3QSRA

Crystal structure of trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
250
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAAPDVDGFLVGGASLEPGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_497370 gene
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 85
structure length 250
sequence length 251
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qsrA00
1LRNA 3R13A 4NNBA 4P61A 2V2CA 3N3MA 3T44A 5CZ0A 5LNVA 3W1UA 5HUPA 2B7NA 4TR9A 4ADSA 1VZWA 4GNJA 2YYTA 2R91A 1O60A 5LHEA 4O17A 1G4TA 1TV5A 1AL7A 2CLMA 2FPYA 3NPXA 4FIQA 4HKPA 2ABAA 4TMBA 1KLYA 3EWUA 4K8HA 1G7UA 2RDUA 3W7HA 5LGXA 4A22A 2CZDA 2Y85A 2QCEA 2PURA 2CLEA 1VCFA 3TU9A 3BLIA 3M41A 3W1NA 1JULA 1GYLA 3A24A 4MFDA 2WV8A 3S1UA 1GJPA 1SFJA 3E49A 3QF0A 1ADOA 3W87A 3P5YA 3QM3A 4MOZA 5AOUA 2CLHA 4O19A 4H3DA 3WJZA 3S6DA 3KFTA 4HHPA 5LNUA 2V30A 5DXXA 4DO5A 4QNEA 1FCBA 1KFJA 1GPWA 1Q45A 1C9DA 1J5TA 2ZBTA 3N14A 5I3HA 1XCFA 5DY3A 2OMAA 1NSJA 1LOQA 3NXFA 3W7LA 2V9DA 3L5MA 4FNQA 3IVSA 3UD6A 1A50A 5DBTA 1YDOA 1FDJA 4AMAA 5FF3A 3G1AA 2YX0A 5EBUA 3L9CA 2PCQA 5CPNA 3EKLA 3GDMA 4UFLA 3M9YA 5J5DA 1TYGA 5D30A 1MEIA 3LDVA 4LU0A 1SZFA 1OYAA 3QFEA 4MZYA 3HG4A 1YTDA 2HMCA 2ZRVA 4NT0A 3M5YA 2X1SA 4NZJA 2FJKA 3W85A 5FI8A 1KFEA 2DZVA 1ML1A 4JX5A 1RQBA 4IWWA 2W0UA 1LLZA 4JR5A 4UIOA 1G69A 4IOTA 1S5VA 1L9WA 1QOQA 3TW6A 1W8SA 3C0JA 5DELA 2E6FA 3SGZA 2X1UA 1YXYA 4XKYA 4YXGA 2YW3A 1X1OA 3UNDA 1F7BA 1KFBA 3STCA 3HPSA 1LROA 4LC6A 1UUOA 1O5XA 3TV8A 4WOQA 5LGZA 5BMXA 3F03K 1KV8A 1RQEA 2ZA2A 4N2YA 4WOZA 2RHGA 4LRTA 1G6CA 3M16A 3G8RA 2RH9A 1JCYA 3W7NA 2EAWA 1SZGA 2ZA1A 1ICPA 2YDAA 3C2OA 3JRKA 1LBFA 3LCGA 3P62A 3F4NA 4QNWA 4FXSA 4WJEA 3CTLA 4QIUA 2Y7EA 4ZZ9A 3RMJA 3CHVA 3UWQA 2ZRXA 3ATYA 4O8RA 3L68A 3B04A 3CIWA 3FIGA 1L6YA 2NV1A 3LI1A 3DH7A 3BARA 1XKYA 2B7OA 2NX9A 2A7PA 2GJLA 1JUKA 2TRSA 3W7DA 1I2NA 5BNKA 3CIXA 2PRMA 4ZL1A 2NXIA 2OJPA 4LS0A 4CNPA 1R47A 2ZZ7A 2ALDA 3GAYA 1OJXA 3LCXA 1ZHAA 4S2CA 4LRSA 1SO6A 2YZRA 5D32A 3TSBA 4GXMA 4I7VA 1KM4A 2B0MA 5CZTA 3W7OA 2NXGA 3VE9A 2VFEA 2P0OA 4PH6A 2OX1A 1OFQA 1KLZA 3MO7A 4KWVA 4FIRA 2JBMA 2Y6ZA 5AHLA 2DZXA 3E02A 2Q8ZA 3MJYA 4NXSA 1GWJA 2J9ZA 1C8VA 4LC8A 2QEZA 3PY2A 3HJZA 2JGYA 1F73A 1FX6A 1R30A 4JN6A 1XI3A 4K38A 3P61A 3OG3A 3VFLA 1KM6A 2QCNA 3LV6A 1DBTA 2QUVA 4ZQNA 3THQA 1RR2A 4JEQA 4IPJA 1OFRA 4CCDA 2X1RA 5EA9A 3EKZA 1PVNA 1I4NA 3CEUA 2CWNA 1AG1O 5F1UA 1K03A 2JGQA 3QYQA 3GKAA 3QC3A 4Z1AA 3BG3A 4Y96A 3G1FA 5CPOA 3W73A 4ZQRA 3MI6A 4NQ1A 4MIMA 4DBEA 1SPQA 4M6QA 5AYXA 5FESA 4IMCA 5HJLA 4PC8A 4KFNA 3E0IA 3I6RA 4JTTA 1SR9A 1SZEA 4LTSA 3R89A 3TFXA 3MW7A 1VPXA 2FB3A 3KAOA 1WA3A 4RZ6A 1OX4B 4YMZA 5EYWA 3LXBA 2WOQA 5I3IA 3R2GA 3TH6A 2ZRYA 3CEPA 4LVAA 3GXNA 1JQXA 4JX6A 4FB7A 4XUGA 3B0UX 2C14A 4AXKA 1EWEA 5DLCA 3L2IA 1FDZA 2C19A 3TMQA 5F2IA 5IBXA 3S5YA 1ZY9A 2QCFA 4UFMA 4X3ZA 4AWTA 5AHEA 2G96A 4YLWA 1ONRA 1TRDA 1VS1A 1XM3A 1OG0A 3M5VA 3GDTA 1VYSX 2NUWA 1K7EA 1KM1A 2A1YA 2C13A 4KFPA 4W9TA 4AWUA 2NUXA 4EWND 3PBUA 2FIQA 1ZAJA 5C5YA 3Q2DA 4N4QA 4TX9A 3GNNA 1OF6A 3G18A 3RK8A 5AYYA 3P60A 1OX4A 4MJZA 1TQJA 1TMHA 3T4CA 3GXPA 4Z0JA 1Q6RA 2RDTA 2A4AA 1K8XA 1I2QA 4X2RA 1D3GA 4M6PA 1D9EA 3MP4A 1Z44A 1AMKA 4XZ9A 4ADTA 3MWAA 1ZNNA 1TREA 2QCLA 1XBXA 2B4GA 1H62A 1W3IA 1H50A 1O5KA 1OYBA 5IM51 1VJIA 1YYAA 1XBZA 4WD0A 2CZEA 3NQMA 4O15A 1F6KA 1KBJA 3GVGA 1SO3A 1W5PA 2Y7FA 3OHIA 4LNYA 3W74A 4UTJA 3Q94A 4OE7A 1SW0A 4JTHA 1BWKA 3DFOA 2CFFA 2Z6JA 1M7PA 3TSDA 5E1QA 4FX8A 1J4EA 1DKWA 2QCCA 4GWEA 4FNSA 1PCWA 4K37A 3ZR4A 3N19B 5KINA 1YPFA 5G1YA 3RU6A 5F2GA 1LRTA 2VFFA 1GQNA 1DQWA 1H7PA 4HSOA 3L65A 3W86A 1GVQA 1HO4A 3HBLA 2DP3A 1B9BA 3PUOA 5CPMA 3W7RA 1DV7A 3M44A 1FWRA 4O57A 1HL2A 3IIZA 1MO0A 2Q3OA 1ME9A 1B4EA 1GEQA 4JTSA 1KBIA 3B0PA 5FF2A 4A2RA 4DO4A 2P10A 1IIHA 2ZYFA 1I2PA 1TV7A 5BW6A 1XFBA 1JUBA 4AWSA 4PL1A 5C54A 3UPBA 5F1VA 3K30A 4BWLC 1OK6A 4JD4A 4UTHA 3UXAA 3UWYA 5DN1A 1GG0A 1GYNA 4BI5A 4LVGA 3LTYA 1OX5A 1Q6QA 1XUZA 5AC7A 3KXQA 3EWXA 3M0ZA 3DI1A 3W1LA 3NA8A 3S42A 1PHQA 3S1WA 2QCGA 5U7SA 3A5FA 1TSIA 4HPXA 1S3HA 3QJAA 3TCEA 1B3OA 3G1XA 3BW2A 1H60A 4XTDA 1LORA 2GQ9A 4MYXA 1QCWA 5D05A 3P84A 3B4UA 2RDWA 2DZTA 1MEHA 1WQ5A 1QPOA 4A21A 2G95A 4GC4A 1EPXA 3TR2A 4IXXA 4J9JA 3GDRA 3TQ0A 5CZSA 3M43A 3N9RA 2DU2A 3DFTA 2C6QA 3BLEA 1TPEA 4UFKA 3W1TA 1HO1A 1UCWA 2QUTA 5E0KA 3LRLA 3C52A 4FNRA 2QKFA 2QUUA 3DXIA 4WY0B 4O13A 4RK8A 3GR7A 4ORIA 4EF9A 3CQ0A 3CLMA 3DFQA 2OT1A 3C4UA 2RKXA 5DXYA 2E5DA 2C18A 4HNNA 1PS9A 3H55A 4PTNA 5D2XA 3UZJA 2QR6A 3O07A 3G24A 1LM1A 1TTPA 1DL3A 3GB6A 4K39A 4UMBA 3FOKA 4NXKA 3I7SA 4AHOA 5LNRA 3P80A 1NFBA 3CWOX 3L21A 1H7OA 3IGSA 4LV4A 1JCMP 4XTIA 2DJXA 4UMAA 2DZPA 2PE4A 3U6WA 1TV8A 4HIBA 4R53A 4QISA 5K4XA 4LT9A 3S5ZA 3C61A 1XC4A 3SZ8A 1AK5A 3ZWSA 5FF7A 4Z08A 2FPTA 1H7XA 4PCFA 5KSWA 2JK2A 1VYRA 3CPRA 3O6CA 1SQ7A 3W9ZA 1FWTA 3PR2A 4CQ8A 2ISWA 4UTLA 3PBWA 1LOSA 4M7TA 1FXQA 1U5JA 4AEOA 1K7FA 3VI2A 3TJLA 4O1AA 1ZFJA 3G22A 3BW3A 1QMLA 4XBSA 2ZFAA 5DY2A 4MKNA 4Q4KA 4WZHA 1AL8A 3DFPA 2QAPA 1L6SA 2OZ0A 4O18A 3C8FA 3CU2A 3S5NA 1AW2A 3P7YA 4JTUA 4O54A 4ZMGA 1NAL1 3G8EA 