3QSRA

Crystal structure of trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
250
Chain Sequence
b'MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAAPDVDGFLVGGASLEPGFINIVNSNVHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_497370 gene
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
total genus 85
structure length 250
sequence length 251
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qsrA00
4LC6A 2Z6JA 3H53A 1R2TA 4AH7A 1I2QA 2YW3A 1LBMA 2FB3A 4U4MA 4AEOA 3HG4A 4FIQA 1KTBA 3PG9A 4LC8A 1O5XA 3N9RA 1TPC1 3CM4A 4JY9A 5HNRA 1XBXA 2J9ZA 1JR1A 3LLFA 4M7TA 1TSIA 5FESA 3EX6A 2FB2A 3CEUA 1SO3A 2TRSA 3TC7A 3NQ7A 4R53A 1VQTA 4YL2A 3M5VA 2R14A 4PL1A 1F05A 4ADSA 1YXCA 2I9EA 3QW3A 4RR4A 2Q3OA 4N4PA 3LM7A 4DF1A 3E96A 4RV8A 1SFJA 4LV9A 5CPOA 5KZEA 4ZL1A 2JGQA 2DZPA 5EL1A 5LNWA 3OBKA 1YXDA 2CZ5A 3WJXA 3P82A 4NNAA 3N2XA 3B0UX 5EY5A 5FF2A 3TU9A 4O1BA 2F84A 4S2BA 4NZFA 2Q8LA 1C8VA 3MP5A 2RFGA 1NFBA 3HQ1A 1U5JA 4MVAA 3IVSA 5F2IA 2VXNA 4CQ9A 2ZZ1A 1IF2A 4O4WA 3TAKA 2C14A 2Z0IA 2X1SA 1LRQA 1T96A 1I4NA 1KW1A 2Y88A 1H7NA 3S5ZA 1PHWA 4YWIA 8TIMA 3VE9A 1XXXA 4CQ8A 1LTDA 4O53A 3QSTA 4AF0A 4FNPA 1LOQA 1B9BA 4MFDA 4PA8A 5DBUA 3TXVA 5BOOA 4MYAA 3PR2A 1N8FA 3LHTA 1EP2A 3G3MA 1QAPA 3NQGA 1TIMA 4OU1A 4C1LA 1V7YA 3O8AA 4FF7A 4UMBA 1SZEA 1R30A 2EHHA 2EF9A 5A8GA 2Y70A 4ONVA 4BFAA 3W7DA 2VOMA 4I7UA 1W31A 4QM1A 1IGSA 4MY1A 3QMTA 1VCFA 4Z08A 5J5DA 2GVLA 5D04C 3SSJA 2WNNA 5ABTA 4RZ4A 3TAOA 1W5QA 3W73A 2WO5A 3LHWA 4K8HA 1UB3A 1XUZA 1ZHAA 1VPXA 1TQJA 1UASA 2YPIA 1YDOA 4IUOA 3RF9A 3P8IA 4R7JA 3B4UA 3M44A 3E02A 3TR2A 4QAIA 6TIMA 2C16A 4QJ1A 2V0TA 1MXSA 1FWSA 3IIPA 1LCOA 3HBLA 3S1UA 5F2LA 3CIWA 3ABSA 3TMLA 4P2VA 3W22A 2TPSA 3GR7A 1K7EA 3LI1A 2QCDB 1TV7A 1K8ZA 3BPWA 2CFFA 1U83A 5U7SA 4MJMA 2CLEA 3G1SA 4KFPA 2DZVA 3MO7A 1LRNA 1VLIA 4JXCA 3W88A 2Y6ZA 2QCLA 3M16A 5D2XA 5DXYA 3HF3A 2Y7FA 3TH6A 2YYTA 3NL5A 5F1UA 3NM1A 1KM4A 3B06A 2H6RA 3P84A 3T44A 1OFQA 2RH9A 1EA0A 1OX4B 4TMBA 4JX4A 3JRKA 4KFNA 2QR6A 4O15A 3BO9A 5D32A 3S42A 1LLZA 1C29A 4HKPA 1NVMA 2FFCA 3O63A 1RQHA 1G4SA 4LVDA 1OABA 4XKYA 2YYUA 3DU0A 4M6QA 1EEPA 1RV8A 5AHEA 1XBYA 1ZY9A 4CQAA 2VFGA 4JD4A 5G2HA 2Z1BA 3BW3A 2F7FA 2V5LA 3S9YA 2P1FA 5AHMA 1W5NA 2O7SA 2ZFAA 2JBMA 3SI9A 3LX9A 3D0CA 1GTEA 5DCDA 5K2ZA 1OF6A 3NVTA 1IIGA 1W3IA 4LUJA 1GVOA 1YXYA 1FDYA 2NUWA 2J88A 1KFKA 4LVBA 2V2HA 1EWEA 3EWXA 1WAUA 3QMRA 4KKXA 4GUJA 4JTTA 1Q3NA 5CKSA 3C2VA 1LZOA 3FLUA 4WX2A 1DQWA 3W87A 3P8JA 5L6UA 3NL6A 1TPWA 3N34A 2J27A 3C2OA 3NDOA 3T40A 3W1MA 1K3UA 1F73A 5HR6A 5BMXA 2ZZ7A 1TMHA 5EKYA 2QJHA 3MHFA 1VZWA 2A7PA 4JY8A 1XKYA 1LP6A 1SQ7A 1WOAA 2UV8G 3O07A 4WD0A 3UWVA 4UNLA 3B04A 4MYXA 3MI6A 3OA3A 3QYQA 2CLIA 3SW6A 2TYSA 3STCA 5HULA 4XWUA 3THQA 3G1AA 5FF4A 5E93A 3GR8A 2CLLA 1FXQA 3LBCA 1T99A 3CTLA 4ZQPA 3EWYA 2QCCA 4OV4A 2CZDA 1G6CA 2A5HA 3B0PA 3TNOA 2P10A 5LHEA 3I7SA 2X2GA 5H91A 4JTJA 1JCNA 3DFNA 4HHPA 1QNVA 4FXSA 1SZGA 2NXGA 2C1HA 3NAVA 1TRDA 1TPDA 5D33A 1KA9F 4NVTA 5HUPA 3FS2A 3N14A 4DBEA 2ATSA 1EP1A 5CSSA 4DXVA 5L9FA 1W0MA 2ABAA 3LHUA 3LCXA 3P80A 4QQ3A 3KVMA 4CCDA 3BLFA 3TJLA 1JULA 4HNVA 3WK2A 3GVGA 3NZRA 4L4LA 3W85A 3QEZA 1EPXA 1TRIA 4N6EA 1TJRA 3K30A 4ZQNA 5KITA 2G96A 4TIMA 2ZZ3A 2Y61A 5CGQA 3BVJA 4O10A 3W23A 4XTDA 5F4WA 2X1TA 3MUXA 2JK2A 4ZQMA 4UC5A 3NGJA 4FX8A 1ZNNA 4ZMGA 4JX5A 3MYPA 3Q37A 5E0KA 4GUFA 3L65A 1GEQA 3CHVA 1O94A 3DFOA 3M1ZA 3NQAA 3L5MA 1AL8A 1K8XA 1JCYA 3HG5A 4NT0A 4XQ6A 2WSYA 4LRTA 1FWRA 1SFLA 2ZRYA 1O60A 1F6PA 1B57A 2CZEA 1MSSA 3FIGA 1ZAHA 3W1TA 4E2DA 1M5WA 3C56A 3NQMA 5J5RA 1SZNA 2BX7A 2GPTA 3VFLA 2X30A 3DBPA 2GQ8A 3BW4A 4JTKA 3GNNA 1THFD 1Q6QA 3DGRA 1XBZA 5HWMA 3G1YA 3GNDA 1OG0A 2DZXA 1QR7A 3I68A 2TMDA 4GUIA 2VEKA 4N9BA 5AHLA 4MZ8A 3U8GA 5C2XA 3EWBX 5AFDA 1W5OA 3LCLA 1FWTA 2ISSA 4IQLA 4ZZ9A 3WJZA 5CZ0A 2NLIA 1KV8A 2ZTJA 4KFOA 5F4XA 3T7VA 4A21A 4YCOA 2C13A 1ALDA 1J5TA 1RD5A 3HGJA 1VCGA 4HNNA 5AHIA 3UWYA 1HUVA 3TE9A 1IXPA 3G1VA 4Z0SA 2V5BA 4X22A 1VJIA 1TJPA 3M5ZA 3R12A 3W1RA 4H4IA 1KFEA 2WNQA 3M41A 3FFSA 2OT1A 2E6DA 2HSAA 3V75A 4HSOA 3W7JA 3CT7A 2B0MA 3HGOA 3W7NA 4K39A 3S1WA 4BI5A 4A2RA 4LU0A 4WOQA 3RK8A 1XL9A 3LXBA 3OEXA 1W56A 1FWWA 2DJLA 3DKLA 1XFBA 1DV7A 3UWWA 4IPIA 1JUBA 4JYEA 1W37A 3W7KA 5I3JA 4JTUA 2E5BA 1UCWA 3KX6A 3LXAA 4UTJA 3PUEA 3GYEA 4ORMA 4GE8A 1G4PA 4ZQRA 1ME9A 3CB8A 4JDYA 1EIXA 1B4KA 4JYFA 3TCEA 2V2DA 3UXAA 1TCDA 4TX9A 2Y7DA 1A53A 4U28A 3PF3A 1SO4A 4FNQA 3S5NA 4IPJA 4L4MA 3W86A 1WXJA 3UNDA 3TSBA 4O52A 2V30A 5D2TA 1FCVA 2QEZA 3THAA 5D38A 3WK0A 5G1YA 1ME8A 4QNEA 1QDSA 2JKEA 2PRMA 1YDVA 5DCEA 3VNDA 4EF9A 2A4AA 1H50A 3DFPA 3NA8A 4UFHA 2DP3A 5BNKA 4MLRA 4EOUA 5EA9A 4O19A 3W1PA 1Z41A 1TPEA 3OHIA 4MPQA 1J2WA 1Q6OA 3N2MA 3LOTA 1VRDA 2QCNA 1TREA 2RDWA 1W1ZA 1GQNA 1DORA 4UTUA 4O1DA 3EX1A 3I6RA 1JCLA 1H7WA 4YCPA 4XTIA 4R33A 3ANYA 2AAMA 5CG7A 4MLJA 2PC4A 1YPFA 1GG1A 3QF0A 2WV8A 2YX0A 4UUIA 3LBMA 3C4UA 4ALDA 2EAWA 3PM6A 3MYOA 2A1YA 3KOFA 4WZHA 2RHGA 4HNTA 3R89A 4S1FA 2QKFA 2VKZG 3GKAA 1TPH1 3AO0A 4JS3A 3CEPA 3W7PA 3L67A 3EXRA 2X1RA 2V81A 1BWLA 1W5PA 1EUNA 3FKKA 1RPXA 4RZ6A 4K38A 3RNDA 