3KXQA

Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
237
Chain Sequence
IRPFIAGNWKMNGTGESLGELRAIAAGISRLFEALICVPATLLSRAFDILGGENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWTSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKAIDFLTICDVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6A resolution
rcsb
source organism Bartonella henselae
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 86
structure length 237
sequence length 249
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kxqA00
2V2DA 3AO0A 4LS1A 2ZA3A 2VFIA 4JXCA 3DH7A 4ONVA 4N9BA 2YR1A 5FEPA 1DV7A 4K36A 1QR7A 3C2VA 1GG1A 4O53A 1SZNA 2WSQA 5D38A 5F2LA 2OX1A 3QPYA 1W3NA 5CPLA 4XZ9A 4Y9AA 2B7PA 1MZHA 3SFKA 4FXRA 1XCFA 5F2IA 3LCXA 5E1QA 4PEKA 2FB3A 2OCZA 1B4KA 3P82A 4UR8A 5H91A 4LC8A 4KFOA 1H1YA 4MIMA 3GVGA 4XWUA 1K7EA 4O19A 1ICPA 1XKYA 3MJYA 1IGSA 1TPB1 1G4PA 3TSBA 3HO8A 3NM3A 2XN0A 4IX0A 2DZPA 3KOFA 3G1XA 4N6FA 3TROA 3GXTA 3VI2A 5KTLA 3BVJA 1DJNA 3PUDA 3THAA 2ZZ2A 2RH9A 5C2XA 3M7WA 3BW2A 3OVQA 3W70A 1TRDA 3JRKA 5G1YA 1V5XA 4MVAA 4RZ4A 4NZJA 3CM4A 1S5TA 1S3HA 3L2IA 3LTPA 4MJZA 5L6UA 1DOSA 3NOEA 4C1KA 1LYXA 3L9CA 1LLWA 4CCEA 2AAMA 1NF7A 2JKEA 3OVRA 1G4TA 1OX5A 5CZ0A 4JS3A 4GWEA 4Q32A 3LV6A 3W1UA 4TU1A 3S5NA 1T0OA 4MZYA 1ZENA 3T44A 3FKRA 3PG9A 4FIQA 4NX0A 3EX2A 3C2FA 5BOOA 1ALDA 2ISWA 3G1FA 1QPNA 4ALDA 1SPQA 1JULA 1FDYA 3S1XA 4RK8A 3LI1A 1TQXA 1KM2A 2Z6JA 5TBOA 4ICNA 2H6RA 1U5JA 4GFSA 1R2TA 1G7VA 4GUFA 1GVOA 1OF6A 3M47A 2HMCA 1YADA 5EBUA 5AC7A 5FF3A 3ABRA 3EKLA 5D2WA 2TMDA 4OV9A 1VLWA 5F2MA 5IBXC 4NNCA 5G1TA 2D73A 1KLYA 3QMSA 1KFEA 3RMJA 5FEZA 3KAOA 3WK3A 4Z1AA 4WOQA 3M1ZA 4NNBA 4HN4A 1UUMA 5DY3A 1QWGA 5D05A 4GUJA 1DVJA 2WKJA 5CSRA 1HL2A 2Y7FA 5C54A 4GE8A 2WNNA 2YW4A 4H6KA 4JEQA 4A2SA 5J5RA 4GXMA 1LP6A 3NQ8A 4LUJA 1LRTA 1JUBA 3A5FA 3L65A 4LV9A 2WNZA 5AOUA 6TIMA 1UB3A 2ZFAA 2ZZ3A 8TIMA 1O5KA 4RR4A 3LB0A 4AEOA 1MSSA 3GLCA 3W7QA 4DQWA 4E2DA 1NFBA 2VFHA 3NQEA 4Z0JA 3LLFA 1D3GA 4ORMA 2BX7A 4UMCA 1TV5A 3KVMA 4DBEA 1FCQA 5D37A 1BKSA 1FWNA 2A21A 1B3OA 4JYEA 3R8RA 4OT7A 3PUEA 4CNOA 1OK6A 2OJPA 3KVKA 4NXSA 3Q58A 3Q37A 4FHAA 2DORA 2VFFA 3EXRA 4P61A 3IVSA 3W85A 1K02A 2J6XA 4NT0A 4O1AA 3UWYA 3IIVA 1SUXA 4HHPA 4S2BA 5LNUA 1M6JA 2W79A 1HFBA 2DP3A 4JR5A 1W1ZA 3HG4A 4HIBA 4Q4KA 2B7OA 3HOJA 3TMQA 3W1AA 3HGOA 2Y7DA 2GQAA 3BLIA 4DO4A 2TPSA 3W3OA 5F4SA 3I7QA 3MHGA 1XUZA 1GWJA 1R46A 3T7VA 1XL9A 3TC6A 4NJKA 4Q33A 4N02A 1N55A 2GPTA 3O8AA 3DENA 2ZYFA 1Z44A 1FUYA 3UY8A 3IIZA 5DLCA 3UZJA 3S6DA 1R2SA 1W5QA 3FJLA 3OHIA 2VEIA 3EB2A 3DFPA 2VELA 1I4NA 4M6VA 4A29A 3O07A 5AHLA 3TIMA 3S1UA 3SR7A 1X1ZA 3LCWA 3GNDA 1F73A 2H3BA 3OG3A 1FX6A 2ZRWA 1GPWA 4K7YA 1W3TA 5DXXA 3NO5A 4UC5A 2DU2A 1YTEA 3S5OA 4KFPA 1Q6QA 3FOKA 3W1TA 3O15A 1E51A 2PC4A 4MLRA 1W31A 4CQAA 3M5XA 4RXFA 1ME7A 4IXHA 2ZZ4A 1OYCA 2X1RA 2QJHA 3ABOA 5AHNA 3NPVA 3DZ1A 2X1SA 1WA3A 3GNNA 2YPIA 1T8XA 1HUVA 4WD0A 3UWUA 4BWLC 1TPWA 1UUOA 1LROA 4DF0A 1QOQA 3ABSA 2NWSA 3O05A 4NJIA 2A1YA 3G1YA 3OEXA 3GYEA 4I7WA 4BK9A 3TW6A 1WAUA 4WQ6A 1VHNA 3STEA 1W5MA 3GB6A 2Y88A 3MUXA 2QCNA 1JJKA 4JTEA 3N3MA 5LGXA 1EP1A 4O10A 4AXKA 3U6WA 4IMFA 2P10A 1F6KA 3ELFA 4XQ6A 3LV5A 2WSYA 3QQ0A 2CZ5A 3IVTA 3QH2A 4LVDA 1L9WA 4LY8A 1KBJA 1XBZA 4A21A 5AB3A 4NVTA 4RKAA 3RF9A 4UTMA 1T96A 1TJRA 4IPJA 2RHGA 3FYOA 3T40A 1R2RA 3DFSA 4AWSA 4XKYB 3MBDA 2FLIA 1VCFA 2H8XA 1JCNA 5HWNA 4UUIA 5K3VA 2DJLA 4ZQCA 3W1XA 5G4EA 1BWLA 1X7FA 2CLOA 4J9JA 1KLZA 1KTCA 3FJ6A 2JK2A 1YTKA 2B0MA 1EUNA 2RFGA 4OQVA 2FPTA 1I2OA 3PB2A 4QNWA 3M16A 2CLEA 3QSRA 1KFKA 1C8VA 4A2RA 4D2JA 1P5BA 2CZEA 3LRMA 3MI2A 3VKJA 4UFHA 4N9DA 1B57A 4OWGA 4AH7A 4O16A 1SO4A 2GJLA 4O1BA 1ADOA 3C56A 4IOTA 3TC7A 1OFAA 4NJJA 2ZZ5A 1TYGA 2BXVA 1OYBA 1SZFA 4KWVA 5BMWA 3S1WA 2V30A 3CPRA 1SW3A 4JTTA 2WOQA 3BARA 4ZQRA 4PODA 4MYAA 2Q3OA 3A5VA 3WK0A 3QC3A 2GJNA 2QCGA 2VEKA 1XBYA 1ZAHA 4NXKA 3ZWTA 3U2OA 4ZQPA 1MO0A 3GDLA 1R47A 4ML9A 1KW1A 5F1UA 1GZGA 4U4MA 3DKJA 4NZFA 1LM1A 3W73A 1A5BA 3L5MA 2QCHA 3EX6A 1ZCOA 4EOUA 1K7FA 5FEWA 4WY0A 1HG3A 2JKPA 3C0JA 4WXZA 1UJPA 1M7OA 4JX4A 3ABQA 3B0PA 3G1HA 1AW1A 4AHQA 4MFEA 3LHTA 3UNDA 4X9SA 3IGXA 3M5VA 1L6SA 2Z6IA 2PRHA 3EWWA 3C6CA 1K3UA 3NYZA 1QPRA 3W07A 3WJXA 3IRDA 1KTNA 1WDWA 5G4WA 1OHLA 1J2WA 5EA9A 3WK1A 4UTUA 2FPYA 3WFAA 2ZCGA 1OYAA 2NV1A 3DFOA 3SGUA 1NVMA 1SO3A 3H53A 2ZRUA 1W8SA 3W7KA 3I65A 4FF7A 1LLZA 3LRKA 2I1OA 2E6DA 2Q8LA 5KZMA 3BPWA 3NZ1A 2QAPA 1PCKA 2CFFA 4XKYA 3P74A 1VPXA 5SWUA 2GVJA 4Y8FA 4JTLA 1SFLA 2PRLA 3QFEA 4CQ8A 4CQ9A 4N4PA 2E6AA 1ZNNA 2CLKA 2DZWA 4GBUA 2R91A 3L0NA 2FQIA 3GIYA 2CLLA 2F84A 3ZWSA 4NU7A 2QCCA 4MFDA 4NUWA 3LXCA 2ZDRA 4JIPA 1AK5A 1F5ZA 1VS1A 3GDMA 4DPQA 2GOUA 2YYUA 1FCBA 3HB9A 2QDHA 3HPXA 1GEQA 5HR7A 5LNVA 1VZWA 2V82A 1H7XA 1SR9A 4Z1CA 1YXCA 2W0UA 3ATYA 5D02A 2E5BA 3C4UA 3R2GA 4BF9A 5U4NA 3FKKA 1VJIA 2ABAA 3NQMA 3UWZA 3HG2A 1DHPA 3V1PA 1I2QA 1GTEA 4M5PA 4HNVA 1OFEA 4FNTA 5HUPA 2HTMA 3H55A 2DZUA 4IGHA 3CEUA 3MP3A 2HS8A 2V2CA 1Q6LA 1FBAA 4UXDA 4LS2A 3W2MA 3QJAA 5C6MA 3VE7A 5D09A 5BW6A 5HNRA 5HUOA 4ADTA 2C18A 2A7PA 4CNNA 3KVLA 4UMBA 1HTIA 1F7BA 4E0CA 3NL3A 