3KXQA

Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
237
Chain Sequence
IRPFIAGNWKMNGTGESLGELRAIAAGISRLFEALICVPATLLSRAFDILGGENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWTSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKAIDFLTICDVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6A resolution
rcsb
source organism Bartonella henselae
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 86
structure length 237
sequence length 249
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kxqA00
2QF7A 4M6PA 3QRHA 1F5ZA 1IIGA 1DJNA 4X3ZA 2F7FA 1KM4A 2RH9A 3LHYA 3W87A 1PS9A 4O50A 5DXYA 1FCQA 1AK5A 3TQKA 1G67A 1KFBA 3W3OA 4AMAA 3HQ1A 1EX5A 5AYZA 3LLDA 3LOTA 2WOQA 1D3GA 1O5KA 1XBVA 2F84A 2QCMA 3TU9A 3I6RA 1UASA 3BV4A 3NQ2A 3M6YA 3O07A 1L6YA 5DBUA 5K4XA 5EPDA 1YDVA 3HJZA 1FDYA 2QUVA 5C54A 1OVDA 2CLLA 4BFAA 1AMKA 4E2BA 1QO2A 4HNUA 4MJMA 3TIMA 4LVFA 1JUEA 1TMHA 1VYSX 4PTNA 1OX4B 3W7CA 3QSRA 4OE7A 2CU0A 1W3TA 4DELA 3HB9A 3HGRA 3LXBA 2I14A 2NUWA 4YL2A 3L0KA 2QJHA 3NPUA 4UCGA 2VEMA 3KVJA 3G1VA 3N9RA 1F6KA 4IOTA 3NL3A 3PUDA 1Z44A 1GJPA 2V2DA 4DO4A 4PCFA 3ZWSA 1I2OA 4N4QA 5C5YA 3MYPA 1XC4A 1GYNA 1JRCA 4WY0F 3R12A 5TBOA 1H5YA 2X2GA 1YTEA 1WDWA 2GVGA 3TJXA 1ZENA 4JTGA 1MEIA 2ZZ5A 4UTIA 2H8ZA 2HSAA 2PCQA 5CSSA 4JIPA 3PSVA 6ALDA 3QQ1A 3ZFHA 1KTCA 1R2SA 1CW2A 2ZRXA 3W1PA 3WFAA 2I1OA 2DZXA 2ATMA 2J9ZA 4YXGA 3NQEA 3DBPA 4CQAA 2RDTA 4TU1A 3NAVA 1XL9A 1KFJA 4DF2A 5FF2A 3USBA 3TROA 4JD4A 1G4EA 4UTUA 4HNTA 3L0GA 2EHHA 3C2FA 1CX9A 3UPBA 2CLIA 3L5AA 4IWWA 1I2QA 4AF0A 2NX3A 3QH2A 2B7QA 3M47A 1I45A 1H50A 3G0XA 1VQTA 3M5ZA 1T8XA 3QYQA 3EXRA 4ZQNA 5K3VA 1SPQA 5LGXA 2NUYA 3LTPA 5E1QA 2FB2A 1VRDA 3R13A 3VFLA 1S5TA 1NFBA 2DZTA 4WQ6A 5J5DA 3STCA 1ZAIA 4CNOA 1ZFJA 3W1NA 3LCGA 4OBTA 2E5BA 4IJBA 3EWXA 1JUKA 3H53A 4OQVA 3PUEA 2OT0A 4GUIA 2ZZ3A 4Z08A 4R7JA 1KW1A 5CPMA 4EF9A 2TMDA 4PEKA 4WX2A 2CW6A 3N2XA 3MI2A 3QSTA 2VKZG 4XBKA 1H63A 4K8EA 4GFSA 1SFLA 3PBYA 4ADTA 4CQ8A 3E0IA 3FIGA 5HWMA 5AYXA 2V30A 4DO6A 3C0JA 3QM3A 1EWDA 4UUIA 2Y7GA 3GNNA 4O1AA 1OFEA 3SIZA 1YTKA 1M6JA 1UCWA 2ZZ1A 1VPXA 2PRLA 3W7JA 3DKLA 3GR8A 1G4PA 3CLMA 1ZAJA 3PM6A 5BOOA 3W2UA 1AW1A 3QQ0A 2YPIA 3CEPA 3W22A 3FKRA 1FWWA 5AHEA 2BLEA 3IVUA 4LT9A 1OFDA 2V5LA 1LOLA 1ME9A 1Q6QA 1HTIA 4UC5A 1EP1A 2DZWA 3TW6A 1K8ZA 1XUUA 1TPC1 4UTMA 4HSOA 4JYDA 3DFNA 4IMDA 1VCGA 2A7PA 5CZSA 5CZ0A 1WV2A 2CLOA 1AG1O 4LVAA 1P0KA 3BG9A 3GX9A 1MEWA 5D37A 3OVRA 5AB3A 5HUPA 4O1BA 3LRMA 3CM4A 1IGSA 1OABA 4PFMA 3N3MA 2QCHA 3HGSA 4HPXA 5F2IA 2G97A 3DI0A 3HG4A 3L2IA 3NL6A 2X1TA 3AO0A 4FNUA 3Q2DA 1AL8A 1KM5A 3MI6A 2AAMA 3CTLA 3W1QA 4UTHA 4S2CA 4O4WA 3O8AA 3NM1A 1GPWA 1SZFA 3L5LA 4DF1A 3W1RA 1C9DA 3TX9A 4JYFA 1A50A 3E12A 1RPXA 1QPRA 4IQLA 1JR1A 1TPEA 2WSYA 1Z41A 5AC8A 3TH6A 4BR1A 3VE9A 4JNMA 3MMTA 2Y7DA 5KMYA 1SO3A 4ORMA 1W3IA 3MJYA 1X8FA 4TR9A 3ZS4A 1J4EA 1U83A 4O12A 3I7SA 1W37A 4UR8A 3F03K 4TIMA 4AHQA 2TSYA 4A21A 4AH7A 1TQXA 3N2MA 3RLUA 2VXNA 4DXVA 2O7SA 4ZMGA 1SU5A 2XFWA 4NNAA 5A5WA 5KINA 3IRDA 2X16A 4LV4A 1K7EA 3KOFA 4FIQA 4K38A 3UPWA 4FF7A 1XCFA 4HNVA 1P4CA 3SSJA 1FWTA 1ONRA 1LZOA 5DN1A 2NXIA 3C56A 1LBFA 5LKYA 1OF8A 1R30A 3NQFA 3PULA 5KZDA 3GDTA 4RXFA 3ABSA 1TPVA 1ZAHA 4AF0B 2KZHA 3PS7A 1RQBA 3M0ZA 5I3IA 1IF2A 4JDBA 1H1YA 3W7IA 3DGRA 2UV8G 4LRSA 4FNTA 1J5TA 3PB0A 4ORIA 1QOPA 4DBDA 1OJXA 4LS1A 3MYOA 3NGJA 3H54A 3NVTA 3NR0A 4BI5A 4E38A 2HMCA 1EUAA 4ZQOA 2A2IA 3L66A 5EL1A 2J27A 3RF9A 4OT7A 5C2XA 3W1TA 1PHWA 1VCFA 3DXIA 5D2VA 5BW6A 3TXZA 1DJQA 2J24A 2QCCA 1DQXA 3NEVA 2LLEA 4LVGA 3BO9A 3NM3A 2XN1A 5LNSA 1XBYA 4N6EA 5MHBA 1YYAA 4QNWA 1FX6A 3QPYA 1YPFA 5CPOA 5TQLA 5D33A 2Y89A 1XBZA 3BGGA 4J9JA 1JQVA 3ABOA 2E68A 1NF0A 2ZRYA 5CG7A 4XQ6A 1SSGA 1VS1A 1EPXA 3S8HA 3FA5A 5F2GA 5FI8A 1YADA 3MW7A 5A8GA 1EWEA 4DEFA 3BG5A 3LDVA 6TIMA 3S5NA 2H3BA 4K7VA 1X1ZA 5F1UA 3TMLA 4IUOA 1WQ5A 1TPWA 3V75A 3TR2A 1KFKA 1SFJA 4CCEA 1O95A 4E0CA 1H7XA 2V9DA 4DPPA 1JVNA 3B4UA 3CB8A 3IVSA 3PF3A 1TV5A 3LCHA 1DKWA 4NX5A 1L6SA 4JTEA 5HQEA 3YPIA 3G3DA 2HTMA 2YYUA 3NDOA 4JX5A 3W73A 5AYYA 1T96A 1PCWA 4UNLA 3GXPA 4OHQA 3ZWTA 4FO4A 1F73A 2OT1A 1GTHA 4M19A 3DFTA 4GUGA 1E51A 4JTSA 2G5WA 4MY8A 3W7HA 4JTTA 4HKPA 3HG2A 3T40A 2C1HA 1G4SA 4WUIA 2A5HA 5AN7A 3NPXA 1ZALA 2QEZA 5HR6A 1FBAA 2DZUA 2YZRA 1TQJA 3L21A 2PRMA 1Z48A 5KZMA 2NUXA 3W7KA 1KM3A 1MZHA 3O15A 1JCNA 2ZA1A 1A53A 3W7GA 4O8RA 1IXOA 3C2OA 4B5NA 3EKZA 2ZA3A 5LSMA 5CZTA 4FB7A 5BNKA 3NQDA 3NQCA 4X9SA 3W75A 3LXAA 1QWGA 4N6FA 2W79A 4O13A 2ZRWA 3S1XA 1W1ZA 3MP4A 3QPZA 4UMAA 1MEHA 1PV8A 3ANYA 3UY7A 4EF8A 4XWUA 4AVFA 3GDMA 1P0NA 4BF9A 5I3FA 4RCXA 3CIWA 4QM1A 1ZJIA 3UWQA 3EWUA 1RD5A 1A5SA 5G1YA 3FOKA 3LHWA 3O06A 2QCDA 3M5XA 4NJKA 4RX0A 4UTTA 4EIVA 5EKYA 4XZ9A 1O94A 2ALDA 1N8FA 3TNOA 2C13A 2QCGA 3QC3A 2Y7FA 4WOQA 1KBIA 4JTUA 1SW7A 1Q45A 1Q6OA 3PR2A 4L4LA 3LBCA 3CQ0A 3OVPA 2IQTA 4C1LA 1I2RA 3I7QA 1VYPX 1W54A 3HG5A 1H61A 5G4EA 1NAL1 4FNSA 2Q8LA 4YLWA 2X30A 4HSNA 3EX6A 3OVQA 4Z1DA 2GQAA 3K30A 4LC8A 3IV3A 4TMBA 4AWUA 3RK8A 3PB2A 3A24A 1W56A 2QJIA 1DHPA 3LTYA 1OFAA 2VEPA 4H6KA 3MUXA 1Y0EA 1R2RA 3E02A 3C3NA 2ZTKA 4I7UA 