3QSRA

Crystal structure of trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
250
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAAPDVDGFLVGGASLEPGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_497370 gene
rcsb
source organism Trichomonas vaginalis
total genus 85
structure length 250
sequence length 251
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qsrA00
4NZFA 3VKJA 2A21A 3FJLA 1QPNA 4Y9AA 2BWGA 1PVNA 3FYOA 1T0OA 4J9JA 3FFSA 3G1SA 4LVFA 3HO8A 4JTJA 3MUXA 3DXIA 5TBOA 4DEFA 4O16A 3PWAA 4CCCA 1SU5A 3F1QA 4JN6A 2VEPA 4PC8A 3PAJA 3V1PA 5HQEA 3PSWA 3ABSA 3IGUA 2H90A 5D32A 1XBYA 3ZWTA 3WFAA 1VCFA 1G6CA 1FXPA 1XBZA 4FNUA 1WAUA 2BTMA 4MY9A 3DFTA 4A22A 1XM3A 3W7RA 4O18A 3QQ1A 4IJBA 5CSRA 1G4PA 1ZCOA 1QMLA 4GC4A 3I7RA 1I2OA 1SO3A 4QJ1A 5D2XA 4LVDA 3LXAA 3NQDA 3T40A 4UIOA 3W1AA 4O4VA 2BSLA 3FLUA 1GVFA 1VHNA 1T8XA 4RZ6A 5G1TA 4TO8A 3DZ1A 2G95A 4MLRA 4NJIA 3TAKA 3NG3A 4TX9A 3QC3A 1NF0A 1SR9A 2A7RA 2E1DA 3ATZA 4IMFA 2CLKA 3G1DA 3O6DA 4LC8A 4M6QA 1B57A 1F6PA 5D2YA 2WOQA 2C16A 3MHGA 5EPDA 3KRZA 2WNNA 5A8GA 3W7HA 4UNKA 5F4XA 1F6KA 1TRDA 4QNEA 1IXNA 3O1NA 5CGQA 4RZ5A 1SQ7A 2YW3A 4IUOA 4HKPA 1XBVA 1TV7A 2ZRUA 4XBKA 3EXTA 2VFGA 4CCDA 1KFEA 4DXVA 4AEOA 1YXCA 3CTLA 4O52A 1H7OA 2BX7A 2CLHA 3THAA 3CB8A 3QQ0A 2XFWA 3W7CA 3CQ0A 3FKKA 5CZTA 4O14A 1CX9A 1VYRA 2B7PA 3W88A 4E0CA 2NLIA 3BW2A 3WK3A 1LOSA 1Q45A 3GDMA 3G1VA 1VYPX 4KFOA 2FB3A 4PTNA 2NUYA 3C2VA 3IIXA 1KLYA 1OFRA 5AHLA 2RDWA 4AVFA 4O1BA 2XN0A 3BLIA 2A1YA 1W3TA 1SZFA 2E5CA 1F05A 4R7JA 2WO5A 3CWNA 2GJLA 2W79A 1OF8A 2JK2A 4RV8A 3BW3A 3QW3A 2ZBTA 4WX2A 1SSDA 3W1TA 5D2TA 4DO6A 2C14A 1F5ZA 1HO1A 2J88A 4WJEA 3CU2A 3RMJA 3GNNA 1G69A 5HJLA 3NEVA 5CG7A 2NUXA 2EF9A 2GQAA 5HR7A 2JBMA 3ABOA 3KXQA 3T55A 3L5MA 3UWZA 1H5YA 3BW4A 4XKYA 2E5BA 3LLDA 3PM6A 2CW6A 3P5ZA 2NXGA 1UBSA 3KHJA 4A3UA 4FXRA 1CW2A 1R30A 3UYCA 3LCXA 3OEXA 4TMBA 3GIYA 4LWWA 1VCGA 1OG0A 3TFCA 1EB3A 1GVQA 3LM7A 2J27A 5FF7A 3WJSA 4UTHA 2X1UA 1YPFA 2ZFAA 1S3HA 1GEQA 1XKYA 4KFPA 1JCMP 3GDKA 4GUFA 4O8RA 1W31A 2DP3A 2ZZ1A 2WPBA 2A2IA 3WK0A 5BRBA 1RPXA 3HBLA 2NV2A 1ZALA 3BPWA 3GXNA 5C55A 3NQFA 3L67A 1E51A 1R2RA 1W0MA 3A5FA 3U6WA 3M47A 4HPXA 2YYUA 1TO3A 3PBYA 5AHFA 4GXMA 4X22A 1FBAA 5IBXC 2B7QA 1JCXA 4PL2A 3PB0A 1LORA 3LCLA 4FNTA 4KKXA 2V9DA 3W2NA 2D73A 1VZWA 1GJPA 1I2RA 2CZFA 3C3NA 4MZYA 3VFLA 1WX0A 4K36A 5FF0A 1K7FA 3JRKA 2Q3OA 4K7VA 2Y62A 1WOAA 1P5BA 3N2MA 2ISSA 3NL6A 1P0NA 4NXKA 4JYFA 3C0JA 4GRSA 1F7BA 3Q37A 3LBCA 5BMXA 4MFEA 3PY2A 3C4UA 3LLFA 4IPIA 3LXCA 1GQNA 1XXXA 3G24A 4R34A 3BV4A 3B03A 1D9EA 1IIGA 2QEZA 2X16A 4LUIA 3W1UA 1JCLA 4LS0A 4IXHA 3FOKA 4PCFA 1OJXA 1JRBA 4W9TA 1OFAA 4A2SA 3ZWSA 3WJZA 4OV9A 4FO4A 1DORA 1GVRA 5LKYA 2FFCA 1H7PA 3G8EA 2V2DA 2O7SA 2QJGA 5HWNA 3KRUA 2OT0A 3TCEA 1XL9A 1IXQA 3TDFA 4JTKA 4UC5A 5EYWA 5CKSA 2G97A 4UMBA 4UFIA 3HG4A 1A53A 2QCGA 1EWEA 3Q58A 2Q3RA 3DFSA 1GWJA 4JTGA 2ZZ6A 1J4EA 3BG3A 3DENA 4YCOA 3L0NA 3W2UA 3W72A 4MYAA 4N9EA 1FDYA 4O17A 1PE1A 2Y89A 4KFNA 3TSBA 1Z48A 5AB3A 5F2GA 4HSOA 3LHWA 3LHTA 2ZZ4A 3ABQA 3L66A 3W22A 1ZENA 4ZQCA 2WV8A 1YADA 3C6CA 4S1FA 1KFKA 1KW1A 3KRSA 3NAVA 1M7OA 3B0UX 2IQTA 1G7UA 5DXYA 5I3FA 4LC6A 2F84A 4ADSA 1AW2A 3NQ6A 3RLVA 3PF3A 4HPJA 1Q3NA 1FXQA 4GUJA 1NF7A 3GXPA 4WQ6A 4ZQRA 3R8RA 3NQEA 3RU6A 3W2LA 3M6YA 3LCIA 3GLCA 4QISA 3W2MA 1LRQA 1LLWA 3S1VA 2QCDB 4DF0A 1B9BA 3HOJA 3QEZA 2PRLA 3HG2A 4JYEA 1VLIA 4MIMA 4PEKA 5L9FA 4CNOA 3F4NA 4CQ8A 3MBFA 4JYDA 4AXKA 3BVJA 4UTIA 3QMRA 2V8ZA 3HPZA 5E0KA 1ICSA 2HSAA 3UNDA 1ZNNA 4M6PA 1FCBA 3PSVA 3E0IA 3N14A 4PH6A 1F73A 3I7SA 3M16A 2TMDA 4WY0F 3TA6A 1I45A 3N3MA 4BI6A 1QPRA 2AAMA 1UUMA 5LNSA 3ZR4A 4MZ1A 3QJAA 3THQA 3UWWA 3EWWA 5D30A 1VRDA 3EX1A 1EPXA 1I4NA 5HUPA 3HG3A 1ME7A 1YLVA 1XBXA 3IVSA 3DFPA 4I7WA 5K9DA 3STCA 1L6WA 1LTDA 4LOCA 1JQXA 4JTFA 4MUZA 3W7LA 1SUXA 4MY1A 3LRKA 4AF0B 2NZLA 5LHFA 2VEIA 2I1OA 4WD0A 3UPWA 2CZDA 1EX5A 2H3BA 2FJKA 3G1XA 4AB4A 1M7PA 5DELA 4Z0JA 3E12A 1K7EA 3PBVA 2FIQA 2O7QA 3NQVA 3S9YA 3IIZA 4H3DA 3T7VA 5IBXA 1JRCA 1TTJA 2CLMA 4QSHA 1OX4A 3W1QA 3I65A 3R12A 2TRSA 1VHCA 4S2CA 4L4LA 1LDCA 5DCDA 5KZDA 1HO4A 3IGSA 4N6FA 4UCGA 4JEQA 3UWUA 4N2YA 3S1XA 3S42A 5FI8A 5KSWA 3W7EA 3P80A 5D33A 3NQMA 4KWWA 5HMSA 2JKAA 2A4AA 2WKJA 5DXXA 2A7NA 2QCFA 2E09A 1KBJA 3MP3A 3QFEA 4NVTA 2AGKA 4DBDA 3LOTA 1HTIA 4L4MA 5I3KA 4HT3A 4HNNA 3LRLA 4NX5A 1YXYA 4O50A 3BK0A 3DFOA 3MJYA 3SZ8A 1G4SA 3W73A 2GPTA 3W2KA 2YR1A 4ICNA 4HIBA 4TMCA 2P0OA 3W85A 5KMYA 4EWND 2CLEA 1OYCA 3DHDA 4FNPA 3LB0A 1QO5A 2LLEA 3PBWA 3N73A 2P10A 3NL5A 4FNSA 4UTLA 4MPQA 2YFNA 3P82A 4Y8FA 3TXZA 4QQ3A 4LY8A 3I68A 4JS3A 1EWDA 3DFNA 4UTWC 1TYGA 5HULA 4UUIA 3EWXA 1BKSA 3W1PA 4UNLA 3BLEA 4UTKA 1TTQA 1AL7A 1THFD 4R53A 4ZQNA 3P7YA 3GDLA 2QUVA 4JTLA 3GB6A 2Z1BA 4GBUA 1P0KA 1Y0EA 1K02A 7TIMA 4CQAA 1H63A 1GYNA 1RV8A 2QCMA 3FEMA 1EP2A 5AYZA 5K9XA 1DHPA 3FJ6A 3WK1A 4FHAA 5BW6A 3TSMA 3NQ8A 3CEPA 1SFJA 4O0KA 1O4UA 1TTIA 1OHLA 1ME8A 1XI3A 4GUGA 5AYYA 1YDOA 2Y7DA 1MO0A 1L2UA 3IV3A 3QF0A 2RHGA 1WQ5A 1KM2A 3L21A 4NJJA 2Y88A 4WZHA 2ZZ2A 3UXAA 4RKAA 4ONVA 2Y7EA 3GVGA 4O13A 5HWMA 