTA 1H7PA 3Q67A 1OADA 1RP8A 3IJ6A 3BLOA 4PCNA 1VFFA 3NXLA 5G2WA 1U5JA 1HG3A 6REQA 4GVFA 3WLSA 4MLRA 1XBXA 1RCXB 4XQ6A 2YA2A 4POCA 4Y90A 5H91A 5B7YA 5FJJA 3GXMA 1HJUA 2Y8UA 4YCPA 2WVVB 3SQLA 4JTIA 5G5IA 1XIHA 3PZGA 3O15A 3H6OA 4L1XA 1NFGA 4B5SA 1I2PA 3E0VA 3BANA 2DT1A 3VX0A 1B30A 1JZ2A 4ALDA 4PODA 1E55A 1NWRA 1PCKA 4F48A 3T44A 4US5A 2W3ZA 2W91A 1OFEA 3QHMA 1W1PA 5ENLA 4V1YA 4TUFA 3L7RA 1DIDA 2BV9A 3B97A 4JFUA 3STCA 4GWEA 3BCFA 3EAUA 1V6XA 5FOOA 3GNRA 3H23A 1FH7A 4N42A 1KQYA 3MI3A 5D03A 4ICNA 1YDNA 3QF0A 3VTRA 4DJED 3FVDA 3MYPA 3B8DA 5H2ZA 1DP0A 1YXYA 1NDVA 2A0NA 4LNCA 4JTTA 3FA5A 3U5YA 3V5CA 3U2CA 4C6DA 3L9CA 1KXQA 4IOTA 1Q6QA 4DWSB 2VT0A 3FXGA 1B3WA 1UC4A 3P2VA 1TZZA 2VR2A 1XINA 2ISSA 2WM0A 3NQCA 4RE3A 3DI0A 3GNPA 2PCEA 4TTGA 1JZ4A 5G2HA 1F3EA 2D24A 2ZUMA 1OJXA 2VWSA 3AZRA 5BU6A 1DJGA 1K9DA 3M0LA 5LGXA 1PIIA 4U2ZA 1W17A 3CQIA 2HPMA 4GZ7A 5DXYA 3VOHA 3KOFA 3OODA 4QFUA 3GUGA 5G1MA 2TPSA 2X05A 5D9NA 1ITXA 3KWXA 1HKJA 2WKGA 3BAKA 3L0KA 1H50A 3TMLA 1JI2A 4CUCA 3WUBA 4X9YA 1VH7A 3R8HA 3ONBA 4GZIA 4M1RA 1OYAA 4Y9MA 4CD7A 5TAOA 1JDAA 3WQWA 2XFFA 1Q8JA 2J79A 2UY5A 4CNTA 3CV2A 2GJRA 4P7QA 2CBIA 4HU0A 2V3FA 4J2PA 2E6YA 3H4GA 3O1NA 3HQPA 4DJFC 3RU8X 3W70A 2QR6A 4DF0A 3E0FA 2O56A 3G1RA 3UWYA 1GOWA 4G6CA 3GDLA 2ZFAA 1SFLA 3CQJA 4PR4A 1TPFA 4JQ1A 4LS1A 3IJDA 3HU7A 1IWAA 1SJAA 2I16A 3EB3A 1M68A 3CLWA 1KRAC 1ZAHA 1XIJA 2FHCA 4QS5A 1GJPA 3HPAA 2HNEA 3NQ8A 4GBDA 2HJPA 3LCIA 4RW3A 2ZUNA 5CGMA 3KRSA 3V1PA 4IMEA 4C6KA 3AS1A 4MJMA 5IM51 3SR7A 2WPBA 5A8MA 3C4UA 4C65A 1C7TA 3NGFA 4TXEA 5FSEC 2PCQA 4OHQA 4NJGA 3KL5A 2JKAA 3TLQA 5A6LA 3DFNA 2FTWA 3I65A 1GGOA 3NA8A 3GKAA 1Q2SA 4OUEA 1SZGA 3N2TA 4HHHA 4BQ4A 1KCKA 2ASHA 4O1BA 3PZOA 2BY1A 4C1NA 1WV2A 1C92A 2OKTA 4UOZA 1HKKA 1M01A 5G1TA 3UU0A 2YA0A 2J13A 3NURA 3HQ1A 4BF5A 2NX1A 1XSIA 1W32A 2C91A 5AC4A 1H3GA 2I56A 5TQLA 4AEOA 2QXWA 1B3OA 4QM1A 2RH9A 1REQA 1AZ1A 4F0LA 5C71A 3HOJA 2EO7A 4IMCA 3W85A 3K5XA 1MZRA 1V6UA 3M0IA 1UA3A 5BRQA 3K4AA 4UOJA 3TNBA 3IUHA 2YFOA 2W67A 1PDYA 4LAOA 3U48A 3WLKX 2O7QA 3SCPA 4JD4A 3A12A 1C8YA 3UPMA 4MJZA 2DIJA 4M1BA 4ZTXA 4CU8A 1O66A 3PNZA 3GR4A 2BGSA 1GKQA 1ZCCA 3E49A 2ZRWA 1V6YA 1PZ2A 1EYWA 3UXAA 3KL3A 4WK9A 3QY7A 3BGAA 1J0KA 3W25A 5ABTA 4DJFA 4Z1BA 3S46A 4DJDD 4NVTA 2VFGA 3CZGA 3I3BA 4RR4A 2CEQA 2W66A 2ZX6A 5AVHA 3VIHA 1FA2A 2W0UA 2DZTA 3SRHA 1W3IA 3DGBA 1PTDA 4IXHA 2I7GA 1VFMA 3GQYA 4L4MA 5CPQA 5AC8A 3N2CA 3OZYA 1QT1A 3N6HA 4Z0JA 3FOKA 4MUZA 4NRRA 4JTSA 4ROQA 1VAHA 1EEXA 3BLKA 1OD0A 3SURA 1X6UA 3VKCA 1TPH1 3ELFA 3SRFA 2ZADA 3WQFA 1PL9A 3WMSA 2GSHA 1HKVA 3W7CA 4LYPA 3QJAA 1XGEA 7PTDA 3A21A 4V2XA 3G1HA 1KFEA 4EXAA 4HHLA 3VZXA 2CHRA 3STPA 5KZ6A 3A3HA 1FHDA 3JZEA 4YXGA 2F6UA 4FNSA 3N73A 2INFA 1KTBA 1QNSA 2A85A 1KKRA 1DL3A 1E6ZA 3SADA 2ZZ5A 3TMQA 4PB3A 4X9SA 4KETA 5HJXA 4PYSA 1UWTA 2YLLA 1JUEA 3IGUA 3DFOA 1UC5A 2FH6A 2EPHA 3P82A 1EXBA 1RJRA 2R1PA 2XWDA 3SRDA 4UCFA 3SIZA 4FF5A 3HN3A 4MKNA 3IRSA 1HTIA 3BAXA 3CO4A 4IGNA 4CQCA 