4O16A 4NJJA 2I1OA 1D3HA 2JGYA 2FPVA 2B7QA 3P7YA 2P0OA 4AWSA 4FNRA 3HPXA 4DELA 3L66A 2O7QA 1W8SA 2ZBTA 3HPZA 2H3DA 3W83A 1P4CA 3P67A 3EKLA 4LNYA 2C15A 2QF7A 3W71A 3R8RA 2DZUA 3MJYA 4O1CA 5A5WA 3KVKA 2XN2A 3W1QA 4O17A 4XBSA 2FPTA 4WY0B 4Y8FA 2C6QA 2FLIA 4N9CA 3KVLA 3QQ0A 3G1XA 3BV4A 1PV8A 2G97A 4UFJA 1K8YA 4EWND 1P0KA 4OE7A 3IGSA 5D02A 4BI7A 1LOSA 3DAQA 1H7OA 4IMCA 3G24A 4O57A 2WJZA 4UNKA 1FCUA 1YYAA 4FX7A 4LV4A 4OBTA 1OYCA 3L9CA 3HG3A 3QZEA 3GDMA 2A7RA 2CLFA 2QUTA 3GAYA 4B5NA 2J24A 3TKFA 1XM3A 3W7EA 1UBSA 1W3NA 3EB2A 5GVJA 1JQVA 1KM0A 2WQPA 3W2NA 1SR9A 1NAL1 3NQFA 3KRZA 1G4EA 2DORA 3HPSA 1RZMA 3IV3A 2ZRUA 3DFTA 1D9EA 2HS6A 3GK0A 4WQ6A 3W74A 4JTHA 4IOTA 5D2YA 4AWTA 3G8RA 1KV5A 3G0SA 4A22A 3L5LA 2CWNA 4NX0A 5KZDA 3F4NA 3NXFA 5LNSA 3I7QA 2ZRXA 1F74A 2ZYFA 4O18A 2W79A 2C18A 4AHQA 1X8FA 4JYDA 3I65A 5CPNA 3GDTA 1Q45A 3DHFA 1H1YA 2ATMA 4UFMA 3G0XA 2CU0A 3KRUA 3W6YA 4RKAA 3NG3A 1TTPA 5K4XA 3KAOA 1H1ZA 2OT0A 4IWWA 1LORA 3P60A 4JN6A 1H63A 5CSRA 1KLZA 3HGRA 1YADA 4UFLA 2J6XA 4TU1A 4MUZA 1DQXA 1LDCA 2DZWA 1DJQA 1WOBA 4Z1DA 4GNJA 3R13A 5LKYA 2HMCA 3BGJA 4OQVA 2EGZA 4AHPA 3H55A 3I7RA 3NQVA 4DPQA 3G0UA 3O16A 2Y7EA 1WQ5A 3B05A 5DY3A 3INPA 3W76A 3BW2A 5K9CA 3ATZA 2ISWA 4OV9A 3STEA 3QW4B 4LTSA 1DL3A 3G1FA 2GUUA 1BKSA 1LROA 4FB7A 5DBTA 3N3MA 5G4EA 5T26A 3RFAA 4M5PA 4TR9A 4FX6M 3A5VA 3JS3A 1GJPA 2QJGA 5FF7A 3GZ3A 3L68A 3TFXA 3O6YX 2GOUA 2ISVA 2FQIA 4X9SA 2YDAA 3IIVA 2Y89A 5AHFA 5I3GA 3PBUA 2H90A 3MMTA 1X1ZA 3LCWA 3G8EA 3PWAA 2FJKA 1A5BA 4Y96A 1ZJIA 4UFIA 2VFFA 4WY0F 4CLMA 3PS7A 1QPOA 4I9AA 1FDJA 2A6NA 3LI0A 3W7CA 2YSWA 3OVRA 3DKJA 4QITA 1OVDA 7TIMA 3LCHA 2GVJA 1CX9A 4CNPA 3H54A 1DJNA 3CWNA 2CLOA 3GDKA 3TSMA 3BGGA 4ICNA 2RDUA 6ALDA 1ICPA 1H62A 5LSMA 1ML1A 4LS0A 3NR0A 4ADTA 4LS1A 3W7GA 3P5ZA 4PODA 5HR7A 5D2VA 5TIMA 5U4NA 2Q8ZA 4O13A 3EXSA 1TQXA 3UD6A 3YPIA 1TPFA 1GOXA 4UCGA 4TMCA 4IGHA 4BI6A 5H2ZA 2GVGA 5C5YA 1KFCA 4PCFA 1GT8A 2FPYA 3GB6A 2H8ZA 5FEWA 4KWWA 1FWNA 5FF3A 4JTSA 3A23A 2V82A 3E12A 2BZNA 3MW7A 4OWGA 1G4TA 1AL7A 1EP3A 3DFSA 3CIXA 4Y9AA 2ZTKA 1PL9A 1IXOA 3KVJA 4GC4A 3TQ0A 5CZJA 3TW7A 1KBIA 3EWUA 3W70A 2V9DA 3HO8A 4K37A 3GXTA 5LZLA 4NXSA 2Y62A 4MY8A 1F6KA 1QPNA 5AC8A 3L0KA 1VYPX 4LT9A 3PY2A 3SZ8A 3A9IA 1O4UA 1X1OA 3O6CA 4FNTA 4DEFA 3C8FA 1F7BA 4MIMA 3C2EA 3VKJA 1QCWA 3EXTA 3Q94A 4Z0JA 2YR1A 1KM5A 5D03A 3LHVA 3WJSA 1XDLA 4JTIA 4O0KA 1WV2A 3WK3A 4PL2A 4MZYA 5D2WA 3CU2A 1MZHA 1W3TA 3NOEA 2H8XA 3PUOA 1QOPA 3BK0A 3W7HA 4AB4A 3GXPA 3QFEA 1Q6LA 4AF0B 1HO4A 4O11A 5EBUA 5I3IA 1UUMA 4QIUA 4GBUA 4NNBA 2NX9A 1ZCOA 2IQTA 5CZSA 2J9YA 2A85A 4K6AA 1K7FA 1YTKA 3M7WA 4QNWA 3TUUA 1Q6RA 4LOCA 4EF8A 1LBFA 1FBAA 3R2GA 4O0ZA 3UY8A 3STGA 4DF0A 1QPQA 1GVRA 4FEZA 3W07A 2WOQA 3FJ6A 4GUGA 3IIOA 1IIHA 2BSLA 1KM2A 2YGYA 3BLEA 1P5BA 3N73A 4I7WA 3Q58A 2R94A 1FXPA 5LHFA 3EWWA 5K3VA 2Z6IA 5E1QA 2QCFA 1QWGA 4JDBA 1I2PA 1Z42A 1OK6A 5G5IA 3IIXA 1PVNA 2AQWA 1ICQA 3C0JA 4LW7A 1H7PA 3UY7A 3OVQA 2JKPA 5AOUA 2GJNA 3NPVA 3S0CA 1I2NA 1LOLA 2HTMA 1VHCA 3TQVA 3EX3A 3M6YA 1EUAA 5AYZA 2FDSA 1ZAIA 3TK7A 1KTCA 5CPLA 1W54A 1NF7A 3HG2A 1VCVA 1KTNA 4WUIA 2Y7GA 1WYIA 3W7OA 1DVJA 4IX0A 1ZAJA 3TFCA 3B0VC 1WBHA 3PBVA 4WJEA 1AMKA 1J4EA 2I14A 1LRTA 3MHUA 2OZ0A 1V5XA 1E51A 1R46A 3HIJA 4N02A 4MZ1A 1HO1A 1QO5A 5AHNA 3MI2A 1I2RA 4K36A 4O28A 2GJLA 2ABBA 4AAJA 3LXCA 1A5AA 4FO4A 3SECA 3VI2A 5KSWA 1OJXA 5I3FA 3DXIA 3TC6A 1K03A 3LDVA 4O4VA 1L6YA 2ZRVA 1Z48A 2NV1A 4ADUA 4OGZA 4LVGA 4XKYB 3FKRA 3GAKA 3F4WA 4X3ZA 5C54A 3TXZA 2BTMA 2Y63A 3TA6A 2VELA 3QM3A 3ATYA 2BLEA 2ZA2A 1HTIA 2QCDA 3DFQA 3L2IA 1EX5A 2E77A 3QC3A 1OF8A 1GZGA 1MEWA 4JTEA 1MEIA 3AJXA 4DF2A 2PRHA 3SR7A 5C55A 1ZALA 1AW2A 1TTQA 3E9AA 4NX5A 4O12A 3S1XA 3T4CA 1RQBA 2QAFA 1KFLA 1VH7A 3NL2A 1PE1A 4RX0A 5F4SA 1AW5A 2DJXA 2RDTA 1O95A 4DBDA 1XBVA 3M47A 1I2OA 1CW2A 1OFOA 1DBTA 4IMEA 3EKZA 1OX4A 2VFEA 3FYOA 4Z1BA 3W1LA 4JNMA 4RZ5A 3L0NA 4Q33A 3NPXA 5TBOA 1R47A 4Y6GA 2XN0A 1F5ZA 4FIRA 5BRBA 3WJWA 3UWUA 4EVZA 1M6JA 1AG1O 3RU6A 2QJIA 4A2SA 4RXFA 2NUYA 1ADOA 5LGZA 3W2UA 1DKWA 4OT7A 1L9WA 4NZJA 3WFAA 4M7SA 1X6UA 2E6AA 3LV5A 2E6FA 1A5CA 3IVTA 5LNVA 1P1XA 4N9EA 3PSVA 1BTMA 4R34A 3UWZA 3FJLA 5C6MA 1SZFA 2ZA3A 3TMQA 3MI3A 3U6WA 5AC6A 3G3DA 1H7XA 3LTPA 5AN7A 4BF9A 4H6KA 4UTKA 1SSDA 5KTLA 3UQNA 3W7QA 4UR8A 1SW3A 1RQEA 3PG8A 1OFBA 2YFNA 2CLKA 3USBA 3LCIA 1JJKA 2ZA1A 2X1UA 4IMDA 3NPUA 1GYLA 3ABQA 3NEVA 3G18A 1L6SA 2RKXA 1G67A 1KM1A 3E49A 4AMAA 1SU5A 2CLMA 1FCBA 5IM51 2A7NA 4Z1CA 3QPZA 4MY9A 1EWDA 1S3HA 3TROA 3BG9A 1XC4A 5FI8A 2A0NA 4PFMA 4ZQCA 2VFHA 3GDRA 4RJEA 3TIMA 4A3UA 3P62A 3C3NA 3PBWA 3PVFA 4UTTA 1H7RA 1R2RA 4JX6A 1PHQA 3RLVA 5BMWA 1DHPA 4UIOA 2GQAA 1JCJA 1HG3A 3W2KA 2OMAA 1KFBA 4NJKA 4BWLA 5HJLA 2B4GA 3TX9A 4JTFA 2DZSA 3NPWA 5D05A 3S8HA 3F1QA 1IXQA 1JCMP 1FUYA 2W0UA 3DHDA 4HT3A 3ZWSA 3TW6A 3GLCA 1QOQA 3SJ3A 1S5TA 3R5EA 4M19A 4CNOA 4DO4A 5HMSA 3LLDA 3IVUA 3IRDA 3CQ0A 3DH7A 2E6YA 1SUXA 2FIQA 3LV6A 4UMAA 3C61A 3T78A 1VYSX 3IIZA 2ALDA 1TPB1 1GVQA 1OFDA 3O06A 1W5MA 3S6DA 1VYRA 3QMSA 3W7IA 5D37A 3UXDA 3NQ2A 3ELFA 4LY8A 2C3ZA 1CI1A 1JRCA 3E0IA 4BK9A 5DXXA 3NQ8A 