2DORA 1R47A 2FLIA 4LVBA 1Z44A 1TRIA 1MEIA 3DFQA 5LNRA 3UWQA 2GQ9A 3EKLA 3EX6A 4D2JA 4E38A 3FYPA 3U8GA 3S5ZA 1TPC1 3HQ1A 3W71A 5G2WA 3NO5A 3NZRA 4K7YA 1GOXA 1FWNA 4ML9A 1TIMA 2YXGA 1T96A 3HMJG 2JKPA 1EP1A 4PODA 1PS9A 3FKRA 1G67A 3L5LA 4A21A 2DZUA 4UTTC 4O1CA 1TPH1 2A7PA 3EX4A 1P1XA 2ZQ0A 4ALDA 2HS6A 3SSJA 2GOUA 4WY0A 1QWGA 1H51A 2ZA2A 4EF8A 3P61A 4PFMA 4K38A 3VE7A 4LV9A 2ISWA 4Z08A 2YW4A 1DKWA 4XQ6A 3D0CA 4Z1CA 3A24A 4LS2A 1LP6A 1H7XA 2J24A 2ZRWA 4FNRA 2WJZA 2PRHA 2V82A 1NSJA 3PUOA 3NGJA 1HUVA 2NX1A 3EEGA 3G0XA 5HINA 1RQBA 3P8JA 2QCLA 4KWVA 2ZRXA 4WOQA 3SY5A 3R5EA 2OX1A 1KM5A 3C2EA 3ZS4A 2VFIA 3A5VA 4M6VA 1TCDA 3QSRA 3TAOA 1KTNA 3LCWA 3IIPA 4I7UA 1F74A 4HNTA 1O94A 5FESA 2AQWA 4IX2A 2Q8LA 2BLEA 4MOZA 4IOTA 4OV4A 5G5IA 5AHIA 2Z0IA 1OK6A 4N9CA 4DF2A 3IGXA 4WY0B 2GUUA 3B06A 3NPWA 5LGZA 4LTSA 3M5YA 3SFKA 3OVQA 2DZTA 1VQTA 3TC7A 3NQGA 3VE9A 4O53A 3CC1A 2RFGA 1RD5A 1IXOA 1A5SA 4NX0A 5E1QA 2X1TA 1GZGA 5D05A 5T26A 1ICQA 1QNVA 2YX0A 1MZHA 3EX2A 3O05A 5HWJA 3UY7A 1WA3A 1YPIA 3MYOA 1VR6A 2YDAA 3A23A 3NXFA 3B0VC 3I7QA 4ZQMA 1EUAA 3LTPA 3SI9A 5KTLA 1ML1A 2DJXA 3PG9A 2H8XA 3NPXA 5HUOA 2QCNA 1TPVA 1L9WA 3O15A 3N34A 2ZCGA 3TNOA 3JR2A 1X1OA 2X1RA 5CPLA 1N8FA 2J9ZA 1W3NA 1I2NA 1X8FA 2OT1A 3T44A 1DV7A 1OFOA 2C3ZA 3JS3A 2DJLA 3IRDA 3T4CA 8TIMA 3W7JA 3BARA 4OHQA 1ZAHA 4FB7A 2QAFA 4NXSA 4C1LA 2QDHA 1C9DA 2YSWA 1EA0A 5LZLA 3M7WA 2QKFA 1C29A 2TPSA 4H4IA 3AO0A 1MEHA 5EKYA 3W7MA 2WSQA 3I6RA 2J9YA 5FF2A 3G1HA 1OFQA 3G3MA 4LW7A 2B4GA 1ZY9A 3NL2A 2WQPA 1OFBA 2PCQA 1YTKA 1FWTA 3DKLA 3BG9A 4RLIA 2YCEA 1QOPA 3QMTA 4DELA 2VXNA 1LM1A 3O07A 2E6FA 3GAYA 3A22A 3IVUA 3W2JA 3G1AA 2DZSA 4NUWA 2F7FA 4JX5A 4IGHA 2B7OA 1XUZA 2JGQA 3GR8A 1LRNA 1X6UA 1H7NA 5C5YA 1FCVA 4JDBA 1GVSA 1C8VA 2V2CA 3NPUA 1QPOA 5EBUA 2BXVA 2TSYA 3GKFA 2VFEA 1ADOA 1SO5A 2HTMA 2FPYA 1LRTA 4XKYB 4FEZA 3R89A 3ELFA 4ZL1A 1TJRA 3KVJA 4FNQA 4FXSA 5CZJA 4N02A 5G2IA 3MWAA 4YWIA 3MI2A 2EPHA 4E2BA 5CPOA 3GZ3A 2WSRA 3F4WA 3TIMA 1N7KA 3INPA 1KM6A 5F2MA 1KFCA 4BF9A 1Q6RA 4N9BA 3IVTA 1JCJA 3L68A 3TUUA 5HNRA 4GWEA 4Y90A 4OGZA 4N4QA 1GVOA 4JTTA 3S5OA 3L0KA 4IMCA 2V30A 1D3HA 1IGSA 3DI1A 3O16A 1TV5A 2FPTA 5BOOA 3BLFA 5AYXA 2ZZ7A 3N19B 3O6YX 4JD4A 3NA8A 1DOSA 1JQVA 3G0SA 3VI2A 1ME9A 5L6UA 4UTTA 4FIQA 5FEPA 4BK9A 2B7NA 2Z2UA 4GUHA 3P62A 3NNTA 1W5OA 4RXFA 4NJKA 1OVDA 5TQLA 1DJNA 4K6AA 2Z6JA 5FEWA 4X9SA 2W0UA 3M0ZA 4JX4A 3TJLA 5D38A 4ORMA 5DCEA 3GDTA 2GVJA 2RH9A 2A85A 1T99A 2FQIA 3DKJA 1SZNA 4Y6GA 2KZHA 3M44A 3TU9A 4UR7A 2RDUA 1GYLA 1Q6OA 5H2ZA 4C1KA 1S5WA 1QPQA 1W3IA 4FX6M 4AH7A 1RR2A 1LLZA 1O95A 3TXVA 4JR5A 1S5VA 1U5JA 4MKNA 2P1FA 5CPMA 4IQLA 3H53A 3PS7A 4FX8A 5KZEA 2H3DA 3TSDA 1SO4A 6TIMA 1W5PA 4LRSA 1WOBA 4AMAA 1OF6A 2ZRYA 4O1AA 1JR1A 2WNQA 3NVTA 3BGGA 3TROA 3TQVA 3NQCA 4I7VA 1GG0A 4FIRA 5TIMA 1SW7A 4M7TA 5K2ZA 4A2RA 1B4KA 1Q6QA 5D02A 1W5NA 1Z41A 3DHFA 3G1YA 5H91A 4JICA 2C0AA 4JTEA 3E96A 4O10A 3NQ7A 3FA5A 3R2GA 4XTDA 4MZ8A 3HGRA 3N2XA 5F4WA 1L6SA 3W86A 4IMDA 5LNWA 2R91A 5D04C 3G0UA 2V0TA 4DO4A 3QMSA 1FX6A 3U2OA 1FWWA 3TQKA 3SJ3A 3QW4B 2X1SA 2JGYA 2WNZA 3B04A 1KTBA 1B3OA 4LV4A 2W6RA 5D2VA 3GDRA 4ADUA 3C8FA 1W37A 2E68A 3GKAA 4LT9A 1LOLA 2QUUA 1WBJA 3L65A 2NXHA 1AW1A 4PA8A 1TPB1 4OE7A 1G4EA 3W07A 1J2WA 2VEKA 2EHHA 4ZMGA 2FDSA 5AFDA 1QOQA 3DI0A 3TK7A 4JNMA 3UZJA 5DCBA 1PCKA 2E6DA 3QYQA 3RK8A 3PUDA 1DVJA 4YCPA 3S5YA 1JVNA 2NWRA 3DGRA 1MXSA 3L9CA 1SFLA 4JTSA 4UFJA 5F2LA 1K7XA 2CLOA 3F03K 1I2QA 4NJHA 1IXPA 1I8JA 4AWUA 2V2HA 5BNKA 1JUEA 1M6JA 3H55A 3W7KA 2J9XA 3UWVA 4Z1DA 4Q32A 3OG3A 3LI0A 1TSIA 1YTEA 4S2BA 1F76A 2CZ5A 3HGOA 1OFDA 4HN4A 4O0ZA 1XDLA 3H54A 1YYAA 3ANYA 4OT7A 2H8ZA 4LNYA 2OCZA 3W70A 3M1ZA 2QJIA 2YYTA 3KVMA 3LDVA 1ZFJA 3MI3A 1L6YA 4M5PA 5D37A 1GTEA 3TKFA 4MYXA 3LV5A 1DL3A 2EAWA 3E49A 2E77A 4DPQA 1FCUA 4IMEA 3NR0A 2V5BA 3OBKA 3HGSA 3ABRA 4AWSA 4U4MA 4BR1A 2GJNA 1VCVA 4K8HA 4CCEA 4H6KA 1V7YA 4YLWA 3GR7A 3TV8A 3CM4A 1HG3A 3G18A 1DBTA 2GQ8A 4TR9A 4BWLC 3QH2A 3O06A 1WBHA 3PG8A 5DN1A 1TV8A 1TB3A 1ZHAA 3LCHA 1NFBA 1OX4B 4MY8A 3EWBX 3LV6A 4QNWA 1Z42A 3BG5A 1XCFA 2ZA1A 4N6EA 5F1UA 2QF7A 2YGYA 3SW6A 5CPNA 1TQJA 2ATSA 1VGAA 1ZAIA 1R46A 3MP5A 4JX6A 3UWYA 1XC4A 1KTCA 5KZMA 4TU1A 1B4EA 4QIUA 1LOQA 2X2GA 1JJKA 3DBPA 4AHQA 3QM3A 3M9YA 1DQXA 4EIVA 1AL8A 2R94A 4UFMA 1WDWA 3BGJA 2VKZG 4O12A 4XBSA 1EEPA 4YL2A 2HS8A 3CIXA 5DY2A 1KFJA 3W83A 3UQNA 3W74A 2C6QA 4QITA 1OX6A 4JGDA 1W1ZA 5HR6A 2ATMA 1X7FA 4NU7A 1H7WA 3LCGA 1TJPA 1BTMA 4BI5A 4GJ1A 4IX0A 3S8HA 3MYPA 2Y63A 1PCWA 4QM1A 3IEBA 4O1DA 5K7JA 4GE8A 1UUOA 4WXZA 4K8EA 1X1ZA 4PL1A 1LBMA 3L2IA 3PVFA 4LVGA 3MP4A 2NXIA 1XUUA 3HPXA 4YXGA 1S5TA 3P5YA 1I2PA 4LU0A 1H7RA 3M41A 3LHYA 4GNJA 4IPJA 4WOZA 5C6MA 2V5LA 3M43A 1MSSA 5IM51 1K3UA 3EWYA 4K37A 2NX9A 3EWUA 2DU2A 3CLMA 2GVGA 3TH6A 3VCRA 5LSMA 1KM1A 4Z1BA 3B4UA 3MHFA 1O5XA 2C1HA 4Z1AA 1HFBA 1QFEA 1QAPA 5LHEA 3LHZA 3P74A 4XUGA 2PC4A 3W84A 2CFFA 2A6NA 3GYEA 1LBFA 3MHUA 2CZEA 1W5QA 4R33A 5U7SA 1W54A 2OJPA 1TTPA 2C18A 2TYSA 4LRTA 4N9DA 5G2HA 1LROA 4DPPA 1TREA 2NV1A 2GVLA 4DQWA 5EMUA 4X3ZA 1GT8A 4CNPA 5J5DA 2VENA 1LCOA 2QCCA 2VEMA 2YZRA 