3ZM8A 4FNUA 1UWAA 2FVLA 3LCXA 4FX7A 2GVEA 4A3YA 4B5UA 4WJXA 1YQ2A 5I2UA 3WK1A 2DORA 1KC7A 3VD9A 3UNDA 4AHOA 3R0UA 3L4YA 4EPBC 1XLAA 4WDWA 4NSBA 2JQXA 1KFKA 2VRJA 4A4AA 1DJQA 3NEHA 5A8OA 4LX4A 3FK4A 2DY3A 2C71A 2F6KA 5CBBA 3T08A 2QDHA 3QKEA 3O16A 1TSIA 5D38A 4OOUA 1DJIA 5HK4A 1QNRA 1EHNA 1V51A 3WQVA 4IHCA 1E3XA 1P7TA 2XFWA 4CN6A 4NJIA 2D2GA 5BROA 4LBRA 1DJNA 4KGLA 1QHZA 1NWSA 3WIJA 1XD1A 2INEA 5AB3A 2IKIA 4D6DA 1QW8A 3CWOX 5I07A 3CT7A 2PODA 1PPIA 5HINA 5FESA 2V3GA 4O28A 1GQLA 3BJFA 4PCFA 5A8QA 4N2YA 3HGSA 5CC5A 2UBPC 1RAKA 2ZE0A 3UJFA 1DJXA 1C91A 3QYQA 5BYWA 7REQB 1G01A 1I1WA 1W1IE 4AWUA 5A69A 3F1QA 1SO4A 1MFVA 2UZ9A 3UY7A 3LQGA 1FP9A 3W2NA 1CCWB 3RRAA 3RO8A 4JIHA 1EC8A 4JOMA 3NCOA 1R46A 1V08A 2VWTA 3QFWA 1R3RA 1PTGA 2DSWA 3N25A 3KZPA 4RXFA 3W74A 3BJSA 3OQ8A 1O1HA 1S5NA 2AQOA 3W2MA 1TPDA 7XIMA 1IV8A 3W9ZA 4U5KA 3W2KA 4M81A 4OGZA 1QPQA 4KBXA 2YZ5A 1V0LA 3B8WA 3QMTA 2J8FA 3NOYA 5D2XA 2GQ8A 2WB5A 3MV11 1AVAA 1OX6A 1S5VA 1KFCA 3I3EA 3MW7A 4HCDA 3G6MA 1XPGA 1F05A 1KKOA 4MZYA 4JNMA 3RITA 4J3TA 5HDRA 3OYXA 1GW9A 4FLOA 2ZA2A 3GXNA 3PZNA 3THCA 4IMAA 1H62A 4EXQA 4WXYA 3F4CA 4XZMX 2I57A 4AIUA 3NSNA 3CS2A 4HNLA 4A8RA 2NX3A 2IS7A 2ISWA 4JTGA 5TNVA 3M5XA 5F1VA 1MEHA 3AU6A 5BOFA 2WNNA 1TE1A 1EO7A 1FY6A 2CFFA 2AKMA 4L4PA 1K8XA 4ATDA 3PBYA 1LQ0A 1NFBA 1EXPA 3I6EA 4LCQA 2DZAA 5CPLA 2ZUWA 4L7ZA 4HA3A 4TMCA 3OVPA 2E1WA 5F2GA 1VP5A 1GG1A 4AHPA 2ZYFA 5EPDA 2ZDSA 4MNJA 4NNCA 3IVSA 1B4KA 2QMKA 4A2SA 4XAFA 2G4JA 4QLJA 4YTSA 2O7SA 3RM8A 4GNKB 1ME9A 1XYFA 4CU6A 4HPGA 4ZTYA 5HNRA 4DZIA 2EHHA 4QSFA 5D37A 1P7TB 2XH0A 2EPMX 3REQB 5KZMA 4AX6A 4JDBA 3LBOA 3N11A 3NQVA 3R89A 2PP3A 4EIVA 1UIPA 1JDDA 4S3CA 3M0XA 3CZEA 3ATZA 4H2HA 1CBGA 4WSHA 2PLKA 2ZRUA 3WK3A 3TYAA 3HBLA 1Q3NA 2OO6A 3VNLA 3G0UA 1RJQA 4KWWA 4UTFA 2H90A 3E5PA 2YW3A 1MQRA 4K8EA 2OLAA 4LEQA 2GVLA 2J75A 5REQA 4HNTA 4PC8A 1DQWA 1T40A 1AH3A 1NFPA 1R2TA 1UCWA 3WD0A 1BQCA 2Z1XA 3UW6A 4ENLA 2ZC8A 3IGSA 3NQMA 4XBKA 4JBRA 4J1OA 3ZT7A 4ZO9A 1Q6CA 1ZBCA 5EFDA 4ATLA 1BYAA 1XDLA 2EG7A 3QSRA 1WDRA 4GUHA 4KS0A 5BW6A 3RCMA 1UKSA 2GGJA 1SM9A 2G50A 1EBGA 2P8CA 2WCAA 3USZA 1U83A 2J74A 3RM4A 5I3GA 4XSLA 3STEA 2XSAA 4U3AA 1EH9A 4MWAA 1DIKA 1LYXA 1SZEA 2YCLB 1TPC1 2OZ0A 4QAWA 4ADTA 3TXVA 3QHNA 3QHOA 3LI0A 3T2PA 3R7MA 5I23A 1EIXA 2GGGA 4Y8FA 2XJ7A 3KRBA 1XIEA 2Y7DA 3S6DA 2D2JA 3GR8A 3WJXA 2WWCA 1VQTA 4HA4A 1CLXA 3DU0A 3G1VA 1YTDA 1V8EA 4X0VA 1BYBA 2YIHA 4HK6A 3MP3A 3HGRA 1EWDA 2DSKA 3L68A 3O2LA 5AFDA 3ABSA 3FDKA 1A3WA 2R94A 2WLYA 1RA5A 4ZFMA 3N6JA 4Q4RA 2ISVA 2BMBA 1YEYA 2X2GA 4TX8A 1E1EA 4E0CA 4OJYA 3H26A 1JZ5A 3OHMB 3P67A 3U2ZA 1AMYA 2VVSA 4LUSA 4W8BA 3MKVA 4HZMA 3T55A 1F76A 5ECUA 2Y62A 3S1VA 3AXMA 3CYJA 2OVLA 4LXFA 3G3DA 3PTKA 2ACQA 3A4AA 3ITYA 4YHGA 3P8IA 4C6EA 5I6SA 4H6KA 2W79A 4ORIA 1J11A 3R1ZA 1XCFA 4MFEA 1GVSA 3IGXA 2QF7A 4UFLA 2OWCA 4E4FA 4DXVA 3W6MA 3U3HA 4S2CA 4YPJA 4I8YA 4XX6A 4WCJA 3O6YX 1V3JA 4J2MA 1B4EA 4DWSD 3N2BA 2ZICA 2OYKA 3LM3A 3MUXA 4BZYA 5AYZA 