3KHJA 5MHBA 2A2IA 4POCA 1YLVA 2E5CA 2CW6A 5LNUA 1OFRA 3A22A 3UZ5A 4PH6A 3GX9A 1WDWA 5FEXA 5IBXC 4IMFA 3NZ1A 3LTSA 5KINA 2NV2A 2HS8A 5LNRA 2D73A 4O1AA 1TTIA 1EB3A 5K4ZA 2VENA 4N6FA 3C52A 3DENA 4IMGA 3NM3A 5AB3A 1N7KA 3PULA 3L5AA 2ZRZA 1D3GA 2V2CA 3IGUA 2QDGA 3NQEA 4HPXA 1ONRA 3TV8A 2BXVA 4NJHA 1TTJA 5CPMA 3L21A 1JRBA 4UXDA 1GTHA 4K7VA 4M6PA 2J9XA 1YTDA 2X16A 4UTHA 3EX4A 4NNCA 4MFEA 5CZTA 3S1VA 5HQEA 3A24A 3RLUA 4KWVA 3LHYA 1YTEA 3BG3A 4AVFA 3KRSA 2E68A 3W72A 2ZDRA 4HN4A 3O15A 3TJXA 4JTLA 3U2OA 1GVSA 3SIZA 1FDZA 3W2JA 3NL3A 5K9XA 4JICA 3M43A 1GWJA 1ICSA 1UJPA 2DU2A 1TYGA 2PCQA 1G7UA 3BG5A 5HINA 3JR2A 3LTYA 4LS2A 1O5KA 1SO5A 1MEHA 1SW0A 4M6VA 3LHZA 1RVGA 2VFDA 4TO8A 3W3OA 2NX1A 4E38A 4DO6A 3Q2DA 5F2GA 1XUUA 2QCGA 4ML9A 5K9DA 3KFTA 2WSQA 3CC1A 3P81A 1SPQA 4UTTC 2ZRWA 2PE4A 2NWSA 4JEQA 1YPIA 1PCWA 1LYXA 4WOZA 4WXYA 4GFSA 1SW7A 3G22A 2ZZ5A 3GIYA 3KXQA 3NQDA 1F76A 4BWLC 4YMZA 3NQ6A 1OX5A 4GJ1A 3CWOX 1S5WA 4EIVA 1TO3A 4JIPA 3W1AA 3P61A 4NUWA 1OX6A 2FTPA 4N9DA 2C19A 4J9JA 3O05A 4HSNA 5FEPA 5I3KA 2G95A 3W75A 4JTGA 2JKAA 4AWUA 4DO5A 4QISA 2VFIA 1ZFJA 4O50A 3BLIA 1VGAA 3EWZA 1QPRA 3IEBA 3S5YA 3W7LA 2B7PA 4JR5A 3C2RA 4N2YA 4CCEA 1TPUA 3PB0A 3WJYA 4K7YA 3HJZA 1WX0A 4PEKA 3MHGA 2ZZ6A 4GWEA 1S5VA 1T0OA 3LRMA 2ZZ2A 4AHOA 4ZQOA 4G1KA 1I45A 3L0GA 3O1NA 3ZR4A 2NWRA 2KZHA 4X2RA 4CCCA 4LRSA 2GQ9A 1XCFA 1BEUA 2B7NA 4IXHA 1XI3A 1QMLA 2Y85A 4AXKA 1LM1A 3W1XA 4A29A 3M5XA 4UTLA 1WA3A 3C2FA 2VEPA 1H5YA 4NQ1A 5G4WA 2NXHA 3DI0A 2VC6A 3MWAA 2W6RA 3NQCA 2QUVA 1OHLA 4O14A 3M0ZA 2LLEA 3V1PA 3W7RA 1VS1A 4I7VA 1QO2A 2QAPA 3W2LA 2E5DA 4JGDA 5F2MA 2VEIA 1X7FA 2ZQ0A 2OJPA 1PS9A 5BW6A 3W84A 2YZRA 5LGXA 1SO6A 1FQ0A 3W7MA 1T8XA 3EX2A 3VCRA 1BWKA 3N9SA 2YXGA 2XN1A 3S5OA 1M7OA 4QSHA 4O54A 5F1VA 2E09A 4FXRA 2OCZA 2CLHA 4NXKA 3C6CA 1FCQA 4UFKA 3B03A 2QCEA 4UMCA 1NEYA 4XUGA 2YCEA 1TPVA 3LCFA 1HL2A 3QPYA 4MJZA 4OHQA 3LERA 3P5YA 5D09A 5DCBA 3STFA 3LRKA 2Z2UA 3LRLA 1OYAA 1LLWA 2R8WA 4XZ9A 2VEMA 4E2BA 2NZLA 4DQWA 1A5SA 1B4EA 1AW1A 3OIXA 3G1DA 1M7PA 3G1HA 3QH2A 4HPJA 3SGUA 4NJGA 4UTWA 1OK4A 2WNZA 2NX3A 4UTMA 3LB0A 3IGXA 1P0NA 2QCHA 3OVPA 2NUXA 2PURA 1JVNA 3B8DA 2YW4A 3PAJA 1KBJA 3MBFA 2EPHA 5HWJA 1OYBA 1NSJA 3SY5A 2WSRA 3ZFHA 5KMYA 4H3DA 1MO0A 3PC0A 4ORIA 5AC7A 3QQ1A 2ZCGA 2EKCA 3UWQA 2XFWA 1GPWA 3M9YA 1A50A 1H60A 1KM3A 3HGSA 1K02A 2Q3RA 2TSYA 5G2IA 1GYNA 2V8ZA 1KM6A 2BWGA 1I8JA 3NYZA 3PUDA 3OG3A 2E1DA 1IXNA 4IXXA 4WY0A 2A21A 3WK1A 4Y90A 4IX2A 3MP4A 2G5WA 1YDNA 1F2JA 2R91A 3FYPA 1H61A 3NO5A 2PRLA 3QRHA 3T55A 3FA5A 4MOZA 5HWNA 4RXGA 3ZS4A 1OFPA 3W1UA 2WKJA 5EPDA 1ZENA 4MKNA 1OFAA 2CZFA 4DPPA 3DI1A 4UR7A 3SFKA 4YLWA 3QJAA 3UYCA 1G7VA 4IJBA 2NXIA 1Y0EA 1KFJA 2WPBA 2AGKA 3HMJG 5AYXA 4S2CA 1JCXA 5EYWA 3A5FA 3LGEA 1DOSA 1FX6A 4E0CA 2C0AA 3NNTA 4K8EA 5FEZA 4P61A 3LCGA 1UUOA 3MBDA 3MP3A 4PTNA 1K7XA 4GRSA 3PBYA 5KZMA 1WBJA 4W9TA 5DLCA 4FNUA 5G2WA 4RLIA 3UZJA 4HNUA 4Z1AA 1B3OA 4NU7A 5SWUA 1PCKA 1TB3A 1TV5A 4Q32A 3RMJA 4NJIA 1AK5A 4WXZA 3PB2A 1QFEA 4GUHA 3W1NA 1L2UA 2QCMA 5G1TA 1H51A 3W2MA 1NF0A 3FEMA 4C1KA 3ABRA 1C9DA 2ZZ4A 3TDFA 3HOJA 3W9ZA 4O8RA 5DY2A 3EEGA 5HUOA 1TV8A 3A21A 1PIIA 3VE7A 1GG0A 1XDMA 5IBXA 5EMUA 1G69A 3GKFA 3FOKA 1Z44A 3P74A 4XBKA 2B7OA 5AYYA 3QSRA 3BARA 4D2JA 4LUIA 1RR2A 4RK8A 4CNNA 5DN1A 4YXGA 1VLWA 1JUEA 4LWWA 1JQXA 3CLMA 4HIBA 1OFEA 4FHAA 4PC8A 1SSGA 1HFBA 1LBLA 3UPWA 3N19B 4BR1A 2DZTA 4N4QA 1VR6A 3PSWA 3TSDA 2H3BA 2QDHA 1GVFA 1VC4A 3GDLA 1L6WA 1JUKA 5FF0A 2YFOA 3HB9A 1FY6A 4FNSA 4RCXA 5D30A 4JIQA 2OX1A 1N55A 5K7JA 4UTWC 3DZ1A 3M5YA 4UTIA 5I3HA 4GXMA 1VHNA 3UPBA 1R2SA 3O6DA 4LVAA 5DELA 4ZVJA 3ZWTA 3GXNA 2A6LA 1KLYA 3CPRA 3ABOA 3TQKA 2QUUA 1ME7A 3SGZA 5TQLA 4Q4KA 3F03K 4LVFA
chains in the Genus database with same CATH superfamily
2Z6JA 3UJ2A 3E5BA 3L4UA 4AH7A 2YW3A 4H2HA 3BGAA 4M29A 4AEOA 1DEDA 1BYCA 1GYMA 3LS9A 2B81A 2PGEA 4TVDA 3CM4A 4A3QA 5HNRA 5FSEC 1XBXA 5CXPA 2YBVA 4IICA 4M7TA 1Q4WA 2HE8A 3WEOA 3EX6A 2FB2A 2HV5A 4XZLX 1JDFA 2ZADA 1LJYA 4LUTB 4IT1A 1E9ZB 5M03A 5EMKA 4R3UA 1UPPA 3RGTA 2EEXA 4ZL1A 2JGQA 3PTMA 5LNWA 3WJXA 4YIWA 4OIFA 4EAMA 4NNAA 3N2XA 2JEPA 3GHUA 3LA4A 3NYDA 3TU9A 3VD5A 2F84A 2P0IA 1C8VA 4H9YA 3UP8A 5BRPA 2RFGA 1V08A 3HQ1A 4DZHA 3NOYA 1QNOA 5F2IA 3M7SA 4PUNA 1S38A 2QF8A 2ZZ1A 2PDMA 2Y0FA 1PYMA 4TUFA 3AOFA 1JCTA 3PPHA 1F4AA 2NT1A 4PBFA 1UH3A 3T1GA 1T96A 3UR2A 1GHRA 3GVRA 4GQRA 3SCTA 3T09A 3WCZA 4HPNA 1XXXA 3MSGA 4O53A 3TQPA 3ITXA 1H49A 4PA8A 2X0YA 3TLQA 1ISZA 1N8FA 5A94A 3GNXA 1DPMA 2CNCA 5BU6A 5M1TA 1XLHA 4I90A 3S83A 1LQAA 1OIFA 2O56A 3VM7A 2Z7KA 1UP0A 3ANVA 1ADSA 1XH0A 4H2CA 4P5UA 3W7DA 2XM1A 4F0LA 4I7UA 2BVWA 4EXQA 1B9ZA 3KW3A 3TTSA 3K13A 4LBSA 2YLAA 3ITTA 1L8NA 2X40A 1JIBA 2GVLA 3UVAA 3SSJA 1E43A 3LBOA 1OCBA 3AMCA 3VKBA 4C90A 2RJHA 5JQ9A 3A13A 1DE6A 3W73A 4GI9A 4ZENA 4YN5A 3GG0A 1UB3A 1XUZA 1ZHAA 3VGHA 4GNVA 1R0MA 3KE0A 4LYRA 2GK1A 3AXXA 6TIMA 1XYZA 4RPPA 4V27A 1FWSA 1BQGA 1GOOA 1WZMA 2WMGA 3CIWA 1EQCA 3TMLA 2MNRA 5C8BB 3W22A 3KS6A 1XLEA 4WK9A 3AXMA 2PLKA 4RPQA 3SCUA 4M24A 3BPWA 4LEFA 3DYMA 4WKHA 3N4FA 2IW0A 5A69A 4P8VA 2DZVA 3KL3A 