6ALDA 3IIVA 2QCEA 1PV8A 3RF9A 2NUWA 2V81A 3LTSA 1ONRA 1BWLA 5CZSA 3W7IA 1FWSA 1TQXA 4FX7A 3T78A 3TW6A 1OFEA 3S0CA 2VFFA 3C61A 3PR2A 1OYAA 3M5ZA 2ZTJA 1O5KA 3HJZA 1QCWA 3QRHA 4NJGA 3OA3A 3QZEA 3L0GA 4UTUA 2DZXA 4Q4KA 2EGZA 1WV2A 3CT7A 1W5MA 3FS2A 1Q6LA 2Y85A 1TPEA 2E5DA 3SIZA 3GXTA 4P2VA 4HHPA 3HB9A 4NQ1A 5K9CA 1JCYA 2A0NA 2J6XA 1BEUA 3GX9A 3SR7A 4TIMA 5F1VA 1RVGA 2VOMA 1H1ZA 5CZ0A 3W7NA 3CIWA 4DF1A 1H1YA 4O28A 2JKEA 1KV5A 3K30A 3CWOX 3SGUA 3W23A 2QDGA 3LI1A 4CNNA 4ZQPA 4N4PA 3NYZA 4AHPA 1H60A 1U83A 5K3VA 3GAKA 1K8ZA 1SPQA 3RFAA 1OFPA 1HL2A 4JIPA 3LHUA 4NZJA 3LBMA 2R14A 5FF3A 1G7VA 5I3JA 1GG1A 1A5BA 2OZ0A 4HSNA 4O19A 4EF9A 3HPSA 4BFAA 1P4CA 3EWZA 1H62A 3MO7A 1VLWA 2QR6A 3C52A 5AN7A 2CWNA 3C2FA 4IWWA 4BWLA 2Y61A 3V75A 4IMGA 1O60A 4JTHA 1A5CA 2ZZ5A 2ABAA 2FB2A 3EXRA 1XDMA 4AHOA 5LNVA 3S1UA 1SZGA 5AC8A 3UY8A 1AW5A 3E9AA 3G22A 4O54A 1GTHA 2VFDA 3LCFA 4U28A 4XTIA 2ISVA 3PC0A 4UTWA 3LGEA 4JTIA 4JY8A 2G96A 1UB3A 2C19A 3O6CA 3QPZA 5F2IA 3UXDA 2H6RA 3W76A 1GPWA 3CHVA 3QSTA 3P67A 2C13A 4EOUA 3LERA 1KFBA 5AC6A 2B0MA 4P61A 2CLLA 2A5HA 3W1XA 1RQHA 1H61A 1K03A 4DO5A 1JULA 1QDSA 1RZMA 5U4NA 4M7SA 2XN2A 3W9ZA 4O4WA 3LTYA 3W1MA 3DH7A 3WJWA 1G4TA 3W75A 2E6YA 4CLMA 2WSYA 3B8DA 2Y7FA 4BI7A 4ORIA 2ZRVA 1VPXA 4M19A 5C54A 1QR7A 2QCHA 4O11A 4OWGA 1K8YA 3P84A 1EUNA 3KVKA 4ADTA 2UV8G 4O15A 3TW7A 3W1NA 3C2RA 5DLCA 4E2DA 3L5AA 4UFHA 3W7GA 4AAJA 2Y7GA 3HIJA 4LUJA 3N9SA 1R2SA 2HMCA 4NNBA 1N55A 2CLIA 2YPIA 3NOEA 1UJPA 2ALDA 2DZWA 2G5WA 4A29A 3A9IA 3M5XA 3OIXA 5K4ZA 1OABA 2YFOA 2VELA 5G1YA 1FDZA 4JXCA 1K8XA 4RK8A 5EL1A 3W3OA 4GUIA 3O8AA 2PRMA 2Y6ZA 3G8RA 1SW3A 2ZRZA 5EA9A 1LBLA 4IXXA 5BMWA 1DJQA 1UCWA 4OBTA 4WUIA 4UMAA 3OVRA 2ZTKA 4WXYA 4MLJA 4Y96A 5FF4A 5AC7A 3TX9A 2CU0A 2QCDA 2EKCA 2Y70A 3EKZA 1A50A 3GK0A 3AJXA 5LNUA 1KM3A 1M5WA 3LXBA 3PULA 3STFA 1D3GA 4DBEA 2ZDRA 4G1KA 5D2WA 5I3IA 2VC6A 1JUKA 5F4SA 3B05A 2CLFA 3UPBA 4X2RA 4NNAA 2ZYFA 3STEA 1J5TA 1BWKA 1FY6A 3NQ2A 1EIXA 3TFXA 5ABTA 2DZVA 3W6YA 2QUTA 5AHNA 2OMAA 3NZ1A 3C56A 3MI6A 2BZNA 1FUYA 2A6LA 1AMKA 2PE4A 1ZAJA 4HNUA 1YXDA 2PURA 5MHBA 3M5VA 1DQWA 3R13A 2Q8ZA 2R8WA 3PB2A 4ZQOA 4I9AA 3SGZA 3W7PA 1IF2A 1SO6A 1ALDA 1AK5A 2XN1A 1PHQA 3QPYA 1OX5A 2I14A 4LVAA 3NDOA 4RCXA 3LHVA 1NAL1 4UFLA 3STGA 1JCNA 3USBA 2FPVA 5KITA 3KAOA 1IIHA 4MFDA 4GFSA 4LS1A 2ABBA 2FTPA 3N9RA 4JTUA 4Z0SA 4AF0A 1PIIA 3MMTA 5DBUA 4K39A 1KA9F 5I3HA 5E93A 4ZZ9A 4FF7A 1W8SA 1SZEA 5SWUA 3Q94A 4YMZA 1ZJIA 1ICPA 1XFBA 3OHIA 1R2TA 5GVJA 4EVZA 4NNCA 1TPFA 1WYIA 1CI1A 1KBIA 5AHMA 3TE9A 1FQ0A 3HG5A 1TPUA 3ATYA 3NM1A 4OQVA 5DBTA 5C2XA 1NEYA 4RXGA 5J5RA 4MVAA 4CQ9A 5I3GA 1YTDA 4OU1A 4RJEA 1W56A 3GNDA 3LRMA 3TMQA 1FDJA 5G4EA 1TPWA 1UASA 1QO2A 3NL3A 3WJYA 4JY9A 4O57A 4UTMA 1EP3A 3NPVA 4UR8A 3DAQA 4B5NA 1H50A 1VYSX 2C15A 5DY3A 5K4XA 3O63A 3IIOA 4XZ9A 4UMCA 4Q33A 3Q2DA 5FEXA 3TJXA 3PBUA 3W7QA 1YDVA 3KFTA 5G4WA 3OVPA 3B0PA 5AHEA 3TC6A 3CEUA 3G3DA 3MBDA 1SW0A 2RKXA 4UXDA 3P60A 3S5NA 1NVMA 1FWRA 5A5WA 3S6DA 5AOUA 1KM4A 2ZZ3A 3UZ5A 3PUEA 3LX9A 4JIQA 3KX6A 4AWTA 3EXSA 3NM3A 4UTJA 3WJXA 2ZA3A 1AG1O 1LYXA 3W87A 2VFHA 3TQ0A 1OYBA 3BO9A 1LZOA 3WK2A 1KM0A 1WXJA 3ZFHA 3P8IA 5D09A 2RDTA 2QAPA 3HF3A 3HGJA 4RX0A 2Z6IA 4UFKA 3A21A 5FEZA 5EY5A 3SECA 1SSGA 3NQAA 2DZPA 3S1WA 4XWUA 1KV8A 3E02A 3TMLA 1TMHA 1OK4A 1PL9A 3G1FA 3KVLA 4MJMA 3UD6A 1VS1A 1A5AA 3MW7A 3DU0A 3W7OA 1YDNA 1VH7A 4POCA 3TR2A 1PHWA 3KOFA 3CPRA 3EB2A 2NWSA 3RLUA 1F2JA 3FIGA 2QJHA 3W7DA 1TPDA 4RR4A 2I9EA 4JDYA 4HNVA 4ZVJA 1VC4A 1VJIA 3W1RA 4QAIA 3C2OA 1FCQA 1MEWA 1KFLA 5CSSA 3RNDA 2E6AA 3W1LA 1RQEA 4RZ4A 4MJZA 1JUBA 5LGXA 5D03A 3YPIA 5KINA 1KLZA 4NT0A 3P81A 3VNDA 2X30A 2NX3A 3EX3A 1V5XA
chains in the Genus database with same CATH superfamily
1TELA 1JZ4A 3FYOA 3WNMA 1CLKA 2XSBA 1EQPA 4GO9A 1WDPA 3MZ2A 2XG9A 5TBOA 3MUXA 1IT7A 3M0LA 4H9VA 3ABZA 5C2GA 2PSNA 4PR4A 1A3XA 3V1PA 5HQEA 3PSWA 3ABSA 1ZZMA 3TYBA 2PTDA 5D32A 1XBYA 1TUFA 2W63A 3CGTA 3LPFA 4GXPA 2IKIA 3ARYA 3E1F1 4A6GA 1QW8A 1UOZA 5CAHA 4FNUA 1VBGA 1LQ0A 4J3ZA 3BQ5A 1HKIA 1RJPA 7ODCA 3W7RA 5CSRA 1JZ6A 1C3FA 1DTUA 4UWMA 4F0HA 1EBHA 3I7RA 1SO3A 1EJTC 5D2XA 4TOQA 3EMCA 4H6EA 1BQGA 3BLKA 2VVNA 3KL3A 3W1AA 3FLUA 4US6A 4HGXA 4JNZA 2Q02A 1S2CA 5G1TA 1QATA 4TO8A 1JPHA 3TAKA 3NG3A 4QXIA 3LPGA 5JH2A 3UW6A 1SR9A 3MZNA 3A13A 1JF6A 2VCBA 1G9HA 1NARA 1C91A 4P7RA 4A3QA 1HJUA 1GVYA 3KRZA 2WNNA 5A8GA 5D9MA 1EX1A 5F4XA 1F6KA 4LUSB 4QNEA 1P7TB 1J96A 2DT3A 3AYTA 2CHOA 3R58A 1GK8A 3EXTA 4CCDA 4E4PA 1E6SM 1W9VA 3CMGA 1YXCA 2QPSA 3F4DA 2ZXDA 3V4BA 1R9YA 3E5PA 3BLLA 3W88A 1MFVA 1LOSA 4A35A 3ARQA 2FB3A 2NUYA 5XIAA 3C2VA 3RYSA 2QJNA 1OFRA 4XO7A 2WZMA 4E8DA 5D4YA 4O1BA 4XIAA 3HZ3A 3BLIA 3G77A 5FJPA 4DLFA 5HQLA 1F05A 2WO5A 1KR1A 1AJZA 4C5YA 1OF8A 3HQNA 4LF1A 4PTMA 2JK2A 4R3UA 4C5ZA 4WX2A 2PDBA 3W1TA 4BZYA 2KX9A 4DO6A 2C14A 1HO1A 4R9XA 1EDGA 3W82A 3DHUA 4G56A 3UCQA 5HJLA 4LANA 3W27A 5CG7A 1VKFA 1JCTA 3I6TA 3UGVA 5HR7A 3UWZA 1OIFA 3OJGA 4RL3A 1H5YA 1CXKA 1WKFA 4XKYA 3PM6A 1LLOA 3KHJA 4FXRA 3BZJA 3ZZ1A 2WVSA 3IJDA 2X05A 3LCXA 4TMBA 5BCAA 1VCGA 3VKDA 1GVQA 2OQHA 3UYIA 