3KXQA

Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6a resolution
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
249
structure length
237
Chain Sequence
IRPFIAGNWKMNGTGESLGELRAIAAGISRLFEALICVPATLLSRAFDILGGENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWTSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKAIDFLTICDVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Crystal structure of triosephosphate isomerase from bartonella henselae at 1.6A resolution
rcsb
source organism Bartonella henselae
molecule tags Isomerase
total genus 86
structure length 237
sequence length 249
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3kxqA00
1GYLA 1X7FA 2RDWA 3TA6A 3P84A 3MYPA 2NWSA 4ZQCA 2A7NA 1TPH1 3LXBA 3L68A 4JYFA 2CFFA 3CTLA 3LOTA 4YCOA 1SFJA 1JUKA 3BG9A 2C16A 4AF0B 1E51A 1B57A 2DZVA 4AMAA 3Q37A 5FESA 1TPUA 1L6WA 1QAPA 3M44A 3AO0A 3T4CA 3L66A 2AQWA 1TTQA 5I3JA 1C9DA 3I68A 5LGZA 4AAJA 3STGA 1GZGA 1XBYA 3F1QA 5KTLA 3E0IA 3OBKA 3DFQA 4K36A 5D33A 4O52A 3ABOA 1HG3A 2Y88A 1GWJA 5D2YA 2OJPA 3BV4A 1VZWA 4JICA 4E0CA 4JD4A 3SGUA 1EEPA 3MP5A 4O50A 3W6YA 3GK0A 5C2XA 4LS2A 1EP1A 2CU0A 4E2DA 4FXSA 4MZYA 3G24A 5CSSA 3EXTA 1NFBA 4ZQOA 2YCEA 2Y70A 1PVNA 3QMTA 1RQBA 4JDYA 5DCDA 2DZXA 1BWKA 4NVTA 2H3BA 1AG1O 3S6DA 2H6RA 1OX4A 6ALDA 2QKFA 1KFCA 2CLEA 4ML9A 5BMXA 5KSWA 3O8AA 3MBFA 3CPRA 3F4WA 1VCVA 2QCEA 4GC4A 2VC6A 2NXGA 5H2ZA 1VJIA 4R53A 4ZQMA 3G3MA 4S2CA 5CZJA 4RK8A 2QF7A 1RVGA 2DZTA 3L0KA 5MHBA 4FX6M 3SZ8A 4RV8A 4MPQA 2WNZA 4LS0A 5K9XA 3I65A 4H4IA 4ZZ9A 2VFEA 5AHLA 1OK6A 1CW2A 3PVFA 1TV5A 3STEA 3A22A 1VYRA 3KFTA 5KZDA 1EA0A 1FBAA 1WV2A 3L0NA 3P61A 2VEKA 2HS6A 3NQ7A 3LB0A 5F2GA 2GPTA 4UTJA 3BK0A 3FYPA 1XC4A 