4FLSA 6TAAA 2ZVIA 4GOAA 3TH6A 5AYBA 1AQMA 3IJQA 3OOQA 5A95A 1EGZA 5F1UA 3I10A 1KM4A 1RD6A 2H6RA 3P84A 1OX4B 4DJED 3JRKA 1R3SA 2QR6A 2FHFA 2VYOA 2C79A 3BO9A 3S42A 4HKPA 4MB4A 1FWDC 1NVMA 1HQTA 1NDWA 2FFCA 4FSAA 1BRLB 3KRBA 3RCNA 3WQ8A 4LVDA 1JDCA 4R85A 3KZPA 5AHEA 2Z27A 2VFGA 3WY1A 3LY0A 4PSPA 3WMBA 3UA3A 2O7SA 3RYSA 3UVIA 3SI9A 4MSSA 1OGGA 4C7DA 1NOFA 1MFVA 2HK1A 5K2ZA 1J18A 4LUJA 1W1A1 2PC8A 3QBUA 3GNRA 2EJAA 2V2HA 4DJEC 3EWXA 3WF3A 5HDRA 1H3GA 1DQWA 3APGA 3GVQA 1HGYA 2UY2A 5L6UA 4JKLA 1IEVA 3N34A 3MVTA 5I79A 3HM7A 5LIXX 3VZXA 3GU1A 3UCQA 1K3UA 1F73A 2C91A 3KM8A 1RK5A 3CV1A 2ZZ7A 5A6SA 1TMHA 4JOMA 5EKYA 4KETA 2QJHA 3GW0A 1SQ7A 1ZGDA 1WOAA 2Z1VA 5KEZA 1EJSC 5CQ1A 4WD0A 1LT7A 2I56A 2O9PA 1F6YA 3U9IA 1OWQA 3OA3A 4Q22A 2CLIA 2PDFA 3O0KA 2TYSA 1Q65A 4MJ2A 5HULA 4XWUA 1J0JA 5FJJA 1FXQA 1LG1A 3LBCA 1T99A 3CTLA 5JMUA 1VAHA 3PZ9A 1E6ZA 4H83A 3ARPA 1ZJAA 2QPSA 2INFA 1G6CA 5FJTA 3L4WA 2A5HA 3OZMA 2C71A 2P10A 3I7SA 2X2GA 3VKKA 3WBXA 1QNVA 1TRDA 4F2UA 1OC5A 4NVTA 2ATSA 3F2BA 2VUNA 4FXJA 5L9FA 2ABAA 4W7VA 2OTDA 1D7KA 4W93A 2NQ5A 2ZUTA 2AMXA 2PP0A 4ACZB 2I5QA 1E9YB 4IIHA 1X39A 3WK2A 3CZLA 4DI9A 3W85A 1QJWA 3LZ5A 4HPHA 3TN3A 1SJDA 3HQPA 5CGQA 3BVJA 4K1WA 3W23A 2CITA 1V51A 2WAGA 5FAJA 3URAA 3N11A 4GI4A 1E0TA 4M3PA 1ZNNA 3WL0A 3PJTA 4LAMA 4GUFA 3L65A 3CAWA 3WG6A 3L5MA 3MMWA 1AL8A 2IQDA 5FJRA 2ZRYA 1O60A 4FLOA 1F6PA 5HMEA 4A8RA 2IKGA 3FIGA 3KBWA 3P0XA 4IUGA 3RRXA 4YVVA 3C56A 1UMYA 1GNXA 3UG8A 4B2DA 1IR1A 4C65A 1SZNA 2BX7A 1V6YA 2PZ0A 2J25A 3BAWA 5AC4A 1K77A 1Q6QA 1XBZA 3LM3A 1OG0A 4J7RA 5CEWA 3PWIA 3H24A 5AHLA 3ITGA 1Y7VA 4GVGA 5C2XA 3EWBX 5AFDA 2FMNA 2ACRA 1PIGA 2ISSA 4IGMA 4HMEA 3LSCA 1A49A 3QHMA 2X0HA 2VEFA 4PYSA 2NLIA 3WEZA 1HP5A 1DWFM 2ZTJA 3AIEA 3MVIA 4KFOA 3DDMA 4A21A 4YCOA 4WHBA 3SGGA 2W61A 3IUIA 1RD5A 3HGJA 1VCGA 2XVLA 4HNNA 5AHIA 4Z0SA 3WQVA 1ZJHA 3R12A 3R25A 3QR1A 5XINA 2V63A 3M41A 3UEQA 1HZYA 4V28A 1NWUA 5JBDA 4RV3A 4DZIA 1X6LA 4ZOCA 2OT1A 4Q8OA 1R6WA 1FVPA 1JNEA 4HSOA 4S39A 1QBBA 2ANUA 4EAYA 4HU0A 3HGOA 1VFOA 2Y1HA 3S6OA 4KRZA 4LU0A 1XL9A 1RCQA 1FWWA 5ABEA 4PN2A 1DJGA 4LQ1A 3ZLHA 1XFBA 3EWDA 3ARZA 1QK0A 4Y7EA 1IV8A 1JUBA 1P6CA 1W37A 3BTNA 3VZYA 3WQDA 3LNPA 4UTJA 1MDRA 3EOSA 3U2EA 3CB8A 4JDYA 5CBBA 3CIVA 2GLKA 4OBRA 1B4KA 4JYFA 1I1WA 3TCEA 2Q09A 4F9JA 3UXAA 1ZTVA 5I07A 3WQGA 4RDZA 3OB8A 4B2DD 3PF3A 1CLKA 4FNQA 4R88A 3I4KA 1E9IA 1UR2A 2CETA 2OSWA 5CH9A 1NDYA 1VKFA 3HFTA 3TSBA 3V35A 2V30A 5AYIA 1FCVA 2QEZA 2FVMA 3UZWA 5D38A 4AEFA 1OC7A 4QNEA 1O12A 2PRMA 4PEEA 2JALA 3NA8A 4JTCA 2P50A 3SRFA 4H8HA 5EA9A 3NGFA 3WF1A 5A1AA 3LUTA 1IT7A 3NTYA 4XO6A 3BMVA 1J2WA 2CBVA 4MPQA 3N2MA 2PDQA 3LOTA 1XD0A 1W1ZA 1GQNA 2XUCA 4UTUA 1MXDA 3WYZA 4HQVA 1W9UA 3CV2A 3EX1A 1JCLA 2Q6ZA 2VDHA 3ANYA 1QRQA 4M6UA 4MWAE 4WJXA 2WV8A 2BV9A 2WPGA 3PM6A 4BZYA 3CHFA 4TTGA 1UC5A 2HNEA 4HNTA 3R89A 3EZ4A 3W7PA 4UWMA 1MFUA 2V81A 5I23A 3ZSTA 1UW9A 1EUNA 1E6XM 4K38A 2YCIX 4NJJA 1YEYA 2EJ1A 2VJXA 2AL2B 3P7YA 2P0OA 3N17A 5REQA 4FNRA 3E2SA 3HPXA 2WJFA 1QI2A 2O7QA 1ADDA 1W17A 3PWGA 1FRBA 4HU8A 5M3WA 1MRAA 3MJYA 2XN2A 4LNCA 3W1QA 4O17A 4XBSA 2C6QA 2FLIA 4UQAA 5I5RA 3QQ0A 2A3CA 1ITCA 3ISIX 4KWSA 4R5EA 3W38A 1K8YA 4CN1A 1P0KA 1ONWA 5M17A 1LOSA 3VGDA 3D5HA 2F8QA 4UNKA 1R3RA 4OBTA 5TF0A 3WZ0E 2W27A 3IJDA 2CLFA 2V3GA 3GAYA 1UBSA 2CC0A 1PPIA 4J3TA 4CD6A 3EB2A 1EO7A 1KRBC 3USZA 4PTDA 4ERAA 1KKOA 3QV9A 2ZUUA 1DHKA 3W2NA 1SR9A 1NAL1 3NQFA 1RAKA 2ZRUA 3H4WA 5GJNA 3EDKA 3IK4A 3FHQA 1JG9A 4WQ6A 1OCJA 3MV01 2W91A 2QDDA 3G0SA 3VGBA 3F4NA 3I3EA 4WLCA 4RNHA 4JPGA 3RPTA 2OG9A 4GYJA 2C18A 3M0MA 1QPKA 3VINA 1X8FA 4AHQA 1C3FA 3I65A 5CPNA 3B8UA 4ZB0A 1H1YA 1YNQA 1FHLA 3KRUA 3W6YA 3NG3A 5BWFA 3I3DA 1JZ4A 5K4XA 6A3HA 2JF7A 2OT0A 3P60A 3RU8X 5CSRA 1BG4A 1JPHA 1S1PA 3SCOA 4PUDA 1ODUA 4JBRA 1V7AA 4GNJA 5LKYA 2WC4A 1RA0A 3I7RA 1GUVA 3FX4A 3O16A 4J40A 1HF6A 4KEVA 4PFHA 3INPA 3W76A 1UA3A 2VRKA 4AVOA 4IL2A 2OFJA 1UD3A 1HJXA 1UOZA 3HURA 4QBXA 3N3MA 2GUYA 4GY1A 3RFAA 4TR9A 3F7JA 4FX6M 2QJGA 1NFPA 3WQOA 5A8PA 4AX6A 1YHTA 1Y65A 1BGAA 4JHMA 4LF1A 1Q5MA 3PBUA 2H90A 2VX7A 3MMTA 1GZ1A 1Q8AA 2EXOA 1X1ZA 1VRXA 7CGTA 3G8EA 2NT0A 3E6EA 5TD4A 2FJKA 2PBOA 4UFIA 2VFFA 4WY0F 3PS7A 4R7WA 3UU0A 3ZJ7A 3M07A 2VZUA 3DKJA 7ENLA 1OB0A 3H54A 1JZ2A 3CWNA 3GDKA 3IRSA 3TSMA 3BGGA 4ICNA 2XYLA 4HK5A 6ALDA 3MSYA 4RW5A 1EYEA 3GC2A 1ML1A 3VAVA 3NR0A 2D0HA 4ADTA 3W7GA 5MKGA 5HR7A 2EBNA 5U4NA 3RG6A 3LMZA 7XIMA 2FZ8A 3KP0A 4GIAA 3LNMA 3YPIA 4FI4A 4KEUA 5H2ZA 4BI6A 2GVGA 4LEQA 1PX8A 4XAFA 4PCFA 3UXLA 3ITLA 4JTSA 1H0IA 3E12A 2BZNA 3UA4A 2ZXQA 1XRVA 4HPGA 1EP3A 3CIXA 4Y9AA 3TQ0A 3QQWA 1IXOA 5D4YA 4HA4A 3TW7A 2D24A 3H2AA 4G7EB 1IZJA 1Q85A 3M0LA 5AC8A 1NY1A 3F4CA 2DFAA 3A9IA 3H2EA 1F7BA 3A3WA 3WLMA 3HQOA 3EXTA 3OZYA 2YR1A 4GPNA 1XDLA 2AKZA 3F5LA 4O0KA 3WK3A 1WKFA 4HD5A 2J8TA 3CU2A 1J93A 1V0KA 4D6JA 1P0DA 4AB4A 2OOGA 4AF0B 5EBUA 4QIUA 4GBUA 2OYMA 4G9PA 1Q6EA 3SN1A 4NNBA 5CZSA 2A85A 4AG0A 4K6AA 1YTKA 3TUUA 1Q6RA 3FGCA 4LOCA 2E4TA 5HJXA 3GG8A 1R85A 4XAGA 1PXGA 4DF0A 2ISDA 4DBSA 4ZO7A 2WOQA 4CN4A 1OM0A 5IFTA 2V67A 2WM0A 2FTYA 4I7WA 3Q58A 5LHFA 