4CD6A 1KGXA 3VD7A 1EC8A 8XIAA 2Z7KA 3LQGA 4HMEA 1JCMP 1QK0A 4O8RA 1W31A 4ZR8A 2ZZ1A 2A2IA 5BRBA 3VU2A 2UY3A 3OA5A 3QHNA 2OLHA 3BPWA 1FOBA 2BB0A 3GXNA 5C55A 3L67A 2I5GA 3WQPA 1RP9A 3M47A 2VDHA 5AZ1A 4E4UA 4JN8A 3A4WA 2OGJA 3ALGA 4GXMA 4X22A 1M41A 4GNVA 4F48A 4BHYA 3PUGA 2DPEA 2I56A 3REQB 4KKXA 2V9DA 2D73A 3QYSA 4Q8TA 3SN4A 1I2RA 5HANA 4XISA 4IGSA 3GU2A 3JRKA 3CYJA 4JKLA 2Y62A 1WOAA 3WBAA 1P5BA 5PTDA 2ZX9A 3ZYZA 4I9JA 4GRSA 1W9PA 2J8FA 3LBCA 4KRUA 3QXBA 4AIEA 1KXQA 1XXXA 1CENA 5AVHA 4QG6A 2QEZA 2X16A 3LD5A 2X41A 2WJFA 2VZTA 1TX0A 2OZ3A 4W86A 2CERA 5MF5A 5AKQA 2CYGA 3ZWSA 3KWXA 6XIMA 3EBVA 4HPHA 4NZCA 4RUBA 2I9UA 5FJUA 2V2DA 3FGCB 2OT0A 3EAUA 1XL9A 1NQ6A 1IXQA 3HFTA 2HBVA 4JTKA 4XD6A 1RBAA 5CKSA 4HZ6A 4GC3A 4UFIA 3MCNA 2DVXA 3TTYA 1UD3A 3VC5A 3LPOA 3DFSA 4AYGA 1J0KA 2XU2A 4JTGA 2ZZ6A 2QUMA 2YJQA 4YCOA 1VFFA 3WKZA 2VT0A 1PE1A 1QI4A 1Z48A 4S39A 1IEWA 4XZNX 3TP4A 5F2GA 4IMAA 3EDFA 1KCZA 5AC5A 2PCEA 4B5TA 4HVXA 4C6KA 4BQ5A 4Q7BA 3C6CA 4S1FA 4GZIA 3WBYA 1M7OA 2XVPA 2IQTA 1G7UA 2XGIA 2QVHA 3OLIA 2DY3A 3ARWA 2V69A 4ADSA 2G3JA 4DLMA 4LBUA 3PF3A 3AIEA 4DRSA 4YTUA 2PMQA 4GUJA 4WQ6A 4JTCA 3NQEA 1D8WA 2R82A 3GLCA 4WEVX 4QISA 3R94A 1MUWA 3WUBA 4DF0A 2IKHA 1B9BA 2WW5A 3QEZA 9RUBA 2PRLA 1HGYA 3OGSA 4JYEA 3DESA 3F4VA 2PI6A 4JQ4A 2G37A 1Q66A 3N4EA 2PDMA 3BVJA 1FVPA 3QMRA 1XGEA 3HV8A 2HSAA 5E0KA 4NAFB 1BQCA 1MDLA 3M16A 3W02A 4JHOA 5JXQA 4HHMA 3AXXA 3H2NA 1NWSA 1I45A 3N3MA 4BI6A 2AAMA 1UUMA 4MKSA 3ARXA 2AL1A 1BGAA 3UWWA 2EG6A 4M8UA 3IVSA 4QS5A 7ENLA 4I7WA 5K9DA 4A3HA 3STCA 1L6WA 3OBAA 4LOCA 1JQXA 4NZ3A 5HPOA 4MUZA 1RBOB 4PULA 2NZLA 5LHFA 2PWGA 2VQUA 4X2PA 2VEIA 2I1OA 3UPWA 2Y1HA 4REQA 1EX5A 3UERA 1ZQ5A 2BVTA 1XIMA 4AB4A 1IEQA 2XSAA 4J28A 1OD0A 1BFNA 3E12A 1JF5A 1GCYA 2IXVA 3PBVA 1TWIA 3N15A 5E9AA 4H6RA 3GY1A 1ODUA 1EGVA 4KETA 1JDEA 1PB0A 1VHCA 4LYPA 1A3HA 1JPKA 2YOCA 3LYEA 4L4LA 1LDCA 5C2CA 1CXIA 4WSJA 4N2YA 4B2DD 3S1XA 3AALA 5FI8A 5KSWA 1V02A 4TVUA 3W7EA 4ZB5A 3U48A 5HMSA 1V8EA 1XRSA 2WKJA 5C0QA 2QCFA 3PP7A 3MP3A 4NVTA 4ZOAA 4DBDA 4HT3A 4P7OA 1YXYA 1FWAC 5CH9A 3WQFA 4CN1A 3IS4A 4NRRA 1G4SA 1G0CA 4LH8A 2YR1A 1E6RA 1MZRA 2P0OA 4GNKB 3GBEA 1R0MA 3DHDA 3PTQA 1QO5A 2LLEA 3PBWA 1VFUA 4AIOA 1V79A 3WDHA 3NL5A 1PIGA 4HOZA 4PSPA 4Y8FA 3MQTA 4QQ3A 3WQDA 1J0YA 4YIWA 1Q8JA 4JS3A 4HCHA 5GPRA 1EWDA 4UUIA 3EWXA 3RJXA 3L4VA 3KDNA 1AL7A 4R53A 3P7YA 2BFGA 4B2DA 3AS2A 2F2KA 3GB6A 2Z1BA 1EGMA 4LCRA 3URQA 1NDYA 4QE4A 4PMDA 1Y7VA 1ZUAX 2PGRA 1M7XA 1DHPA 1SFTA 3BMVA 1V93A 3WK1A 4OKDA 1VFLA 4NSBA 2A3EA 1TTIA 5A8OA 2VYOA 5AYYA 3VILA 1EF2A 2RHGA 1Q6CA 2FVKA 3SCUA 4QBXA 2Y88A 1OG6A 2ZZ2A 3UXAA 2WJDA 1TWSA 4LVBA 2PDJA 2DT2A 3KBSA 1DJYA 2CKSA 3EKLA 3EX6A 4D2JA 3FYPA 2V3FA 1A5UA 4JHMA 3L4TA 2FZ8A 4F8XA 5I06A 1B3WA 5A8NA 5M3WA 2WNWA 1YKWA 4W5ZA 1GOMA 4ML9A 2V67A 4KF1A 5FJRA 1VEPA 4LQ1A 4W7VA 2QT3A 2DZUA 1TPH1 3KBWA 2A7PA 3IUIA 2ZQ0A 4CEXC 4WY0A 3GG1A 1GNXA 1POKA 2A3CA 4GX8A 2ZA2A 3P61A 5FCZA 3VE7A 2PDGA 2ISWA 1DKWA 4XQ6A 1MNZA 2QLYA 4LS2A 6REQB 3VGHA 2PRHA 4PFHA 1L6FA 3V0SA 1NSJA 3PUOA 3NGJA 3EEGA 3ITGA 3G0XA 3NJ3A 4Q8PA 3IUHA 1S3TC 1E72M 2QCLA 1VFOA 4QQUA 1JDDA 3R5EA 3GHRA 4M6VA 1XHGA 3TAOA 3GTNA 3IIPA 3N12A 1F74A 4I7UA 3C0QA 4HNTA 4JIHA 1O94A 4HSHA 1RJQA 5D9PA 1KR0A 1E1FA 5CSYA 4Y9PA 3KBNA 4MOZA 3B8IA 3CUXA 1UR4A 3IGXA 5LGZA 1RD6A 3QR0A 1E0WA 2WMKA 3BAXA 1AD1A 2G3IA 3S4TA 4ENLA 1BXNA 5CZKA 4HJFA 2RFGA 1RD5A 2KAUC 4MF4A 4U5IA 2X1TA 1GZGA 1E4LA 3PNZA 5D05A 1ESWA 2YX0A 2ANUA 5HWJA 1WA3A 3ABXA 1KNWA 4IPPA 3VIPA 2YDAA 3WQEA 3I7QA 3ITOA 2GVYA 1ML1A 2DJXA 3NPXA 1TPVA 1L9WA 3N34A 3JR2A 1X1OA 4MTVA 4DJED 1N8FA 1W3NA 3ITTA 3D47A 1I2NA 4PRWA 5A6KA 2OT1A 2C3ZA 4RNFA 3BARA 4C6BA 3W24A 5LZLA 1NFGA 1V02E 1HQTA 1E5NA 3G1HA 4RPPA 1O68A 2B4GA 5ENLA 4S38A 2PCQA 1VBHA 3AICA 1B1YA 4CN6A 4R9OA 3QMTA 2OR2A 2VXNA 1LM1A 3CZ8A 2OWXA 3TJIA 2P3EA 2F7FA 3BSGA 4JX5A 1UD4A 4IGHA 2XDFA 5A2CA 3GR8A 1KCLA 4JAWA 1UZ1A 4IG2A 1FCVA 1C8VA 4C6PA 2BXVA 3GKFA 4PUDA 4XAFA 1JNEA 1LRTA 3KVJA 1KXVA 3MI2A 4GCAA 3UXIA 1NFPA 3ZVIA 1O1ZA 3INPA 2WSPA 2F38A 1KM6A 4CCZA 4HHHA 5EMKA 1KFCA 1IWPA 3URBA 4K1GA 1E56A 3L68A 1TE6A 5HNRA 5FAJA 1V08A 4N4QA 3FY1A 3C0LA 3S5OA 3L0KA 3DI1A 3JUGA 3RX3A 1IHIA 4B3LA 1I1XA 4W8BA 4RDZA 3V5CA 2XM1A 2V3EA 3AIBA 4LX4A 3NA8A 1JQVA 1ME9A 5L6UA 5FEPA 2Z2UA 4GUHA 4NYUA 2Z27A 3NNTA 1W5OA 1A4LA 5REQA 1DJNA 4QDWA 3TYAA 1O5QA 2GVJA 4KWSA 1T99A 4Y6GA 4G7EA 4UR7A 3CLWA 4AWEA 2RDUA 1GPFA 3FX4A 1Q6OA 1S5WA 1W3IA 1GHRA 4FX6M 4AH7A 1O95A 4HA3A 2VUYA 4LAUA 2QQ6A 1UP0A 2P1FA 1HP5A 3V0TA 1QXLA 1TFVA 2DW7A 1JGMA 4H9ZA 4IQLA 3ZLGA 3PS7A 3BTNA 1W5PA 4LRSA 3HJEA 1OF6A 3R4IA 4JIEA 3A12A 3NVTA 5BXSA 2PFHA 2WC7A 2G3MA 5HMDA 1XV8A 2FHCA 3JZEA 4MB4A 4TTUA 4A2RA 3DHFA 1YMYA 2NLYA 4JICA 3E96A 4LYKA 4O10A 3NQ7A 3EA3A 4TV6A 4XTDA 3HGRA 3N2XA 1MQQA 5F4WA 1L6SA 2WCAA 3N6QA 5IXEA 1YX1A 3U2OA 4M51A 3SJ3A 2AL2A 4IISA 3B04A 1JPIA 4LV4A 3RN6A 3GDRA 4ADUA 3GIPA 4XKMA 3CQIA 4LT9A 2NQLA 1WBJA 1XC6A 1GOKA 2J8GA 1TPB1 1G4EA 3UJFA 4ZMGA 2FDSA 3DI0A 4JNMA 3V3WA 5DCBA 4LF2A 2E6DA 3PPCA 1B3ZA 3FJNA 3DGRA 2O9PA 1K7XA 3F03K 4AWUA 2V2HA 