2JKPA 1B3OA 2CLMA 4JTGA 2E77A 4JX6A 3NZ1A 4LVFA 4A22A 3WFAA 4DO4A 3ZFHA 1WX0A 3GDKA 5K7JA 5HWMA 1MEHA 3MJYA 1K3UA 2ZA1A 1G6CA 2ZRWA 1D3GA 2GQAA 4IWWA 4O4VA 3TDFA 1O5XA 1S5WA 2QCGA 4MUZA 1WYIA 2GVGA 3U2OA 5TBOA 1Q6OA 5DXYA 2B7NA 5I3GA 1FWWA 2DZWA 5F4WA 3PY2A 1XFBA 3SFKA 4EF8A 1HL2A 4CNNA 3AJXA 2VFDA 3SIZA 3LCLA 4L4LA 3SGZA 2TPSA 3WK1A 1EP3A 3NQEA 4N02A 3S1UA 2DP3A 2VFIA 1P5BA 3UYCA 1P1XA 4RXGA 3UXAA 4E2BA 2BSLA 4HT3A 2E09A 4PL2A 4MVAA 1JVNA 3NQAA 3E02A 2ATSA 3TQVA 1L9WA 3NPXA 1W37A 4Z1AA 1OVDA 2VEPA 5AHFA 3TCEA 1TJRA 1IF2A 4LY8A 4UTWA 1RD5A 4NUWA 4BI7A 2CZFA 4IOTA 4MLJA 4ZQNA 1FDYA 3IIXA 4M6QA 4X9SA 4RCXA 1KM4A 1F2JA 1QR7A 5D03A 2NWRA 3W23A 1XM3A 2FQIA 3S1XA 2WSQA 5DY2A 3VCRA 2DU2A 1UB3A 1SO3A 3CT7A 2DJLA 1NAL1 3B0PA 1BEUA 1M7OA 3MMTA 3LI0A 3VE7A 3TMQA 3CQ0A 5LKYA 3UY7A 1KFBA 3HPXA 2ATMA 5DCEA 5G5IA 3G1VA 4K6AA 5AOUA 1JUBA 1QPNA 5E93A 4MYAA 4O54A 3ZWTA 3P67A 1IXOA 1YDOA 3DKJA 4GBUA 2X1SA 2X16A 1FXQA 3HO8A 1GVRA 1F76A 3O06A 3HPSA 2GOUA 1LYXA 3L2IA 4N4PA 3C2RA 4IMGA 5ABTA 3BG5A 3DFPA 1OFBA 4BI5A 5BOOA 3ZWSA 1A5AA 5EBUA 2VOMA 2XN2A 3MUXA 4NU7A 4UFJA 3UPWA 2RHGA 3B0UX 3G1AA 1ZENA 3QM3A 3HGSA 2JKEA 3C2FA 1UASA 5AHMA 3T40A 1JCNA 1K7FA 3KVMA 4GWEA 4IJBA 3KX6A 4UMBA 1A50A 3W7JA 1SZEA 2QJGA 4NQ1A 3PULA 1I8JA 3BGGA 1H63A 1KFEA 4AH7A 2G95A 4GFSA 4PODA 2A85A 3DENA 3U6WA 2ZZ3A 4Y6GA 1C8VA 4AVFA 5LSMA 5K9DA 1XBVA 2Y7FA 3I7SA 3VE9A 3WJWA 1DHPA 3SJ3A 3OA3A 1LLWA 2DZPA 4O19A 3QQ0A 3LDVA 2C18A 4WUIA 5CSRA 4K7VA 4JYEA 4AEOA 3QC3A 2VFFA 5F1UA 3MI6A 3P7YA 1KFLA 3UNDA 4OQVA 1FQ0A 3LTYA 2R14A 3OG3A 2RH9A 1KLYA 1I2OA 3G0UA 2W0UA 5K2ZA 5G2WA 5AB3A 2GVLA 2CLHA 3M5XA 4AHOA 7TIMA 5EPDA 3M1ZA 3O1NA 1U5JA 3NQ2A 3W7LA 5D2VA 1F7BA 3C6CA 1M6JA 1FWNA 