2XPKA 2D2HA 1N8IA 1TVLA 1E4IA 3V1HA 5DFAA 3UXKA 3S9ZA 2PU0A 2BS9A 1QWGA 3AHXA 1ZP4A 3G6MA 4GG9A 2VUYA 1Z42A 2ZE3A 1KGXA 1PVNA 3VD7A 1ICQA 5B7YA 1J6OA 1N82A 1W3JA 2YL8A 3UY7A 5CJNA 5AOUA 1TX2A 3NPVA 4J35A 3S0CA 4LYQA 1ZZMA 2F6UA 5FA5A 3OLIA 3ICJA 3GG1A 1ZAIA 4Q6JA 1TV4A 1RPKA 3AMGA 4JFTA 4OUIA 4DBUA 1U5VA 1HT6A 2FH6A 4WUIA 1FWBC 1DVJA 3OZOA 5DMYA 3E0WA 4Q8TA 1Z3NA 3UG5A 1WBHA 2WCGA 1O5QA 2IMRA 2PDKA 3AMLA 4V33A 4XZBA 1F07A 1I2RA 3MI2A 4O28A 2GJLA 5EFFA 5IXEA 1A5AA 2R1KA 5KSWA 1OJXA 3WUGA 1R8LA 3TC6A 1X97A 3CL7A 2E0PA 4LVGA 2OZ3A 4XKYB 3T07A 4X3ZA 3CZGA 4V15A 4NI3A 4MG4A 2J6VA 3QM3A 4ERGA 1F8MA 2ZA2A 3DFQA 3L2LA 2VI0A 2E77A 2X41A 4FALA 2XU2A 2R1LA 2HRWA 1MEIA 3TZFA 3UG4A 4DF2A 1OD0A 3E9AA 4O12A 1Z6KA 3V0SA 3QFWA 3MS8A 1VENA 1VH7A 1PE1A 4IPNB 2ZUVA 1AW5A 2DJXA 4HMDA 2O9RA 5HBFA 3CMJA 4DBDA 1XBVA 4LAUA 2PDPA 4F3HA 1LQ2A 4Z1BA 1EJUC 5IHSA 4JNMA 5BCAA 1XIDA 3L0NA 3E2RA 3NPXA 2XN0A 1F5ZA 5BRBA 2DVUA 4EVZA 1EJTC 4LAOA 5XIAA 4IG2B 1FWJC 1DKWA 1K4HA 4OT7A 4HNCA 3WFAA 4M7SA 5BXTA 1GOWA 2Q01A 3MWCA 1X6UA 4I3GA 4N9EA 3VOFA 1UZDA 4EXAA 3MSDA 1UKPA 5C6MA 1QW9A 3TMQA 2CKRA 4L64A 3U6WA 1IEXA 4P7QA 5AC6A 2OEMA 1H7XA 3DG7A 4X2PA 1EZ2A 1XW8A 3NDZA 4UTKA 1SSDA 2VZOA 3BSHA 3W7QA 3LD5A 2OKOA 1M68A 3RJYA 1KB3A 4TX6A 4KGLA 3R11A 4G1NA 2BY3A 1TUXA 4HOXA 1GYLA 4QR6A 3CAKA 3T0DA 5C9UA 1CLVA 2CLMA 5IM51 1YKWA 2IXUA 3QPZA 4RNFA 3TROA 5FI8A 2A0NA 5RUBA 4GHRA 4YHGA 3TIMA 3U2ZA 4JN7A 3C3NA 3UR8A 3PBWA 3PVFA 1XLCA 3NEHA 3QR0A 5BMWA 3EKGA 3B0XA 2XVPA 2I5GA 2C7FA 2OMAA 5G1MA 4NJKA 4BWLA 2BB0A 4V1XA 2HVMA 5HJLA 1XKJA 5LXXA 4JNZA 4L1GA 2DZSA 3THDA 2E67A 3KLKA 3OTRA 1FUYA 2W0UA 2BDQA 2Y4SA 2WHKA 3VYLA 3EPMA 1NQKA 1S5TA 4AZIA 4Z2HA 3VK5A 1TWDA 2G41A 4I5RA 4Y9MA 1E1FA 4DO4A 2QVHA 5HMSA 2ZX6A 4UCFA 3CQ0A 3DH7A 3GBDA 2FIQA 1QI3A 3IAQA 4JL1A 4ZOBA 3UCDA 1VYSX 3IIZA 2WB5A 2ALDA 3O06A 1PZ2A 4GISA 4KCVA 2Z1WA 1EL3A 2PLJA 1VEMA 3SRHA 3S2JA 4DBWA 4IPLA 4XAYA 1HKJA 3N6JA 2BGQA 2A2IA 4POCA 2E5CA 4UZSA 1OFRA 3A22A 4US6A 4GY7A 4A35A 4UQDA 1BAGA 1RK6A 3NZ1A 5KINA 1GHSA 3T8QA 1XLBA 4O1AA 1TTIA 2PCEA 1ZBVA 4N6FA 1VF8A 3C52A 5AB3A 2OLSA 4JIEA 4DJFA 3VDBA 3OODA 3KL0A 4YYFA 1Q7ZA 2BXVA 1VJSA 3GH7A 3BV7A 3L2MA 2WWDA 4Q8VA 2QPUA 3R0UA 3CAQA 2O0TA 3RM9A 1PX3A 4UTHA 1J8VA 1YRRA 2PPGA 4MFEA 3S1VA 4ICCX 4GQ0A 4KWVA 4IFKA 4CD5A 5HQLA 4AZHA 3W72A 2ZUSA 1L8PA 2ZDRA 4HN4A 3RUBL 3TJXA 3TYCA 1FDZA 1PTDA 1E3ZA 3W2JA 3NL3A 1K9FA 1EDQA 5ABFA 5K9XA 1GWJA 1RJPA 1TMQA 1UJPA 1I1XA 2EG7A 2GGGA 3GTNA 3BICA 1G7UA 4AXNA 3BG5A 1LUCB 4H9VA 1PTGA 3JR2A 4LS2A 1MEHA 4AZ5A 4M6VA 4GZ7A 2NX1A 4GGHA 2VC7A 2VVNA 4WDTA 3RLGA 5F2GA 3HFYA 3VGGA 3KFTA 2ACQA 1IQ8A 3P81A 3WMLA 1LYXA 4HCLA 2WWCA 4WXYA 3G22A 3WD0A 2VR4A 1CIUA 3GIYA 2VT0A 3BMWA 4BWLC 5FAGA 3BAKA 4JIPA 1J0YA 1OX6A 4GBDA 2C19A 4Z2IA 4JTGA 1R7OA 2JKAA 3B9AA 4JFSA 2VFIA 4O50A 1VGAA 2CHRA 3W7LA 2B7PA 1UD8A 3N6HA 4JR5A 3PUGA 4N2YA 5CBJA 1I75A 3WJYA 2INZA 3HJZA 3KS5A 4WKFA 1FTXA 4GWEA 5H6HA 1GJWA 3AXHA 2ZZ2A 4AHOA 4MHBA 3ZR4A 3WH6A 4QP0A 4OECA 7PTDA 4CEXC 3T81A 2QS8A 1BEUA 1XI3A 3URQA 2Y8UA 4F0RA 3MV11 2GGEA 4IPPA 4A29A 4INFA 1WDSA 3EDJA 1WA3A 1D2KA 1H5YA 2G4JA 5G4WA 2NXHA 2VC6A 1Y5WA 5C7VA 2WLYA 2LLEA 3KBMA 4H41A 2DZAA 1DWAM 2E5DA 4FOUA 4FLRA 2QJJA 1VFLA 4XD4A 2YB1A 1PS9A 5BW6A 3RN6A 2YZRA 3GG7A 5LGXA 2CBUA 1T8XA 3VCRA 3A9BA 2XN1A 1Q2SA 3S5OA 1PZ3A 1B3YA 1M7OA 4ZOEA 4L6OA 4CVUA 4NXKA 4AD2A 3SQSA 1GQJA 2FHCA 2O9TA 3B03A 1E15A 1NEYA 4XUGA 2YCEA 1TPVA 3T0CA 4OHQA 4Y9PA 3SUSA 3LERA 3P5YA 5DCBA 3STFA 3P0WA 4E8CA 1A5SA 1AW1A 2OB3A 3G1HA 2VRJA 4MKSA 6REQA 2WNZA 1ELSA 3M0HA 2D2JA 3LB0A 4KT2A 3B8DA 4C5YA 4XD6A 1A5KC 5HWJA 4C6LA 1NSJA 1NP0A 2QPXA 3PC0A 4ORIA 3ZM8A 2ZCGA 3SCWA 1EIBA 3UWQA 4B15A 3U57A 3MT1A 1GPWA 3PJUA 1A50A 1XG3A 1KM3A 1T40A 4G8TA 5AVNA 3PUDA 1UPMB 2E1DA 4A3RA 4FZIA 4I5UA 5AZ1A 2GK1B 2GSJA 4WY0A 5TAOA 2D1ZA 5HATA 1V6UA 2AMGA 1F2JA 2R91A 1H61A 4F4RA 1IGWA 4RXGA 3W1UA 3AMDA 5A2AA 3A4JA 4EPKA 2CZFA 3REQB 1EDGA 2P5NA 3SFKA 4YLWA 3CK5A 2DIJA 4GO9A 3PTKA 1JFHA 4D6FA 5AYXA 1WNOA 5DMNA 2CXGA 5EYWA 5GNYA 2Q02A 1LT8A 1GONA 2C0AA 3NNTA 3KHDA 4K8EA 4P61A 3QOMA 3MBDA 4G56A 1PKNA 4GRSA 3PBYA 2DUAA 5KZMA 4FNUA 5G2WA 3R7MA 1B3OA 3NQBA 1KKRA 2A3EA 1TV5A 4Q32A 3PP7A 2NV9A 1P6WA 3CUIA 1CNVA 4EPBC 1DIOA 4GUHA 2V69A 2QCMA 4EPDC 3SY1A 3W2MA 1XYAA 1NF0A 3FEMA 1UD6A 3B0YA 4JL2A 3UESA 1T8QA 3O2LA 3GBEA 5HUOA 1PIIA 4PMNA 5T9CE 2VZSA 3FA3A 3PK7A 3CQIA 3EB4A 5IBXA 2NQHA 5LIYX 2B7OA 4KCUA 5AYYA 3TYUA 2A3LA 4RK8A 1BTCA 3C0QA 2V3DA 4LWWA 3WLRA 4JIIX 4HIBA 4PC8A 1SSGA 1HFBA 3R43A 3UPWA 4BR1A 2DZTA 1ONEA 2PTWA 3TSDA 2H3BA 3NO1A 2QDHA 1GVFA 1Z8AA 5FF0A 4HSHA 5D8ZA 3VTRA 3HB9A 1HJVA 1FY6A 4FNSA 4RE3A 5ABHA 2OX1A 5CJ5A 3T2PA 3FW6A 3M5YA 2R6OA 4UTIA 4PCTA 3VKCA 3O6DA 5DELA 3GQYA 2GVEA 4S38A 3UJEA 4ZXLA 1AMYA 1ME7A 4GMEA 3SGZA 2VRQA 3TOYA 3IJ8A 2CZVA 5A6KA 5A2CA 2NVDA 1R2TA 2XISA 2HXTA 1I2QA 2FB3A 4TX8A 4FIQA 2W9MA 3QYSA 1KWKA 1TPC1 5C7HA 2XH4A 4UB9A 4XAPA 3DX5A 3LLFA 3QPEA 1TSIA 1BF6A 1EYWA 3CEUA 2OWXA 2TRSA 3GZAA 3TC7A 1O6IA 3CUGA 4R53A 1R9XA 2DSUA 4MGGA 3WLLA 4YL2A 3M5VA 3ZT7A 4DUWA 4PL1A 