5DMMA 1WO2A 1R3QA 2X2YA 2Z26A 1TR9A 4U2ZA 2AKMA 3T08A 3W7KA 2AOSA 2PDUA 4AEFA 2P76A 3VABA 3VIFA 3LI0A 1P0BA 1TSIA 3NGFA 1F76A 3WG6A 1OFDA 1TV2A 1YYAA 4FSAA 4OT7A 2QJIA 2YYTA 3QZ6A 4L1WA 1RK5A 1JDFA 3A4AA 3KVMA 3U7BA 3LDVA 1MNSA 2EJ1A 1L6YA 1GTEA 2EAWA 5IDIA 5F7UA 5FJJA 3BAIA 3EDEA 5H1WA 1H3GA 2FZ9A 4K8HA 4KW2A 4YLWA 3TV8A 2VX5A 3CM4A 1HG3A 3G18A 1DBTA 4TR9A 3VM7A 4J40A 4HU8A 2PWFA 3EDDA 1AH0A 4NRSA 2GGHA 5DN1A 1TV8A 4F9JA 4A8RA 1ZSXA 1OX4B 2WVVB 3EWBX 3LV6A 3BG5A 2ZA1A 2AGTA 1J2BA 2PD9A 4MWAD 4GJJA 4WGHA 2D1ZA 1ZAIA 1R46A 1YE6A 3MP5A 1D8CA 3UWYA 1KTCA 3VC6A 2X2GA 1JJKA 4Y7EA 3QM3A 4XZHA 1DQXA 2R1NA 3WMCA 3B8UA 3CIXA 5BOEA 5LIYX 1KFJA 3WYZA 1B2YA 3W83A 3AU2A 3C8NA 4QITA 1MW2A 4V1XA 4I8YA 1US2A 3FA3A 1X7FA 4NU7A 1PX4A 3K8KA 3CASA 4GJ1A 3IANA 4C6IA 2Y63A 2OSWA 2F8QA 1V0KA 4PMZA 3AMKA 3JW7A 4F3HA 4WXZA 1OCQA 3MP4A 9XIMA 3AIVA 1EJVC 3URAA 3M41A 5C6MA 4IP7A 5J8LA 4NI3A 1MSSA 5IM51 1K3UA 3I4KA 3ITVA 4K37A 4B9ZA 3WCZA 2ZVIA 3UZWA 2DU2A 3CLMA 3S2LA 3WLHA 3TH6A 4HPGA 1KM1A 5CPQA 4CU7A 1FA2A 4IJCA 4LUSA 2CXEA 1O5XA 2C1HA 4DUVA 1P7TA 3LHZA 1Q6EA 2PC4A 4AZHA 3S47A 1M7JA 4EX4A 1BHGA 1QTWA 3GU1A 4AIBA 5FIPA 1NWTA 2CZEA 1W5QA 4R33A 3RPDA 2NQ5A 2OJPA 1K6WA 2TYSA 4LRTA 5G2HA 3IAPA 2VWTA 3CHCA 2NV1A 4DQWA 5J5DA 4CNPA 4WDXA 1EJSC 1WP6A 1B9ZA 3GW3A 1VF8A 3RF9A 2DH3A 3S6OA 5D8WA 3EPOA 5CZSA 3GVWA 1FWSA 4FX7A 5AYBA 1OFEA 2X0SA 7XIMA 2O9RA 3C61A 1CLVA 3PR2A 4ZGYA 1OYAA 4YYCA 2ZTJA 4L9YA 1QCWA 3M0HA 3QRHA 3TC3A 1B5TA 4NJGA 3PZGA 5DX7A 3F7JA 1QOXA 3VXGA 4ZTYA 3HQOA 1Q6LA 4BEQA 2E5DA 4H9TA 3GXTA 4FOUA 5K9CA 2FMNA 1BEUA 1CT5A 2J6XA 3T2PA 2VOMA 1GORA 4GYJA 1H1ZA 9XIAA 1DXEA 4GPNA 5AECA 4DF1A 1EO7A 3AISA 3SCTA 1H1YA 4O28A 4F66A 1A4MA 3MKVA 1XLKA 4WVXA 1PYFA 2QS8A 1XLBA 3CUFA 3WDPP 1F8IA 4ZQPA 4AHPA 4W4QA 3CQJA 1H60A 3OLGA 2IPWA 4NF7A 1SPQA 2Q01A 3RFAA 5BU6A 5LA2A 4JFSA 3CUGA 2EO7A 4JIPA 3GVVA 2R14A 5FF3A 3SN0A 4B5UA 3KS5A 1A5BA 4GBDA 3OLDA 4E2OA 1QWKA 1H62A 1H09A 1QJWA 2QR6A 3MT1A 3C52A 4GYPC 1CPUA 2CWNA 3OZYA 3G5EA 3MMWA 3GG0A 4BWLA 3E0LA 1DJGA 2ZXQA 1UH3A 1BYCA 3REQA 1A5CA 2VL4A 2ABAA 2FB2A 1XDMA 3S1UA 3UG3A 1SZGA 1AW5A 4U28A 1Q4WA 3CHFA 1W3JA 1UD8A 4UTWA 1UB3A 3UXDA 4QTGA 2QMKA 3CHVA 1F8MA 1G01A 2PEVA 3P67A 3V7PA 2E3ZA 2OZTA 2CLLA 3ZT7A 3A47A 2A5HA 4CQCA 1Q2SA 1EQCA 1VBJA 1Y5WA 2EKGA 1QDSA 4RZBA 1RZMA 3RCNA 3W9ZA 4O4WA 3LTYA 4Q8NA 3W1MA 3DH7A 2YB4A 3UPMA 2XIMA 3WJWA 4H7ZA 4PE8A 1I60A 2E6YA 4JKKA 4C7GA 3B8DA 2YBVA 1DXIA 3P0XA 4B15A 2OOGA 3QOKA 2DVUA 5DEZA 2ZRVA 4NHVA 3BLPX 5C54A 3EOEA 4OWGA 1CB7B 1XLMA 3VZZA 1HT6A 4YYFA 4GFIA 4PYSA 3RR4A 2ODOA 3TW7A 4AD5A 1Q8AA 4Q7IA 3J7HA 3QQWA 1RHCA 4AAJA 4ZCWA 2Y7GA 3HIJA 5B7YA 1R2SA 1WXZA 1U5VA 3EA2A 1XYFA 1W3HA 3G1RA 2CLIA 2PF0A 4GIRA 3KBJA 4LUYA 3AXIA 2DZWA 2DW6A 3A9IA 3M5XA 3OIXA 5K4ZA 3GO2A 3NVDA 5XIMA 2VELA 3P6LA 4GUIA 3ZJ6A 2Y6ZA 4H1ZA 3FJ4A 1SW3A 2ZRZA 1Z9AA 1LBLA 4GGHA 3OZMA 5BMWA 3ZR6A 1W9BM 1HKWA 4MDOA 5HQMA 3OVRA 5LIXX 5FF4A 3MVTA 5AC7A 3TX9A 2CU0A 1WDQA 3EKZA 3GK0A 3ZSSA 1UWTA 5LNUA 4AEEA 3SCQA 4DBEA 2ZDRA 3PFMA 1LWJA 5I3IA 3B05A 4DNMA 3BC9A 4NNAA 2ZYFA 1FY6A 3NTYA 5ABTA 3P93A 2QUTA 3AUJA 5AHNA 4NAFA 1NDWA 3MI6A 2BZNA 1AMKA 4RDYA 1ZAJA 2ZUVA 4ZO9A 3M5VA 1P43A 3PB2A 3ERPA 4ZQOA 3VINA 4EP8C 3M0IA 1AK5A 5DMLA 1PHQA 3QPYA 3GNXA 4RCXA 3A4JA 1NAL1 1XRTA 4UFLA 3STGA 4S3DA 4LAZA 4GFSA 4HMDA 4Z0SA 5EBAA 2UY5A 3AYRA 2PDQA 3QGKC 4Q4MA 3LSCA 5E93A 1SZEA 4JFUA 4PCPA 4YMZA 4HJWA 4AQLA 1FHLA 1ZJIA 1UWUA 1R2TA 5AC4A 1KWKA 1GONA 4EVZA 1AUSL 5AHMA 1CI1A 1KBIA 3TE9A 1V77A 3AJ7A 4EANA 1TPUA 4OQVA 5C2XA 4GKLA 1IWAA 2Z2BA 4OU1A 4RJEA 1W56A 2ZE3A 2GZXA 4IPLA 2ZDSA 1ITXA 3GNRA 3D6NA 2VJXA 3NL3A 3LNPA 1CGWA 2E1WA 4QX4A 1UYQA 4O0QA 4RV3A 2L5HA 6TAAA 1TVLA 3UR8A 1EP3A 3C3UA 4WKAA 4ZOEA 2FTYA 3NOYA 3WFLA 2QIWA 3AS0A 1UA3A 1H50A 3VNLA 3TQPA 2CBJA 4F79A 4Q33A 1ZB5A 5FEXA 3TJXA 4GY1A 1YDVA 2CZVA 3CAQA 3S1GA 1DWGM 3TC6A 2W3ZA 4KRZA 4AZGA 4F9DA 1QW7A 3MBDA 4U5KA 1SW0A 3P60A 1NVMA 4W5UA 5A5WA 2ZZ3A 4ILSA 4AY8A 3LZ3A 3IUDA 1XH1A 3NM3A 1AG1O 1LYXA 2VFHA 1E4MM 4GMEA 3PZIA 3WK2A 2GGJA 5D09A 2RDTA 3U2EA 4WKFA 2Q09A 3A21A 2Y0FA 1SSGA 2DZPA 2CXGA 4XWUA 1P0DA 3M4HA 3PZ9A 3MTWA 1EC7A 1PL9A 3KEHA 2VURA 2AQOA 4HD5A 3UD6A 3QV7A 1A5AA 3MW7A 2WM1A 1UBPC 4YVVA 2PF8A 3M0XA 3RM9A 1PHWA 3KOFA 3AHXA 2XWEA 1F2JA 1IT0A 4D1JA 2NT0A 1TWWA 2I9EA 4PMUA 4JDYA 4AIUA 4LBRA 1VC4A 3RX4A 1HL9A 4RDVA 1SR0A 3W1LA 1RQEA 3LMZA 1JUBA 3YPIA 5KINA 4ZE5A 1KLZA 2C7FA 2NX3A 2QNEA 4KERA 2QJJA 4NZFA 1K8CA 3VKJA 1JI2A 5I79A 1I75A 1PVNA 2OVLA 4J9JA 1Q7QA 3S9ZA 3CUZA 4OBSA 1IT8A 3BAWA 3DXIA 4O16A 2WMIB 4YN5A 1JG9A 4CCCA 4EPEC 3TTOA 1CECA 3S2MA 3SURA 4JN6A 5BZAA 3PAJA 3UP8A 5BROA 4DY1A 2XH2A 1OGGA 3IGUA 2H90A 5A1AA 4KWUA 1VCFA 2IW0A 1TMQA 1IEIA 1EHNA 1WAUA 1UROA 2WHKA 6REQA 1ONWA 3PZNA 3QQ1A 3TEVA 1G4PA 1D7FA 1U22A 1KC7A 1QMLA 2OELA 4GC4A 1I2OA 3QKEA 5I02A 3SQSA 3B97A 4JKMA 3NQDA 1ITQA 1LJYA 2BSLA 4OVXA 4XZLX 2QUNA 4GABA 1D3CA 4TX9A 3QC3A 3WL1A 3AWOA 2ZUNA 3SSZA 2E1DA 4IMFA 1R3YA 4H9YA 4HB7A 3I4EA 1B57A 1LL6A 1HGWA 2C16A 2PTWA 1Q7ZA 1E1EA 3VD9A 1UPMB 4IIHA 3GNOA 3ZSTA 