1MQQA 1OFAA 3QW3A 1A4LA 1UR8A 3GYCA 1XG4A 3UNTA 3RPTA 3WDJA 4GH1A 3D3FA 5FJTA 3DFPA 3D5HA 4LB3A 4LGXA 1XIIA 5CBJA 3UF9A 5HWNA 3BW4A 3IJIA 1UW9A 1MNZA 4JYFA 3M5VA 3T6CA 3GXTA 1EB3A 2WVTA 2Y5SA 2VOMA 1XL9A 2V5CA 4M0XA 4UQBA 3FIGA 4HTBA 2Z29A 1V77A 2WWDA 3DGRA 1S2VA 4AIBA 1NDZA 1OSEA 3DHDA 1X1OA 4ZMGA 5M03A 3CHVA 2J77A 3BQ6A 4FXJA 1C8QA 4RZBA 3AYRA 2HROA 3STFA 4F0HA 2FPVA 4C7GA 3TH6A 1V6WA 2VEPA 2VMFA 1F74A 3W23A 2Q01A 4UIOA 4ZQPA 1CYGA 4JX4A 2O9PA 2V0TA 4Q8VA 4FXFA 5C2XA 2HS8A 4C6MA 1US3A 2ZZ1A 3IAPA 2TODA 3SI9A 4CVUA 1SFSA 4P8UA 4UNLA 3FEMA 4M6PA 3W3OA 1CZ1A 5I3FA 2GWGA 5EMJA 4YWIA 1LCOA 4NF7A 3MC5A 1B9ZA 1ELSA 1S1RA 1BAGA 1HL8A 4IFKB 4CD6A 1OZQA 4JTLA 4IFOA 4NILA 4YN5A 1CTNA 1RD6A 4PMOA 1A5AA 1BWKA 4LC8A 1RPXA 4Y2WA 2WKLA 4MSSA 3ARYA 3W7LA 4HU3A 4QS6A 2EG8A 1HKIA 2YDQA 3LTSA 3TKFA 2AQVA 1XBYA 1GW1A 2NQJA 1G4PA 1ZB5A 3HPXA 4WXZA 4YLWA 1IR2A 3C2YA 1V6TA 1H4PA 4UQCA 3QFEA 2JGQA 2QDDA 3U4FA 5B80A 4IPPA 4S2BA 1B3VA 3NQAA 1BPLB 3QOMA 3TZNA 1GK8A 1WAUA 1ZGDA 5C70A 1Z44A 2FJUB 1V3IA 5I0DA 1W91A 2GUBA 5HWMA 4RDYA 3G24A 4MM1A 2YCIX 3GYEA 8XIAA 3EDJA 3NZQA 2A3CA 4BQ5A 1SPQA 4ZSTA 3NUKA 3PVFA 2BXYA 2DZBA 3NO3A 4C6FA 3FAWA 4HHMA 4MVAA 4U10A 3EB4A 4JN8A 3TUUA 5T9BG 2PDIA 3MHFA 1ZSXA 2CLFA 2PB1A 1WXJA 2Y70A 4OZOA 2FFCA 1H7XA 1R6WA 3QQ0A 5KMYA 3E3HA 4EF8A 1DWJM 3PG9A 1W1YA 1KNWA 3FKRA 4ZOEA 3N34A 5I7GA 3LV6A 1E1CA 4AC7C 1LOLA 3L4TA 2WMIB 3DYOA 2QPUA 3BLDA 1GQJA 3GNXA 3IWPA 4J40A 2SFPA 3UZWA 1A5UA 2Z1BA 3TNOA 3CIVA 3QOKA 4AFYA 1XLEA 4QXIA 4LVAA 2VDIA 3IK4A 4PMNA 2WYSA 1R87A 3UG3A 1RQHA 2TMDA 2WJDA 1A5OC 2OOFA 2YR1A 3UT0A 3PWGA 1EOKA 1TO3A 4QQ3A 5MKGA 3DEQA 4PZVA 4XAPA 3BL3A 1EYEA 3AUJA 4L80A 4GUGA 4C90A 3B0XA 4J28A 2ABAA 2FTYA 4LY4A 4M80A 1TIWA 4GG9A 1CLKA 3Q37A 5K9CA 3N29A 1A5SA 1FWFC 3IIZA 6ALDA 2R24A 3KL0A 5C9ZA 1EGZA 3DUGA 4D8LA 1U33A 2PEVA 5BMWA 3CZ8A 2XU2A 1K4GA 1RSCA 4L5ZA 1A5KC 5HPCA 3RPDA 2VENA 4RJEA 2P8BA 4N4QA 1LOQA 3CPGA 3GG7A 1CX9A 3OVQA 2A21A 3WMCA 4KKXA 2CERA 2VZSA 1EFZA 2WSYA 3C86A 2XVPA 1R9ZA 2ZX7A 4DF1A 5AHNA 3ICJA 4D6GA 3MJYA 4XKMA 2B7PA 1JPIA 2V8ZA 2JIEA 5B7ZA 4S38A 3ARQA 1ISXA 4IJRA 4YMZA 3S2JA 5HPOA 4ROPA 4ZXLA 4RNFA 2VZVA 2REQB 3LCFA 2I9UA 3WH6A 1LG2A 4BQ3A 2FMOA 4QX4A 4FR1A 2G3MA 1HNYA 1XIMA 1QK2A 3AFBA 1XLDA 3VC5A 1ME7A 1B3XA 1TMLA 2PURA 4GC3A 4ZOCA 2V5LA 5H8UA 3E74A 4QJ5B 1SGJA 1VPQA 2WAGA 3DOPA 1CGVA 3KCLA 2BP1A 2ZTKA 3GTXA 4F2TA 3WDHA 4BQ2A 3O06A 4H7ZA 3E2SA 4O14A 1VEPA 3BVJA 4AISA 1I6NA 3KM8A 4KEMA 2AL1A 3P6LA 2Y6ZA 2E0PA 4K1WA 1Z3NA 3ZYZA 2DH3A 3PBWA 4UTUA 3Q58A 2QCGA 3TTSA 1E0VA 4CKQA 1LRQA 1NOWA 2EEXA 1JL8A 3LCLA 1V3KA 4DZ5A 1SSDA 3GVVA 5JBDA 4I8DA 2FVKA 4ZB2A 1EWEA 2DUAA 4F0RA 3KBVA 3VD7A 2NWSA 3LCGA 3C0QA 1WX0A 4M8UA 3CYVA 3W7KA 3L0GA 3VABA 2C14A 1FCUA 5D8WA 1NQKA 4KCWA 2Y7GA 2OZTA 1JF5A 3SUUA 5AC5A 1CDGA 3AO0A 2EPNA 1X97A 2Y1HA 4OBTA 2MUCA 2Y88A 5IDZA 1JCYA 4CNPA 3LLDA 1TMQA 1A0CA 4FHAA 1UUMA 5FJOA 2XDFA 4WKAA 3V18A 2A79A 1ZJHA 4CD4A 4JIRA 2VYOA 