3OQ8A 3W27A 1YXCA 3LPOA 4A8LA 1RCXB 3T42A 3CQHA 3CH0A 1U30A 3E96A 4RV8A 4LV9A 3AHTA 3M0YA 3EPNA 3WH5A 2DZPA 3S6TA 5EL1A 2CZ5A 2GDQA 4KESA 1E6NA 2Z28A 3PZOA 3KDOA 1UH2A 3FAWA 4R9OA 2CKSA 2Q8LA 1ZBCA 4D6EA 3OLGA 4NHVA 1HX0A 2VGFA 3KEHA 4DVOA 1EJRC 3QR3A 4CQ9A 4Z2GA 4KIRA 3DG6A 4K2SA 3CUJA 2P3EA 5CG0A 3TN4A 1ECQA 5CC7A 4FNPA 1M03A 3TXVA 2GSHA 3LHTA 4BJHA 3KLLA 1ITQA 4OU1A 1J5SA 4W85A 4C1LA 3GFYA 1PZ0A 3HJEA 4CD8A 1V02E 2F38A 7TAAA 2PU1A 4FF7A 4AX7A 1ZSXA 1WZLA 4ONVA 2F6XA 4BFAA 1RH9A 4AIOA 1QNSA 3FDGA 3ZR5A 3VNYA 4Z08A 4LB3A 5D04C 3S4TA 5ABTA 3PZQA 2G0WA 4RZ4A 3TAOA 4W84A 4MNJA 3PNUA 3DYPA 1XFCA 1VPXA 1UASA 1XLAA 2G3IA 4QEEA 4DB7A 3ZOAA 2PP1A 3LQGA 4AC1X 4IUOA 3RF9A 3P8IA 3M44A 4QAIA 3TR2A 3ZIZA 3PFMA 1CB2A 1MXSA 4US5D 1V6WA 3S1UA 5F2LA 3ABSA 2HCVA 3GR7A 1K7EA 2QCDB 1XF0A 3AICA 4JAWA 3LPFA 3O6AA 4QG9A 5U7SA 5E5CA 1Z89A 1Q4NX 2CLEA 3G1SA 1W1B1 4ZE4A 3M64A 3GNPA 2OOFA 3HF3A 1FH7A 4ERIA 1DTNA 1QI5A 3GC4A 4K3ZA 3NM1A 1RBLA 1OFQA 1TZ9A 1EA0A 3MA8A 2Y8VA 4MJ4A 3AUOA 5D32A 1LLZA 2FKPA 4IMAA 3U5UA 1RQHA 3MSRA 1G4SA 3SBFA 1Z69A 2YYUA 3DU0A 4DUVA 3R8HA 4HK7A 4JQ3A 1EO5A 1ZS2A 5G2HA 3BW3A 1PBGA 3A3HA 3S9YA 3I6TA 1DIDA 2GSEA 2JBMA 3LX9A 5CLTA 3K2GA 2XH0A 3BURA 1IIGA 1AODA 1GVOA 4W4QA 3VA8A 3VGFA 3U7VA 4H8VA 1SM9A 1R5YA 1O5RA 4NAFA 1EWEA 4WSJA 4QX4A 4GUJA 1Q3NA 2PAJA 3C2VA 1LZOA 3VUSA 4GVFA 3W87A 3VCCA 3P8JA 3C2OA 4D8AA 4U5IA 2INEA 2YA0A 3MPGA 4QLLA 2FHBA 1VZWA 4JY8A 3N2TA 4XIMA 1XKYA 4JIRA 1ISVA 2FVLA 1M1BA 1IWBA 1IE7C 1XH2A 4UNLA 3AJ7A 4MYXA 2R1NA 4OZOA 4OBSA 3QYQA 1WDPA 3STCA 4I6VA 1MW1A 5FF4A 5GJMA 1KFWA 4ZQPA 5REQB 4XBJA 2ICSA 3EWYA 2QCCA 1FP8A 1NOWA 3XISA 4PMYA 3VMPA 1XYCA 4LANA 4JTQA 2OYLA 2W3ZA 4JTJA 1SZGA 1W9BM 8RUCA 3NAVA 1KA9F 4EX4A 3A3XA 5HUPA 1SYTA 4DBEA 3DN5A 1EP1A 5IHRA 2J7EA 4DXVA 3BLPX 4D6CA 2QQ6A 4NZ4A 3KVMA 5DMMA 4CCDA 3TJLA 4HNVA 2J7DA 1SJBA 4KBXA 4AFYA 1QBAA 3GVGA 4H1ZA 4PMRA 1CTNA 4N6EA 3K30A 5KITA 1E71M 4TIMA 4AU0A 4AMCA 4O10A 5I09A 4KEMA 2YBUA 3MUXA 2JK2A 4UC5A 3W6MA 3NGJA 4S3EA 5IDIA 3CT2A 2FZ9A 1QXLA 4JX5A 3BAXA 5LYRA 2OYKA 3MYPA 1IEIA 2W4XA 1XIFA 4HP5A 1OT1A 1S39A 2BOEX 2GDUA 3FVMA 1K8XA 4R27A 1AH4A 4FA3A 3SQLA 4LRTA 1FWRA 4RNJA 2YL5A 2J74A 1OSEA 1UD2A 1W2VA 3ARXA 3SUVA 3N2OA 4H6EA 5A6BA 2VD9A 1RY0A 3DBPA 2GQ8A 3DG3A 3HV9A 3L4VA 1THFD 3QY8A 5D8WA 5HWMA 1BLIA 3WQ5A 3CS2A 5HMDA 3CL8A 4XO7A 1VP5A 2CXEA 4Z2JA 4N9BA 4MZ8A 3U8GA 2WJEA 1FWTA 4IQLA 4YTSA 3EPOA 3VMOA 4ZZ9A 5CGMA 3WJZA 4PRTA 7REQA 1VIZA 3PTQA 2ZDSA 3T7VA 3KOWA 1H41A 1PO9A 1ALDA 4ZSUA 3CAVA 2IPFA 1JPIA 3G1VA 2V5BA 4J2PA 4IIFA 4PUKA 4X22A 3VOHA 1A5MC 2UZ9A 2JF6A 3LENA 4H4IA 1Z9AA 1KFEA 4I9TA 5FJIA 5FACA 2PDNA 3GIPA 2D3NA 1XR2A 2E6DA 3BZJA 3V75A 3R8GA 2WCSA 3CT7A 3THCA 3W7NA 4ROPA 1ITUA 4UR9A 3TCSA 2IKHA 3WD1A 2BP1A 2PDIA 3RK8A 3VIKA 5A6MA 1DJHA 2WZIA 1A0DA 2VC9A 1JF6A 2DJLA 4RE2A 2ON3A 3S1GA 4IPIA 3GXMA 3W7KA 4YU1A 4OFCA 4C6QA 4DZAA 2QYGA 5BROA 1GW9A 2BY0A 4H7CA 3VDAA 1CENA 4U28A 1PDZA 3PN8A 4JFWA 3AYTA 2YIHA 4L4MA 1GOKA 3W86A 1V4YA 1WXJA 3VO0A 3BSMA 4O52A 4DWSD 1DIEA 3FN9A 3MCMA 2PI6A 3N4AA 5G1YA 2YA1A 1WB0A 3SO7A 3LGGA 5DCEA 1GORA 1XINA 3G5EA 2DP3A 1K1DA 4DY1A 4KRUA 2J77A 3EA2A 4O19A 4L80A 3ZLFA 2POZA 4GGBA 2QCNA 1TREA 3WNOA 3ONBA 4ZGYA 3WSUA 4PRRA 1A0EA 1JI1A 1XC6A 3GXIA 1ZJBA 3CUHA 2RAGA 2PC4A 1YPFA 3OBEA 5HXMA 3C4UA 3OGRA 3FGCB 2HPIA 3KWSA 1UIOA 4DWSC 2A1YA 5IRPA 3KOFA 4JCLA 3GHRA 3JUGA 2VKZG 2RDXA 3C8NA 1DWIM 3CEPA 4WDWA 3GTIA 3L67A 2VD8A 3MKKA 4NIRA 3BOLA 4Q8PA 1BWLA 1E72M 2OQYA 1RPXA 4LUSA 1LF1A 3CL6A 3L12A 4HBKA 2I1OA 3GTXA 1IZKA 3KTXA 2BODX 3PNZA 4F2BA 1G1YA 2FVKA 4IQEA 4B92A 4MM1A 5LA1A 3L66A 1BXBA 3KWXA 2XWEA 3HPZA 3WQWA 4C1NA 2O55A 2C15A 2QF7A 4DZ5A 1X38A 3WH7A 3E2QA 2PWUA 3B8IA 2DZUA 3KVKA 1J12A 2KAUC 4HYVA 2XWDA 3SEPA 3M46A 2ZWYA 3NSXA 1H09A 4U3CA 4ZE5A 1T6MA 1V3LA 5D02A 3KBSA 4UQ9A 4IMCA 4L61A 4O57A 1JGIA 4W8LA 1YYAA 1MQRA 4X60A 3QZEA 3GDMA 3W26A 2J24A 2JIEA 3QGKC 3W7EA 1FWGC 5E0CA 5GVJA 1JQVA 1KM0A 3EEZA 4IP7A 4QTGA 2DORA 1RZMA 3IARA 1Q8JA 3DFTA 2HS6A 3GK0A 5AVHA 3W74A 2XZ7A 3M0KA 4C6KA 1F3TA 5KZDA 2CIPA 3NXFA 4M1BA 5DT5A 3IJ9A 1F74A 2W79A 4V2XA 1E3XA 3GDTA 2UY5A 3EOLA 3OPSA 5JBEA 3ARVA 2ATMA 2GWGA 4UFMA 2PDCA 4TQTA 2XVKA 5E6YA 4RKAA 4IWWA 1LORA 1EKOA 3AIBA 1KLZA 5C9RA 2Y5JA 1IYXA 4MUZA 1DQXA 1DJQA 4C5ZA 1EZWA 1FP9A 1KQZA 3R13A 2G50A 1E9LA 3B8VA 1FHUA 2HMCA 2VX5A 4DUXA 4OQVA 2EGZA 4NL1A 4RUBA 3PZUA 3S2CA 4B4HA 1TA3B 3OGSA 3G0UA 2Y7EA 4WCJA 1WQ5A 4LCRA 4OJYA 1XQLA 3BW2A 1B30A 3CZJA 3STEA 3QW4B 4M51A 5J04A 3VNLA 2GL5A 4FB7A 3HTWA 5DBTA 5CGTA 3CBWA 3L7RA 4XVDA 7A3HA 4AY7A 3NO3A 3VPLA 3JS3A 5FF7A 3GZ3A 3L68A 4HU4A 2GOUA 3ALGA 2ISVA 4X9SA 2YDAA 2Y89A 2V6AA 3RX3A 3NZQA 2PMQA 1TCMA 3V5OA 3GH4A 1PKMA 4L1XA 3LCWA 3WLHA 1JNDA 1JDDA 2FMOA 4KPLA 3OO2A 2HJPA 3P3BA 4CLMA 1QPOA 4I9AA 2D0GA 3LI0A 4JFVA 1AD4A 5A8NA 4QS5A 3W7CA 4GYFA 1OVDA 7TIMA 3LCHA 2V3EA 3QV6A 3W02A 4CNPA 3VD3A 3VIFA 4R7OA 1ICPA 4K68A 8A3HA 1C7TA 1PYFA 2WJDA 3BZGA 3B9DA 6CGTA 4FP1A 2CPUA 4RZBA 4LS0A 3P5ZA 3SUWA 3AIVA 3ITVA 1REQA 4O13A 3C5QA 1L0PA 1P7TA 1TPFA 4UCGA 1W32A 3A47A 1GT8A 