3H53A 5I3KA 4PA8A 4TMCA 2H8ZA 3BLFA 3NZ1A 4FNTA 2JKEA 3R5EA 3FKRA 3MI3A 3W7PA 4M19A 3S1XA 3V1PA 2W79A 3M47A 2JKAA 1G4EA 2PRLA 3O63A 3NNTA 3W1XA 3NEVA 2QCMA 3B0VC 6TIMA 1F76A 3TQKA 3SJ3A 4K6AA 3C56A 4GUGA 4E0CA 1GVOA 3C3NA 1TB3A 1PV8A 3QSTA 3WK2A 1FCUA 3LX9A 1KA9F 1WOAA 4Y8FA 4IPIA 3IVUA 1TPFA 3O05A 1TPDA 2NV2A 5HULA 5D2YA 1NF0A 3PAJA 4FF7A 3THAA 1KV5A 1TTJA 8TIMA 3G1VA 3UQNA 2CLKA 4PL2A 4H4IA 4UTKA 2C3ZA 3GDKA 4RKAA 1KW1A 4UUIA 2CU0A 1V7YA 3LHZA 2ZTKA 4YCPA 1RVGA 1X8FA 3TROA 4AHQA 4ICNA 1IIGA 4BR1A 2TSYA 4FX7A 4DQWA 2VENA 4X9SA 2A85A 4R33A 4IX2A 1UASA 4S2BA 4LUJA 5EMUA 4ZVJA 2YGYA 4E2BA 2VFGA 3NPVA 3MUXA 4MUZA 3QSRA 4LVFA 3H54A 5G2WA 3A21A 3LHUA 3G1YA 4IMFA 5AC8A 1ZJIA 1YDNA 3P8IA 1EP3A 1V5XA 4JGDA 4MJMA 1G4SA 4RXFA 3WFAA 4WXYA 1FWSA 2O7SA 3W1RA 1RQHA 1EIXA 2TMDA 4NVTA 4P2VA 3W7KA 5KITA 3I68A 3EXRA 4AAJA 1YTEA 4LY8A 4HNTA 3CC1A 3LRKA 3OBKA 3QZEA 2WQPA 3BK0A 5KZDA 3TAKA 3NL3A 4CQAA 4QSHA 4HSNA 1ICSA 3HG3A 1TPB1 4NJKA 2PC4A 3KVLA 2NWSA 3O6DA 2YYUA 4MYAA 2V2HA 3INPA 1XUUA 3NQVA 3BG9A 1B4KA 3NQEA 5K4ZA 4NJJA 2X1TA 3W2JA 4OV9A 3PF3A 3OVQA 3QQ0A 3GDLA 1AW5A 2J27A 1SO5A 5D02A 5K9XA 1P1XA 2HS8A 2Z2UA 4UNLA 4MZ8A 1CW2A 2ZZ3A 1AW1A 4GUJA 2V8ZA 1LTDA 3KX6A 4AHPA 1HG3A 3HO8A 1JR1A 1KFCA 1T0OA 3HB9A 2Y7GA 1XBVA 3QRHA 2VEIA 4OQVA 3W1PA 3E96A 1SFLA 3LB0A 2ZQ0A 1T8XA 4A2SA 5CGQA 2ZTJA 4EIVA 1ZCOA 2V5BA 4QITA 1H63A 4M7SA 1XDMA 2NWRA 2ZZ6A 5HMSA 4GBUA 1KFLA 2ISVA 3PUEA 5DCBA 4HNUA 4O28A 1R46A 4HT3A 1HFBA 3W72A 4IMEA 3R8RA 4NX0A 2Y7DA 5HINA 2WSYA 3A23A 1QPRA 3HPZA 3T40A 4JXCA 2WSRA 4IJBA 3UWVA 3N2MA 2BXVA 1IXNA 3NR0A 3O15A 2BZNA 3PSWA 2DJLA 2BLEA 2E5BA 1SSDA 4NNCA 4FNPA 3NAVA 4O1CA 3PBVA 3LCFA 3T78A 1WBJA 4EVZA 4LOCA 4HNVA 1MSSA 4K36A 1VCGA 3UY8A 4GFSA 4UXDA 4DF1A 1TPH1 1RPXA 4N9DA 3WJYA 1E51A 1VRDA 3N9SA 3Q58A 3PB2A 1XDLA 3W84A 3HPXA 1UB3A 4OU1A 5A5WA 2V81A 3IV3A 4BI7A 1FCVA 2FDSA 4YCOA 1ZAIA 2A6NA 4AH7A 2Z6IA 3TA6A 3MMTA 3KVMA 3U2OA 1W5QA 1OFPA 1DORA 1DHPA 5C2XA 4RZ4A 2BTMA 1TTIA 4UMCA 4GUHA 1IGSA 2F84A 5FEZA 3T55A 1IXQA 3E12A 1EP1A 3C2VA 2GOUA 4XQ6A 5HWJA 3EX3A 3FJ6A 2ZCGA 2B7QA 4OBTA 1KTBA 3EXTA 2PRHA 2AGKA 1P5BA 1YXCA 5EY5A 4Z0SA 4IUOA 3ANYA 3GXTA 5IBXC 2ZZ1A 1PE1A 3O06A 1L6WA 1P4CA 5D2VA 5BMWA 5FEWA 4UTTA 1X1ZA 4GE8A 2Z1BA 1TPC1 2E68A 3GR8A 1GTHA 3UWWA 1YLVA 4UFJA 1YTKA 4K7YA 1JQVA 4WXZA 5SWUA 3S1VA 2VELA 4LVDA 4OGZA 2I1OA 2Y88A 3EB2A 4QM1A 4H6KA 4CNOA 4JY9A 2VOMA 2E6YA 1EWDA 3UWZA 4UTMA 3LCHA 2BSLA 5G2HA 4UCGA 5KTLA 3FS2A 3WK0A 1F05A 3E9AA 3PSVA 1VLIA 2FQIA 4WX2A 3B8DA 4QAIA 3P8JA 5TIMA 1ZALA 1VR6A 3T7VA 2A7RA 4MY9A 3KRUA 3W2LA 2OT0A 3RF9A 2VKZG 4IGHA 4N9BA 2CZ5A 3M7WA 1N8FA 3NQ7A 1LP6A 1QOPA 1QR7A 4YL2A 4NZFA 3PM6A 3TX9A 1UJPA 1OF8A 1ZENA 2CW6A 3QPYA 1P0KA 4ZQCA 1BKSA 3IIXA 1EUAA 2FB2A 1DJNA 3BW4A 1LRQA 5AN7A 1WBHA 2GUUA 3CWNA 3PVFA 4O52A 3QQ1A 1HUVA 1H51A 1VGAA 5AC6A 4GUIA 1QO5A 2WNNA 1JCJA 4UTWA 4WQ6A 5EKYA 7TIMA 1S5WA 4MY1A 5FEPA 4C1KA 3HQ1A 4UTUA 3EX1A 3GIYA 3IVTA 1QPNA 3MP5A 2J9YA 3ABOA 1WXJA 4AB4A 3O8AA 4JTKA 3TFCA 1F2JA 3A22A 3M1ZA 3G0UA 1G7VA 4BK9A 3LCIA 1QNVA 4LV9A 4UTIA 3LERA 5H91A 3TMLA 1WAUA 3L66A 2QAFA 2V82A 3EWZA 4MLRA 1EB3A 3EEGA 4Y90A 2H6RA 5TQLA 1W3TA 2QCDB 1PCKA 4ZQMA 4DF2A 3MBDA 5K2ZA 1O94A 3LBMA 4BI6A 3NQCA 3CM4A 1G67A 3U8GA 2YXGA 4GJ1A 1FWNA 3W7JA 4JTGA 3W7QA 2IQTA 1W5MA 4JY8A 2V5LA 2YFOA 4BWLA 3W23A 5KMYA 3W7EA 5TBOA 4AF0B 3LHVA 1OFEA 1TPUA 3QEZA 3TKFA 1YPIA 2A5HA 2A6LA 3BO9A 4MPQA 3SSJA 3C2FA 3BG5A 5AFDA 2DORA 1TQXA 1YXDA 2Q8LA 1OHLA 3FKKA 5CPLA 4DPPA 3NPWA 3HGJA 1W1ZA 4RXGA 5L6UA 1FUYA 5EPDA 2Y61A 4FHAA 4RCXA 5KZMA 2ZA3A 2EKCA 1SW3A 5LSMA 3FEMA 1LCOA 2I14A 2R94A 3M5XA 2V0TA 5CKSA 2XN1A 3WJSA 1JUEA 2XN0A 4CQ9A 5BOOA 1A53A 4X22A 2EF9A 4TIMA 1NEYA 2X30A 4O12A 4O11A 4JDBA 1LLWA 2X16A 1LOLA 1SZNA 4PFMA 3KRZA 2H8XA 2ZZ2A 3ABSA 3ABQA 1FY6A 1U83A 3CT7A 3WJXA 1H61A 3RFAA 5DCDA 1TO3A 4AF0A 1VQTA 2WNQA 4DEFA 4O1DA 3VE7A 4OT7A 4IMGA 1K8YA 2NLIA 1VHCA 3UPWA 1G4PA 5LZLA 3PC0A 4JYDA 1R2TA 3CB8A 1JVNA 1DJQA 3B05A 3LHTA 5D33A 2ABBA 1MXSA 3PS7A 1K8ZA 2QDGA 3QW4B 4DO6A 1MEWA 1L2UA 1WV2A 4KFOA 4G1KA 3C2EA 3FFSA 1KTNA 1WDWA 1TPWA 2P1FA 2ZRZA 3IGXA 1FWWA 4K7VA 4KKXA 3W7GA 3DKJA 2Y63A 3LV5A 3IIPA 3STGA 5D2WA 5I3FA 1W56A 1RD5A 1EUNA 3TQVA 2E09A 2GVGA 3W76A 4MVAA 1WX0A 2VXNA 4WY0F 4WY0A 4O16A 5MHBA 1TRIA 1NF7A 4CNNA 3GKFA 4L4MA 2D73A 4S1FA 3DGRA 3ZFHA 2YFNA 2QJGA 4O0KA 3GAKA 5G2IA 3M5ZA 1QDSA 2E77A 3F4WA 2QJIA 4MLJA 2AQWA 5FF0A 3TSMA 3DHFA 4HN4A 3FA5A 3SIZA 2ZDRA 3NQAA 1BWLA 1DVJA 2Y62A 3EXSA 5LKYA 4CCEA 2DZSA 1QPQA 1OFOA 3HG2A 2W6RA 2J9XA 1GG1A 3QMTA 3NQFA 1H7RA 3NOEA 1NVMA 3P82A 1BTMA 3DI0A 1VC4A 3O16A 3G0XA 1DOSA 2VFHA 5LNWA 3NG3A 3TIMA 3W2KA 1Z41A 1I2OA 3G3MA 3DAQA 3LXAA 1T96A 2YSWA 2ZRUA 3PBYA 1VH7A 2C1HA 4EOUA 3DHDA 1OVDA 3HGRA 3NM1A 4JTFA 1RV8A 4RJEA 3W88A 3EWBX 4LUIA 4NU7A 2R8WA 1LDCA 1XXXA 3UZ5A 3NQ8A 3TAOA 1KM3A 4BF9A 3NQ2A 5D2TA 1FDYA 1I2RA 2WNZA 4NX5A 4UFIA 5D37A 3EWWA 2A0NA 3UYCA 1PHWA 2G5WA 3HOJA 3KHJA 3N2XA 3I7QA 1KFKA 1VHNA 2C0AA 4I7WA 4XKYB 2GQ8A 4E38A 1H7WA 3NYZA 1W54A 1VCVA 3L0KA 3OA3A 4JTIA 2DZUA 3W7CA 3M6YA 