4JIQA 2C15A 3B03A 5A5WA 2ISWA 1SPQA 1G4TA 2A6NA 1JR1A 1FCBA 1TPFA 4AWTA 2OCZA 1ZALA 2QCNA 4XBKA 3C2EA 2DZSA 5F4SA 2R91A 4KFOA 2WSRA 3ABQA 3KAOA 1OK4A 2ZZ1A 3EXRA 4O13A 1DQXA 5U4NA 1SO5A 4UTIA 3TJLA 3LHVA 3LRKA 2PC4A 2EKCA 3B06A 3RFAA 5D02A 1YDNA 4DO5A 2HS8A 3CU2A 4JTUA 4CLMA 4HNTA 1AMKA 3WK2A 5LNRA 1IGSA 4H6KA 2QR6A 1MSSA 4FEZA 1ONRA 4O0ZA 3MHFA 1AL7A 3INPA 4UFKA 3TXVA 4K38A 3PBWA 3W2NA 2VFGA 1LORA 2FJKA 4Y90A 1EUNA 3DKLA 3B0VC 3STFA 4ZMGA 3GXNA 1R46A 5DCBA 3M5ZA 5D38A 1EWEA 1FDJA 5LNWA 1YTEA 3MYOA 2X2GA 1TSIA 3VNDA 4UUIA 1SU5A 2NX1A 3S42A 3LLDA 5T26A 1NSJA 5L9FA 4WY0B 4FNUA 5DBUA 3MO7A 1Q6QA 5HQEA 2YDAA 1ME8A 3N9RA 3W1QA 3QJAA 3L21A 1TRDA 2V8ZA 1KW1A 3W2JA 1YLVA 3N2XA 1W1ZA 4XUGA 4WY0F 4N9CA 1UCWA 2C19A 3NL3A 4I7WA 5AHNA 2YW3A 5FF7A 1TREA 4DBDA 3FA5A 3QZEA 2E5CA 3M47A 4K8HA 5G2IA 3P62A 4ZQRA 3NQGA 2CLFA 3PG8A 3EWXA 3NAVA 3GKAA 2J6XA 3PG9A 3NQDA 2CLIA 1ZFJA 2PRLA 1LOLA 4CCCA 1IIHA 5L6UA 5C54A 5FF0A 3VFLA 1OFEA 1VGAA 4POCA 1KM5A 1LTDA 3NQ8A 4UTUA 1ZJIA 3R8RA 1K02A 1ML1A 2HSAA 3QRHA 4GUIA 2V81A 1QO5A 4UMAA 2NXIA 3BLIA 4IUOA 4PEKA 4R34A 2ZZ6A 5D2TA 3ATYA 3FEMA 1QO2A 1WA3A 4MY1A 2RKXA 3BW4A 3DU0A 5EL1A 1W3TA 1R2SA 2O7SA 4M19A 3R13A 1A5CA 1ZNNA 2AAMA 2QCHA 3HIJA 4Z08A 2QEZA 3W7MA 3ATZA 5KINA 4MZ1A 2Y7GA 1J5TA 3H54A 3HOJA 5HULA 3S1VA 1FCVA 3NGJA 2ABAA 1RZMA 2ZA2A 3W7EA 3C2VA 2EPHA 3Q58A 3EWZA 1ZY9A 3D0CA 3O15A 1W3NA 2YYTA 1H62A 3PAJA 3PR2A 1O4UA 3OIXA 1GVSA 3LV5A 4XKYA 5LNVA 3NDOA 4KFPA 4YL2A 3W7HA 4GRSA 3G1DA 1GJPA 1LRNA 3G8RA 2GQ8A 5LZLA 4BWLC 1DKWA 1OG0A 3T55A 4LT9A 4OV4A 3GLCA 4O16A 2V2DA 1H5YA 1VR6A 4IPIA 3LXCA 1G7UA 4LWWA 3SR7A 1ICPA 1YYAA 3L65A 3SW6A 5FF4A 1LOSA 5FF2A 4IMEA 4MFDA 3W1UA 2FB3A 2ALDA 3QW3A 1JCYA 4YCPA 