3QSRA

Crystal structure of trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile-45 variant)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
250
Chain Sequence
MRTFFVGGNWKANPKTVEEAEKLIEMLNGAKVEGNVEVVVAAPFIFLPTLQQKLRKDWKVSAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGMKIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQDAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAAPDVDGFLVGGASLEPGFINIVNSNVHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trichomonas vaginalis triosephosphate isomerase TVAG_497370 gene
rcsb
source organism Trichomonas vaginalis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 85
structure length 250
sequence length 251
ec nomenclature
pdb deposition date 2011-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qsrA00
6ALDA 1W31A 1W54A 1I2QA 3ATYA 4PFMA 3O15A 1KTBA 1SQ7A 2OMAA 3QW4B 1VH7A 1KM0A 3O8AA 2QCDB 5MHBA 4I9AA 4JX4A 4LVBA 5AHLA 5HWJA 1TRDA 4UFLA 3W7CA 5FF7A 3W71A 1VHCA 3W2LA 1LOQA 5IBXC 5SWUA 1ZENA 4M7SA 4IXXA 1Q6OA 3SI9A 4GXMA 3UPBA 3GKAA 3W2MA 5DY2A 1QPNA 3HB9A 5AHNA 1C8VA 3LI0A 4ORIA 5FF0A 5CZJA 4S2BA 3ZWTA 3C2RA 3O1NA 1LOSA 5BNKA 4UFMA 5F2GA 3L65A 2ZTJA 1J5TA 3IVUA 1NAL1 5HWNA 4NUWA 5KZDA 4LUIA 3GXNA 1G67A 1KM2A 2ZRXA 2CLOA 4LVAA 1SW0A 3B05A 1PIIA 3M5YA 1YPIA 3HPSA 3YPIA 1IXNA 3HGRA 4RV8A 3UNDA 3TC6A 1SSDA 2X1TA 4CLMA 3W6YA 1H61A 3L5AA 1QNVA 3U8GA 1KV8A 3TC7A 4N6FA 4GUJA 3P62A 2C3ZA 3HGOA 2FFCA 3FJLA 2J9YA 3TMQA 3TQKA 1TJRA 4FNQA 4DBDA 4JS3A 1KTNA 3I68A 1TPVA 4AHQA 4O0ZA 4POCA 3ELFA 1PHQA 1OX4A 4GUHA 4RZ4A 1B57A 3M0ZA 4XTIA 3UZ5A 5F2IA 4GFSA 4H3DA 1W8SA 1RQEA 4LWWA 4DQWA 4K7YA 4UFHA 1KV5A 3QJAA 3O6YX 1TV8A 2QCDA 5T26A 1YDVA 3DFTA 1DV7A 3I7QA 3OEXA 5EMUA 5CKSA 1IXQA 1L9WA 4RXFA 3MBFA 1OFRA 3O16A 3A9IA 2AAMA 2CWNA 3P8IA 1EUNA 4NJJA 3G3DA 3PBUA 3NQDA 1L6SA 3O05A 1CX9A 2XFWA 1P0KA 5D32A 1GJPA 2Q8LA 3WJYA 5D02A 2FPVA 4UNKA 5LNUA 2WNQA 1EWEA 3V1PA 1OFBA 1YLVA 2ZRZA 4RK8A 1I2PA 3KHJA 3BLIA 1R30A 1DOSA 4ZVJA 2GVJA 4CNPA 4WOZA 4CQAA 1QPQA 5BMWA 2GVLA 3HQ1A 5AFDA 4AF0A 4KWWA 3C56A 3DI1A 1V5XA 4A22A 1ZCOA 3IIZA 3GDMA 3CWOX 2CLIA 3LV6A 3M1ZA 3ZWSA 5CG7A 4WY0A 4RX0A 2V2HA 3NDOA 3UWYA 4JTTA 4RZ5A 3UWQA 3GXPA 3CEPA 1FWNA 4BF9A 4IPJA 3TA6A 1EX5A 1PCWA 1W5NA 2CZ5A 3TW7A 4N6EA 4O28A 3OVRA 3UQNA 4BFAA 5K3VA 2YW4A 1OFOA 4AB4A 3GNDA 5LNVA 1KM1A 1GYNA 4DELA 1FBAA 2GJLA 2JGQA 5G5IA 1XM3A 3W76A 4O11A 2QCCA 2YDAA 3P8JA 4IX2A 4MZYA 1TV7A 4LY8A 1OHLA 2G96A 1ICSA 4NT0A 1UB3A 2WKJA 4EF8A 4IPIA 5LHFA 5LNWA 4W9TA 1H63A 3KRUA 3FOKA 4JGDA 5C2XA 2WNZA 1P0NA 5D09A 3PR2A 3LCIA 1OX5A 1DJNA 5CPNA 1UUMA 2VFDA 3LV5A 1TYGA 1SW7A 1RR2A 1ZNNA 1ME8A 2H8ZA 4PA8A 3LM7A 3F1QA 3IIOA 3GVGA 3L5MA 4DF2A 4AF0B 3DFPA 3W7IA 5DBTA 4DPPA 3DHDA 4MFEA 2ALDA 3W7PA 3M41A 1QWGA 4JX6A 2RH9A 2TPSA 4ALDA 1EUAA 3QZEA 4WXZA 4KFNA 1MSSA 3W1AA 1U5JA 4FIQA 4JDBA 5H2ZA 4E2BA 3GLCA 3HG4A 1DJQA 3JRKA 1VLIA 1VR6A 3L68A 4BI7A 2ZA1A 2V81A 3A21A 4LVFA 3W7HA 3BG3A 1N8FA 3IGUA 1W0MA 2J88A 2G5WA 2V2CA 3W1UA 4I7VA 1YPFA 4DXVA 4M7TA 4U4MA 3IGSA 1H62A 1GG0A 1XKYA 2WQPA 3KVKA 3QYQA 3SSJA 2CZEA 2GOUA 3W1TA 5EPDA 1FQ0A 7TIMA 5E93A 3L5LA 3USBA 3P61A 2E1DA 4M5PA 1MEIA 2RDWA 5I3GA 2NXGA 4WXYA 1XDMA 3A5FA 2FPTA 4QNEA 1QMLA 4MLRA 5G4WA 1VCGA 1QDSA 1W3IA 4Y9AA 4ZQOA 2FIQA 5DCEA 1G4TA 2E6FA 2R14A 4TIMA 2P1FA 2PE4A 1I2RA 3ZR4A 2DZXA 3F03K 1KA9F 2NXHA 1VHNA 1YYAA 1OYAA 5EBUA 5HINA 3S1VA 1QOQA 1ZJIA 1YADA 4XWUA 5G1TA 1PS9A 4O4VA 1KFKA 2ZZ7A 2PCQA 3LHYA 4O19A 3GAYA 3RFAA 3W70A 3VE9A 4MZ8A 1H1YA 4HNNA 1AMKA 5K7JA 3STEA 2GQ8A 5F4XA 1ZALA 1ML1A 4JXCA 3E02A 4UTMA 1SR9A 3LOTA 4RXGA 1HFBA 2HTMA 3NQ2A 4BI6A 3DU0A 1LRQA 4S2CA 5AC7A 3SGZA 3QQ0A 4WOQA 3U2OA 1R2SA 4NZFA 4IMGA 2CLKA 3LRKA 4MYAA 1JCYA 3PAJA 2BTMA 2ISSA 4JDYA 2QCLA 4DPQA 2G97A 4TX9A 3GXTA 1O95A 4KFOA 1F5ZA 3IIPA 4IMFA 3NA8A 3B0UX 1VYRA 3FKKA 1VQTA 3G8RA 2WO5A 3PWAA 3GDRA 3W7DA 2Z6IA 3G0SA 3PB0A 3TE9A 2B4GA 1OF6A 4GE8A 3CQ0A 3B8DA 4OQVA 5DCBA 3QQ1A 2E09A 3VCRA 3Q2DA 4JIPA 4AEOA 2B7OA 3HBLA 3W83A 4EF9A 3DZ1A 4ICNA 1S5VA 2J9XA 1GVRA 1XFBA 3EWXA 1FWTA 3BW3A 4MUZA 2HMCA 4AMAA 3VKJA 3PBYA 4B5NA 4RLIA 1XBYA 2EF9A 3G1HA 2DZPA 2RDUA 2Z1BA 3W07A 1FCQA 2DZUA 3LHUA 3L0GA 4DO4A 5EYWA 1J4EA 3C52A 3NQ7A 3W73A 4HIBA 1KM4A 3BLFA 3QPYA 3EEGA 4GC4A 5E1QA 5I3FA 3A5VA 2QJIA 4S1FA 4NZJA 2F84A 1OJXA 3N2MA 4AHOA 1Q6LA 4UC5A 1X7FA 3MMTA 3V75A 5FF4A 3NPUA 1LP6A 2I1OA 1W5OA 4G1KA 4UIOA 2E5DA 5DY3A 1FDJA 4GNJA 3TSMA 3P81A 2PRLA 3T4CA 2VFEA 3GAKA 3W84A 3PULA 5FF2A 3EXRA 5F4WA 2EKCA 3PG8A 3T7VA 3C0JA 1WQ5A 1Q45A 2A0NA 1E51A 1VS1A 2Y89A 5KMYA 1TPB1 5CZ0A 4ONVA 3FA5A 1DL3A 5LGXA 3VE7A 3KAOA 1FDYA 4M6VA 2VFGA 3NQFA 1G7VA 3NQCA 2P0OA 5U7SA 3NPXA 1ICPA 4JN6A 1W37A 4A3UA 3CB8A 3MHGA 1TTQA 4Z1BA 3SR7A 1X1OA 1ADOA 5HJLA 3LTPA 3O6CA 1TPEA 1O94A 3S9YA 3NG3A 2V82A 3TSBA 1L2UA 2JKPA 3TUUA 3NOEA 4ZQRA 3RMJA 1TPWA 4AH7A 3K30A 1IGSA 1LRTA 2FB2A 2TMDA 3DBPA 1Q3NA 2Y85A 1OK6A 4N4PA 4HHPA 3L0KA 2QUUA 4CCDA 2ZRWA 3WK0A 3Q94A 2PURA 2VELA 3S6DA 2CLFA 2LLEA 1OYBA 3G0XA 2J6XA 3TFXA 1YTKA 3TDFA 6TIMA 4JTLA 4ADTA 3OIXA 4TMBA 4FNSA 2QUTA 1K7XA 1H60A 4CNNA 4JEQA 2NV2A 1SZNA 1UJPA 1F76A 1JCXA 