4ZQPA 3S0CA 3HIJA 4O14A 5AHMA 3SECA 5K9CA 5F4WA 3NM3A 3N34A 4B5NA 3LHWA 3L0GA 1K3UA 1Q6OA 1SSGA 3UXDA 3QH2A 3PG8A 4LVBA 2GVLA 3NQGA 6ALDA 1KM5A 3W07A 3NL2A 4O10A 2H3DA 1UUMA 1JRCA 3AO0A 3C6CA 3GX9A 5J5RA 1OFBA 5I3JA 2ISSA 1SUXA 3L0NA 3MHGA 4Y6GA 2A21A 3NZRA 2CLFA 2WJZA 2YR1A 1KTCA 3G1HA 4UFHA 3WK3A 4LWWA 2HS6A 3OVPA 3P67A 4JTEA 1H1YA 2E6AA 3QW3A 3TC7A 1F6PA 2H3BA 3P5ZA 4ADUA 3MYPA 3IIVA 2ATMA 5L9FA 3JS3A 3W83A 5F4SA 5LHFA 1OYCA 4DBDA 3HMJG 2I9EA 1FXPA 4POCA 2CLLA 1JCLA 4JX4A 4FEZA 1I45A 4ZQOA 5GVJA 2J88A 4M5PA 3YPIA 1S5TA 1TCDA 4I9AA 5U4NA 3TC6A 5FEXA 3TK7A 3W70A 3TW7A 2NUYA 4N6EA 5G4WA 3W7IA 3L67A 2ZZ4A 5KZEA 1IXPA 3C2RA 4O1BA 3KRSA 1WYIA 1IF2A 1XL9A 2F7FA 4GUFA 3SY5A 4N9EA 1JJKA 3IRDA 1KM0A 4JNMA 4DELA 2A7NA 5E93A 2Y70A 3BV4A 3STEA 5G4EA 2VEMA 3PULA 1W37A 2EPHA 3LBCA 4JYFA 4QQ3A 4XBKA 1SO4A 3NQDA 3EWYA 3I65A 4NJIA 1FCQA 2C15A 1OX6A 2WPBA 3ZWTA 3W7MA 4WUIA 2QJHA 1ALDA 3FYPA 1QWGA 2QF7A 2YCEA 1TPVA 4A29A 5C55A 3LRMA 4JDYA 4DF0A 2OCZA 2Q3RA 4O0ZA 2VEKA 1X6UA 5AHNA 1OABA 3SR7A 3SFKA 3ELFA 4UC5A 3G1DA 1GOXA 2XFWA 4OHQA 4NJHA 4PODA 1KM2A 3RNDA 3W1MA 3BPWA 1GT8A 1Z48A 2Z0IA 1QAPA 5HWNA 4R34A 2G97A 3W6YA 4Q32A 1F5ZA 5AB3A 2FPVA 1A5BA 1YADA 4TO8A 4UR7A 1I8JA 3GYEA 1O4UA 4ONVA 4DPQA 3HG5A 1M7OA 4CLMA 3PUDA 4K8EA 3DENA 1VYPX 1SW7A 4FX6M 4FXRA 1ME7A 4MY8A 1GVFA 1H7NA 1PL9A 2VFIA 2NZLA 2V2DA 3EX6A 3EX4A 2EGZA 2WSQA 3LTPA 5I3GA 4LW7A 2CLOA 3GLCA 1IXOA 3WJWA 5D09A 3LOTA 5AYZA 4NUWA 3ATZA 3SGUA 2JKPA 2X2GA 5H2ZA 1JCNA 1ME8A 3W2MA 5HR6A 1F74A 5ABTA 4MZ1A 1YDVA 3HGOA 4UTTC 4JIQA 2UV8G 3LCWA 1H1ZA 1LBLA 4IMDA 1GTEA 2WO5A 2A2IA 3QMRA 2C16A 2BX7A 2Y89A 3KVKA 3B06A 4MFEA 3UWUA 1ZAHA 5D38A 1EX5A 1GVRA 3F1QA 1QO2A 3S9YA 3MYOA 3TDFA 2NXHA 4KWWA 1A5AA 3UY7A 1LZOA 3RLVA 2DZWA 3PB0A 2E6DA 3NGJA 3GNDA 1O95A 1M6JA 2GPTA 3MHUA 5CG7A 3QPZA 1XBYA 3G0SA 3W1QA 3VNDA 1H5YA 2H90A 3A9IA 3IEBA 1W5NA 3V75A 1OFDA 3S5OA 1P0NA 2WKJA 3GZ3A 1J2WA 4N02A 2XN2A 1Q6LA 1X7FA 3O6YX 4LS2A 3JR2A 1CI1A 1CX9A 5AHFA 5K3VA 5DCEA 3DZ1A 4LS1A 1N7KA 3DFSA 2CLIA 1GVSA 4RZ5A 1LYXA 3L5AA 1Z42A 4NNAA 3ZS4A 1D3HA 4O50A 4XWUA 3ABRA 2GJNA 4NJGA 1B57A 1W31A 4QJ1A 5FF4A 4DXVA 1K7XA 1A5SA 1RZMA 3B03A 3G3DA 4I7UA 3KVJA 3W71A 2NX3A 3HGSA 3A5VA 2ZRWA 2E1DA 4UTWC 1C29A 1R2SA 3OVRA 4N4PA 3NQ6A 2KZHA 4UR8A 3LXCA 2AAMA 1LBMA 4UNKA 1W0MA 1MZHA 3QMSA 4ML9A 3RLUA 3TNOA 1R2RA 1W3NA 5K9DA 2E5CA 5HUOA 1THFD 5T26A 4RX0A 1TJRA 3PWAA 5LNSA 2B7PA 3IGUA 4N6FA 4JTJA 2FFCA 5F2LA 1SU5A 4RV8A 4IXHA 3O1NA 3D0CA 5G5IA 1UBSA 2QCHA 3LGEA 1T99A 3Q37A 4E2DA 4JS3A 3IIOA 5EL1A 4R7JA 4CCCA 1EP2A 3FYOA 3R12A 4OWGA 2HTMA 4EF8A 2HSAA 4D2JA 3W75A 3LM7A 3W2UA 3PG9A 4FO4A 4JYEA 1N55A 4RR4A 2GQAA 2J24A 4O4VA 5F4XA 4PEKA 3W22A 2TPSA 4OV4A 4YWIA 4O53A 1A5CA 5K7JA 3SI9A 2RFGA 3WK1A 5HWMA 3LI0A 3P81A 3NO5A 3NVTA 1BEUA 3S8HA 3DBPA 3HF3A 2NX1A 3N73A 3G1SA 1HTIA 2QCDA 3GK0A 2ATSA 4U4MA 4Q33A 4RLIA 1Y0EA 4GRSA 2CZFA 4HPJA 3NL6A 3NPUA 5DBUA 5G1TA 3OEXA 4Z1BA 1W5OA 3BVJA 4JIPA 4JTLA 3L5LA 4M6VA 1TIMA 2BWGA 2FLIA 1M5WA 3W3OA 2LLEA 2FTPA 1ICQA 3DU0A 3W2NA 2VC6A 1Q3NA 3USBA 5HQEA 4FNUA 4ORMA 4AVFA 3TUUA 3LLDA 5BRBA 3DFNA 2EHHA 5A8GA 3TJXA 3EX2A 1TTQA 3NL5A 1PIIA 3LLFA 3STFA 5AHIA 3TXVA 4C1LA 1JCXA 3LTSA 2YPIA 1JRBA 1FBAA 1WOBA 3LHYA 3P74A 3MHFA 1FQ0A 3KOFA 3MI2A 4O4WA 1GZGA 3VKJA 3NDOA 3TXZA 2VFDA 3I7RA 5CZJA 2TYSA 2VEPA 1QFEA 4IX0A 2R14A 4A3UA 3FJLA 4Z1DA 1K02A 5HR7A 3AJXA 3BGJA 4N9CA 3VCRA 2QDHA 2YW4A 5F2MA 1OFAA 4JICA 3DKLA 5CSSA 1TJPA 4Y9AA 2O7QA 5D03A 4Z1CA 4IQLA 2J6XA 2ZZ5A 1VLWA 1EEPA 5HNRA 3SW6A 3LCLA 4ALDA 3MP3A 5CSRA 1EA0A 3W1AA 2GVJA 5D04C 3MBFA 5C6MA 4U28A 4BFAA 3OIXA 4L4LA 4TU1A 3TE9A 3BGGA 1OK4A 3FLUA 1DQXA
chains in the Genus database with same CATH superfamily
2QF8A 3T2QA 4NNBA 1PIFA 2V2CA 2INZA 3U5UA 1EJVC 4YU1A 4FA3A 5LNVA 5HUPA 2OOFA 4TR9A 4AD2A 4GQBA 4ADSA 4DYKA 3H2AA 2YYTA 1EBGA 2R91A 4HN8A 3OHMB 1JPDX 1JYWA 4Y9MA 1G4TA 2D69A 4W4QA 3UZZA 1AL7A 2FPYA 3NPXA 2XIOA 2VZSA 4K8HA 5LGXA 2CBIA 4A22A 2QCEA 2PURA 3CUFA 4IG2A 1F3TA 3M41A 3W1NA 1W1B1 2WV8A 3RITA 2WNWA 4XD3A 2XM1A 1B0IA 3P5YA 4MOZA 4LY4A 3S6DA 3KFTA 4CD4A 5DXXA 4DO5A 3EB3A 1KFJA 1TG7A 2ZBTA 3RHGA 4F0KA 1RP9A 3BMXA 3II1A 5DQPA 4A6GA 3L9CA 2I7GA 2FFIA 3M9YA 4HOZA 3W24A 3AS2A 2ZXAA 3LDVA 4LU0A 4PCPA 2J13A 4IL0A 4RPPA 2DVXA 4XZLX 1J5SA 1KQZA 2PGRA 1RA0A 4LB4A 3S6TA 4H04A 4IWWA 1LLZA 5BU6A 1CLVA 3K2GA 1QOQA 3C0JA 5DELA 3CIVA 1E73M 3BAJA 2V3EA 1NU5A 2X1UA 3ZO9A 4PMZA 1UUOA 4BQ5A 2PODA 5GNXA 2G50A 4BZYA 3AQUA 4DVOA 3URQA 1U33A 3JRKA 4PCNA 4WJEA 4QIUA 5A6KA 3CHVA 2C91A 2P0IA 4O8RA 1T6MA 1QNRA 3TN5A 1V51A 3DH7A 1LLOA 2WZIA 4Y2WA 4HTBA 3WLOA 2OFJA 2Z00A 4M8UA 4YHGA 1V77A 3HTWA 2ICSA 3VDHA 1E43A 5BNKA 3VNKA 2PRMA 1QWKA 3T8QA 4CNPA 1GOIA 3GAYA 4IPNB 1OJXA 4INFA 2HPMA 1ZHAA 2IKIA 3FCPA 4I7VA 6PTDA 8RUCA 1KM4A 2B0MA 1TJ1A 4ZOAA 4Q4RA 4ZB0A 3UT0A 1NOWA 4PH6A 1R3SA 1V6VA 2WZHA 1B31A 3W81A 3LZ5A 4FIRA 5AHLA 4CQDA 3E02A 1XYZA 2Q8ZA 4NXSA 1GWJA 2J9ZA 1C8VA 3NVDA 4LC8A 3ID7A 3PY2A 4NSBA 1B3ZA 4JN6A 4R88A 4ZBCA 3OG3A 3VM7A 3ZR5A 1KD0A 1MW2A 3N6HA 3SO7A 3THQA 1XLLA 4Y9PA 2PEVA 