3HBLA 2Y62A 3NYZA 4QJ1A 5DXXA 2V82A 4QNWA 1KTCA 3G22A 4NJHA 4PA8A 3NQMA 3PUDA 4IXXA 5E0KA 3LLFA 3BW2A 3PS7A 3NL2A 3O63A 4R7JA 1S5TA 3R2GA 2YSWA 3MP3A 3THQA 3SECA 2YGYA 1LDCA 4K8EA 3W1MA 3IEBA 4N6FA 1DVJA 3PF3A 3UPBA 5TQLA 5AYXA 4LU0A 3UWQA 3W2LA 3ZS4A 2I9EA 3DXIA 3TXZA 2WSYA 4JX4A 2JBMA 5CGQA 3A9IA 1RR2A 2YXGA 1UUMA 2QCDB 3JR2A 3NPUA 1YXDA 2D73A 3ELFA 1OFRA 1SZNA 3LHTA 4EOUA 4MY9A 1OHLA 1TPB1 5FEPA 2NUYA 2ZRZA 3G1SA 1NEYA 3W2MA 3GR8A 3QSTA 3HF3A 2TMDA 4XKYB 5IBXA 3DFNA 4RZ4A 1HTIA 4MFEA 1PIIA 3KVKA 3HG3A 3DHFA 3O07A 4O4WA 3TU9A 1QMLA 2PURA 2VEIA 4ADSA 1EP2A 3W75A 4S1FA 3P5ZA 4K37A 4O18A 1L6YA 3V75A 2ZTKA 1ZCOA 4O28A 4CQ9A 5F4XA 4O1AA 1VYPX 1H7PA 4RZ5A 1WOAA 3QH2A 4LUIA 3L67A 3B4UA 1VHNA 3PBVA 2VXNA 4LC8A 3S5OA 3W87A 3PUEA 1SW3A 1D9EA 3RNDA 2BWGA 3MW7A 4JIPA 5AN7A 1TB3A 2YR1A 3GVGA 1R2RA 1XXXA 2DZUA 3A23A 1ZAIA 2QDHA 3CC1A 4O11A 2F84A 1K7EA 3WJSA 1P0KA 1LBLA 1PL9A 4HSOA 3P8IA 1W5OA 3BLEA 1LLZA 4I7UA 4UTTA 5C6MA 5E1QA 1XI3A 3IVUA 2QUUA 5G4WA 2FDSA 3HGJA 2YFOA 1O5KA 3CWOX 4CNOA 2RFGA 4FX8A 3MI3A 1OX4B 3LTPA 5K4ZA 3C8FA 3OVRA 4O57A 5F1VA 4FIRA 4DF0A 1XBZA 4YXGA 3CHVA 1DL3A 4EF9A 3P60A 4GUJA 5D05A 4HPJA 1UJPA 2GUUA 3N34A 1JQXA 2A0NA 1TTPA 4NXSA 4Y8FA 1G4PA 1S3HA 5DLCA 3W88A 3FS2A 1XKYA 3GXTA 4O17A 5LHFA 3QEZA 1W56A 5EYWA 1B4EA 3C4UA 4O1DA 5BNKA 4LS1A 3IRDA 2JKAA 3NQVA 1J2WA 4O1CA 2B0MA 3LV6A 1FCQA 1OFDA 4TR9A 1ZHAA 1H7NA 3M7WA 4PTNA 3T7VA 1LRQA 3G3DA 2WPBA 2XN0A 3LTSA 3GB6A 1FWTA 5LGXA 4JTKA 1TV8A 2JGYA 1TRIA 3EEGA 2UV8G 4CNPA 1QOQA 3DI1A 4BF9A 1R47A 2R94A 3IGUA 3JS3A 3S5YA 3STCA 4XTDA 1Z48A 2EGZA 4RX0A 5F2MA 3LCFA 3O16A 1XDMA 3G1HA 3M0ZA 1T8XA 3GR7A 1ICSA 2V9DA 2B4GA 3CIXA 3RF9A 3U8GA 3UWUA 1WDWA 3VI2A 3EX1A 1DORA 