5FI8A 3LCHA 4BI7A 1QMLA 3DFNA 1Q6RA 5KMYA 5CKSA 3O6CA 1TB3A 4S2CA 5L9FA 4K6AA 4IUOA 4PA8A 1D9EA 4MY1A 3SZ8A 4NX5A 2F7FA 2NXIA 4LTSA 3WK2A 5FF2A 5GVJA 5A5WA 4O13A 1G4EA 2CLFA 3A9IA 3OA3A 1PV8A 3L0KA 3C8FA 2QUTA 3N19B 1L6YA 2VFEA 5HULA 1ME8A 1AG1O 1EX5A 1YLVA 4JY9A 1F05A 2QDGA 4JTGA 5D04C 3TAKA 5J5DA 1G6CA 1SSGA 3NQVA 3PVFA 1OG0A 2A4AA 1MEWA 2G96A 1A53A 4MUZA 4ORIA 3S5ZA 2ATSA 4IQLA 2ZQ0A 1FWRA 3LX9A 2A7RA 5D32A 4O0ZA 4WJEA 3TKFA 1WBJA 3W7DA 2V5LA 4JYDA 4UTHA 3EX3A 4PL1A 2A6LA 3GAKA 3N73A 1K8XA 3TJXA 1QDSA 3E9AA 1IXQA 3R13A 3SW6A 2CWNA 4Y90A 1H7OA 2DZSA 5EMUA 1GOXA 5K9CA 4LW7A 4POCA 3T78A 1XDLA 5EYWA 2YZRA 4IJBA 2ZA2A 1DQWA 3N2MA 3FEMA 2QJIA 3TAOA 1QFEA 1CW2A 1XBVA 3GKFA 5AN7A 5CPNA 2GVGA 1GT8A 2A0NA 3QW4B 4UTJA 3S8HA 1G4SA 4PCFA 2I9EA 2ZRYA 3FFSA 2VOMA 3KRUA 4LOCA 2NX3A 2KZHA 4JTFA 2I14A 2NZLA 3TJLA 3O1NA 2WNQA 4K38A 1RQHA 1XFBA 3N9RA 3UYCA 1PIIA 4YWIA 3QF0A 1A50A 4QJ1A 4DXVA 1OFPA 5K4XA 3GAYA 3PUOA 4MKNA 3F1QA 1JCYA 3DHDA 5DN1A 4UTWA 1V7YA 3STCA 5KZEA 1RV8A 4E2BA 1FWSA 5D2TA 1WYIA 5G2WA 4O8RA 3NNTA 1EWEA 3HPSA 3BK0A 1ZALA 4FXSA 4O4VA 4RZ5A 3CHVA 4YCOA 1TO3A 1FWWA 4EF8A 1YDOA 3UY7A 4IWWA 3I6RA 3T4CA 1OX4A 4HNNA 3W7PA 5I3KA 3NPXA 1W37A 3HPZA 3G3MA 7TIMA 1H61A 3W1NA 5K7JA 4DEFA 3T55A 3GR7A 2TSYA 3W6YA 2ZRVA 4N4QA 1VRDA 3HF3A 4H3DA 1KM5A 4R33A 2HS6A 3SIZA 4OV4A 1THFD 4WY0B 3G22A 4CLMA 1SZGA 3LERA 3GK0A 1VGAA 1QOPA 2E6FA 4DO6A 3QYQA 3P81A 1YYAA 1TTJA 4XTIA 1XXXA 3QW3A 2YW3A 2R14A 3TQKA 3W7HA 4AHOA 4S1FA 4JD4A 2VXNA 1C9DA 3IGUA 3S42A 3O6YX 4NJHA 1PVNA 5EKYA 1SW7A 5U7SA 1DBTA 4G1KA 1U83A 2B7QA 5AHMA 4ZL1A 2WO5A 3G1SA 3FS2A 4DO5A 1ICQA 1G69A 3W83A 2PCQA 3PB0A 4JTUA 5ABTA 3O6DA 5DCEA 3DI1A 2G95A 2ZTKA 3LBCA 3TA6A 1H7NA 1PHQA 3EX4A 1IXOA 1Q3NA 1Y0EA 3STFA 1N7KA 4PFMA 3C3NA 3QRHA 3QSTA 5DBTA 3ZS4A 4LVGA 2C16A 5F2GA 1W0MA 5DBUA 4CCDA 1WQ5A 2R8WA 1T99A 4K7VA 2NV2A 4GC4A 2VFDA 4UTTC 2QEZA 5F4XA 3GXPA 2VENA 1TPH1 2YSWA 1OFQA 2VFGA 3G3DA 3MP5A 4BI6A 3LHUA 3GDKA 3NQGA 4QNEA 3C2EA 2C13A 3P61A 3B0UX 1PE1A 3UXDA 2LLEA 2NXGA 3GZ3A 3LCLA 3OIXA 3USBA 4JICA 4O52A 3LXAA 4FX8A 3W87A 2Y70A 4UIOA 3RLUA 3INPA 3NA8A 3R12A 2FFCA 3WJWA 1YDNA 3K30A 3W23A 3LHVA 2GUUA 1TCDA 4MYXA 2GQ8A 3G0SA 1LBFA 2J9YA 1FWTA 3P5YA 4EWND 5K9DA 2ABBA 4UFIA 3PWAA 3V75A 3DFTA 2ATMA 3IGSA 4K39A 2WQPA 3M6YA 1UBSA 3W1QA 1FXQA 1RPXA 4JN6A 1JVNA 2EKCA 3TE9A 1F76A 1H60A 4UTTA 1NAL1 2EAWA 3DXIA 2OT1A 2Y6ZA 3QPZA 1K03A 3DHFA 5G5IA 1IF2A 3HQ1A 1ZJIA 4TMBA 3W9ZA 3Q94A 2C3ZA 4FB7A 3TSMA 2QCMA 1SZEA 2V9DA 1XC4A 1J4EA 1XUUA 4ZQMA 1HO1A 3W76A 2DZTA 5AYYA 3GR8A 1XM3A 1X8FA 3HG3A 1CI1A 4UFMA 3B8DA 3I7SA 4N9CA 4UTKA 4X2RA 3MWAA 1XBXA 4PC8A 1ME9A 1ML1A 3HGSA 3TX9A 5DELA 3KRZA 4N9EA 4IMGA 5HJLA 4O18A 3P84A 3TV8A 1QCWA 3L66A 2NX1A 3MP4A 4M7SA 3L0GA 3Q2DA 2H3DA 1F2JA 3W88A 3P67A 3TR2A 2E1DA 4UCGA 3CT7A 4ZQOA 4BI5A 4R53A 1LRNA 4PH6A 5HWJA 1R30A 4LVBA 2YDAA 5LNSA 3EXTA 1ZHAA 5H2ZA 1SSDA 1A5SA 2E6YA 4FNQA 4HPJA 1TPFA 3EWBX 1RQBA 2A6NA 4QSHA 2OT0A 1TPDA 1M7PA 3STGA 1FXPA 2V81A 3MI6A 4QITA 3A23A 1AL8A 3HG5A 5EL1A 3YPIA 4OHQA 3QQ1A 1VCVA 1F74A 1Z48A 2G5WA 3DBPA 1W56A 3W71A 3L68A 5FEXA 1BTMA 2TRSA 2YYTA 4OE7A 4FEZA 3GX9A 3BG9A 4H4IA 2C0AA 5G2HA 1RVGA 4FNRA 2VEMA 3LM7A 3W7RA 3G1DA 3SJ3A 1TPC1 1XDMA 3SGZA 2BSLA 4WZHA 3I7RA 1OK4A 3JS3A 4BFAA 1VHCA 3LBMA 1SQ7A 3NL5A 3H54A 3TDFA 1X6UA 5KSWA 1HO4A 1K7XA 1RR2A 3G0UA 4I9AA 3NPWA 1YXYA 4JGDA 4QISA 1ZFJA 3RK8A 1IIGA 2XFWA 4O12A 4A3UA 2CU0A 3G24A 5CSSA 2QCDA 3TXZA 1O94A 4JX6A 2EPHA 5LNWA 5E93A 2A5HA 2HSAA 2ZZ6A 1KM1A 3P80A 4O28A 4LWWA 2NXHA 4RCXA 3D0CA 1BEUA 2A2IA 4X3ZA 3MI3A 1KM6A 3NQ7A 4EIVA 3GDTA 3JR2A 3TQ0A 1GVFA 4AF0B 3F03K 1BWKA 5D2YA 1TIMA 3F4NA 2C15A 3P8IA 4LUIA 2X2GA 5HR6A 2QCEA 2FPVA 3DGRA 2IQTA 2X16A 3C52A 3UWVA 1XI3A 4I7UA 2GVLA 4AF0A 5T26A 1DKWA 3NVTA 4Z1DA 2E5CA 4JTSA 4YLWA 1JCLA 3VNDA 3EEGA 1P1XA 2J24A 2BWGA 5HMSA 5LHEA 4WOZA 1KFLA 1P0NA 1VLIA 1GTHA 3FLUA 3MHUA 4RV8A 3G1VA 1NEYA 4O0KA 4Y96A 1GG0A 2WSRA 5FF7A 3AJXA 1G7UA 2E5DA 1TMHA 4LC6A 4O17A 2AQWA 4O1DA 2A7NA 4O11A 5FESA 4QAIA 5BMXA 4N6EA 4X22A 3NQCA 4XTDA 1GQNA 1OABA 1GVRA 4KKXA 3CEPA 3TFXA 1KBIA 2FDSA 2BZNA 3IVUA 4IMEA 3IEBA 1TTIA 2P0OA 2WJZA 4UMAA 2YXGA 3TXVA 5A8GA 3UPWA 3TH6A 1TREA 3EWZA 5D30A 5K2ZA 5AC8A 3KX6A 4MLJA 4WX2A 2ZTJA 4YMZA 1SO6A 1H62A 4QQ3A 1EUAA 2QKFA 2ZZ1A 3R89A 2VEPA 5KZDA 3S1VA 2Z1BA 4WUIA 4DPPA 3I68A 1H51A 1VQTA 3BO9A 3P5ZA 3LCFA 2YX0A 4E38A 1IXNA 1OFRA 4L4MA 4YL2A 5AHFA 1VCGA 1EWDA 1A5CA 1QO5A 1Z41A 2Z0IA 3W74A 3NGJA 3HMJG 1WOAA 4GJ1A 4UTLA 3EX1A 2ALDA 3M5YA 3N34A 1I2NA 4ZZ9A 2E68A 2FB2A 3MW7A 1ICSA 1H50A 3SECA 1N8FA 2QAFA 3BW4A 3KXQA 4NNAA 5AYZA 1EIXA 4JTKA 4O4WA 3ZFHA 2NUYA 2ZRZA 1O4UA 4GRSA 3FYPA 1H1ZA 2JKAA 3NZRA 4Y6GA 2ZZ7A 2Q8ZA 5I3JA 2Z2UA 4DBDA 3TUUA 3W2JA 4FNUA 4BWLA 5EY5A 1TTPA 5I3HA 3PR2A 1DORA 1CX9A 1VYRA 4MOZA 3E02A 3VE9A 3KVJA 1GVQA 3NDOA 4AMAA 1AW2A 2JGQA 1K8YA 2NLIA 1VR6A 4UFKA 5AHEA 3U8GA 1RZMA 3W7CA 3QMTA 3LHYA 4TIMA 3MHFA 4OU1A 1LZOA 2CLIA 3EWXA 1W3IA 4I7VA 3PG8A 1O60A 3LTYA 1LTDA 4TO8A 1O5XA 5DCBA 1TPUA 2X30A 1TJPA 2ZRXA 1SFJA 1FDJA 4UNKA 3EWUA 3TQVA 5LZLA 2Y63A 