4CCDA 3KEHA 5EA9A 2WAGA 2YA1A 5GJNA 4AU0A 2CWNA 3W37A 1LUCB 1UWTA 1K03A 1XX1A 1PX3A 3W53A 4LFYA 1QW9A 4QXIA 5CPOA 1A5OC 5FESA 3KL0A 1XIFA 2WMIB 4KFNA 2OWWA 3LGGA 3I6RA 4ML4A 3MW7A 5HJYA 2FB3A 3PJXA 2G3MA 4RZ6A 1OX4B 4YMZA 3VU2A 3RLHA 2IPJA 3F2CA 3TH6A 3V3WA 1OADA 3WLLA 1UR9A 1YRRA 4JX6A 4FB7A 1LJYA 3SB0A 3B0UX 4HHMA 4B5WA 1KC7A 2C14A 2VCCA 1Z7AA 4AXKA 1EWEA 3C0QA 4FP1A 2PDPA 1ZY9A 2DIJA 3H70A 4UFMA 1ONRA 1XG3A 3M5VA 3I3BA 2WMIA 4E8DA 4W9TA 1UOZA 1V0KA 4EWND 3PBUA 2QDDA 4IIBA 3B8UA 2E25A 4N4QA 3GNNA 5C9XA 3P60A 4HPNA 1OX4A 1Z3NA 3T4CA 3GXPA 4Z0JA 1Q6RA 2RDTA 1GJWA 1K8XA 1D3GA 4X0NA 4ADTA 3MWAA 1AQHA 1ZNNA 1ZSXA 1BXNA 3CBWA 1HQTA 4C6KA 1E15A 1VJIA 4HZMA 2J8FA 8XIAA 1OCBA 1XBZA 1EYWA 3L4ZA 3TWBA 4H6QA 3I6EA 1J01A 4O15A 3V5FA 1CIUA 1W5PA 2WCGA 2PTWA 4IZGA 3Q94A 1SW0A 2CFFA 1M7PA 4H9ZA 1NM9A 1XRFA 2AMGA 4GWEA 5BWFA 4YVPA 3CYVA 1PCWA 3ZR4A 2GOKA 1YPFA 5F2GA 1XCXA 3H6OA 1LRTA 1W9DM 2VFFA 3C86A 1GQNA 3SRDA 4TUFA 1R9ZA 4PYSA 1S1RA 4WCJA 4NG3A 1EXBA 1GVQA 1UH3A 3HBLA 3KRBA 3PUOA 1KCLA 4UR9A 3W7RA 1FWRA 4W85A 4EAYA 1MO0A 4QFUA 3QOKA 3CH0A 1V3HA 4JTSA 5FF2A 3ONBA 4QEHA 1KRMA 1IIHA 2ZYFA 5HNNA 3GTIA 1S39A 4JQ1A 4XKMA 1E0UA 2OGJA 1CPUA 5F1VA 5CGTA 4DZIA 3S2MA 1FWEC 1VFFA 1VIWA 3UWYA 5DN1A 1OX5A 2DUXA 1W17A 1XUZA 2WCAA 3I4EA 3BAWA 4IMAA 4AYGA 4NRSA 1AZ2A 3S1WA 3BZGA 4XB3A 5U7SA 1R0MA 2HPIA 4J5NA 1TSIA 4HPXA 4DAIA 3RRXA 3TCEA 1XLHA 1LQ2A 2Z29A 1TA3B 1DJXA 3SRKA 1K1DA 5FJPA 1V02A 4GISA 1VBJA 1DTUA 3RX3A 1PSCA 4TVDA 1QUMA 3EKGA 5JH2A 2YDRA 3GTXA 2IQ0A 1HX0A 4XZBA 1WQ5A 2REQB 4A21A 1ELSA 1EPXA 3S6OA 1UR3M 3TR2A 2WZMA 5FJRA 3FEQA 1EDQA 2G3IA 2GGIA 4HYVA 4AZGA 4UFKA 2EG6A 1HO1A 4XIAA 8CGTA 2QUTA 3GHUA 3VDCA 4WGXA 2VD8A 4HPHA 2V5DA 4WY0B 2XH4A 4EF9A 1MW3A 3DFQA 5DXYA 4JFUA 3H55A 5D2XA 2QR6A 3P6LA 1LM1A 3WENA 3QTPA 4JNZA 3CWOX 4LV4A 4XTIA 2DJXA 4Y9NA 3U6WA 4HIBA 1HKIA 3WLNA 4S38A 3AYVA 2OLSA 4AY1A 2XIMA 1QI4A 1BG4A 3ZWSA 1MFUA 4Z08A 3B9DA 5CPTA 3CJPA 1TVNA 4H01A 5KSWA 4FOKA 1VYRA 1XF0A 3AZRA 4GZJA 3O6CA 1SQ7A 4JQ4A 3PR2A 5I3DA 3VXGA 3LSBA 3AI0A 1QMLA 5A6SA 1OIMA 4MKNA 4Q4KA 3DFPA 2QAPA 2ZUUA 4AWEA 3BAKA 3TYEA 2OZ0A 4O18A 3C8FA 3LS9A 4C5YA 2VDGA 4QG8A 3IPWA 3SY8A 4JTUA 3H8AA 1XV8A 2INEA 2GVEA 3H53A 1R9YA 3MSRA 3B8WA 1XSJA 4OZOA 1MUCA 4FNTA 3R5EA 3FKRA 3MI3A 3W7PA 4DYJA 3V1PA 3DYOA 1DWGM 2WC7A 3NNTA 3WQCA 1F76A 5IHSA 4PTXA 3ZSTA 3UNTA 1GVOA 1TB3A 1PV8A 3WK2A 3EB4A 2QULA 4Y8FA 2CIPA 2PLMA 3PAJA 4FF7A 1A5LC 1M9HA 3I10A 3UQNA 2Z25A 2CLKA 4ATDA 4H4IA 5CPQA 1J93A 1KW1A 4GVGA 4U5IA 3GG0A 1XIMA 2H9AB 1RVGA 3NZGA 2J6VA 1IIGA 4QG6A 3PPHA 1KCXA 3BAXA 4X9SA 2Y0FA 2JQXA 4IX2A 1IWAA 1GW1A 2F6KA 4ZVJA 3N11A 2L5HA 2OTDA 3DIPA 2VFGA 4JFWA 3QSRA 1WZMA 3R7MA 2IXVA 4XD5A 1W1IE 1UD3A 1RH9A 1YDNA 4BF5A 1TFVA 4HA1A 1C9WA 1E6PA 1DJZA 1G4SA 4DHGA 1P0BA 5HANA 3AXKA 1BRLA 4K68A 3TLQA 4HNTA 1RJRA 3CC1A 3WDRA 3QQWA 4R5EA 3RM4A 2WQPA 3BK0A 2WWCA 2H9AA 5KZDA 3BWWA 4F40A 2NV9A 1UD8A 4QP0A 2HK0A 4HSNA 4OECA 3INPA 4FR6A 1UKQA 1CXLA 2BOEX 4PUKA 3RN6A 3BV7A 3W2JA 4QLLA 3OVQA 2NQLA 4NL1A 1XYFA 3FJ4A 4C6OA 5BCAA 5I7GA 2Z2UA 4W7WA 4MZ8A 2FTYA 1DXIA 2V8ZA 1LTDA 1QHPA 2JEPA 1R3WA 1U30A 3E3HA 3HO8A 1KFCA 2R1NA 1T0OA 1XDJA 2Y7GA 1XBVA 3AYRA 3MDUA 3CAQA 2VEIA 3S47A 2VR4A 3E96A 1SFLA 3LB0A 1M3UA 1T8XA 2O55A 1FWGC 2ZTJA 4EIVA 3L4UA 2KAUC 4M7SA 1ZTVA 4F0SA 5EFDA 2NWRA 2ZZ6A 4AY8A 4MWAC 4GBUA 1KFLA 4L61A 3C2YA 4HNUA 4O28A 3W0KA 3F5LA 1NFPA 2FZ9A 1XYMA 4AD3A 2Y7DA 3A23A 3FSUA 3T0BA 3HPZA 3EBVA 1VBHA 4LNCA 1E0TA 4F0RA 1IXNA 3PSWA 1QHOA 2DJLA 4NNCA 3B8SA 4O1CA 3LCFA 3UR2A 1WBJA 2VGBA 1R7OA 3WD4A 1GKRA 1WDPA 3T4WA 1JFXA 4R9OA 1DJYA 3AHXA 4HNVA 1VCGA 4GFSA 4UXDA 3NDYA 3GR4A 1E6SM 3CMJA 2VM8A 4C7DA 1PZ3A 3N9SA 3PB2A 3F4DA 5DMNA 3HPXA 4GO8A 1WAWA 2VI0A 3IV3A 2POTA 4D8LA 1ZAIA 4ZCWA 3KZPA 2W5FA 4HA0A 1DHPA 5KZ6A 4AEEA 1ZB5A 5C2XA 3SURA 1TTIA 2GLKA 3B8TA 3E74A 3M0KA 3HFYA 1RBOB 4GUHA 1IGSA 1UH4A 3WLIA 2F84A 2F9RA 1F07A 3A64A 4M80A 1D2KA 2GOUA 1I1WA 2B7QA 1EKOA 4JQ3A 2YA0A 2QS8A 4BEUA 1UYQA 2BASA 2ZZ1A 1PE1A 3K4AA 4GABA 4F0LA 1X1ZA 3TJ4A 2ZUSA 4WHBA 4ZXLA 1UOKA 2E68A 1GTHA 2W92A 3PPCA 3ZLGA 4QX4A 4D72A 3B9OA 1EX1A 4C6BA 2I1OA 2Y88A 3EB2A 4QM1A 1GNXA 2PGWA 2HVOA 2VOMA 1HJXA 3VAVA 5G2HA 5KTLA 1QNOA 2BP1A 2XSAA 3DC0A 4GH1A 4XX6A 1DJGA 5XIAA 4PUWA 1GUVA 4JIIX 1RBLA 3P8JA 4KEZA 1GKQA 2A7RA 4MY9A 1WZLA 5AZ0A 3U2EA 3L2MA 4PTDA 3RF9A 4IGHA 3PJTA 3NQ7A 4B9YA 3OZPA 5I5RA 2YXOA 3CQKA 4YL2A 3TX9A 1Q65A 1UJPA 5AY7A 5HA7A 3S2NA 1OF8A 3WBWA 2CW6A 3DC8A 3QPYA 5FAJA 1P0KA 4PN2A 4GBDA 1EUAA 4REQB 1F3EA 5LXEA 3CWNA 4B5XA 3FV9A 3GYCA 3H21A 3QQ1A 2D1ZA 3RR4A 3URBA 4UTWA 5EKYA 7TIMA 4YVVA 4J3VA 3IS4A 3HQ1A 3GIYA 3TZNA 1EZ2A 1BF2A 3GHRA 4R7WA 4GD0A 4D6HA 1WXJA 4AB4A 3O8AA 3IJ6A 2YBVA 3TFCA 3ITYA 4LAZA 1HT6A 4BK9A 1J0KA 4V2XA 2QAFA 1WCGA 1UMYA 2V82A 3THCA 4JIHA 4KEUA 3EWZA 1EB3A 1IE7C 3P93A 2YL9A 4Y90A 3MB9A 1W3TA 3DGBA 4KCTA 3TTSA 5I79A 3KZSA 4AVOA 3TONA 2QGHA 4REQA 3XIMA 4JY8A 3N2BA 2YFOA 3ZT7A 3W7EA 1XLAA 2IKGA 3AC0A 3PZGA 3EEZA 3PFRA 1EBHA 4JHOA 2VVNA 2J79A 3DG3A 3SSJA 3BG5A 2PWUA 2VZTA 4GYPA 2Z1KA 1OHLA 1UQZA 