4WX2A 2LLEA 1SW0A 3NQFA 3W07A 4LVBA 2QAFA 3ABSA 3NEVA 4KKXA 4OE7A 4Q32A 4ONVA 2FPYA 3CEUA 3EKZA 2CWNA 2J24A 4EVZA 1H7RA 3MI2A 1NF0A 2BLEA 3Q94A 1F6PA 3TNOA 3GKFA 1B4KA 1S5VA 3MHUA 2PRMA 2I14A 4O8RA 4YWIA 3W2UA 1Z41A 4FHAA 3W1AA 3LCXA 3TIMA 4WJEA 3QPYA 4E38A 4Z1DA 5BRBA 2J27A 3OVPA 5J5DA 1JCJA 1RPXA 1DQWA 1VQTA 1M5WA 4U28A 4UTKA 4J9JA 4UFIA 3W7CA 1V7YA 1A5SA 5AHEA 3LHUA 1WXJA 1G4SA 2V2HA 4FNQA 3P8JA 3HB9A 4XBSA 3G1YA 4RZ6A 3SY5A 2ZFAA 4FX7A 5DY3A 3GZ3A 2OX1A 4HNVA 3E12A 4WZHA 2E5DA 1FX6A 3QPZA 1G67A 4GJ1A 1QDSA 4X3ZA 5BMWA 5CZSA 3RU6A 5AFDA 2FB2A 4KWWA 5CKSA 2ZTJA 1IIGA 1GTHA 2RDUA 1YXYA 2KZHA 2W6RA 3UWVA 1KBJA 4JTJA 2V2CA 4QAIA 4IX0A 3KXQA 1I4NA 3BPWA 4UCGA 1BWLA 4O1BA 1X1ZA 1VLWA 4TIMA 1IXNA 4PC8A 5K3VA 1JCXA 1TYGA 2P1FA 4JN6A 3N14A 1LM1A 2ISSA 3W1PA 2CLLA 1HO1A 1JRBA 3G18A 3W7RA 1UBSA 3CEPA 1EIXA 3E49A 1RV8A 3W7OA 1PHWA 3GYEA 4UR7A 4FNPA 4AWSA 3N73A 2QJHA 4OHQA 4S2BA 4MYXA 1F6KA 4FF7A 4RR4A 2J9YA 2F7FA 1QPOA 1QPQA 3LM7A 3SSJA 2YYUA 4ZVJA 1G7VA 4XTIA 3V1PA 5I3IA 4H3DA 3P81A 4HNUA 3G0XA 3GIYA 4CCDA 3GNDA 1TMHA 1TIMA 1NVMA 3PWAA 4LVAA 3UZ5A 5LNSA 1Q6LA 2FIQA 1KFKA 1W5QA 1AW5A 3PUOA 1I2RA 3LHWA 3B04A 3M6YA 1W5PA 1WAUA 4JX5A 2OT0A 2ZRUA 2V5BA 1KM0A 4UTTC 2EHHA 2WOQA 1VC4A 2E6FA 4R33A 2QJIA 3F4NA 1W3IA 4NJIA 5HUOA 3BG3A 1TJPA 2Z1BA 3C56A 1SSGA 3H55A 4GNJA 4LW7A 2H3DA 3TE9A 1W54A 3PBUA 1EWDA 1T96A 3DFTA 1QOPA 2ZDRA 2Y89A 3L0GA 3WJYA 3CWNA 1I2NA 1OYAA 2J9XA 2XFWA 1A5BA 1V5XA 4N9EA 2RDTA 3IIPA 5D32A 3IGSA 5D04C 4I9AA 2X1TA 4NZJA 1GG0A 1MEWA 1F5ZA 1GTEA 4L4MA 1PE1A 1K8XA 5F2IA 4JEQA 1TTIA 3P74A 3TFCA 1SO4A 3FOKA 2ZZ4A 4BR1A 4UTWC 3TAOA 4O10A 3R5EA 1I2PA 3HQ1A 4MJMA 1TPDA 1JCMP 5G1YA 2CLKA 3KVJA 1AL8A 3LHYA 2QAPA 3BGJA 3S8HA 