2OCZA 3COTA 1KBLA 3LZ3A 3T7VA 1R86A 3BSMA 1ISYA 3RO6A 3WLIA 1XI3A 1QOXA 4CEXC 3M0VA 2PA6A 3CXOA 2HV5A 4KFPA 3URQA 1PZ0A 4AIEA 4N6FA 4TV6A 1MW3A 4LUJA 3QGKC 4MFDA 1HFBA 1GHRA 5LHEA 4MMWA 4CN4A 1NU5A 4ZO7A 1H0IA 3UA4A 4A05A 1EX1A 3OG3A 2GGEA 3NEVA 4YTRA 4MUPA 4DVOA 1EJ7L 1PSCA 2PWDA 1Z89A 3CASA 4JQAA 2X0YA 3T42A 3C52A 1Y5WA 4X63A 2YL8A 2BXZA 2BOEX 2NV9A 3CUIA 5FF4A 5GQBA 4UXDA 5LNWA 1NH6A 1YBQA 4W88A 4HJWA 3ARSA 2EXOA 3S9YA 2PLCA 2WC7A 3URNA 1XLKA 1KBJA 3H2EA 4MADA 3UCCA 1UR9A 3TJIA 3I7SA 4AYGA 1EOMA 2UWFA 4H19A 4JTCA 3SCRA 5AOUA 3CK5A 2XGIA 3PG8A 1LG1A 4C6JA 4GC4A 1FBAA 1UR2A 1XLLA 2H9AB 3VO0A 1MDLA 3LU2A 1ZU8A 2YW4A 3CZKA 1R3SA 2BGQA 1AD4A 4XZNX 1NP0A 4LNYA 3CEPA 2BHZA 3TP4A 2Y7EA 3P84A 4BFAA 1XQKA 5LGZA 1A3XA 3LHWA 1ZRQA 4E4PA 1M65A 3ANVA 1LQ2A 1PHQA 1TV4A 4H9VA 4NAFA 2PTXA 3AU2A 2XG9A 4S3KA 1QUMA 2PAJA 4O1FA 2HISA 2YOCA 2E28A 4XTDA 1FWNA 2CHNA 4IUGA 2X7VA 4PE8A 1V6VA 4IL2A 1J0ZA 4ECLA 4PCPA 1QPRA 4DBWA 1VR6A 2ESCA 1SJBA 1M9HA 5LIKX 3GVGA 3PJXA 1LM1A 4BI7A 1UKTA 1E9LA 4OV9A 3IJ7A 1GVEA 3RCNA 1O6IA 1UROA 1OM0A 2IKJA 3W27A 1PKNA 4EPKA 4OIFA 4O16A 4REQA 1TMHA 2YPIA 4WDUA 1Z41A 3MPGA 4JXCA 2AQWA 4GPNA 1IWBA 1JI1A 3MHGA 4LT9A 4C7FA 2DUZA 4HYVA 5DO8A 3KTSA 5HMFA 2Z2AA 3CU2A 1T99A 4LV9A 4N0RA 2WHMA 3GXIA 4GQGA 5LXXA 4RXGA 3VOFA 2GQ3A 2WMJA 3KTXA 5LA2A 2V82A 3GNOA 4GVIA 3QR0A 2PP0A 3EWCA 3LD5A 5C6MA 4K8HA 3VOJA 1ONEA 2A4AA 1C7SA 3N18A 4QG9A 4WGXA 1K03A 3P62A 3GBDA 1UD2A 2OLSA 3LGEA 4FX8A 4YVXA 5LIYX 1UOKA 4LVFA 3DFQA 3UA3A 4J3VA 4JTKA 3RF9A 1T7LA 1G1YA 3EOLA 4R33A 4AEEA 1VLIA 2BHYA 1S1PA 4S3BA 4HOXA 3VC6A 3A13A 1TRDA 3LENA 3YPIA 3WH9A 4DLFA 4Q8NA 4Z2KA 3SEPA 2O9OA 4DUVA 4HU4A 5LXEA 3GW3A 1O94A 1RA0A 4MHBA 3J7HA 4Q7IA 1EPXA 2V2CA 1EO5A 4G9PA 3ARPA 3ARTA 3SGUA 4Z08A 5CBIA 1P0DA 4S3DA 2XSXA 1I4NA 9CGTA 1T0OA 4CCZA 4ZO6A 2WQPA 2PDXA 4NAFB 3VOCA 3VKAA 4KWUA 3O0FA 5T26A 4O1CA 3ATYA 3W7IA 1R3YA 2NXHA 4RX0A 2YL6A 4KH2A 3MVIA 3GNDA 2PLJA 3S0CA 4OFCA 1E4IA 4EWND 2I17A 1YXDA 1J6OA 4R5EA 1YPIA 3I6RA 2C15A 2CLPA 5C9XA 4LANA 1MNSA 1YKWA 2V3DA 1PX3A 5DBTA 3V7PA 1RCQA 2Q09A 4U5IA 4GHRA 1EKOA 1MRAA 1RH9A 5EMMA 3W37A 2VD8A 4QIUA 4JZ5A 4D6CA 2Z25A 2UY4A 3ZXWA 2XIOA 1IIHA 1E0WA 2A5HA 1DWFM 4REQB 5HWJA 5HBFA 3LXBA 2BY0A 4LF2A 3TXZA 2PMQA 4MF4A 3L2LA 1I75A 2QJNA 1W9XA 5HA7A 3E1F1 2Z2BA 3R25A 1M7XA 2DT2A 3MCOA 1WE5A 2V68A 3GXDA 3NM1A 3TE9A 3LG3A 3FA3A 1BLIA 1SQ7A 1US0A 1JJKA 3VGGA 1XLHA 3TOYA 2Z28A 2HXTA 2PDJA 1Z8AA 3UJEA 1YNYA 4I9AA 2V5DA 4QQUA 3NQ6A 1L0PA 4JTDA 1PWMA 3HJZA 3TW7A 2A6NA 1OB0A 1T8QA 4KEVA 3TTQA 2V30A 2X41A 2D3NA 2GOKA 3GVRA 4MKVA 5T8GA 2EF9A 3FKKA 2XIIA 2J27A 1SW3A 5LIXX 2VDGA 3GRIA 4O0KA 3L66A 3HGJA 2MNRA 3LUTA 1NWTA 2IKGA 4HPNA 3CQ0A 2XN1A 2CLLA 4ZEPA 5GVJA 1FDJA 3KBSA 2A3AA 4DXXA 2BOFX 2XVGA 1QRQA 4FF7A 1JCNA 3NPWA 1X39A 1WUEA 1ITUA 2HVOA 4ZENA 3EDEA 3KVJA 3R2GA 1HP5A 1MEIA 4WIWA 1A5BA 1GVQA 3B0VC 4GE8A 5U7SA 5FL0A 4PTXA 3ABRA 4AD4A 1C9WA 2DSUA 2D0GA 2I5GA 4J9JA 5EU9A 2YCJA 4GCAA 