5SWUA 3DFQA 2H90A 1XUZA 2X1SA 3ATYA 3P5YA 3R2GA 3GB6A 4NNCA 4LU0A 3R89A 4Y96A 4XKYA 4RV8A 3A5VA 3W2KA 2NLIA 1LOSA 3L68A 4MY9A 5G4WA 4KFPA 3LCWA 1YPIA 2BSLA 4IPJA 4UTWC 5K9CA 5LHFA 1GVOA 1LBLA 2RKXA 2TRSA 3LCLA 4N9EA 1OHLA 2AGKA 3OEXA 4UIOA 3GNDA 2E77A 4GJ1A 4YCPA 3WJZA 3THQA 1JCLA 2BWGA 4LC6A 2J9XA 2FJKA 1SW3A 3M16A 5D2TA 1NSJA 1TV7A 1TB3A 2J88A 3EXSA 2NX1A 1M7OA 3IGXA 3O1NA 3S5OA 3NQ8A 5DY2A 3W2NA 4GXMA 3L65A 3S5ZA 4UFMA 3UWZA 1OYBA 3S6DA 1XFBA 2I9EA 3GK0A 4R33A 1DVJA 3TSBA 3IIVA 4FX6M 1HO1A 2A21A 4POCA 5HMSA 1YXYA 2ZYFA 3VKJA 3W7RA 2FB3A 3EB2A 2QUUA 4CQ9A 2ZCGA 1LLWA 1S3HA 3MO7A 3LHTA 4N9BA 1VLIA 4KWWA 3W6YA 4Q32A 3WK1A 1G6CA 3Q37A 2OX1A 1UBSA 5D04C 5EY5A 1IXQA 1A5BA 1TJPA 3CT7A 2B7OA 2ABAA 2B4GA 5CZJA 5FEPA 3IVTA 1K8XA 5G1TA 3C6CA 2E5CA 1MSSA 3OHIA 3TA6A 2Z6JA 1SO6A 3DFOA 3STFA 4UFLA 1H7PA 3CHVA 3DENA 3A21A 1VJIA 4Y90A 4FX7A 4NZFA 3PAJA 3STEA 3DH7A 3NQ6A 3FJLA 3GZ3A 1R47A 4HPJA 4AB4A 5AHFA 1SO4A 4O57A 4NU7A 1YXDA 5EMUA 2V5BA 2CLHA 3DKJA 5LZLA 3CEUA 4JXCA 4FNQA 3C2VA 3W1AA 3BG3A 3QJAA 3SGZA 2A1YA 4HN4A 2ZRUA 2ZZ4A 3JRKA 4BK9A 1RV8A 4RJEA 4A2SA 2ZDRA 3BARA 2XN0A 1C29A 4EVZA 3OA3A 3EX4A 3A5FA 1YDNA 3PWAA 3EEGA 2BX7A 5LNWA 3HF3A 3FKKA 4JTKA 3L0NA 3UXAA 1BEUA 3NQGA 1JQXA 4P2VA 1KM2A 2VFIA 3UZ5A 1OFRA 4GRSA 3UWWA 5AHIA 1ICSA 5G2WA 3UWYA 3NQVA 3A9IA 4O17A 2QCLA 2CZEA 3LXCA 3O6DA 3B03A 5I3JA 3L67A 3P80A 3CC1A 4IPIA 1UUOA 3TCEA 3I7RA 3U8GA 3RU6A 1RQHA 3PG8A 1A5CA 3MP5A 4IXHA 3QMTA 3QMRA 4ZQPA 4CCDA 1I4NA 1WYIA 1IXPA 4A3UA 4JN6A 2OJPA 2GVJA 2PURA 1ADOA 1WA3A 1SR9A 4MVAA 4M7TA 1WOAA 4HNNA 5CPNA 3WJWA 3KRZA 3EX2A 5FF0A 4TMCA 2EF9A 4A29A 3CWNA 4O16A 1EIXA 2EGZA 2BZNA 2YX0A 2GOUA 3FYPA 4O52A 4KFOA 2E6AA 3LX9A 5HINA 1ZY9A 1F74A 2DJXA 3Q94A 3UWUA 2A4AA 3W76A 1FQ0A 1KLYA 4HT3A 3E96A 1UUMA 2ZZ2A 1O4UA 3EX1A 3NL5A 3GIYA 3NZRA 3CWOX 2QCNA 4K39A 1UJPA 3NQAA 5FEZA 4ADSA 5K9DA 4LVDA 2C0AA 3CU2A 2PC4A 3BW3A 1KFCA 3DFSA 4NJIA 3NG3A 4RZ4A 1FCUA 4Q4KA 1BKSA 2JK2A 1GWJA 2C15A 4PC8A 5HJLA 5D02A 1THFD 3UYCA 3NZ1A 3TQVA 3KVKA 4R34A 3TUUA 1K7XA 3TSMA 3UY8A 3GXTA 3NPWA 1ME7A 3O63A 1W5NA 4OV9A 4DF0A 4Y6GA 2W6RA 4LY8A 3FLUA 5HULA 2QUTA 2E6DA 1JRBA 1D9EA 4O54A 3HMJG 4C1KA 1XM3A 3NL2A 4RZ5A 4Z1AA 5H91A 3F4WA 3LV5A 2RFGA 3KVMA 4WXZA 1GQNA 4AEOA 3EWBX 3W84A 2VFGA 3CPRA 2Y62A 2C18A 4QITA 5D03A 3W7PA 4LRTA 1ZNNA 1OFQA 3PSWA 5CGQA 1PIIA 1MO0A 2WNZA 3QZEA 2Y70A 1KLZA 1DQWA 3C4UA 3MHGA 4O28A 1RVGA 2D73A 4Z0SA 2XN2A 2WPBA 1OYCA 4Z0JA 4ZVJA 3A23A 5DCEA 1F7BA 4O11A 1LORA 2ZA2A 2Q3RA 3SI9A 2V2CA 4JTLA 5EYWA 2WKJA 1KBJA 3G3MA 4LOCA 3IEBA 3BGJA 3VE7A 1FUYA 1ZHAA 1HL2A 1N7KA 4QNEA 4AHPA 1VLWA 3KRUA 5LGZA 4LW7A 3THAA 2V2HA 1G7VA 3WJYA 4GE8A 2CZDA 3KX6A 3HO8A 1XI3A 2FPYA 1AW5A 4O4VA 3EXTA 4FXRA 2B7PA 3TFCA 3GXNA 1OX5A 2ABBA 3D0CA 3IGSA 1GEQA 1KM6A 1QNVA 3U6WA 4JY9A 3VNDA 2DZPA 3BW4A 2A0NA 3W2LA 4JR5A 1BWKA 3PBVA 1W5OA 3PY2A 1G7UA 2ZZ6A 1FDZA 3O16A 1OYAA 3N19B 5KZEA 4N9CA 5D2XA 3G0SA 5AC7A 2OMAA 3C2EA 3G1FA 2VELA 3UWVA 1SO5A 4PA8A 2C6QA 4P61A 1A5AA 1XBXA 4TX9A 5CKSA 1FXPA 1OFPA 4NXSA 1OX6A 1TCDA 1SZEA 1LRTA 2YFOA 3E49A 4H4IA 2ZRVA 3S1WA 3G22A 3B0PA 1WOBA 5FF4A 3ELFA 1F2JA 4IMGA 1LCOA 3GAKA 2CFFA 3M1ZA 1M5WA 4BWLC 3GR7A 3SW6A 1TTPA 1SQ7A 4NZJA 2GJLA 5K2ZA 2H3DA 3I68A 3LLFA 3O05A 4WZHA 3G0UA 2WO5A 5AC6A 3P74A 1I8JA 2YYTA 2E6YA 1TTIA 2WV8A 4MZ1A 1VHNA 4FIRA 4R53A 3DHDA 5ABTA 3PBUA 1HG3A 2HS6A 3TXVA 3ABQA 2V82A 4GBUA 1GTEA 2QAFA 4PL2A 1KTBA 1AW2A 1OX4A 5K9XA 3HPSA 3KHJA 2J6XA 2NXHA 3W9ZA 3HIJA 4KWVA 5E93A 1GVRA 4MJZA 1LDCA 1QFEA 1QDSA 2YCEA 4A2RA 4MPQA 4GC4A 3SECA 3G8RA 5FF3A 2TPSA 2YW3A 2BXVA 1YLVA 1TV8A 1L6WA 2B0MA 3F4NA 1OFOA 4CLMA 3KFTA 2VEIA 5F4SA 4UNKA 5DXXA 5I3KA 4CNNA 2JKEA 3STGA 3GVGA 1TYGA 2W0UA 2ZFAA 1EUNA 5AFDA 1GOXA 2CWNA 4IXXA 3NA8A 2WNQA 1GG0A 1G69A 3TW7A 4DPQA 4YWIA 1H7WA 3FYOA 3S9YA 5G5IA 2ISWA 1X7FA 2VFHA 4AWSA 3RFAA 1RQEA 3LV6A 1SUXA 2QAPA 3QW4B 1GG1A 1L2UA 1GYLA 3SGUA 1TIMA 4EOUA 2YFNA 4O15A 1OG0A 1BTMA 2GQ9A 5D2YA 4NX0A 4IGHA 4LWWA 1VH7A 1VZWA 3W7EA 3G1DA 3LHVA 3CIXA 3EKLA 5E0KA 1V7YA 5FEXA 2NV1A 1AL7A 5AHMA 4O0ZA 1FDJA 4L4MA 1W8SA 1QCWA 3IIXA 3P7YA 4MYAA 2FLIA 3SZ8A 3W88A 2C16A 3FEMA 4UXDA 1BWLA 2ZQ0A 7TIMA 1NF7A 1FCBA 3DI1A 4MFEA 4LNYA 1TPB1 5DCDA 4U28A 5KITA 2FIQA 1L9WA 3EWYA 1GVFA 2ATSA 2FFCA 2EKCA 3DHFA 1LLZA 1KM0A 3GAYA 5U7SA 4H3DA 3W7DA 1XXXA 2FPTA 4E2DA 1OK4A 5D30A 4JGDA 5EA9A 2YGYA 2WNNA 5IBXC 1PE1A 2CLKA 3TQ0A 3W86A 2RDWA 3P61A 1UB3A 3DZ1A 1TPDA 1FY6A 3NYZA 2NWRA 1I2PA 2JKPA 3W7NA 2NV2A 3P67A 4WY0B 1FWRA 3MHFA 3HGOA 4O18A 8TIMA 1I2NA 2NZLA 4OWGA 2G96A 2YW4A 5LNRA 4UTKA 4UTJA 3RNDA 4BI7A 4O10A 4Z1CA 3TJLA 3LRLA 3O6CA 1O60A 5HUOA 2R91A 1K3UA 2V0TA 3VI2A 3GKFA 2Y61A 1DORA 3MBFA 2RDUA 4WD0A 1DBTA 5F4XA 3MBDA 1W0MA 4JTJA 3S1UA 3KAOA 3UNDA 3N9SA 1VR6A 3GYEA 4RXGA 3P81A 2EAWA 1XKYA 3W1LA 2FTPA 4M5PA 4KKXA 4UMCA 4ZQCA 3A22A 4TO8A 3W74A 3M5VA 1B4KA 2WSRA 3FFSA 3O6YX 2E5DA 4QISA 4LS0A 4MLRA 3W7MA 1V5XA 1TPUA 1H51A 2FPVA 3C2RA 4BI6A 4NT0A 1EP2A 3OG3A 2FQIA 3WK0A 4X2RA 3DAQA 3WJXA 1WX0A 1ML1A 1T0OA 3W1MA 3W1UA 4NNBA 1OK6A 4Q33A 2QKFA 1W31A 2A7NA 3S1VA 4AXKA 4GWEA 