3O05A 5LNUA 3GDTA 4IQLA 1H60A 4GXMA 2WNNA 3UQNA 2CZDA 3B8DA 1I2QA 1JRCA 4C1LA 3LBCA 3RLVA 3USBA 4IPJA 1WBHA 3I7RA 5U7SA 3KRSA 1YXCA 2IQTA 5HWNA 3UWYA 3EWUA 4CCEA 3QQ1A 5GVJA 2WJZA 3WK0A 4DQWA 1AW2A 3W1LA 3M9YA 4DBEA 1EPXA 4JTIA 1TPC1 3FKKA 3TSDA 4LRSA 2CZ5A 2E5BA 1OF8A 3N3MA 1RQHA 3W73A 3KHJA 4QIUA 4LV4A 3TC7A 3UWWA 4ORMA 3N2MA 1DV7A 3DFOA 4NXKA 3P82A 1X6UA 1TCDA 4BK9A 4X22A 3EX4A 2ZZ7A 4FB7A 2NV1A 4M6PA 3C61A 1QPRA 4DO6A 1GOXA 5FEXA 1FWSA 3FLUA 1XUZA 4UTHA 5K4XA 3W2KA 5CG7A 1KLZA 1YDVA 5G4EA 1B9BA 1WBJA 5HUPA 3TSMA 4FIQA 4WXYA 4NJKA 1G69A 5CZTA 2NZLA 1XUUA 2H8XA 4UTMA 4IMFA 4LVGA 3TJXA 4NX5A 1C29A 4LC6A 3EWWA 5G2HA 4CQAA 1H7WA 3LX9A 3WJXA 3DBPA 3KOFA 2X1UA 3P5YA 2V0TA 5D30A 3W22A 2BTMA 1O95A 3T78A 3HG5A 3FIGA 3LCGA 3NPVA 3CLMA 4NX0A 1N8FA 2YFNA 3EX2A 4FNRA 5FEWA 3IGXA 3GDLA 3M5VA 3DH7A 1KTNA 4ADUA 1W5MA 5KITA 1TQXA 3LXAA 1EUAA 5CPLA 1GG1A 3O6DA 3M5YA 3OHIA 4UNLA 4UTLA 1U83A 1XDLA 1J4EA 5EA9A 3TW6A 1NF7A 3TV8A 1FXPA 4PL1A 3W1RA 3TSBA 1OFPA 5SWUA 3G0SA 1N55A 2C13A 4LVDA 4HHPA 4NJJA 2OZ0A 1VPXA 1GVQA 3IIVA 1A53A 2ZRXA 4OBTA 4LUJA 1LBFA 4JR5A 1H51A 1ALDA 1MZHA 5HINA 4UR8A 3UWZA 3W72A 1AK5A 1MEIA 4O14A 1PCWA 3C3NA 1SW7A 3OEXA 2VKZG 2PRHA 4QNEA 1MO0A 4RKAA 1SZFA 4P2VA 2B7PA 2E6YA 3DFSA 1K8YA 3KVLA 4O0KA 3W74A 3E96A 2PE4A 4TO8A 3ABRA 2CLOA 5EKYA 4G1KA 3IVTA 4OGZA 2DJXA 3LHZA 2Y7DA 3WJZA 5IM51 3NG3A 1XBXA 4MZ8A 1P4CA 4AHQA 2FPVA 3W7NA 5HWJA 4MKNA 1PHQA 1OJXA 1T0OA 2FPTA 3HG4A 4HKPA 1VCGA 3NQCA 3NR0A 5CZ0A 2ZA3A 1YTKA 1GPWA 3UXDA 3FFSA 2NXHA 2Z6JA 2I1OA 4M6VA 1WOBA 4BI6A 2Y63A 3FKRA 1YADA 3NVTA 3PSWA 1AW1A 4GE8A 3MP4A 4C1KA 1FCUA 4N2YA 3NO5A 2P0OA 3W70A 4DF1A 2YZRA 4O53A 4RXFA 1PCKA 4AXKA 3LERA 1L6SA 1F05A 1KM2A 4EIVA 