5IXEA 1L9WA 3EX1A 1E4LA 1P6WA 4TX6A 1UWIA 4P7NA 1OF8A 2I5QA 2KX9A 1A3HA 1UOZA 1Q4WA 1GOKA 3M6YA 3BURA 5K3VA 1NOUA 5H6HA 2XGZA 1ONRA 3W0KA 1AA1B 1ZBVA 3ITLA 1U2YA 2HTMA 1VRXA 2NQHA 4F9DA 2INZA 1EPVA 5XIMA 3P5ZA 1XRVA 2RKXA 3WMLA 4HN4A 4AZHA 5JBFA 3VE9A 3BG3A 1A0DA 3TQVA 4HSNA 3BWWA 2QPSA 4AD2A 1A0EA 4M6QA 1GOIA 1JIBA 1VFSA 1JCTA 4EOUA 3TR2A 4DI8A 1ZBWA 4DNHA 4GJJA 3VUPA 1F07A 1KB3A 1H41A 1KXTA 4RZ5A 1FTXA 3TR9A 2HNHA 4M29A 4WOZA 4JFWA 3MO4A 3WLOA 1UASA 2PUZA 5AYIA 3EA2A 4A8IA 2BVWA 2XFYA 4HA0A 3AIEA 3PSWA 5EYWA 3QW4B 4DYJA 1KLZA 4JYDA 3IIOA 3NQ2A 2ACRA 1HN1A 5C7HA 3NZGA 4R9OA 1GUVA 4UC5A 4PRTA 3RR4A 4C6IA 2JF7A 1DWAM 1HJWA 1XLFA 1WPCA 3GAYA 1XWYA 1B90A 3DIPA 4RPQA 2FGLA 4MDOA 4WLCA 4PFMA 2GJXA 1UQZA 1FFQA 1PUDA 3L4ZA 2CZ5A 3VM5A 4LUTA 1F3TA 2DH2A 1MW1A 1PKYA 3GHSA 2B7NA 1HZYA 3LLXA 3N2MA 3VDAA 4UTLA 4DN1A 3AXKA 1J96A 1N8WA 5D2WA 3WENA 1H1NA 1TKKA 2ATMA 2YJQA 3PM6A 4GI4A 3W38A 1CI1A 1H5YA 1XLJA 4QE5A 2BTMA 4J3XA 3QR1A 4HTYA 4AAJA 4GQRA 3DFSA 3C61A 2YA1A 2WZHA 1SO6A 1FWEC 3MWAA 4O15A 3TN3A 3WQ6A 1W3LA 3WY1A 1ICPA 1KD0A 2E5DA 1GVRA 3M7WA 5CC3A 1PCWA 4N6EA 2QCDA 3ZVHB 3AS2A 4UFMA 3BMXA 2B81A 4TIMA 3MBFA 5C8BB 2XWEA 2FLIA 4NUWA 3SFWA 4G7EB 3MMUA 3GH5A 4W85A 3OLEA 1F9CA 4GINA 6PTDA 2IQ0A 3GXFA 2DDXA 5BXPA 1DJYA 5M5DA 1OG6A 1ZBKA 2E67A 3GM8A 4IQJA 4MB4A 1JDEA 3K4WA 1V5XA 1PEZA 1AQ0A 1AJ2A 4DM2A 4GNJA 1QU4A 3XISA 4IQEA 1GVYA 4UB9A 1IZJA 4E8CA 3NL2A 2I5IA 1OD8A 1IF2A 1P6CA 1FWGC 4K3ZA 3GTFA 1RP9A 3CHDA 4OBSA 3A24A 3EXTA 2QV4A 3PPCA 4MWAE 2YL9A 4KESA 2Q8LA 3HPZA 4NP7A 2EPKX 4GKLA 4GI8A 5GJNA 4YU1A 4V15A 4R88A 2QULA 2ANUA 1UH3A 1M5WA 1F2JA 2EQDA 4XVDA 4D1IA 2WBGA 1XH2A 3VIGA 1KXHA 4AD0A 4D9PA 3NQFA 3URBA 2X42A 2ZRYA 4NYYA 1R7AA 1S2TA 1VLWA 3CQKA 3WLNA 3LNMA 4XD4A 1KRCC 3TU9A 2A7NA 3WDPP 2OT1A 2ZTJA 5D4YA 3EX4A 1W31A 2NXGA 1PYFA 3PZIA 1IE7C 2ADAA 2VFDA 1MSSA 3LA4A 4HYRA 3TTYA 3VNJA 4A3UA 3BO9A 4HJFA 4ACZB 1GEQA 3B04A 4GY0A 3TOPA 5FEZA 1WBJA 1Z69A 4M7TA 2PI6A 4W87A 3O07A 2CIPA 4P8VA 2YFNA 3Q65A 4GZEA 1U5VA 4K2SA 1TWSA 4I7UA 3EA3A 4YIWA 1TIMA 4UZSA 3IUDA 4E2OA 1Q8AA 5HJLA 5CC6A 1UZ4A 4LBUA 2ZZ2A 1KO0A 4GO8A 3JW7A 4PBFA 3S2NA 1OWQA 4IFRA 4RDVA 2CNCA 1S38A 3B0UX 4HU8A 1BYCA 5K9DA 2WKJA 4GJIA 4MZ8A 3M0YA 2ZC1A 4FEZA 4KCVA 1W9PA 4PMRA 4B9YA 2R91A 4R27A 4AZCA 4RE2A 1SR9A 3EOSA 1P5BA 5DMMA 2WM1A 4MKSA 2PWFA 2QAPA 4TV5A 2J7CA 3ZR6A 1RUSA 1G7VA 2VFFA 3AIUA 3N2OA 3W1PA 3UYIA 3F4VA 3WO8A 5C7VA 3MSDA 3H8AA 1HXJA 1E51A 3V5FA 3ZQ9A 3OP2A 3UBPC 1QW7A 5F1UA 2OPJA 3BG5A 4HP5A 1NM9A 2XIMA 4C6BA 5D05A 2G0WA 1HVQA 1O68A 3QMSA 4GXWA 4MAVA 4DPPA 3OPSA 2QPXA 2D1ZA 3NM3A 1F6YA 2CC0A 3OG2A 1OFOA 2V5KA 1QHOA 1PS9A 1S46A 2O4QA 1KBKA 3QM3A 5CZKA 1GG0A 1XIGA 3NAVA 2R9RA 1L6SA 1XIBA 5IHSA 3ABXA 3EWUA 3UZXA 3VNMA 1XISA 5DRCA 2B4GA 4QBXA 5CZTA 1ZFJA 2ALDA 2VEFA 4P7LA 4J3ZA 2QVNA 1KGUA 3I3DA 5CCZA 2NX9A 3UR8A 1M7OA 1YTEA 4CNOA 1XLIA 5AC6A 1TVLA 1OX4A 4UMCA 2NVDA 2ZBTA 3OLDA 3B8SA 5M2FX 3DENA 3RUBL 1MO0A 4HNVA 4TVUA 