3KXQA

Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
237
Chain Sequence
b'IRPFIAGNWKMNGTGESLGELRAIAAGISRLFEALICVPATLLSRAFDILGGENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWTSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKAIDFLTICDVYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6A resolution
rcsb
source organism Bartonella henselae
molecule tags Isomerase
total genus 86
structure length 237
sequence length 249
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kxqA00
4N4PA 5BNKA 3CWNA 4X2RA 3WK2A 1LRQA 1SU5A 1H7PA 2ZTKA 2QCCA 3LV5A 1R2SA 4IX0A 4I7VA 5K4XA 1QAPA 1TREA 4GXMA 4U28A 5HR7A 2KZHA 4UFMA 3W9ZA 1ZAJA 3L21A 3EWYA 3E96A 2NXIA 1A50A 4N2YA 3DI1A 3AO0A 3BARA 3NR0A 5U4NA 1XDLA 1W56A 4IX2A 4RZ4A 5LNSA 3GYEA 4WXZA 4NNAA 3S5OA 1JUBA 1JUKA 2DU2A 3BW2A 5HWMA 3NQCA 3KRUA 1K8YA 5SWUA 1C9DA 4XUGA 2QDHA 2Q8ZA 5EA9A 1R2TA 1H62A 2V81A 5CSSA 4O19A 2VEIA 4DO5A 1H50A 1K02A 2YW4A 3BV4A 4MPQA 1RQEA 3LCXA 3O6YX 4M5PA 4AWUA 2B7PA 4FX8A 2GJLA 3KXQA 2CLMA 2CWNA 3PBUA 4DBEA 4JICA 4BK9A 3BG9A 3OVRA 1TPUA 4RZ5A 4IQLA 5IM51 4RK8A 1M7OA 1GOXA 3NNTA 2YW3A 1W31A 3WK3A 3M16A 1KFLA 2HMCA 4WZHA 3KFTA 4GUHA 5AOUA 3M0ZA 2XN1A 3GAKA 1MEIA 4LS2A 2H8ZA 2EPHA 3GKFA 5D2TA 1X8FA 3MBDA 5L9FA 4MZ8A 5J5RA 3USBA 1WV2A 2NUXA 4G1KA 1TTIA 3FLUA 1ZFJA 1PE1A 3QJAA 3IIVA 1ZHAA 3IVUA 4OHQA 3TFCA 1NEYA 3NQGA 5I3KA 1JCMP 1KFJA 2JGYA 2ZYFA 3LCHA 1Q6OA 1PL9A 1JULA 3WJXA 1VCGA 3ZWSA 1SZFA 1HUVA 4GFSA 2C15A 3FEMA 1VS1A 3OVQA 3N73A 2OJPA 4M7SA 3FOKA 3W83A 1KA9F 2A7PA 3TAKA 4N6EA 4O1AA 3TW6A 5LHFA 5E93A 3HIJA 4EVZA 1Q6QA 2V2CA 3W7JA 3TNOA 4EIVA 1SZEA 4MJMA 3O1NA 2ZZ7A 2C13A 1TPEA 2FPYA 3W1MA 3G0UA 2ABAA 3GKAA 1AMKA 5LSMA 5G4EA 1HFBA 3LHTA 4UTHA 3TJLA 1FWWA 3SIZA 3G1YA 1Q45A 5AHLA 4ORMA 1KM0A 1CI1A 3EWXA 1JQXA 1W1ZA 3L65A 3QH2A 3G3DA 4LV4A 5G5IA 1FBAA 4RLIA 3M1ZA 3PC0A 1VLIA 2Z6JA 3UZ5A 3C8FA 5I3GA 2X30A 4QSHA 4FIRA 2R91A 1TV5A 4O8RA 4POCA 2Y70A 2ZRYA 1HO4A 4Q32A 5EL1A 4TMCA 3STFA 3Q2DA 1JQVA 1A5CA 1SW7A 3D0CA 2NLIA 1GYLA 4ZL1A 1OFDA 2QJHA 1DOSA 5CKSA 3RK8A 4FX6M 5H2ZA 2ZBTA 4JYFA 4MYAA 2B7OA 3EWUA 1F76A 2VEPA 2GQ9A 5EPDA 3FJLA 5HWJA 2J6XA 3ZFHA 4FNTA 7TIMA 2CLHA 3PBVA 5FEWA 2E5CA 1ONRA 3C61A 4ZQNA 3G0XA 4IMEA 5DCDA 3N34A 2E77A 3G1SA 2YGYA 4Y8FA 1S5VA 4RCXA 4XQ6A 3W7GA 5EMUA 1CX9A 3T44A 5K2ZA 4AVFA 2PE4A 1ML1A 4LTSA 5HQEA 1PHWA 3N14A 4JTJA 5KITA 2B0MA 2ZRVA 2CZDA 3LHVA 1SZGA 3SI9A 3TC7A 4EF8A 1OYAA 1QOQA 3LTYA 2XN0A 4DO4A 2OMAA 4K7YA 3SGZA 3A22A 3UD6A 4O28A 5AHIA 3VE9A 4LT9A 1KFCA 4O11A 4PEKA 3R8RA 4OE7A 3PVFA 1PHQA 1SFJA 3OHIA 1IXPA 2QUVA 1W5MA 3EEGA 1UBSA 4K8HA 2NWRA 2QJIA 3T55A 3P80A 4FHAA 4KFPA 3GNNA 2ZRZA 3NM3A 1LRNA 4WOQA 3TSBA 4N9BA 1G4PA 4IXHA 3QEZA 1QO2A 5DBTA 1XFBA 1WQ5A 2QAFA 4MY8A 3OEXA 2DZSA 2OCZA 1I2OA 2C6QA 3IV3A 5U7SA 1I2PA 4NXKA 1LRTA 5FF0A 4UR7A 5FF4A 2ZA3A 3S8HA 3HF3A 4WXYA 1LBLA 1B4KA 1TPH1 4NX5A 3TV8A 4XWUA 5C6MA 5D05A 2I1OA 5D04C 5CPOA 4WUIA 4NUWA 1OFBA 3NL6A 4O52A 3S5YA 1TIMA 4C1LA 4K39A 5LGZA 3W7QA 3T4CA 1D3GA 4MYXA 4AH7A 3LTPA 3DXIA 4IMCA 2OZ0A 2YXGA 1L6YA 4BWLA 3FA5A 4UTTA 4MY9A 1H7RA 5AYZA 5HUOA 3W7DA 1PV8A 3ZWTA 3QW4B 2TPSA 1MO0A 4M19A 2JKEA 1R2RA 2QKFA 2AQWA 3TROA 3TXZA 2CFFA 2AAMA 1PVNA 1X6UA 2HS6A 2RDUA 1I2NA 4BF9A 4C1KA 3QF0A 3B0VC 1VYRA 3GXTA 1I8JA 2Y85A 1L9WA 4P2VA 1KM4A 2QCHA 4IXXA 1N55A 2GQ8A 2ZFAA 1W8SA 3I68A 3QC3A 3M47A 3L68A 5BRBA 4YCPA 4CQAA 3P8IA 1LZOA 3FYOA 1ICQA 3OG3A 4UC5A 4FF7A 3DFQA 3G1XA 3P67A 3W74A 1EP3A 3BVJA 3LTSA 2ZZ1A 3DAQA 2FIQA 3F1QA 2NX1A 3C2VA 1YDNA 3HG4A 4IMDA 4DQWA 1EP2A 3LI1A 1ME7A 4O12A 4X22A 3S1WA 3Q94A 4YL2A 3L0NA 2WSYA 5HINA 1MZHA 3TUUA 3ABRA 1G7UA 1QPNA 2B7QA 1R47A 4M6QA 3P74A 1EIXA 4O13A 4DPQA 1VGAA 2VEKA 3PG9A 5IBXC 2X1UA 5D2YA 3T78A 3U6WA 4P61A 3NZ1A 4RV8A 5KINA 1XBZA 1JR1A 4UFHA 3NDOA 2QCGA 1OFEA 2ZRXA 3Q37A 1Z48A 3UWQA 3G3MA 3P84A 3HB9A 4CCCA 2Z1BA 1YDVA 4ICNA 3C6CA 3ZR4A 2VKZG 1DQWA 3LRKA 2QCEA 3HGOA 1XXXA 2Q3RA 3MHGA 4L4MA 4E0CA 5BW6A 3E0IA 4K8EA 2GQAA 2VENA 3A5VA 5FF3A 2QR6A 2ZZ6A 2J88A 2Y62A 3GDTA 3DU0A 4CCDA 1S5WA 1O4UA 1ZY9A 3B8DA 2WJZA 5HULA 5HR6A 4R33A 3C3NA 3YPIA 4S1FA 4UMAA 1SPQA 3ABOA 4FXSA 1XCFA 3STCA 1GEQA 1YXCA 1VYPX 4WQ6A 1YDOA 2C16A 5I3JA 3IVTA 3QM3A 1YTDA 3G24A 5BMWA 3DFOA 3W7PA 3NQ6A 2F7FA 3MO7A 4LS1A 4O4WA 3ABQA 1ALDA 1TMHA 4XZ9A 5KTLA 3O6CA 1TYGA 3L0KA 1EA0A 5LZLA 1XC4A 4OGZA 3B03A 5D2XA 2ATMA 3LHYA 1Z41A 1S5TA 3WFAA 8TIMA 4MIMA 1D9EA 5K7JA 4BI7A 3I65A 4KKXA 3DFNA 1RVGA 1A53A 2DJLA 2E6DA 3GDRA 4IUOA 2H3BA 1WOBA 2Y6ZA 1H1YA 4LUJA 1ZENA 3N2MA 5DCEA 3H54A 1GG0A 1C8VA 1I2QA 3PS7A 1OYBA 3NQ2A 3B0PA 3MUXA 1QFEA 5HJLA 4NJIA 3PB0A 1TQXA 1K8ZA 3V1PA 4H4IA 3VE7A 3G1FA 2X1RA 3IEBA 4GBUA 2E6AA 3UPBA 3PWAA 1SO4A 1A5SA 3A24A 3S6DA 1H7OA 1FDYA 1Y0EA 3W1NA 3JRKA 4RJEA 1UJPA 2PC4A 3KHJA 5D38A 3ZS4A 3M6YA 2WNNA 5BOOA 4NX0A 1TRDA 5DBUA 3W1LA 1TV8A 5DLCA 3TIMA 2ZCGA 1JVNA 3L0GA 4UTJA 1Q6RA 3I7RA 3PAJA 3N9RA 4LVBA 4LRTA 4JTEA 3O6DA 4B5NA 4K38A 2HSAA 3DZ1A 4IPJA 4BWLC 3QYQA 4S2CA 3S5ZA 4W9TA 1OG0A 3NZRA 4FNQA 1SUXA 4NJGA 4Z1BA 1W0MA 2BZNA 1J5TA 3LOTA 3CT7A 2JKPA 1OF8A 2E6FA 3HO8A 