3AIBA 5CPLA 9XIMA 5L6UA 5HAOA 1QPKA 4RCXA 5KZMA 3CUZA 2JF7A 1SW3A 5LSMA 2V38A 1XKJA 3CQJA 3ANUA 1JUEA 2XN0A 1LQ0A 1FH8A 2EF9A 1P0DA 4O11A 4JDBA 1V8EA 4UNIA 1LOLA 3SRFA 1MRAA 1NARA 3K13A 3OLIA 1UW9A 2H8XA 3TN6A 1FHUA 3WJXA 3RFAA 4TXEA 5DCDA 4PUEA 4I8YA 1WDQA 4LANA 4DEFA 3H4GA 3NJ3A 2CWXA 3UZYA 5TAOA 1VHCA 3UPWA 5LZLA 2CKRA 1ESWA 3CB8A 1ISXA 4PB4A 4UZUA 4XAZA 2QDGA 3AIWA 5LIUX 4DO6A 1W9VA 4GJJA 2I56A 1WV2A 4AD1A 1KTNA 2DT2A 2P1FA 1VB9A 2D0GA 2EXOA 2W63A 2XWEA 5C70A 2BVYA 2Z27A 4NASA 1XSIA 3IIPA 4S3AA 4NZCA 2HXUA 1RD5A 1EUNA 1OC7A 4OOUA 4W8LA 1WX0A 2NT0A 5A6BD 3WF3A 1TRIA 4DM2A 3FHAA 2D73A 4S1FA 2YFNA 1Q2RA 1QDSA 1QXLA 2MNRA 1MQRA 4CN4A 1J0HA 3P0WA 2B81A 2Q8XA 2TAAA 3TSMA 3DHFA 3VZXA 2V68A 1DVJA 2Y62A 5FA5A 2PWGA 4CCEA 1UR1A 1POKA 1QI3A 3NOEA 3GU1A 4DWSD 1NVMA 4ZO7A 1VC4A 3GBEA 1S3TC 2HISA 1DOSA 3FJNA 3NG3A 3TIMA 3WBAA 1I2OA 1A3HA 1V6YA 3VINA 3PBYA 1JEZA 1VH7A 2C1HA 1N8IA 4L1WA 3UGVA 3R79A 1OVDA 1YNQA 4LQ1A 1YQ2A 2VEFA 3HGRA 3NM1A 4JTFA 4GCXA 3OG2A 2WM1A 4LAMA 2BY0A 4B92A 1YPXA 3HFTA 2OXNA 4C6FA 4ZENA 4DB7A 4FOJA 3B97A 1F6YA 4PFHA 2O56A 3QOMA 2GK1B 3NQ2A 1FDYA 1R9XA 3GH7A 1GW9A 3EWWA 2G5WA 3V36A 1MFVA 3I7QA 1KFKA 4I7WA 2C0AA 4XKYB 4KETA 2J7BA 1J9YA 4HMNA 1VCVA 1ONEA 5AC4A 4U31A 2XDFA 4AXNA 1HKKA 1DWFM 4QCFA 1F4HA 1PZ0A 4YS1A 1PBGA 4QDWA 3VX1A 3UXDA 3Q67A 3PG8A 1WKFA 2GVLA 1KB3A 3HQPA 1K6WA 1OGGA 5DMYA 3NL2A 4O10A 2G0WA 1UUMA 2GK1A 3ARYA 2ANUA 3N6QA 2VJXA 3ZVHB 4ERGA 4XVDA 4G9PA 4FS9A 4Y6GA 2Z1SA 1KTCA 2PF0A 2HS6A 4NIRA 4JTEA 5JH1A 3GNPA 3WQ6A 4UQ9A 1F6PA 1V6UA 5A2AA 3KTXA 2OO0A 4NZ1A 2ZXDA 2X7WA 1R6WA 5L9FA 4RV3A 1NJJA 3XINA 4MWAB 1OYCA 3HMJG 3W28A 1FXPA 1JCLA 4JX4A 1I45A 3RR1A 4M5PA 1S5TA 3GG1A 1TCDA 4I9AA 1OZMA 4DJFC 4UQEA 2E40A 4EACA 1ONWA 3ZVHA 5LA2A 3GXFA 3QR3A 3PANA 5A95A 2BGSA 3SY5A 1K9TA 4UQBA 4GOAA 4ZOEA 2A7NA 5E93A 2Y70A 4N0RA 4CNTA 1ISYA 3M0YA 5G4EA 1J8VA 3PULA 1W37A 3MUAA 1ODZA 6A3HA 3NQDA 3I65A 1WP6A 4B5TA 1OX6A 2WPBA 4DJDC 2FZBA 4J7RA 3SCSA 1JZ7A 4EANA 2WMHA 3LMZA 1QATA 2YCEA 5C55A 3LRMA 1RA5A 4DM1A 5ABFB 1IT0A 2Q3RA 4V33A 4O0ZA 1US3A 3TEVA 3GTHA 1X6UA 3DYMA 3NSMA 5FD0A 4D6IA 1SR0A 3SFKA 3GO2A 1GOXA 2C0HA 4PODA 4J2PA 4KWOA 2YL8A 4R34A 2FDMA 3MANA 4D1IA 4Q32A 1F5ZA 2VCBA 3H2FA 2FPVA 7A3HA 3B9AA 1TX2A 3RU8X 3K46A 1A3WA 2POZA 3GYEA 3BUVA 3ARSA 3HG5A 1M7OA 1K4GA 3I3EA 3ZM8A 4FXRA 1ME7A 3KOWA 4MY8A 1GVFA 3F7JA 1LG1A 3CZKA 4B4HA 4ACZA 4CVUA 2PDNA 4HGXA 5ABFA 4MJ4A 3D6NA 4H8HA 4KRUA 5I3GA 4LW7A 1A3XA 2P53A 4NUWA 3PBGA 2PTXA 5H2ZA 5CC5A 1Q7ZA 5HR6A 2PTDA 4UTTC 3GH5A 4XG1A 1FH9A 5D8ZA 3LCWA 1LBLA 3VIIA 3B06A 3UWUA 3WLQA 1XIBA 3S9YA 3MYOA 4LBRA 1B90A 3UY7A 1FWCC 3RLVA 3QVQA 3NGJA 2GPTA 1Z32X 4KMQA 4TTGA 2XINA 3QPZA 1ZJBA 3A9IA 4MPKA 1CCWB 1VBGA 2DIKA 1OFDA 4H00A 3WEZA 3GDBA 3AMLA 1V7AA 1R85A 5BOEA 1UMLA 1DIKA 4DJED 5FCZA 4W89A 5K3VA 4LS1A 1N7KA 1AODA 2CLIA 3MMDA 5DANA 3KCLA 4XWUA 3S9ZA 2PU0A 4NJGA 1W31A 1UIPA 3W02A 3ZJ8A 4QJ1A 1EJ7L 3BLLA 4AZ7A 3ARRA 1VKFA 3WH9A 1A5SA 3KVJA 3H2NA 2E1DA 3RLGA 1C29A 1R2SA 4N4PA 3NQ6A 4LYRA 3DN5A 3CUIA 3S2LA 1LBMA 5AZ1A 3QMSA 2J78A 2WLZA 3WLSA 5HUOA 3VOFA 5T26A 4RX0A 5LNSA 2B7PA 3SCWA 3VA8A 5A8PA 3O1NA 3D0CA 2QCHA 4HJWA 4E2DA 5EL1A 2FHCA 3FYOA 4OWGA 5BOFA 2HTMA 1H4PA 2Y1HA 4CD5A 1S1PA 4D2JA 1PJ9A 2VURA 3LM7A 4H41A 3A12A 3PG9A 4OTKA 1J18A 5LIYX 2UY3A 4H8VA 4PEKA 3AXIA 2ZVRA 3C5QA 2QPUA 2DSVA 4HYRA 3WK1A 1RUSA 3NO5A 4L56A 1BEUA 3KBSA 1RCQA 3DBPA 1ZJAA 1YHTA 3TN4A 2ATSA 4S3FA 4Q33A 1Y0EA 4AQLA 4NILA 3NPUA 4PE8A 4XAFA 1BGGA 2Z4GA 2VEGA 3BVJA 1CGXA 2GJXB 4JIPA 3NTYA 4M6VA 4WJ8A 3AWNA 3B9NA 3PNZA 3PZIA 2VC6A 2PBOA 3FSTA 4DBWA 4FNUA 3WMLA 5BRBA 3DFNA 2EHHA 1VJZA 5A8GA 3SCOA 4XD4A 5AHIA 3TXVA 1JCXA 4Z2KA 2YPIA 3LHYA 2F8QA 1WKDA 5TD4A 1KCKA 3P74A 2W67A 4C1NA 2O9RA 3H7UA 4O4WA 1V08A 3NDOA 2VFDA 3I7RA 5CZJA 1YBQB 1JL8A 1YMYA 1P6BA 2TYSA 3MS8A 1DJHA 1SJCA 1XIHA 4HJFA 4H9VA 3AHYA 4HCDA 1CWYA 2INFA 3FJLA 1WKYA 4GXWA 2GJXA 4BA0A 1IEIA 4LPCA 3WBEA 4IIFA 4QTGA 3T09A 1Y5VA 2QDHA 4KWUA 4DXXA 5F2MA 1OFAA 4JICA 4C6LA 3EA2A 4P8UA 3QV8A 4Z1CA 4A3QA 4IQLA 2J6XA 2ZZ5A 2PDUA 1VLWA 5HNRA 3RXZA 1XIGA 3V0SA 3MP3A 4TQTA 4M51A 3MBFA 1BF6A 1MQQA 1ZGDA 4Z17A 3DG7A 3N9KA 4BFAA 4W5ZA 2UBPC 3BGGA 1DQXA 4XZIA 5DT5A 1QTWA 3R13A 5FIPA 4P61A 2CBVA 3N3MA 3VVGA 4S23A 5D9MA 3R4IA 1KBLA 1VZWA 1UPPA 1O60A 3PZNA 2ADAA 1CXFA 5LHEA 4L80A 5ABEA 2O0TA 5CAKA 3LYEA 3H23A 4TMBA 3MWCA 1ITCA 1XLJA 4MSSA 2NLYA 3MV01 2CZDA 2Y85A 3V5CA 1M53A 3ZR6A 3E49A 1UD4A 1ADOA 3W87A 3JZUA 4YNGA 2CLHA 4S39A 4PMDA 4HHPA 5LNUA 4M82A 1EPVA 1EJTC 2V30A 3A47A 1FCBA 4D6CA 3BTNA 3UBPC 4C6CA 3N14A 3OBAA 2DT1A 4F8XA 4WKHA 1A4LA 3E5PA 4H9XA 4JHMA 2V9DA 3W7LA 3ITLA 3AAMA 1KGXA 3UD6A 1YDOA 5LA0A 4LUTB 3ME3A 3G1AA 4GCAA 2YX0A 4F3HA 4FK9A 4QAWA 3DECA 1TYGA 1MEIA 3FDGA 3EYPA 1SZFA 1OYAA 3U0HA 1W1TA 1W1PA 4X63A 3MUY1 2X8RA 1CDGA 1ITQA 1RBAA 4NT0A 4L6OA 1FHDA 5BXTA 1JXJA 1PTDA 1EXPA 3UU0A 5FI8A 3GFZA 4GI4A 3VMOA 4BKNA 2VT0A 3NO1A 2W0UA 1C93A 3VKBA 4JR5A 1BHGA 4DYEA 1G69A 4IOTA 2V6AA 2VUYA 1KXHA 4UB9A 2QPXA 2YW3A 4PTVA 3STCA 2EBNA 1LROA 2NVCA 3T07A 4KGJA 1W3HA 2VCAA 