2DZVA 4PTNA 5LSMA 3P8JA 1RQEA 1AL7A 1LORA 5FF0A 3NQ2A 4KFNA 1C29A 1H7PA 3PF3A 3RFAA 4ZQNA 1I8JA 4FX6M 4P2VA 1P0KA 3RU6A 4OBTA 2RDWA 3IIPA 2FJKA 4UFLA 1WX0A 3EXSA 3QEZA 1G67A 3KRSA 1MXSA 3G1AA 2P1FA 6ALDA 2EGZA 5E0KA 1L2UA 1QPOA 1NF0A 3MBFA 5C55A 3VCRA 1X1OA 3NEVA 3M5ZA 2Y89A 4GUHA 3SSJA 3G18A 4XBKA 2ISVA 1KFBA 1EP3A 2BTMA 3CWNA 1KV8A 2YFOA 3CIXA 2B7NA 4PL2A 1GYNA 2WPBA 2E77A 4JDBA 4UTWC 2CZDA 2Y7GA 3BGGA 1KTBA 1EEPA 1GYLA 3IIOA 1KM4A 4UFJA 4IX2A 4HPXA 3OBKA 3PULA 5C5YA 3DKLA 1B9BA 4DF1A 3NAVA 4Z0SA 4QIUA 2PURA 2C1HA 5I3FA 4RLIA 1YXDA 3MO7A 1W5OA 3W7NA 3G8RA 3WJZA 3PBYA 2V0TA 5AFDA 3BG5A 3W2LA 4Z1BA 4LV4A 4QM1A 3S0CA 2QCFA 3GXNA 2E09A 2OZ0A 1YTDA 1WBHA 2Q3RA 2X1TA 1UASA 5CZTA 5F4WA 3DFQA 2G97A 3W7LA 1JRCA 3W1MA 2J9XA 3L5AA 3LHZA 3E49A 3PBVA 1LOQA 1LOSA 5I3IA 3L21A 3O63A 4CNPA 3VFLA 1H7RA 5K4ZA 3W22A 1GVSA 4ZMGA 4O1CA 4TR9A 5CPOA 1VYPX 3RNDA 3MMTA 1WV2A 3N2XA 1JCMP 1AMKA 2NUWA 1I45A 5LKYA 3FA5A 2QCLA 5EPDA 3OVPA 1VYSX 4EF9A 4BR1A 1QPQA 1WOBA 1QAPA 2YGYA 3MYPA 3LLDA 2QR6A 4LNYA 1ONRA 3W2NA 3PAJA 3LOTA 1EP2A 3W7GA 2CZFA 3CB8A 3LDVA 4ADSA 3HIJA 4JNMA 1YDVA 1TRIA 3PS7A 1LBMA 3TCEA 3R5EA 3ATZA 3L67A 2V8ZA 4MZ8A 3BW3A 1Q6OA 2C6QA 4HNTA 4O15A 4LS0A 3ZR4A 1FY6A 3NQ6A 1TV7A 4M7TA 3E12A 1OFDA 3BLEA 3M43A 2XN1A 3B06A 3HBLA 4MY9A 1LDCA 2NUXA 3EKZA 3HGRA 3LXBA 1EPXA 5DY2A 5DXYA 3B05A 1OF8A 4JY8A 4IXXA 4R34A 1ZAJA 1FDZA 3W75A 2ISSA 4LRTA 2C14A 2AGKA 3BLFA 1H63A 1W54A 4K8EA 1AW5A 1JR1A 3QZEA 4TMCA 1JCXA 1EA0A 5TIMA 3DAQA 3F4WA 4CCCA 5D2XA 5TQLA 2FIQA 4HSNA 1OFBA 4JYFA 4A22A 3DI0A 1TPEA 1SU5A 5CG7A 3KFTA 4MPQA 1Q45A 3QM3A 1LCOA 3NL6A 4K37A 4AAJA 3WJSA 2UV8G 1KM3A 3L5LA 3S5YA 1PCWA 3PBWA 4LT9A 3W2KA 3GKAA 2V5BA 3CWOX 1LRQA 3O16A 3EWYA 2VKZG 3NPUA 4O14A 4C1LA 2H8ZA 4FO4A 2QUVA 3NL2A 2H90A 3LCGA 1I2PA 5DCDA 4DELA 3M41A 1PS9A 3PSVA 3RLVA 1K8ZA 4GUGA 1M5WA 1TSIA 3W7EA 1O95A 3B03A 4RJEA 4MY8A 1F6PA 1OFOA 2YFNA 3UQNA 2WV8A 3UWWA 2CW6A 4HKPA 3QMRA 1S5VA 4AVFA 2A85A 3UWQA 3NM1A 3THQA 1DJQA 1LOLA 2FTPA 3TK7A 2O7QA 3G0XA 1W5PA 1DL3A 2OMAA 1H7WA 5D33A 4M6QA 4AWTA 5LNRA 1JQXA 2RKXA 2BLEA 1YPIA 3B0VC 3LI0A 3PC0A 4XUGA 4TX9A 4KWWA 4Z08A 3C2RA 4UNLA 3TSDA 1JRBA 4MZ1A 5AYXA 4O50A 3UPBA 4O54A 1Z42A 1YPFA 1SW0A 3HGJA 1WXJA 4YXGA 1GJPA 3M9YA 4AHPA 5KITA 4HSOA 1VC4A 3A21A 2Y85A 1JUEA 1MEIA 2X1UA 3LRLA 3N14A 1QNVA 3IIXA 3B04A 3TW7A 3PSWA 4M19A 4IMDA 5AHIA 1KV5A 3W2UA 4JX5A 2EF9A 3CTLA 2ZBTA 1SO5A 2J88A 3PY2A 1FCVA 3S9YA 1KFJA 3W1RA 3ANYA 4JTJA 4ADUA 5I3GA 5AC6A 3BV4A 3W84A 3TU9A 2DJXA 5FF4A 2Y61A 2CLMA 4FNPA 3LCIA 2CLHA 1OX4B 3NG3A 3BGJA 4LVFA 2Y7EA 4HNUA 3W7OA 3UXAA 5BNKA 1TV8A 5BRBA 1VH7A 4JDYA 2C19A 5HQEA 1IXPA 1EB3A 4WXYA 3P7YA 4L4LA 4XBSA 2NWRA 3W72A 4O57A 5F1VA 3GDRA 2EHHA 1S5WA 3CU2A 4M6PA 2RDTA 1P4CA 2XN2A 3C61A 1H5YA 5CPMA 4NJGA 2QCDB 3A22A 3P60A 4B5NA 1MEHA 3W7MA 1KA9F 2JGYA 3TFCA 2QJGA 3DU0A 3FIGA 3CQ0A 4AWUA 1NSJA 1B4EA 1FQ0A 4LRSA 3CIWA 2W6RA 4EVZA 3C2OA 4FX7A 3SY5A 3M44A 2DZXA 1PHWA 4FNSA 4K8HA 3BG3A 4N2YA 3P62A 5D2VA 3A24A 3PM6A 3CLMA 4IPIA 3W7JA 2GQ9A 3MYOA 1OX6A 1TPVA 3G8EA 2QUUA 3N9SA 4HT3A 4FIRA 4LVAA 4W9TA 1A5AA 3IV3A 1KM0A 1LBLA 5CZJA 1PL9A 2RDUA 4OGZA 1JUKA 1KFCA 2O7SA 4ZVJA 2TYSA 4RZ6A 3NQDA 5D03A 5CGQA 2ZA1A 4AB4A 5LHFA 4LU0A 2V2HA 1TQJA 4JIQA 1IIHA 4YCPA 3LHWA 5K9XA 5G2IA 2J27A 1ZY9A 1JQVA 4UR7A 1ZAIA 1JCJA 2JBMA 4NQ1A 1I2RA 3E0IA 3LGEA 4MJMA 4UTIA 2Y62A 5LGZA 1TTQA 2B4GA 5IM51 4RX0A 3NR0A 1J5TA 1OJXA 3UD6A 3W1LA 3W1PA 3UZ5A 3NQFA 2PE4A 2J9ZA 5CZSA 2VC6A 1OVDA 5MHBA 1DQXA 4R7JA 1W5NA 1FCUA 2R94A 3O06A 1L6WA 1UCWA 4U28A 1D3HA 3TNOA 3W7IA 5HWMA 2NX9A 1RD5A 3CC1A 3HJZA 3LTSA 3NXFA 3SI9A 4GUIA 3TMLA 4GNJA 4JTIA 4DF2A 4JTHA 3NQAA 2YCEA 1QO2A 3E96A 4WY0F 3KHJA 2PRMA 4IMCA 3WJYA 2QF7A 3W86A 5IBXA 5KINA 3B4UA 4RXGA 3PBUA 3M0ZA 5HINA
chains in the Genus database with same CATH superfamily
4DZAA 1VEPA 3AO0A 4LS1A 4N42A 2ZA3A 4JXCA 5EB8A 4N9BA 4QCFA 1CENA 2KAUC 4NYYA 3QGKC 4FLOA 1GG1A 5D38A 5F2LA 4ZO6A 1E40A 2OX1A 1EBHA 5CPLA 3H2CA 4XZ9A 4Y9AA 3UG5A 3W25A 1MZHA 3SFKA 4FXRA 1B54A 1MDLA 4XUYA 3P82A 4QROA 1PKYA 4LC8A 5BRQA 4C6DA 1CXFA 1XKYA 2FFIA 3T6CA 1L8NA 4HTBA 5H8UA 2VGIA 3LQLA 4IX0A 3HV8A 4FP1A 1JI1A 4GYKA 2GDUA 1GVYA 3O7UA 5A2CA 3CS2A 4PUKA 4PUJA 2YA2A 2XWEA 3PUDA 1XCXA 3THAA 2ZZ2A 4M81A 1TZ9A 4GHRA 3BW2A 3OVQA 3CUXA 4QX4A 5G1YA 1V5XA 3WY1A 1KRAC 2NQHA 2OB3A 4JNYA 3QFWA 1S5TA 3UGRA 3IJ9A 3BUVA 5HAOA 4KWOA 2PU1A 4Q4SA 1HW6A 3QGAC 3B8WA 2AAMA 2Q71A 1UZHA 1XLHA 1Z32X 3OVRA 3EOLA 5CZ0A 4EPBC 1ONXA 3M07A 1QT1A 3VIOA 3TYEA 3T44A 2Z26A 3FKRA 1E6RA 2XJ7A 1KD0A 1ALDA 2BV9A 2ZKMX 3IWPA 4PUUA 4ATWA 4RK8A 2CKRA 3LI1A 5CC6A 1TQXA 1KM2A 5TBOA 4ICNA 2H6RA 4ERAA 2EJAA 1RBLA 1ESWA 3GDBA 1GVOA 5CPSA 1K4HA 1YADA 2CC0A 5FF3A 1O12A 3EKLA 5D2WA 3UJRA 4L6OA 4HHHA 1KXHA 2F2HA 3WX7A 1BD0A 2V3DA 5FEZA 4LF1A 4NNBA 5D9PA 4IM4A 4D6HA 1QWGA 5D05A 1DVJA 2D3LA 5C54A 5LA0A 3RJYA 2YW4A 4H6KA 1XLEA 2WJEA 5CZKA 3TTQA 3NQ8A 4LUJA 1VBUA 4RNJA 3L65A 3KTSA 2ZUNA 3ITXA 5AOUA 3QXBA 2ZX7A 4JIRA 4RR4A 1P7TA 3ABZA 3F7JA 4AEOA 1GHRA 1JD7A 1TMLA 2Q09A 2GLKA 3R8HA 2WYSA 4DQWA 3PBMA 1JZ5A 2VFHA 