3KVJA 3NXFA 3UXDA 4A2RA 4BR1A 3DKJA 4NNBA 4FF7A 1DBTA 2ATMA 3BGJA 4Z0JA 3TH6A 5FEXA 1KLYA 2WOQA 3DXIA 3PSWA 1EPXA 1VCVA 2VC6A 3S1UA 2ZFAA 1JCNA 4HNVA 1FXPA 4GUGA 4O50A 4AWTA 3WJXA 3TAKA 5K9DA 1KFEA 3BO9A 3MW7A 3EKLA 2VFIA 4O4WA 4WY0F 2RKXA 5I3IA 3A22A 1KFCA 3W7JA 1EEPA 3N2XA 2RHGA 2C0AA 2FQIA 4DEFA 2UV8G 2H6RA 4LS2A 4YCPA 5GVJA 4QIUA 3NAVA 1B9BA 3N34A 3TV8A 3MI2A 2FB3A 2YYUA 3ZS4A 1VYSX 4EWND 3B0PA 1K7EA 2Y61A 1NVMA 3DENA 4LVGA 2FTPA 3M16A 3QSTA 2EAWA 3R8RA 3W7KA 4FO4A 1JRCA 2H8XA 1XUUA 2YR1A 1ZY9A 2V5LA 3TU9A 4P61A 1ALDA 4K39A 3PUOA 1QO2A 2WSQA 1VPXA 3RNDA 5D2VA 1H7RA 3NL5A 3NR0A 1GOXA 4O12A 5J5DA 2X1SA 3QMSA 4WQ6A 4WD0A 4O53A 5HQEA 2JKAA 2ZA2A 4O57A 2ZRVA 3TQVA 4AWSA 3PG9A 1KLZA 2DU2A 2YPIA 5EL1A 3P80A 5LZLA 3NPVA 1O5XA 2NLIA 4RJEA 1OFAA 3G18A 2I9EA 1B4KA 1AK5A 2NWSA 3G1SA 3HJZA 3R13A 3GK0A 4JICA 3EX3A 5K2ZA 3RLVA 1B3OA 1HO4A 3WK2A 3W7LA 2QDHA 1LM1A 1SW3A 1ZAIA 5A8GA 2E6DA 1G7UA 2WSRA 4WX2A 4N9CA 3D0CA 3MP4A 1Z41A 1M6JA 4Z08A 1HUVA 4BI5A 3C4UA 3E49A 4IMEA 2HS6A 2A6NA 5D33A 2W79A 4IMCA 3HOJA 3L66A 1XCFA 1VGAA 5A5WA 4NX0A 1SO3A 1R2RA 4OHQA 4FIRA 1SO6A 1JUBA 1ZAJA 4XBSA 1LLZA 4BK9A 2KZHA 4LC8A 2V5BA 3R89A 1H7NA 4MY1A 1HO1A 4DO5A 4JTSA 3KFTA 1K02A 5KZEA 1RV8A 3UY8A 2J9ZA 2W0UA 1TPDA 1WBJA 3CTLA 1LBLA 4L4MA 4Y8FA 1WOBA 4IMDA 4HNTA 5LNSA 1RPXA 3QSRA 3W1MA 4UNLA 3EX4A 3EWWA 1GG1A 1FCVA 1FWSA 1SPQA 1VCFA 3CIWA 4UMBA 5LGZA 1IIHA 3GB6A 1EIXA 1SZGA 1Y0EA 3GDLA 2ZBTA 4LTSA 4CCEA 4AAJA 2Y62A 2VEKA 3EWZA 1FWWA 4A29A 2VEMA 1I45A 3BV4A 4A2SA 3T40A 1ME7A 1QPRA 3HF3A 1DORA 4QQ3A 1NFBA 1X8FA 3KX6A 4I7WA 3LCXA 4QJ1A 1W3TA 4FNPA 4UMAA 1NF0A 3LGEA 1PL9A 5F2LA 3DKLA 1XDLA 2ZTKA 3MUXA 2Y7EA 1L6YA 3G1YA 2YFOA 4O1AA 5DN1A 2NX9A 3FLUA 2VFFA 3F4WA 4GWEA 2ZYFA 2ISVA 1EWDA 1WA3A 3UZJA 4ML9A 1VJIA 1SO5A 4JY8A 4UTUA 5FEWA 4IXHA 3MHUA 4E2DA 4LU0A 3BGGA 4PH6A 5CPLA 2H3BA 2JGYA 1OX4B 4QISA 5DBUA 2ZA3A 3M5ZA 1OFQA 3C2FA 3I7RA 4KKXA 1D3GA 3DAQA 4HPXA 1GVSA 4R33A 3PB2A 1ME9A 1THFD 2YXGA 4NJGA 3P7YA 5FEPA 3H55A 1XXXA 3LBCA 1JUKA 1F6KA 5HUOA 1R46A 2FPYA 3BVJA 4OE7A 2YFNA 4E0CA 5F1UA 4N9EA 1RQHA 1P5BA 3TKFA 1XI3A 2V8ZA 2Y88A 3CT7A 2V30A 3N9RA 2E6AA 3HG5A 4R34A 1FCUA 1O5KA 3NZ1A 5D2YA 1KFJA 3SJ3A 4AXKA 1JCMP 1HG3A 3RK8A 4OU1A 5AC8A 4K8HA 2CU0A 5CSRA 4IWWA 3UWWA 1WDWA 2WSYA 1D3HA 2E5BA 3MYOA 3O63A 3FKRA 3KOFA 1W5QA 3LCHA 4HSOA 3R12A 1D9EA 4JYFA 3ABRA 5LKYA 2C19A 2QUVA 1XBZA 3W2JA 4QM1A 5TQLA 1JULA 1KFBA 1S3HA 3EX2A 4UXDA 4X9SA 5U4NA 2QF7A 1XBVA 1XUZA 4MPQA 4O17A 3TAOA 1GWJA 1SU5A 3W7OA 2EHHA 4UTIA 1F6PA 1EP3A 1FUYA 4UTHA 3TMLA 5I3JA 3FYPA 1KBIA 3W74A 3PUEA 3WK1A 5BW6A 3W1NA 3OVQA 2ZCGA 3C6CA 4FX7A 2YYTA 3W72A 1AL8A 3Q37A 5D2TA 3O07A 4QNWA 3FIGA 2A5HA 1FCBA 1X1ZA 2CLMA 3S5NA 2BWGA 3CM4A 3TW6A 3QPZA 2A7PA 2Y63A 3HG3A 1TREA 3GR8A 4O10A 4GUIA 3W7EA 4ZQPA 5CSSA 4LT9A 2XN1A 3OHIA 1M7PA 2JK2A 2PRMA 2WJZA 4NNAA 2BLEA 1MZHA 1LLWA 3NO5A 1Q6QA 2X2GA 4JTUA 3LLDA 1JQXA 3P60A 2XN2A 3E96A 5G1YA 3G1DA 1NSJA 2BSLA 4H4IA 3DFSA 3GR7A 1UASA 3LERA 4PC8A 1PCKA 3NVTA 4Z0SA 3S5YA 1TPC1 2J27A 2XN0A 3IGXA 3M44A 5D2WA 5LHEA 1HTIA 4JNMA 3NL3A 3WFAA 3INPA 3W7MA 3DFNA 5AHIA 3G1AA 3GDKA 4UTLA 1GTEA 2V0TA 1G4EA 3EXTA 4K7VA 1GT8A 1WBHA 5FF3A 1T96A 2YZRA 4O1DA 1MEHA 1W5PA 2QAFA 3I7SA 4MFDA 1OK4A 4PL2A 1LOLA 1TTPA 4XQ6A 2QCMA 3LHVA 2X16A 3BG9A 2TSYA 1JQVA 3C2EA 1P1XA 4ZZ9A 4NXKA 3JS3A 1A5SA 4UCGA 1NEYA 3TQ0A 3LX9A 3BW2A 2ZZ6A 5C54A 4DF1A 4FHAA 2QKFA 3LBMA 3WJWA 5EY5A 3WK3A 3NL2A 4JX5A 2TRSA 1G6CA 3NQVA 2E6YA 2Y6ZA 3EWBX 3NQ6A 4Y90A 2C13A 3HO8A 4O54A 4JTGA 4BWLA 4MY8A 1QPOA 4N9BA 3PY2A 3QRHA 4I7UA 3OVPA 2NUWA 1GYLA 2QCFA 3E9AA 4HSNA 1BTMA 2ISWA 3KXQA 3EX6A 4NX5A 5D38A 2ZZ5A 1SSGA 1ONRA 4U28A 1ICQA 4MOZA 4MZ1A 1G4PA 1AW5A 1AG1O 1FX6A 2GQ9A 4IUOA 4K6AA 1OG0A 1WX0A 1FY6A 4H6KA 1YTEA 2NZLA 3STGA 1OFDA 2ZDRA 2QCHA 5CPMA 1B4EA 2NUXA 5DELA 3CC1A 2O7SA 5C5YA 1Z44A 1KBJA 4TR9A 3UXAA 4K8EA 4EVZA 5K4ZA 4KWVA 3IEBA 4OGZA 4CCCA 3DGRA 3H54A 1F7BA 4Q32A 4OWGA 2H3DA 2OZ0A 3L2IA 4RKAA 4O1BA 3IIXA 1XL9A 3CLMA 1SFJA 1NF7A 1T0OA 1H50A 3NYZA 2HS8A 3THQA 2Y7FA 4MJZA 3G1FA 5G2WA 2H90A 1FDZA 1OFPA 4IX0A 4HT3A 3LRLA 5IBXA 2Z0IA 4HPJA 1KM3A 1ZFJA 3EKZA 4YWIA 3NQMA 3THAA 1TPUA 1G4SA 2DZTA 2GUUA 3W1PA 3KRZA 3W7GA 1GZGA 1V7YA 4QITA 1JUEA 1J2WA 2OX1A 2WV8A 1TQXA 1TPFA 2A6LA 3BPWA 4FX8A 1F73A 5HULA 3KRSA 2YCEA 1ZHAA 1LBMA 2ABBA 4JY9A 1K3UA 5BRBA 2BX7A 3W7NA 2ATSA 4LVDA 1WV2A 2JKEA 4NNCA 4QSHA 3W1QA 1DKWA 5K4XA 3EB2A 3NNTA 3VI2A 3GKFA 2Z6JA 3G24A 3LHWA 4K37A 3LCGA 1YTDA 3O06A 1BWKA 3R2GA 1GEQA 3G0UA 4FB7A 4YCOA 2A1YA 4O16A 1F05A 1U83A 4LUJA 2QAPA 4NXSA 2R8WA 3N14A 5G2HA 5EA9A 3HGJA 2C14A 3TX9A 2FJKA 1TJPA 3OA3A 4JYEA 3GIYA 3GDTA 2YW3A 4RZ6A 4AWUA 1TCDA 2DORA 4YLWA 3LCFA 5K9CA 4NQ1A 5HUPA 3W2UA 4IGHA 2ZRUA 2CLEA 3S5OA 2ZQ0A 3PC0A 5KTLA 3O6DA 3RLUA 4ADSA 4WY0B 4Z1CA 4Q4KA 2F7FA 2DZSA 4MIMA 1F2JA 3C2VA 2VXNA 3C8FA 2NX1A 1JCJA 3VNDA 5C6MA 3BG5A 3CU2A 4QAIA 4EIVA 3LLFA 2A4AA 2NV1A 3B06A 4O1CA 2O7QA 4PL1A 1SFLA 1L6WA 4JIQA 3NEVA 5KINA 1JVNA 2VFHA 5AN7A 4TO8A 2E5CA 4GRSA 4CNOA 4FEZA 1GQNA 3B0VC 3P5YA 1PVNA 3L67A 5CGQA 4UMCA 3HMJG 3W7QA 3MI6A 3S5ZA 5L9FA 2HSAA 3S0CA 1SUXA 1TO3A 