4K7YA 2WSQA 1K8YA 5AHNA 2O7QA 2QCEA 4MIMA 5G2IA 4FX8A 1Q3NA 1B9BA 1QO5A 4GUHA 5K7JA 1VGAA 3BLFA 5HR7A 1H7RA 1GVQA 4K37A 3HGJA 3GLCA 2DZVA 2QR6A 3G18A 2ZTJA 5FESA 3BLEA 1FWNA 2Y63A 2J9YA 4G1KA 1WXJA 2A85A 3EX3A 1H1ZA 3P82A 4NUWA 3MP3A 5BRBA 1F05A 2QDGA 2Q3OA 1NEYA 3P8IA 3W1XA 1TSIA 3U2OA 3QEZA 5FEWA 3HOJA 4JTHA 3G1AA 3NOEA 4ICNA 5AOUA 1N55A 3HG3A 4ZQMA 5L6UA 3UD6A 4MUZA 3Q58A 2YXGA 1XDMA 1VHCA 1M7PA 2V81A 2NXGA 3LCIA 3DFPA 4XBSA 4UTWA 4ONVA 4NJJA 1Q6LA 3I65A 1SSDA 2Y7EA 3W83A 1JUBA 1T99A 2CLMA 4JICA 4FHAA 1JULA 1K7FA 4I7VA 4PODA 3TV8A 4FXSA 2WQPA 3LI0A 4I9AA 4K6AA 1F76A 3B0UX 1W5QA 4RLIA 1PCKA 4ZQRA 2A6LA 3HPZA 1SZGA 4IMCA 5F1VA 3W07A 3N34A 4QAIA 4S1FA 3M44A 1S5WA 1D3HA 3LHZA 1HUVA 1DOSA 2TYSA 1KFLA 3W2JA 3IIZA 1LRQA 1P1XA 3MI3A 3GKAA 3E9AA 2Q8ZA 4Y8FA 2GVLA 2YSWA 2E6FA 5D38A 2QJGA 4LV9A 4XTDA 1TPFA 3G1XA 4XTIA 4JTFA 1GT8A 1TPH1 3PG9A 1X6UA 5KSWA 3L9CA 4IMEA 1R46A 1U5JA 3SY5A 3W7QA 3JS3A 3HBLA 4XUGA 4JTIA 1YXCA 3NPVA 3RLVA 3TK7A 3LTSA 3RMJA 4MYXA 3EWZA 2H6RA 1P5BA 5F2LA 1TTJA 4NJHA 5D2WA 5KTLA 3T78A 3UZJA 5D05A 4S2BA 3C8FA 3BVJA 4M6VA 4MZYA 3QW3A 1XDLA 2VENA 2ISVA 1DL3A 4UTTC 1SZNA 5DELA 1PHQA 1LP6A 4NQ1A 2JKAA 4UFKA 3B05A 3TMQA 4OU1A 3G1YA 5HWJA 2Z2UA 3LI1A 1QMLA 4M7SA 1QR7A 2Y85A 1S5VA 2C14A 2FDSA 2OZ0A 3LB0A 4N02A 1KV8A 4GUFA 3GDKA 1EA0A 1MXSA 2WJZA 3LHUA 2Z0IA 5I3HA 3GDRA 4QSHA 5CSRA 3IGUA 5D32A 2RHGA 5BMWA 2DZSA 2VFDA 1RR2A 4EWND 1EP3A 4O1CA 5L9FA 1WAUA 3WK2A 5TIMA 3KXQA 1LBMA 4JS3A 4MY1A 4JY8A 4MLJA 4PL1A 3N73A 1KFEA 4O1DA 3T4CA 1F6PA 4ZL1A 2E1DA 3C61A 3LM7A 1TRIA 1FWSA 3B04A 2A7RA 3R8RA 2ZBTA 5C6MA 4RK8A 3LCXA 5LNUA 4MKNA 3LRKA 1CI1A 2AQWA 2DU2A 4DBEA 5EBUA 2P1FA 3G24A 4QJ1A 2HS8A 3DU0A 4NVTA 5HNRA 1H60A 2QCFA 4CNPA 4UFIA 1VCVA 3MHUA 2Z6IA 1HO4A 2VOMA 4W9TA 4ADUA 4WOZA 2GPTA 3NNTA 5FF7A 3M41A 3M7WA 1LTDA 1KTNA 3LBMA 4UMBA 3PUOA 1OF6A 2ZRZA 4ZZ9A 1LRNA 3NQ7A 1QAPA 3T7VA 4N2YA 3W7OA 4ALDA 3B8DA 1ICQA 2CLEA 1JCMP 4U4MA 1J2WA 1LROA 3BK0A 3S5YA 3P60A 1W3NA 1NVMA 4LVBA 4DO5A 4GNJA 1K02A 4MOZA 4I7WA 1Q6RA 4JX4A 4JX6A 3WJSA 2CZFA 3NO5A 1B3OA 4O0KA 5DLCA 3AJXA 2B7NA 3KVLA 3ZR4A 2QCDB 3TE9A 5GVJA 3W71A 1ZCOA 3G1SA 5LNVA 4AWTA 4O14A 4YCOA 3BPWA 2R94A 5D09A 3PVFA 5U4NA 3SR7A 4MZ8A 1HFBA 3OBKA 4XKYB 1FCVA 2JBMA 3EWWA 3TDFA 2DORA 2PRHA 3W70A 4FNRA 1PVNA 1KV5A 5F2MA 1TJRA 1O5XA 1RZMA 3W72A 3M9YA 3ABRA 1KM1A 1H7OA 2GJNA 3W2MA 4CCCA 3B0VC 3TFXA 2GQ8A 4QIUA 1EB3A 3W7LA 5IM51 2A6NA 2EPHA 2PE4A 5BMXA 1JCXA 3OIXA 1B57A 1YDOA 4LS2A 5C55A 3PBWA 1G4TA 4LUIA 4JEQA 2DP3A 4MFDA 2VEKA 2QDHA 5G2HA 3B06A 3S42A 5I3GA 2C19A 1TTQA 3KRSA 1W5MA 1H62A 3JR2A 4K8HA 4FEZA 4D2JA 5K4ZA 4WY0A 4JIQA 4HHPA 3GDLA 1IXNA 4RR4A 3W23A 4UR7A 1QOQA 1H7NA 5F4WA 2YR1A 3ATZA 1K03A 2VFEA 1PL9A 1EEPA 1GVSA 2NX9A 2VFFA 3IIPA 2Y6ZA 3UXDA 1DV7A 1VYRA 3HPXA 4OV4A 4FNPA 4RZ6A 5LHEA 2G95A 2CZ5A 3BLIA 3PC0A 4ML9A 2R8WA 4OGZA 1WBJA 5AHLA 2P10A 4IX0A 2VC6A 4UFHA 4JYEA 4M6QA 3LGEA 5DY3A 4BWLA 3P84A 3TSDA 4YMZA 1Z42A 3N14A 1B4EA 4UFJA 3LERA 3M43A 2Z1BA 4IMFA 4LUJA 4IX2A 4Y9AA 1FXQA 3INPA 3WK3A 3TAKA 2DJLA 4KFNA 4AAJA 1WBHA 1VC4A 5CPLA 3UQNA 3MWAA 4UTLA 3FJ6A 4K36A 3T55A 2H8XA 5DCBA 5H2ZA 1KA9F 1TREA 1JCJA 3NXFA 3F1QA 3QF0A 4GUJA 3S0CA 3G1HA 4RKAA 2GUUA 3BW2A 3H55A 1R2TA 3IIOA 2ISSA 1OFBA 1SW0A 1ALDA 4AHOA 2R14A 1JCYA 2NWSA 3L5MA 4NJGA 4NXKA 5DBTA 3SFKA 2BTMA 1TO3A 1QPOA 3TAOA 1X1OA 3R5EA 2P0OA 4JDYA 1YTDA 4HIBA 1LOQA 1LM1A 3QFEA 3SJ3A 3P62A 4O53A 4WJEA 2YDAA 3QMSA 5J5RA 2CLFA 2E09A 4DQWA 1JJKA 4QQ3A 4Z1BA 3TC6A 2Y88A 3G8EA 3TKFA 3C52A 2JGYA 3P5ZA 1C8VA 1QPQA 5IBXA 1ICPA 1QPNA 4X22A 1ME8A 3VCRA 4A22A 4O19A 3V1PA 3W85A 4LTSA 3T44A 2OCZA 5T26A 3FS2A 3M5YA 3TC7A 1W5PA 2V8ZA 3LCFA 2ZZ7A 1GZGA 1IIHA 2JGQA 3NQMA 2C3ZA 5HWNA 1TRDA 4WXYA 2X1RA 4N4PA 3P8JA 2X1UA 1LYXA 4PH6A 4N9DA
chains in the Genus database with same CATH superfamily
1O6IA 2QF7A 4JCMA 4MWAC 4NYYA 1F5ZA 1OD0A 4X3ZA 2F7FA 3BJSA 3W87A 2PP1A 1PS9A 1SJBA 3U3HA 5DXYA 5A8NA 1D3CA 1V3KA 1G67A 3W3OA 1E0VA 3LLDA 2HJPA 3EDJA 2WYSA 5H8UA 1AH3A 3NQ2A 3M6YA 1UYQA 3O07A 5DBUA 1FDYA 2QUVA 3SRHA 1OVDA 4D6HA 3C0SA 1QO2A 4HB7A 3TIMA 4LVFA 4Q8UA 4LYPA 4PTNA 4PBGA 1QHZA 3A4XA 1HL9A 4S3KA 4PBFA 1E73M 1V93A 2PWFA 3WMCA 3HB9A 4G7EA 4LB4A 4UTFA 2YBVA 3T0AA 2NUWA 4Z2HA 3L0KA 2QJHA 4UCGA 2VEMA 3KVJA 3WQWA 1ZZMA 2QPXA 1Z44A 1GJPA 4DO4A 1E4IA 4EAYA 4E8DA 4RW5A 2WVTA 3UG4A 1JDCA 1GYNA 1KWGA 4B3KA 3RAOA 2X2GA 3M0HA 3L4XA 3DN5A 3MA8A 1F3EA 4PMQA 3M7SA 4KWSA 2ZZ5A 2H8ZA 4AZHA 3KRBA 2QMJA 1JD9A 1R2SA 4HYWA 2YKKA 1MFVA 2I1OA 2J9ZA 4PMYA 3RR1A 1M3UA 1KFJA 4AU0A 4FI4A 3WQ6A 1DHKA 1A5UA 1QUMA 3TROA 3HU7A 1CX9A 3M64A 2VGIA 3K13A 4DAIA 1TJ1A 3OJGA 4C6PA 3V18A 2XISA 3BAKA 1VQTA 1E6RA 1T8XA 4H00A 3TTQA 4L65A 5JIWA 3CAWA 3DDMA 1SPQA 3DYOA 5LGXA 2NUYA 2OQYA 3LTPA 2FB2A 4R7OA 3IJDA 4AZGA 1NFBA 3MVTA 1VBUA 3WD1A 3VKBA 1JUKA 3IARA 2R6OA 3PUEA 5CC7A 2A3CA 3E2SA 1CYGA 4PEKA 2CW6A 3MI2A 4ILSA 2VKZG 3WLMA 1HQTA 2JEQA 1EXBA 5HWMA 3UWEA 1P0BA 4B92A 2VZSA 2QIIA 1FWJC 2Y7GA 4O1AA 2GSEA 1UC4A 3GG8A 4NL1A 6TAAA 1UCWA 4NZCA 1V02A 3MKCA 3XIMA 4TVCA 1VFTA 4Y8EA 3ITYA 2X09A 1DE5A 1AW1A 