1EJ7L 3NQEA 4Z0JA 2E8YA 3A4XA 2BX7A 4LCQA 3WD2A 2INZA 3B9AA 5D37A 1BKSA 1WAWA 3MKCA 4E8GA 5I5RA 1RALA 4CNOA 1OK6A 1QI3A 3FXYA 3KVKA 2XZ7A 3Q37A 2DVXA 2PC8A 3TTYA 4GY7A 1BLIA 1GUVA 4RUBA 4F0SA 3UWYA 1DQUA 4HHPA 4UQDA 2W79A 3P14A 2DP3A 2R1MA 3CV2A 4ZO7A 3N1AA 5BYWA 4Q4KA 1BFNA 1R7OA 1RH9A 2EG6A 1TX0A 3CV7A 3EA2A 1PKLA 3I7QA 5F4SA 4HOXA 3MHGA 3ICJA 3WLSA 4A8RA 1AA1B 3DC8A 2VZVA 1HL8A 4JFSA 2CITA 4CU8A 1FUYA 3W27A 1JEZA 2OKTA 3IIZA 2OKOA 5DLCA 4B9YA 3WNPA 1VJSA 4IGNA 4DY1A 1W5QA 3C2YA 3OZMA 2J25A 1I4NA 4M6VA 3TIMA 3H8AA 2H3BA 2ZRWA 3WUEA 4S3KA 3VMNA 4K7YA 1W3TA 1OEPA 1JF5A 4D6FA 5DXXA 3KDNA 3SQSA 3SUVA 1F61A 4NP7A 4PMOA 3NO5A 2F61A 4KFPA 3W1TA 3O15A 3OZPA 4YNGA 3QVQA 3SIMA 4RXFA 3UXKA 5CQ1A 2ZZ4A 3SCRA 5JUVA 2WNWA 2QJHA 5GJPA 4LAKA 4H8UA 5AHNA 5HQLA 4MNLA 1UUOA 2YBTA 2X42A 4I5XA 4DI8A 3H4XA 1GYMA 2NWSA 2A1YA 5GJMA 1JXKA 3W4RA 3T9PA 4WHBA 3AHVA 4MAZA 3TW6A 4NZ1A 1BG4A 4WQ6A 1VHNA 3STEA 4L9XA 3MUXA 3AALA 4JTEA 4WK9A 4G5DA 4E2VA 3H7RA 2FGLA 3U6WA 4DJDC 1F6KA 3DG7A 3V7PA 3LNPA 4DWSA 3QQ0A 3IVTA 3L4UA 4HNOA 2ZIDA 1XBZA 3QTPA 1O68A 4NVTA 2O0TA 4JKLA 3RF9A 1TJRA 4MG4A 3FYOA 3D3FA 3AS2A 4NAFB 3WG6A 2J7DA 3JU2A 4LBRA 4QGCA 4AIEA 4X0VA 2DJLA 4BQ3A 2BNJA 3FJ6A 3ITYA 3QR3A 1EUNA 1BSLA 2FPTA 3PB2A 3EB4A 1KFKA 3G77A 1XHGA 1C8VA 2AL2B 1P5BA 2CZEA 3VKJA 4F9JA 4UFHA 3POCA 5CEWA 4OWGA 2GJLA 1RP8A 3VD7A 4O1BA 6A3HA 4R3UA 4XD5A 1OFAA 2OPJA 1ZSXA 4NYUA 4B9ZA 2ZZ5A 4RE4A 1TYGA 3ARVA 2BXVA 3PFRA 3SADA 3M0MA 3S1WA 2YB4A 2ZUMA 2WOQA 3BARA 4PODA 1OWQA 3JUGA 4MYAA 2Q3OA 3A5VA 7TAAA 2WANA 1UR1A 4P8XA 2VEKA 1XBYA 3AXXA 3U2OA 3QV9A 2UY5A 2ZUUA 4BF7A 4U4MA 3SSZA 3W73A 2O4QA 1PIGA 4AY8A 1XYMA 1EJXC 3WQPA 3VXGA 3CK5A 2QMKA 4HMNA 3WQGA 1GHSA 1HG3A 1PX4A 1E0XA 3SUWA 3ABQA 3B0PA 1NM9A 1W1B1 3G1HA 4C5YA 1KWGA 3LHTA 1J0JA 3UNDA 5H8MA 3IGXA 1L6SA 3FX4A 4H00A 2Z6IA 2VVSA 2WHMA 1IR1A 3EWWA 1ISYA 1QPRA 3W07A 5BZAA 4HYVA 3PTQA 4UTUA 4JTRA 1US3A 3SUSA 3WFAA 1TWDA 3H2AA 1OYAA 2NV1A 3DFOA 3W29A 5AC4A 4H9YA 1LQ0A 4Z42C 3LRKA 5C7VA 4Z2JA 6XIAA 2PTWA 3WZ0E 2PDNA 3BPWA 1MYRA 3IJ7A 4ZTXA 3QFEA 2G3MA 1G9HA 3GXMA 3GIYA 3QHMA 3ZWSA 3ERPA 2IUZA 1CEOA 2ZDRA 1H0IA 2HBVA 3GDMA 2YYUA 1S46A 5IXEA 3S9ZA 3S2LA 3F2DA 4Z17A 3WBXA 1YXCA 2W0UA 4DWSC 4HPHA 2UBPC 3KBWA 5U4NA 2VZOA 3ARSA 4XZLX 3FKKA 4WKAA 3NQMA 3WO8A 3V1PA 1I2QA 1GTEA 3UJEA 4HNVA 1BQCA 2IPWA 2DZUA 2PA6A 3QY7A 3MP3A 1A0DA 1UZ4A 4UXDA 4NY2A 3W2MA 3UXLA 3VM7A 5BW6A 5HUOA 3CZKA 4ADTA 4CQDA 3AMGA 3WEOA 4AWEA 3NL3A 4WGXA 4R85A 3CL6A 3DERA 4E4FA 1PX3A 3MMDA 4V33A 4K6AA 5I77A 5BU6A 1WDSA 1DWAM 3B4YA 3SZ8A 4NX5A 4FLRA 3T07A 4J3ZA 1EGZA 3TP4A 5FF2A 3S4TA 1UUQA 3SRFA 1RSCA 5A8NA 1PV8A 4PTMA 4C1NA 3VPLA 3EGJA 3TCSA 1QATA 4QHRA 3UJSA 1EX5A 4LCSA 1OGBA 3TAKA 3WDHA 3VOFA 4HP5A 3HJEA 4QSFA 3PVFA 2VWTA 4MUZA 1A53A 3S5ZA 5DT7A 1UWTA 2W92A 3RX3A 2A7RA 3TKFA 4O0ZA 5H1WA 2JEPA 3EX3A 2A6LA 3E9AA 2Y8VA 1JXJA 2CWNA 3BOFA 3SW6A 4Y90A 1H7OA 2DZSA 4L6HA 4EAMA 5EMUA 2XH2A 5I79A 5K9CA 4U2ZA 2OXNA 3TYZA 4KEZA 3CIVA 3J7HA 1XH2A 3UCCA 1MNSA 1DQWA 2PBGA 3N2MA 1VB9A 1EF2A 4ASTA 1QFEA 3UPMA 3EDDA 4XAGA 3GKFA 2H9AB 2A0NA 4KEMA 3T2OA 4CGTA 3QW4B 1G4SA 2ZXQA 2ZRYA 1NQKA 1O7AA 4HJWA 3VU2A 2KZHA 3TJLA 1PZ1A 3O0KA 3PJXA 2WNQA 1XFBA 1BRLA 2DT1A 1PIIA 4DLMA 4I5UA 4FAMA 2FGBA 3PUOA 4L1GA 4DIAA 3F1QA 3DHDA 5C71A 4UTWA 1Z9AA 4EAYA 1FWSA 1UIOA 4G2DA 2Z24A 5G2WA 2VO5A 3O2LA 1EWEA 1V3KA 3IS4A 3BK0A 3C5QA 1P43A 1CTNA 1Y65A 4H83A 4FXSA 4O4VA 5CXPA 3BJTA 1FWWA 3PZIA 2BXZA 3V5CA 2QLYA 3T2PA 1XWYA 3HPZA 4Z2GA 2WBGA 3W1NA 4DEFA 2TSYA 3NGFA 1EYEA 2OSYA 4N4QA 3HF3A 1REQB 2WZIA 2WZEA 1V6XA 2HEJA 4H8VA 4KCVA 4D6IA 3G22A 1R3YA 4H9UA 3GK0A 5B80A 1QOPA 1C7SA 3WUBA 4TX6A 1TTJA 3QW3A 4KEVA 3GNRA 4E3TA 1LLOA 1JGMA 1R6WA 2BB0A 4BY3A 2PAJA 4NJHA 3L4TA 2P3EA 2PWVA 1SW7A 5U7SA 4DM2A 1FWBC 2BG5A 4CD4A 5AHMA 1R85A 2O92A 4M1BA 4AIUA 1Q13A 1ICQA 4AZ7A 1G69A 5E09A 3W83A 2BOEX 2XM1A 3ES8A 3DYMA 1VAHA 5DCEA 3DI1A 2XVPA 2ZTKA 3EOSA 1IXOA 1Q3NA 1B30A 4C1NB 4DYKA 1Y0EA 2O9TA 1ZLPA 3QSTA 3WENA 3T81A 3QLLA 5F2GA 1W0MA 3HFYA 3R7MA 2R8WA 2NV2A 4QEEA 1A4LA 2VFDA 1MMFA 3GXPA 2BHYA 1UMYA 2VENA 1IWBA 4WJ8A 4AFYA 2D0HA 3WQ6A 3R10A 4F2BA 3TTSA 2O9OA 1PE1A 3V0UA 2GQ3A 1CECA 2JFEX 2RAGA 2RJGA 3NDYA 3WL0A 1A49A 1S39A 4MUPA 4LB3A 2XWDA 4JICA 2J77A 4FX8A 3W87A 2Y70A 2F6UA 4UIOA 4M1RA 3PZGA 3MY9A 1YDNA 1KWKA 4MYXA 3CNYA 1XGZA 3R6IA 4MTVA 1EHNA 5K9DA 2VT0A 3U7VA 1E1EA 3V75A 4HA1A 1DIOA 4GZEA 3M0XA 4A3HA 5FAGA 1F3WA 3ALFA 5FA5A 1RPXA 2EKCA 3TE9A 4LB4A 4DZIA 1I0DA 3ES7A 2EAWA 4Y9MA 3OHMB 2OT1A 1AD1A 1BSIA 4WSJA 1CT5A 1PXGA 3GG7A 3BZJA 5G5IA 3FA3A 3SFWA 1IF2A 3DBNA 1Z6KA 3OODA 2P53A 2J7BA 1XUUA 3AHTA 2YL9A 4LALA 3GR8A 3QLDA 4UFMA 1A4MA 4TVDA 1UR3M 4UTKA 4X2RA 4PC8A 3EDKA 2VQTA 5A6MA 3HGSA 3TX9A 4X63A 2E0PA 2FZ8A 3MP4A 3L0GA 4YTUA 3Q2DA 2BMBA 1F2JA 2X2YA 2HRWA 4UCGA 4AC1X 2XH7A 3CT7A 4ZQOA 4BI5A 1XYFA 3E38A 5A6BA 1ZHAA 2E6YA 2PBOA 2A6NA 4LANA 4QSHA 5BWFA 4AD5A 1M7PA 2JALA 3STGA 3VZZA 3A23A 3VINA 5ABFA 1VCVA 1M9HA 1ZPTA 3PTDA 4IIBA 1XDJA 1VRXA 3WLKX 3KDOA 4R5EA 5FEXA 2TRSA 4FEZA 4OJYA 2VEMA 3VABA 3G1DA 4GYFA 2FHFA 4BF5A 1TPC1 