1WYIA 2VKZG 1LTDA 3W86A 2CZFA 1JRBA 2OT0A 3BLEA 4BWLC 2B7NA 3HPXA 3QEZA 4CQ8A 3P82A 5AYYA 1OX6A 1CW2A 3B4UA 4WUIA 4TMCA 3QF0A 2EGZA 1A5CA 1S5TA 4JR5A 4UTTC 3BK0A 3A24A 3W9ZA 2VOMA 3G1VA 2OJPA 3UY7A 4UFKA 3UPWA 4CQ9A 2ABAA 4HKPA 3CEUA 1H7OA 2A21A 1MXSA 4KFPA 3L21A 3FFSA 1LRNA 3HGSA 1AW1A 2CFFA 3FYOA 2RFGA 3EWYA 1LYXA 2ZZ4A 2NX3A 3UWUA 4X2RA 3PUDA 1LDCA 3MP5A 5IM51 3P5ZA 3LB0A 1OABA 1Z42A 4PTNA 3MI3A 4ADUA 3L9CA 3FEMA 1A53A 3LRMA 5D2XA 3M5VA 4Q33A 1QR7A 3LDVA 1QOPA 1TQJA 3UWZA 2V9DA 4JTKA 5AOUA 1AW2A 3ZFHA 1TMHA 3NQGA 2V2DA 4GBUA 3FJ6A 2AQWA 2QDGA 5AB3A 3NM1A 1RVGA 3PBWA 3PSVA 5D03A 1VC4A 1K7FA 1Q6RA 5AC6A 3DFQA 5FESA 1PV8A 1GPWA 5H91A 1DQWA 3S42A 3ATZA 2A7RA 3LCWA 1QCWA 4TU1A 5F2MA 3W22A 3TIMA 4E38A 3DHFA 5K9XA 3LCLA 3ABQA 3TNOA 2Q3RA 4N4QA 5DCDA 3UYCA 1I4NA 2FDSA 3W85A 1MEWA 3DFOA 4JYDA 4RCXA 4R53A 1S5WA 4JD4A 3W2KA 4FNUA 4MVAA 1BKSA 3MP3A 1YXDA 4L4LA 3ANYA 2NXIA 5AYXA 5BMXA 2WPBA 4UR8A 1I2OA 1JCLA 3NPWA 4K36A 5EKYA 4UTWC 4XKYA 4EOUA 1P4CA 3EXSA 4NVTA 2R91A 3WJSA 3E12A 4GUFA 3IV3A 3S8HA 3NL6A 3C2OA 4M6PA 4UUIA 4WJEA 2Y7GA 3C61A 1OF8A 5C55A 1DQXA 1OVDA 2QR6A 3EWUA 3NZRA 2VEPA 2X1UA 3N73A 1X6UA 3RU6A 4YXGA 3LXBA 2C15A 3F4NA 4XKYB 4ORMA 1KW1A 1RZMA 4MYXA 4OBTA 4UTKA 4A21A 4HNUA 2QCGA 1YXCA 2ZRYA 5G2IA 4LS1A 3HPZA 1EP1A 4FNTA 4NJIA 2R94A 5J5RA 4XZ9A 3TSDA 2E68A 5HR7A 5AHMA 3W1XA 4O13A 1H51A 3DI0A 3H53A 3PVFA 3TXZA 4HN4A 1GTHA 2CLLA 4GJ1A 3W1RA 3MBDA 2VENA 3STFA 2X1RA 3PBVA 1HL2A 3WJZA 3QH2A 4MJMA 3SY5A 1R2TA 3I6RA 2OT1A 3MWAA 4DBEA 1GVQA 3IIVA 3IVSA 3LXAA 2Q8ZA 2BZNA 4O15A 1AL7A 1XC4A 3OBKA 1W1ZA 5DXXA 5D30A 4P2VA 1CI1A 2C16A 4XUGA 3M5XA 3W88A 1IXPA 3GX9A 1PHWA 3SFKA 3U6WA 3BW4A 4DF0A 1YDOA 2CW6A 4LNYA 3NGJA 5AHEA 3QW3A 3QC3A 5F4SA 3LHZA 3MO7A 5BOOA 1T99A 2QEZA 1VYPX 5KSWA 1TIMA 1KFLA 5AHFA 1IIGA 3SZ8A 3T55A 3C3NA 1A50A 2Z2UA 2JBMA 2NWRA 4IJBA 3RF9A 3G22A 1OYCA 4IQLA 4JTJA 1M7OA 3NQ8A 4J9JA 3I65A 5G4EA 4O0KA 3PS7A 5AYZA 2Y70A 5FEZA 1O4UA 1VLWA 4ZQMA 4Z1DA 1EP2A 2GVGA 2J24A 3VFLA 5FI8A 3PM6A 5KITA 1MO0A 3G8EA 1H7PA 4NJHA 3OG3A 4X3ZA 1W3NA 2ZZ3A 4LRTA 3QFEA 1K8XA 1TRIA 4LS0A 1TB3A 5HMSA 2E77A 3IRDA 2IQTA 1TTIA 3TJLA 1I8JA 3TR2A 2DJXA 1ZAHA 1YXYA 3B03A 4JTIA 5E0KA 1TSIA 3FS2A 1LORA 1QO5A 3R5EA 4MKNA 4RR4A 4DO6A 4JTEA 5LSMA 4O14A 3W23A 2B7PA 4PCFA 1G69A 2GPTA 3GZ3A 3LXCA 3M9YA 3N19B 3P67A 4OT7A 3TCEA 3IVTA 4NU7A 3E0IA 1RQBA 1LBFA 4MY9A 2PC4A 3CHVA 1N7KA 4M6QA 5D04C 2EPHA 5DXYA 2ZZ1A 4IOTA 4JTFA 1QAPA 3DH7A 1JJKA 4N02A 3TROA 3W1LA 1EA0A 1K03A 5HWMA 4UTWA 3ABSA 1W56A 4MLJA 4ZQNA 1KM6A 2CZDA 1Z48A 1UCWA 4UFIA 2RDTA 3BARA 3KVMA 2W6RA 1WXJA 2NUYA 1N55A 3GNNA 2P10A 4LV9A 4YMZA 5D37A 1UUOA 4LV4A 4LW7A 2Q3OA 3UWVA 2DZWA 3W2NA 4UR7A 3S1XA 4N2YA 3STCA 1R47A 3P84A 1TV5A 3UD6A 3NQAA 4XBKA 5I3HA 5TIMA 4Y6GA 3N9SA 4FNRA 3Q58A 5F1VA 4XTDA 2GQAA 1I2NA 3JR2A 1DVJA 1VZWA 3B04A 3NM3A 4R7JA 3TJXA 1GVFA 3N3MA 2A2IA 2GJNA 4OV9A 3CWNA 1H5YA 3MJYA 2VEIA 3A23A 4ZL1A 3TK7A 5DLCA 2DJLA 5HR6A 3W3OA 4FXRA 2TYSA 5I3KA 2A7NA 1FWRA 3TFCA 1LCOA 4NJKA 1A5AA 3M6YA 3KVLA 4Y96A 3MYPA 1XBXA 3CIXA 3HIJA 1C29A 4FXSA 4PODA 1WAUA 1M5WA 1OFEA 4X22A 2C6QA 2FLIA 2BXVA 3QMTA 1TTJA 4O18A 1SZFA 2Y7DA 4C1KA 5LNRA 3LHTA 3W7RA 1LROA 1UBSA 3AO0A 5TBOA 1YDNA 4UTJA 2YGYA 2A85A 1BWLA 4AHPA 4UFJA 1TPH1 3QMRA 3W87A 3GYEA 4D2JA 2OCZA 4AVFA 1EB3A 1WOAA 2QCEA 5L6UA 5CZTA 1GVOA 3P74A 3SGUA 4LOCA 2YSWA 3SIZA 3TXVA 1QFEA 3LTYA 4UTTA 2WNNA 4LC6A 3HG2A 1SO4A 3M7WA 3NQEA 4FX6M 4Z1AA 1DHPA 5CPOA 1SZEA 4O52A 4LRSA 1IF2A 4WZHA 3S1WA 4K38A 2C1HA 1C9DA 2D73A 2QJGA 2PRHA 1F74A 2C18A 4N9DA 1LZOA 1RD5A 4ZMGA 1H7XA 5CZSA 2B0MA 2QJHA 4PEKA 3T78A 4YL2A 3EX1A 2X30A 4M19A 3MHFA 1KM5A 4OV4A 5KZMA 1K8YA 3T44A 2CLHA 1FXQA 1JR1A 1BEUA 2B7QA 3M43A 1H7WA 4C1LA 1K8ZA 2I14A 2DP3A 3G1XA 2QCNA 3LI1A 5D05A 2DZVA 4O8RA 8TIMA 3LTSA 3SECA 1PE1A 3AJXA 2G95A 3QM3A 2AGKA 4JTHA 5ABTA 1H1ZA 1A5BA 1O60A 3M47A 3PF3A 4ZQCA 3G3MA 5HNRA 1VRDA 1T8XA 2YX0A 1IXOA 1KTCA 2ZZ2A 3W75A 3ABOA 1W5MA 3L0NA 3SW6A 3CPRA
chains in the Genus database with same CATH superfamily
4WKFA 1I2QA 4M81A 4LBSA 1SQ7A 1V7AA 1VH7A 3O8AA 4I9AA 1PKYA 3W4RA 4QQUA 3KOYA 2VR2A 3SUUA 3W7CA 5FF7A 4QG9A 2G3IA 3W2LA 3RPMA 2D2JA 4IXXA 4HMDA 2W9MA 3UPBA 4ILSA 3ZM8A 1RA5A 3RO6A 2O4QA 1P43A 3WQ6A 1D8CA 2XZ7A 3DC0A 1S2CA 1JXKA 3C2RA 1LOSA 4UFMA 3L65A 1NAL1 1UJQA 6REQB 4NUWA 4C1NA 3KE0A 3CO8A 4A3QA 2CLOA 2J7GA 3RG6A 4JCMA 3BSHA 4MUPA 3HQOA 1YPIA 4HTYA 3B9NA 2ANUA 2WKGA 1V6TA 4D72A 3WNOA 3TC6A 4G7FA 5JVLA 1PTGA 3L5AA 1QNVA 1QBAA 4N6FA 4GUJA 4F48A 1N8WA 3HGOA 3EOLA 2YCIX 1UH4A 1I75A 2J9YA 1TJRA 4B5XA 4XSLA 4JS3A 5A69A 4HHMA 4POCA 2UBPC 3ELFA 3CZKA 3DDMA 4LF1A 3N1AA 1WPCA 3OTRA 1E6ZA 3R79A 1KV5A 1KD0A 1IQ8A 1JEZA 5T26A 1W3LA 5CKSA 1OADA 5EMKA 3O16A 3P8IA 3G3DA 3PBUA 3AZTA 4YHGA 3S2JA 4US6A 1Z3NA 3R8HA 1KR1A 4HVXA 1E3ZA 2XFWA 3WJYA 1NWSA 1VF8A 2FKPA 4C91A 1Q66A 4US5D 1XYLA 3UXKA 3TOYA 1I2PA 3BLIA 4JTDA 1DOSA 4DNHA 1G1YA 4ZVJA 2GVJA 3MSRA 1EO7A 4KEMA 4NHVA 5BMWA 2GVLA 5AFDA 4AF0A 4H7ZA 1RP8A 1V5XA 3G1RA 4E3TA 4J3WA 4E8CA 3E5PA 4DWDA 1YBQA 1PIGA 5A6JA 1TA3B 4GVGA 3ZWSA 3UVIA 3NDOA 1XLCA 4AZ5A 3GXPA 5E6YA 3TTSA 3DFHA 