3W7IA 5AN7A 4K36A 3NAVA 5F2MA 3ANYA 4I9AA 3KRSA 2NV1A 3S1XA 5LNWA 3DFSA 1ICSA 1JRCA 3CIXA 2YFNA 2ZZ4A 4XKYB 2X2GA 4UR8A 3MYPA 2X1SA 3ATYA 3W1QA 2ATSA 3W7HA 5D09A 1XBXA 3KVKA 3MI2A 3QQ1A 4R53A 1O95A 3G18A 3VNDA 2YZRA 2RHGA 5LNVA 1GYNA 3G8RA 2J9ZA 4TU1A 5FEZA 1VHNA 2BXVA 3GAYA 5FF2A 1LBFA 1VR6A 3TH6A 1LDCA 2WSRA 1TTPA 1O5XA 3F03K 3M9YA 4O0KA 3NPWA 1VRDA 4O14A 1IXNA 4UTWA 4O50A 2C0AA 4ALDA 1RPXA 3VFLA 2PRLA 2WOQA 3EXSA 3C2OA 3W85A 4PA8A 3ABSA 4HPJA 1OX5A 3UY7A 3PG8A 1BTMA 1KLYA 2ZZ3A 4QAIA 4ZQPA 4A3UA 1T99A 1UASA 3W87A 1PIIA 2OX1A 4AHQA 3PUEA 4GRSA 4Y6GA 1DVJA 4PL1A 2ZQ0A 2VFDA 4YXGA 4CNNA 3OBKA 2Y7FA 1K7FA 3HG2A 1JCJA 5DN1A 3G8EA 3R12A 3FFSA 3TW7A 3QMSA 3MBFA 4ONVA 2W6RA 1L6SA 1SO3A 3BW4A 4JTLA 2CZ5A 3EB2A 5CPLA 2XFWA 3W1PA 1GVFA 3W84A 1GTEA 1WX0A 3U8GA 4HHPA 3FKKA 4NVTA 1EP1A 2R94A 2WKJA 1GZGA 4UFLA 4JTIA 4I7WA 3V75A 3S42A 1JCNA 1GVRA 4OQVA 2HTMA 2QCNA 1OYCA 2VEMA 3EX1A 1OFRA 3BLEA 3WJSA 5T26A 5LGXA 3LXAA 3M5XA 1KFKA 2IQTA 3UYCA 3S5NA 2DZUA 4JGDA 3LCWA 3W2JA 4JY9A 2DZVA 1Z44A 1C29A 4PH6A 4O57A 2WPBA 2CLIA 1XI3A 4MUZA 4RZ6A 1FWNA 1W5NA 3W7KA 3IRDA 1ZCOA 1K7XA 3TQVA 3GLCA 5E1QA 4DBDA 3WJYA 1YPIA 1GT8A 1YXYA 5AB3A 4RX0A 1A5BA 5F1VA 3BG5A 3NYZA 1ADOA 4JTFA 1NVMA 5D33A 1AW2A 1PCKA 1WXJA 5TQLA 2ISVA 3E12A 4HKPA 1X1OA 3W7MA 4FX7A 3C2FA 2A6NA 5KSWA 2GPTA 4CNOA 3PF3A 3TK7A 2CU0A 1P0NA 1T8XA 3GDLA 1X1ZA 3TSMA 3LM7A 3HBLA 3C56A 2LLEA 1XDMA 3EXRA 3IGXA 4NQ1A 1SR9A 4GNJA 1W54A 1W3IA 4LNYA 3IIZA 4KFNA 1HTIA 4JTUA 1AW5A 2PRMA 2VC6A 3EWBX 4HT3A 3TE9A 5K9XA 4BI6A 3C2RA 3A5FA 1OFQA 4UMBA 1P5BA 2TSYA 2FLIA 1FCBA 4UNLA 2G96A 4CQ8A 1NF7A 4AAJA 2H3DA 1L2UA 1TRIA 4QM1A 1K8XA 2FDSA 3H53A 3W73A 1KLZA 1LROA 3CEPA 4UTUA 3NM1A 4AHPA 4H3DA 1FXPA 4A21A 2C19A 3GR8A 2JBMA 2E6YA 1TPC1 2PCQA 4MOZA 4E38A 3OIXA 3P7YA 1TPB1 3NQDA 3P81A 3W7RA 5D2VA 2QDGA 3P5ZA 1KM6A 1PCWA 3P8JA 5F1UA 1ZNNA 2ZA1A 2V0TA 4JEQA 1JRBA 2QJGA 4FNRA 5FESA 4PTNA 5C2XA 3SSJA 4PFMA 3L67A 1NFBA 5D32A 2GVGA 3M5ZA 5CZJA 2CLKA 3MJYA 4A2SA 3QPYA 4UTKA 6ALDA 2OT1A 3NQMA 3NQFA 3EXTA 1LOQA 2XN2A 3JS3A 4OWGA 3W2KA 3W7NA 3W2LA 3TX9A 2VFGA 2V5LA 1VYSX 3DBPA 3N19B 3PBYA 5F2GA 4OBTA 3EWZA 3R89A 4PL2A 5CPNA 2NWSA 3SZ8A 2V82A 3M5VA 3W23A 3MI6A 3LLDA 3MMTA 4YLWA 1H1ZA 4M6VA 3UZJA 3E9AA 4UTWC 3PUDA 4H6KA 2CLFA 5G2WA 2DZWA 3LI0A 3C4UA 4UUIA 1GVQA 1H5YA 1SFLA 4PODA 2V2HA 4UFJA 1KM1A 3C2EA 3EX4A 3PSWA 3TAOA 1FWRA 2O7QA 3RU6A 3W2NA 1LTDA 4LVGA 4CNPA 4LC8A 3O05A 1RZMA 1DQXA 1XKYA 4K37A 5AHMA 3S1UA 1AW1A 3LXCA 4XKYA 5C55A 2RFGA 2RH9A 4JDBA 4GE8A 2J24A 2A4AA 1RQHA 4XTIA 3EX3A 3G1AA 4J9JA 5G2IA 4HNVA 4NJKA 1QOPA 4EWND 2X16A 2G5WA 1Z42A 1LYXA 4LRSA 2BTMA 2I9EA 3R13A 2A21A 3NO5A 1LLZA 4R7JA 1QPRA 3W2MA 1DJQA 3H55A 3UPWA 2QUUA 1O94A 1H7XA 3LCGA 3O06A 5HWNA 5DELA 2P0OA 1AG1O 4GUGA 3W22A 1LM1A 4HNNA 4NT0A 4LU0A 3NQ8A 4CLMA 1P1XA 3CIWA 1U5JA 3O07A 3M7WA 3EKZA 1N7KA 3OA3A 2P1FA 1AL8A 5A8GA 3VI2A 3RFAA 4NZFA 4MFEA 3UXDA 1P0KA 5CPMA 3M41A 1RQBA 4TX9A 3PBWA 1IXOA 3M43A 2V2DA 1SZNA 3B04A 1M5WA 1KFEA 3LGEA 3CU2A 1TTJA 3LHUA 1EPXA 1YXDA 1B4EA 2FPTA 2NZLA 3W2UA 4WY0F 1TO3A 5F4WA 3MP3A 1MSSA 2J27A 3NL3A 1IF2A 4JYDA 1FWTA 3IGUA 2QAPA 4BI5A 5I3HA 1B3OA 4HSNA 4JTSA 3B06A 4NJHA 4IOTA 1D3HA 5H91A 3W72A 1H7NA 2A85A 1TB3A 2Y7EA 5EKYA 4Z0SA 2J9YA 1VCFA 1Q3NA 3HGJA 3TSDA 3STEA 3QQ0A 1W5OA 3W70A 3GX9A 3M44A 4Y96A 5G4WA 4NZJA 5AHEA 4WX2A 1F2JA 1I2RA 1GG1A 4ZQRA 1TV7A 4Z1AA 3CQ0A 3G1DA 3FJ6A 5AHNA 1WA3A 3HPSA 3UXAA 4NNBA 3CTLA 1IIHA 1SO5A 3S1VA 3L66A 2GVJA 2VELA 4JS3A 3BW3A 1EWEA 1LOSA 1KW1A 3E49A 1R30A 1TJPA 4TR9A 4ML9A 3UWYA 4TIMA 1S3HA 3DENA 5HNRA 4RR4A 3MWAA 4MZ1A 5AHFA 2G97A 3S0CA 4X3ZA 1QR7A 4IMGA 1VH7A 1DV7A 3HGSA 3L9CA 2UV8G 5F4SA 2V5BA 4O1BA 3LRMA 4TMBA 3G1VA 2EAWA 1YYAA 1TPDA 3F4WA 3TQKA 2PURA 1OFPA 4ZZ9A 4MLJA 2A7RA 4MZYA 1OVDA 1EEPA 3SW6A 1K7EA 1G4SA 3DHFA 1I45A 1NSJA 2WV8A 3P5YA 4PC8A 1SW0A 1WBHA 1OK6A 4AHOA 3W7EA 5MHBA 1YTEA 3G22A 4O4VA 4LC6A 3IIOA 2E68A 1G4EA 1VC4A 2CZEA 2TRSA 5AC6A 5D37A 3HPXA 4X9SA 1UB3A 2A7NA 1H51A 4NXSA 3NL5A 2ZDRA 5J5DA 2YCEA 1ZAIA 4WOZA 3O16A 3G1HA 3WK1A 3PY2A 1TPFA 4NJJA 1MEHA 3NG3A 4A2RA 3UWZA 1NAL1 2EKCA 1OFOA 4JX5A 1KV5A 3P62A 2BLEA 1W37A 4UTLA 4O1CA 4LWWA 2Y7GA 5K3VA 1T0OA 5G1TA 2ZZ2A 3GK0A 1IIGA 4U4MA 1BWLA 2C18A 4ADSA 4FO4A 2DZPA 2QUTA 2R14A 2WO5A 2H6RA 2GJNA 4UTTC 3TU9A 1B57A 1BKSA 4QNWA 2BX7A 4JIQA 2Y88A 1VLWA 1TQJA 3NVTA 4GUIA 4UIOA 2A1YA 5AYYA 3NPXA 4NNCA 3LXBA 2FPVA 2VOMA 4JY8A 4AF0B 3LX9A 3GDMA 3C52A 3BGGA 3SECA 3GIYA 2Q8LA 3NGJA 4MVAA 1OFAA 3QSTA 2QCDB 2YPIA 2VFHA 4Z1DA 1DHPA 1GJPA 5F4XA 4XTDA 1K3UA 5K9CA 4BR1A 3CEUA 4FNUA 1QO5A 4MLRA 1OX6A 3HPZA 2WSQA 1OJXA 2E1DA 2ISSA 1R46A 3HG5A 1FX6A 4JNMA 2ABBA 4HN4A 1WBJA 1FCQA 1VJIA 3LCLA 2HS8A 3A9IA 4JTHA 1G69A 4ORIA 1AK5A 6TIMA 1YTKA 5K9DA 1FCVA 5F2LA 4YMZA 3THAA 4HSOA 1UUOA 4GUFA 1KTCA 3A21A 4ZVJA 2YFOA 5A5WA 1P4CA 1KTNA 2TMDA 4KWVA 3TR2A 1TTQA 1W3NA 3VCRA 1KTBA 1ZALA 4XBKA 1QCWA 2VFFA 3W1TA 4O1DA 3K30A 1QDSA 5FI8A 3WK0A 3JR2A 3FKRA 3BLFA 4QISA 2YX0A 2CW6A 5I3FA 4KFOA 3W1RA 2FFCA 4K6AA 3HMJG 4MY1A 3DHDA 1FUYA 3STGA 3KAOA 4N9CA 1GPWA 4AB4A 3LCFA 