3LNPA 3CEPA 1JZ3A 5FCZA 3P14A 4RE3A 1PDZA 5AHEA 2V5LA 3AYRA 1JI2A 1R3RA 2BDQA 5I77A 1O68A 3L4TA 3B3DA 1HTIA 3WY1A 1EP1A 1VFLA 1NFPA 4UQDA 3UR8A 2AAAA 2DZWA 2FTYA 4F3HA 1I0BA 1V6TA 1XUUA 1TPC1 1H4PA 4JYDA 3DFNA 1HVXA 3PP7A 7A3HA 2VC7A 2FMNA 1EQCA 1EIBA 3ZO9A 4LVAA 1K9EA 5EGRA 3OVRA 3SEPA 4O1BA 1JDEA 1TWIA 5HA7A 2QCHA 3HGSA 4HPXA 2R24A 2PLKA 4NILA 3TLQA 2WNWA 2AAMA 2UWFA 4DX3A 1W1YA 3QHOA 5CJNA 1T8QA 5A1AA 4DF1A 3QZ6A 1A50A 1CB2A 2WVVB 2XH2A 1RPXA 4YVPA 2EJAA 4IQLA 3HPFA 2GYIA 3GTFA 4GQQA 3GW0A 4JOMA 4H6RA 3ZXWA 1YNYA 3MMTA 3S1GA 4ORMA 1EFZA 3VILA 3QV6A 4YPJA 1XS2A 1LWIA 2G3MA 3ZS4A 4O12A 1U83A 3F03K 3OGRA 4TIMA 5CEWA 2TSYA 6PTDA 3T8QA 1UP2A 3N2MA 4H41A 2O7SA 4EK7A 4ZMGA 1W1PA 4NNAA 5CGTA 1MI3A 2X16A 4LV4A 4H1ZA 4IGSA 4FIQA 1E70M 1U33A 2GDUA 1FWTA 1XH2A 2QGYA 4XAYA 2NXIA 1UD5A 1LBFA 3NQFA 1XC6A 1BTCA 4MDPA 4AF0B 3VOGA 4US5A 4F40A 1R85A 4FNTA 4ORIA 3BCFA 3OZPA 4LS1A 3MYOA 1M04A 1US3A 1Q5MA 1M7JA 3NR0A 2HNEA 2HMCA 1EUAA 2QHAA 4BKNA 5C9RA 4LAZA 1OQFA 4ZQOA 1CXLA 3KS6A 2CXEA 5FOOA 1BQGA 1AD1A 3FDKA 4UQ9A 5BW6A 1DJQA 2J24A 1DIDA 1KCKA 1KRAC 5C9ZA 2LLEA 3BO9A 3NM3A 2WC4A 5LNSA 4N6EA 2FZ9A 1PKNA 4AX7A 4ATDA 5TQLA 3AUJA 1EGVA 2Y89A 2WMJA 3GTHA 4DI9A 3POCA 3ABOA 1NF0A 3BAWA 3DERA 3HURA 1SSGA 4ZO6A 2NVCA 1B0IA 2ZX8A 3RITA 3SRKA 4DEFA 3WH7A 3B8UA 3LDVA 4ZODA 2NT0A 3AIQA 3SRFA 3JU2A 4IUOA 3TA9A 1WQ5A 3V75A 1KFKA 4GFIA 2X05A 1J01A 4GG9A 1MYRA 1IQ8A 4KERA 4CNTA 1U1JA 5CSYA 4DY1A 1C93A 1R8LA 3IVSA 3TOPA 1TV5A 2WMIA 1T5AA 1R3TA 3BMWA 3SCQA 3G3DA 4I5UA 4JX5A 1UD2A 2AL2A 2ACSA 2HROA 3GXPA 4OHQA 3WLIA 2DH3A 1H1NA 3ORWA 2VVSA 1TMQA 2VZTA 3DFTA 5C9UA 4GUGA 1JL8A 1E51A 2Z7KA 4L1XA 3ONBA 4FA3A 2G5WA 4MY8A 1XCWA 2J79A 2C1IA 4ZB0A 3T40A 1G4SA 5HNTA 3WBAA 2BASA 3SCOA 1YKWA 4HU4A 1UHVA 2YL9A 1J18A 1QW7A 3JW7A 2PRMA 2QMKA 2WXDM 3KLKA 2PDLA 1JZ6A 1TIWA 3W7GA 1MXDA 1ZU8A 3C2OA 1GZ1A 1XYMA 4QLJA 4RDVA 2Z7GA 5LSMA 2EG8A 5BNKA 4DI8A 2D69A 3VMPA 3S6OA 1QWGA 1T40A 4N6FA 1W1ZA 2VZUA 3UY7A 4GBDA 1HJSA 3QBUA 4AD5A 1IV8A 3GDMA 5A3HA 2AKZA 3I6EA 3OW1A 3CIWA 3TYEA 4QM1A 3ITXA 1A5SA 4GXWA 2YXOA 3FOKA 3UJEA 3LHWA 3LK6A 5IXEA 4L61A 4R7WA 5AC4A 4UTTA 2OKOA 1O94A 4AY8A 2DIEA 2XH4A 4D1JA 1AODA 1QPKA 3PR2A 4L4LA 3LBCA 4LUTB 2BY1A 3CQ0A 3OVPA 2NW0A 5BOFA 3I7QA 3ARQA 3FDGA 4KCWA 1NAL1 2UBPC 4FNSA 2P8CA 4AW7A 3GH4A 3EX6A 4HSNA 3KCLA 4V2XA 3CUZA 4GMEA 3K30A 3WZ0E 2DGAA 2E3ZA 5CJ5A 3L7RA 1W56A 3CZJA 2QJIA 1XIEA 1DHPA 2W61A 1L6FA 3LTYA 1PZ2A 3OBAA 5AZ1A 5BCAA 4HCDA 2ZTKA 4WJXA 4I7UA 3MMWA 2H90A 2CBJA 4ZCWA 3UVAA 3CASA 3N2OA 3R2GA 3GB6A 1CZ1A 1C7SA 2D23A 1ZTVA 5HJYA 1DWGM 2D0GA 3ARSA 4Q8NA 1FWBC 4EXQA 3FK4A 4MY9A 3ZLHA 3D5HA 3LCWA 4QROA 2OWWA 3QOMA 2RKXA 3H70A 5I24A 2HK1A 4WKHA 3RM4A 1OHLA 2AGKA 3OEXA 2PDFA 4GJ1A 2IKGA 2Z2BA 4LEQA 4INFA 3WJZA 4YCPA 5A8QA 4LC6A 3WF0A 3WH5A 1SW3A 4LXFA 3ANUA 1G01A 3PNUA 3RRAA 3S83A 4X61A 2NX1A 2GDQA 4GINA 3FJNA 1MRQA 3NQ8A 1PJ9A 1M7XA 4ZXLA 1TE1A 1A0DA 3S5SA 1BYCA 1S2AA 1OYBA 4W5UA 3RPTA 3S6DA 3TSBA 2PTZA 4FX6M 1V08A 4IP5A 1QI5A 2ZICA 4PMDA 1KFWA 4LUTA 1XLAA 2QUUA 3U2ZA 3H21A 1LLWA 2WVUA 3ARUA 5D9NA 1VLIA 3W6YA 4Q32A 2FH6A 2D2JA 2OX1A 2V5JA 4H6QA 4X9YA 1EDQA 1JDAA 3CT7A 2PODA 2ABAA 3QKEA 5FEPA 1HKJA 2E5CA 3TYZA 3AU2A 1UW9A 2GWGA 4J3WA 3TA6A 3ZM8A 1SO6A 4UZUA 3CHVA 4UR9A 3PFRA 3PAJA 4TXEA 3DH7A 2E1WA 3NQ6A 2CNCA 3BURA 1OCNA 3GZ3A 1GCYA 2XFYA 4AB4A 1SM9A 4O57A 1YXDA 5EMUA 1LG1A 2V5BA 4JIHA 5EB8A 1FVPA 4JXCA 2EXOA 4FNQA 3A3WA 3MUAA 2JALA 3BG3A 3QJAA 3SGZA 2A1YA 4HN4A 3JRKA 5FD0A 1XV8A 1Q7QA 4P8VA 3DFHA 1C29A 2XJ7A 3PWAA 4W7VA 4JIRA 3FKKA 3L0NA 1JQXA 2HPIA 2YL6A 2WZHA 3CXOA 1UD8A 1GGOA 1KM2A 4P2VA 3E74A 2VFIA 1FP8A 3CBWA 5G2WA 3GVRA 3A9IA 3EOUA 5IFTA 3LXCA 2VL4A 1DJZA 1Y5VA 1Y8BA 2WVVA 4D8AA 4MNMA 1L8PA 3U8GA 1A5NC 3RU6A 3PG8A 4AZ7A 3NSXA 1NQKA 1OINA 3VNYA 2WMKA 2NQHA 4CCDA 2HXTA 4XAFA 1VJZA 4ASTA 3PHAA 1W9UA 3PWGA 2PURA 2I5GA 3CIVA 3OP2A 4QTGA 1SR9A 4M7TA 4URIA 1WOAA 4HNNA 7XIMA 3N3TA 4IISA 5FF0A 4TMCA 3AUOA 4M3PA 1DPMA 4O16A 1EIXA 3E2QA 3KE0A 4B5UA 4DXKA 2GSJA 5BU6A 3U2EA 3OPSA 4W85A 3BLPX 2D3NA 1S2VA 1ZY9A 3CZ8A 1F74A 1FWHC 2DJXA 5KZ6A 1Z8AA 3E96A 1UUMA 2J8FA 1O4UA 3EX1A 2X0SA 4DYEA 2DW7A 3NWRA 4GABA 3ARPA 3NQAA 4XZHA 2GJXA 5K9DA 1LLOA 3TN5A 4W84A 3UJ2A 2PC4A 2XGBA 3OO2A 4MF4A 1W9PA 3DFSA 2VX7A 3GXIA 2F2KA 4RZ4A 3BQ5A 1W1TA 1BKSA 1UC5A 5HQLA 4PC8A 5HJLA 5D02A 4R34A 3IUHA 3PPGA 1QNQA 3GXTA 3UY8A 1ME7A 3V0SA 3BL3A 4DF0A 2W6RA 5HULA 2JFEX 1J93A 2QUTA 3AMKA 4UZSA 1JRBA 3GC2A 4DVOA 3EAUA 4RZ5A 3AYSA 1H09A 1YE4A 1UOZA 1XRSA 1GQNA 1V3MA 4Q7NA 1P0EA 3CPRA 5DFAA 2Y62A 5D03A 2CLPA 1OFQA 3ZLFA 5BYWA 2WNZA 3QZEA 4HU0A 4AIOA 3WBWA 1KLZA 3MHGA 4O28A 3RLHA 1S2CA 1PKYA 1MQRA 2WPBA 2IPJA 4ZVJA 4O11A 2X7VA 1LORA 3KWXA 3SI9A 4HJFA 4Z2GA 3M0MA 4IQDA 2BY2A 4K2SA 2O9PA 2V3GA 4D71A 4LOCA 3RIKA 3VCNA 3B0XA 5HAOA 4DJFC 1N7KA 4AHPA 3KRUA 1UA7A 3P0WA 2F2HA 4BQ3A 3THAA 5FSEC 3MDUA 1YIXA 1XIFA 1AJ2A 5IOBA 1W1IE 4O4VA 2DQWA 1XLMA 2B7PA 2HVMA 3E3HA 4GVHA 1OX5A 1U5HA 2L5HA 3IGSA 4H8HA 3W2LA 3SQSA 1BWKA 2ONEA 1W5OA 3PY2A 1A4MA 5CSUA 2ZZ6A 1ZGDA 3WQFA 1OYAA 3SCVA 1S5NA 3H4GA 3MKVA 