3TYCA 1IZJA 4RZ5A 1JD9A 2YW3A 4IUOA 1E1CB 2ZRUA 4KEVA 4O52A 1H7OA 1KFWA 3CB8A 5CZTA 4O14A 3IJ7A 1W17A 4GD0A 4H8NA 2Q8XA 3WK3A 2TODA 2Z1KA 4ASTA 6CGTA 5T91A 4IUGA 3IIXA 4TVDA 3N2CA 2XH7A 3WDQA 2RDWA 2A3HA 1GJWA 1BSLA 1SZFA 4AMCA 3CAKA 3O3RA 4AG0A 3BOFA 4R7JA 3C5QA 3ZXWA 2GJLA 2W79A 4A3RA 4YWSA 4RV8A 2V63A 5E5CA 4YJ5A 3BW3A 3SADA 4PMXA 2PD5A 4CD8A 1CEOA 1HVXA 3H2FA 3RMJA 3GNNA 1QI0A 3IPWA 4AYSA 3NEVA 1T40A 2EF9A 5DT5A 2GQAA 3IGHX 5CQ1A 1XIBA 1DE6A 3L4XA 4HTBA 3BW4A 3F2CA 4ACYA 2CW6A 3P5ZA 1W8GA 1UBSA 4A3UA 3POHA 2ESCA 1FWCC 1CW2A 1R30A 3TFCA 1O6IA 1IZCA 3E2QA 2UBPC 3COTA 3SIMA 1S3HA 4GI6A 1XKYA 1KCKA 2FKPA 2DP3A 1CGUA 2WPBA 2JFEX 2R9RA 1W1VA 3HBLA 2NV2A 3RM4A 4ML4A 4IQDA 4ACZB 4HPXA 1TO3A 1U5HA 1XH2A 1V51A 2CEQA 2PWUA 1ZS2A 5M2FX 1DWAM 4AD4A 1LORA 1EXBA 5LA1A 5LIUX 4ZA0A 3R8HA 4AZ6A 1VZWA 3CPUA 2EG8A 4MZYA 4WJXA 3D3FA 3VFLA 1WX0A 2WANA 2PTZA 5FF0A 3WO8A 4K7VA 1HKJA 1DE5A 3N2MA 5CBBA 2ISSA 5A6AA 1IYXA 2DFAA 1BVZA 1UMYA 1OCNA 3C0JA 2YKKA 3GBDA 3NYDA 2GGGA 4MFEA 4J3UA 1DPMA 1R3TA 3K4AA 2VGIA 1GQNA 4R34A 3BV4A 1D9EA 3ITYA 2W67A 4C6DA 1MDRA 4LS0A 2ZX6A 4PCFA 4GZJA 4PB3A 1BLIA 5EB8A 3WJZA 1ONEA 4OV9A 1BD0A 1HJQA 1GEHA 3L2LA 5LKYA 2DUXA 2FFCA 3VMOA 3WEOA 5EGRA 3U2CA 2HVNA 3G8EA 1X97A 3KRUA 5LIKX 4GVHA 3EDKA 2EEXA 4UC5A 5EYWA 4ZOCA 4GY7A 2G97A 4UMBA 1EWEA 3Q58A 2Q3RA 3FAXA 1J4EA 3DENA 1Y8BA 3W2UA 2XH0A 4IFOA 2Z25A 2FYMA 4V1YA 3TSBA 1GVIA 1PKNA 2OQYA 3LA4A 3LHTA 2BHYA 3ABQA 3W22A 3VFCA 5GJNA 4AZ7A 3CH9A 3VO0A 1KW1A 3KRSA 4XBJA 3NAVA 2YDQA 1W9XA 4XAZA 3KHDA 4E2VA 1FXQA 2WYSA 1XLIA 1NF7A 3GXPA 4ZQRA 2J75A 4NIRA 3AMDA 3LCIA 3ARSA 2OSXA 4D6HA 1LLWA 2PWHA 3CNYA 2QCDB 3VIJA 3VZXA 2CBVA 1BF2A 4NY2A 4JHZA 3HG2A 1PO9A 1VLIA 4FAMA 5L9FA 4ZEPA 4DWSB 1EJXC 2C79A 4CQ8A 3MDUA 2RUSA 4JYDA 1FHDA 2ZWYA 4J3VA 3QY6A 2V8ZA 3NIYA 4L1XA 3BH4A 1V0LA 1ZNNA 1TWZA 3VIOA 4F0LA 4M6PA 1FCBA 3PSVA 4PH6A 1F73A 3I7SA 1NDZA 3H6OA 3EMQA 1XLCA 3DG7A 1XLFA 4WY0F 3TA6A 2OXNA 3E5BA 1J0ZA 4GG9A 3F5LA 5LNSA 1CGVA 3EWWA 1HP4A 2Q71A 5HUPA 3HG3A 3L2MA 1GOOA 1SJDA 4GGBA 4F40A 2BGSA 2W66A 3W29A 4MY1A 3LRKA 1DJZA 2YIHA 1SJBA 2CZDA 1CLXA 2FJKA 4EXQA 1LWIA 1H5VA 3MUY1 3AXMA 2O7QA 4H3DA 5JBEA 2V38A 1DIDA 1KQYA 3VNJA 1GOWA 4FALA 1OX4A 2WVVA 3CMFA 3UG5A 2TRSA 1H1NA 7A3HA 1CGXA 2XFRA 4M0XA 4LFYA 2VGBA 1HO4A 3TWAA 3N3TA 3LZ5A 4H7CA 4GY0A 1V3HA 4G6CA 3S42A 1VFHA 3BJTA 3EB4A 7PTDA 2ACUA 2X1IA 3NQMA 1HXJA 3THCA 3T42A 2A4AA 3S83A 2A7NA 4ZSUA 4F0MA 1B3XA 2VO5A 3R0DA 3LOTA 2NSXA 3LRLA 4NX5A 3S3GA 3EOOA 1XIIA 3ZLFA 3SZ8A 4FXFA 3PTKA 3H2MA 4ICNA 4XO6A 4GACA 4TMCA 3PZQA 1XD1A 2O9OA 4L65A 2P10A 4GVFA 2PB1A 1R7AA 4Z2LA 1EBGA 4RW5A 3I68A 4GO8A 1MXGA 3DFNA 1PWMA 3T4WA 5HULA 4UNLA 4EKJA 1XPYA 5E6ZA 1THFD 3GDLA 2QUVA 4PMJA 2VZUA 1K02A 2HDJA 2PS2A 3ZVHB 2BOEX 1FH7A 2R1LA 4Q4SA 4FHAA 5CCZA 4O0KA 1SFJA 2GVEA 4OZOA 1HJSA 2YBTA 1L2UA 3TNBA 2WMFA 3OOQA 1KM2A 1RPKA 1PKYA 4CUCA 4RKAA 5HNUA 1WZLA 3WLJA 3ZJ8A 3ENLA 3UXLA 2GWNA 2DORA 3TA9A 2FLIA 4QE5A 1EYEA 1TRIA 1EZ2A 2I17A 5LNRA 4DYKA 2GQ9A 2ISFA 2RJHA 4DJDD 3S5ZA 2BVYA 3HQ1A 1QPKA 4EXBA 3NZRA 1GOXA 1XLHA 2VZVA 1T96A 3LN3A 3HMJG 3VZYA 4JQAA 2JKPA 4S3JA 3GFXA 1G67A 3WENA 4O1CA 2J25A 3EX4A 2HS6A 2OYMA 1QWGA 1I6NA 3BURA 2GDUA 4EF8A 2F61A 4K38A 2IQ0A 4LV9A 4XIMA 3WQGA 2YW4A 3D0CA 1W2PA 3NO3A 1LP6A 1H7XA 3WLTA 3E0WA 2NQ9A 2OSYA 1IR1A 4L4PA 1VB9A 1ZBWA 3UJRA 2NX1A 5A6JA 1E0UA 3TN6A 1JI1A 2QPUA 1PX8A 3BUVA 2OX1A 4DJDA 3N13A 3LCWA 3QR3A 3WLSA 2Q8LA 2ACRA 2BLEA 4PTXA 2Z0IA 4DF2A 5IOBA 2XH4A 4WY0B 2GUUA 3B06A 3D46A 1UR3M 5HJXA 1GVEA 1QHPA 3CHEA 3FEQA 4L56A 5C9WA 2GLKA 3OVQA 4YTRA 2DZTA 1VQTA 3GE7A 1F4AA 1D7KA 1ICQA 4YTTA 3UY7A 2F6KA 1VR6A 3AMGA 3A23A 2F9RA 1LG1A 3NXFA 3RILA 2VMFA 2YA1A 2QCNA 2J7EA 2ZCGA 3TNOA 1BTCA 2X1RA 5CPLA 2J9ZA 2W5FA 3ZJKA 5I00A 4BA0A 3FN9A 2DUAA 3BLOA 2DJLA 8TIMA 3ITCA 4PUMA 3QOMA 4DXXA 5HDRA 4FB7A 5I5RA 1RCQA 1ZAHA 2GJRA 2QAFA 4C1LA 3QV6A 3PTMA 2YSWA 1JFHA 2DVTA 2RDXA 2TPSA 4TV5A 4N0RA 4H4IA 1AODA 2PDKA 5FF2A 1XLGA 4MB1A 4LW7A 3BG9A 3T1GA 4S3KA 3ARZA 3GAYA 3VMNA 4XK2A 2P3ZA 3FHQA 1J9YA 4NUWA 3FXYA 2ZUUA 3RO6A 1B3VA 2I5QA 2JGQA 1DQUA 5C5YA 4L6HA 4CGTA 4UQDA 2V2CA 1QPOA 5EBUA 1ADOA 2HTMA 3WLIA 4FEZA 2BOFX 3ELFA 4TUFA 2OEMA 5G2IA 3MWAA 4W8LA 2CKRA 1TJ1A 3RG6A 1XDJA 5HMEA 2WSRA 4P7NA 1ISXA 1E0TA 1N7KA 3PK7A 4S23A 4ATWA 1NOFA 1J79A 2FZDA 5F2MA 2VR2A 5JQ9A 4N9BA 4GINA 2GQ3A 1JCJA 3MV11 4IL2A 3TUUA 3M07A 3RR1A 4Y90A 2BODX 4JTTA 4I9TA 2HPMA 4FR6A 4IMCA 3T0CA 1T8QA 1V0MA 5BOOA 1V3MA 4A05A 4UQEA 2VEGA 1CB2A 3WLQA 1YNYA 4AY1A 2OO0A 3VI2A 3G6MA 5BRPA 4UTTA 4FIQA 3UZZA 1F07A 3H7RA 3MVIA 1PWLA 2VEFA 3GH4A 4OECA 3LNMA 5HPCA 1XYZA 2BASA 3N2TA 4H6QA 2FMOA 4RXFA 4K6AA 1BG9A 2Z6JA 1XRVA 4MNKA 5M5DA 5DCEA 1Q6GA 5AY7A 2BS9A 2FQIA 1SZNA 2HXUA 2RJGA 3UR5A 3V5OA 4QR6A 4J2MA 5A2AA 2CIPA 4V27A 2POZA 1IE7C 4R5EA 1L0PA 1QPQA 2GGIA 3UZXA 4S3GA 2BHZA 1MW3A 5IHSA 2QJMA 4JR5A 1QI3A 1S5VA 5HAOA 3H53A 4Z17A 3UF9A 4DYJA 5I3DA 3TONA 6TIMA 2XZ9A 2WHMA 4ZFCA 4X61A 3CUIA 1JR1A 2WNQA 3E38A 1OCBA 1RCXB 4ATLA 3NQCA 4I7VA 1CZ1A 1GG0A 1Q7MA 4NAEB 4F0RA 2BVDA 2G3FA 5REQB 5K2ZA 