4DELA 2NX3A 4UCGA 1YLVA 2QF7A 1YADA 5D2WA 3WJZA 1UCWA 3P61A 4DXVA 4Y9AA 2ZRUA 3RF9A 1G7VA 4LS0A 3O8AA 4JDYA 1G6CA 4O10A 5AC7A 3B05A 3HGRA 3W3OA 1K03A 4AWSA 1F74A 1RD5A 3BG3A 3LLFA 1QPOA 3MYOA 4ADTA 1ZAHA 2NXHA 3NPVA 3BK0A 4GWEA 2J9XA 2CLOA 1TCDA 3W1XA 4FIQA 3NPUA 4JXCA 1EUNA 4UFKA 4OU1A 2V30A 4JTKA 1PS9A 4LVAA 1FWSA 2B4GA 4MKNA 1VZWA 4ZQCA 3UWUA 2VFIA 1VPXA 4WJEA 1MXSA 1T96A 3KRZA 1LORA 4YCOA 2Y61A 5CG7A 3TFXA 3W1AA 2V8ZA 1QPQA 2C3ZA 3TQ0A 2WNZA 4HNUA 3CWOX 4RKAA 5L6UA 3NQVA 5C54A 2FB3A 3PSVA 4N6FA 1SSDA 4A29A 1VHCA 4E2BA 1HO1A 2TYSA 1J2WA 3AJXA 4DPPA 1HL2A 3DKLA 4LY8A 3U2OA 3IIXA 3IIPA 4O53A 2CLEA 2E5DA 4NU7A 3R5EA 1GVSA 3GB6A 3MHFA 2Z2UA 2JGQA 3CB8A 2FJKA 1DORA 1KM3A 3SGUA 3BGJA 1WOAA 1U83A 3PM6A 1FDJA 5IBXA 4MFDA 1ICPA 1UUMA 1N8FA 4FNSA 4AWTA 4XBSA 1LOLA 3BO9A 2R8WA 4PCFA 3W1UA 3HQ1A 3RMJA 4JIPA 3FIGA 3GNDA 2C1HA 4EOUA 3DFTA 1A5AA 4IWWA 5TIMA 3RLUA 4LW7A 2I14A 1DBTA 1FDZA 1M6JA 2WNQA 3INPA 3TXVA 5AFDA 2P10A 5G2HA 1AL7A 3KVJA 1W3TA 3W07A 2X1TA 3O63A 1EX5A 4KWWA 5LKYA 5EBUA 1ME9A 5AYXA 2RKXA 5GVJA 3BPWA 3HJZA 2W0UA 3T40A 4QNEA 4IJBA 3UWWA 3NEVA 2C14A 3NQ7A 4K7VA 5CGQA 1LP6A 3F4NA 4UNKA 2Z6IA 4OT7A 1SQ7A 4GC4A 3G0SA 3SY5A 3CPRA 1MEWA 4QIUA 5F2IA 5HUPA 1H60A 1EB3A 2O7SA 3CHVA 1FQ0A 5DY2A 1XBYA 2BSLA 2FB2A 3LBCA 4AXKA 1H63A 4E2DA 3L5AA 5DXXA 2GVLA 3W6YA 4HIBA 2PRHA 3W71A 3VKJA 4UTIA 1GVOA 1W5PA 4WY0B 2YYTA 4AEOA 5K4ZA 1B9BA 5KZDA 1JCYA 1JCLA 5FF7A 4UFIA 1M7PA 1XBVA 1G4TA 3M5YA 4OV9A 2GOUA 3RNDA 1OHLA 1OX4A 5D03A 3EWWA 3L2IA 4GJ1A 3KOFA 1H61A 3W7CA 3NA8A 2VXNA 1V7YA 4LVDA 3DH7A 3PULA 2YDAA 4Z0JA 3R2GA 3DFPA 4DF1A 1RR2A 1G67A 4RXGA 3W76A 2NX9A 2NUWA 4OV4A 1XL9A 4A22A 4LV9A 3W7LA 3THQA 5D30A 2NUYA 3QMTA 3PR2A 2E09A 1GQNA 4BFAA 4Z1CA 4AF0A 4QJ1A 4JR5A 2EGZA 3QRHA 1TJRA 1JJKA 5AC8A 3TKFA 2QCDA 3NL2A 1BWKA 3LCIA 3GDKA 3DKJA 1QWGA 2H8XA 3EX6A 2QCLA 3L5MA 1X7FA 3KVLA 4YWIA 3TC6A 1JUEA 1KFBA 1LLWA 3SR7A 2NV2A 1TSIA 5EY5A 3W7OA 4IMFA 1XUUA 2FQIA 2A2IA 1Q6LA 5DCBA 4Z08A 1DL3A 3I7SA 1SO6A 3NOEA 3EKLA 4M6PA 4JX6A 3LHWA 4JD4A 3N3MA 1EWDA 3DGRA 3SJ3A 1V5XA 4FB7A 3QPZA 3E02A 5E0KA 1SSGA 4FXRA 3LV6A 1OABA 1SW3A 4ZQOA 2F84A 3PUOA 3I7QA 2JK2A 2Y89A 5DXYA 3FYPA 2A5HA 1QNVA 4ZQMA 2RDTA 3NQAA 1F6PA 4DEFA 3GVGA 3TA6A 3LDVA 5TBOA 4R34A 2Y7DA 3C0JA 4O15A 3HOJA 2A0NA 4JN6A 3UQNA 3B0UX 4TO8A 3O15A 2D73A 3QSRA 1KV8A 3MHUA 4O0ZA 4LVFA 3TJXA 2CZFA 2E5BA 3MI3A 2AGKA 2Y63A 5CZ0A 1FY6A 4O16A 3BLIA 2CLLA 5KMYA 1LCOA 4MJZA 1VCVA 3TDFA 4AMAA 5LHEA 4L4LA 4JTGA 4ADUA 3FS2A 4JYEA 3ELFA 4Y90A 3OVPA 5ABTA 1I4NA 3QW3A 4O18A 4HNTA 1ME8A 3CM4A 1ZJIA 2ZRWA 1XUZA 5FEXA 4UXDA 3CLMA 2ISWA 3CC1A 2DORA 1O5KA 4Q33A 3W88A 4IPIA 1J4EA 3TMLA 2ALDA 5FEPA 4WD0A 4N02A 1WYIA 2YSWA 1DJNA 2ZTJA 3P82A 5DY3A 3W75A 2ZA2A 3LERA 3N2XA 3LHZA 4ZMGA 3QMRA 4O54A 1BEUA 3MP5A 4EF9A 2QCFA 3GZ3A 4LOCA 4HPXA 3MW7A 4QQ3A 5D02A 1IGSA 1KM5A 2FTPA 3IVSA 5LNRA 1IXQA 4O17A 2DZXA 2VFEA 5BMXA 4IGHA 4I7UA 3EX2A 4QITA 5G1YA 2A6LA 2WQPA 3GXNA 1E51A 5C5YA 3ATZA 3KX6A 4M7TA 5EYWA 3QFEA 4DO6A 3PB2A 3LB0A 2EHHA 1EUAA 1QMLA 2V9DA 1O60A 5CZTA 3UY8A 1THFD 1GTHA 4CQ9A 1CW2A 1XM3A 5KZMA 3TMQA 3HG3A 1F05A 2W79A 1NF0A 1RV8A 1TPWA 2RDWA 2DP3A 1OK4A 4FNPA 3KVMA 1JCXA 3NQEA 3UNDA 3I6RA 5CZSA 3W86A 4UMCA 3N9SA 4JTTA 3B4UA 2B7NA 4JX4A 4FEZA 2EF9A 2Q3OA 2H90A 3WJWA 1FCUA 3TCEA 1FXQA 4DF0A 2BWGA 4N9DA 1WAUA 3RLVA 3QZEA 4S2BA 3A23A 3S9YA 3UWVA 2QCMA 1KBIA 1F6KA 2Z0IA 4N4QA 1OX4B 1KM2A 5I3IA 1L6WA 2YR1A 1F73A 2G95A 5HMSA 1DKWA 1OF6A 1F5ZA 1LBMA 2GUUA 3IGSA 3L5LA 1GWJA 3SFKA 1VQTA 5LNUA 4RXFA 5CSRA 3MP4A 4DF2A 3LRLA 1YPFA 1WDWA 1F7BA 1H7WA 3DI0A 2QEZA 3NXFA 4WY0A 4CCEA 3GR7A 1TPVA 4UTMA 3P60A 1W5QA 2DZTA 2ZZ5A 4D2JA 5KZEA 2DJXA 1KBJA 4Q4KA 4GUJA 2YYUA 2OT0A 2JKAA 4N9EA 2NXGA 1HG3A 3GXPA 3Q58A 3LBMA 4LUIA 3T7VA
chains in the Genus database with same CATH superfamily
4N4PA 4CKQA 5BNKA 3CT2A 2INFA 4GIEA 2QCCA 3S46A 2FHBA 4IX0A 2VZSA 3RM9A 4U28A 2KZHA 3W9ZA 1ZAJA 3APYA 1TWIA 1E1FA 1JAEA 5HXMA 5D9PA 3BARA 3NR0A 1XDLA 2CXGA 3R8GA 3VGFA 4RZ4A 3WDHA 3PNUA 4WXZA 4IG2B 1JUKA 2DU2A 3GSMA 3NQCA 4Q8TA 5SWUA 1C9DA 2QDHA 3CHFA 4KEMA 1CT5A 3VXGA 4GY7A 4ZOBA 1ZSXA 1RQEA 1R3SA 3WBWA 3AS1A 4YPJA 4Y9MA 1XLEA 3QZAA 2CLMA 3RPMA 1B0IA 1HL8A 2OO0A 3M0VA 4F0SA 4ZE4A 3BG9A 3OVRA 1TPUA 4GIYA 4Q8QA 3QY8A 4DBSA 1M7OA 4AYGA 3UZZA 3F4VA 3UJEA 3W25A 1JYXA 4GZ7A 3M16A 2HMCA 4HBKA 4NAFB 4WZHA 5CEWA 3W37A 2DVTA 5AOUA 1MEIA 3BZJA 1XHGA 2EPHA 3GKFA 1V0LA 5L9FA 4MZ8A 4J40A 3DG6A 2Y5SA 1WV2A 4O1EA 1Q8JA 3BDKA 2WANA 3FLUA 1QNRA 1E0XA 3DYOA 3IIVA 1UH3A 3WQ4A 3VOGA 2ZYFA 1Q6OA 1PL9A 4ML4A 1HVXA 7REQB 1LG1A 2HZGA 4GFSA 3BCDA 1VS1A 4DJDD 2I56A 4XVDA 1HJVA 1XIDA 2A7PA 4HHLA 3W02A 2PEVA 4GD0A 5E93A 4MWAD 4K2SA 1T6MA 4I3GA 3TNOA 1O68A 4XG1A 3SUWA 1DWAM 3I10A 3BUVA 3KDOA 4M8UA 2FVMA 1MFUA 3WEZA 3ZVHB 2FPYA 2ABAA 2VEGA 1UUQA 3BQ6A 3BAIA 4RUBA 2OLSA 4HZ7A 2BY2A 3FGCA 3TJLA 1FWWA 4TXEA 3B3DA 1Z8AA 1Q45A 4R3UA 1CI1A 3EWXA 4WEVX 3T1GA 3F2BA 3QH2A 3VVGA 3G3DA 5G5IA 4RLIA 2VTFA 4EPKA 4UQDA 3PC0A 2Z6JA 3OYXA 1TV3A 3UZ5A 5IHRA 4PCNA 4FZIA 1MQRA 4AZ7A 4GQBA 1TV5A 4O8RA 3PTMA 4Q32A 2HQAA 