4LUTA 5BMXA 4IISA 1XLCA 4OVXA 1UKOA 5C7HA 5B7ZA 1PB0A 1IZCA 1TV4A 1JCYA 2EAWA 1SZGA 3T0CA 2BHYA 2ZA1A 1XGEA 1ICPA 2VNCA 3I6TA 2JALA 2WHMA 3F4NA 3FAWA 3CTLA 4ZZ9A 2GQ3A 3AHZA 5A6MA 4LB3A 3WF1A 3WLKX 2W61A 3B04A 1HJWA 3FIGA 3LI1A 1F8IA 4XBJA 4BEQA 1NFGA 1TUFA 4DJFA 2VUNA 4GG9A 3WNLA 5ABHA 2PUZA 1B2YA 2GGHA 3GW0A 4F0HA 3W7DA 5CPSA 4ACYA 3CIXA 1BKHA 3AU2A 4I9TA 2ZZ7A 3QGKC 4QLKA 3APTA 3EMCA 3LCXA 1XFCA 4S2CA 4C6NA 4LRSA 3TSBA 3GE7A 2PAJA 1FHVA 5CZTA 3I4KA 2GGJA 3VE9A 1HKWA 2WC4A 3PK7A 4TX6A 2P0OA 1ZRQA 4KWVA 3BAYA 2XH2A 1CTNA 4QDMA 2DZXA 4MG4A 3MJYA 2I16A 2ZC1A 5BRQA 1F73A 3P61A 3WD1A 3LV6A 1DBTA 4MJ2A 5HMEA 4JEQA 5GNYA 3NIYA 2Z1WA 2YLAA 1YDYA 3EKZA 1I4NA 3FNDA 5F1UA 3WNNA 1ISZA 1ZCCA 3QYQA 3GKAA 4XSMA 1AJZA 4TX8A 3BG3A 2GJPA 5A8MA 3W73A 1UP3A 3MI6A 4FLRA 4IMCA 1HW6A 5A94A 4JTQA 1A47A 4B16A 4EXAA 3R89A 2NQHA 2W4XA 1A5KC 3KAOA 1SJAA 2J7HA 1BYDA 3KHDA 3LXBA 1L0PA 2WOQA 4DBUA 4LVAA 4CEXC 3FXYA 3PTKA 1M41A 4B4FA 1QOXA 4X3ZA 3TZFA 5GPRA 2G96A 4Y8EA 1BQCA 1OG0A 2ZIDA 1QT1A 2NUWA 1YW1A 5I07A 1XPGA 4G7FA 1N82A 3WDHA 3Q2DA 2BGNE 2WJFA 1OF6A 1XW8A 3RK8A 1IWPA 1TMHA 3V7PA 4QR6A 2A4AA 1KFWA 4M6PA 4I5UA 4FZIA 4JCMA 4C5ZA 1GQIA 3U7VA 4A8NA 4E4UA 2QCLA 1AD1A 1XBXA 2D23A 2OEMA 5HQLA 2ZXQA 2R1PA 3P0XA 3OBEA 5FKYA 4KRZA 3GVGA 1E4NA 1G0CA 3S5SA 4DNHA 2QVNA 4JTHA 5FSDC 4HMEA 4Q7BA 1DE5A 4F4RA 4DN1A 3TSDA 4JTAA 2FVMA 1T7LA 1TZ7A 2OYMA 1J4EA 1DKWA 2QCCA 3PAOA 3D46A 3L12A 1HF6A 3MZ2A 4IHCA 2Z1XA 1EJUC 4RNHA 3RU6A 1XISA 1PAMA 4C90A 2XM2A 2PDCA 3WYZA 2OODA 2F2KA 4PCTA 4YIWA 3VIKA 2CESA 5CPMA 1VPQA 1DV7A 1ME9A 1B4EA 1PKMA 4GACA 1GEQA 3TR9A 4A2RA 5CSYA 1UA7A 4N42A 5H8UA 4P7OA 3ENLA 4MGGA 1I2PA 4RE0A 5EMJA 3E6EA 4PL1A 1VFLA 4KIEA 3AIQA 3K30A 3UPBA 3DBNA 4JD4A 1WB0A 2VQUA 4GI8A 4DZHA 4YTRA 1OCNA 3M0ZA 3DI1A 4XV0A 3VOCA 3ARUA 1UD6A 2VVSA 2QCGA 3A5FA 2XGIA 3QJAA 1MWOA 1B3OA 1DXFA 3AMKA 3G1XA 4JQ2A 1H60A 4XTDA 1FWBC 1LORA 1F3XA 1QCWA 2Z1VA 3P84A 3B4UA 1D8WA 5KETA 1ZBKA 4BQ2A 3CL7A 1UP0A 3UYIA 1QPOA 4I5RA 1ZLPA 4ECLA 3GSMA 3SN4A 4GVIA 4H8UA 3N9RA 3DFTA 2ZX6A 2VRJA 4ZOBA 4I9MA 5CLWA 2V5CA 3R6IA 3SDOA 3QHOA 5E0KA 3BURA 3C52A 4GC3A 3UVIA 1OEPA 4O13A 2OQHA 1LL4A 2WMGA 4HU8A 2OT1A 4DO7A 1JXKA 2OZTA 3IAPA 4J28A 4PTNA 4NYYA 3UZJA 1TTPA 4E3TA 1YX1A 5H6HA 4AHOA 5LNRA 4YN5A 1NFBA 3L21A 3U3HA 4XVEA 4KH2A 2PE4A 2Q02A 3A4AA 4R53A 3QTGA 4ZO6A 3S5ZA 4IFKB 4DXKA 1AJ2A 1XC4A 2DSZA 1SFTA 4Q8TA 3CZJA 3VCNA 4JPGA 4HK5A 3ZXWA 2FPTA 1E5JA 3OIHA 5C9WA 2CBUA 1EIBA 3VNMA 3T2PA 3W9ZA 1FWTA 4CQ8A 2E8ZA 4UTLA 1LOSA 1FXQA 4DZAA 4LYPA 2IW0A 3OPSA 4J4KA 3SCQA 5DY2A 5I00A 4AC1X 4LUYA 1L6SA 3T08A 1YE4A 1EGMA 1SVDA 2WC3A 1L8NA 1CT5A 1AW2A 1CNVA 4O54A 5BWAA 4RW3A 3B9EA 3G8EA 2H8ZA 5HXMA 4IFKA 3S1XA 2HBVA 2QGYA 3M47A 4H7VA 1Q6EA 1G4EA 4Q8MA 4LAKA 5T91A 3NEVA 3Q45A 5DO8A 2FZMA 6TIMA 1H3GA 1HJSA 3TQKA 2QHAA 1KRAC 3AZSA 4E0CA 1Q7MA 2DW6A 4RDYA 3UR8A 3NXLA 3LX9A 2WKLA 5E0FA 4FXFA 4IGMA 2NV2A 3THAA 1TTJA 8TIMA 2QNEA 1RCXB 4HYWA 9CGTA 1EJWC 4UTKA 2C3ZA 4CGTA 4UUIA 2XU2A 2CU0A 1H09A 1JPIA 3GG7A 4NP7A 4IQDA 4YCPA 4I90A 1TE6A 1X8FA 3TROA 2C1IA 3KBVA 5JXQA 1NWSA 2TSYA 2AL1A 3LN3A 3MY9A 2GSEA 3CUJA 4S2BA 4LUJA 1HVXA 5EMUA 4Q4OA 1FRBA 4E2BA 5G4HC 3MUXA 4HBKA 4LVFA 3H54A 5G2WA 4DUWA 3K1GA 3G1YA 1ZJIA 3P8IA 2DT0A 4NZ3A 4MJMA 1EL3A 1JD7A 1RQHA 1EIXA 3EDEA 3PFMA 4NVTA 4V28A 7ODCA 5KITA 3UA4A 3I68A 2D3LA 1YTEA 4ZGYA 3CLWA 4IF2A 4EPDC 3QZEA 1MQPA 1CGYA 1W91A 4QSHA 4R85A 4LALA 3HG3A 1TPB1 4FPSA 3LPOA 3O6DA 2VQTA 3LMYA 3NQVA 1B4KA 3SIMA 4C6QA 3TYBA 4NJJA 1DWAM 2X1TA 4OV9A 3IANA 3QQ0A 3GDLA 3ES8A 2J27A 5K9XA 2HS8A 4UNLA 1CW2A 3GUGA 1AW1A 4GUJA 1HKMA 3ERPA 3H2OA 4AHPA 1Q8AA 2YA2A 4H7ZA 3QRHA 1OSEA 1JNDA 1HIZA 1I1XA 4D71A 3W1PA 2ZQ0A 2HBXA 1QI5A 5CGQA 1ZCOA 1H63A 3SY1A 3S1GA 4JTDA 1XDMA 3GS6A 2YJQA 2CEQA 5HMSA 1WDRA 2PPGA 4LYKA 3PUEA 4X9YA 1CXIA 3W01A 3RG6A 4HT3A 1HFBA 3W72A 1AQMA 3OZYA 2WVUA 1WXZA 2Q09A 2CHNA 2WSRA 2DT3A 4IJBA 1SSDA 3OQEA 4H2HA 6TAAA 3PBVA 2Y8KA 3WQPA 1TX0A 1KXQA 2OZ3A 4G5DA 1E70M 3WJYA 4L9ZA 3Q58A 4J3XA 1XDLA 1LWHA 3W84A 2PB1A 4OU1A 5A5WA 4YYCA 2FDSA 2A6NA 3TA6A 3CPGA 3TYCA 3MMTA 1JGMA 1OFPA 1NQKA 3WQVA 4GQQA 4W93A 3DFHA 4XD6A 2BTMA 1IT8A 1CGWA 2YIHA 4UMCA 2WCSA 5FEZA 3QXBA 1EP1A 2DY3A 3CQIA 4NHVA 1CLXA 1JPMA 2AGKA 4HA4A 4Z0SA 3SFWA 2VRKA 1J10A 4GIRA 4D8ZA 4KCUA 4PEEA 5BMWA 4QSFA 1M01A 3BCJA 3H4WA 2FH6A 2QXWA 1GJUA 4GX8A 3RCNA 3E5BA 1M04A 3OGSA 1TPC1 3E38A 3NSXA 3WNOA 4UFJA 4K7YA 1JQVA 1ODUA 5SWUA 2J7EA 2VRQA 2QUNA 4FF5A 4V1YA 4CNOA 4MWAD 3UWZA 4UTMA 1ZBCA 1TZ9A 1UR0A 1VLIA 5C7VA 5HNUA 2FQIA 4QAIA 4MDPA 5TIMA 2WPGA 3B3DA 3KRUA 4JEJA 2BHZA 2VKZG 2HZGA 1AUSL 2A3LA 7REQB 2CZ5A 3M7WA 1N8FA 1QOPA 2WMJA 4GPNA 1ZENA 2YDQA 4BY3A 4ZQCA 1RPKA 4XZHA 2FB2A 1DJNA 4MUPA 1TJ2A 1HKVA 4C65A 1PWMA 3POHA 1BD0A 1VGAA 5AC6A 4GUIA 1JD9A 3OOQA 4WQ6A 1Q4NX 2EJ1A 5H8PA 1DEDA 5FEPA 4UTUA 3EX1A 1HGYA 2QJJA 3FHQA 3MP5A 5XIMA 3GNRA 4CU6A 3ITXA 3S83A 4Z2LA 1VFSA 3M1ZA 3A22A 1FWIC 4HNOA 4QJ3B 3F5KA 2ISFA 3WQ8A 1G7VA 3LCIA 4LV9A 3LERA 5H91A 4NY2A 2PC8A 4O8AA 1DXEA 1Q6GA 3M0JA 7REQA 2Z26A 1ADDA 5AVNA 2IKJA 1ZZMA 1CLKA 