2RDXA 2WNWA 2Y1HA 3UQNA 1BKHA 2CBJA 1OFOA 3TTQA 3IV8A 3GNDA 3LY0A 3AWOA 4B4HA 4MJ2A 4EXQA 4DELA 4RZBA 2WMFA 3PPFA 2GJXA 2GJLA 2RJHA 4HCDA 2YDAA 2J7BA 4ERIA 1PEZA 2PLKA 4LY8A 4PTWA 3GHUA 4HA3A 3ITXA 3VGHA 2WKJA 4EF8A 2YDQA 5GPRA 3VD3A 1H63A 3KRUA 5AYIA 2WNZA 2KAUC 3TONA 1X39A 1BYBA 2C7FA 4V1XA 2JE8A 3XINA 4J4KA 1UUMA 3LV5A 1SW7A 4ATDA 1ZNNA 2J62A 2H8ZA 4PA8A 3LM7A 2DIEA 3L5MA 1OSEA 5DBTA 2XSAA 4MFEA 1E6XM 3AS2A 1CGTA 5EMJA 2CZVA 4GABA 4YTSA 3UCQA 2BXYA 2TPSA 2Y8VA 3QZEA 1JDEA 4YHEA 3JRKA 4QLJA 3A4JA 3FA3A 1V6VA 4A3HA 4L6OA 3NSXA 3A21A 4LVFA 4HHHA 3IGUA 3K8KA 1W0MA 3AIBA 1Z7AA 4IL0A 3W1UA 4DXVA 1C92A 4M7TA 3IGSA 3VOHA 1XKYA 1AQMA 3LYEA 1M01A 3W1TA 4XUYA 1FQ0A 3M0LA 3USBA 5TNVA 4U3CA 2E1DA 4E3VA 1EKOA 2RDWA 2NXGA 1QUMA 4NRRA 1XDMA 1XW8A 1U2YA 1CXFA 1W3IA 1FFQA 2FIQA 2FZBA 3ITOA 2E6FA 1XLHA 2IQ0A 4CCZA 1UR9A 2DZXA 4BA0A 1KA9F 3OGRA 2P53A 4XVDA 4QXIA 1CGUA 1NOUA 4JQ3A 4XB3A 5H1WA 3DYOA 5I5RA 3WDRA 1MW2A 4QGCA 1K70A 1Y65A 4J3ZA 3GNPA 2DVUA 3CPUA 1OINA 4DM1A 3IJ8A 2EPNA 1HFBA 1T41A 4Q4SA 2IPJA 4N42A 2VGGA 1U5HA 4GPNA 3SGZA 3W01A 3QQ0A 1EBHA 4WOQA 3U2OA 1R2SA 5EFFA 1K4GA 4IMGA 4D71A 3LRKA 4MYAA 1JCYA 4JDYA 3KP0A 2QCLA 4ZBCA 4FSAA 2G97A 1O95A 1DWJM 3NO3A 4E5TA 2XINA 3EMQA 3ITYA 4LJ3A 4L65A 2Z6IA 1S39A 1VPQA 3PB0A 3TE9A 1M03A 1Q63A 4JIPA 2JF7A 4AEOA 2B7OA 3CV1A 3HBLA 3W83A 4EF9A 1GVRA 4NZ3A 1TWSA 2J25A 2HMCA 4AMAA 2V38A 4RLIA 3G1HA 3OGVA 1UD2A 3AJ7A 3ITTA 3TYZA 2O9TA 2GGGA 1FCQA 5H8UA 4DO4A 3L0GA 3I4EA 3C52A 2WCSA 1SFTA 3L4TA 1W1TA 3EEGA 4HZ6A 3LNPA 1DXFA 2F84A 1Q6LA 1V02E 3MMTA 1LP6A 2I1OA 5I00A 4GHRA 1QNOA 1YMYA 5DY3A 1JZ3A 4GNJA 2VRJA 2WJEA 2W91A 4IJCA 4GD0A 4KERA 3S9ZA 2BOGX 3SADA 3W84A 4HP5A 4H00A 5F4WA 2EKCA 3QGVA 1TMLA 4DJFC 1E51A 5CC7A 4MPKA 4GISA 1VS1A 3HPFA 5KMYA 1D7FA 5LA2A 1IT8A 1E6NA 2CBUA 4FLOA 3KAOA 4M6VA 4TX6A 3F2BA 2V3FA 2VFGA 3NQFA 2ACRA 5U7SA 1XICA 3UETA 3EDKA 3MHGA 2AMXA 4F2BA 3NOYA 4GVIA 3QV9A 3T2QA 3S9YA 2NQJA 3TSBA 1L2UA 3ZXWA 4DUOA 3K30A 1ESWA 1LRTA 3DBPA 3S1GA 2Y85A 4N4PA 1UH2A 4E4UA 1US2A 2ZRWA 3TYUA 4U33A 1OGBA 2VELA 4GGBA 1EOMA 3BQ6A 2O4MA 1XHGA 4JTLA 3IS4A 2QUTA 1K7XA 1H60A 4AC1X 4DJDA 1SZNA 3WUGA 1JCXA 3NXFA 4DNMA 1W3HA 3UXDA 2ONEA 3AHYA 3EMCA 2ATMA 2WW5A 4MSSA 4Z0JA 2OR2A 1W1YA 5FEXA 2FZDA 3GRIA 1POKA 1OGGA 1EPXA 3O6AA 4JNZA 1RUSA 1QT1A 3WEMA 1V08A 2P3ZA 4U5IA 4DJDC 4GUGA 3RLHA 1W9PA 1UC4A 2HRWA 4AWTA 3MZNA 3TAKA 3EKLA 2VFIA 2Z28A 4RE4A 4QE1A 3UZWA 2Z27A 4H19A 3O7UA 5FL1A 1XR2A 2WSPA 3T0CA 3WLPA 2G50A 4DEFA 4KRUA 1J8VA 4F9DA 5GVJA 3PFMA 3NAVA 4RNIA 4BQ3A 2FB3A 3WH7A 1J18A 1AQFA 5I24A 2WCAA 3H26A 3W7KA 1GOMA 2PTZA 1WO2A 2V5LA 3MA8A 3N11A 1QO2A 3URAA 4P7OA 2WSQA 3RNDA 1GQIA 1H7RA 3NL5A 2BS9A 3NR0A 4L80A 5CSYA 5J5DA 1M7JA 3RM9A 2L5HA 5I09A 2OLAA 3S2CA 4AEFA 4O53A 1LL7A 2ZXBA 2FGBA 3FHQA 1KLZA 4CN4A 3R58A 1J9YA 1Y5VA 2WKLA 2WMGA 5LZLA 3NPVA 1XYZA 2XHYA 4QS5A 4NIRA 2UY4A 4AZGA 4IH3A 1B4KA 2PDQA 1AK5A 2O9PA 3W37A 2NWSA 3R13A 3VABA 1HX0A 1UP0A 3LLXA 3WK2A 3WNKA 1ZAIA 2J7HA 4GLEA 3NSMA 1G7UA 1EDTA 2E9LA 3D0CA 3L4ZA 1B0IA 4RE0A 4R3UA 3V4BA 3WQGA 1WZAA 4BI5A 3C4UA 1EBGA 3W38A 5D33A 2A6NA 1DJYA 1CECA 1E1CB 4WDWA 2Y2WA 4NZ4A 3VOGA 4NX0A 1PXGA 2PP1A 3ZJ8A 3RCMA 1CPUA 1SO6A 1JUBA 4H9UA 4CNSA 1WUEA 2ZE0A 4F4RA 1U1JA 3RAOA 4QAWA 3KP1A 1Q7QA 4DO5A 1KGUA 3KFTA 1K02A 4LH8A 5KZEA 2J9ZA 8XIMA 4GVFA 3CTLA 4C5ZA 3SCVA 3VILA 4L4MA 3PZQA 4ZB2A 2RJGA 1RPXA 2GLKA 3C2YA 5A2BA 3HQPA 1UQZA 3NGFA 4AIEA 3H7VA 1FCVA 1TWWA 4B5TA 4A4AA 1UWUA 1SZGA 2ZBTA 2VEKA 1ECEA 2J7FA 3O3RA 2DZBA 1V77A 4AZIA 1QPRA 1JPMA 1NFBA 1HVQA 3WLLA 3IK4A 1NF0A 4XAGA 3DKLA 2OYLA 1AH0A 4MB1A 3IJ6A 1L6YA 2V5KA 4QFUA 3JZEA 4PGLA 2ZYFA 2ISVA 4X9YA 4ML9A 3V35A 1QW7A 1SO5A 4JY8A 4QHRA 5FEWA 4E2DA 4LU0A 3HN3A 1EJTC 3ZO9A 1OX4B 1W3JA 1D3GA 3DAQA 4HPXA 4R33A 1EC8A 2YL9A 4GCAA 3P7YA 1GQKA 2DW6A 1XXXA 1GOIA 1VFMA 3ITLA 4Q6JA 1GYMA 4LEQA 3BVJA 3TWAA 1EH9A 2DVXA 1HJQA 3U57A 4GYPC 2XH2A 2E6AA 3HG5A 4R34A 1JCMP 2QPSA 2CU0A 5CSRA 1E0WA 1CB7B 1QK0A 1XSIA 1UZHA 2AL2B 2WSYA 1D3HA 4W8LA 1LLOA 3FKRA 5LKYA 1W5QA 3R12A 1C93A 2XJ7A 4JYFA 4RDZA 4D1IA 4KF1A 2FVLA 4L9YA 1XIEA 1V79A 4QE4A 1L6GA 2WHLA 2YXOA 3TAOA 2PP0A 2WSKA 4OJYA 3W7OA 3CBWA 4B9ZA 2EHHA 4UR9A 5LIYX 2G3JA 4XAZA 4FPSA 2YB4A 3K46A 2CHNA 1KBIA 1JYVA 1KRMA 3MDWA 3W1NA 1RCQA 4FX7A 2WCGA 1J0KA 4B4FA 3Q37A 2ZX9A 5D2TA 3O07A 4QNWA 1FCBA 2CLMA 3EMZA 4ZGYA 3TW6A 1QTWA 1KXTA 2A7PA 7REQA 1N82A 5HOSA 1NFGA 1TJ0A 1VAHA 1MVYA 1TCMA 4ZQPA 2CESA 2JK2A 3WUFA 1T8QA 3N17A 1MZHA 1Q6QA 1YKWA 3LLDA 3BZJA 2YCJA 1J79A 1NSJA 3GU9A 2PCEA 4GYJA 1GONA 3SQMA 2WQDA 4XD6A 1UASA 4Z42C 1UMYA 1XGEA 3L23A 3M44A 5D2WA 2Y4SA 3MSGA 1DXEA 1HTIA 1XH0A 3DCPA 5AHIA 4CNUA 2PFHA 4UTLA 4GNKB 4BY3A 3EXTA 1GT8A 1XC6A 1W32A 5FF3A 4ZXLA 1J0YA 2QAFA 3I7SA 3QHMA 3ARVA 4ERGA 3GTHA 2QW5A 4DHGA 3GWQA 4EK7A 4MM1A 1HJXA 3SQLA 3BG9A 1UOKA 2TSYA 4QEHA 4ZZ9A 1W6TA 4E6MA 5C8BB 1A5SA 1W2PA 1CXEA 4RNHA 3MKKA 4FHAA 5HMDA 3UA3A 3WJWA 1QHZA 5EY5A 4JX5A 2PWEA 3NQVA 1WKDA 2E6YA 3VYLA 2YLLA 4Y90A 5I0DA 4JTGA 1CENA 1NIUA 3OVPA 1GYLA 2VX5A 2QCFA 3VZZA 1J0JA 3EX6A 4KIEA 1ZQ5A 5D38A 1HJUA 1XIGA 4K1GA 1AG1O 4IUOA 2GQ9A 4GIRA 5HJYA 4QBXA 