3HM7A 3OGVA 4O0QA 1A5CA 3D0CA 1V51A 1OFDA 1XLMA 1HJSA 1RBAA 1GEHA 1HP5A 4V27A 1NWSA 2XVPA 3RK8A 5H2ZA 4DYEA 3CYVA 1J0JA 2B31A 2WKLA 2GQ9A 3BOLA 3S5SA 2EKGA 2C1GA 2W92A 3ZFHA 3QHOA 1M03A 2E5CA 1UC5A 2V69A 4IMEA 2VP8A 4Y8FA 3VUSA 4DHGA 4WDWA 2R24A 5EMUA 2PE4A 4LTSA 5HQEA 1BGAA 1KB3A 4JTJA 1B30A 3ECQA 2ZRVA 4PMDA 2CZDA 4QG6A 2WHMA 1SZGA 3TC7A 4EF8A 5CSYA 3LTYA 1V6TA 1V77A 5EMJA 3IACA 3VE9A 1KFCA 1PKNA 3R8RA 2O9OA 3OJGA 3TTEA 1W5MA 3EEGA 4HQVA 4K8HA 3DBNA 2QJIA 4KS0A 4FHAA 2ZE0A 2ZRZA 3NM3A 4N9BA 1G4PA 2XH7A 1QO2A 4TVDA 5DBTA 3KTXA 1WQ5A 1UOZA 2QAFA 1K77A 3II1A 1DTNA 3OEXA 2IUZA 1XS2A 4NXKA 1LRTA 1JZ3A 2ZA3A 1XJBA 5TAOA 3HF3A 4BKNA 1J01A 1QHPA 2J78A 4NX5A 1AQ0A 5D05A 3BH4A 5D04C 2ZC8A 3WF3A 4AIEA 4U5IA 4YVVA 2HVMA 4DNMA 5HBFA 2OX4A 3BLDA 4FXJA 4G7EB 3DXIA 2PI6A 6A3HA 2OZ0A 2NQZA 1L6YA 1O66A 3GG1A 3NGFA 3FA5A 4UTTA 3QLDA 4FOUA 5JH2A 4M19A 3AHVA 3TXZA 4AG0A 1S3TC 4BF9A 5EBAA 5ABEA 3QF0A 3B0VC 3UJ2A 1I8JA 7TAAA 2Y85A 1HJXA 4XK2A 1ZTVA 3Q4DA 1L9WA 4U3AA 2QCHA 2V67A 1N55A 2GQ8A 2ZFAA 1BQGA 1E3XA 3MU7A 3L68A 5CXPA 1PWLA 3AXXA 1XH2A 4K1GA 1NWTA 1J12A 3WLJA 3G1XA 3ITYA 3GS6A 3N15A 1E5JA 1EP3A 4BF5A 3H2EA 1YDNA 3LI1A 3OZMA 1QHZA 3ABRA 2YDSA 1R47A 3P74A 4DPQA 4KT2A 4X2PA 4AZ5A 4JFTA 3PG9A 5D2YA 3T2QA 4P61A 4ERGA 4D6FA 3WH5A 1XYZA 2E9BA 3F5LA 3UWQA 1R3WA 1RP8A 1T7LA 1LJYA 3KOWA 3SCQA 5M1TA 1Q7MA 2P8CA 3LRKA 4JTQA 5BW6A 3HZ3A 5BXSA 4OOZA 1H11A 1BVZA 4Z2GA 3DX5A 1V3IA 4BS0A 1K70A 2ZZ6A 1V6WA 4PN2A 1O4UA 2Y2WA 4Q6XA 2BS9A 5HR6A 2QVNA 3DFHA 1XPGA 2WK2A 2NVAA 3ABOA 3ZT5A 1GW1A 3MS8A 1CXEA 2BGQA 4F0MA 2O92A 1GEQA 1VFLA 5ECVA 1YXCA 3WKZA 1XIFA 3G24A 3EB4A 1V02E 1V3MA 4XSLA 3DFOA 5GQBA 3PZIA 3RO8A 2OWWA 1M04A 2C1IA 4ROPA 3MO7A 1TMHA 4IZGA 5KTLA 2PWDA 3O6CA 4LB3A 3L0KA 3WZ0E 2ATMA 3LHYA 2UY4A 4QE4A 8TIMA 2HEJA 2WLYA 3TQPA 4IUOA 3SO7A 5JBDA 4LUJA 1W2PA 1WPCA 1ZENA 1X1NA 1G9HA 3EB3A 5DCEA 3H54A 1GG0A 4J3TA 3WMLA 5CBBA 1B5TA 3MMWA 5HJLA 3PB0A 4DIAA 1TQXA 4HSHA 4FP1A 3VE7A 2XIIA 4GBUA 4Z2KA 4W8LA 1BWVA 3QOKA 2J4GA 3A24A 1NJJA 4P8XA 1KRBC 3S6DA 1E71M 1FDYA 2P3EA 1H3GA 3W1NA 4ZE5A 4UTFA 3ITOA 4RJEA 4XO6A 3RCNA 4LXFA 4NILA 1UPMB 5CCZA 3ZS4A 2VC5A 2WNNA 5HOSA 4HJWA 3V7PA 4GFIA 4F2BA 4WIWA 1V3HA 2WHLA 1OGSA 3UG4A 3UT0A 3TC3A 2PDNA 2HSAA 3ARVA 1BQCA 2IPJA 1HKWA 4RPQA 1VBRA 1E1EA 4NRRA 3WQWA 5BRPA 1H2JA 5DMMA 4Z1BA 1WZLA 2E8ZA 1Q2RA 3C8NA 3N13A 5AN7A 3CV7A 3NAVA 4HK7A 4I9AA 3KRSA 3S1XA 3G77A 3GNRA 4RZBA 1LUCA 3GBDA 3W7HA 2PBGA 3G18A 2PMQA 3N6QA 3B9OA 1GYNA 2J9ZA 2OZ3A 1LBFA 4R9XA 3QTPA 1EJUC 3ZJ7A 2GGGA 1TTPA 1MI3A 1R7AA 1VRDA 4O14A 4ALDA 4PB3A 4GABA 4DM1A 1Y8BA 4QAIA 1D8CA 1GKPA 2Y0FA 4F9DA 1V0KA 4ZQPA 4H9VA 1U5HA 1DQUA 1PIIA 2CBVA 1HGYA 1MNSA 4Y6GA 4PL1A 2ZQ0A 3WN6A 5D9MA 2PDIA 1AD4A 1K7FA 1JCJA 3IANA 3LY0A 2FVKA 3R12A 1FH8A 3TW7A 3QMSA 4ONVA 4ATLA 3BW4A 3BAJA 4GO9A 4HHPA 2QLYA 3GVWA 3U7VA 2WKJA 2I7GA 3M0HA 4UFLA 3SEPA 3V75A 3S42A 4OQVA 4JNYA 4MWAA 1UR9A 5I2UA 3OGRA 5LGXA 1K9FA 2MUCA 2IQTA 2XIOA 4M0XA 3W2JA 2DZVA 1Z44A 3RO6A 1QJWA 2ZXAA 4PH6A 4D8LA 1A3HA 4O57A 1JEZA 3G5EA 1O12A 4IIBA 4RZ6A 3SCOA 1JPDX 3LU2A 3UJFA 4DBDA 4ACZA 1YXYA 3PN8A 1O6IA 3NYZA 2D1ZA 4Q8VA 2W9MA 5D33A 4B92A 1AW2A 3NZPA 3IK2A 3W7MA 7XIMA 2F38A 5FD0A 4X61A 4L64A 4E8DA 1RJQA 4GPNA 3TK7A 1T5AA 1T8XA 1XYMA 5HQMA 4H01A 2PF8A 2LLEA 4DWSA 1R3YA 2E9LA 4LNYA 4B4FA 2HROA 1HJWA 1UMLA 3H7VA 5K9XA 3C2RA 2Z2BA 4D72A 1X39A 1UZ4A 5HJXA 4AAJA 2H3DA 1DWJM 1L2UA 1IEQA 3CO4A 3VOIA 4QM1A 4Q4QA 5JBEA 5FSDC 2FDSA 3W73A 1CTNA 1LWJA 1ZBVA 3NM1A 3R79A 4H2HA 4A21A 3GR8A 4HU8A 2VEFA 5I06A 2PCQA 1XLJA 3VOJA 2QXWA 1WKEA 5A6KA 4WDXA 3P7YA 3U57A 4AD3A 3KBNA 2W66A 3QV7A 1PUDA 1UHVA 3P8JA 2FMOA 1AJ2A 1RXOB 1E73M 1WUFA 3CL8A 3UPMA 3W82A 5JIWA 2V0TA 1HKKA 4JEQA 2WVSA 1DXFA 1FWFC 9RUBA 4PTNA 1LQ2A 1IT7A 4TV5A 3SY8A 2O9RA 4Z42C 1XIHA 1XIMA 4A2SA 3GVRA 3QPYA 1IEWA 4C1NB 3K4DA 1E55A 2OT1A 1JD9A 1V6YA 1J0IA 3NQMA 1RBOB 3NQFA 4AZBA 1EDGA 1OT2A 4OWGA 1C8XA 4HTBA 5ABGA 2GGJA 3W7NA 1C9WA 3VO0A 3L7RA 1W17A 1MFVA 3CZLA 3QY7A 4PUJA 3DBPA 3OB8A 5LA2A 1OINA 2IKHA 3EWZA 5CPNA 3CPUA 1QPKA 3LGDA 3A12A 3PZ9A 3ME3A 4TVCA 5J04A 2PU0A 3MMTA 4E4PA 4DI9A 2W67A 3UZJA 3TWAA 1U5VA 3UW6A 1DIEA 2QPSA 4W88A 2DZWA 3PJXA 3LI0A 4CEUC 4D6HA 1PTDA 1GQLA 6XIAA 1R8LA 4FAMA 3RU6A 4P7LA 3W2NA 1LTDA 3PNZA 3C86A 4PYSA 1DQXA 4K37A 3S1UA 4XKYA 4ZB0A 2RFGA 2ZUMA 3WLOA 2XJ7A 3G1AA 5G2IA 4HNVA 1I9CB 1EF2A 4NJKA 3WF0A 1Z42A 4NZ1A 4DYJA 4C6KA 2JALA 1G01A 3F5KA 3R13A 2A21A 3I6TA 4DJDC 1VFFA 1QPRA 4PMXA 5H6HA 2G0WA 3FCPA 4B5UA 4ZO6A 3B9EA 4LU0A 2G41A 2W3ZA 4MWAC 4S38A 3NQ8A 1P1XA 2F61A 4F0LA 2Q71A 4OIFA 5DEZA 3AHZA 5A8GA 3VI2A 3UP8A 4MUPA 1P0KA 9CGTA 4L1XA 4TX9A 4F79A 5M2FX 1QK0A 3M43A 3WCZA 1S2CA 1Q6EA 1XIBA 3OYZA 2RJGA 3LGEA 3NTYA 3LHUA 1B4EA 3MC5A 3N4AA 3CXOA 3SCTA 1MSSA 4ZGYA 3H7UA 1OY0A 2QAPA 2ZICA 3M0IA 5I3HA 1XGZA 2PDHA 1BXBA 4GX8A 4GA8A 1BVNP 2FH8A 4JTSA 4IGMA 1T41A 3VGDA 1H7NA 3RU8X 1UWAA 2JF6A 4I5RA 1OEPA 1Q3NA 3STEA 1NY1A 3QQ0A 1QNQA 4Y96A 3PTQA 3E5BA 3S6TA 1GG1A 4YYCA 3O9NA 1WA3A 4OJYA 2VDIA 4Q8MA 3S1VA 2PDXA 4JS3A 1EWEA 1E4LA 3ZQ9A 2BOEX 2VZOA 1TJPA 4TR9A 4ML9A 