4I3GA 1B4KA 1US0A 3G1YA 5C70A 2C0AA 4JTEA 1TE1A 3MY9A 3WQVA 3R2GA 2RAGA 1S2AA 4IMDA 2R91A 2V0TA 4DO4A 4OIFA 3TQKA 2CNCA 3WF4A 3KDOA 3Q65A 2JGYA 2WNZA 1GW1A 1J5SA 3C8FA 2HJPA 5C7HA 4OE7A 3W07A 1J2WA 5AFDA 5IRPA 2VC5A 3AZSA 1K1DA 4Q8UA 3RK8A 1BYAA 1MUMA 2R1PA 3PUDA 5DMNA 1DVJA 3L7RA 4DN1A 1XLDA 2DGAA 4M3PA 3S5YA 2VP8A 3OU8A 3L9CA 4JTSA 5F2LA 1R5YA 1I2QA 1I8JA 2WZHA 3OO2A 5BNKA 5BRQA 4NILA 4UB9A 4HK6A 1TV4A 3UWEA 1M6JA 1ZTVA 1MQPA 3UWVA 4CNTA 3OG3A 2E8ZA 1XX1A 2HWGA 3QGAC 4HN4A 4O0ZA 1YHTA 3H54A 4LNYA 5EFDA 3M1ZA 4F0KA 3PAOA 2J47A 5H8MA 2ZICA 2PTYA 4PMRA 1DTNA 4MGGA 1RVKA 4B16A 2YB1A 5ABEA 5GJMA 3L4YA 3LV5A 1DL3A 3R79A 4IZGA 2E77A 1OADA 1OIMA 1Q65A 1UA7A 4GI8A 3NR0A 3OBKA 3HGSA 3ABRA 1HVQA 4U4MA 4BR1A 2GJNA 1VD6A 4ZB2A 4H6KA 1PDZA 2GQ8A 3R10A 2HCVA 4BWLC 4CN4A 2PBOA 5GQBA 3NZGA 1QNQA 1TB3A 3LCHA 1NFBA 1X39A 2HXTA 1EJUC 4MY8A 2WMIA 3ZOAA 2FH8A 4QNWA 3LGDA 1Z42A 1UQYA 4N6EA 4HZMA 5F1UA 2XSXA 3T8QA 1RLCL 5C8BB 2QF7A 2YGYA 3SW6A 4FLQA 3WMLA 1TQJA 4XD3A 1XC4A 1MW0A 4WF7A 1LOQA 3IARA 4HNCA 4DUXA 4C6NA 4L9ZA 2R94A 4O12A 3VMPA 3OZPA 4AC1X 1LUCB 4KS0A 4MHBA 2E28A 3W74A 2C6QA 3WQ6A 2D69A 5HR6A 2ATMA 2GWGA 3AXHA 3JZUA 3LCGA 4O1FA 1TJPA 1E9IA 5TD4A 1A5MC 2PDYA 1F3XA 4O1DA 4LB4A 1QU4A 5BWFA 3W26A 1XYAA 1UIPA 4M56A 4K8EA 3HTWA 1LBMA 2NXIA 5I07A 1XUUA 4MUPA 3HPXA 4YXGA 1P0EA 1W1IE 4WOZA 4PUNA 3MUCA 2V5LA 3DIPA 4KCWA 2PPGA 3EWUA 4WKHA 1F3WA 4MB3A 5LSMA 3MPGA 2UY4A 3B4UA 3AXKA 1HFBA 1QFEA 1QAPA 1V3IA 3SUUA 5LHEA 4JTDA 2NQJA 1CCWB 2OX4A 4DJFD 1E1CA 2FHFA 1NOWA 3SQMA 2DIJA 1UIOA 2E4TA 4J1OA 2QIIA 2C0HA 1TTPA 3CV2A 2C18A 3QHOA 4N9DA 2VI0A 4HTYA 3DUGA 5EMUA 1GT8A 2VENA 2QCCA 2VEMA 1CDGA 3IIVA 1PV8A 2VHLA 4QHRA 2V81A 2FDMA 3TJ4A 4DVOA 3CUJA 1L8NA 4IICA 3LTSA 4GA8A 3SUWA 3B8TA 4P7QA 1BWLA 3T78A 4GVGA 4MWAB 1FWIC 1YNPA 4S3FA 1WDSA 1UP2A 4CD4A 3M5ZA 1PJ9A 3BMWA 4XVDA 3VGDA 3F5KA 1X8CA 3QZEA 3WQ8A 1E6NA 5I7GA 4L7ZA 2DZXA 2NVAA 2EGZA 1WV2A 5A3HA 4UTUA 1W5MA 3SCOA 1ZBKA 2C8NA 2G8ZA 4HYVA 1A0CA 3SIZA 1UKPA 4P2VA 4HHPA 3HB9A 1O66A 1AQMA 4TIMA 5F1VA 2EPKX 4G9PA 4XZMX 3CIWA 4DJFA 1GHSA 1A3WA 3K30A 1ISYA 4B5XA 3W23A 2I7GA 1Z7AA 4CNNA 4YHEA 1Y5XA 1T5AA 1J8VA 3UJSA 1K8ZA 4B5WA 1S2VA 4UZUA 2VOTA 3LHUA 4IP4A 4MDPA 3LBMA 1JAKA 1UD6A 3ES8A 2ZUMA 3AZRA 2OZ0A 4O19A 4ACZA 3HPSA 4EF9A 2DSUA 3EWZA 1YQ2A 4K2SA 5AN7A 3N2BA 3AIRA 4I5XA 3H7UA 1OY0A 2VRQA 3LENA 4C1NB 3QZAA 3RLHA 3WD0A 8A3HA 1QNRA 3CIVA 1O60A 4R27A 4ZBCA 1QHOA 4Q4RA 4DM1A 1CXEA 3G22A 3LCFA 2XVKA 4RE3A 2ONEA 1UZDA 2G96A 3KTCA 2C19A 3O6CA 5F2IA 1W1PA 2GDVA 3W76A 3S9IA 1GPWA 4FA3A 2Y5SA 3TLLA 1WUEA 1REQB 4P7LA 5EMJA 3KP0A 4GQQA 1XIEA 3WQ5A 1KFBA 1Z69A 1GYMA 3W1XA 1RQHA 3EZ4A 4DO5A 2WM0A 3WH8A 2YL6A 4M7SA 2HVOA 1QASA 4G8TA 4QDPA 3SRDA 2Y8VA 3CL6A 3QN3A 2W62A 3QHMA 2VR4A 4CLMA 4BI7A 4ECLA 4M19A 3M0YA 4L6DA 1QR7A 2G4FA 1PZ1A 4OTKA 1FRBA 2XIIA 3P84A 3BICA 3KVKA 4DWSD 3W37A 2DH2A 3MUZ1 1QNSA 2OYKA 2FGZA 5A69A 1MQRA 3ALFA 1EDQA 1XISA 2D3NA 4UFHA 1KRAC 4WK9A 3AOFA 3N9SA 5KETA 4YTSA 3XINA 4AD0A 4AUBA 3SO7A 1WCGA 3VNYA 3N25A 4PUUA 3IJQA 2CWXA 2YLLA 5G1YA 4PBFA 1FDZA 1K8XA 1M9HA 7TAAA 1V0NA 2PRMA 5CJ5A 1Z3NA 1QW9A 4GI4A 5EA9A 5G4HC 1DJQA 4WSHA 1EHAA 3UU0A 4WUIA 1DIOA 3T09A 4WXYA 3RAOA 4MLJA 4Y96A 4INFA 1GJUA 3M0VA 2QCDA 4A8IA 3IJ6A 2F6UA 1RA5A 3A3WA 3PULA 1D3GA 1XCXA 4DWSA 5D2WA 5F4SA 4Z1YA 2ZC1A 2PWEA 4R7WA 3TFXA 4JIIX 3AIWA 4WSKA 4DI9A 2DQWA 1IWBA 1FUYA 4MPKA 2PE4A 1YXDA 4EACA 2R8WA 1XIHA 3SGZA 1V6UA 1S2TA 2BY0A 4IL0A 3FK4A 1BPLB 2WHJA 2FTWA 1LL4A 1UH4A 1VRXA 3LHVA 3EGJA 1JCNA 3USBA 3N2OA 1WE5A 3MC5A 2QVNA 2ABBA 2FTPA 1EGZA 4HK7A 2G4JA 4ICMA 5DBUA 3ICJA 1BAGA 3WBWA 3SEPA 2QDEA 4I90A 2I57A 3UCDA 5SWUA 2EJAA 2HE5A 1ICPA 4EPDC 3UR7A 1OM0A 5BYWA 4HCLA 1FWGC 2OWCA 3RLGA 4HMNA 5BXTA 3OIHA 4J3WA 1E9ZB 4MVAA 3VPLA 3JVAA 5I2UA 1LT8A 3DECA 3WQCA 1UKSA 3LRMA 4NP7A 3LBOA 1J0HA 1QO2A 4JZ5A 1EKOA 3WJYA 4L64A 4JY9A 4HHLA 5BXRA 1XYBA 1VJZA 3VDGA 2CHRA 2ZX8A 4MJ2A 4UTMA 2OZ8A 5HNTA 3PJTA 1C90A 3VKAA 4UR8A 1O5RA 2HEJA 4B5NA 5JU6A 1F4HA 3O63A 3IIOA 4UMCA 4WCJA 3RRAA 3Q2DA 2J77A 3T07A 3PBUA 4A8LA 1BVNP 5G4WA 3KBVA 4XAPA 5AHEA 3G3DA 2RKXA 2Y8UA 1RJRA 3UEQA 5A6MA 3PZMA 3AZTA 5AOUA 1KM4A 1IEXA 3O6AA 1DIEA 4H00A 1IEVA 4JIQA 4AWTA 1X96A 1S5MA 3EXSA 3H70A 4DBWA 2WLZA 3W87A 3ZT5A 1JDCA 3BO9A 3CWHA 4B4HA 1LZOA 1WXJA 5CBIA 3BOXA 2EPMX 2JIWA 5FEZA 1AJ0A 3H24A 3CTTA 3S1WA 4R7OA 3F4CA 1TMHA 1OK4A 1K9EA 4XSMA 5TAOA 4A8NA 5AVNA 2OTDA 5T9CE 2EPOA 4MJMA 3ZVHA 3OW1A 4BY3A 2ICSA 2A3BA 3DU0A 3W7OA 2YL9A 4POCA 3CPRA 3EB2A 1C9WA 3BCDA 3UFYA 3FXGA 3AAMA 1VEMA 4ZVJA 3KL0A 2Z1VA 1JPDX 3W1RA 3C2OA 1M3UA 4U3AA 4EK7A 3AMCA 3M0MA 3IWPA 4MJZA 4RNHA 2D0HA 3ORWA 5CEWA 1W6TA 3EX3A 1V5XA 4KRTA 4JTAA 5HNNA 1QPNA 1QI5A 2Z24A 4GK8A 4IPNB 2VZSA 3H12A 1R86A 5EU9A 3G1SA 2QPXA 3EWCA 1EJRC 1G1YA 1V6XA 3HO8A 3GXMA 4H8HA 3RM8A 1GQJA 1SU5A 3JU2A 5CPSA 2BVWA 1FHUA 1UC4A 2VEPA 4PC8A 1FH9A 3FAWA 2W91A 5C9RA 4IHCA 4B92A 5CC3A 3ONCA 4EWJA 3ZWTA 3WFAA 4C60A 4JTQA 3EOUA 1L2QA 1U1HA 2DUZA 4W87A 3T6CA 3IJIA 2BTMA 3DFTA 3RMEA 4A22A 1XM3A 1E71M 4L9XA 1G5AA 4O18A 4IJBA 3I3EA 1XGDA 1ZCOA 