4C90A 3C2EA 3G1FA 4ZFCA 2VELA 3UWVA 6REQB 2C6QA 3F4DA 4Q8VA 3V16A 1OX6A 3TLLA 1W9BM 3VMNA 2IKIA 3AYVA 3QY7A 2XM1A 2ZRVA 1ECEA 5HPCA 2WHJA 4H8UA 1F2JA 3L4ZA 1LCOA 2J74A 3NDZA 3M1ZA 1TTPA 1NWSA 3PTDA 3VIIA 4IQEA 5DRIA 1EOKA 3FAXA 1MZRA 2OZ8A 2E4TA 1I8JA 1GJUA 3AIRA 2YYTA 2E6YA 3HV9A 3T42A 3PBUA 1HG3A 2HS6A 4PL2A 3K2GA 4QJ4B 3MQTA 2VX6A 4YYCA 5LA0A 1U30A 5A8MA 4B3ZA 3M0KA 3SECA 2XPKA 4LAKA 1TV8A 3F4NA 3KTXA 3NJ3A 2EO7A 4X63A 1XSJA 3PZOA 5A6SA 4ERAA 5I3KA 4RNIA 2PZ0A 2DT2A 1OC5A 5HJXA 2W0UA 2ZFAA 1E1FA 2X2YA 5HATA 5AYBA 4C1NA 1I0DA 4IXXA 3KW3A 4WVXA 4WIWA 3Q67A 3AYTA 1RJQA 2YDQA 1W3LA 3FYOA 4L4OA 1QHOA 2GGJA 4AWSA 1RQEA 4B16A 4E5TA 3U5YA 2INZA 1UMYA 4GIYA 5JH1A 1TIMA 3MWCA 1WXYA 4IJCA 3GM8A 1WDRA 4F0LA 1KRMA 1BTMA 2GQ9A 5D2YA 3APTA 4NX0A 2UY4A 4LWWA 2CBUA 1BQCA 4TV6A 3RG6A 1EJSC 5EMKA 2EKGA 4KMQA 3CL7A 1V6WA 1AL7A 2JE8A 1E4NA 2FLIA 2GJXB 1BPLB 4UXDA 2CXGA 3W00A 4GJJA 3BDKA 1LG2A 4Q6JA 3EDDA 1KRCC 3WDHA 4HGXA 1GHSA 1GVFA 2ATSA 1HIZA 4YHGA 1JNDA 1KM0A 3GAYA 4H3DA 2V69A 1OK4A 1M65A 4JGDA 1MQQA 1Q2RA 1PE1A 5JVLA 3W86A 1FH9A 1TPDA 1PXGA 3W7NA 4AIEA 4RNFA 1FWRA 4PYSA 4O18A 2NZLA 4OBSA 4XUYA 2G96A 2NQ5A 4OJYA 4O10A 1V6UA 1EGZA 3TJLA 4IIDA 4KPLA 5C9XA 1GNXA 1RK6A 1IZKA 1XLIA 2R91A 3K8LA 1XPYA 3CV6A 3UW6A 3GHSA 3PJTA 4GY1A 2RDUA 1LL4A 1AQFA 3MBDA 3UA3A 1NWUA 3BUVA 4F66A 5C7VA 1W0MA 2ASHA 4JTJA 4HMDA 3TZFA 3CMFA 3UNDA 4LYRA 3I10A 1NJJA 3GYEA 1F4AA 3WH8A 1MW3A 2EAWA 4PRRA 4GCXA 2XIJA 4ZQCA 3CQKA 4DJDD 3H2AA 2WSRA 3CV1A 2QVNA 2G8ZA 4GA8A 2OQHA 2FPVA 1FFRA 4NT0A 1NOFA 4CNUA 1GUVA 5CC5A 1CGYA 1EH9A 3OG2A 4X2RA 1CGTA 1GOIA 1WX0A 4E8GA 4NNBA 4TUFA 1QNOA 4Q8TA 4Q33A 3RCMA 5A2AA 3S1VA 4QG8A 4K7YA 3UPMA 3AIUA 5E6YA 2WVSA 4NYUA 5G2IA 1Q3NA 2W5FA 1SJCA 4KH2A 1C9WA 1VGAA 4DLMA 3TW9A 2DZVA 1Q6FA 3NIYA 1FWNA 1RVKA 2Y63A 1F6YA 1BXNA 3SUSA 3BLKA 2QDGA 3WBXA 1V3HA 3P8IA 1XISA 3UCDA 3QEZA 3HOJA 4FXFA 4ICNA 3NOEA 3MSDA 4I3GA 3HG3A 2Y1HA 5L6UA 1I60A 3Q58A 2YXGA 1VHCA 1QU4A 1M7PA 2QXWA 3N6QA 4QSFA 4QBXA 3DFPA 5BXPA 3CS2A 2PF0A 4FOUA 1Q6LA 2Y7EA 1JUBA 1T99A 4JICA 3SURA 5IFPA 5JBEA 4PODA 3MY9A 2OSYA 3TV8A 3SN0A 2WQPA 1RJRA 4I9AA 4IL0A 5BXSA 1RBOB 1XCXA 1UH3A 2A6LA 5M3WA 1SZGA 3PJUA 4Z2KA 3W07A 1XLKA 2Y5JA 1XW8A 3N34A 4QAIA 3QV8A 4A8NA 1YHTA 4FK9A 1DOSA 1KFLA 1KXVA 1XYZA 3EKGA 4TOQA 2VC9A 3VNMA 3WL0A 5CG0A 4Y8FA 5JMUA 4DNHA 2YSWA 2VEFA 4QAWA 1ADSA 2QJGA 3K8KA 3G1XA 2PDUA 4JTFA 2Y24A 1TPH1 3CV2A 3J7HA 1X6UA 1U5JA 3SY5A 3TTSA 3GW3A 1D8WA 4ML4A 5T9BG 3LTSA 3RMJA 4MYXA 2DUXA 1P5BA 1CLXA 1FWEC 3CUXA 1MUWA 4K8GA 1AFSA 3H4XA 5D05A 4S2BA 4FS9A 3C8FA 1VEMA 1XDLA 2VQTA 4UTTC 4CU7A 5DELA 4NQ1A 2JKAA 4UFKA 3B05A 3TMQA 3GC4A 4M7SA 1GZJA 1H11A 2Y85A 4ZTXA 1A3WA 3ZR6A 2PEVA 3A3XA 1P6CA 3A4AA 3IAPA 5BZAA 4IIFA 4DJEC 5D32A 2DZSA 2OOGA 1LBMA 1TUFA 1UPMB 4V15A 3WQCA 5REQB 2MUCA 3WF3A 4IPLA 3KBWA 4GACA 4PL1A 1F61A 1BSIA 3C3UA 1FWSA 3VDGA 4S3EA 4ERGA 2A7RA 2W62A 3EMQA 1E9ZB 4ZA0A 5LNUA 4MKNA 4GVIA 3IS4A 2RJGA 4IH3A 3TP4A 2P8BA 4RNHA 3DU0A 3HQNA 4NVTA 2FGLA 4MNJA 4D6DA 4CNPA 5BRQA 2EBNA 4ADUA 5B80A 3LGGA 4XZIA 4N0RA 2PLJA 4UOJA 4H7CA 1ZP3A 3M41A 4EAMA 4PUJA 2ZOXA 3AROA 3PUOA 3VZYA 1F9CA 2SFPA 3H24A 4ZZ9A 1QAPA 3UJRA 2CLEA 1JCMP 1JZ8A 5AZ0A 4DO5A 4LVBA 1F8MA 4I7WA 4LBSA 1Q6RA 3W01A 1R3WA 1JCTA 2CZFA 3U7BA 3NO5A 4L9XA 2CC0A 3LS9A 1B3OA 3Q65A 2J75A 1RLDA 1VFUA 4GNKB 3WKZA 3EDFA 1GQIA 4O1FA 1ZCOA 2BGNE 2FJUB 3G1SA 3CH9A 3URBA 3LG3A 4MMWA 1CPUA 4AQLA 5TAOA 3PVFA 3SR7A 4MZ8A 1CLKA 3FHAA 3TDFA 5FJPA 1PVNA 2GVEA 3JZUA 3NQBA 3VXGA 1DJXA 1TJRA 1W3JA 2PDNA 1KM1A 3W2MA 1C8QA 4CCZA 2PE4A 4LUSB 5BMXA 3Q45A 3ITGA 3ZJ6A 4LS2A 3PBWA 4MFDA 2QDHA 5I3GA 4US6A 1UWIA 1W5MA 4HQVA 1H62A 3NUKA 4WY0A 1XIDA 4JIQA 3WEOA 1ESWA 1IXNA 4ERIA 3W23A 3U7VA 5MKGA 1E40A 1ZJBA 1EEPA 2IPGA 2NX9A 2BGQA 2Y6ZA 5AVNA 1DV7A 1YPXA 2FH8A 4OV4A 3WQ8A 4FNPA 5LHEA 2G95A 3WNOA 3SAZA 4IX0A 4UFHA 3NZGA 5I2UA 4M6QA 3LGEA 1MW0A 3TSDA 2XVLA 3W6MA 3M43A 1RHCA 4MTVA 4IMFA 4IX2A 1FXQA 1AH0A 3S9IA 3UA4A 2DJLA 4KFNA 4AAJA 5MKGB 4PEEA 3BCJA 3R25A 3R4IA 3RGTA 3MWAA 1ELSA 4UTLA 4AYSA 4I5XA 2H8XA 3VX1A 4GX9A 2ANUA 1AJZA 3R58A 1NWRA 2NSXA 3M0VA 4GUJA 2YCJA 4PMNA 2GUBA 4YTQA 3IIOA 3WDIA 1AZ1A 2XYLA 4NXKA 1TO3A 3TAOA 3VGHA 1PAMA 4XAPA 4HIBA 1PUDA 3FSUA 3GFYA 4KRZA 2YDAA 3QMSA 4OECA 5J5RA 3L12A 3G8EA 3C52A 3GC5A 4A3QA 4JNYA 1K1DA 3BSHA 4RV3A 5IBXA 3Q4DA 4X22A 5A6BA 3V1PA 3W85A 2VGGA 4FLOA 2OCZA 1RA5A 2GJPA 4PUUA 4BF7A 1XYFA 3WQ4A 1KD0A 1UR1A 4YS1A 5HWNA 1GPFA 3ZVIA 3DCPA 2VO5A 4M6PA 1FP9A 3C8NA 5MF5A 3HFYA 2WMHA 3LHYA 4H7VA 4O50A 4TVDA 4D6EA 1UROA 1GORA 4AMAA 3V4BA 1EX5A 2PDGA 1Q66A 3ARXA 3OQEA 2E9MA 5K4XA 5EPDA 1C8YA 3GTXA 5C54A 2NQZA 1AMKA 5HNUA 4E2BA 3NGFA 3STPA 4ZOBA 1NDZA 4HNUA 1GOKA 2VGBA 3S2MA 1NDWA 4UQEA 3H12A 4S23A 5REQA 2I14A 2D3LA 1PPIA 2OGYA 5FJJA 4J2MA 5FJRA 2VDGA 4YL2A 3ITOA 3NPUA 3F4CA 3VMOA 4GVGA 3AMDA 3TJIA 1Q8AA 1F6KA 3PUDA 2X7WA 3CGTA 3F2DA 4HK5A 5ENLA 3ZWSA 5ABGA 4F2UA 3KOWA 2W27A 3LPGA 1XC4A 2HPMA 5I79A 3NO1A 2G4FA 4WY0F 4JQ3A 1IEIA 2E28A 2HDJA 1WDWA 5C9WA 1MWOA 1MEIA 4UTIA 2PCQA 5CSSA 3PSVA 3ES8A 3WH9A 3W25A 3VIMA 1B9ZA 3ZFHA 1LQ2A 