1BAGA 1R3QA 2Z25A 4MM1A 1DWHM 4OKDA 3M0XA 4X3ZA 4DXXA 4ZFMA 4IMGA 1E9IA 5CJMA 1DE5A 4O1BA 3LRMA 3G1VA 3PJTA 1YYAA 4FA3A 3FJNA 2PURA 3EDJA 4NY2A 1U1UA 2FZNA 4MLJA 3T07A 1EEPA 3JZEA 1G4SA 4W7UA 3RXZA 2X0YA 1NSJA 4PC8A 3RITA 2J66A 2Y1HA 4JOMA 4M80A 1WBHA 3EPNA 4XISA 4Q4MA 4WLCA 5MHBA 1I60A 3N2BA 1RUSA 1DJYA 2E68A 1VC4A 5AC6A 1XSKA 4PFHA 1A5NC 3HPXA 4YTSA 5AC4A 1XIEA 1ZQ5A 1UB3A 3RLHA 2OB3A 4LCQA 5J5DA 1E3ZA 2YCEA 3ZVIA 5CBIA 1PZ1A 4NJJA 4XAPA 1NAL1 3BJSA 3PK7A 1OFOA 5FKYA 4JX5A 3VFCA 2FYMA 2BLEA 3TN6A 1EJ7L 3B9DA 4LWWA 3TYEA 3CK5A 5HPCA 3GK0A 1IIGA 4U4MA 1TELA 2R14A 4H2CA 3AHTA 1M1BA 4GKTA 1HN1A 3PPGA 4PB4A 4M82A 3UG8A 1DJGA 4A3HA 3DYPA 1BKSA 1XV8A 3QTGA 2L5HA 2X40A 1VLWA 2EG8A 3TWBA 4UIOA 3SB0A 5AYYA 1XYBA 1Q8AA 3LX9A 3GDMA 4H8NA 2F6UA 2V5JA 2HVOA 4QX4A 4AMCA 3RCYA 1GJPA 5F4XA 3SM0A 4HYWA 4MLRA 1J8VA 1FHDA 3DCPA 2WSQA 1R46A 3HG5A 1LL7A 2VQUA 4QLKA 1WBJA 3H26A 2DT0A 3FXYA 1AK5A 3SQSA 2D20A 3OO2A 3DG7A 1FCVA 3THAA 4HSOA 5EFFA 4PMYA 1KTCA 3A21A 2YFOA 1TWWA 4KWVA 1W3NA 3VCRA 3MUIA 1ZALA 1DJWA 5JMUA 3K30A 1JPHA 1QDSA 3BLKA 1R3RA 2ZKMX 4ZTYA 4LBSA 4KFOA 1ESWA 5A2CA 4MY1A 4JHOA 2HWGA 4N9CA 3LCFA 4DELA 2NX3A 2ZX7A 2DW6A 3AIVA 1I75A 2PDJA 5D2WA 3WJZA 5HNTA 1BLIA 2VHLA 1UCWA 3VGEA 4DXVA 1M68A 1G6CA 3B05A 4W5ZA 1F74A 1O5QA 2IQDA 3P3BA 3NPVA 1N2VA 2OEKA 1TCDA 2PAJA 3DG3A 1BYCA 4C65A 4OU1A 2V30A 3AC0A 1BGGA 4LVAA 3ERPA 4PBGA 1B90A 3GHUA 3PANA 3AIQA 1FWHC 2QZRA 4CNTA 1T96A 3ZMRA 1LORA 3CMJA 3W1AA 3FDKA 1QPQA 3MZNA 4HNUA 2OO6A 5D9NA 3TJIA 3NXLA 9XIMA 4A8RA 3PSVA 4GIAA 5BWAA 1VHCA 5ECUA 2TYSA 4I8YA 3S9IA 3UR5A 4LY8A 1XLFA 4J3SA 4NU7A 4C6CA 3R5EA 1GVSA 3GB6A 5IDZA 2REQA 2JE8A 4LAZA 2X7VA 3E0VA 3CB8A 2FJKA 1F6YA 1DORA 4CD6A 1IEXA 3SGUA 1E40A 4PRRA 4HU4A 3FNDA 3AU6A 1WOAA 4Q8UA 1FDJA 3DIPA 4LAKA 3MSYA 5IBXA 1TZZA 1SMAA 4MFDA 1X7IA 4FNSA 4KEUA 4RE4A 1LOLA 3BO9A 6CGTA 2WJDA 2PFHA 3C2YA 3HQ1A 3UNTA 2W63A 3RMJA 1K6WA 5I02A 5H8MA 3NOYA 3GNDA 4XAFA 3IAQA 1DBTA 2WNQA 3TXVA 4LEQA 5G2HA 5TNVA 1QASA 3T8LA 1W3TA 2X1TA 1XQLA 4M29A 2Y4SA 1RLDA 4ZSTA 5GPRA 4KEVA 4KWWA 1JYWA 5LKYA 1ME9A 4NI8A 1EGMA 1QW7A 4QRNA 4YHGA 1HVQA 3CLWA 4K7VA 5CGQA 3F4NA 2A3CA 3G0SA 1D7KA 3MO4A 4LAMA 1QUMA 1E6ZA 4FK9A 2ZXBA 4BQ5A 1H60A 5MKGB 2DFAA 2O7SA 3KCLA 1UD2A 3MA8A 4BQ3A 2J77A 2AL1A 3GYCA 3KE0A 1CXKA 3N25A 5D8WA 3UZWA 1RK6A 4BF7A 2OZTA 3W71A 4UTIA 3BQ5A 5XIMA 1WO2A 8RUCA 2QV5A 2YYTA 3DYMA 4AEOA 1B9BA 5KZDA 3SRDA 2FZ9A 1JCLA 3EOLA 3VA8A 2P76A 3URAA 1M7PA 3ZO9A 1ITCA 3HU7A 1K6AA 1OHLA 4MNJA 4YIWA 4GJ1A 3VOFA 3W7CA 3NA8A 2VXNA 1V7YA 4LVDA 2ACUA 4JTCA 3SIMA 1G67A 3PZNA 4PMZA 4YVXA 4QXIA 2CHOA 7ODCA 2DSWA 3LMYA 9XIAA 3W7LA 2GUBA 2E09A 4EAMA 4BFAA 4Z1CA 1VFOA 3GFYA 3ES8A 2GYIA 4XZNX 1QVBA 2NVDA 3TKFA 1BWKA 3T08A 1QBAA 3QFWA 1UKPA 3O0FA 3S6OA 3TC6A 3WH8A 2FH6A 3SR7A 1EJTC 2GQ3A 4KWUA 3RR4A 4HK6A 4IMFA 2EO7A 5DCBA 1GOQA 5I24A 3VUPA 4GVHA 4M6PA 1OT1A 3GQYA 3CV6A 3N3MA 1BXCA 5ENLA 1IZKA 2QMKA 5G1MA 1JDCA 3LV6A 1REQA 2OLAA 1QI2A 2YDQA 5CG0A 1TUXA 2WMJA 1QNVA 4ZQMA 2YBVA 1F6PA 4F0KA 3FA3A 1A5MC 1PIFA 4Y8EA 3V16A 4QHRA 4C5YA 2XDFA 3C0JA 3KS5A 1FWDC 4AISA 1C7TA 2PTYA 4TO8A 4P7RA 3EAUA 4MDOA 4S3GA 3DN5A 1F61A 4LYRA 2WWCA 3WNLA 2E5BA 1UQYA 2AGKA 2GJXB 2CLLA 5KMYA 5FAJA 1XINA 1VCVA 2P0IA 1L6GA 3R25A 4E5TA 4AMAA 5LHEA 4L4LA 4LGXA 2X2YA 1KR0A 4Y90A 5ABTA 4JTRA 3QW3A 4HNTA 1ME8A 1TR9A 5I6SA 1QBBA 4N42A 2G4FA 1LT7A 1ZJIA 5IOBA 4J7RA 3CLMA 2ISWA 3CC1A 2DORA 5LIKX 3O7UA 1KO0A 3TMLA 1HJQA 1NOUA 4I5UA 1EEXA 2QUNA 4JHZA 4B3ZA 4RL3A 4D1IA 5DY3A 4CCZA 3S47A 2DIEA 5GNZA 1BEUA 1C3FA 1NDZA 3EDKA 4H7VA 4JTDA 4LOCA 5CAHA 3KCOA 1DXIA 2J75A 3AIRA 3ZOAA 3VNKA 3OZPA 2FTPA 3U7BA 4O17A 2CHRA 1JG9A 3L4ZA 1EBHA 2Y24A 1KGUA 3GC5A 4RNHA 3V36A 4BEUA 2A6LA 2WQPA 2WAGA 3R6IA 4ERIA 3WQ6A 2IXUA 3KX6A 2CBUA 1O5RA 3QFEA 4DO6A 1Q13A 2CERA 4ZOCA 4L6OA 4GVGA 3KEHA 1JL8A 4JL1A 1CW2A 4FSAA 2D0HA 4JIIX 4WK9A 1GOWA 1TPWA 4FNPA 4HGXA 1MZRA 2DPEA 1JCXA 3NQEA 4HA1A 3QKEA 8CGTA 1LWIA 2VT0A 2CESA 3W86A 4UMCA 4XZBA 1DWIM 2ODOA 4FEZA 3M0MA 3CHEA 1E70M 1M3UA 4DF0A 3FAWA 4N9DA 1WAUA 4G5DA 1TIWA 3B0YA 3QZEA 4S2BA 3SN0A 4Q6JA 1OQFA 4H9ZA 4CN4A 4HYRA 4N4QA 1F73A 4IFRA 1J18A 1QNPA 4OTKA 5HMSA 3MCNA 3K4WA 4C5ZA 4R85A 4GIRA 3THCA 1I0BA 5H1WA 3U5YA 1R86A 1HX0A 5A95A 1VBHA 4EANA 1F7BA 4H6EA 1K4GA 4UTMA 3MPGA 3MKCA 3WO8A 4P8VA 1W5QA 3R43A 2DZTA 2YA1A 2AGTA 4BQ2A 4Q4KA 2WCSA 4GUJA 1X6LA 4DRSA 1QATA 2OT0A 3GR4A 4N9EA 1YX1A 1CGVA 3LBMA 4QBXA 4GI9A 2WC3A 1CGTA 1KRCC 4YU1A 3WK2A 1ADSA 1LRQA 1UG6A 2ZTKA 3EMCA 1R2SA 3W53A 2PD9A 5HR7A 4UFMA 3EWYA 3E96A 2NXIA 1A50A 3UA3A 1R3VA 4LCSA 2VC7A 4R5EA 4IX2A 3K1GA 2GVYA 4NNAA 1VFSA 3S5OA 1JUBA 1XX1A 3V18A 1IQ8A 1K8YA 2BHZA 3WNNA 1TMLA 1PKYA 5EA9A 4A8NA 1W9UA 1UA3A 3GTIA 2V81A 2VEIA 3ARTA 1H50A 1K02A 3BV4A 4BQ4A 1RPKA 2QULA 3LCXA 3TR9A 4AD1A 4M5PA 4P7NA 2B7PA 4FX8A 1LQ0A 1EA9C 3KP0A 1GKQA 3EOOA 3WDJA 2PCEA 4IQLA 4AX6A 3SCSA 4PB5A 3IWPA 1UP3A 1Z9AA 3DERA 2OYLA 1V8EA 3NDZA 1W9VA 3GNOA 2PDWA 2QIWA 3KBWA 1V3JA 4LAUA 3L4XA 2XN1A 5IDIA 5JQ9A 3VGBA 2QJMA 5J5RA 3F4DA 1RLCL 1PBGA 2DSUA 3R0KA 3WLNA 4LUSB 1P0DA 4OHQA 3TFCA 3VYLA 