3VIMA 3GE7A 4US6A 1N8FA 2GOUA 4PUMA 4DUWA 2J47A 2YDRA 1XC6A 2PTYA 5H1WA 3R12A 3HG3A 3BAYA 1WKDA 3DBPA 3EPOA 4C91A 2X40A 1GCYA 5EY5A 2Y8KA 4DX3A 3GC4A 3PJTA 4IIGA 4Z2IA 4ZQRA 1KM1A 3L65A 4H8UA 5LKYA 1O60A 3RAOA 4FOKA 4S3FA 3GD6A 5HQMA 5I09A 1GOQA 3N14A 2C8NA 3QPEA 4B3KA 3OIXA 4IG2B 5HUOA 1P48A 2VX7A 4LBSA 1Y8BA 3NJ3A 1LLWA 2EBNA 4FK9A 1M7JA 3FXYA 3S1UA 3PTQA 4C6QA 2I14A 3AYVA 1EJUC 1FWBC 3S5YA 1GZ1A 2WW5A 1JGMA 2OGJA 4FNRA 8A3HA 4GUIA 2X0HA 1AQFA 2OWXA 2PRMA 1LF1A 3OGVA 1IWPA 4NJKA 3DFHA 4UTIA 2O0TA 1TJ2A 3BLIA 5XINA 3KBWA 3VMPA 1EGVA 4IP4A 5AHEA 1S2CA 1RQBA 4PTWA 4IPNB 4EK7A 4HT3A 1PKMA 1TQJA 3B9OA 4F9JA 1KW1A 2BZNA 1QBBA 1WDWA 5IHRA 3HURA 4UOQA 2QCHA 3UP8A 4KWOA 3QZAA 4QDPA 4DEFA 4DIAA 5FSDC 2XIQA 3SY5A 3PSVA 3O6DA 2J24A 1DWHM 1L6YA 3ZWSA 4UTHA 1K77A 1ZS2A 5EFFA 3EKZA 4LW7A 3G1SA 1JUBA 3GU2A 4PA8A 3USBA 2VZOA 3ZSTA 3VNZA 1R38A 5F4SA 5AZ0A 1X38A 1DV7A 4PMDA 1MXSA 2HK1A 3UWZA 2X1RA 5CZJA 3BJTA 3C2VA 2ZUSA 1ENUA 1HL9A 2ZIDA 1ADSA 2VCAA 3RX2A 2CW6A 1E6NA 1U1UA 2A1YA 1FKXA 1RLCL 3FW6A 1VFTA 1QPKA 1CWYA 4U31A 1G69A 1J8VA 5E5CA 3AMGA 3IJQA 2DUXA 4FALA 1XIDA 3WG6A 3CH9A 2BSLA 3ZT6A 1A4MA 3VKBA 1WAWA 2HK0A 1EQPA 4E2VA 2PC4A 4LC6A 4MB1A 3AYSA 4H8HA 1JCMP 4W5UA 1W2VA 1IT0A 1YRRA 4OU1A 3CWHA 5ABFA 1G4TA 1J2BA 3OTRA 2HBXA 4AF0B 4LCSA 1XG3A 1EZ2A 2DFAA 3SSZA 1BKHA 3W1NA 3PK7A 3ZLHA 3PHAA 5C9UA 1OGSA 4I9TA 4HK7A 2WMFA 3SUVA 1R9XA 2NXIA 4ZODA 4P7OA 3UGRA 3U0HA 1B0IA 1JAKA 4PH6A 2HDJA 2FJKA 1OCJA 1XF0A 2X16A 3WL1A 2FZMA 3LXAA 1FWHC 1VD6A 4ICCX 1RD5A 2Y85A 1H5VA 3FHAA 4JN6A 3WDIA 5BMXA 1SUXA 1THFD 5BCAA 2DIEA 1QDSA 2ZRVA 3RX3A 4LB4A 4CU7A 5C2CA 3C8NA 2ZRXA 1M03A 3B8TA 3QR3A 1F6PA 2GK1A 2WANA 3NOEA 4KWVA 1WOBA 2J6VA 3LXCA 1UBSA 1KGXA 2QUTA 3RYSA 2FZBA 4XBSA 4ERIA 4DO5A 1AJZA 4GOAA 4IQLA 3FVMA 1IZKA 1V3LA 3VCNA 3H24A 4WQ6A 4PTNA 1NVMA 3ECQA 1FKWA 4GXPA 2OEJA 5AYBA 1P43A 4ZCWA 4E8DA 1KTNA 5DELA 3R94A 1TJPA 3NYDA 3FAXA 3TW9A 1K8ZA 3VXGA 1J93A 5HXMA 1AG1O 3TA9A 1KQZA 1Q45A 1MW0A 3GX9A 1FRBA 2XPKA 1W5QA 1VCVA 4GGHA 3NFUA 2WPGA 1SVDA 1WP6A 1OFDA 3CPUA 3BLFA 2VUNA 1NDWA 2FB2A 1E3ZA 3E0WA 3CJPA 1ISWA 1C9DA 2YB4A 3I7RA 1KGWA 1FWRA 1B54A 3WBXA 4HIBA 4IMDA 1S2AA 2NQ5A 5FL1A 2VP8A 3T0AA 4B16A 2QZRA 1XFCA 1RBOB 1TB3A 5D2TA 1LWIA 1J5TA 4DI9A 1M7PA 1PHWA 3E02A 5EMKA 3MMDA 4FNQA 4N9EA 3UESA 3WKZA 2VQTA 2ZWYA 1XLGA 3GHTA 2D23A 3MCMA 2WJZA 3UD6A 2CBUA 5CPSA 4EAMA 1EX5A 1S3TC 3WFLA 1WXZA 4MIMA 2WNWA 4RZ6A 3PPFA 5DMNA 4XZHA 3MTWA 5L9FA 4HVXA 4M6VA 1XR2A 2ODOA 2Z6IA 2VHLA 1TFVA 3L4XA 4NNAA 3F2CA 3KBNA 4MOZA 3WFZA 2R1MA 3HFTA 3M44A 4JQ3A 3E9AA 4JY8A 3T40A 3IK2A 1XYZA 3EKGA 3HF3A 3KXQA 3CL8A 3WQCA 3K8MA 2CLOA 3W72A 4XAGA 3DG7A 2NV1A 1EJVC 3TZFA 4KPLA 4EXBA 3AALA 4MYXA 2PTDA 4A3QA 4WJ8A 1CXIA 2ISFA 4JX6A 5HMEA 3W84A 1HO4A 1RXOB 2WK2A 3U9IA 4LVDA 4XAYA 4AWTA 3U8GA 3BAJA 1XHGA 1XH0A 2VELA 3MUCA 1OFRA 5FJIA 2DVXA 2XZ9A 2QVHA 1AW1A 1ICSA 2X0SA 3TAOA 2XSBA 4PTMA 4Z2LA 3CTLA 2D2OA 3DKLA 3WUFA 1P6BA 4I7VA 4NZCA 