1XDMA 3RM9A 4MNMA 1OK4A 1RJRA 4J3SA 4EPEC 4S3CA 4Y2WA 2FVMA 5A6JA 3H12A 2OO6A 3WH6A 4A3UA 1M41A 3T0CA 3NXLA 5CSSA 3AIEA 4GQGA 2XDFA 3MA8A 2CIPA 1S5NA 3IACA 3M7SA 5F7UA 1KM1A 3P80A 3D0CA 3SCPA 1H2JA 4GCAA 3VD4A 3JR2A 2GSJA 1J96A 5D2YA 3QV7A 1H4PA 1Q6GA 2IQDA 2C15A 2QCEA 3STPA 1CXEA 1TVPA 3EWDA 3DGRA 1BKHA 4U31A 3C52A 2DZAA 3RAOA 3FJNA 3B8TA 1CGXA 4Z1DA 2PF8A 2E5CA 4JTSA 2JF7A 3AIQA 1JCLA 3VNDA 1S2TA 4WR3A 3SCQA 2RDXA 4XD6A 2X40A 2HQAA 2NSOA 3A47A 3RRXA 4D6EA 1EDGA 2BWGA 2ZUWA 4WOZA 4JCMA 3WD0A 1GTHA 4HMEA 3FLUA 1GKRA 1NEYA 3E0WA 1OQFA 1GG0A 2WSRA 5FF7A 4WRHA 1NOFA 4MJ2A 4RDVA 1TMHA 4O17A 1U1JA 4N6EA 4ZOCA 2WC3A 3CEPA 3TFXA 1XLBA 4C6PA 4ZODA 5A8GA 2WJDA 5ABFB 1TREA 2DT2A 5AC8A 4PBGA 3K1DA 4JCLA 1HKKA 4MLJA 4WX2A 3EEZA 1W9VA 1OT1A 3P6LA 4XB3A 1SO6A 1H62A 1HVXA 2JIWA 1RJQA 3K5XA 4C6IA 3KLKA 2VEPA 2I9UA 4R7OA 1PYMA 4MSSA 2Z1BA 4WUIA 4Q6JA 4DPPA 2PDMA 3CXOA 1H51A 3UXIA 3URNA 3VVGA 2WK2A 1LT8A 3QBUA 4FA3A 3KBMA 4IGMA 3PZNA 1IXNA 1J12A 4L4MA 3KCLA 5CC3A 3TQPA 4KETA 1RXOB 3ITLA 1WOAA 4UTLA 5FJIA 1EC7A 1YQ2A 2BXYA 3N34A 3VOCA 3EMQA 4MNJA 4BKNA 1KBLA 2E68A 3MW7A 4I6VA 3SECA 2QAFA 3BW4A 1OY0A 1EIXA 4O4WA 1J79A 3TC3A 2X1IA 4RV3A 2VCCA 1OZMA 4Y6GA 1BYCA 4QE5A 3NSXA 4FNUA 4XBJA 5EY5A 3PR2A 1DORA 3B9OA 1VYRA 5CH9A 2EPLX 3WF4A 3E02A 1JDFA 3KVJA 1GVQA 3NDOA 2PLJA 1F6YA 4Y9NA 1K8YA 3KOYA 3VKAA 2YL5A 3AHZA 4OBRA 3MHFA 1J6OA 3EWXA 5E6ZA 3IANA 1KXQA 4BEQA 3PG8A 4CD6A 1O60A 2FMNA 3WF2A 2CETA 1TPUA 2X30A 5JQ9A 4UNKA 3EWUA 3TQVA 5LZLA 1L6FA 3AWNA 3W0KA 4PTNA 5DEZA 5FL0A 1AL7A 2PDHA 4I8DA 3WFZA 3DG6A 2G50A 1REQA 1VIWA 4J2PA 1XQLA 3RFAA 3E2SA 4GK8A 4YWSA 4PUNA 3QGVA 1UC5A 2RDWA 3IK4A 3IIPA 1WX0A 3VGDA 1XIBA 3QEZA 2X0SA 1HXJA 3E5BA 3KRSA 1MXSA 1W1PA 3UR2A 1OIMA 3VGBA 1E1CA 1GK8A 6ALDA 2EGZA 3MBFA 2XVKA 3QKEA 1ONEA 3RR1A 1QHZA 4XBKA 2XVLA 1A0EA 2BTMA 1KV8A 3GO2A 3CIXA 4H7ZA 4UTWC 1UOKA 4BEUA 4DAFA 1EEXA 1TCMA 4EXQA 3R58A 1GYLA 2V5KA 4UQAA 3PULA 3KZPA 1OCBA 3AI0A 4DF1A 3NAVA 2PDWA 4QIUA 2AL1A 3SAZA 1GQIA 3MO7A 3H70A 3PP7A 5JIPA 4Z1BA 5ECUA 3GXNA 1OINA 2Q3RA 4JQ2A 5F4WA 3IRSA 1CXHA 3BURA 2D69A 1AUSL 2YCJA 3PBVA 1JZ8A 2WM0A 3O63A 4CNPA 1N2VA 1YIXA 4ICMA 5E5CA 1GVSA 2DDXA 3OLDA 2PZ0A 4GZIA 4O1CA 5CGTA 2VURA 3AMKA 4BS0A 5RUBA 3N2XA 2WMIB 1UWUA 2F9RA 3W00A 2PZNA 3UWEA 5LKYA 3FA5A 4BR1A 2BODX 2ZX9A 1WOBA 3W2NA 3PAJA 3TYBA 3A9BA 2IPGA 3M4HA 1ZGDA 4ZR8A 5LIWX 3W7GA 3S2MA 2HE8A 5D9OA 3R5EA 1X7IA 1I0BA 3FA4A 1XLAA 3WLRA 4R7WA 4MZ8A 1B0IA 4O15A 5CAHA 3VIJA 4M7TA 3IAQA 3THCA 3E12A 3HBLA 1LDCA 2OODA 5DXYA 3U48A 3GIQA 2PDUA 4ZXLA 1W1YA 1V3JA 2C14A 2MNRA 4RE2A 3L4VA 1JCXA 3MQTA 2R1PA 4JAWA 1TELA 1AD4A 2L5HA 2XH4A 4KERA 2PDPA 1VEOA 2WVVB 4XG1A 3KP0A 1OFBA 1UKPA 1IT7A 4A22A 3DI0A 4ES4A 1SU5A 3PZVA 3VTRA 5A8MA 1Q45A 5BXRA 3QM3A 1LCOA 3D47A 1UR2A 4K37A 3WJSA 4AZ5A 4XZBA 4K3ZA 3K1GA 3CHCA 1IZJA 1FKXA 4LT9A 4HU4A 3MSGA 2IXUA 4E5TA 3M0VA 3CWOX 1LRQA 2ZOXA 3GWQA 1ZBKA 3NPUA 4O14A 5ABHA 3VX1A 3RG6A 1YE6A 3NL2A 1KCLA 4FR6A 3LCGA 1I2PA 3V35A 3M41A 1PS9A 1HKIA 2WMJA 1VPQA 3RLVA 1IV8A 4HTYA 1RCOB 3QTGA 1M5WA 3B03A 1OC5A 4Q4QA 3UQNA 1O1ZA 3SCUA 1QOXA 1NJJA 3NDZA 1V6VA 2A85A 3UWQA 3CV1A 3NM1A 3THQA 1XIDA 3V3WA 1LOLA 1CBGA 3KS5A 3TEVA 1C91A 1W5PA 2OMAA 4S23A 3B9NA 2RGLA 3B0VC 1HJXA 1G0CA 4CEXC 2F2KA 4G8TA 3NQBA 1A3WA 5AYXA 3UPBA 2NSXA 1QWKA 1RUSA 3GC5A 5TNVA 5DMNA 2Y85A 1MEIA 3N14A 3IIXA 3BAYA 1GOKA 4UTFA 4IMDA 4M51A 4QAWA 3W2UA 1E0UA 3T1GA 2GSEA 1JDCA 3FGCA 2VP8A 1ITCA 2XHYA 3BV7A 3ANYA 2WW5A 3L23A 1DIKA 2DJXA 1MFUA 2CLMA 2W67A 3LCIA 1OX4B 3UJ2A 3DC0A 1DJWA 1PDZA 1JYVA 3UXAA 5CJMA 4PE8A 3RN6A 1TV8A 4XVDA 1UIPA 3H24A 2C19A 2ON3A 4M29A 4FOJA 4C6FA 1PSCA 1RA5A 1M53A 4L4LA 2IW0A 3W72A 1TWSA 1B2YA 2EHHA 1ZQ5A 3EAUA 1H5YA 2G3FA 2NQ5A 4JFUA 2QCDB 3A22A 3P60A 4B5NA 3R25A 3TWAA 1KA9F 3H2FA 3AIRA 3BLLA 2ESCA 4EE9A 3CQ0A 1EZ2A 1NSJA 4GNVA 2J7FA 3PHAA 3LBOA 1KXVA 1B4EA 2W6RA 2I5QA 3AQUA 3URQA 3C2OA 4LSBA 3ZYZA 3ARWA 4FX7A 3LGGA 3M44A 3VGGA 5G4HC 1EDQA 1E55A 3GG0A 3K4WA 4IPIA 4B5XA 3MYOA 2YXOA 3LY0A 1TPVA 2YXXA 1KRMA 4HT3A 3R0KA 1A5AA 4W9TA 1TR9A 2OLSA 1KM0A 1Y7VA 5EBAA 1J18A 1QNQA 1IQ8A 1EFZA 1SJAA 2GGJA 3WLQA 3NQDA 3S1GA 3ZXWA 5CGQA 4AB4A 2XSXA 4LU0A 1ITXA 1IIHA 4IG2B 1Y5WA 1TV4A 4GNKB 1JCJA 3SRKA 1J8VA 3LGEA 5LGZA 3B8SA 1JDDA 1ISWA 3NR0A 3TYDA 3W1PA 1VD6A 3UZ5A 3PWGA 4EPKA 4G1NA 4LFYA 5DFAA 1DQXA 2CCRA 1FCUA 3EPMA 4B15A 3O06A 3KCJA 4U28A 3OVGA 3W7IA 1JDEA 2WQDA 5BOEA 3RHGA 3NXFA 3SI9A 5A6AA 5DMMA 2I17A 1I1WA 3TMLA 4DF2A 3NQAA 4A6GA 2YCEA 5A95A 1FWDC 3ANUA 4AQLA 2OTDA 4PBFA 3WJYA 2QF7A 4RL3A 3W86A 1JPDX 2D23A 3M0ZA 4DWSB 1E9IA 5C2GA 3EMZA 1JZ3A 2P88A 2ISDA 2GYIA 3MCOA 1DV7A 3L4WA 4K36A 3E6EA 3QPYA 3LPOA 2B7PA 4Q8MA 4LX4A 4QBXA 1NQ6A 4GI8A 3DX5A 5E1QA 2OYLA 4PEKA 3B8VA 2Z29A 4IIDA 1B4KA 1IWAA 3VAVA 1H1YA 4MIMA 4ACZB 4XWUA 3C0LA 3GU9A 4O19A 1ICPA 3MJYA 1X8CA 2OGYA 3KWSA 1CB2A 3NM3A 1R5YA 1XRSA 3B97A 3KOFA 4GBDA 3WNLA 4QJ4B 1ZBCA 3CTTA 3GUWA 5CSUA 3M0YA 5KTLA 3BVJA 4AEEA 1UP2A 2RH9A 3M7WA 1TRDA 2VDHA 3JRKA 1QNSA 2ACSA 1DWHM 4RZ4A 5BXTA 5IFTA 4NZJA 3VIPA 3FYYA 4M82A 2J13A 2YDSA 1S3HA 4HMDA 3LTPA 3I3BA 