1ZBKA 2JGYA 1AMYA 1UR3M 3LCHA 4GNKB 3VD3A 3OQ8A 3XINA 3KCJA 1EKOA 1UROA 1WXZA 2C15A 2HBXA 1L2QA 4GVFA 1A47A 2OJPA 1MW2A 4M7SA 3SUUA 1M53A 4AC1X 1XIJA 4N6EA 4O1AA 5LHFA 1MUWA 4A3QA 3GUWA 3HIJA 4EVZA 3RIKA 3GIQA 4D6CA 1SZEA 2V3EA 4NYYA 2OWCA 3OBEA 3W1MA 3G0UA 3UR2A 1AMKA 1XH1A 1XRVA 4JKKA 1Q6FA 4QR6A 1PPIA 3SIZA 5AHLA 1JQXA 2UY3A 3KL5A 3VU2A 2WPGA 2OQHA 4KH2A 2ZWZA 4FR1A 1VB9A 3PZGA 5H8UA 4QS5A 3C8FA 5DMYA 4FIRA 2R91A 1J6PA 4POCA 1UH4A 5GJMA 2F8QA 1W9DM 2ZOXA 3STFA 4HP5A 1SW7A 2NLIA 1GYLA 2ZBTA 3KWSA 3AWNA 4PMUA 4J3XA 4X63A 3CMGA 5EPDA 1BXNA 3G1RA 3GY1A 4FNTA 2PLMA 3PBVA 3C61A 3G0XA 4ZA0A 1UW9A 1JZ5A 2V68A 4RCXA 4XQ6A 2YCLA 3W7GA 5KETA 1ZZMA 3MV01 4JZ5A 4FLOA 3N14A 4MB4A 3KOZA 1SZRA 1OYAA 1EJVC 4J27A 1U33A 3UD6A 4O28A 4AD4A 4LT9A 4AC7C 4D6JA 1PHQA 1SFJA 2GL5A 3HPFA 4ILSA 3OU8A 4PRTA 4KFPA 3T55A 2WVVB 4HU3A 4WOQA 3TSBA 1GCYA 1A4MA 4LSBA 3SUVA 1ECQA 4MY8A 4EXQA 2VRKA 1I2OA 5U7SA 5FF4A 5B80A 1XD0A 3VIMA 1Y5XA 2PDQA 4LY4A 2FMNA 4W87A 4XWUA 5C6MA 5M5DA 2I1OA 3VM5A 4KGLA 1TKKA 1J0HA 5CPOA 2F9RA 4HMCA 4JEJA 2QGHA 2QUMA 3NL6A 3JU2A 4M1BA 3S5YA 5A94A 4R7OA 2JIEA 3W7QA 4MYXA 2YCKX 2YCIX 3VOHA 3GUGA 2V5DA 4GXPA 4IMCA 2YXGA 4BWLA 1XFCA 4IPPA 3AS2A 3BV7A 3VNYA 3W7DA 1PV8A 3ZWTA 2TPSA 1MXDA 2QKFA 4L1WA 2YXOA 2CFFA 4Q22A 2R1NA 1PVNA 1JFHA 1I2NA 3WFLA 1SFTA 4IG2A 3STPA 4PUDA 2ZC1A 3GXTA 4ZO8A 1WKDA 1KM4A 2J62A 5I3DA 3FXGA 3V0TA 3WUBA 2XGBA 2YJQA 1W8SA 3I68A 4DVOA 4P5UA 3CZGA 2PZNA 2RGLA 4CQAA 1AD1A 2FKPA 5BROA 3FYOA 1ICQA 4UC5A 2NQ9A 3OVGA 2FGZA 3BTNA 3Q65A 3LTSA 3DAQA 4ZO9A 3SCUA 3B9NA 5DMLA 3F4CA 3GNXA 2DUAA 4IMDA 4CQBA 1EP2A 3GFZA 1ME7A 4O12A 4JBRA 3M7SA 2J8FA 3B4YA 3TUUA 3WYZA 2B7QA 1K9EA 4NAFA 2PUZA 1SJAA 4KQNA 1V03A 1XF0A 1EIXA 2XPKA 2VEKA 1KQZA 1K4HA 3H7RA 1Q7ZA 1S38A 4YJ5A 1B3YA 3BOXA 4UOQA 1U2YA 2QCGA 1EXBA 1XLAA 2E67A 2ZRXA 1Z69A 3Q37A 4LJ3A 3G3MA 1UKSA 3NSXA 2ZXDA 7REQA 2UY5A 1CLXA 4IIEA 4DXKA 2OQYA 4AZGA 4MNMA 1H0GA 3GO2A 1XXXA 4OVXA 4AD0A 4E0CA 2QGYA 3I6EA 2VENA 1W9BM 5FF3A 1DXEA 1MRQA 3GDTA 2WVUA 1S5WA 1ZY9A 1HXJA 2Z00A 5HULA 3RR1A 3ZVHA 4KCTA 4UMAA 1R5YA 1HKMA 1MW3A 3STCA 4H9TA 3QXBA 1FA2A 1VYPX 1ISZA 4WQ6A 3PWIA 2C16A 3IVTA 3QM3A 1HKJA 3A6OA 1AH3A 1S5NA 5JU6A 5XIAA 2GWGA 3EZ4A 3HURA 1TYGA 4NZ3A 1EA0A 4CVUA 1R85A 3GTHA 4RW3A 1WP6A 1EYEA 5D2XA 4WRHA 5FJOA 3ZZ1A 1Z41A 3TN3A 1D9EA 3CHCA 4JIEA 4NP7A 2XINA 3DFNA 3QC0A 5I5RA 2E6DA 2H3BA 1WOBA 1HGWA 1BF6A 3EEZA 1QOXA 4IIGA 5A6MA 1XYLA 2R6OA 1SR0A 4FALA 1QFEA 3V1PA 3VIJA 3Q67A 3G1FA 3IEBA 5BOFA 2E6AA 3UPBA 3PWAA 1SO4A 5GNXA 2IMRA 3GRIA 5B7YA 1H7OA 1JYVA 1GNXA 2XVKA 5D38A 3M6YA 4HVXA 3FA4A 4GNVA 4NX0A 4W8BA 5DBUA 3W1LA 2ZCGA 4PCTA 1JVNA 4URIA 4UTJA 4IHCA 1L8NA 3PAJA 4LRTA 4JTEA 1KD0A 3O6DA 4B5NA 3VC5A 4GBDA 4K38A 4DJFD 2HK0A 4BWLC 4FR6A 4B5XA 3S5ZA 3PFMA 1JNEA 1PZ3A 1EGZA 4IPNB 4FNQA 4HPNA 1J5TA 1MW1A 5E70A 3W7IA 4C6DA 4HHHA 2BBFA 5F2MA 2ZUUA 3RUBL 5LNWA 3NO1A 2ZZ4A 3EDEA 3TTSA 4PUNA 1FHLA 7CGTA 2QQ6A 1F3EA 2AL2B 3K8MA 3W1QA 2ICSA 3QQ1A 1O95A 2CIPA 3BCFA 2BODX 4LALA 4HCHA 4JCLA 2RHGA 1JF5A 1QI3A 4MF4A 1US3A 4KRZA 3RX4A 3VX0A 2BXVA 1VR6A 3P14A 1CXLA 5KZ6A 2VZTA 3TH6A 1YE4A 4G7EA 2WSRA 1Y5VA 1GOOA 4W5UA 2BVYA 4O0KA 1F07A 1DPMA 1UIPA 5ABHA 3WH9A 2V6AA 3N2TA 3EXSA 4DZIA 1W3HA 1KGXA 4HPJA 1OX5A 3UY7A 3PG8A 1BTMA 4I9MA 4EPEC 1VPYA 3EMZA 1S1RA 3SRHA 5FA5A 3E38A 2HCVA 4A3UA 3VIPA 3L12A 1FP8A 3QBUA 3W87A 4FI4A 1A0EA 4AHQA 3PUEA 1NTHA 3REQB 2BP1A 4YXGA 1B3ZA 1XRTA 4WHBA 1WDQA 1ISVA 5DN1A 3G8EA 3FFSA 3WH6A 3MBFA 4H8HA 3E0WA 1EO7A 1WAWA 1L6SA 5DFAA 4UB9A 3ES7A 1SO3A 1TWZA 5CPLA 3EB2A 4NYUA 2XFWA 2PODA 4WF7A 1GTEA 1HKIA 3U8GA 3HQOA 2BHUA 2OSYA 2R94A 4QSFA 2VNCA 5AYIA 1SJCA 1VFUA 1VBUA 3M0YA 1JCNA 3AICA 1KXVA 1ZJBA 2HTMA 1OYCA 3U2EA 3QV9A 3EX1A 4C6EA 1TVPA 3BLEA 3GG8A 2P5NA 3ITCA 4GACA 4TOQA 3CO8A 1Z32X 3M5XA 3UYCA 3S5NA 4JGDA 4E2OA 4JY9A 1C29A 2D22A 4J3UA 1XI3A 1YEYA 3S2MA 3DDMA 1FWNA 1D2KA 2Q01A 3W7KA 3IRDA 4UR9A 1E0WA 1ZCOA 1K7XA 3TQVA 5HMEA 5E1QA 1AQMA 1VEOA 1QU4A 1NDWA 4WJXA 1GT8A 2GJRA 5JVLA 2WMGA 1ADOA 3ZXWA 1WXJA 3C2FA 5KSWA 2GPTA 4IIDA 3ARZA 3PF3A 2D24A 3QLLA 1ONEA 3NURA 1P0NA 2GOKA 2FJUB 3GDLA 3LM7A 2EBNA 3J7HA 3HBLA 3C56A 3MUZ1 3WD1A 5CJ5A 4F40A 1W54A 4JAWA 2V38A 1GONA 3IIZA 4KFNA 2TODA 3ZIZA 1ZL1A 4C90A 1P0BA 3WD0A 1P5BA 1QNOA 2TSYA 3VD9A 1PSCA 1TUFA 2G96A 4CQ8A 3AXIA 4NF7A 5FL0A 1NF7A 1MXGA 3H53A 1KLZA 4AHPA 2PBOA 4H3DA 3KBSA 4H1ZA 3JVAA 5I07A 1ODUA 2PDYA 4E38A 4GG9A 3OIXA 2WCGA 3W7RA 3NJ3A 1XW8A 1KM6A 1PCWA 1I1XA 4B3LA 1NM9A 4I8DA 3WSUA 3SQLA 1ZNNA 4PUKA 1ONXA 2CKSA 1JRBA 1NDYA 2Y5EA 1ZLPA 3PZOA 3BC9A 2DQWA 3L67A 2WWDA 3WUGA 4DWDA 4PMNA 5CZJA 1GW9A 4UTKA 2HK1A 4HA3A 4F0RA 3ALGA 4GHRA 2D2JA 4OUEA 2XN2A 4V33A 3JS3A 4CU7A 1EGVA 2FZBA 1ZJAA 1RJPA 5I7GA 3W2LA 3QR1A 3GNPA 3TX9A 3EBVA 2WKGA 2YBUA 3N19B 4HNCA 2EG7A 2P3ZA 4K68A 2X0HA 4GINA 2PGWA 5FL1A 1W9PA 5FJIA 4HB7A 3N2OA 4YLWA 1GKRA 4M6VA 3E9AA 4MJ2A 5I78A 1JI1A 5G2WA 3PZVA 4UUIA 4PODA 3NO3A 2V2HA 4F9JA 4XD5A 4UFJA 3TAOA 1FWRA 2AAAA 3GVQA 4LVGA 4W84A 3NYDA 1BSLA 1RZMA 4H9MA 1AW1A 4XV0A 3CH0A 1GYMA 3AAMA 3LXCA 3E2VA 2A4AA 2FDMA 4XTIA 3RM8A 