1OG0A 2AQOA 4H6KA 3WL1A 4CQDA 2ZDRA 1ZJHA 1HJVA 2ZIDA 5DELA 2VDIA 1HJWA 3CC1A 2O7SA 5C5YA 1FWHC 1BG9A 4K8EA 3UXAA 2W3ZA 5K4ZA 1ONWA 1FKWA 1TWZA 2GWNA 3SGGA 4C90A 3SSZA 1EYWA 4OWGA 3T05A 3VMPA 2DT2A 2H3DA 4RKAA 1PWMA 3GY1A 1H50A 3GW0A 3NYZA 4IGMA 2HS8A 4DWSD 3G1FA 3CMFA 3MKCA 4AC7C 1OFPA 3QKZA 2Z0IA 3QY8A 3VOFA 2QDEA 3VNZA 5CBBA 2D69A 1RBAA 2BHUA 2X7VA 1TPUA 1G4SA 2GUUA 4XX6A 2C1IA 3KRZA 3FGCB 1V7YA 3NSNA 4QITA 1JUEA 4WKAA 1B9ZA 2OX1A 1TPFA 4QJ5B 1HZYA 3TN4A 1LQAA 3MVIA 3I6EA 3BPWA 4FX8A 4H9MA 4WJXA 3VMOA 1BVZA 3LZ5A 4YNGA 3B8SA 3E0WA 2XTKA 5IXEA 4QSHA 1BVWA 4NNCA 4C6BA 1E9IA 1QU4A 3VI2A 3PPGA 2Z6JA 1XV8A 1X96A 3G0UA 2XVLA 4YCOA 1U83A 2CYGA 3HA1A 3WBXA 2R8WA 2QJJA 5EA9A 3HGJA 1Y5WA 2JALA 4JIRA 2WMIB 1KC7A 2YW3A 4RZ6A 1TCDA 2DORA 4YLWA 1TMQA 2PGRA 3W2UA 1MUCA 4ZO9A 2ZRUA 2CLEA 2ZQ0A 3RLUA 4ADSA 4Q4KA 2F7FA 2DZSA 5T9CE 4REQA 3C8FA 4IIDA 4EP8C 4MDOA 4BF5A 4L6DA 3CU2A 2PTYA 3ZOAA 4QAIA 3LLFA 4XBJA 4DYKA 4YTRA 1NWTA 3OIHA 1P48A 1VBUA 1F4AA 1DJHA 4S3KA 3NEVA 1P6CA 3M0YA 2VFHA 2SFPA 4QDPA 1ZRQA 1CDGA 2PUZA 2XIJA 4GRSA 3UR8A 3B0VC 5XIMA 1XD1A 5CGQA 5C70A 1UZDA 5L9FA 4A3YA 3AIEA 2EO7A 3OA5A 4GGHA 5F7UA 3AMKA 1JRBA 3BLEA 1UA3A 2PS2A 1KO0A 2Z1VA 3QEZA 2HISA 3GTNA 5AYYA 3EOSA 2HBVA 3B3DA 3SCOA 3A24A 3W9ZA 4Q3MA 4C6QA 2OJPA 3RM8A 4B5SA 2ABAA 1RK5A 3L7RA 1H7OA 2RFGA 2WZIA 4X2RA 3RR4A 1QI5A 3FAXA 4WF7A 4X0VA 5IM51 3KTCA 3LB0A 1OABA 5CGTA 3WQCA 4ADUA 1A53A 5JIPA 1MXGA 3ARZA 4Q33A 4B92A 4OFCA 5EU9A 3VD7A 4MB4A 2CHOA 3F4DA 4GYFA 3UWZA 4JL1A 4MADA 4J3SA 4KGJA 5AOUA 1GKRA 3PBWA 3RX2A 2IPFA 4AYSA 3VNKA 5AC6A 5FESA 3T0AA 1GPWA 4PMUA 1DQWA 3QR3A 4TU1A 2X7WA 3NO1A 3PNUA 4NL1A 1I4NA 4INFA 1I1WA 1RBLA 2DDXA 4A8RA 3AYRA 3BCJA 3EPNA 2UY3A 4R53A 5CBJA 2XIIA 2NXIA 3WG6A 3T1GA 1ELSA 3VDAA 1X1NA 5ABFB 3NPWA 4MMWA 1VBRA 1KXVA 3VD4A 4RE3A 1UH3A 3WMSA 3NL6A 3C2OA 1V6UA 2DV0A 2Y7GA 1F9CA 4Y9PA 1OVDA 3LUTA 1O5QA 1K6AA 3N73A 1X6UA 2CWXA 1FRBA 2C15A 4Q7BA 2X1IA 1ITUA 4AY8A 4A21A 3A47A 3OZPA 3HPZA 1EP1A 4NASA 2PDFA 5J5RA 2EPKX 4AX7A 3CQJA 3GIQA 1EJUC 3MY9A 1H51A 1QI0A 4CN1A 4HN4A 1PZ0A 2CLLA 1FWGC 3F7JA 4GJ1A 1FTXA 5LIUX 2WZTA 2ODOA 3NYDA 4PBEA 1XYBA 2OT1A 3A3HA 2MNRA 1CIUA 1GVQA 1MQRA 4TVCA 1E9LA 4LANA 2INEA 3V1HA 1B31A 2PDLA 2PC8A 3GVWA 2ICSA 1OD0A 1BG4A 3OBKA 7PTDA 1DQUA 3PNZA 1FWCC 4XUGA 3IWPA 3SFKA 1YNQA 4FZIA 3AMDA 3AC0A 3QW3A 4BJHA 2VUYA 2OQLA 3VNJA 1T99A 2E7FA 4M80A 5KSWA 2D2GA 4AZBA 3DG7A 3T55A 4IJBA 2NWRA 1R87A 4JHOA 1RLCL 3RF9A 2DSZA 4IIEA 1Z89A 1TZZA 5JMUA 5AYZA 3TVAA 2PDBA 1VLWA 2CLPA 1CNVA 1EP2A 3CMGA 2GVGA 2PF0A 2ZC1A 3C5QA 3V7PA 1OCJA 3R43A 5FI8A 3PM6A 2R24A 4NJHA 3RU8X 1HW6A 2XYLA 1OCBA 1UPMB 2X8RA 4LS0A 4AZCB 5JH2A 2DJXA 4JTIA 6TAAA 3AHTA 4CEXC 1MQQA 1LORA 3R5EA 3BSGA 3BAXA 4Q22A 1R9XA 4UQCA 3CNYA 4KCVA 2GPTA 3LXCA 4OT7A 1V0LA 4KETA 1IWAA 4PE8A 2PSNA 4H9ZA 3NURA 3S6OA 2PC4A 3DG6A 4M6QA 5D04C 2ZZ1A 1HKWA 4JTFA 3DERA 5D4YA 4KIRA 2I5QA 2QZRA 3PZGA 3R6IA 4I90A 2G3MA 4ZQNA 1DIDA 2CZDA 1Z48A 3WF2A 3BARA 3MUIA 2Y0FA 2W6RA 2X41A 4PB5A 4LV4A 4M82A 4W7UA 1BF6A 2Z1WA 1T7LA 3A4AA 3ARSA 4LW7A 5B80A 4C6DA 4UR7A 3TYEA 4L64A 3UD6A 4XBKA 5I3HA 3TYDA 4F0HA 1HN1A 2ZXDA 2VZTA 4GOAA 2PEVA 1I9CB 4XTDA 3AIVA 1UOZA 1RCOB 3N3MA 1SJDA 1EHNA 2GJNA 2IKGA 3MJYA 3A23A 5FA5A 1GCYA 1L8PA 3BJFA 2GZXA 5BRQA 5DLCA 4LPCA 5KETA 4PYSA 3LPFA 4HK7A 1JZ4A 5LYRA 3PZMA 1RY0A 1EX1A 1XBXA 4P8WA 1NU5A 4ZXOA 2YOCA 1QNQA 3VX1A 3GD6A 1TTJA 1XQLA 4AD1A 4O18A 1SZFA 5LNRA 4D6GA 1XKJA 5TBOA 1O12A 4HZ7A 2YGYA 4REQB 2XGBA 3VDBA 1UUQA 4DN1A 2P76A 3SGUA 2YSWA 3WY1A 4U2YA 4A8NA 2WNNA 4G56A 2NT0A 4LC6A 3HG2A 2EPMX 4M1RA 2V5DA 3AUOA 4E8DA 4GQBA 4GZIA 4O52A 4LRSA 4WZHA 1IF2A 2A3BA 2J4GA 1BRLA 4GI8A 1C9DA 2QJGA 3JUGA 4IP5A 2PRHA 5EFDA 4Q7IA 3QZ6A 1XRVA 5HMEA 2CITA 2QJHA 1J0IA 2YBUA 4KGLA 4OV4A 2OELA 3OJGA 3WQ5A 2D22A 1JI1A 5DT7A 1H2JA 3TN6A 2EPOA 3BLDA 1K8ZA 2DP3A 3LI1A 5D05A 2DZVA 4O8RA 3THUA 4HNOA 8TIMA 4MNMA 3SECA 3AJXA 3E2VA 1LL6A 2AGKA 2BY3A 3N4AA 1H1ZA 1A5BA 3LD5A 3M47A 4WDXA 3SEPA 4ZQCA 2YX0A 2NLYA 5D9OA 1KTCA 3IACA 3PHAA 2OEKA 1UR8A 5CEWA 4HA0A 1PTDA 3O15A 3TOPA 4AD0A 1QASA 1XRFA 2OMAA 4C7DA 2BVYA 4ZEPA 2QCDB 1DXIA 1PX8A 4W86A 5MHBA 2PLJA 2XUCA 1ISXA 2INFA 4LVBA 5FCZA 3ANUA 2XISA 2WMHA 1TRDA 4UFLA 1KCLA 3W71A 1VHCA 1ZENA 4ZA0A 4GY7A 2ON3A 5BU9A 1JPHA 3T4WA 3TQPA 3LI0A 2PB1A 3NZQA 4PCSA 4IMAA 2VQTA 1HKIA 4H1ZA 5FF0A 5CZJA 2BVTA 4X63A 3ZWTA 1W1IE 1ONXA 3O1NA 1S5NA 2ZTJA 2WVTA 3IVUA 1ZUAX 2Q01A 1OCQA 1GQLA 1JPIA 4L1GA 1JF5A 4LUIA 2GUYA 1G67A 5IOBA 2ZRXA 1SW0A 1PX4A 4CVUA 1N8IA 1IXNA 4F0RA 4ZR8A 2X1TA 4GA8A 4CLMA 3W6YA 2HZGA 2QT3A 3ISIX 1OGSA 2WZEA 4IGNA 3P62A 1UWRA 2OPJA 4DXXA 5BWFA 2FFCA 3TMQA 3TQKA 3VCCA 4W7VA 5DMLA 1TPVA 3GG0A 4O0ZA 1P1MA 3QZAA 1TR1A 3GYCA 4AD4A 2GK1B 3UZ5A 5F2IA 4AIUA 3TN5A 4UQAA 4H2CA 2ALRA 2GDQA 1R86A 4UFHA 3U5YA 3QJAA 3ZMRA 3O6YX 5TD4A 1TV8A 1FA2A 3CV6A 3I7QA 1DV7A 5EMUA 1L9WA 1OFRA 3ZVHA 2CWNA 2YA2A 4NJJA 4OTKA 1IZCA 4EANA 4TXEA 1LF1A 1NH6A 1GZJA 2QVHA 4J3UA 4CN6A 1XINA 3NQDA 3DGBA 1CX9A 1TR9A 1WKEA 2BMBA 3CAVA 3FXGA 3TP4A 4IFKA 3H2NA 5LNUA 2WNQA 3V3WA 1EWEA 5H6HA 1DIOA 3V1PA 1AQHA 3ZVHB 4WSHA 1TVLA 3ZJ7A 3DUGA 3NFUA 