4GIEA 1LUCA 2D3NA 1DOSA 4C1KA 3VNZA 1XF0A 3L9CA 1NF7A 2JKEA 2BY3A 1L0PA 1QK2A 1SZRA 5A3HA 4D6DA 4JS3A 1XGDA 4KS0A 3LV6A 1KGWA 2AAAA 1T0OA 2OVLA 2VNCA 4MZYA 1ZENA 4PMNA 4QG8A 4PUDA 4P7RA 5BOOA 2ISWA 4ALDA 4OECA 1SPQA 1JULA 3S1XA 1E9LA 4GVHA 1XG4A 1W17A 5T9CE 2Z6JA 1U5JA 3UNTA 4GFSA 1E15A 4UQEA 1Q2SA 1TKKA 4DB7A 3WBYA 1E6ZA 1J6PA 5EBUA 5AC7A 3DYPA 1FH7A 3GTNA 5IBXC 4LYQA 4NNCA 4PUEA 2ZADA 3LZ3A 3F5KA 3WBAA 3AYVA 3QMSA 1KFEA 3GVWA 5H6HA 3WEZA 4Z1AA 2GGGA 5IHSA 4PR4A 3AAMA 2AMXA 4S3GA 4F8XA 2WKJA 4A3RA 3GZAA 2J6VA 4JEQA 4A2SA 1U1UA 4GXMA 3GBDA 3U3HA 1LP6A 2BVYA 2VCAA 1ISZA 3A5FA 2REQA 3K46A 2VEGA 2WNZA 6TIMA 2REQB 2A3BA 2ZFAA 2I5IA 4EXBA 4WSHA 3WBWA 1MSSA 1JF6A 3FDGA 2JIEA 3BAXA 3S83A 1KB3A 5A6TC 5JBDA 5AVHA 4HOWA 4C6BA 1R9ZA 3LLFA 2IKHA 3UVIA 4MGGA 1D3GA 4ORMA 4DBEA 1TV5A 3KVMA 2R82A 1FWNA 1KBBA 1B3OA 3R8RA 1VFLA 4OT7A 4Q8WA 5I2UA 3Q58A 2DORA 3EXRA 4P61A 3PUGA 2DVTA 5I6SA 1Q8JA 1UR4A 2Y5EA 4FPSA 3CLWA 5LNUA 2Z1KA 1IEQA 1M6JA 5I03A 1HFBA 1MW1A 1V03A 4JR5A 4B2DA 3HG4A 3EA3A 2B7OA 3G6MA 3TMQA 4PMDA 3W1AA 3BLIA 4DO4A 2TPSA 2W91A 3PJUA 1V02E 4QDWA 1GWJA 3MUIA 4HK5A 3TC6A 3I6TA 2VI0A 4Q33A 4N02A 1UOZA 1A5MC 1VBGA 3O8AA 3S46A 1Z44A 3C86A 3WQCA 3UZJA 3ZSTA 3NZPA 3RO8A 3S6DA 1R2SA 3FJLA 3U9IA 3DFPA 1AMYA 4XVEA 1UWQA 2GGIA 2PTDA 1X1ZA 4PYSA 3F2CA 4V2XA 4HZ8A 3RLGA 1FFRA 5CJNA 2EG8A 2E9LA 2DW6A 3E2RA 3GNOA 3S5OA 1Q6QA 3GIPA 2VCBA 3FOKA 4YHEA 4AZCA 3OBEA 3MDWA 2BVWA 4CQAA 1E4IA 2JF6A 3VOJA 3NPVA 3GNNA 4Q3MA 1V6YA 1T8XA 2W9MA 1HUVA 4WD0A 3UT0A 4INFA 3V5OA 4PCTA 1LROA 3ABSA 3RR4A 4NJIA 3G1YA 1OADA 4TOQA 1YDYA 1DEDA 1HL9A 2XU2A 2BFGA 1XIHA 1W5MA 1A47A 3VA8A 3N3MA 2PDCA 5LGXA 4DLFA 1WP6A 4H19A 1TV2A 3ELFA 4XQ6A 3E1F1 1ODUA 1NU5A 4C6QA 1A5NC 1L9WA 1H09A 1TA3B 1ZZMA 4CNUA 2TAAA 1KBJA 4NHVA 4AW7A 1WZMA 4A21A 1EF3A 1HJSA 4RKAA 2G3JA 1GOQA 1W9UA 3BTNA 3T40A 1B90A 1R2RA 1LG1A 4DX3A 4UOZA 3MUCA 2H8XA 1HJVA 3W01A 5HWNA 5K3VA 3WQOA 3KM8A 1AFSA 3NTYA 1BWLA 4KRTA 1OCQA 3S47A 4CN4A 5IRPA 3AZTA 1KLZA 4LUSB 3AMDA 2B0MA 4RDZA 3M16A 1JPKA 4D2JA 2FZ9A 3A4AA 1DJYA 2WB5A 4N9DA 1VKFA 1SO4A 2PTXA 3WLMA 4IOTA 4IG2A 3RDKA 4LAOA 4JBRA 3R0DA 1FWJC 4JIEA 1SZFA 1V6WA 2EPKX 1SW3A 2IPFA 1Z7AA 3MUY1 4KCUA 3OLIA 3WK0A 3QC3A 3A12A 1ZAHA 4NXKA 5XIMA 4AXNA 4LQ1A 1GORA 2QPSA 1R47A 1KW1A 5C9UA 1GZGA 1HNYA 4GINA 2VEFA 3U2ZA 1B3WA 3EOOA 4JL2A 3QHNA 1VFUA 3OU8A 1F4HA 3GUGA 4WY0A 3WD1A 2V3GA 4AHQA 2F6KA 1Q7ZA 3THUA 2W66A 4GVGA 3TA9A 3M5VA 1QTWA 4IICA 3N2BA 4LJ3A 4L1WA 1N8WA 2AL2A 2DT3A 1E72M 3TJIA 1Q66A 3WJXA 3IRDA 3VO0A 1KTNA 1RCXB 1KGUA 2FPYA 4IL0A 1JIBA 5C70A 3U57A 2OGJA 1SO3A 3H53A 1W8SA 2ZDSA 3RU8X 2ZVIA 1KXTA 4X2PA 3W7KA 1LLZA 2QQ6A 2I1OA 3FHAA 2QZRA 2Q8LA 4NAFA 1FWIC 3P74A 1FWFC 3V0TA 4Y8FA 1E4MM 3GH4A 4JTLA 4CQ9A 1Y5VA 4LCRA 4D8AA 2E6AA 1ZNNA 3L0NA 2FQIA 2F84A 4NUWA 3TN5A 3EBVA 4IIHA 2W63A 1VS1A 3SJNA 2GOUA 3II1A 3Q4DA 3AXMA 4DXKA 3RCNA 2V82A 1CLVA 3O6AA 2ISFA 2UZ9A 4G7EA 3VIHA 3DESA 2XVNA 5D02A 2P3ZA 3CMFA 1PKMA 4Z2HA 1RK5A 1TUXA 4S3BA 4JQAA 1W9BM 1E71M 3UWZA 1DHPA 4PMQA 1DE6A 5HUPA 5HK4A 3I6EA 1DJIA 2WMGA 3GFZA 3JVAA 1KQZA 2D2JA 4QG9A 1Q6DA 5HQMA 3QJAA 5C6MA 1ITUA 2G41A 1UR8A 4LXFA 2ZX8A 4QTGA 5HNRA 1G5AA 1U22A 4E0CA 1MQPA 5JU6A 4JN8A 4WKHA 3NCOA 1QMLA 3UG8A 3NIYA 1RK6A 4KBXA 2RUSA 1W2PA 5KMYA 5CKSA 3O6CA 2A79A 4S2CA 5L9FA 1IWPA 3OTRA 3ZLFA 3VUSA 3B8IA 4J3XA 4W88A 5EMKA 3AU2A 5GVJA 2RJHA 5A5WA 1XIJA 4O13A 2JQXA 4P7LA 1G4EA 1XH0A 3B3DA 3GD6A 3L0KA 3C8FA 2QUTA 2W3ZA 3N19B 1XGEA 5HPOA 2ADAA 4PSPA 4AD4A 2AMGA 5HULA 1KO0A 5JMUA 5D04C 3I4EA 5JH1A 3WCZA 2Z7KA 5FIPA 1OG0A 4ORIA 2G96A 2XYLA 2ATSA 4IQLA 4H6QA 3LX9A 5D32A 5AZ1A 1WBJA 3W7DA 4M56A 2V5LA 4UTHA 3TJXA 3GAKA 4F9DA 3GM8A 2AOSA 1GOXA 1NFPA 3SCTA 1G01A 2ZA2A 3OJGA 4KRZA 1GCYA 3TAOA 3K4AA 4CVWA 4PULA 2HCVA 1ODZA 3WQ4A 3CBWA 1I60A 2E1WA 3VCCA 4CN6A 5IHRA 1HJQA 1B31A 2VOMA 1BQGA 4K38A 3QF0A 1JI2A 3CH0A 4NZ4A 1ENUA 1PZ3A 4V28A 1Q6EA 1GJUA 2Z1WA 4JIIX 4MKNA 1NWUA 1XRFA 3STCA 3UR7A 2ONEA 4AU0A 4HU0A 3H4WA 4E2BA 2EPMX 4FOUA 3HPSA 2D22A 1KBKA 4UWMA 3EDFA 3KRBA 1LG2A 4DHGA 1M7XA 3CHVA 4YCOA 2R24A 3PZOA 2OWCA 2BOFX 1TO3A 3UY7A 3I6RA 3W7PA 1JZ2A 3F2BA 2FJUB 2QVHA 3W6YA 3E0LA 5BXSA 1KM5A 1QUMA 4R33A 4EXAA 3H23A 3GVVA 3VDGA 4CLMA 1SZGA 3LERA 2PDLA 3OYXA 2BGNE 3T0BA 2VX5A 4DO6A 3T0DA 3P81A 1YYAA 7PTDA 1IEVA 1XXXA 1W8GA 1J2BA 4IQJA 4LEFA 3IGUA 4FF5A 2GFTA 4X61A 2PFHA 3MWCA 3KBSA 1DBTA 3T08A 1U83A 4ZL1A 4OTKA 1EXPA 1W32A 4J5NA 4W4QA 1EIBA 4F3HA 1E6QM 1JL8A 3ZR6A 1OD0A 3TOPA 2WMFA 2PCQA 6XIMA 2GK1B 2MANA 3PB0A 4JTUA 4IJRA 2G95A 1DIDA 2NQZA 3EX4A 4PMJA 2Q6ZA 3C3NA 4S3AA 1TZ7A 4US5A 3ZS4A 2C16A 5DBUA 3WDIA 3BQ6A 2VX4A 2E40A 4K7VA 2O9PA 3A4WA 4UTTC 3FAWA 2QJJA 1OFQA 3G3DA 4BI6A 3LHUA 2YCIX 4QNEA 3B0UX 4MM1A 2GUBA 4WSKA 3ME3A 3UXDA 2LLEA 4TTUA 1JGIA 2EPOA 3ITOA 3OIXA 1OB0A 2CXGA 3WF3A 4AYSA 4DWDA 4BJHA 1K9TA 3LXAA 3H2EA 3NA8A 3R12A 3N4AA 1T41A 3WJWA 1SFSA 3W23A 3N25A 3LD5A 1V3HA 1LBFA 2J9YA 1FWTA 3SGGA 4C6CA 1NWTA 4PTWA 2ABBA 4UFIA 1UD3A 3H4GA 2X8RA 5KEZA 1YPXA 1PUDA 2OO0A 4XAFA 4AMCA 1UBSA 4YS1A 5FCZA 1K6WA 1GOMA 4PMYA 4YHGA 3W1QA 4JHZA 4PBEA 4JN6A 