4NASA 4Q7NA 1EDTA 3DFYA 2J25A 4LUYA 4EWND 4QDPA 2PA6A 1RVKA 4QJ3B 5CC7A 2PGFA 1DJXA 2BV9A 5FSEC 2OVLA 2HJPA 3QN3A 1DJQA 3IAPA 4WVXA 3O06A 2WM1A 2DW7A 4GUGA 1M9HA 1LM1A 5C9ZA 4US5A 4CLMA 1OBAA 4WDUA 1QHOA 2OSWA 2IW0A 4N0RA 5CPMA 4C60A 3B40A 2EPMX 4B9ZA 1SZNA 3B04A 1VEMA 2J6VA 3KL3A 2FPTA 3UZXA 2I5QA 2NZLA 1BKHA 5LIXX 2HNHA 3DC0A 4YWSA 5M03A 3W2UA 4WY0F 5EMMA 4INFA 2J27A 3QGAC 3TW9A 2ANUA 4AEEA 2ZWYA 4BI5A 1E6QM 2HPMA 4S3BA 4ZOEA 1UP0A 4HSNA 3L2LA 3B06A 3P2VA 4NJHA 1D3HA 4DJED 2QJNA 2QW5A 3BAKA 2A85A 2Y7EA 5EKYA 4UCFA 2MNRA 3GX9A 4LPCA 5G4WA 1R87A 2E1WA 4NZJA 1I2RA 3MTWA 2AQVA 1XYCA 1TV7A 1XIGA 4B2DA 4Z1AA 3ABXA 4J3WA 2DSZA 2PTXA 1G0CA 3QPEA 2BHYA 3L66A 2GVJA 2VELA 1LOSA 1KW1A 4PTWA 1R30A 3R1ZA 5FIPA 2XH4A 3UWYA 4PE8A 1S3HA 3DENA 1KBLA 5HNRA 4RR4A 3S0CA 1Q66A 4Z2LA 1VH7A 3HGSA 5F4SA 2V5BA 4H6QA 3DEQA 4P8WA 4W7WA 2GJPA 1EOKA 1TPDA 1OFPA 3IUHA 2C7FA 1EOMA 3RLGA 2GDVA 4HD5A 1I45A 2WV8A 1SW0A 3UCQA 1CDGA 5B7ZA 4W89A 5A1AA 2DH2A 2WZTA 4S23A 3WQEA 4B16A 2CZEA 3KTCA 5D37A 5D8ZA 4X9SA 3WLQA 1H51A 3TONA 1JFXA 3NL5A 5FAGA 4JL2A 3GE7A 1V02A 2XM2A 1ZAIA 4AIBA 1C91A 1MEHA 4LUTA 3UWZA 2EKCA 4NZ5A 4QS6A 5IHSA 4NRSA 4FS9A 4UTLA 1W1A1 4GYPA 3EOUA 1ECEA 3IUDA 1MQPA 3BLLA 1SYTA 3OTRA 4GQQA 1A0CA 2C18A 2J7EA 1HW6A 2QUTA 2YZ5A 3AALA 1ZPTA 2AKMA 2XISA 4L6DA 4C1NA 3WEMA 3TU9A 1ISYA 4E8GA 1SJBA 5BWFA 1TQJA 1YQ2A 3ARWA 4F4RA 3S9ZA 3NPXA 1VF8A 3LXBA 4AF0B 4MVAA 1C90A 5CGMA 3R58A 3BMXA 2P50A 4UWMA 5E09A 1CGWA 1GHSA 1ZGDA 4QG9A 3SUSA 1FX6A 4JNMA 5IXEA 2ABBA 4L65A 1WCGA 2DT2A 3LCLA 4JTHA 1RD6A 1KCLA 2EPOA 2HISA 4LAOA 1XGEA 3SJNA 5F2LA 4ZVJA 1I1WA 3TR2A 1P4CA 1KTNA 2TMDA 1E0TA 1TTQA 1UR8A 1KTBA 1QCWA 2VFFA 4TVUA 3W1TA 3RYSA 3UVIA 4MGGA 3WK0A 3V0UA 4TV6A 1AZ1A 3FKRA 4QISA 1V3LA 1ISWA 1CECA 3D3FA 4RNJA 3ITXA 4TX8A 3T9PA 2XIJA 4UOZA 3TEVA 4WGHA 4YHEA 5HATA 1NFPA 3LPFA 3HMJG 1GPWA 2VD9A 3HPAA 2RDXA 3KBJA 1YLVA 3VMOA 2ON3A 2GLKA 1Z6KA 5BCAA 4AY8A 4JDYA 5AC7A 2Z7GA 1RD5A 3LLFA 1QPOA 1ZAHA 2NXHA 4GI4A 4GWEA 5I23A 2J9XA 2J79A 3KBVA 4ZXOA 1JI2A 2DEPA 4JTKA 1VZWA 2VFIA 1BYDA 1WDPA 3P0XA 2ONEA 3KRZA 2Y61A 2GK1B 3R94A 2RGMA 1L0PA 4W8AA 4E3TA 2WNZA 2FVLA 2YLAA 3CWOX 1TA3A 3NQVA 4HOWA 1D8WA 5C54A 4CQCA 1OM0A 1NWRA 4ZB2A 4N6FA 1SSDA 4E2BA 3HTWA 4XO7A 4DPPA 3IIXA 4AVOA 3H2OA 3IIPA 4O53A 2CLEA 3NSMA 2FZ8A 3TYCA 3E2RA 2Z2UA 5HDRA 3TNBA 4YNGA 2EEXA 3BURA 4ATDA 3SCRA 5AY7A 3MCMA 3WLHA 1E9LA 1E6PA 3HN3A 1E4NA 1UUMA 2VGBA 1N8FA 4AWTA 3H70A 4XBSA 2R8WA 1KQYA 4AZCB 1PX3A 3QR0A 4ICMA 2QV4A 4KW2A 4IWWA 1TX0A 3RG6A 3RLUA 3WQGA 1XLHA 1F9CA 4LW7A 3INPA 3S4TA 2P10A 4LFYA 4F66A 1AL7A 2GDQA 3W07A 1JGIA 3RJXA 2OGJA 1SJDA 3O63A 3UXLA 4DJFC 3KBMA 3LBOA 3HJZA 4GYPC 2TAAA 1CGYA 1JPKA 1BYAA 2A3BA 3H8AA 4PMVA 4REQB 3SY5A 5FOOA 3LK6A 1KCXA 1A3XA 4ENLA 4QIUA 4D6GA 1DIOA 1FQ0A 4OBSA 1S39A 2BSLA 2FB2A 3MSGA 2GVLA 5IFTA 4NSBA 3BMWA 4IL0A 1V3KA 3KLKA 2PRHA 2PDCA 2YA0A 3POCA 4JHMA 3V4BA 3K46A 3LSBA 1VPQA 4WY0B 1V6XA 1NARA 3WIJA 3H2CA 2PD5A 2R1PA 4PMJA 2PWGA 4UFIA 1XBVA 3C0LA 3MCOA 1G4TA 2CBJA 4G1NA 2GOUA 3RNDA 4V2XA 3WMBA 1CENA 1OX4A 5D03A 4GZIA 4TTUA 3K1DA 3L2IA 1RY0A 3JZUA 1WZMA 3DH7A 3LPOA 3PULA 3GG0A 4Z0JA 2H9AB 3CUZA 3DFPA 1VIZA 4RXGA 5I79A 3E0FA 4MPKA 5C8BB 3WY1A 4A22A 2VX7A 3ANVA 3GDBA 2NUYA 5D4YA 2G3JA 4HJFA 4PULA 4D9PA 4H6RA 1UIOA 5CBJA 3WD4A 4QJ1A 3OLIA 1TV2A 3QRHA 4UQ9A 1KGWA 4KESA 3TYUA 3VGGA 1KKOA 3LCIA 1RY8A 2KX9A 3LN3A 2A79A 3DKJA 4GJJA 4I5XA 3EX6A 2QCLA 1X7FA 4YWIA 1JPMA 1KFBA 1C92A 1TSIA 3W7OA 1Q6LA 1WZKA 1DL3A 3I7SA 4PR4A 4JX6A 2ZUWA 3DGRA 4FB7A 5E0FA 3E02A 1SSGA 2ZIDA 1SW3A 3TZFA 3LNMA 1MRAA 2RUSA 3PUOA 2E7FA 3I7QA 1OG6A 2JK2A 2Y89A 5DXYA 4M51A 4M3PA 2D2GA 3PTKA 3LDVA 5CQ1A 4LH8A 3CPGA 1KRMA 4O15A 3IJLA 3HOJA 3UQNA 2NQHA 1ZS2A 3O15A 1OADA 4IP4A 2NSOA 4OBRA 1KV8A 1EYWA 4O0ZA 1XSJA 2CZFA 5I09A 1FY6A 3NIYA 5DF0A 4DBWA 4NZCA 4XAGA 3CBWA 2WBGA 4MJZA 3EA2A 3TDFA 1BSIA 4ADUA 2Y8UA 1FWCC 3ELFA 1I4NA 4C91A 1A4LA 5TF0A 4IF2A 1XC6A 3MMUA 3WF4A 4IQEA 2OKTA 3CM4A 4GC3A 5FEXA 5C9XA 4N7QA 4L56A 4Q33A 1W9XA 3BICA 4IPIA 2E25A 2C71A 2ALDA 4UZSA 4B90A 3WQ8A 2Y8VA 3LEPA 1WYIA 1MQQA 1DJNA 2DY3A 5E5CA 3W75A 2ZA2A 3LERA 3DC8A 4O54A 4CD4A 4Q8WA 1Z3NA 4EF9A 3GZ3A 4JFVA 3T0TA 1IGSA 1XKJA 4S3EA 1IXQA 2FHFA 3VKAA 3H4GA 3M6DA 4GMEA 3W6MA 2WMIB 5G1YA 4OZOA 3GXNA 4S3DA 1E43A 3MVIA 4CQDA 2B81A 3DOPA 5EYWA 2E28A 3R7MA 1E5NA 1GHRA 1R6WA 1QMLA 2V9DA 1DWFM 5CZTA 1GTHA 4CU6A 1NQ6A 1XM3A 4HA0A 5KZMA 3TMQA 3SFWA 1F05A 3OHMB 4H00A 4JQ3A 3OLEA 5CC6A 1S2AA 3UNDA 5CZSA 2I16A 2DV0A 3N9SA 2B7NA 4W85A 1JZ6A 5BZAA 4EWJA 1EFZA 1FXQA 3LNPA 2BWGA 1CGUA 3L4WA 3RLVA 2QJJA 3ZT7A 3FX4A 3UWVA 3AWOA 1JDFA 1KBIA 1F6KA 6PTDA 2AMGA 1KM2A 3PJWA 5MKGA 1W32A 3N04A 1UJQA 4BY3A 5A69A 5CSRA 4D6IA 4L6HA 4DI8A 2J8GA 1TVNA 4Y2WA 3ANUA 2I5GA 2QEZA 4ZENA 3P60A 3IJ7A 3PPHA 5KZEA 2DJXA 1JGMA 4DUVA 2JKAA 2NQ5A 2DT3A 2NXGA 3EPMA 4CGTA 1HF6A 1W1PA 4GCXA 3VNIA 1HG3A 3H21A 4PMQA 3GXPA 4DUOA 3PWGA 2DQXA 2PDPA 5HNUA 3B0XA 3CWNA 5T8GA 1ZP4A 2Z1SA 1H7PA 4Z1YA 3LV5A 4I7VA 4GXMA 1CBGA 2VQTA 3L21A 1UR0A 1FKWA 3VNLA 3GVVA 4N2YA 3VDAA 3DI1A 2P8BA 3AO0A 2XH2A 2QNEA 