2QJMA 2BG5A 3AWOA 3QQWA 2EJ1A 1UD3A 5KTLA 1MFUA 2OTDA 4Q4MA 4PUJA 1IXOA 3I6TA 4ZQMA 3CIWA 2BVTA 3U6WA 4CVWA 3EDDA 1EHAA 2JEQA 3MMWA 3CC1A 1PBGA 1YIXA 2WZMA 9RUBA 4LYRA 4D6IA 1ZCOA 4Y9PA 3QTGA 5CC7A 4XZWA 3V16A 5A6TC 3PBUA 1TV2A 1R3TA 4PUDA 4O19A 1L8PA 4F40A 1E6XM 5LNVA 1BSIA 4X0NA 1TREA 5FAJA 1OYCA 4B5TA 3GDTA 3EX2A 1LDCA 1XUUA 4C1LA 2ON3A 4X22A 2VC6A 3OW1A 2PDQA 3W6YA 3MJMA 7A3HA 3IJLA 3DFTA 3W1AA 3P14A 3BOLA 3HA1A 4NAEB 5DY2A 1XBZA 1O95A 4OOZA 1YX1A 5I02A 2WSPA 5FD0A 3BW3A 4B2DD 1MW2A 1TTIA 4P8XA 4I5UA 3GK0A 2ZOXA 1BHGA 4FNTA 4RPPA 2HZGA 1YE6A 4C60A 4BHYA 3PNUA 1H7WA 3P0WA 5DBUA 1J10A 4XO7A 1NSJA 4PMYA 4CNSA 4LFYA 3A9BA 3W6LA 3F5JA 3SN0A 3P93A 4Y9AA 4H6RA 1OGGA 5HQEA 3W2LA 2C79A 2Z00A 1EF2A 2ZWZA 3HTWA 1X8CA 5CLWA 1X1NA 3QH2A 2XINA 3KTCA 1QCWA 3LBCA 2Z7KA 3IGHX 3GVQA 3MKCA 3VIJA 1L6GA 1QI2A 2WHKA 1RHCA 2X1UA 2G95A 1D3GA 4FXSA 4ZQNA 2ZX5A 5TF0A 2WO5A 4L64A 2FVMA 3W4RA 3NPUA 1NF7A 2ACSA 1JEZA 1XDMA 2FKPA 3ZZ1A 4LWWA 5JH2A 5EBAA 2Y4SA 4PB5A 2CHOA 2AMGA 4RE4A 3EWWA 2ABBA 4KF1A 4AUBA 4H4IA 4MNMA 4HQVA 2PDYA 3SN1A 2Y63A 2OGYA 3M47A 4O8AA 2MANA 4I3GA 4JS3A 3EDKA 1KM6A 2F8QA 6REQB 1UWRA 2B0MA 5A8PA 3K13A 1E71M 1AMKA 4ATWA 5FI8A 3B06A 2BXVA 1JXJA 4L9YA 3R58A 3CZJA 3FSUA 4DJEA 3NVTA 3W29A 4IZGA 3MV01 3UR7A 3N6QA 1SYTA 1GPWA 3AXXA 3BCJA 4GY1A 4ZVJA 1GKRA 1JUKA 1YDYA 1JPMA 2J4GA 4NASA 3WN6A 4NZJA 4ZE5A 1EA0A 2CXEA 1K8CA 2HCVA 4Q6JA 1LUCA 1EC7A 3C2RA 1W5NA 1W1TA 1E56A 4MNKA 3D0CA 5FACA 1CT5A 3IARA 3G1FA 1UP0A 3AS0A 2AGTA 1WUFA 4DLMA 4ZGYA 1NP2A 3OYZA 5KITA 2ZKMX 3RU6A 1HT6A 3A23A 5FJRA 4AG0A 1RV8A 3PFRA 1L6WA 3JRKA 1VPYA 3ANYA 4FA3A 1ZY9A 3UXKA 3LTYA 1K7EA 3I4KA 3IIPA 4BWLC 5AHLA 2GL5A 5E0KA 3WF2A 1F4AA 2CETA 2E8ZA 3AIRA 1DIEA 4RV8A 4DRSA 5I5RA 3H7VA 4PRRA 4NZ4A 1A5MC 1JZ3A 4AVFA 4O4VA 3QZEA 1ZQ5A 1E4MM 2RGLA 4E2DA 4F4RA 4RL3A 4MAZA 1KM4A 4YS1A 5A6KA 1OFPA 6ENLA 4YTUA 3W7QA 3BSGA 4UFKA 3D47A 3FGCA 4LH8A 5HATA 5K4ZA 1LJYA 3CL7A 2Z4GA 3T2QA 2JIWA 4G1NA 4W8LA 3MUY1 1NTHA 4P61A 1XPYA 4ORMA 4YHEA 5D9MA 3IVTA 4ICMA 1Z32X 4DJDC 1PVNA 1DOSA 5A6BA 2DW6A 2DIKA 3L23A 3APTA 3CMJA 2OYMA 2FTPA 2DQWA 3N4AA 1KCLA 1J79A 1UYQA 1X6LA 3SRKA 3HB9A 3DCPA 2ZUTA 2WC4A 3MS8A 5LSMA 4NNBA 3B8IA 3B9AA 2E40A 1Q85A 1TPUA 3IIVA 5JQ9A 2JKPA 1EJXC 2ZA3A 2H3DA 4TX9A 3W01A 3CAQA 3W71A 4AC1X 2CLEA 4WUIA 5DCBA 3O7UA 3UZ5A 2Z6JA 4OQVA 4PMJA 3F2BA 1EC9A 1QFEA 2QUMA 2VVNA 4W9TA 2OQLA 4I6KA 4NZ5A 2J78A 3ITTA 3S5OA 3T1GA 1N82A 5D04C 1H1ZA 4XSMA 1JCLA 3CUXA 5MHBA 1XX1A 3APYA 5KINA 4KT2A 4M7SA 3IRDA 4EX4A 2FZ9A 1F7BA 1ZPTA 4Q4QA 4K1GA 1FXQA 4KRUA 1B31A 2E09A 4GLEA 3B03A 7TIMA 1BG9A 1FVPA 5D9PA 1TWDA 3F4DA 3CTTA 1LUCB 1CGUA 3MA8A 3A4XA 1XGDA 3MCNA 4PUEA 3FJ6A 3QTPA 5E70A 1SJDA 1QAPA 3G3MA 4C6CA 3MDUA 4IGMA 1XV8A 2V81A 2WHLA 1TPEA 6TIMA 1QNQA 4AY1A 2NUWA 5HULA 4J27A 3OGSA 1JQVA 2E5CA 3C0JA 3MSYA 3SO7A 3ISIX 4RDWA 1JRBA 1T5AA 4JPGA 1EJSC 1Q6EA 3RN6A 3C5QA 3SAZA 1NQ6A 2AL2A 3T0DA 2HMCA 4I5XA 4ZL1A 3O63A 1K4HA 1NAL1 3LEPA 2IXUA 