2H8ZA 5FF3A 3A23A 2QIIA 1Z7AA 2V82A 1RP8A 3MW7A 4QG6A 1E6QM 3KOZA 3LGDA 1AL7A 3V16A 1YNPA 2ZTKA 1JDEA 1GZJA 4GC4A 3TYZA 4J3UA 3EWUA 4GQQA 2FGZA 3GXTA 5LZLA 2Y62A 3NJ3A 1TVNA 3L0KA 3WX7A 4S3GA 1X1OA 1F4HA 4FNTA 5GNXA 3C8FA 4LSBA 3AHVA 4GI6A 4GIRA 1QCWA 3Q94A 4AIEA 3LHVA 4ATDA 3FYYA 3LN3A 3KBJA 4HZ8A 2VR2A 1W3TA 3W6LA 2QJNA 3FXYA 1BPLB 1QOPA 3AIRA 2YCLB 4Z2LA 1RCOB 5I3IA 3CO8A 3JW7A 1R3QA 3HPFA 3TTOA 4M81A 1ZCOA 2IQTA 3ZVHA 4B9ZA 1K7FA 3SM0A 3M7WA 4QNWA 1XYMA 4EF8A 3AFBA 2PTYA 2OODA 1FBAA 3R2GA 4O0ZA 3SJNA 4FEZA 3FJ6A 3IIOA 3QOKA 1DJZA 3ABXA 2HVNA 3S46A 3DHUA 3U0HA 3N73A 2R94A 1FXPA 2HBVA 3EWWA 4HYWA 2YLLA 4MB3A 4D8LA 5DANA 4AQLA 4P7RA 3VOGA 3EDEA 2Z29A 5CC6A 1W1TA 2PSNA 3DC0A 1OK6A 3QHOA 2ZOXA 3M0IA 1TJ2A 3C0JA 4GYKA 3U48A 4GO8A 1GK8A 1SVDA 5DO8A 5BYWA 4H00A 3OVQA 1S1RA 3WFZA 4IQJA 3OGVA 3WQ6A 1DXIA 1VHCA 1XIHA 4GJJA 5ECVA 2QZRA 4IFKB 3M6YA 3LSBA 1EUAA 2Y24A 5AYZA 1XV8A 3UF9A 3T2QA 1KTCA 5HK4A 2XVGA 1W54A 1NF7A 2GJXA 1VCVA 1KTNA 2Y7GA 1WYIA 4KEZA 4IX0A 1ZAJA 1C91A 3B0VC 1TR9A 5J8LA 2I14A 4MDPA 1LRTA 2F6KA 5LIKX 1V5XA 1E51A 1R46A 3HIJA 3QTPA 1QO5A 3AROA 4XX6A 1DJXA 1V03A 4F8XA 2C1GA 3GVWA 3S2LA 4Y8EA 4B16A 3FAXA 2ZX9A 3TYEA 5T8GA 4FR1A 3D3AA 4O4VA 1L6YA 3PANA 4QLKA 2QXWA 4OGZA 3E3HA 3K4DA 4BEQA 4KCTA 4B3ZA 2C8NA 3RO8A 2X2YA 1E0XA 2RGLA 2VELA 3OQEA 3ATYA 1ENUA 2J66A 1EX5A 1GOIA 1GZGA 1W2PA 3RM8A 4AD3A 2PRHA 1TKKA 1X98A 1AW2A 4NX5A 5XIMA 3PZTA 3CUFA 3V18A 2BY1A 2WNWA 3T4CA 2PP3A 1KFLA 3NL2A 3U4FA 3N29A 2XJ7A 1I2OA 1OFOA 8CGTA 1OX4A 1UR8A 2VZVA 3OYXA 2A3HA 4FIRA 3WJWA 4WR3A 1FOBA 2WYSA 2J7FA 2OWWA 1V8EA 1BRLA 2YJQA 2NUYA 1ADOA 3BCFA 5LGZA 1L9WA 2I57A 3UBPC 2E6AA 2YXOA 1J0KA 2E6FA 2Z00A 3LV5A 4HOZA 3IVTA 5LNVA 2I9UA 1P1XA 3ZJ8A 1SFSA 3PSVA 1BTMA 4RL3A 4QDPA 1RALA 1SZFA 3C3UA 2ZA3A 3MI3A 3IJLA 3NFUA 4W88A 2DT0A 1V3KA 2SFPA 4H6KA 3UQNA 3N6QA 4BQ4A 3VGEA 4F79A 1WCGA 1OD8A 3PG8A 3V36A 1OFBA 2PTZA 2YFNA 4GXPA 2ZA1A 2F2HA 3NPUA 3ABQA 2RKXA 1KM1A 3SCVA 4GCAA 4AMAA 5KZ6A 1CCWB 1UZ1A 2EKGA 3QTGA 4HMNA 1EWDA 3M0JA 2V5KA 2VFHA 4RJEA 4L56A 3P62A 2PLMA 1VBHA 1QT1A 4MPKA 4LY4A 1J9YA 1R2RA 2PDUA 1K6AA 3BOFA 1ODZA 1DHPA 4YWSA 4UIOA 5T91A 2GQAA 3MY9A 1QNRA 2BBFA 3MUIA 5FCZA 3TX9A 3GM8A 3H7VA 4CKQA 2IPWA 3NPWA 5D05A 1X8CA 2GYIA 4HT3A 2J78A 3TW6A 3RAOA 4HZ7A 1M7XA 4LYKA 3BWWA 4QAWA 4CNOA 3IVUA 4GLEA 3IRDA 2E6YA 1SUXA 1V3IA 3LV6A 5F7UA 3SY8A 4W87A 1J0HA 3QHNA 2GVYA 1WDRA 2Z1XA 3B8WA 2YCKX 2P88A 2IUZA 1W5MA 1E70M 1U1UA 4C6BA 5D37A 4PMVA 1YNYA 3W81A 4GVIA 4ACZA 3S9IA 3ELFA 1UH4A 3MO4A 3E0IA 4NZ5A 4AZCA 1OBAA 3AIWA 3KHJA 1YPXA 1KXHA 1ZQ5A 2VDIA 1YLVA 3VNMA 1H11A 3UZ5A 4H7ZA 2ZXAA 3GX9A 1WDWA 2ZC1A 4E3TA 2NV2A 2HS8A 1K9DA 3CYVA 1XIIA 3KDNA 4KERA 2IS7A 2DDXA 4F0SA 4PBGA 4S3AA 3NM3A 1XIMA 5FD0A 3MDWA 2V2CA 3W00A 3OJGA 2WZHA 3NQEA 4DI8A 4HPXA 3FNDA 3TV8A 4HZ6A 4NI8A 1W9PA 5CPMA 3L21A 4UXDA 3JZUA 2WCAA 4CNSA 4WJ8A 1MW2A 1JXJA 2XFYA 5JH2A 4NNCA 2QMKA 3AYRA 4GFIA 5HNUA 3EA3A 1J6PA 3APYA 3BG3A 3KRSA 4XB3A 3JU2A 3SIZA 3QV7A 3OHMB 2WLZA 4JICA 4W7UA 3NZGA 4L6DA 1IWPA 4L5ZA 4RE0A 3VIMA 4E6MA 1SGJA 2PCQA 2DH3A 2ASHA 5HINA 3UWEA 2PGRA 2D2GA 2VHLA 4A6GA 3FSUA 1X1NA 2ADAA 1XGZA 1SO5A 4LBRA 1SW0A 3ITOA 1KCKA 3LHZA 2VFDA 1C7SA 1U1HA 4TO8A 5LA2A 3W3OA 1XUUA 3TN6A 3UZZA 1KNWA 4HNLA 5CPQA 2WSQA 3BAJA 3CC1A 4CGTA 8XIAA 2HNHA 1XRSA 2PE4A 3FXGA 4JEQA 4ZEPA 5FJUA 1PCWA 3ES7A 3NQDA 2IKJA 3WFLA 1F76A 1TZZA 4DYEA 2WK2A 3NQ6A 1S5WA 3H7UA 4EIVA 3KZSA 2YOCA 5E09A 3P61A 3W1AA 4H8NA 4KIEA 4HSNA 4QCEA 5FEPA 4QJ3B 1IEQA 4X63A 3APTA 4AWUA 4DO5A 4QISA 5AY7A 3BLIA 1LL7A 3PPFA 1V6TA 1M65A 3IJ6A 1QPRA 3U7BA 1VFHA 3C2RA 3QY6A 3SFWA 3TVAA 3PB0A 1KXQA 4PEKA 3MHGA 2E9BA 1XLIA 1WPCA 4WSHA 4G1KA 4W5UA 1I45A 3L0GA 3O1NA 3WDJA 1ISYA 1E1CA 2WZMA 4PRWA 3WQ4A 4LRSA 1B3VA 4HHLA 1XCFA 3PZMA 2B7NA 2OEJA 4IXHA 1QMLA 1ZU8A 3EMZA 1H4PA 1VBRA 2HQAA 3C2FA 1GQIA 4MAVA 5IOBA 3DI0A 3MWAA 1PUDA 2W6RA 4JHOA 3NQCA 2PS2A 2QUVA 4J3SA 4LXFA 3M0ZA 3V1PA 9RUBA 2UY4A 4I7VA 3BL3A 3W2LA 1YW1A 3MUY1 3V7PA 1X7FA 4UOJA 3BAIA 3TW9A 1FQ0A 1R87A 3W7MA 4C91A 3SQMA 3DERA 4QSHA 1UC4A 2CLHA 1BVZA 4HGXA 1FHDA 1JXKA 1FCQA 3C6CA 4UFKA 2CLPA 3L4YA 4HMCA 3LCFA 1HL2A 3QPYA 4MJZA 3H2MA 2EG6A 1E0VA 3LRKA 2VX4A 3LRLA 1LLWA 4XZ9A 4ZR8A 4JTDA 2WHJA 1WDDA 2ACUA 2QGYA 3QH2A 4HPJA 3SGUA 4CD7A 1RVKA 1EJWC 5I7GA 4NJGA 3EMCA 2NSOA 1P0NA 2QCHA 1HIZA 1ISWA 1JPDX 3PAJA 1PWLA 1FWCC 4YJ5A 1WE5A 4H3DA 3AAMA 4AY1A 1F3WA 1MW0A 1PJ9A 2DUXA 5CPTA 5E70A 3RO6A 1WKDA 2XFWA 4AVNA 3M9YA 3HGSA 2Q3RA 2TSYA 2EPOA 2V8ZA 2HVOA 3U3HA 4ZTXA 4GH3A 3VDCA 3WK1A 4Y90A 4IX2A 1QHPA 3MP4A 2X0SA 1J10A 1YDNA 4QS6A 2PRLA 1KO0A 4XZNX 4MOZA 4D6DA 5HWNA 4NY2A 1W3HA 2J62A 3ZS4A 1U5HA 1OFAA 1EGVA 1ISXA 1UZ4A 3UYCA 3VDGA 5I03A 1Y0EA 3SUTA 4ZFMA 4S2CA 2WVTA 1FX6A 1KR0A 4GINA 3LCGA 5BWAA 1J01A 4WEVX 4PTNA 1K7XA 1EXPA 4W9TA 3RCYA 3T9PA 4BQ3A 2J79A 4NU7A 4FLQA 3UNTA 1EOKA 1MVYA 4PTWA 3CB3A 1UR4A 3VOCA 3MU7A 2UY3A 1XSIA 4QRNA 2OU4A 1C9DA 4YTRA 4O8RA 1XSKA 4PUMA 1M01A 3RMEA 4HJWA 5DT7A 3VE7A 1FFQA 5EMUA 1G69A 3LK6A 4Z17A 2GGHA 1Z44A 4XBKA 4MWAA 2GQ3A 3KOXA 3QSRA 4S3BA 5G4HC 4E3VA 3EB3A 