3N1AA 3VMNA 1TZ7A 1W56A 3GYEA 1X96A 3IV8A 4XZWA 5HWMA 5A6TC 4H8UA 4XUGA 4UQBA 4GLEA 2O9TA 1H62A 2JFEX 5CSSA 2INZA 2VX4A 5LA0A 4DO5A 3W0KA 4MPQA 4DJEC 3O6YX 2Y5JA 3GC2A 2AQOA 4LQ1A 3UESA 3KXQA 1K9TA 4YTUA 4WGXA 2WZIA 2XWDA 3PBUA 4W86A 4DBEA 1PIGA 4JICA 4Z2JA 1B1YA 3E74A 2XU2A 4RZ5A 1CYGA 2D0FA 4NG3A 5IM51 3TYAA 4IQDA 1C8QA 4EAYA 1US2A 3NNTA 1R7OA 1W31A 5AKQA 3WK3A 1J10A 1YIXA 3FY1A 3VNMA 4GUHA 3EOSA 1UQZA 3GD6A 5D2TA 3MBDA 4HU0A 4QLJA 4D8AA 2WHJA 4DJDA 1JIBA 1TTIA 1ZFJA 3QJAA 1ZHAA 3IVUA 2VX6A 2UWFA 2F6XA 1NEYA 4ZEPA 3NQGA 1JCMP 1KFJA 1Y7VA 2GJXA 7PTDA 5DO8A 3WNPA 4LF2A 1SZFA 3FEMA 3OVQA 4H19A 1LWHA 3H2MA 3I3EA 3UR7A 3LENA 3W81A 1V0MA 4GO8A 1KA9F 3TAKA 1P1MA 1KXQA 4MHBA 1Q6QA 3MUCA 4HTYA 3O3RA 3W7JA 4EIVA 5XINA 1NP0A 2YKKA 3KRBA 3E6EA 1C8YA 3UR8A 1CLVA 4S39A 1TPEA 3WDIA 4QJ5B 3W4RA 4BEQA 3GKAA 2EJ1A 1E6RA 5G4EA 4FLQA 2ESCA 4UTHA 3NVDA 3G1YA 4XD4A 4LYKA 3K8LA 1KM0A 4ORMA 1W1ZA 2DZAA 2VD8A 3MANA 3FJ4A 3EYPA 2Z26A 1VLIA 4C6JA 2J7CA 1HL9A 4JIRA 4AIOA 5CAKA 4QSHA 4QAWA 3UCDA 1LF1A 2Y70A 2ZRYA 1HO4A 4CN6A 2ACSA 3WQCA 3XIMA 4IP5A 1XSIA 5EL1A 2PZ0A 2Z1WA 1CPUA 3Q2DA 1JQVA 1Q65A 5DT7A 4FX6M 3H2AA 4JYFA 2B7OA 2QDEA 4K8GA 3AMKA 1UKTA 4Q8OA 3FJLA 5HWJA 5HK4A 2J6XA 7TIMA 2CLHA 2QF8A 5FEWA 2XGZA 4BZYA 1ONRA 4ZQNA 3HMCA 2J7DA 4IJCA 5C2CA 3GXFA 3N34A 5T9CE 3G1SA 2YGYA 3KW3A 2VDGA 1S5VA 4GI8A 4DAFA 1QRQA 1RA0A 2CEQA 5K2ZA 3R0UA 2ZUTA 4AVFA 1ML1A 2QIIA 3KTSA 2B0MA 4CEXC 3CB3A 4C6IA 1F3XA 3TA9A 1QOQA 4RE2A 2XN0A 3VNZA 2OMAA 3S1GA 5A8QA 3A22A 3THUA 1G5AA 4XX6A 1BVWA 5AHIA 2POZA 4OE7A 2OGYA 3O0KA 2QUVA 1UBSA 2NWRA 4JTAA 3UU0A 3GNNA 1LRNA 4MAZA 3WLPA 3R8HA 1VD6A 3QEZA 4IXHA 4NIRA 4TQTA 1XFBA 4LNCA 2DZSA 2C6QA 3OP2A 1I2PA 1ENUA 5FF0A 1FRBA 1UWRA 3S8HA 3VNJA 1UZDA 1FFRA 1BF2A 4WXYA 1LBLA 4ZCWA 4A8IA 1KCZA 1ADDA 1NOWA 1CB2A 1OFBA 4TTGA 4WSHA 5HNNA 4WSJA 2WXDM 4O52A 3ABZA 1RAKA 1D3GA 2WM0A 4AH7A 3LTPA 4DAIA 5CZKA 5AVNA 4ZODA 1JNDA 1P48A 3VDGA 4MY9A 1H7RA 5AYZA 5HUOA 3QW4B 4RDWA 4Q4OA 4C6LA 1R2RA 2OFJA 2ISFA 4C6NA 3GTNA 4V15A 2AAMA 4J5NA 1B9ZA 4X60A 3UFYA 4C1KA 1TJ2A 3SSZA 4QJ4B 1IR1A 4H83A 4P2VA 4IXXA 3ARSA 1EHNA 4C6OA 4X9YA 5BXRA 2OSXA 3HJEA 2X0SA 1UOKA 3UXIA 3OG3A 4FF7A 4PZVA 1PJ9A 2E8YA 1QW9A 3AU2A 4P7QA 3F1QA 1PXGA 2NX1A 3WQ5A 4E4UA 2BXYA 4WR3A 3TLQA 2DIKA 4DQWA 2VGFA 3S1WA 3Q94A 1YMYA 4ERAA 3I3BA 1J11A 3L0NA 4YL2A 4GKLA 2WYSA 5HINA 1E1CB 1G7UA 4JNZA 5GJPA 4PEEA 3ONBA 2JEPA 4M6QA 1CZ1A 1A5LC 4IPLA 2WSKA 4D6DA 4BA0A 3TVAA 1X8CA 1CLKA 3U6WA 3DHUA 4RV8A 4YYFA 1XBZA 1XYFA 4I6KA 3D5HA 4UFHA 1Z48A 4WSKA 2CC0A 3UJRA 4PGLA 1OD0A 3ONCA 3HB9A 4CN1A 3CUHA 1YDVA 1XDJA 3LQGA 4ICNA 2CPUA 3ZR4A 3ZM8A 1DQWA 3FK4A 2QCEA 3HGOA 2Q3RA 3MHGA 4C7FA 4K8EA 4XAYA 3GTXA 4C6PA 3A5VA 3N17A 4U3CA 3VKCA 2QR6A 4H41A 2Y62A 4A35A 3B8DA 4WDTA 2WJZA 1AA1B 1OB0A 3C3NA 3YPIA 3E0LA 4S1FA 1SPQA 4L61A 2FZDA 4FXSA 4PMOA 3S83A 1POJA 3T05A 3AMDA 1YDOA 1OD8A 5I3JA 3GHSA 1YTDA 4H04A 3ZSTA 1XG3A 3NQ6A 2EPNA 1TJ1A 3SQMA 2J47A 1PDYA 1E9ZB 1IHIA 4O4WA 3ABQA 4MG4A 1ALDA 3A47A 5LZLA 4OGZA 2PDLA 1S2UA 3VD5A 3WFAA 4IFOA 4MIMA 3PPFA 2GSHA 5K7JA 1ITXA 4BI7A 4RE3A 1FWEC 4KKXA 2VZUA 3K4AA 3T6CA 1Z7AA 1A53A 1W1IE 3LA4A 2Y6ZA 1H1YA 3N2MA 3ARPA 3CJPA 1C8VA 3OA5A 3MUXA 1R38A 1ZCCA 4U2ZA 1K8ZA 4H4IA 1Q4WA 2X1RA 3CQJA 1A5SA 1KRAC 3MVTA 4KPLA 1EBGA 1LL6A 3JRKA 4CNSA 1UJPA 2PC4A 3WUEA 1HJUA 4MKVA 1DE6A 2HPIA 4UBPC 5BOOA 1TV8A 5DLCA 5EU9A 3TIMA 2VVNA 4LVBA 1KWGA 1TG7A 4Q8NA 2PTWA 2Z2AA 3QYQA 4S2CA 4XD3A 2DIJA 3FVMA 1TMQA 4W9TA 1OG0A 1L6FA 2WVVA 3NZRA 1LLOA 1SUXA 1TJ0A 4NJGA 1W0MA 2BZNA 3WX7A 1IGWA 2JKPA 1OC6A 2E6FA 2WZMA 2WHKA 4K36A 2WW5A 3DFSA 1ICSA 1JRCA 2PB1A 3CIXA 4S3JA 4YVPA 4DO7A 2YFNA 3B8UA 2X2GA 4E8CA 3WL0A 5CPTA 2X1SA 3ATYA 2ATSA 3KVKA 3QVQA 4WKHA 1Y65A 1JZ8A 3SY1A 1SMDA 5LNVA 1XG4A 3TYDA 4LEFA 2ZVRA 4TU1A 5FEZA 3A9BA 5FF2A 2VR5A 4DY1A 1LDCA 3ZYZA 4Q3MA 3M9YA 3NPWA 1A0DA 5A6SA 1IXNA 4O50A 3CAQA 2C0AA 3VFLA 5A6LA 5AYBA 2WOQA 3W85A 4QG8A 4PA8A 2A3EA 2OQLA 1FOBA 1A80A 5REQB 3U4FA 2GGHA 3UCCA 3TJ4A 1FWBC 1T99A 3D6NA 1H49A 3WNKA 4GRSA 4IGSA 1DVJA 2VFDA 3AJ7A 4CNNA 2Y7FA 4IISA 3WLKX 2IPFA 3HG2A 1JAKA 3WG6A 3I4KA 3TTQA 3WD3A 2W6RA 3V35A 4JTLA 2CZ5A 1ELSA 3W84A 1GVFA 1WX0A 2OU4A 1B54A 1BRLA 1YNQA 2PLJA 2PPGA 1EP1A 1OC7A 2GVEA 2G3FA 2XVLA 4AWEA 4JTIA 2IQ0A 4I7WA 1YNPA 1OIFA 1GVRA 2QCNA 2XIMA 2VEMA 2OWXA 5BU6A 1CCWB 3OG2A 1OFRA 3S2NA 3ZSSA 3LXAA 3V0SA 4OOUA 2DZUA 3LCWA 2PDGA 4H9XA 1V7AA 3CAVA 5BU9A 3W27A 4FF5A 2PTDA 2CLIA 4MUZA 1AQHA 3U4AA 3VKDA 1OIMA 2OOGA 2BY1A 3LYEA 2VURA 2WZHA 4UQCA 3VIOA 1YPIA 2BB0A 4ECLA 4RX0A 1GVEA 4JFWA 2VOTA 2QVHA 4CD7A 1CNVA 3H22A 4JTFA 1NVMA 1PCKA 2ISVA 3E12A 1X1OA 1S5MA 2A6NA 5CH9A 3U0HA 3L4YA 2CU0A 3MUAA 1B3VA 3RX3A 1Q85A 4WKAA 1X1ZA 4KIRA 4C6BA 1XDMA 1EZ2A 4NQ1A 1SR9A 3RX2A 1W3IA 4OECA 2KAUC 1UKOA 2VWTA 2XTKA 1EHAA 1PX8A 1IE7C 3EWBX 2V63A 4HT3A 3U9IA 4BI6A 4UMBA 4DWSD 1J0KA 2FLIA 1FCBA 3WF1A 4UNLA 3QHMA 3OOQA 3RRAA 1TRIA 4HNOA 2G3IA 3CEPA 4UTUA 3VDBA 2NSXA 3KZSA 2C19A 2CZVA 1RCQA 4D1JA 2JBMA 2E6YA 1H4PA 1W3LA 4B5TA 3PBMA 3L2MA 5CLWA 2C91A 3AXMA 3F2CA 3CZEA 2QPUA 4LYQA 1FTXA 3P5ZA 2ZXQ