3KVLA 4Y7EA 4BWLA 3NL3A 1E73M 1XH1A 4DZAA 2VGGA 4GIRA 2UY2A 2J88A 2E6AA 3VIIA 1GOOA 2D73A 5CLTA 4CNUA 2IPFA 2Y24A 1QI0A 1UD8A 5AN7A 1WBHA 3LHUA 1D7KA 1HGYA 1YTKA 1B3ZA 4MY8A 3NGJA 3H12A 2KAUC 1MXDA 3B4UA 5HNNA 4C1NB 3C3NA 1QO2A 1UPMB 3DERA 3ARRA 4LF1A 2EG6A 3WNLA 1SZNA 3AYTA 3RILA 4BI6A 1Q13A 1EUAA 3LPGA 3MT1A 3G2GA 2F38A 5CAKA 3PR2A 3WLHA 4E4UA 2XN0A 2DGAA 5HJYA 4DJDA 1REQB 3BOFA 1W3NA 1TVNA 2VFHA 4KMQA 1UD5A 1DXFA 2F9RA 5CG7A 5EGRA 3KUMA 2C0HA 4RW5A 1YNQA 4LS2A 4HCHA 3T0TA 3UWQA 1HUVA 1Z7AA 3VA8A 3MY9A 4BEUA 1MI3A 3GC2A 5L6UA 1C90A 4B9ZA 1OG0A 3BH4A 1BRLA 3VGBA 4JDYA 4ZR8A 1E5JA 2QJJA 4E3VA 3AXIA 3VE7A 1PDZA 3MBDA 4X2PA 4NI8A 4S3JA 2ZVIA 2NUXA 5HAOA 5BXTA 2P50A 4DUXA 3S5ZA 3FJLA 5HANA 1F4HA 3M07A 1UKQA 2YBTA 1OT2A 2E9MA 5D33A 4JGDA 1J2WA 3OU8A 1TTPA 3CAVA 5CJNA 1UP3A 4IH3A 3M0HA 4M51A 3KLLA 3WNOA 3D6NA 4PUNA 3UG5A 1CXEA 2BHUA 2Y5EA 3V1HA 3VKKA 3EWBX 2LLEA 4WDTA 5BWAA 2PZ0A 4GYJA 3OEXA 4UTMA 1IEWA 1SO3A 4OUIA 2RAGA 3TSMA 3PPHA 2AL2B 4MWAC 2GSJA 3ES8A 5F2IA 2BY2A 3TYDA 3VPLA 3S2MA 3O6AA 3H22A 3ZJ6A 3NSMA 3U57A 3PZ9A 5DF0A 3T2OA 1SU5A 4WY0A 2FZNA 1VBUA 3TYEA 3BARA 3EWDA 1Q4NX 3L4VA 1ZAJA 3NQBA 4WSKA 2F61A 5CJ5A 1CPUA 1HQTA 1BVWA 2F2KA 4IJCA 3TC6A 3WBAA 3ZT5A 1K9TA 4GFSA 4IP7A 1GZGA 1ZAIA 3QN3A 4O10A 3W1XA 4XUGA 2A3EA 4KW2A 2XHYA 1XD0A 3E2RA 2P1FA 2R1NA 2GUYA 1JD9A 4AZ7A 3S5NA 1U5HA 4X2RA 3WNMA 3L4WA 4JTHA 5HMDA 1EL3A 1BFNA 3BLEA 3UETA 3DC8A 2C19A 2ZZ4A 3G0XA 1UR1A 2RHGA 3TC3A 1VHCA 1KBBA 2WSQA 1HKWA 1VBHA 1XGZA 2ZRZA 4XZIA 3SGZA 2XVLA 1H63A 4KCUA 4A22A 3CAWA 1YDVA 1CIUA 3AHXA 2Z0IA 1W5PA 1ECEA 1W1A1 3N13A 4IP5A 3GTHA 1RQEA 2RDXA 2J8TA 3BICA 4ADUA 3NXFA 2BBFA 3RXZA 1Q7ZA 3QBUA 1BVZA 3LK6A 2JALA 4V28A 4KFOA 3AHVA 3W1UA 1CEOA 2WV8A 1QI3A 1TUFA 3EEGA 5A94A 3EEZA 4R3UA 5TD4A 5I3HA 5AC7A 3N2XA 4UFJA 1TTJA 4J3WA 2J9YA 3IEBA 3UQNA 3R43A 4ZQCA 2RGMA 1HO1A 2FB3A 3R6IA 1XYMA 4I6VA 3UXLA 3GIQA 3FYOA 3GUWA 4HYWA 1DE6A 3CO8A 3WJZA 3CH0A 5AYYA 4DZHA 5CG0A 4JKKA 2G4FA 2D69A 1W2PA 3IACA 1ITQA 3K8LA 3NZPA 1WDPA 4S23A 1EGMA 1H1YA 5K2ZA 4FXRA 4IIHA 3O6CA 3ES7A 2NQLA 2Q3OA 2GGIA 4ML4A 1PO9A 1AL8A 4W7UA 4IGHA 3WQGA 1YW1A 3EZ4A 1IT8A 3FX4A 2Q3RA 3GW0A 1G67A 1B9BA 3EMCA 3P81A 2BB0A 4S3EA 4O8RA 1JZ6A 4N9BA 1ZHAA 4S1FA 1DWGM 1QNVA 4XAZA 4XKYA 4WVXA 4WOQA 3EA1A 3AUOA 1QO5A 3NQDA 2CWXA 3L4UA 4O11A 1EJWC 5DY3A 1BXBA 3V5OA 3BAWA 3WBWA 2CBVA 4B5VA 4L6DA 1CGWA 5A6MA 3TK7A 1E6QM 3II1A 2NVCA 5JIPA 2YX0A 3W1RA 5I00A 4H9TA 3DHUA 4PMVA 1QMLA 4DWSC 4GACA 3WLLA 5GJMA 3B05A 4DAIA 1JCJA 5IOBA 4UUIA 2PWHA 3GFZA 4O50A 3MZ2A 1W3JA 2PWEA 3M64A 3UPBA 1DTUA 3UEQA 3TCSA 3VFCA 4GA8A 3LCWA 4FS9A 3HJEA 4PEKA 5PTDA 4PBEA 1C29A 2ICSA 3ME3A 1E0TA 3W82A 1TR9A 1VFLA 1IEVA 4ILSA 2VOTA 5GNXA 4WSJA 4L6OA 3H2MA 1OYBA 3EWYA 1HJSA 4HPHA 1UP2A 5D2VA 1TA3A 1MRQA 4GI9A 4CCEA 3RLVA 1AW2A 4B5NA 3R0DA 1S39A 3M41A 2PGFA 1XRTA 2V6AA 2W92A 1XICA 4Q8OA 1VHNA 3DKJA 3SN4A 2D20A 1V0NA 2BWGA 3VAVA 2GQAA 3KS5A 3C56A 1RY0A 1TWIA 4Q4PA 4N4PA 5D09A