4DJDA 1AQFA 1KD0A 1VLWA 4CU7A 2XIQA 1C8XA 4FHAA 1LBLA 2OLHA 4GIYA 3PSWA 2YXXA 4S3DA 2CHOA 1OZQA 1JYXA 4KRTA 4RCXA 1RHCA 4JIQA 4MNMA 4QGCA 3OVGA 2PLCA 4KS0A 4GXMA 1VHNA 3UZXA 1XICA 4PUJA 4LVAA 2A6LA 1KLYA 4DUOA 2XGBA 2DPEA 3ABOA 1GJUA 1AJ2A 3CASA 2WBKA 1TJ0A 2HE5A 3F03K 1TELA 2VQUA 1RUSA 2WHLA 3WDIA 2V38A 1LBMA 1S46A 3UPMA 1HGWA 3HG4A 5GJPA 1CLXA 4LC8A 2BMBA 2Z7GA 3N9RA 5BRQA 4JY9A 2WXDM 1S2TA 1Q7QA 1KXTA 2J9ZA 3WD4A 3E2VA 1JR1A 3URNA 3DECA 4W5ZA 5FESA 4G2DA 4NKCA 4I8YA 2GGIA 3OW1A 1SO3A 3NQ7A 3WDRA 4JTRA 2BFGA 5BXRA 1PKYA 3EMQA 2R14A 1S2VA 3ANUA 2YDSA 1DXEA 4RR4A 4N4PA 4DF1A 1SFJA 1XLKA 3VD9A 3N12A 2PTXA 3MJMA 3DFHA 3C2YA 4AWEA 2HK0A 2PWHA 3OBKA 3P82A 3B0UX 3RX4A 1C8QA 4XD3A 4O1BA 4NZFA 3I6EA 4Y9OA 1NFBA 1U5JA 3NXLA 3OA5A 4MVAA 3F5JA 1ZRQA 4DJDD 2VXNA 3TAKA 3CGTA 2Z0IA 2X1SA 4A3YA 2PDJA 1XPGA 1LRQA 1KW1A 2Y88A 2X05A 5FL0A 1AA1B 1H7NA 3QV8A 4GI8A 3S5ZA 1PHWA 4YWIA 8TIMA 3VE9A 5M2FX 4DM1A 1LTDA 3QSTA 1MNZA 4AF0A 3M4HA 1QI0A 3WLKX 4C7GA 4MYAA 2Y5EA 3PR2A 4HN8A 4DWSB 1EP2A 3AIUA 1QAPA 3G3MA 4PB3A 3NQGA 1VBGA 1TIMA 1S2WA 1V7YA 1K6WA 3VKAA 4S23A 4QFUA 4ZXOA 1JYWA 1EHNA 1OGBA 1R30A 2EHHA 2EF9A 1SMAA 2Y70A 4JFUA 5A8GA 1IR2A 4MWAC 2VP8A 3B8TA 2MANA 1W31A 2ALRA 1EH9A 4QM1A 4DJDC 1IGSA 1VCFA 4NG3A 4Q4QA 2WKLA 1BKHA 2WNNA 2DQXA 2I16A 1W5QA 1F9CA 1ZBWA 2WO5A 3Q65A 2HROA 1NOUA 2ZXBA 3LU2A 1EX1A 1YDOA 3B4UA 3E02A 3DESA 1HJUA 4HHHA 4QJ1A 1N2VA 3FEQA 3N4EA 1JF5A 4JQAA 4U33A 3EGJA 2GJPA 2DSKA 2TPSA 3LI1A 4REQA 3MUAA 4XVEA 1TV7A 1K8ZA 1XLJA 1KWGA 2CFFA 3VOIA 5TNVA 1WP6A 2V5CA 3VNIA 1W9VA 1VLIA 2JQXA 2Y6ZA 3W88A 3QLLA 1NQ6A 2YB4A 4ATWA 1E0WA 1P6BA 3SN4A 3EWCA 3NL5A 5BU9A 2G3MA 2RH9A 4TMBA 4BY3A 4URIA 3TA9A 4KFNA 2WSKA 4O15A 1E40A 4PB5A 3TONA 1GPFA 3O63A 1W1PA 2XSXA 1N8WA 2NSXA 4XKYA 3ARRA 2RGMA 4M6QA 2VWSA 1RV8A 4HTYA 4MNKA 5C2CA 4CQAA 1Q6FA 4JD4A 2Z1BA 2G4FA 2V5LA 1HJQA 4YPJA 3D0CA 3RXZA 1GTEA 3ARUA 5DCDA 3AXKA 3NVTA 1MW3A 4P8UA 1R9ZA 4Q8NA 3E0FA 2E9MA 4YTQA 2NUWA 1KFKA 4LVBA 1CGVA 4D6GA 4UQEA 4C6JA 1WAUA 4KKXA 2DW6A 3FLUA 1OGSA 1CB7B 4GK8A 4GNKB 2J27A 4XZWA 3NDOA 3T40A 4IZGA 3W1MA 5HR6A 4LALA 1VB9A 5BMXA 2AGTA 1UUQA 1LP6A 2XGIA 4L4OA 5BXSA 3B04A 3MI6A 3JVAA 1HNYA 3K5XA 1EHAA 1TMLA 2PZNA 3GO2A 5E93A 1A3HA 1POKA 1UKSA 4EKJA 4LAZA 3OG2A 1G0CA 3BCDA 2WHMA 1T7LA 3QGAC 5LHEA 2AOSA 3SCQA 3SUUA 5H91A 2C1IA 3CNYA 1JCNA 4HHPA 2VZTA 4FXSA 2C1HA 2XSBA 4BHYA 4XZIA 5D33A 4MTVA 3R4IA 3UR5A 2QGHA 3FS2A 3BLOA 2HDJA 2D3LA 4E8GA 3NDYA 5H8MA 3UR7A 2W66A 3LHUA 3LCXA 8XIMA 3GNOA 4HZMA 4QQ3A 3LQLA 3FJNA 4B91A 1VFSA 9CGTA 3WLTA 2FGBA 1TRIA 4LB4A 4NILA 4EWJA 1B5TA 1I6NA 1C93A 2Y61A 4F0HA 1VFMA 3R0DA 4XTDA 5CSUA 2X1TA 5B7ZA 4ZQMA 1QNQA 3QXBA 4FX8A 3WD3A 1US2A 4XZHA 4ZMGA 2YA2A 2CBIA 3Q37A 5E0KA 3GTHA 3M1ZA 1JD7A 1R86A 2IPJA 3NQAA 3VABA 3URBA 3BANA 1JCYA 1HKWA 2WSYA 1SFLA 3KP1A 3ORWA 1B57A 2CZEA 3AHYA 3MCOA 3AS0A 1ZAHA 1JAKA 1M5WA 3NQMA 3V4BA 3ZR6A 5J5RA 4B3LA 2PDHA 5BXPA 3KL5A 3WNNA 2X30A 4HYRA 4DLMA 1SJAA 3GNNA 3DGRA 4Q8MA 3G1YA 1V3HA 2DZXA 4ZA0A 3EDDA 1GEHA 4GUIA 2X7WA 1XLLA 3BSGA 3VMNA 1R38A 2UBPC 4B3KA 1B1YA 2XFFA 5EU9A 3AS2A 1YBQA 1R3YA 1KV8A 5F4XA 4H9TA 2WMHA 4OOUA 4PCSA 4J3WA 3UWYA 2JIWA 3TE9A 4JQ1A 2NQ9A 3ARSA 4N7QA 2PDBA 1VJIA 1TJPA 3M5ZA 1JYVA 4LGXA 3TJIA 1S5NA 3W1RA 3H70A 3ARTA 3P2VA 2E8ZA 2V5JA 4UQCA 4JIHA 2DT1A 4M56A 2B0MA 5A3HA 1F3EA 1TIWA 4K39A 3S1WA 1DXFA 3KCJA 3S5SA 1V6XA 3DKLA 3BCJA 1DV7A 1QW8A 2PD5A 4MAZA 5JU6A 2BASA 3S3GA 3UWWA 4Z2KA 2E5BA 4JEJA 1P7TB 1UCWA 5E9AA 3PUEA 3GYEA 4ORMA 3MQTA 3ZO9A 4IJRA 4ZQRA 1ME9A 1EIXA 5I2UA 3UZYA 3BQ5A 1TCDA 3GYCA 3FK4A 4W8AA 1ZP3A 2EO7A 4XUYA 2VO5A 3S5NA 2QHAA 1CGYA 3CXOA 4CU8A 3UNDA 5D2TA 5EMMA 4WKAA 3THAA 3WK0A 3WDQA 4DYJA 2G3FA 1ZCCA 4AEEA 1QDSA 2JKEA 4L9YA 2G3NA 3HA1A 1YDVA 4FOKA 4EF9A 4UFHA 1OQFA 3H8AA 2V3FA 1E1EA 4GA8A 1E4MM 2W5FA 1KR1A 2BVYA 2ACSA 3A6OA 5HMFA 4JN8A 1Q6OA 4HK6A 3N15A 2RDWA 1UR0A 1A4LA 1C8YA 1DORA 4C6FA 4O1DA 1HL8A 5DX7A 4XTIA 1EF2A 4R33A 1XH1A 1KRMA 1AQHA 4W7WA 2AAMA 2F9RA 1O1ZA 3ZVHB 1UHVA 1GG1A 1DWGM 1TJ1A 2YX0A 3LBMA 4ALDA 2EAWA 1EJVC 3MYOA 2RHGA 3TWAA 3K8MA 3AO0A 1S3TC 1LWHA 2E40A 2B31A 1WKYA 2X1RA 1E5NA 3RNDA 3FKKA 4O16A 4L65A 4YYCA 2IXVA 2QUMA 1D3HA 4M0XA 2JGYA 3FVDA 2FPVA 2B7QA 1BVWA 1TE1A 3WUFA 4DJEA 1J0IA 3PZGA 2CERA 4LFYA 3LYEA 4AYGA 1W8SA 4RNIA 2H3DA 3W83A 4MB1A 1CGTA 3MDUA 3P67A 1G9HA 4JZ5A 4LNYA 4Q8UA 3NVDA 3R8RA 1BXNA 1U33A 2W62A 2XDFA 4IFRA 4Y8FA 4N9CA 3BV4A 3FJ4A 5D9PA 4UFJA 4EWND 1VPYA 3IGSA 1WUFA 4A4AA 1H7OA 2AL1A 3G24A 5HJYA 2WJZA 2BGSA 2GJXB 1KCLA 4FK9A 1FCUA 4FX7A 4LV4A 3L9CA 2P8CA 1S2CA 2A7RA 2QUTA 4DN1A 1HP4A 1XM3A 1E4LA 1W3NA 3PBGA 1FKXA 1G4EA 1A3WA 3HPSA 1AFSA 4IP4A 3TTEA 4A8NA 4IOTA 1KV5A 3WLPA 4A22A 2FZMA 3L5LA 3ZT5A 2CWNA 3C86A 4YVXA 5LNSA 3I7QA 3T08A 1EC9A 2ZYFA 4H7VA 3QN3A 5CJMA 1IWAA 2VCBA 1M53A 1AJZA 2CU0A 3ID7A 2Z25A 1P1MA 1BVNP 3H2FA 3WBEA 1H1ZA 4HTBA 3AMKA 1H63A 2J7HA 3PZVA 1YADA 5I3DA 2DSZA 2J6XA 4LYPA 4HJFA 2QULA 1CECA 1NFGA 4U10A 3DOPA 3REQA 2DZWA 9XIMA 4Z1DA 1SJCA 2DT2A 3SN0A 3CUXA 1A5UA 3H55A 3NQVA 4DPQA 2NVAA 4AZBA 3VFCA 1UKOA 1SR0A 1H0GA 3MC5A