4GBDA 3FVDA 1QXLA 2DIJA 4CNPA 3TLLA 3GE7A 4PMVA 5FOOA 2HDJA 2OEJA 3ARTA 1O5RA 4LAUA 3DI1A 4W5ZA 4ACYA 3IIZA 4PR4A 3BMXA 2CLIA 1YE4A 5EMMA 4YPJA 4IISA 5CG7A 2CXEA 3ABZA 2X09A 4GG9A 2HVOA 4TVUA 3GC2A 1PCWA 2CZ5A 1JYWA 4O28A 2GJPA 2IUZA 4BFAA 2YW4A 5IFPA 5DO8A 1B30A 3A9BA 1BYDA 1GYNA 4E4PA 3SBFA 1FBAA 4W93A 3UXIA 5JBEA 3STPA 2YCKX 1PTAA 4K1WA 1FFRA 1HGYA 3PJXA 4IX2A 4Y2WA 2ESCA 4MZYA 2G96A 1OT2A 1UB3A 5FJIA 3VM5A 4Q8TA 7ODCA 3PTKA 4IPIA 5LHFA 4BHYA 4W9TA 5A6SA 3FOKA 4J3XA 2GUBA 1GPFA 1PPIA 4ZB0A 3VIKA 5I06A 1NDVA 2DT3A 5CH9A 3HTWA 3BAIA 2VFDA 1TYGA 3NVDA 1XPYA 1RR2A 2FVMA 4BS0A 3W26A 1CBGA 3F1QA 3K5XA 3IIOA 3GVGA 3A4XA 3IJIA 1EIBA 3DFPA 1UR2A 2ALDA 3W7PA 3BDKA 3TLQA 4ALDA 1EUAA 3AU2A 4GMEA 4J3TA 4GH3A 4KFNA 5C9RA 1MSSA 4IG2B 3SRFA 1ISVA 3BLKA 2I5GA 3GLCA 1KNWA 4L1XA 4BI7A 3QHNA 4MAVA 4MGGA 3W7HA 3CZLA 4HU3A 1KFWA 3EDDA 2G5WA 2HROA 2V2CA 3P2VA 1L6FA 4DJFD 4Z2KA 4J2MA 2ZOXA 1H0GA 1YPFA 4I7VA 4C6NA 4H9YA 3ZLFA 4B5UA 1H62A 3NEHA 1KQYA 1E15A 2WQPA 2VZSA 3UERA 1PB0A 3D5HA 5E93A 3P61A 1YQ2A 2VC5A 3UJRA 5CC5A 2VQUA 5I3GA 4WXYA 1B3VA 2PZNA 4F8XA 2FPTA 3L4VA 1QMLA 1IZJA 1VCGA 1QDSA 1TV4A 3VC5A 2QHAA 1JIBA 2PE4A 2PDMA 1XH2A 2HVNA 5LA1A 1UC5A 2I16A 4IFRA 1AFSA 3F03K 1BXBA 2NXHA 1VHNA 1YYAA 2PDPA 1QOQA 2Y8UA 3ARXA 1YADA 4XWUA 1Z8AA 3VU2A 2ZXQA 2ZZ7A 1AJ0A 3KCOA 3W70A 4HOWA 4QROA 4J27A 1AMKA 5CG0A 5K7JA 2GQ8A 4MTVA 1ZALA 4CEUC 4PMYA 4IICA 3ES8A 1K6WA 3N4FA 4JXCA 3FSTA 3ZSTA 1R0MA 3GXFA 1P0DA 1W1PA 2HTMA 1GVIA 1JNEA 4ZTXA 4C5YA 2Z2BA 4BI6A 1V3HA 3DU0A 3UZXA 3DG3A 5AC7A 1TVNA 3EOOA 5JQ9A 3AQUA 2YLAA 3WQVA 2QIWA 8RUCA 4TX9A 3AS0A 4GQRA 1F5ZA 4P7RA 3F5JA 3WQ4A 3B0UX 1VYRA 2QUMA 2PBOA 2R82A 1LQ0A 1NQ6A 1AD1A 4IP4A 3OYXA 3MPGA 3I3DA 4LX4A 3QV8A 5RUBA 2NQLA 2B4GA 4OQVA 4GE8A 3CQ0A 3M46A 3XIMA 2GGJA 3H21A 5C71A 1VB9A 1TX2A 3VKJA 1YRRA 4I9TA 1SR0A 4HA1A 1XIJA 1XLAA 3N2BA 2DZPA 2RDUA 2Z1BA 2KX9A 3OG2A 3LHUA 3R0DA 3NQ7A 4HIBA 4K2SA 4MWAC 1OG6A 2VWSA 4GC4A 3CZGA 5J04A 4AD2A 2ZC8A 3EBVA 4PB4A 3WLJA 5CXPA 1X7FA 4G1KA 1LL4A 2ISFA 4Q4PA 4FXJA 4NKCA 4H83A 2PODA 4DJDD 4AD3A 3PULA 2VD9A 3EXRA 4IF2A 3T81A 5DRIA 1WQ5A 1QWKA 2B31A 4C6CA 3V16A 2Y89A 1TPB1 1VJSA 2ADAA 3GHRA 3IJQA 4C60A 4LCQA 1U5VA 1R3QA 1RXOB 1FDYA 3E0VA 3AXHA 3NPXA 1QI3A 4S3FA 7XIMA 1EYEA 3RN6A 3SR7A 1VJZA 1ADOA 5HJLA 3LTPA 4IJRA 1TPEA 5FL0A 4D6HA 4EX4A 1US0A 3SCRA 4JFSA 3TNBA 3THCA 4JTAA 3VIHA 4M29A 1LT7A 2J8GA 4AH7A 1IGSA 4NILA 1NJJA 2FH6A 2FB2A 3VIMA 4IUGA 3VGGA 2BGNE 2EEXA 2CLFA 2LLEA 3RRAA 2DIKA 4H9VA 1NP2A 3TFXA 1YTKA 6TIMA 3T42A 4TMBA 1KXHA 3U5UA 2VHLA 5C9XA 2YDSA 3BC9A 1RVKA 3POHA 4H2HA 4PB3A 2GGHA 4A2RA 4BR1A 4NNBA 3K2GA 1DBTA 3WSUA 3ARPA 4B5VA 5CPSA 1XSKA 4PMDA 3FCPA 4S3GA 1TZ7A 2XVPA 1KLYA 5B7YA 4LFYA 5D9NA 3REQB 5CBIA 4NI3A 5HXMA 3S1UA 3E1F1 4HNVA 1D7KA 1FXPA 3RX3A 3BH4A 1KFEA 4PMXA 3MW7A 3F5LA 5I3IA 2DGAA 3A22A 1KFCA 1QHOA 2VC7A 2E8YA 3N2XA 1BXCA 2C0AA 2FQIA 3PPHA 1BXNA 4YCPA 1OB0A 2HXTA 3ITCA 3VM7A 1B9BA 1G0CA 3N34A 4A8IA 3ZS4A 1VYSX 4EWND 2QVNA 2VURA 4LVGA 2FYMA 1UR3M 1ISYA 4H8VA 3PJUA 2BB0A 3WLSA 1VD6A 4I9JA 1C8XA 1JRCA 1R3RA 2WM1A 1JZ8A 1EOKA 1XUUA 1ZY9A 3TU9A 1ALDA 1XLKA 2XG9A 2WVVB 3LSBA 3QTGA 1XIFA 4D1JA 2CHRA 5CGMA 2XIMA 4O12A 1MWOA 2R1NA 3QMSA 4WD0A 5HQEA 3N2TA 3B4YA 1Q2SA 1S2WA 2DU2A 6XIAA 3F2DA 3IJ7A 1DTNA 2W27A 1AA1B 3EX3A 3ID7A 1X38A 1JPKA 1B3OA 1HO4A 1YHTA 3GNXA 4EAMA 5C9WA 1ZP3A 5A8GA 2E6DA 1EZ2A 2WSRA 4LYPA 4WX2A 4N9CA 1OWQA 3MP4A 1W1B1 1Z41A 6A3HA 3S46A 1PX3A 1XF0A 4GINA 2HS6A 2VJXA 4IMCA 4HJFA 3L66A 5A5WA 1XYCA 1EO5A 2XH0A 1K1DA 1C8YA 4OHQA 1E0VA 1HL9A 1KWGA 2P88A 3VTRA 4XBSA 3APTA 3OB8A 1KRAC 1U1HA 4AWEA 2YXXA 4NZCA 2V5BA 1H7NA 1QVBA 2TAAA 4H04A 1E55A 4MHBA 3CAKA 2VR4A 3UY8A 3SCQA 4V27A 1WBJA 5FJJA 1PKNA 1UQYA 4TV6A 1MUWA 2UWFA 4UNLA 3ZR5A 3EX4A 3EWWA 3BLOA 1VCFA 2Q71A 3ITVA 4WKHA 3N04A 3S6TA 1EDQA 3GB6A 1BRLB 4LTSA 4LYRA 1K9FA 3EWZA 1FWWA 1XLLA 5BXRA 5JUVA 1C91A 3QKEA 4A2SA 3LQLA 4C6KA 1ME7A 1FWFC 3PWGA 2DSVA 4QQ3A 3KX6A 4DLFA 3LCXA 3OLIA 3KDOA 1ZJAA 3R10A 5F2LA 2RGLA 1XDLA 3EB4A 2ZTKA 2Y7EA 3G1YA 4U31A 4RDVA 3DOPA 4ZOCA 1NARA 2CKSA 1PZ3A 1F3XA 1T5AA 1CZ1A 1FH9A 1H11A 4UTUA 3MHUA 4PH6A 5ABGA 5CPLA 3M5ZA 5AZ1A 3C2FA 4KKXA 1KGXA 3WCZA 1GVSA 3V0UA 2OOGA 4NJGA 1WDSA 3QXBA 4S3EA 2V63A 3EWDA 3WBYA 4JHZA 4A6GA 4U2ZA 2ISDA 4JPGA 1R46A 5HUOA 1YW1A 2BBFA 4OE7A 5I78A 4E0CA 1XLIA 4WSKA 3MUY1 5JXQA 2WHJA 1RQHA 1P5BA 3TKFA 4FOJA 2Y88A 5CAHA 3QC0A 4J40A 3EDEA 1O5KA 3UFYA 5D2YA 1KFJA 4AXKA 3WLQA 3RK8A 5AC8A 1A47A 3CO4A 4IWWA 2E28A 1JZ6A 2G0WA 4M56A 2E5BA 3GH5A 3MYOA 3O63A 3TTOA 4HSOA 2OKTA 1XBZA 5A6BA 1JYXA 4QM1A 2FFIA 1E6PA 1SYTA 4I5UA 5TQLA 1KFBA 1S3HA 2P8BA 3B97A 2CC0A 5U4NA 4LUSA 1V0MA 1ODUA 1XBVA 2ZXAA 4UQEA 8A3HA 3OLGA 4H8NA 1GWJA 1MNSA 4KH2A 2DVTA 4UTIA 1EP3A 1CLKA 3Q65A 3TMLA 3QHOA 3FYPA 1ZBCA 2FDMA 3WMLA 3PUEA 3B9EA 2ZCGA 3C6CA 2OLSA 3OPSA 2YYTA 3W72A 3EPMA 3FIGA 2BWGA 1CGYA 3CM4A 4XZHA 1PUDA 5HPCA 4HPHA 1TREA 3IAQA 4GUIA 1F61A 3W7EA 3WMBA 4M0XA 3AYSA 1PO9A 2QMKA 3OHIA 9RUBA 4PZVA 2CETA 3NJ3A 2WJZA 2BLEA 3H4XA 5B7ZA 2X2GA 2NQHA 3QR0A 2NVAA 4XAFA 2ZE3A 2XN2A 5DMMA 3E96A 3MJMA 4ZTYA 3G1DA 2BSLA 2DY3A 2PWHA 