5D4YA 3IACA 4C6IA 1XIEA 5BXSA 2QCDB 4ZQMA 1IQ8A 5K2ZA 3OYZA 1T5AA 5JVLA 1EZWA 3WLMA 3N15A 1H49A 3W6LA 4GJ1A 1UWRA 1FWNA 2QDEA 4BS0A 1W5MA 4C6EA 5TBOA 3RMEA 4H9YA 3CMGA 2FZNA 3QEZA 4O1EA 2A6LA 1PTAA 3TJIA 3MPGA 4FAMA 5A3HA 5AFDA 1JZ8A 4RE4A 2Q8LA 1V0MA 3EOLA 4J27A 3IWPA 3F4CA 1FUYA 2J75A 2F6XA 3NYDA 4GQ0A 2FVKA 2ZDSA 1OIFA 4W5UA 2J7DA 3M5XA 2V0TA 4H9MA 5BOOA 3PZMA 4X22A 1B3YA 3CASA 2VDHA 1E6ZA 1NEYA 2X30A 3D3AA 4G56A 1TELA 2DQWA 4PFMA 4US6A 4AIEA 2Z28A 2ZZ2A 2FYMA 2V69A 3ARWA 3ABSA 3ABQA 3CT7A 4L6HA 5GNZA 1H61A 2BG5A 5AC5A 3VKDA 3W00A 4O1DA 1QJWA 3H2MA 4IMGA 3S9IA 2E9MA 1K8YA 3CYJA 4WDUA 3EPNA 3AISA 1Q6CA 4JYDA 1R2TA 1X98A 3G2GA 2IUZA 1KGWA 4Q8PA 4R7OA 1ZP4A 4W7UA 3PS7A 1K8ZA 1MEWA 4AZHA 1L2UA 4MNJA 4G1KA 3C2EA 4CKQA 2ZRZA 1VRXA 5LYRA 2CNCA 3MA8A 4KWSA 2E8YA 1BYBA 3B0YA 3H7RA 1GOWA 3UF9A 4A3RA 2VXNA 4WY0F 4MB4A 1CXHA 1I9CB 1XIIA 3M0IA 2JE8A 4CNNA 1NWUA 3ZFHA 3AFBA 3IJ9A 2YB1A 3N04A 3BQ5A 5A8NA 2E77A 4I3GA 2ZX8A 3MZNA 3V4BA 3W4RA 4Z2IA 4HCLA 2AQWA 2AQOA 5M17A 4JZ5A 4GVHA 2BOGX 2IS7A 3AMDA 4TV5A 2DZSA 4AIUA 3GVQA 3HG2A 5EBAA 3QMTA 1GG1A 4NAEA 5B7YA 3P82A 1BTMA 3O16A 3PZQA 3G0XA 5LNWA 4JIRA 1Z41A 5FJUA 2ZRUA 3DHDA 4I8DA 1J79A 4PMQA 4EE9A 3N2CA 2XZ7A 3R8GA 2G3NA 4RJEA 3W88A 1B3WA 3EWBX 3CL6A 3FVMA 4NU7A 4PCSA 3IK4A 1V6WA 2Y8VA 4V15A 3TAOA 1KM3A 3GW3A 4CQCA 1YEYA 3B8IA 1ADSA 2Q71A 4PUJA 2WNZA 4NX5A 1JF5A 3WUBA 2VWSA 3OVGA 1O68A 2A0NA 2Y5SA 3AHVA 3UYCA 4Z2GA 3BJFA 3HOJA 4HP5A 1FWHC 1SGJA 1VHNA 2WM0A 1W54A 1ZU8A 1FWDC 1EOMA 4PMOA 2DZUA 3W7CA 1Y65A 3ABZA 3DUGA 3HIJA 4O14A 5AHMA 4JQAA 3LHWA 1GONA 1WUFA 1TUXA 3CMFA 5HATA 1TWSA 2JEQA 3QH2A 4F66A 3AZTA 1WKEA 4YTTA 1KM5A 2H3DA 5C0QA 4OJYA 4PBEA 3UR5A 1R87A 2OYKA 3UJFA 1E1FA 1JRCA 4G7EA 1C8QA 3MKCA 3GX9A 4KW2A 5J5RA 2IXUA 1XPYA 2ISSA 3FYYA 2YR1A 1H1YA 2E6AA 1DIDA 2VC7A 1RAKA 3P5ZA 3IV8A 1MDRA 1WDDA 2ATMA 2VL4A 3WLRA 3O0FA 3JS3A 1IEWA 5DRIA 5LHFA 3DERA 3TTOA 5JIWA 4ZQOA 5GVJA 2J88A 3RYSA 5A69A 1ZL1A 1KR0A 5FEXA 3GFXA 4JIEA 3W70A 3M0XA 4BHYA 2GWNA 3TW7A 4IGNA 2PDHA 3IRSA 4G1NA 2HK1A 1OB0A 3L67A 1XG4A 4H6RA 2YOCA 3BE7A 4Q4PA 3KRSA 1IF2A 1XL9A 3LPFA 3NUKA 2F7FA 2ZUMA 4GNKB 2A79A 2C8NA 4N9EA 3IRDA 4DELA 1E4MM 4PUDA 3GXIA 3W29A 2Z7KA 3QV7A 2VEMA 2BY3A 2E3ZA 3UCQA 2RGMA 4HB7A 1HJUA 3CHCA 3IJDA 4NJIA 2Y5JA 3PNUA 4Q8OA 3QV9A 1UD5A 1A5UA 1J2BA 3QBUA 4LAOA 3NO3A 4A29A 2YDSA 4ZFCA 2DDXA 2D0HA 5FOOA 4DF0A 2OCZA 2UWFA 2VEKA 1OABA 3SR7A 2W27A 4GI6A 2DIEA 4HQVA 4E3VA 2OO6A 1E4LA 3MVTA 3BPWA 1A0EA 3FA3A 2D2JA 3QZ6A 3SQSA 3W6YA 5D9OA 4DI8A 5CBBA 5AB3A 5D9NA 4TO8A 4UR7A 4YHEA 4DPQA 3EPMA 3WMSA 3PUDA 2PZNA 3LSCA 3BLOA 2OSYA 2J4GA 3D3FA 3AYTA 3UP8A 2VFIA 3LUTA 3GD6A 1J0JA 1NOFA 3ZMRA 4A05A 3DX5A 2EPMX 1P43A 4GKLA 1XD0A 2IMRA 2WSQA 2QV5A 4XZWA 3WJWA 5AYZA 5FL1A 4ZODA 2O9OA 4GA8A 3SGUA 1MNSA 1WE5A 1HVQA 2F2HA 2VOTA 3LEPA 3V16A 3W2MA 3RIKA 4MNMA 1F74A 5ABTA 3VIOA 4MZ1A 2ON3A 3HGOA 1B1YA 2UV8G 3SEPA 4IMDA 5HK4A 1GTEA 1ZAHA 5D38A 1WXYA 4KBXA 5BXPA 5ABGA 3S46A 3F1QA 1QO2A 3OZOA 2NXHA 3VNIA 1A5AA 5CAHA 1LZOA 3KWXA 7ENLA 3GHSA 3UWEA 1BWVA 2FTWA 5DFAA 2VGGA 4DBSA 1RY0A 2PMQA 1KBBA 3N6JA 2H90A 2GVYA 2PDKA 3K8MA 4DJDD 3WF2A 1J2WA 2Z24A 3UG5A 4IICA 2XN2A 1Q6LA 5GJPA 4LS2A 3JR2A 1CXKA 3DZ1A 3B8VA 1H0GA 3DFSA 3DHPA 4LF2A 1GVSA 4WIWA 4RZ5A 2OOGA 3ITTA 1Z42A 5MKGA 5J04A 3ZS4A 5TF0A 4JBRA 3WZ0E 1J6PA 3ARQA 2ONEA 2HVNA 1PIGA 2AQVA 1OT1A 3PTDA 3W71A 2OB3A 3HGSA 4DLMA 2ZRWA 4UTWC 3OVRA 3KBWA 3GUWA 1A0CA 4PRRA 3GRIA 1R2RA 3TYAA 1W3NA 1Y5XA 1THFD 3UJEA 1KXTA 1EQPA 3W38A 5A2BA 4N6FA 4JTJA 5F2LA 3VGEA 1SU5A 2PDJA 4M6UA 1XLEA 3VUSA 3LQGA 3TTEA 3T0TA 1UBSA 2OR2A 3CV2A 2YB4A 1T99A 3KBNA 1OD8A 3QY6A 4W8AA 3EZ4A 4M1BA 3M7SA 2DFAA 4O1FA 2HSAA 1GHRA 3B4YA 2CC0A 1N55A 1PTGA 2UY2A 4RR4A 2CXEA 2GQAA 2J24A 1C91A 5F4XA 4S3EA 4GYPC 2A3BA 4OV4A 3RX4A 4KS0A 2PBGA 2R1MA 1EJXC 3LI0A 3P81A 5I24A 4NYUA 2NX1A 3N73A 4AX7A 3UA3A 1M1BA 4AFYA 3CK5A 5BU9A 2VC9A 3HQOA 3BOFA 4XK2A 4H2CA 1W5OA 1B9ZA 3FA4A 4JTLA 3L5LA 1TIMA 2BWGA 3HJEA 1R38A 5CSUA 3RO8A 2CHOA 3BMWA 3RUBL 1ICQA 3IUIA 1GHSA 2P5NA 1Q3NA 3CV6A 4AVFA 3EA3A 3LLDA 1F8MA 3EX2A 3BLDA 1PIIA 3STFA 1TE1A 3LTSA 1JRBA 1MXGA 4PMRA 3APYA 2FZ8A 3KE0A 2AOSA 2EPOA 1GZGA 3TXZA 3QHMA 1ZS2A 1JZ2A 1VEOA 1OM0A 3NFUA 5IFPA 4US5D 2FZDA 3TQPA 1LL6A 1BXCA 1KNWA 4IX0A 1WUEA 2OZ8A 4TV6A 4JKLA 4F2TA 4PBFA 2YW4A 1E1CA 4B90A 3DKLA 2XVLA 5CSSA 4Y9AA 3SUVA 4JKKA 3SW6A 3LCLA 4ALDA 5E9XA 1EA0A 3W1AA 4WRHA 2GVJA 4FOUA 4L4LA 4CEUC 1K9FA 1OK4A 2GL5A 4XAYA 3STPA 4GZ7A 4PGLA 2CITA 5CZ0A 2PP1A 3AMGA 3W1UA 1PZ2A 4O17A 3LLXA 3BC9A 1JGIA 1D7FA 3E2VA 2YCJA 4IP7A 1G7UA 2RDUA 4HMDA 4DNMA 4J3UA 1BAGA 1VCFA 4IM4A 3TU9A 3BLIA 1PDZA 1JULA 4FLOA 1SFJA 5CJMA 1OINA 1JDCA 3QF0A 4ROQA 3QM3A 5AOUA 3KTCA 4B2DA 2DEPA 1CXEA 6CGTA 1HJQA 3GNXA 1C9DA 4NF7A 1XCFA 1NSJA 3OA5A 4FNQA 3IVSA 1FKWA 5DBTA 1BRLB 1FDJA 3WNMA 3U5YA 1HZYA 2PCQA 5CPNA 3EKLA 3VMNA 4A8IA 4XSLA 4QROA 4AW7A 1KKOA 2OPJA 1DWIM 2XH0A 1LL7A 3QFEA 3HG4A 3MCMA 1YTDA 5HBFA 2HMCA 2ZRVA 3M5YA 2X1SA 4NZJA 2FJKA 3W85A 2DZVA 1ML1A 4UZSA 1RQBA 1F61A 4GMEA 2DZBA 4UIOA 1S5VA 5BZAA 1W8SA 3GC2A 2E6FA 