1CW2A 4MNLA 1IT7A 3WUBA 3WFAA 2VRKA 4YXGA 3NQEA 3CJPA 3DBPA 3PPHA 4CQAA 3GBDA 4HU8A 2RDTA 4AMCA 4TU1A 3HMCA 4DJDA 3LPPA 4LCRA 1XLFA 1Z69A 1QBAA 4W89A 1G4EA 3FYYA 1WUEA 2EHHA 3L4YA 3QLLA 3C2FA 1BVZA 2GGEA 2CLIA 1IZJA 4M6UA 1I2QA 3DFYA 4AF0A 3QH2A 2B7QA 2DY3A 3G0XA 4LBUA 3UEQA 4JAWA 1BGAA 1I9CB 3QYQA 2F6KA 4C65A 3GS6A 1EC7A 3I4KA 4Y9MA 1S5TA 2PWDA 2OQLA 3QTGA 2DZTA 4WQ6A 1L8NA 1QASA 1ZFJA 3W53A 2YA2A 1JIBA 4S3GA 3LCGA 3GIPA 4IJBA 5I6SA 1ODUA 1VP5A 2OVLA 1UPPA 3SCRA 4Z08A 4R7JA 2PWUA 1KW1A 1WKDA 3TWBA 4B91A 3QSTA 1A5OC 1UBPC 1DJYA 3FGCA 4Z1YA 4JEJA 1UUQA 1TVNA 3W82A 2V30A 1NWTA 1K6AA 2E8YA 1CXEA 4QE5A 3GD6A 1EWDA 3WNLA 1NOUA 3TOYA 4S3JA 3SIZA 4BY3A 2E9LA 2ZZ1A 1VPXA 3CZKA 3SCUA 2PRLA 4NRRA 4DRSA 3CLMA 4PTDA 4H9YA 1C3FA 3AZSA 3DC8A 1Y7VA 4IIGA 3QR1A 1HX0A 1J0JA 3IVUA 4PMJA 1REQA 1OFDA 1R3SA 1Q6QA 1O5RA 2WW5A 3PZIA 1WUFA 5FAJA 1DWFM 5ABHA 4C6MA 1K9FA 2ZX6A 1A4LA 1R87A 3AHVA 3GVQA 1TJ0A 2OG9A 4UTMA 4HSOA 4IMDA 4MG4A 3QY6A 4GZJA 2YLLA 5CZ0A 3BG9A 1MEWA 4L9ZA 5D37A 4OUIA 5AB3A 4D1IA 3SO7A 4HZ8A 7TAAA 3N3MA 5F2IA 2WMGA 5GJPA 3NL6A 4FNUA 5DT5A 4AVNA 4IG2B 1KM5A 1ISWA 3A64A 1FWCC 1SZFA 4LBRA 4V1YA 4XO6A 3OU8A 1E6NA 4GH3A 4GIAA 3E12A 1QPRA 1TPEA 2V38A 2WSYA 5AC8A 2WC3A 3CMJA 4B4HA 3VE9A 3O9NA 3KL0A 2Y7DA 5A6BD 1VB9A 3QQWA 4X2PA 5BWAA 5A94A 4WEVX 1J4EA 1N8WA 1TWZA 1W37A 4FXJA 3TTYA 3WQEA 4A21A 3CL6A 4AH7A 1A47A 4PN2A 3RLUA 3SY1A 4YTUA 2XWDA 3CAQA 5KINA 1K7EA 4AVOA 4K38A 1JF5A 4HNVA 1XCFA 5HXMA 3SSJA 1NDYA 5DN1A 3C56A 4J27A 2WWCA 2WK2A 5LKYA 2X40A 3UFYA 5H1WA 4NZ4A 5KZDA 3TC3A 3MUCA 1TPVA 2A79A 1UKPA 1RQBA 4C6IA 2EG6A 4JDBA 1H1YA 3DGRA 4LRSA 1ODZA 3PB0A 1QOPA 3NVTA 4E38A 1H41A 2BG5A 3E0FA 1EJTC 2J27A 5C2XA 1QI0A 5TNVA 5D2VA 4AXNA 4YYFA 3ZLGA 1HNYA 3L23A 2DSZA 2OXNA 3ARWA 3WG6A 4FOJA 4JQ1A 4Q4MA 1W32A 2A3EA 2CPUA 3BGGA 1JQVA 1Q6DA 2DSWA 5CG7A 4F9DA 3ISIX 2QYGA 4UQBA 5F2GA 5M1TA 4KWOA 1YADA 3M07A 4IF2A 1EWEA 2D0FA 6TIMA 3GXMA 3OZYA 1W2VA 3TR2A 1O95A 2ZC1A 4BJHA 3VGBA 4D6GA 4DPPA 2YDRA 3PZQA 1AVAA 3D6NA 4ICMA 3B4UA 2ZVIA 2OGJA 5ABFB 1JAEA 4NX5A 2WBKA 4J3XA 1OZMA 1EDTA 2BHZA 4H7ZA 1K4GA 7REQB 5ECUA 4UNLA 3SFWA 4Y2WA 4G7FA 1F73A 1HVQA 3BOFA 1EJ7L 4L4PA 3QKZA 2QLYA 4JTTA 3KDNA 3AC0A 2C1HA 5HMDA 1ZALA 1FBAA 2DZUA 1TQJA 3QC0A 3WLOA 3ARRA 1US0A 5C70A 4PE8A 2PDJA 2WZTA 4U5IA 5E70A 2BVTA 3GFZA 1VF8A 1ENUA 2D0HA 3BV7A 1JCNA 3E5PA 1X1NA 2BXZA 4AFYA 1IXOA 1RBLA 3KZSA 4GYPA 5CZTA 4FB7A 4JTRA 1LWJA 2VUYA 2WHLA 3NQCA 3K1DA 4NI8A 2C79A 3LXAA 1JDFA 4HTYA 2YBTA 4E4FA 4XVEA 4GVFA 2W79A 3QPZA 1MEHA 4FLRA 3LN3A 2DV0A 4JTCA 3KBJA 4AVFA 3PZTA 4Q8MA 1TV3A 1JDDA 3T2QA 4DJFA 4RCXA 1KQZA 4Q4OA 1NM9A 1ZJIA 3EWUA 4MUPA 2GUYA 4G6CA 5A6AA 3EA2A 1ZSXA 3O06A 4NJKA 4LAUA 2ALDA 4XSLA 1N8FA 4RE4A 1XKJA 2Y7FA 4US5D 4JTUA 4I9TA 3ALGA 2Z1XA 2IQTA 4IHCA 4C1LA 2VGFA 5CC3A 5BRPA 4BEUA 2Z27A 4HSHA 4YLWA 1WZKA 3RCNA 4LYQA 5GJNA 4TMBA 4AWUA 1OGBA 1V4YA 4CKQA 3E02A 4R9OA 3VVGA 4LNCA 1NP0A 2J7DA 4M24A 1PTDA 3DFQA 4DUXA 2QIWA 5PTDA 1SVDA 2ZWYA 1KQYA 4WDUA 4Y96A 4GI9A 4XKYA 3DG6A 4HMNA 3T1GA 2XG9A 3A5VA 3RX2A 2NLIA 4QEEA 4H9VA 4B3LA 4KFPA 4JIIX 1YPIA 2BSLA 1TR9A 2QZRA 5DO8A 4Q4RA 5K9CA 4HYVA 1LBLA 1KXHA 3W0KA 2TRSA 3CO8A 3E0WA 1M1BA 3ZJ8A 5FJTA 3UGRA 4DZ5A 3FX4A 2QS8A 4QDWA 3S2CA 4XIAA 2FJKA 2Y0FA 3M16A 4IG2A 4XK2A 4H83A 1TB3A 4PCNA 3S5OA 4XISA 5DANA 3UG8A 3WD3A 1GQKA 4GXMA 4UFMA 1SGJA 3H8AA 2NT1A 3GK0A 2I9EA 4R33A 5I06A 3FEQA 2CEQA 3RJYA 5HMSA 3UBPC 3VKJA 3W7RA 4CQDA 5DMYA 2F8QA 3EB2A 2HZGA 1DIEA 2IW0A 5G1MA 3V5OA 3LHTA 3T07A 4YTRA 3AS2A 3WK1A 2XH0A 1G6CA 3Q37A 1M03A 1UBSA 5D04C 5EY5A 1PWLA 2PD5A 1A5BA 7ENLA 2B7OA 3L2LA 1XLGA 3IVTA 2DEPA 5G1TA 1OC7A 1I6NA 1B3ZA 1MSSA 3OHIA 1QI2A 2Z6JA 3DFOA 4IQJA 3WNMA 2ZX9A 3A21A 1GOWA 1TX2A 4UOZA 3B8TA 3SN4A 3BZGA 1R47A 2DFAA 2O9RA 1TZZA 2ZUNA 3DKJA 1KWKA 2OLHA 3C2VA 1P43A 3W1AA 3AS3A 2ZRUA 1RV8A 3EEZA 4A2SA 3O7UA 3VGFA 1SR0A 4EVZA 3PPCA 2BODX 1EQPA 4ATWA 3EEGA 2BX7A 4RDWA 4PULA 4M1BA 2XWEA 2HE8A 1AA1B 1NH6A 4JHOA 1GQLA 3E5BA 3ZQ9A 1A3XA 4D8ZA 2F6UA 3KBSA 4RNJA 5AHIA 2DIKA 4O17A 3THUA 3T4WA 5LIWX 2XVGA 2QCLA 4ES4A 2VOTA 3L67A 5ECVA 3F5JA 5A8PA 2IUZA 4RPPA 2G4JA 2FHBA 2E9BA 2VZOA 1YRRA 4C6NA 6ENLA 1A5CA 2ON3A 2YCKX 4KW2A 5LIKX 3QMTA 4CEXC 4ZQPA 2UY5A 1I4NA 1IXPA 1V6XA 1VEPA 2CZVA 1WA3A 5TF0A 4DJED 1FOBA 1QI3A 2EF9A 4RE2A 4A29A 2Z1WA 4E4PA 3AMLA 1KGUA 3KZPA 4S3FA 1Q85A 2YX0A 1R9XA 4O52A 2DUZA 2E6AA 1XX1A 2O0TA 3KHDA 4XBJA 1IR1A 2A4AA 3CUFA 4M56A 2ZZ2A 3K1GA 2HEJA 1M9HA 2YL8A 4EPDC 3NZRA 2ZXBA 4K39A 4ZENA 4C6DA 4NI3A 3BW3A 3NG3A 1WO2A 2QJMA 1FCUA 5AVHA 4Q4KA 3MCNA 2A3AA 2JK2A 5B7ZA 1GWJA 3KBMA 1THFD 3TQVA 3D46A 1FFQA 3VO0A 3NPWA 2HV5A 1V0KA 1JEZA 3BAXA 3O63A 1JXKA 3FLUA 3VC6A 1U2YA 5I7GA 1BYAA 4O54A 1S1RA 3DHPA 4C1KA 1HJQA 1RPKA 1DJHA 3NL2A 4Z1AA 1OGSA 3KCOA 1XYAA 4WXZA 2RFGA 3CO4A 4AEOA 4L56A 2XGZA 4HYRA 5AYIA 3EWBX 3S2JA 3W84A 2Z1VA 4B5SA 4ZEPA 2C18A 3W7PA 2DQXA 1ZP4A 3PSWA 1MO0A 2Y70A 1HF6A 3C4UA 2VI0A 2D73A 1UWRA 4Z0SA 3OGSA 1OYCA 3VIOA 3A23A 1F7BA 4JFWA 1WZMA 2WKJA 1KBJA 3G3MA 4ZB2A 3VGEA 3BANA 3VE7A 3VOFA 3WDQA 1FUYA 1D7KA 1ZHAA 1HL2A 4UOQA 4QNEA 1VLWA 