3AFBA 4PC8A 4DWSC 4Z0SA 3S5YA 3W02A 1TPC1 2J27A 4ZOBA 2VP8A 3GXMA 5LHEA 1HKJA 2EJ1A 3WFAA 3INPA 1NQKA 2Z29A 3W7MA 3VUSA 1XJBA 3GDKA 3PZOA 1GTEA 3B8UA 3EKGA 4P5UA 4PBGA 1MEHA 4MFDA 1FWBC 3UJFA 4DX3A 3GHSA 4F2TA 2Z26A 2FH8A 3WLKX 3KUMA 4RNJA 3TQ0A 1UBPC 2QJNA 1Z69A 3BW2A 2ZZ6A 2G3NA 5C54A 4W84A 2QKFA 3LBMA 1KCXA 3BAYA 3RLGA 4CU6A 3H7UA 3CUGA 3NL2A 2YB1A 3LGGA 2UY2A 4XV0A 2V67A 2Y6ZA 1OBAA 3E2QA 4BWLA 1Q6FA 1QPOA 1GUVA 4N9BA 4ZB5A 1BWVA 2NUWA 2EG6A 4KQNA 1EJVC 4HSNA 2ISWA 2HNHA 1Z32X 2WVUA 2ZZ5A 1SSGA 3FXYA 1ONRA 3TC3A 3WNNA 1ICQA 4MOZA 1G4PA 1X97A 1FY6A 5FJRA 2AKZA 2FZNA 2IKJA 1KKOA 1CGXA 2AOSA 4B9YA 3OODA 2JQXA 1UP3A 2NUXA 3NQBA 3A3XA 4XVEA 1Z44A 3MUCA 4EVZA 4CCCA 1H1NA 2VZOA 4IZGA 3H54A 1F7BA 2QIIA 1XLGA 4O8AA 1K4HA 3N2CA 1MYRA 2CEQA 3MKVA 3U7BA 1XL9A 3CLMA 1SFJA 1T0OA 4H6EA 3THQA 3OQ8A 8CGTA 2A3HA 4D6FA 2VEFA 5IBXA 2OZ3A 1AUSL 3VZXA 3A6OA 4MKSA 2YDRA 4HMCA 1XPGA 4HOZA 4G7EA 1J12A 4LNCA 2PDIA 3URBA 5ABFA 3CB3A 3BTNA 2CIPA 5C2CA 3W7GA 2DEPA 3B0YA 3MMWA 2WV8A 2HEJA 2YCLB 3N25A 2BNJA 3FJNA 2A6LA 4B3KA 2Y24A 3KRSA 4I6VA 1ZHAA 1JF6A 1DIKA 4Z2JA 3SRHA 4OIFA 4LVDA 1WV2A 4D9PA 1A5LC 3M0VA 4PMQA 1S1RA 3QV7A 4L5ZA 3GKFA 3WO8A 3FSUA 1BWKA 3EEZA 2A1YA 3I6TA 4LUJA 3SUWA 1CTNA 3V18A 3C0SA 1VKFA 4D6EA 4ICCX 2FJKA 3GIYA 2QDDA 4NZ5A 1EJRC 4XIMA 2V69A 3LCFA 2BHZA 4HCLA 3VK5A 3KLKA 4X61A 3S5OA 1C7SA 3VOIA 2VX7A 3HZ3A 3C2VA 3VNDA 1Q6EA 2V5JA 2NV1A 3B06A 2O7QA 3CZ8A 2WMKA 1SJAA 1E5NA 4ZFMA 4CNOA 3W82A 1FHUA 1HF6A 5CSUA 1EC7A 4YYFA 4CQCA 5MF5A 2PTWA 1AVAA 3KCLA 3L67A 4ZO7A 3MI6A 3S5ZA 2HSAA 1SUXA 1TO3A 2BHYA 1WYIA 3O0FA 4IFKB 2VKZG 3TWBA 3N2OA 2OT0A 2VEGA 2B7NA 1C3FA 2XM1A 1YE6A 1EGZA 4CQ8A 1CW2A 2PDKA 1F6YA 4F0MA 3QF0A 4LYQA 5A2CA 4ZSUA 1R8LA 4B2DD 1MUMA 2FZ8A 1W2VA 3WEOA 1R7AA 4HKPA 3CEUA 5AC5A 2C1GA 3UG5A 3WLOA 4KFPA 3L21A 2JIEA 2Z24A 3A64A 1AW1A 1ZZMA 3FYOA 2H9AB 2VO5A 3H2MA 2NX3A 3UWUA 5CC3A 1MFVA 3PUDA 3MP5A 1EJWC 5FIPA 3H8AA 3PUGA 3L9CA 5M03A 1GKQA 1E56A 1L2QA 1IT0A 2V68A 1ZU8A 3S2MA 2F8QA 1CGVA 4KWSA 1Y5XA 4KRZA 1HNYA 5AB3A 3NM1A 1KKRA 2Q8XA 1K7FA 4H8HA 1IT7A 5REQA 1Q6RA 3CGTA 1PV8A 1QNPA 3POCA 2VI0A 3ATZA 3D3AA 3ENLA 5F2MA 3W22A 3TIMA 1S3TC 1VFHA 5K9XA 4RPPA 3SUSA 4K8GA 4N4QA 5DCDA 3UYCA 2FDSA 3PJWA 4MNLA 2QPUA 2YCLA 3DFOA 1E0XA 4JYDA 4JQ1A 2QGHA 2JIWA 1LWHA 4D8ZA 1HKVA 3CQIA 1BKSA 3MP3A 1YXDA 1BGGA 5AYXA 1EDGA 2WPBA 4UR8A 4FAMA 1DWAM 4UTWC 3WX7A 4H8UA 3HJEA 4NVTA 3GTXA 2VWTA 1TA3A 3N6QA 9XIAA 1UIOA 3E12A 4GUFA 4UUIA 4M6PA 4WJEA 2OGYA 4I8DA 1A4LA 3EWUA 1TKKA 4HJWA 2X1UA 2Z00A 2I9UA 2OFJA 2AKMA 4MWAB 3GG1A 1BF2A 4YXGA 1XISA 3KZSA 4OBTA 1RZMA 4IIHA 4UTKA 1YXCA 4LS1A 3GVRA 3TSDA 2I7GA 2NVCA 5AHMA 3DIPA 1B3YA 1B1YA 3STFA 4W87A 4DB7A 1HL2A 3ANVA 4MJMA 1JD9A 1ADDA 1CEOA 3IIVA 1A0DA 3IVSA 3GH4A 1LUCB 4MNKA 3H6OA 2J75A 2RAGA 4G8TA 1AL7A 3PANA 5ENLA 2PDGA 1I60A 5DXXA 4QE5A 2PDWA 4US5A 2WXDM 4HN8A 1HP4A 3W88A 5M2FX 3U6WA 4DF0A 3BAJA 4KMQA 4GC3A 3V36A 1CLVA 4F79A 3MO7A 3ZYZA 3BGAA 1H49A 5FACA 2OB3A 3F5KA 1EJXC 5AHFA 3C3NA 1JZ2A 1A50A 2Z2UA 4PCPA 2O56A 3FAWA 3VXGA 4PRWA 3T6CA 3WMCA 2J6VA 3NQ8A 4J9JA 4H7VA 2OXNA 5CLWA 2EJAA 3PS7A 2Y70A 1XIMA 5FEZA 1EXPA 4ZQMA 1XGZA 3S83A 1E6QM 1TIWA 4AISA 3OG3A 1XIHA 3TR9A 4LRTA 4CQBA 3QFEA 1K8XA 3BZGA 1PAMA 1RHCA 1TB3A 3FW6A 4G9PA 2IQTA 4RV3A 5H8PA 1DJZA 1TX0A 1ZAHA 1YXYA 2QLYA 2VVNA 4S3BA 1ONEA 1Z9AA 3GQYA 5E0KA 5AVHA 3E2SA 1TSIA 1GVEA 5BYWA 1UWTA 1VEOA 2B7PA 4PCFA 4GO9A 1ZLPA 1G69A 1KRCC 3P67A 1OCNA 3TCEA 2HVMA 3SN0A 3G6MA 1BYCA 1RQBA 5T91A 4MY9A 1I0DA 1TELA 2E25A 4EXAA 5HPOA 3GIPA 4IOTA 4PUEA 4J28A 2ZWZA 2ZX7A 4TTGA 4UTWA 1XDJA 1UA7A 3S2LA 1A5OC 2Z2AA 1UCWA 2IW0A 3C86A 3BLLA 4IFOA 1WXJA 2NUYA 1N55A 3GNNA 1R9YA 2P10A 5HDRA 4AVOA 1AZ2A 1UUOA 2NV9A 1GOKA 1W1VA 1JZ7A 2OYKA 4N2YA 3STCA 4PSRA 1UWAA 1MMFA 4HU8A 3NQAA 5FSDC 5GQBA 3WLTA 6XIMA 5F1VA 4GI6A 5HNTA 3JR2A 3NIYA 3B04A 4JQ4A 3THDA 1D3CA 4R7JA 3TJXA 1GVFA 5A8NA 3CASA 3VNIA 4A3RA 1ZB5A 4FXRA 2TYSA 5I3KA 1FWRA 4UQ9A 3OW1A 1R5YA 1E71M 1JDDA 2QV4A 1O6IA 5DRCA 3QTPA 3SCPA 4OUIA 1C29A 4FXSA 3BANA 1UROA 4ENLA 1DJIA 1OFEA 3AMGA 2Y7DA 4C1KA 3LHTA 3W7RA 3AO0A 1JPDX 3KL5A 4L1WA 2XIOA 1BWLA 3ERPA 4UFJA 1TPH1 3MB9A 3W87A 2DH2A 2QCEA 5CZTA 1ZBWA 1GVOA 1FVPA 4LUYA 3WNLA 3ZJ6A 3N18A 3TXVA 2X0HA 4W88A 1SO4A 4HNCA 3WBEA 5CPOA 3S1WA 3AWNA 1IGWA 4K38A 1DE5A 5A6BD 1S2TA 4CNTA 3CUFA 1HGWA 1RD5A 4ZMGA 1H7XA 5CZSA 2B0MA 1YPXA 3AXKA 4YL2A 2X30A 3WDQA 4QLLA 1KM5A 3F4CA 3RJYA 4H6RA 1W9VA 1FXQA 1JR1A 1BEUA 4A35A 4I5RA 2B7QA 4OBSA 3M43A 1DPMA 2QCNA 4DRSA 4GJIA 3GTIA 3LTSA 4XISA 4GKTA 2FTYA 3VAVA 4JTHA 1O60A 1VRDA 2OYMA 2ZZ2A 4XZMX 1W5MA 3L0NA 3SW6A 4AUBA 3FEQA 6ALDA 1W31A 3VVGA 1W54A 4DZAA 3ATYA 3K4WA 1R9ZA 1OM0A 1XQKA 3QW4B 2ACQA 1KM0A 4HMEA 5MKGB 4MWAA 3GNRA 1FWAC 5AHLA 5HWJA 1J2BA 1FH8A 4L56A 3U2EA 1FP9A 2CBVA 2GVEA 4B15A 1NWUA 5IBXC 3BCFA 2W66A 4M7SA 1Q6OA 2X2YA 4BF7A 3GKAA 3W28A 4CVWA 1QPNA 3HB9A 5I07A 4R5EA 1MFUA 1V3LA 2POZA 4ORIA 2PF8A 5BNKA 2DH3A 5F2GA 4PULA 4XKMA 4CD8A 5BXTA 3CH9A 3VIFA 1XYMA 2DFAA 3GO2A 1JD7A 4H9XA 4LVAA 2WBGA 2PDJA 3KBWA 2Z7GA 3UEQA 1PIIA 1QJWA 3LPPA 3U3HA 3YPIA 2OWWA 3B40A 3OZYA 3UNDA 4NSBA 1MI3A 5AZ0A 