2SFPA 3H4WA 1FFRA 4PB4A 1JGIA 1DEDA 3CV6A 1NDVA 1O12A 1WUFA 4QJ1A 3QC0A 3B40A 3N17A 3T40A 3OGVA 4O4VA 1UWQA 4BF5A 1AQFA 3DERA 1VHNA 3H26A 3USZA 2YLAA 3DC0A 3DZ1A 1V3KA 2G95A 1ZU8A 3IACA 4NJIA 3CXOA 3H4GA 1EOKA 2A7RA 2XTKA 3G1DA 3AIQA 3MSRA 3RRXA 4KIRA 4LC8A 4M6QA 3SCSA 2ZUSA 2PDWA 3MHGA 5EPDA 3T9PA 3W7HA 4UNKA 2D22A 2IXUA 3O1NA 8RUCA 4DBSA 1E3XA 1TV7A 3VNIA 1ONXA 1XGZA 2VFGA 1UPPA 2Y2WA 1VIWA 1V3JA 3VX0A 3V36A 3WUEA 1PYMA 3BJSA 3QQ0A 4QS6A 1KBLA 2QDDA 2PDXA 5ABHA 5A8QA 1CX9A 1UWAA 3UNTA 4E0CA 3ME3A 3BW2A 1GKPA 4B90A 3GDMA 4IP5A 1VYPX 4CQBA 1K9TA 4AVFA 3AWNA 4XVEA 2XN0A 4AU0A 3M0KA 2E5CA 1TZ7A 3CWNA 4BEUA 4CD5A 2WKLA 3ES7A 3QW3A 3H2AA 4LALA 4DO7A 5D2TA 1CIUA 1TUXA 1F5ZA 2J88A 1NU5A 4ROQA 4WJEA 3CU2A 1G69A 5A95A 3BANA 2NUXA 5C7VA 2JE8A 2JBMA 3ABOA 3KXQA 3L5MA 4Q8WA 4Q8MA 5M03A 3THUA 4E4FA 2EPLX 4M80A 2ON3A 3LLDA 3GD6A 1MI3A 2NXGA 4JQ3A 3FSUA 2XGZA 3UYCA 4B3ZA 3OEXA 2HZGA 4LWWA 3KE0A 1OG0A 1EB3A 3RCMA 3VNMA 5AZ0A 3LM7A 2J27A 5FF7A 2F2HA 4UTHA 1YPFA 2YCLB 4GJIA 2VRJA 4GUFA 4S3AA 3WF2A 1RPXA 1ZALA 3CV1A 3NQFA 1R2RA 1E0VA 5I6SA 1W32A 3A5FA 3PBYA 2A3AA 3UVAA 3WQOA 3WNNA 3CAVA 1HZYA 3BWWA 1FBAA 3WMSA 1UR1A 3APYA 3LCLA 3W2NA 4H8VA 4WLCA 3VNZA 1GJPA 2CZFA 3MCOA 1KXHA 5FACA 4C7DA 3HPFA 2XM2A 3BLDA 3B8SA 1K7FA 3NSXA 3CO8A 4GKTA 2Q3OA 4DJEA 3CMJA 3PPFA 1PAMA 3NL6A 1P0NA 1RY8A 1X6LA 3ZM8A 1F7BA 2BDQA 3TOYA 1U2YA 3Q37A 3UZYA 2HPIA 4QJ5B 1YIXA 1VJSA 2IPFA 1XG4A 3C4UA 3LLFA 4IPIA 3LXCA 4UNIA 5ABGA 4J3XA 1IIGA 1XYLA 4D6JA 2PDPA 2OB3A 3W1UA 4D8LA 1JCLA 3FOKA 3H23A 1FP8A 4QFUA 1JRBA 4KBXA 1OWQA 3AC0A 4W9TA 1OFAA 4A2SA 4JQ1A 1R7OA 4JL2A 3AQUA 4KESA 4FO4A 1DORA 3VA8A 1S46A 3NDYA 3A3XA 2QJGA 5HWNA 5CJMA 3TCEA 4KT2A 4W88A 2DT0A 4TXEA 3RGTA 4W93A 3HG4A 1J93A 1GWJA 4NAEA 3NUKA 3W72A 4N9EA 1FDYA 1PZ2A 3VCCA 3WQ4A 4KFNA 4V33A 4J7RA 4IFKB 4M1RA 5C9XA 4HSOA 4US5D 3LHWA 2ZZ4A 1CXLA 1C8XA 3VOFA 4X63A 4ZQCA 4D71A 1KWGA 2P53A 1OC6A 3B0UX 5DXYA 4LC6A 3CS2A 2I16A 1KD0A 3ZR5A 4IIEA 2ZUWA 3ITLA 3UG8A 1FWFC 3W2LA 4XAYA 2NW0A 4HOXA 3W6LA 3W2MA 3K4DA 1EA9C 3S1VA 3UCCA 4DZHA 3HOJA 4JIRA 4PEKA 1XIGA 2YCIX 1VBUA 4J35A 4AXKA 4UTIA 3O0FA 4GYPA 4ROPA 1ICSA 4WR3A 1VIZA 4D9PA 2J7GA 4Y9OA 4US5A 3UNDA 3D3AA 3N14A 3QR1A 5IFTA 2XIQA 3OG2A 1B90A 1HF6A 5EMYA 1EYWA 1JAEA 3ZR4A 3DYPA 3CJPA 1ADDA 1V7AA 3QJAA 3THQA 3SGGA 4UBPC 5D30A 1VRDA 3EX1A 1EPXA 4W89A 1S2UA 5KEZA 1ME7A 1YLVA 1XBXA 1XD0A 2HK1A 3QLDA 4JTFA 3W7LA 1TJ2A 1SUXA 3ANVA 2HV5A 4AF0B 3HQPA 2X8RA 2D23A 3R7MA 4WD0A 2ZOXA 5IHRA 1GKRA 2H3BA 3GHTA 3URNA 2I5IA 3HA1A 4C91A 4OFCA 3UJ2A 3GH7A 2GYIA 4Z0JA 4DJDC 4YVXA 3GC2A 3NQVA 4MG4A 3BCFA 3QY8A 3T7VA 5JUVA 4XD4A 1JXJA 4QCFA 5IBXA 1JRCA 1OC7A 3I65A 3R12A 4QLKA 1UMLA 3M46A 1BKHA 3OYZA 1LT7A 2J7DA 3NZPA 4IIGA 2YXOA 2YDRA 3C86A 2Y4SA 3LU2A 2D2HA 3IJ8A 1Y5VA 3TN3A 2IKJA 2BOGX 3P80A 3GFYA 2XIJA 1IQ8A 1DWHM 4KWWA 2VZOA 2AGKA 1HTIA 1LUCA 1P48A 2DDXA 4L4MA 3FNDA 4HA1A 4HNNA 1E73M 2HE8A 3BK0A 3DFOA 3MJYA 4X60A 3SCNA 3AU6A 3W73A 1MW1A 3P2VA 3W2KA 4HIBA 3KZSA 4RW3A 1POJA 5KMYA 3RO8A 4FNPA 3LB0A 2OG9A 2XVNA 3N73A 1HN1A 5CLWA 4FNSA 3WL0A 4MPQA 2YFNA 4KEMA 4F2BA 2XPKA 5I09A 1W91A 2J66A 1RK6A 3UT0A 4KGJA 4PB5A 4UTKA 1TTQA 5DANA 3MV01 4ZQNA 1W3KA 5CJNA 4JTLA 4Z42C 4GBUA 1QT1A 1P0KA 2PGEA 3GVRA 3EKGA 7TIMA 4CQAA 1JZ7A 3SY1A 4C6LA 5HMFA 5CSUA 1EP2A 1ZGDA 5K9XA 1M01A 3TSMA 3CEPA 4MKVA 1O4UA 1ME8A 1XI3A 4GUGA 2CITA 3CT2A 2CC0A 1YDOA 2Y7DA 1MO0A 1IZKA 3H22A 5I0DA 1WQ5A 4MADA 3CZGA 4GYKA 4WZHA 1TG7A 2VDIA 3WD2A 1ZJHA 4L61A 4ONVA 2Y7EA 3GVGA 1L8PA 4O13A 4DX3A 1R47A 1Z44A 4PBGA 1MEIA 3DFQA 4MWAA 3AYSA 4IM4A 1KKOA 1JZ2A 5BXPA 1WPCA 3O2LA 5G2WA 3NO5A 1YE4A 1FWNA 2FHBA 5T8GA 3SQLA 3VIGA 4L1GA 4PODA 1N2VA 3FKRA 3GTXA 3P3BA 1S1RA 2GUBA 4A21A 3W38A 4UTTC 4ALDA 3SSJA 4PCSA 2GOUA 1EZWA 1RLDA 4CD7A 2O55A 5ECVA 3PZTA 4PFMA 2WK2A 4Z08A 5A8MA 3EPMA 5LYRA 5CG0A 4AZCB 4Z1CA 3CH0A 3LQLA 1PIFA 2ZRWA 4FNRA 4LY4A 3TTEA 3QPEA 2V5DA 4JOMA 5A6BD 3H4XA 3GXIA 3N9KA 4WOQA 3WD4A 3SY5A 1KB3A 3ZS4A 2ZUTA 2VFIA 3A5VA 3QSRA 3R0UA 2WXDM 3RU8X 5FESA 1BYDA 1KCXA 4C1NA 4H8UA 1ITUA 4IOTA 4OV4A 4UOQA 4LYQA 2BNJA 3OTRA 4FZIA 3QV8A 3KTXA 3KS6A 1E6XM 4I6VA 4YVPA 3M5YA 3W25A 3TC7A 3VE9A 3PPGA 1IXOA 3EDJA 1A5SA 3NWRA 3CZLA 3WY1A 3ZQ9A 4QROA 5T26A 3BOLA 1JPMA 3EX2A 1B31A 2IUZA 3O05A 1XP3A 1REQA 3GRIA 1E70M 3B0VC 1EUAA 3LTPA 5KTLA 1YW1A 3U2ZA 5HUOA 3O15A 1OINA 2DEPA 5C9ZA 2JEPA 5A6BA 1SFSA 3N1AA 5CPTA 2C1GA 2JALA 3LS9A 1K9DA 3MWCA 1DV7A 3T44A 1R3RA 1OFOA 3JS3A 3T4CA 4OHQA 1J6OA 4WGXA 3VD3A 3OZOA 5FL0A 2QDHA 4XB3A 4WDUA 1UHVA 1E6QM 1MEHA 3CL7A 2WSQA 3EOLA 1PPIA 3I6RA 2J9YA 1OFQA 5JVLA 3G3MA 1PTGA 4XZWA 2Z28A 3WMBA 1ZY9A 2WQPA 1OFBA 1X6NA 4RLIA 2YCEA 1ZCCA 4DELA 2PU1A 1UZHA 2W61A 2E6FA 1VAHA 3A22A 3IVUA 1EEXA 3W2JA 4B3KA 5B7ZA 4KGLA 4XV0A 1XUZA 1PX3A 4C6CA 4ZB0A 1LRNA 1SGJA 4XUYA 1X6UA 2X7WA 1H7NA 4M24A 1Q6FA 3RITA 4JDBA 3NPUA 1JEZA 3MB9A 1NP0A 3CZKA 3CPGA 1IV8A 2VQTA 3OP2A 5TF0A 1J11A 2P50A 2OWWA 3VGGA 4ZL1A 4J3SA 1TJRA 4FNQA 4FXSA 5CZJA 3DFHA 4QEHA 4YWIA 3U3HA 1MXDA 1OZQA 2EPHA 2MUCA 4E2BA 1I0DA 2J13A 2W4XA 3GZ3A 1UR9A 4J5NA 4FP1A