3POCA 1YXYA 3MSGA 2RGLA 4JN8A 1E9YB 3RRAA 1X1OA 3UNDA 1F7BA 3TWAA 1KFBA 4LC6A 1O5XA 3LPGA 5LGZA 3E0FA 3F03K 1KV8A 2FMOA 3EA1A 4N2YA 4WOZA 1E9LA 2E4TA 4LRTA 3PWGA 1G6CA 2DVUA 3M16A 4LUSB 2RH9A 2YDAA 3VIMA 1JDFA 2VWTA 4F9JA 2FKPA 1CB7B 3N12A 1S2UA 2YZ5A 2Y7EA 1LWJA 3UWQA 3ATYA 3KL3A 1EC9A 1YE6A 1L6YA 2NV1A 3ARZA 3MUZ1 2HRWA 2B7OA 1JZ4A 3HPAA 3R43A 2A7PA 3F4VA 3WQFA 1BG9A 2NXIA 2OJPA 4X60A 1KGUA 2ALDA 1H11A 3PP7A 3SSZA 2BBFA 3HV8A 4FLQA 3HQNA 5IOBA 5D32A 2YZRA 4LUSA 4GXMA 4QE5A 2QYGA 2BFGA 3UJRA 5A6JA 3I3DA 4ZO8A 3THDA 3CB3A 2WYSA 2NXGA 3GG8A 4B2DD 1KLZA 4CNSA 4H1ZA 3FGCB 3MJMA 2Y6ZA 1EO7A 4HK6A 1RP8A 2QEZA 3H7VA 1FX6A 1R30A 1XI3A 3HMCA 4FI4A 3VFLA 1KM6A 4EPEC 2HXTA 2QCNA 2QUVA 2WWDA 4IPJA 1OFRA 3UW6A 1I0DA 1PVNA 4KRTA 3CEUA 4JHZA 1AG1O 3CAVA 4LEFA 2CPUA 2X7VA 3VGFA 1AH0A 4GZEA 1ISWA 4NQ1A 4MIMA 4IPPA 5AYXA 1NDWA 1B54A 5HJLA 2YBUA 1CEOA 4GY0A 3GM8A 5HOSA 3FGCA 4DUXA 3GZAA 5ECVA 2NW0A 2WZTA 3CNYA 4ENLA 3PJWA 2OELA 5EYWA 4I6VA 1UJQA 3LBOA 3CEPA 1P7TA 3T42A 2BY1A 3V35A 4J2MA 3QKEA 1MDLA 3LM3A 4Q3MA 1U5VA 3TMQA 5F2IA 5E6YA 5IBXA 1IR1A 3S5YA 2QCFA 3EDKA 2J25A 1C8YA 5AHEA 3AOFA 4AD5A 3UG4A 1VBRA 2BXZA 3Q65A 1XJBA 3GDTA 4D9PA 2QVHA 1EQCA 1BSLA 1MNZA 2C13A 4KFPA 4AWUA 3V5OA 3RILA 1E6QM 2NSXA 2FIQA 5C5YA 5CG0A 3QR0A 4TX9A 3F5JA 4MJZA 1K9EA 1FA2A 3O2LA 3AWOA 1L6GA 4YTSA 1QI2A 1D9EA 2WK2A 3NZPA 1JAKA 1PYMA 4L9XA 5C9RA 1W1YA 1UWSA 2DUZA 1DWJM 2B4GA 1XWYA 2G3JA 1V3MA 5ENLA 2R6OA 3NURA 3R0DA 1VD6A 3R0KA 1BXBA 4WD0A 2CZEA 3WQWA 1POJA 3NQMA 3ZYZA 4U5KA 1F6KA 1KBJA 4HZ8A 2CZVA 2Y7FA 3OHIA 4LNYA 1Y8BA 4UTJA 4OE7A 1F9CA 1KBKA 1BWKA 4L4OA 1HN1A 3A3WA 2VZUA 2Z6JA 3T9PA 2AKZA 1E9ZB 5DMLA 3UJ2A 5CBJA 3ARPA 3VOHA 4FX8A 3WFLA 3SUWA 1MMFA 5DEZA 2VZOA 2ZE3A 5CJNA 4FNSA 4LBSA 4HSHA 5FJTA 2PWFA 4NAFA 3N19B 5G1YA 4B3KA 1Q7QA 1Z69A 1QNPA 3M0VA 1RK5A 1DQWA 1H7PA 3GH4A 1HO4A 1KXVA 1AH4A 3M44A 4O57A 4DY1A 1M68A 3N1AA 4XZNX 5A6BA 4CD7A 1F3WA 2VZVA 2GGEA 1JZ6A 2WSPA 5BW6A 1JUBA 1E0WA 3WQGA 3V18A 1VFTA 4ATLA 4M0XA 4LVGA 1OZQA 4RDVA 3KXQA 3EWXA 1A5MC 4ZE5A 4JFTA 3OQ8A 1S2AA 3W1LA 3NA8A 3S42A 3WMCA 4IT1A 4DWSA 1E0VA 2XVPA 3BICA 4LBUA 1G01A 3GVRA 3BW2A 3IJ7A 2GQ9A 4MYXA 1C3FA 2PWDA 5GQBA 1R3QA 3JW7A 4PUUA 6XIMA 8A3HA 2G95A 3OLDA 3AHTA 4IXXA 5CZSA 3VGBA 2P76A 2DU2A 3M0MA 3BCDA 4RW5A 3BLEA 3F2DA 3W1TA 1E71M 1K6AA 4B91A 4BQ4A 4ZTYA 1E40A 4IIGA 4LXFA 1W9BM 2QKFA 2QUUA 1Q6DA 2WMFA 4HA3A 1Z8AA 1SYTA 4P8XA 4RK8A 2YCLB 3CQ0A 3CLMA 2EG8A 3C4UA 2RKXA 5DRCA 3QFWA 2C18A 4HNNA 4EKJA 2WBGA 1G9HA 2WVTA 3G24A 2EQDA 1DL3A 5HMFA 4K39A 4LEQA 4UMBA 3K8KA 1K70A 3I7SA 3P80A 1JCMP 1X6NA 5IFTA 3A4JA 4UMAA 4LT9A 3KOXA 3C61A 4MKSA 3SZ8A 4KCVA 2PDFA 1QBBA 4AEFA 2QZRA 3WUFA 4PCFA 2JK2A 3KS5A 1RY8A 5B80A 3CPRA 2KX9A 2QIWA 3PBWA 3WD0A 4IIEA 4S3CA 1U5JA 1XYBA 1K7FA 3N3TA 3TJLA 4O1AA 1ZFJA 2YCLA 2PS2A 2W91A 2NQ5A 1VFUA 1YIXA 3E2SA 1PX4A 3PZ9A 4WZHA 3VDAA 3MQTA 1K9DA 1AL8A 1UH2A 1IYXA 1UP2A 5CEWA 3KBMA 4WF7A 4UOJA 2MUCA 4MKVA 4TMCA 1JPKA 6REQB 3BLFA 3NZ1A 4L9YA 3CPUA 3N25A 4ZXOA 4TVCA 1FTXA 3EDFA 4W86A 2GJRA 4D6DA 4OOZA 4H6EA 3MUCA 3U57A 3W1XA 2QCMA 3OGRA 3VTRA 4CN6A 3WNKA 3SJ3A 1NDZA 4GUGA 3S4TA 4AZ5A 3C3NA 4HNCA 2PD5A 3O9NA 1KA9F 1WOAA 3KS6A 2ZICA 4IPIA 1TPFA 3O05A 3VNYA 2NSOA 1TPDA 3KDNA 5HULA 4L65A 2YCIX 1R3TA 2WLYA 3O3RA 1KV5A 3M4HA 4Q4SA 4QJ5B 2X42A 4PL2A 2EG7A 4RE3A 3GDKA 1IZKA 4RKAA 1Q2SA 1UC4A 5I09A 3T05A 6REQA 4IGSA 3LHZA 2G4JA 6ENLA 3NQBA 4AHQA 1BVZA 1W6TA 2HNEA 2CLPA 4BR1A 4FX7A 3ORWA 1HXJA 3VILA 3QHNA 2A85A 1MYRA 4R33A 1C7SA 3N2OA 3VPLA 1UIOA 2YGYA 1SJDA 1NY1A 2A3EA 2YCKX 1BVWA 4XISA 3A21A 1DHKA 1GZJA 5AC8A 1EP3A 1V5XA 4PUMA 1P6WA 4JGDA 4EX4A 5I2UA 4RXFA 1FWSA 3G6LA 2PP3A 3FW6A 1O12A 3WQ5A 1TWIA 4P2VA 1AVAA 4DAFA 4LY8A 2BY2A 2ZUNA 3SCPA 2ASHA 1PZ1A 2J47A 5XINA 4LCQA 3PZOA 1ICSA 4NJKA 3A6OA 1ZJHA 2YYUA 2V2HA 3SUTA 4EPBC 1XUUA 3BG9A 3DYPA 2HV5A 5K4ZA 3CXOA 2J7CA 1AZ1A 3EAUA 3USZA 1VFOA 3O7UA 1AW5A 3JU2A 3A4XA 5D02A 1P1XA 4GYJA 3GXDA 2ZZ3A 5CC6A 3WDPP 1HG3A 4YPJA 3TTYA 1JR1A 2WJDA 2YLLA 4LAUA 3VC5A 4XAPA 4B9ZA 1XCWA 1RD6A 2PFHA 4OQVA 2HJPA 4A2SA 3COTA 4QITA 2V5BA 1E6XM 2GYIA 3G1RA 3OZMA 3VNZA 1OC6A 2XH7A 3N2TA 2UY5A 1XLKA 5EU9A 2VX4A 1DQUA 3ICJA 1QK2A 4OUIA 3R8RA 3TLLA 4NX0A 4E2OA 3FX4A 2WSYA 1QPRA 4DJEA 4JXCA 3GU9A 3K1DA 2ZWZA 3N2MA 2BXVA 2VMFA 3NR0A 3JZEA 3O15A 2BLEA 3BMVA 3NAVA 4JL1A 3T78A 4EVZA 1R8LA 1O1HA 1TWZA 3PTMA 4ACZB 3TCSA 4K36A 3CGTA 3QY7A 3QLLA 3WBYA 1TPH1 1RPXA 2DH2A 4Q8UA 4N9DA 1VRDA 3W82A 2BMBA 1XYLA 4CN1A 3E0WA 2BVWA 1ECEA 1UWUA 2I9UA 3L4YA 3WLPA 1M7XA 1RJQA 3UJSA 4BI7A 4GI9A 3S2CA 4Q8VA 4YCOA 3LK6A 4AH7A 2QJMA 3KVMA 3U2OA 1W5QA 2PDMA 3KCOA 1DORA 3U9IA 2WZEA 2EPNA 1E56A 4RZ4A 3O0KA 3Q4DA 5C2CA 4MF4A 3VO0A 4DUOA 1VJSA 1IXQA 3SUSA 3T81A 4YTQA 4XQ6A 4QG9A 4PUNA 3WN6A 1IHIA 1LUCA 2Z7GA 4OBTA 1KTBA 1LWIA 2J62A 4QE4A 2PRHA 4H8NA 3AUJA 4GQRA 4WVXA 1P5BA 5EY5A 4IUOA 2PA6A 3URAA 3GXTA 4A3YA 5HNTA 3CV7A 3O06A 1L6WA 3BSGA 5D2VA 2HWGA 2QUMA 5FEWA 3G77A 2E9BA 4GE8A 1S5MA 1GYMA 3VM5A 4AZIA 1XICA 1EGVA 3GR8A 3H22A 3UWWA 4WXZA 1SZRA 2RJGA 2W9MA 4OGZA 1O1ZA 1JDAA 3N4EA 4ZE4A