2W61A 1H61A 4PFHA 3U8GA 4AZ6A 3TC7A 4JFUA 1GGOA 2WHMA 4ERAA 2PAJA 5A8PA 4DBDA 4D6IA 1UWQA 2WJDA 1K9DA 4IGSA 3ONCA 1A5KC 4O1FA 2WB5A 1PHQA 1JG9A 1GK8A 4WCJA 3LMYA 3CUJA 3M0ZA 2EG8A 4YTUA 4MWAE 4XTIA 4EPBC 4V33A 3RGTA 1GOWA 4H3DA 2DW7A 1RQEA 2VDGA 2MANA 2QCDA 5EB8A 3DFTA 2BODX 4DUXA 4RXFA 3WH6A 5I79A 1BLIA 3A9IA 2F38A 1T6MA 1EUNA 2Q6ZA 1UD5A 3PFRA 1IEXA 4GQGA 3MWCA 2Z4GA 3O05A 5CPQA 5D32A 2Q8LA 3HMCA 3S3GA 5D02A 4UNKA 4EWJA 2VMFA 3M64A 5E0CA 1J10A 1S38A 4JL2A 4JFTA 4G2DA 1POJA 1O7AA 2EQDA 2WC3A 2PTDA 4PTVA 2BVDA 1A5MC 4OZOA 1W3KA 2W67A 4PCTA 3HQ1A 3ONBA 3RR1A 5A6KA 3RJXA 4A05A 4A22A 3GC4A 1H3GA 4UTFA 1XYFA 3U4AA 3GDMA 3PTDA 1RK6A 4RX0A 3UWYA 4RZ5A 3UWQA 2Y5EA 4W89A 3ZT7A 4YTTA 1FWNA 4BF9A 3TA6A 1DWGM 1EX5A 4UQDA 3TW7A 3W0KA 4N6EA 1BGAA 2HNEA 2WJFA 4HCHA 3ZR6A 4YU1A 3DN5A 4K68A 4EPKA 1RY8A 3RHGA 5A94A 3WD2A 1Q13A 3W6LA 2JGQA 4Q8VA 5G5IA 2QULA 3WIJA 4QEEA 4O11A 3VCNA 1HL8A 1TV7A 1GZ1A 3MSYA 5E6ZA 2D1ZA 5KEZA 1ICSA 1H5VA 1VEMA 3ARYA 4NRSA 2CCRA 4JGDA 5C2XA 3CL7A 1P0NA 5BU6A 1MDLA 1QBBA 4ZO8A 4NI8A 3C3UA 2ZDSA 3N6HA 2XSXA 5DF0A 2E3ZA 5HNNA 1RJRA 4DF2A 3S5SA 4AF0B 3W7IA 4BKNA 4DPPA 3DHDA 5A8MA 1F07A 4PSPA 3OGSA 3G2GA 4F0LA 1QWGA 2AAAA 2E40A 4HK6A 3OZMA 1QW8A 1CYGA 1RAKA 4J5NA 1VBHA 1JAKA 3CAQA 3L68A 3E0LA 5D9PA 2V81A 1MRAA 1DIEA 2NW0A 3FA4A 1C90A 3BG3A 1N8FA 2DSUA 2PA6A 3KZPA 2J88A 4Y9OA 2WLZA 1W8GA 3DFYA 4U4MA 4HYRA 3KVKA 3QYQA 3SSJA 3WH8A 2CZEA 2OWXA 5EPDA 2WMJA 7TIMA 2VX4A 3L5LA 2R9RA 2PU0A 3TYAA 3R0UA 4M5PA 4GX9A 1O1ZA 3LPOA 4C7FA 3NUKA 4QNEA 1XH1A 3VGBA 4MLRA 5G4WA 3ARRA 1F8MA 4NAEA 5DCEA 4LGXA 1G4TA 2R14A 1WP6A 3RRXA 1I2RA 1IWPA 4L4OA 1M53A 3EYPA 2P5NA 4MWAD 4ES4A 3WLHA 3WNMA 4KS0A 5EBUA 5HINA 1U33A 1ODZA 2E9BA 5G1TA 2R1MA 4YN5A 4R7OA 1PS9A 2ACSA 4O4VA 3LHYA 2PCQA 4O19A 2R1KA 3RFAA 2OVLA 4FK9A 3STEA 2R1LA 5F4XA 1VFSA 4FOUA 1ML1A 1XLFA 1UIPA 4UTMA 2G41A 2F2HA 3U7VA 1GJWA 1KXQA 3VA8A 1I1XA 4GYPA 3NQ2A 1J01A 1LRQA 1L8NA 1OZMA 2XM2A 2ZUNA 3R0KA 4P8UA 3GS6A 1M7XA 4OOZA 2BTMA 3PAJA 2ISSA 4B16A 5IDZA 4DPQA 3TA9A 2HWGA 3GXTA 1W17A 1RPKA 3NA8A 4IMFA 3APYA 3FKKA 1VQTA 3AIWA 4IPLA 1S46A 4GX8A 5I3DA 3PWAA 4N7QA 1NDYA 3P0WA 3WQPA 3W7DA 3EDJA 3ARQA 2BVWA 4GIYA 2Z1SA 2IKHA 2E09A 2DUXA 1EPVA 2WVVA 4HYWA 2GK1A 3AZRA 4GXPA 3DZ1A 4L61A 1S5VA 4JEJA 3QGAC 3L2LA 3EWXA 3BW3A 4MUZA 4B5NA 5E9XA 1RJPA 1LG2A 2EF9A 3WUBA 3M07A 2OGJA 3W07A 4JZ5A 1BQCA 5EYWA 3CHFA 1V0NA 3GFZA 3W73A 5TF0A 3BLFA 3QPYA 5E1QA 5I3FA 3A5VA 3BLPX 2GQ3A 4S1FA 1F3TA 3CAWA 1OJXA 2QPXA 3N2MA 4NZJA 5BZAA 1H4PA 3V75A 1MXDA 5FF4A 2QV5A 3MU7A 3NPUA 1V3IA 3QLLA 1W5OA 4UIOA 3TSMA 1UD4A 3OU8A 3T4CA 2VFEA 3SFWA 1HVXA 3GAKA 5FF2A 4GZ7A 1E72M 4V1YA 5FJOA 3PG8A 3SY8A 2A0NA 3M4HA 1IE7C 5M17A 4ONVA 3FA5A 1DL3A 4Q6XA 3NQCA 1B54A 1ICPA 3UT0A 3GR4A 3ICJA 4JN6A 3BICA 4A3UA 2I56A 2QF8A 2C71A 4Z1BA 1SMAA 2PWDA 3VD9A 5JBFA 4PTMA 4AFYA 4HNLA 5MKGA 3WD0A 2XVGA 2V82A 3L12A 5BXSA 4ZQRA 3RMJA 1R6WA 1UPPA 4OOUA 4D8LA 1OK6A 3KBNA 3FJ4A 4HHPA 3L0KA 2J47A 4NYYA 3K1GA 3WK0A 3Q94A 2W92A 2HQAA 1LQ2A 2VTFA 3G0XA 5DT5A 4FI4A 2J6XA 4EPEC 3TDFA 4ADTA 4CNNA 1UJPA 1F76A 4L7ZA 3BGJA 3DECA 1IZKA 1K77A 2IS7A 3PSWA 2PDUA 1J11A 4CD6A 4WLCA 4O50A 3T8QA 4AU0A 3IGHX 3WJXA 1GW1A 1O1HA 3BO9A 4WY0F 4JN8A 3VOCA 4GI9A 1EEPA 4KESA 1ENUA 4HU0A 2UV8G 2H6RA 4LS2A 3BE7A 4QIUA 4XK2A 5HANA 3TV8A 3AROA 4S3JA 1GVYA 5HAOA 1FOBA 2OLHA 3NCOA 1K7EA 2Y61A 3WLNA 2VGIA 3KWXA 1BHGA 3M16A 4PN2A 3QSTA 2QJMA 3LMZA 4FO4A 2H8XA 4JKMA 4K39A 4P61A 1TUFA 1VPXA 5D2VA 3K8MA 3EPOA 1BPLB 2X1SA 3RIKA 4U10A 3IUIA 3CHDA 2ZVRA 4ZE4A 2OTDA 4O57A 4GJJA 2Q09A 4YS1A 3PG9A 5EGRA 7A3HA 3K8LA 4RDYA 1PWLA 4CU8A 3P80A 4HPNA 6CGTA 1YNPA 3W6MA 2VOTA 1O5XA 3OVGA 4C6OA 2NLIA 1XSJA 2ZKMX 4LAZA 5LXEA 4C1NB 1PKMA 3G1SA 2J7EA 4Q4MA 3QV6A 1WDPA 4R9XA 4PMRA 1UZ4A 3RCYA 3RM4A 2QDHA 1LM1A 4Q8NA 1WZLA 1GQJA 5E9AA 4AIBA 2WVSA 3M0IA 5CAKA 5I02A 3UA4A 4UZSA 1HUVA 1ZTVA 3E49A 4IMEA 1V6XA 2YL8A 3PZ9A 4JIHA 3HOJA 1XCFA 1VGAA 1SMDA 2VYOA 3K4DA 1SO3A 5CJMA 1X98A 3QBUA 4FF5A 4FIRA 1G5AA 1LWJA 2VGBA 5DEZA 1LLZA 2XGIA 4LC8A 2VCCA 3R89A 2PLCA 1R3VA 1SZRA 1HO1A 4DZIA 4JTSA 4AZCA 4YTQA 3KLLA 1RV8A 2W0UA 4B2DA 3UPMA 4PUKA 4C6PA 2NQZA 3E2RA 2P8CA 3FK4A 4QCFA 4IMDA 4CD4A 1UHVA 5LNSA 2OZTA 3UJ2A 4B3LA 1VIZA 1GG1A 1V03A 4GVHA 1SPQA 4S39A 3FY1A 4GACA 1IIHA 3GDLA 1EIXA 4CCEA 3GDBA 4AAJA 2Y62A 4YVPA 1ITCA 3W81A 2GL5A 4QTGA 1I45A 4LYKA 3UW6A 3OP2A 5TAOA 3T40A 3UF9A 4B5WA 1DORA 3UCCA 4DZHA 1W3TA 2J8FA 4FNPA 3SUVA 2HJPA 3SN1A 4DJEA 4X0NA 3KWSA 3MUXA 3WENA 4AQLA 2PMQA 4QCEA 4WDTA 2VFFA 3JU2A 3NDZA 4GWEA 1EWDA 2V3DA 3CUIA 2O0TA 4BQ4A 4HMNA 1VJIA 3MCOA 3H4WA 3VKCA 1QNSA 2XFFA 4WHBA 2XH4A 1AJZA 2NT1A 4DWSA 2JGYA 5DBUA 2OSXA 2ZA3A 1QW9A 1TZ9A 3G6LA 3AOFA 1N2VA 2YXGA 2C79A 4R9OA 3H55A 3LGDA 3LBCA 1C7TA 5AVNA 5D9MA 1X7IA 3WEZA 1F6KA 4BQ5A 2OQYA 2YFNA 5F1UA 3GU2A 3GW3A 4PBFA 3LENA 1ZP4A 5IDIA 2FHBA 3A12A 1VIWA 2V8ZA 4DO7A 1XLMA 3CT7A 5IHRA 2V30A 4JTRA 1OD8A 4Q8OA 3NZ1A 3ZLGA 1S1PA 3NTYA 5CCZA 1XIIA 3UWWA 4LCSA 3KOFA 3MT1A 1D9EA 3ABRA 4E4FA 3KHDA 2C19A 4I8YA 3W2JA 3RXZA 3SDOA 4JNYA 1JULA 3L4UA 4RW3A 4S3DA 5HQMA 4X9SA 4Q7NA 1I0BA 4F40A 1WKYA 4MPQA 1KCKA 3CLWA