5LGZA 3TN6A 4N42A 3KLLA 4HK6A 3WLPA 1R3YA 4DBSA 3TN3A 4I9JA 3K4AA 3WJYA 4DM2A 4FLQA 1BYDA 3GHTA 4GPNA 2H9AB 2FYMA 2J8GA 1ITQA 1ADDA 4FXRA 3GXNA 3APGA 3C5QA 4E6MA 2ABBA 4C6OA 3D0CA 1D7FA 1GEQA 4FPSA 8A3HA 4AZIA 4PMZA 4JY9A 3VNDA 2DZPA 2A0NA 1R5YA 1GHRA 3WUFA 1J0KA 2B81A 2WJEA 1FDZA 3O16A 4HJWA 1FKWA 4DM1A 3DIPA 4FR6A 5D2XA 3G0SA 4U2ZA 5AC7A 1J6OA 2OMAA 4Q4SA 1QBBA 3NOYA 1IEXA 2VCCA 1XBXA 4TX9A 3TJ4A 4DZHA 5CAHA 1TCDA 1R0MA 1E55A 1HZYA 1LRTA 2WLYA 4XB3A 3S1WA 4H9ZA 4C6EA 3GU9A 3OZOA 1WOBA 3M0LA 3ELFA 5FF4A 4EE9A 3GUWA 1Q4WA 1Y5XA 2CFFA 5DT7A 4BWLC 5D4YA 3SW6A 4XAZA 1ZLPA 2VWSA 1SQ7A 4NZJA 2GJLA 5EMLA 5K2ZA 3UYIA 4LYKA 2PZNA 3I68A 3O05A 3AXMA 3G0UA 4P7LA 1A5MC 1KNWA 5AC6A 2D2HA 2PC8A 1TTIA 2WV8A 4R53A 2Y5SA 1B31A 3TXVA 3BJTA 3ZR5A 3ABQA 4GBUA 4C1NB 2QAFA 1AW2A 3HPSA 3KHJA 2ZXAA 4MM1A 3W9ZA 1NIUA 3DX5A 4DWSA 3HIJA 4U3AA 4KWVA 4GYPC 4EANA 1GVRA 1QFEA 4A2RA 2CETA 4GC4A 3ICJA 3SUVA 3G8RA 2JF7A 1XLLA 4MADA 4IJRA 4XD5A 2QNEA 1UWUA 4S38A 2C71A 5DXXA 2E0PA 4HA3A 3WUEA 3STGA 4Z42C 3V3WA 3VIFA 1PB0A 4XV0A 3B9AA 4XD4A 4CU6A 5FACA 2P53A 1IWPA 5AFDA 1GOXA 2V3DA 2TODA 1KR1A 4TVUA 3WFLA 1TCMA 1G69A 2QQ6A 3ZT6A 2GDVA 2UY3A 4YWIA 4YTTA 2QDEA 1H7WA 4GQ0A 4ZOEA 4H8NA 5FKYA 3NURA 5G5IA 2VFHA 1WNOA 4GZIA 1R7AA 1GG1A 5DMNA 3TYAA 1BXCA 4EOUA 1J79A 3B97A 3VIHA 3GWQA 1OG0A 1XG3A 2PWHA 1ONEA 3W7EA 3G1DA 3LHVA 1LWHA 3PK7A 1L2QA 3EKLA 2REQA 2R82A 4MJ2A 1EA9C 4GH1A 1NTHA 5AHMA 3W38A 2VP8A 1FDJA 4MYAA 3IIXA 3ZT7A 3EA1A 3MSRA 3QVQA 3W88A 1ZBWA 4QG6A 2OO6A 4B90A 3PZGA 1OIMA 4IGNA 2CWXA 3B9EA 1VFMA 3PZVA 4LNYA 4ZFMA 1TPB1 1PTAA 4DWDA 2FGBA 4D6JA 2FIQA 1L9WA 1R9ZA 3EWYA 4AC7C 3V0UA 2EKCA 1C8XA 4J3UA 3G6LA 4QEHA 1WDPA 3BXWA 2RDXA 3W7DA 5LXEA 5D30A 5EA9A 3AMGA 2ZXQA 2CLKA 4DBWA 3TQ0A 3UR5A 3ONCA 2RDWA 3P61A 1UB3A 3AOFA 3V0TA 2DDXA 1I2PA 4LY4A 5JUVA 1Z9AA 3HGOA 3MHFA 2GWNA 3QY8A 2YW4A 3HN3A 5LNRA 3RNDA 3AHYA 4AYGA 4BI7A 1F07A 1PYMA 3LRLA 3UR7A 5I0DA 5HUOA 3ME3A 2V0TA 3GKFA 1W1B1 2O4MA 1DBTA 2RGLA 5D9PA 5A6LA 2QF8A 2WC7A 3S1UA 2TAAA 2VZVA 1E0WA 4XIMA 2IKHA 3AICA 3WDPP 5E0FA 2VTFA 1IYXA 1XKYA 1BSLA 4W7UA 1QRQA 3QGAC 2BVWA 1UQYA 3R0DA 4UMCA 4HCHA 1ISXA 1HKWA 2J7BA 3FFSA 3O6YX 4AZCA 4QISA 2ZX5A 4MLRA 4NRSA 1TPUA 1H51A 3C2RA 4WDTA 4BI6A 2QGHA 4BHYA 3ERPA 1V6YA 3I3EA 3WJXA 4HMEA 4MB1A 1T0OA 3GO2A 4ACZA 1GVIA 1R7OA 2X8RA 2A7NA 4CVWA 4GWEA 3L4WA 5EMMA 5AHNA 1RUSA 3H2CA 1OGGA 3KTSA 5I5RA 3DG7A 1H7RA 5CBJA 5E9XA 3AWNA 3G18A 2W92A 1J6PA 4HMCA 4F0KA 2ZTJA 3CAVA 1G9HA 3SBFA 4DB7A 3GNXA 1S3TC 3EX3A 3P82A 4NUWA 5BRBA 2V3FA 1F8IA 5EU9A 1XLJA 3U2OA 1GQJA 2BVYA 1N55A 3UD6A 4MUZA 3SCSA 1PDYA 4AIBA 1DJIA 3OYZA 2XINA 1E43A 2NXGA 1PKLA 4MGGA 1F3WA 3LCIA 4ONVA 4NJJA 1JGMA 3W83A 2IQDA 1CXFA 4F0HA 3URAA 2OZ3A 3VD4A 4E3VA 2WAGA 3H23A 4ZR8A 4XZLX 4IMCA 2RJHA 4JZ5A 3GBEA 4C91A 2W67A 5CC6A 2WMIB 3PANA 4S1FA 1F4HA 1OBAA 4BCEA 4UQAA 4DWSC 1XP3A 2QPSA 3W29A 4E8CA 1P1XA 2E6FA 1A0CA 1M53A 2YCIX 5D38A 4LV9A 4LAMA 4XTIA 1GT8A 3VA8A 1UIOA 4H9UA 3PG9A 4C5YA 5KSWA 2ZC8A 4IMEA 3VPLA 1BFNA 3IUIA 4Q4PA 3W7QA 3ZYZA 4KRUA 3HBLA 3KBNA 4XUGA 3RLVA 1YBQA 1FWFC 4DXXA 1D2KA 1G1YA 3CZGA 1BRLA 4IP7A 3PNZA 5JXQA 1ZBCA 3RR4A 1DIKA 3C0QA 3ZSTA 2VENA 1DL3A 1SZNA 1PHQA 4Q8QA 1UR2A 3G1YA 4EPEC 5HWJA 2Z2UA 4GIRA 1QR7A 2XIQA 4AZBA 3LB0A 2AGTA 4UBPC 4N02A 1KV8A 2IQ0A 4GUFA 3MTWA 4TTGA 3FVMA 2WJZA 1TG7A 4H2HA 4B2DA 3LHUA 2Z0IA 3GDRA 4G9PA 3LMZA 5CSRA 4HBKA 3VKKA 3IGUA 4F79A 5J04A 1XRVA 2RHGA 5BWFA 1ONXA 4EWND 1EP3A 1WPCA 3IACA 4O1CA 3K5XA 1WAUA 5CLWA 1JPDX 3N04A 3AFBA 3ID7A 1ZB5A 2GLKA 4AG0A 1KFEA 4QG9A 1TRIA 5XIMA 3EMCA 1PZ3A 4A3HA 2J7CA 4RK8A 3R8GA 3LCXA 1CI1A 3CUIA 4HPGA 3T09A 2DU2A 3GVWA 2P1FA 3G24A 1GOQA 1QW8A 1K4HA 5EBAA 2HS8A 4WJ8A 3OGVA 4GKTA 1HO4A 2VOMA 4W9TA 3NNTA 1ZS2A 1MXGA 5FF7A 3M7WA 1LTDA 1S2TA 3WMSA 3S46A 1J0YA 5CBIA 2VT0A 4N2YA 4WKFA 1YW1A 4ALDA 4Y7EA 1RCQA 2ZVRA 3ABXA 3REQB 1ICQA 2V6AA 1X97A 1VPQA 4A3YA 1J2WA 4L64A 3BK0A 1E1CB 3P60A 4GNJA 4MOZA 4PTVA 2ZUSA 4JX4A 4KCVA 1J10A 4JX6A 3RDKA 3CHEA 4KIRA 4JFSA 1U5VA 3KVLA 4ZOAA 3IJ7A 3ZR4A 2QCDB 3K4DA 3TE9A 3HQPA 1OZQA 4O14A 4D6FA 4ACYA 3BPWA 1E6SM 1TA3A 3U4FA 2R94A 3UXKA 3OBKA 2IMRA 4B5WA 1BGGA 3TTEA 2PRHA 4MPKA 3VD7A 4X0VA 2YOCA 5M17A 2WHMA 4GY0A 3WH6A 3RM9A 4X60A 3V5FA 3B0VC 2DVTA 2GQ8A 5IM51 2OTDA 1VENA 4AUBA 1CXHA 1JPKA 1RSCA 1P7TB 5C55A 1G4TA 4LUIA 4JEQA 2DP3A 4OBRA 3B06A 3U57A 9RUBA 1H2JA 2C19A 1TTQA 3KRSA 3EB3A 1MRAA 3WBEA 4BQ2A 4D2JA 1CTNA 3QZAA 5K4ZA 3LU2A 4Y9OA 1TV4A 2ACQA 4HHPA 3GDLA 4RR4A 1D8CA 4UR7A 1QOQA 5F4WA 1HP5A 2VFEA 2YLAA 2IPFA 2UZ9A 4H8VA 1W1A1 2G3NA 3W26A 1VYRA 2W4XA 3GVVA 3WSUA 3BLIA 1XGDA 3PC0A 4ML9A 5AHLA 2P10A 4RDYA 3ARVA 2Z4GA 1NP2A 2ZUMA 3LA4A 1KRBC 1I1WA 4MJ4A 3P84A 3WD4A 1YMYA 4AIUA 4YMZA 1Z42A 3N14A 1B4EA 4I8YA 3SB0A 3LERA 3LQLA 3P93A 3MSGA 3L4VA 5H8PA 3CHCA 3INPA 1XYLA 4NP7A 4WR3A 1WBHA 3IJQA 5CPLA 1W9XA 4HN8A 3M0XA 4WK9A 3FJ6A 3UG5A 4GIEA 3ZOAA 1UR8A 4KQNA 3B4YA 1TREA 4PUDA 3KUMA 3QF0A 3G1HA 3H55A 4P5UA 1A49A 1R2TA 3S9ZA 1GVEA 3PJXA 3EPMA 1OFBA 3URNA 1SW0A 1OD8A 3KOZA 4AHOA 2R14A 4H9MA 1RD6A 1JCYA 4NJGA 3SFKA 1B3VA 3FJ4A 4JKLA 