1JVNA 3WIJA 4UTTA 1UD5A 3I4KA 1NAL1 3WQDA 4TV6A 3GG1A 2Y6ZA 3CO4A 3DHFA 3ID7A 2CBIA 4GVIA 3R11A 3W9ZA 3Q94A 2XUCA 3TSMA 4ENLA 2QCMA 1S2AA 2ZXDA 3XISA 4ZQMA 3W53A 2DZTA 5REQA 3CAQA 1XM3A 1X8FA 1CI1A 3B8DA 3UW6A 5JIWA 4B4FA 5EMJA 3I7SA 4B5VA 2D2GA 1NY1A 2NV9A 5DELA 2ZWZA 5HJLA 3E74A 2PP0A 1QCWA 1BXCA 2ZVRA 4M7SA 3AJ7A 3AWOA 4Z1YA 4DN1A 2OYKA 1JDAA 1RBAA 5AYIA 4GY1A 1R30A 4ECLA 1NWSA 1SSDA 1A5SA 4Q8QA 4HPJA 3LMZA 1TPFA 4AYGA 1RQBA 3WLTA 1UH2A 4IL2A 1TPDA 4W7WA 3M0IA 1R9YA 4QITA 1AL8A 1W6TA 1XSJA 1F74A 1EJUC 1W56A 3UR5A 1NELA 3W71A 4HZ6A 3BZGA 1SR0A 1BTMA 2YYTA 2DSUA 3GX9A 5IFPA 2FZMA 5G2HA 4FNRA 3LM7A 3BSGA 3W7RA 1WKFA 4JZ5A 4GX9A 3LBMA 4YTQA 3NL5A 3VZYA 1D3CA 3ZT5A 1X6UA 1BYDA 4FALA 3E0VA 1EQCA 3OZOA 4EANA 3EA1A 4JGDA 1ZFJA 1GZJA 1IIGA 3VD5A 2XFWA 4O12A 4IFRA 2CU0A 1IEIA 3H22A 4H9MA 2QCDA 3TXZA 1J0HA 1O94A 5I78A 2EPHA 1R8LA 2A5HA 4GYJA 4O28A 4LWWA 1BEUA 2A2IA 1KM6A 4AD2A 3VILA 4EIVA 1GVFA 4AF0B 4NRRA 4LAUA 1QNPA 1E56A 4J3TA 4LUIA 2E7FA 3GW3A 3WBEA 5GNZA 3APYA 2IQTA 2X16A 4Z2KA 4IPNB 4MB4A 1XI3A 2GVLA 1DKWA 3NVTA 2SFPA 1UKOA 4W5ZA 1UR9A 3EEGA 4HZMA 1VFFA 1GNXA 4TX8A 5HMSA 3GSMA 4GABA 5LHEA 1KFLA 1R0MA 3CQIA 2C1GA 1VLIA 3G1VA 4MJ4A 4Y96A 1QI2A 2WHKA 4F4RA 3AJXA 3PANA 1T8QA 2E5DA 3Q65A 4PRRA 4O1DA 3AUOA 2AQWA 2A7NA 5FESA 4X22A 4XTDA 1GQNA 4D8ZA 1GVRA 1IT0A 3IVUA 4QLJA 1OD8A 3WNKA 5MKGA 4MWAA 5EU9A 2WJZA 4UMAA 2YXGA 4GOAA 2R1LA 5FKYA 1DWGM 4Y9OA 3UPWA 4Q22A 1QU4A 3TH6A 3EWZA 3E2VA 4PMXA 2DZBA 5K2ZA 3KX6A 4WIWA 2CKSA 3AIBA 4AVOA 4YMZA 1EUAA 3WQFA 3R89A 1V6TA 3S1VA 1B3ZA 2AGTA 2Q01A 4UQ9A 4XAYA 1VQTA 3UA4A 3P5ZA 3PTMA 2Y0FA 1S2CA 2YX0A 4E38A 2WC7A 1OFRA 4I5RA 2D0GA 4YL2A 5AHFA 1VCGA 1EWDA 1A5CA 1C92A 4QDMA 4PMRA 4HN8A 3W74A 3EKGA 3EX1A 1I2NA 4X9YA 5LIXX 2FB2A 2VM8A 2NQ9A 2INFA 1ICSA 1H50A 1N8FA 2J66A 2V5CA 4NNAA 5HJYA 2Z1XA 4F0HA 1F3TA 2HZGA 1A0CA 2NUYA 4DBSA 4GRSA 3A3XA 1PZ2A 4HOZA 4EPDC 3OG2A 1H1ZA 4AZGA 8A3HA 2Q8ZA 4H6RA 2Z2UA 3K4DA 4DBDA 4Q4RA 2YLAA 1AZ1A 4I9TA 4ERIA 4HPGA 1TTPA 4AMAA 1C8QA 4B3KA 5LA1A 2NLIA 5AHEA 2ZX5A 1RZMA 3W7CA 1GW9A 1EQPA 4TIMA 5HANA 2XZ9A 3HPAA 3FEQA 4Q8TA 4I7VA 2OEJA 4TO8A 1AZ2A 5DCBA 1XG3A 1SFJA 4OBSA 2Y63A 4CU6A 2YIHA 5T9BG 3SB0A 2DZVA 3WLIA 4H9ZA 1WUEA 4KFNA 1Q8AA 1W9PA 4GVFA 4FX6M 4P2VA 4I6KA 5CCZA 2DH3A 4UFLA 2OOFA 2OELA 1PTAA 2DT0A 2P1FA 2DUAA 2CHNA 1L2UA 1QPOA 2BY2A 4XK2A 1NF0A 3VCRA 1X1OA 3SEPA 3GS6A 3M5ZA 4GUHA 5FSDC 4EACA 2XIJA 3G18A 5GQBA 2NQJA 2B7NA 2WWCA 1BRLB 2XIOA 2VD9A 2Y7GA 1V0LA 4LEQA 1LL6A 3KOXA 3WDQA 5GPRA 1KKRA 2R9RA 1FH8A 3HN3A 1UZDA 1ZP3A 1YX1A 4FLQA 3WQ5A 4XAZA 4HK6A 4WCJA 3KBVA 5I3FA 4RLIA 2CXEA 1TWIA 3PBYA 2V0TA 4RNIA 4LV4A 3B9EA 3S0CA 2OZ8A 2OZ0A 1YTDA 1ITQA 1WBHA 3UG3A 3DFQA 2G97A 3W7LA 3C0SA 1CNVA 5I3IA 1DJXA 3VFLA 3NO1A 1WDDA 5K4ZA 3THDA 3ZZ1A 1WB0A 4H01A 2G37A 4TR9A 1VYPX 3IARA 2DUZA 3HQOA 1XIEA 3MMTA 1WV2A 3P93A 3WLLA 3WQWA 3MV11 5EPDA 4S3DA 2D2OA 3OVPA 1VYSX 4GG9A 4EF9A 1QPQA 3BAWA 4KIEA 4DNHA 1ADSA 2DUXA 4DJEC 3A3HA 2YGYA 4US6A 3LLDA 1DXEA 4F40A 1XLLA 2WZTA 3LOTA 1UW9A 1Q65A 3S3GA 3WFLA 1R87A 4ADSA 3HIJA 4JNMA 1TRIA 3PS7A 2ODOA 1PPIA 1AH3A 3FNDA 4HNTA 3UZXA 1R3RA 1XICA 1M03A 3OOQA 3CV6A 2PF0A 2XN1A 3POHA 2GOKA 4MY9A 2WKGA 3HGRA 3LXBA 3OBAA 2QIIA 3B05A 3WUFA 2HWGA 4JY8A 2PMQA 4R34A 7XIMA 1FDZA 1H63A 3CZEA 3N6QA 2QV4A 1XCWA 1JR1A 3N11A 1C93A 1MRQA 1EA0A 4D71A 1DP0A 3C8NA 4ZEPA 2FIQA 4E4UA 4PB5A 1GQKA 1XQKA 1TPEA 5CG7A 5M2FX 3IJLA 1AJ2A 4JFWA 3O3RA 3GYCA 3L5LA 3S5YA 2PPGA 2G0WA 1PCWA 1V4YA 3VM5A 3W2KA 4B5UA 1HZYA 3EWYA 4O1EA 4C6KA 3APGA 4C1LA 3HU7A 4FO4A 4W84A 4FZIA 2PLCA 5DCDA 4HVXA 2I56A 1EC9A 4H7CA 2HE5A 4H2HA 7REQA 1K8ZA 5BWAA 4GH1A 4S3JA 4RDWA 3WLNA 3LPPA 4GO9A 4Q8UA 3T42A 1F6PA 2HNHA 2YL6A 2V5JA 2YFNA 1LF1A 2EG7A 1EO7A 2CW6A 4M80A 1S5VA 3CQHA 2OQLA 3BLPX 3UZYA 1NARA 2FTPA 4QJ5B 3TK7A 3GH7A 5D33A 4M6QA 2Y8KA 1XLGA 2BLEA 5A6BD 3LI0A 4AY7A 1EX1A 4XUGA 3QC0A 1U33A 4HNLA 3TSDA 3R43A 5AKQA 4O50A 1TMQA 1ZTVA 3HGJA 3VNYA 4P7QA 1GJPA 4HSOA 1N82A 2WPGA 4IUGA 4E4PA 4REQB 4M19A 1AVAA 4L9YA 5AHIA 2QDDA 4JX5A 3CTLA 1CGUA 4FXJA 2ZBTA 1SO5A 3PY2A 1FCVA 1P0EA 2EKGA 1KR0A 2Z1SA 3S9YA 3W1RA 5FSEC 4JTJA 3L4ZA 2X0YA 1BYAA 4U5KA 1C8YA 2ZICA 5DRCA 1WXYA 4FK9A 3FJ4A 3BGJA 2Y7EA 2HXTA 3GRIA 5BNKA 5D9NA 1VH7A 2E9MA 3K2GA 2WSKA 2PWDA 4JDYA 3CHDA 1RJPA 4AG0A 4AEFA 5HQEA 3NFUA 3KBJA 3RM4A 1EB3A 2OZTA 4HCLA 5ECVA 2NWRA 2X7VA 3VUPA 1HGYA 4O57A 4RW5A 1HKVA 4HJFA 2J7EA 3WH7A 4ZOEA 5FL1A 2JGYA 2QJGA 3VIIA 1ECQA 3C0QA 3DU0A 1VF8A 4ICCX 5DMLA 5G1MA 4DYEA 4WLCA 3CYVA 1FQ0A 1A5LC 4GLEA 1HJUA 4L4PA 3FSTA 1UYQA 1I75A 2V6AA 4FNSA 3BG3A 1KFWA 5D2VA 3NZGA 3PM6A 1VBRA 2QULA 1AQFA 4ACYA 1J9YA 1YW1A 4KWSA 4C6EA 3G8EA 3N9SA 3BMXA 1YBQB 4YN5A 1NP2A 5CZJA 1PL9A 1VPYA 1T6MA 3T4WA 1KFCA 2O7SA 4ZVJA 2TYSA 3OGVA 4MMWA 4RZ6A 3FXGA 3MB9A 1Q7MA 2BHZA 1TUFA 2E8ZA 5IDZA 4UCFA 5LIKX 3UG4A 1TQJA 2DY3A 4YCPA 2UY4A 3WD3A 2BVDA 4YIWA 5G2IA 4Z2IA 1NDYA 2QGHA 2QGYA 2XH0A 1ZAIA 2JBMA 1AQ0A 4ZSTA 2QV5A 4MJMA 4UQBA 1EJVC 1J5TA 2J9ZA 4D1IA 5CZSA 2VC6A 1OVDA 4P7NA 1AH0A 3VMPA 4R7JA 2BGQA 1W5NA 2R94A 3VGEA 2EPNA 3GR4A 4UR9A 4A4AA 1L6WA 