2P0OA 2WHKA 4LB3A 3EWDA 4MKSA 3B8IA 4LCQA 2O9TA 3UZYA 4DQWA 4Z1BA 3TKFA 4B5XA 1Z7AA 1BD0A 2JGYA 2PDKA 1C8VA 3TYCA 1UD4A 1ME8A 3VCRA 3H7UA 4O19A 1RY8A 4LTSA 1KXQA 3FS2A 3M5YA 3TC7A 1W5PA 2RGMA 3PAOA 3CL8A 4AEEA 2ZZ7A 3BH4A 3SY8A 4WCJA 2J7EA 4W5ZA 3RMEA 3DESA 5FL1A 2X1RA 1UOKA 2X1UA 1JZ2A 1LYXA 4PH6A 3H2NA 3ZJ7A 4WKAA 3B9DA 3QRHA 2Z24A 1IIGA 1DJNA 8CGTA 2HRWA 2F38A 3TQKA 1KFBA 3APYA 1S2UA 1D3GA 1EC8A 1VBHA 1XBVA 2F84A 3I6RA 4HVXA 1YDVA 2PI6A 4KCTA 2CLLA 2VDIA 4M51A 2VRJA 4L7ZA 1EDGA 1JUEA 1VYSX 3LZ3A 3W7CA 1PWMA 3QSRA 4OE7A 3JUGA 3KM8A 3RILA 2HXUA 1W3TA 4DELA 1TVLA 3HGRA 3LXBA 4HHHA 3ZVHA 1JFXA 5A95A 1CEOA 3WNNA 1QNRA 4EPBC 3LGDA 3G1VA 3GDBA 1EF3A 4PMXA 1QOXA 4PCFA 3HFTA 4N4QA 1VPYA 1CLVA 3MYPA 3UCCA 5TBOA 4AISA 1BRLB 4W7WA 1YTEA 2R1MA 2CBIA 2GVGA 2V5DA 3NYDA 1ZENA 3TJXA 4XZWA 4GLEA 2GFTA 1S5MA 3N2BA 4JIPA 5B7YA 3VFCA 5D8ZA 2PU0A 2ZRXA 3UCQA 3OBEA 2W66A 2J62A 1CXKA 2DZXA 2YL5A 3WD2A 1OCQA 2DSVA 1EJUC 3NAVA 1XL9A 4FP1A 2NQ9A 3CB3A 3PZMA 4JCLA 5FAGA 3L0GA 3UPBA 3TCSA 3L5AA 1W6TA 2NX3A 1I45A 4U10A 5XIAA 1H50A 3M5ZA 4QGCA 1YBQB 4ZQNA 2OZTA 1YDYA 1CNVA 4A05A 5E1QA 1HKVA 1VRDA 3R13A 4M0XA 5J5DA 1ZJAA 4CNOA 5C2CA 3TTOA 3THDA 4J4KA 3UG3A 4OBTA 2PDMA 3MU7A 4C5ZA 3OQ8A 4OIFA 4OQVA 2ZZ3A 1KO0A 3W24A 1XD1A 1KCZA 5CPMA 4EF9A 2P3EA 2TMDA 3N2XA 3BAJA 3QYSA 3RJXA 4XBKA 5BXRA 4OVXA 1H63A 4LQ1A 3GE7A 3PBYA 4ADTA 3E0IA 3WLJA 4P8XA 1J2BA 3UNTA 4J40A 2OKTA 3AU6A 3BOLA 4UUIA 1OFEA 2O55A 2PF8A 1M6JA 2FZMA 3E6EA 1G4PA 3FXYA 4JL2A 4F8XA 5BOOA 3W2UA 3NZQA 3QQ0A 2PDQA 1BYBA 3GRIA 3UVIA 1QATA 2A3BA 1NQ6A 3GHUA 4E3TA 2AMXA 4K1GA 2BLEA 3EPOA 2V5KA 1LOLA 1ME9A 4JTQA 8XIMA 1WDQA 4UC5A 3VNKA 3I3DA 1K8ZA 3HA1A 4DJEA 2EPLX 3AXXA 3BQ6A 2A7PA 3NZPA 2ZX7A 4IUGA 1P0KA 2EEXA 2QT3A 3CHFA 4J7RA 4CQBA 5HUPA 1TX0A 3LRMA 1M41A 1XIJA 3CM4A 1XLHA 3RRXA 1HGWA 3HG4A 3L2IA 2X1TA 1DEDA 4GQBA 3MI6A 3CTLA 4K68A 4UTHA 4JKKA 1PEZA 3O8AA 1GPWA 3L5LA 3W1RA 2OEMA 1C9DA 4JYFA 6XIMA 4IICA 4U33A 4H9XA 2Q6ZA 3AIVA 3EBVA 4Q7IA 6CGTA 1JR1A 2Z1SA 2PTDA 4BR1A 2FDMA 4JNMA 4AZCB 3MJYA 1EBHA 3B0YA 2AL2B 3O3RA 1GOMA 1X8FA 2ACRA 1XG4A 1XLCA 5J8LA 2QJNA 4UR8A 2BOGX 4DUOA 4AHQA 4LANA 4LAOA 4J1OA 1TQXA 4DUWA 4DXVA 2XFWA 5A5WA 4AD0A 4EWJA 1DJGA 1TE6A 4I9MA 3H22A 1OT2A 5T9CE 3UPWA 1P4CA 2YCLA 2PGRA 2WQDA 1ONRA 1J8VA 4JFTA 4UQCA 1OF8A 2VX5A 1R30A 4NIRA 2OLSA 4RXFA 2AQVA 2BP1A 3ABSA 1ZAHA 3M0JA 2BGSA 4AD3A 1UWAA 1IF2A 3UZZA 3SGGA 2UV8G 1KGWA 1J5TA 3EDKA 3UXIA 1KCLA 3QHMA 4DBDA 1OJXA 1OG6A 4BI5A 1LL7A 1ZQ5A 2QV5A 2C8NA 2QUNA 3NSMA 2NV9A 1WE5A 2A2IA 3L66A 5EL1A 2PGEA 3W1TA 1PHWA 2Z25A 3UERA 3U48A 3EOLA 3TNBA 4CNSA 3TXZA 3RHGA 3RYSA 2PS2A 2QCCA 3QOKA 3GSMA 1DXIA 2YA1A 1DQXA 3N25A 4LVGA 3IGHX 2WZEA 2XN1A 4FSAA 4J3VA 1XBYA 4PRTA 1YYAA 2ISDA 1YPFA 4NZ5A 2POZA 4K3ZA 4GGHA 1XBZA 4J9JA 5FSDC 2BB0A 1HP4A 4XQ6A 4D9PA 4QFUA 1VS1A 3S8HA 3FA5A 4S3AA 2P88A 5FI8A 3MW7A 2XVPA 4GD0A 2WZMA 4PMOA 3S5NA 3II1A 1X38A 3WQPA 4MDOA 4G1NA 1TPWA 4CCEA 1FHUA 4MAZA 3B8WA 1TA3B 1LJYA 3UT0A 3CNYA 3MV11 1JVNA 3CB8A 1XICA 3PF3A 1DKWA 1AJ0A 5DRCA 1L6SA 4JTEA 5HQEA 3VKCA 2HTMA 2YYUA 3TR9A 4KEZA 4DWSB 3N4AA 4L5ZA 1B90A 5I00A 1ITCA 3MT1A 1T96A 5E5CA 1PCWA 4C6KA 3DOPA 4JFUA 4FO4A 4BQ5A 4NSBA 1GTHA 4M19A 3AXIA 1G5AA 1TJ2A 3PWIA 3FW6A 2X1IA 4OOUA 3W7HA 2PDPA 1UKSA 4WUIA 1XFCA 2YZRA 1K77A 3VX0A 3L21A 4LUSA 3K8MA 1Z48A 2NUXA 3WF1A 3KDOA 3W7KA 1AQHA 3CYJA 1NFGA 3O15A 1WKEA 1HL8A 1XIMA 3WMBA 2ZA1A 2Z00A 3QTPA 4NAFA 2BNJA 4B5NA 3EKZA 1HKKA 3FY1A 2ZA3A 4Q7BA 3CUJA 4U31A 3EOOA 1LF1A 3W75A 4A4AA 3CK5A 4KBXA 2ZUVA 1IR2A 1XRTA 4O13A 4EACA 5E6ZA 3MP4A 4UMAA 1UMLA 3ANYA 3N9KA 4L6OA 5KEZA 3TYBA 3BLDA 4DHGA 1P0NA 4BF9A 4Q8OA 1XIHA 1SJAA 3UWQA 1RD5A 3VOCA 4MWAA 2I5IA 3LPFA 3M5XA 4RX0A 1NY1A 1ZUAX 4XZ9A 3PTMA 3LPOA 1W9DM 4UNIA 4WOQA 1KBIA 1SW7A 3OODA 1Q45A 1Q6OA 1W54A 1H61A 2BOFX 5G4EA 1XGEA 4YHEA 2Q8LA 3BCDA 2X30A 1QWKA 1VBGA 1E3ZA 3GFXA 1FHVA 3OVQA 5E9AA 1PTGA 3UESA 5HOSA 1QHPA 3RK8A 2HISA 3GR4A 2MANA 4H6KA 1R2RA 4LF2A 4ROQA 2XVKA 3C3NA 3IJ8A 4YTSA 3WQOA 1TZ9A 4WDWA 1KGXA 3ATYA 4C6JA 4LU0A 3QV9A 4XZMX 1JYWA 3VD3A 1O1ZA 3OVGA 3U5UA 4RV8A 2ZUWA 3MUIA 1MUCA 3W2KA 1LOSA 3L68A 1QJWA 5G4WA 4CQCA 3GIQA 4UTWC 1GVOA 3F5KA 3AHZA 2C91A 2JQXA 2P3ZA 3LCLA 4N9EA 4AD1A 1Q63A 1HJXA 2J4GA 1FH8A 2O4QA 4OKDA 3THQA 3P3BA 3R0KA 3MZNA 3WLQA 2J9XA 5D2TA 3MCOA 3EXSA 2J78A 1H0IA 1XIGA 3AAMA 5T8GA 5DY2A 4QE4A 4TQTA 2BBFA 3L65A 3UWZA 3L4UA 3LMYA 2Z2AA 1AMYA 1X98A 3B9NA 1MUMA 4QS6A 1DVJA 3AQUA 3ITTA 3IIVA 2FZDA 1HO1A 2A21A 3R8HA 4WF7A 1W2PA 2ZYFA 3WLRA 2FB3A 1J9YA 3SCPA 1S46A 2QUMA 3KL3A 2YIHA 1FHLA 4N9BA 1JZ4A 4KWWA 1Q4NX 3FV9A 3N18A 3WEZA 4LFYA 1IXQA 1I75A 1M01A 2B4GA 1EZWA 4G7EB 4C6FA 1K8XA 4CN1A 3E0LA 3MS8A 3MSYA 3STFA 1Q13A 1H7PA 1YNPA 3DENA 2EPOA 4FX7A 4GI8A 3STEA 4REQA 4DWSD 3C0LA 2A3LA 4HPJA 4NU7A 4A8IA 3KBVA 5LZLA 1N82A 1MFUA 3N13A 3PJWA 3W02A 1B5TA 1IGWA 4BK9A 4RJEA 1TV2A 1GOOA 3EX4A 3A5FA 3H2MA 1YDNA 2F9RA 3HF3A 2FVLA 4JTKA 3CPGA 6A3HA 1T41A 3UZ5A 1OFRA 3A13A 4HCLA 3R7MA 3UWWA 2BY0A 1C90A 3UWYA 3NQVA 5FA5A 2I9UA 2CZEA 3O6DA 1EL3A 3B03A 5LIUX 4BEQA 3CC1A 3T0TA 3H2EA 3TCEA 5EMYA