1UCWA 3V16A 1XRVA 1AH4A 1XYZA 2PP1A 4PZVA 1FTXA 4KF1A 2G4JA 1J0KA 3QPEA 4GUIA 3VDHA 3VKBA 4GNJA 4JTHA 1QO2A 4B2DD 4V1YA 3MU7A 5AECA 2PRMA 3V5FA 1XW8A 2AQOA 5KINA 4CEUC 3IUHA 4S38A 3KL5A 3U5UA 2OFJA 1XLKA 3DH7A 4ONVA 2YR1A 5FEPA 3AMLA 3HV9A 3C2VA 1S2VA 3NWRA 4O53A 4NSBA 1CXLA 3EDEA 1GONA 4GFIA 4FXFA 2PDJA 4UR8A 2OCZA 5H91A 4FSAA 3GVGA 7A3HA 1K7EA 3LUTA 1QHOA 5CLWA 2J8FA 4RE3A 1GQJA 1IGSA 3TSBA 3HO8A 2XN0A 5A6KA 2W27A 2Z2BA 2NW0A 3H26A 3G1XA 3GXTA 3VI2A 3UA3A 4BQ2A 2QJMA 1XSIA 5M1TA 1B5TA 3BJSA 1F07A 1S3TC 3W6MA 1US0A 5C2XA 1WUFA 5FJOA 3W70A 4F48A 4B5SA 3RMEA 1X38A 4GXPA 4R9XA 3GY1A 4DNMA 1WZAA 4ZTYA 3NSMA 3N4EA 4MJZA 5L6UA 1RBOB 1LYXA 4CCEA 3H2NA 1G4TA 2GVEA 3W1UA 1VFSA 4TU1A 3DDMA 2J75A 1F8IA 1EDTA 3PG9A 1EJTC 4Q6XA 3EB3A 1YBQA 2Q8XA 3DFYA 1FOBA 1QPNA 4GY0A 1E0VA 1SVDA 4JTCA 2G8ZA 2WCGA 3ALGA 4H9VA 4C6MA 3TJ4A 1EYWA 1Q6CA 1ISXA 1BVZA 3T8QA 1G7VA 3WLJA 3CL7A 1OF6A 3M47A 4GH3A 4HU8A 2EXOA 2OX4A 3ABRA 1SYTA 3A13A 2TMDA 4OV9A 3LLXA 3EOUA 1VLWA 4ILSA 5F2MA 3D46A 5C8BB 4B3ZA 3GC4A 3Q45A 5EMMA 1OCNA 4X60A 3KAOA 4ZENA 4WOQA 2PGEA 3LQGA 4NZ5A 3LU2A 4MF4A 1FHDA 4GUJA 4K1GA 1HL2A 2Y7FA 4GE8A 2E28A 5BRPA 4Y9PA 3MO4A 2XGBA 5J5RA 4F66A 1P7TB 1LRTA 2YDQA 1UC4A 1UB3A 1V0KA 3MUAA 5CG0A 3WMLA 3KTXA 8TIMA 5C0QA 3MUZ1 3SDOA 1E6NA 4YU1A 1QBAA 4ZA0A 5E0CA 5FJJA 3GLCA 2BASA 5REQB 3BLKA 4E2DA 2CWXA 2NT1A 3LPFA 4AZ6A 1VP5A 1XX1A 4IGSA 3WELA 4XV0A 4Z2LA 2PEVA 5I7GA 2OJPA 4NG3A 4BZYA 4FHAA 2VFFA 2J6XA 4LPCA 1EH9A 2A3EA 3IIVA 1QHPA 1JPIA 3P0WA 5I02A 1E4NA 3WQVA 1GOOA 3LNMA 1JZ7A 3UFYA 5A1AA 1UWSA 2ZC8A 3BMVA 3MANA 2ASHA 1E0WA 3AROA 3HOJA 5DQPA 3HGOA 2C91A 2G3IA 1R86A 2QDEA 4ATLA 2ACQA 3W3OA 4GZJA 1XUZA 1R46A 3VFCA 3NJ3A 4GZ7A 1EBGA 3ZMRA 2GPTA 5I24A 3DENA 4W93A 3UY8A 3HM7A 4XD3A 4JEJA 1BXNA 3OHIA 3R8GA 3RX4A 2DSKA 3EB2A 2VELA 4I90A 8CGTA 3CUFA 4GGHA 1BVNP 3S1UA 1MW0A 3WN6A 1Q63A 3GNDA 3SO7A 4D6CA 1F73A 3OG3A 1FX6A 3N4FA 1X96A 1GPWA 1PX8A 5E70A 2Y24A 2EJ1A 4DZ5A 2FMOA 2HNEA 2DU2A 1YTEA 2PC4A 4IF2A 4MLRA 1JAKA 1W31A 3M5XA 4HBKA 1ME7A 3ARPA 3RIKA 5D8WA 1OYCA 2X1RA 1VFMA 4JQ3A 1FHVA 2X1SA 1WA3A 3UWUA 1TPWA 2GDQA 3JZUA 1XIFA 2WCSA 1QOQA 2GK1A 1SMDA 3RPDA 3ABXA 4ZGYA 3O05A 3OEXA 3GYEA 3PPHA 4FLSA 1ADDA 1WAUA 3WD4A 3CH9A 1GQLA 2VC9A 2XGIA 2Y88A 1WDQA 2QCNA 1JJKA 1EP1A 3OW1A 4AXKA 3RJXA 2P10A 3PPCA 2HK1A 1XLMA 1KCKA 2WSYA 4FOKA 4AZBA 3PPGA 2CZ5A 3QH2A 5FJRA 3DHPA 4LH8A 4LY8A 4AD3A 3ITVA 3VYLA 2E25A 4KPLA 4UTMA 1T96A 3FVMA 4P8VA 2DIJA 6REQA 1OBAA 3DFSA 4H8HA 1S2UA 4XKYB 4AWSA 3ARTA 1JCNA 3ECQA 4NASA 2HV5A 3EPNA 3UZWA 4ZQCA 2XINA 5G4EA 4HHMA 3PBGA 1YTKA 2PDBA 4OQVA 2WVUA 2VOTA 3MMUA 1XRTA 2OU4A 2CLEA 1KKOA 1UZ1A 4IP7A 1WDRA 4W87A 3GHUA 3DFHA 1PDYA 1Q2RA 3OGRA 6TAAA 1ONWA 3LRMA 3MI2A 1R3SA 2WMIA 1UWRA 3C56A 1NWRA 5CBBA 1XFCA 2PSNA 4NJJA 1OYBA 2VC5A 3ZJ6A 4Q4OA 2DEPA 4P8UA 2CBJA 5BMWA 1LL4A 2V30A 3CPRA 4ZQRA 3BOLA 1NDWA 5ENLA 2PDYA 2PGFA 3N17A 3S2NA 3KOWA 3PZUA 4E6MA 1UR0A 4MDPA 2XFYA 3GDLA 5F1UA 3CZLA 3DKJA 4NZFA 3NVDA 5A69A 1LM1A 3H7UA 1A5BA 3L5MA 3VKKA 2QCHA 5M5DA 2PGWA 3EX6A 1ZCOA 3G6LA 1V3MA 4TUFA 2JKPA 4WXZA 3BICA 1M7OA 3MJMA 1E9YB 4JHMA 2XIMA 2OLAA 4MFEA 2B81A 1UD4A 4X9SA 4GACA 3GXDA 2O56A 3UERA 3V18A 3OYZA 1GKQA 2PRHA 1RCQA 4L56A 4DAIA 1K3UA 3U2EA 2J7HA 1E1CB 3PNZA 5AVNA 5EA9A 1J2WA 4WGHA 3EMCA 3SGUA 1UROA 3F4DA 1NVMA 1MW2A 3ZVHA 4XO6A 4MKVA 4FF7A 3VCNA 4XZHA 1L2QA 3VNIA 3CZJA 3NZ1A 1PCKA 3BL3A 3DUGA 3H7VA 5SWUA 3H21A 3ZJ8A 4C7FA 1SFLA 2PRLA 3RM8A 4CQ8A 1XISA 4F0MA 2CLKA 4H1ZA 2R91A 4PFHA 4NU7A 2QCCA 4MFDA 3U4AA 3LXCA 4MKSA 3TVAA 3V4BA 4QR6A 3E5PA 2YB1A 1AK5A 1F5ZA 1TE1A 4DPQA 2UY2A 3A3WA 3TZFA 1I6NA 2XFRA 1Z8AA 1VZWA 1SR9A 4AUBA 2G4FA 3K13A 4Y8EA 3ATYA 3KZSA 4ZO9A 3C4UA 4CVUA 3L7RA 3C3UA 3CMGA 3TOYA 5CLTA 2AQVA 5E9XA 1FWGC 3HG2A 5IOBA 1UWAA 5CBIA 4FNTA 2HTMA 1DJHA 4TQTA 4JTAA 3CEUA 3AUJA 2HS8A 3N18A 1Q6LA 1FBAA 1UH4A 3KW3A 4OUEA 1M65A 4QXIA 2A7PA 3KVLA 2HISA 1E6SM 1F7BA 4S3EA 1S38A 4DJDA 2DPEA 4BI7A 1F8MA 3DFNA 2IKIA 3LEPA 1U5VA 3GW0A 1TB3A 1POKA 4OUIA 1JYWA 5CJ5A 1RY8A 4PA8A 5T91A 1AQMA 1D9EA 1PJ9A 4QRNA 4QLLA 4LTSA 3WK2A 3UCDA 1UA7A 2RGMA 4C60A 2PGRA 1ME8A 1WKDA 1AG1O 8XIMA 4JY9A 2WVTA 1V3LA 5J5DA 3SCNA 1CGVA 1SSGA 3NQVA 2A4AA 1MEWA 1YEYA 2ZQ0A 2Z27A 2Z4GA 9XIAA 3N73A 2IKGA 1H11A 3R13A 2HK0A 4QE1A 4LW7A 4POCA 1XDLA 1QASA 4DO7A 3KUMA 3PNUA 4XZWA 4IJBA 1XIGA 3HFTA 1J11A 2KX9A 3FEMA 4JOMA 1NIUA 3NURA 4HYWA 5AN7A 5CPNA 4B16A 5FOOA 1TE6A 2CBUA 1E6PA 3ZOAA 5H8PA 3S8HA 1D2KA 2I9EA 4HA4A 3S6TA 4RNFA 1J5SA 3FFSA 3BXWA 4CNSA 2NZLA 2YBVA 3O1NA 3N9RA 3UYCA 3RX2A 5HPCA 4QJ1A 4DXVA 1OFPA 5K4XA 1X97A 3PJWA 2VJXA 1DE5A 2VZTA 1JCYA 5DN1A 3LA4A 1V7YA 4C6LA 3XIMA 4H04A 3ZVHB 2FGZA 3RCYA 2EBNA 4RZ5A 5BU9A 4EF8A 1SM9A 4IWWA 3T4CA 1OX4A 4HNNA 4CQBA 3NPXA 7TIMA 1H61A 4ZO8A 1AJZA 3T55A 1E43A 5KETA 1VRDA 2PB1A 3SIZA 4OV4A 1THFD 3TN6A 1E3XA 3LG3A 2QPXA 1YHTA 4GXWA 1VGAA 3AIWA 2WZMA 1TVNA 3WH8A 3QYQA 4JIHA 4XTIA 4LAZA 4RE0A 2R14A 2BHUA 1WE5A 4JD4A 3RPMA 5AY7A 3S42A 3F5JA 3O6YX 1Z3NA 1Y5XA 4G1KA 3IK2A 2WC4A 4G56A 2PWHA 3L2MA 1H41A 2VX6A 3BAIA 3FS2A 4DO5A 4AY1A 5TAOA 3M0JA 4JTQA 3DN5A