2H8ZA 1LP6A 1OFOA 4UNKA 2G97A 4WOZA 4DEFA 3QSRA 3TQKA 1SO6A 4WD0A 3HJZA 3DZ1A 3LCWA 2WO5A 4FO4A 3BVJA 4PFMA 3RK8A 1VRDA 3RLUA 1TO3A 5D2XA 3I7QA 1JULA 4LRTA 2C1HA 4HNNA 4IGHA 1TTJA 3SI9A 4NNCA 3IIZA 2EF9A 2YPIA 4ADTA 1P0NA 1OF6A 1SQ7A 5BW6A 4OU1A 1H61A 2TSYA 3C52A 1X1OA 5F2LA 3TKFA 1OX5A 5K9CA 1TPVA 3E9AA 3FYOA 1XCFA 3W86A 3QYQA 2DORA 3P80A 2FTPA 1OFQA 2CW6A 3NOEA 1JJKA 1KM6A 1CI1A 1LOQA 3NNTA 3QF0A 1OFAA 4JY9A 4UFMA 1YTDA 4OWGA 1H1ZA 3GAKA 2R8WA 3GAYA 1ZAJA 3LRLA 4WQ6A 2XN1A 4DXVA 4DPQA 1Z42A 3IV3A 4JTHA 3DAQA 3HPZA 2VEMA 4TX9A 2FLIA 3HGOA 1I45A 3GX9A 4NT0A 2GQ9A 2YX0A 3PC0A 3BARA 2NX9A 1SSDA 2Y85A 4TMCA 1KA9F 3TX9A 3W84A 3TQ0A 4AB4A 3NA8A 3PM6A 3NPWA 4HIBA 5C55A 2JK2A 1PV8A 3C0JA 1GQNA 1QFEA 4O15A 2GVJA 1DJQA 4NNBA 4OV9A 1THFD 4JTTA 2ZZ5A 3QFEA 1ZAHA 2A1YA 4JXCA 4QSHA 4JDBA 1VHCA 1ME7A 5J5RA 3EKLA 4GUHA 2VENA 4JY8A 2C6QA 1R30A 4RJEA 1N7KA 3A5VA 3NL6A 1SR9A 3QMRA 4HN4A 2G96A 4EWND 2QUTA 2EAWA 4AWUA 4JTSA 4QM1A 4A3UA 4TU1A 5DN1A 3TAKA 3DI0A 1T99A 1LBMA 2A7RA 1ICQA 2Z0IA 3A5FA 3TH6A 5TIMA 3NQ6A 2FFCA 5HJLA 4IXHA 1SFLA 1VH7A 1QNVA 3JRKA 1UUOA 2WNQA 5KZEA 3S1WA 4XQ6A 3S5NA 5CPOA 4M7TA 2WKJA 2HMCA 1H50A 5FF3A 4Z1BA 2G5WA 2NX3A 1JQVA 1LZOA 2E6AA 1ADOA 1BKSA 1L2UA 1W0MA 4NJGA 4Y9AA 1GEQA 5HR6A 2A7PA 5I3KA 3DHDA 4Q33A 1HO4A 4FNSA 1SUXA 2ZZ2A 1CX9A 3LI1A 1FDZA 4W9TA 4GUGA 3UZJA 3FJLA 3NL5A 4PCFA 4NNAA 3IVSA 1IXQA 4N4QA 2CZEA 2ZCGA 1Q3NA 4IX2A 2ZYFA 4OT7A 3ZR4A 1WQ5A 4Z1CA 3W7IA 3TK7A 4BWLA 1M7PA 3W1NA 4ORIA 2QDGA 5CPMA 2TRSA 1KTBA 4K39A 3EWBX 4QISA 1KV8A 4U4MA 1H1YA 5HNRA 2NLIA 1TQJA 5I3FA 3LRMA 2A5HA 3N9SA 3MHGA 2BZNA 4Q4KA 2OMAA 2WV8A 4JTLA 4X2RA 3I6RA 2C3ZA 2WQPA 2TYSA 4HPXA 5G1TA 1R2TA 3M43A 2A2IA 3R89A 3NXFA 4N9BA 1F74A 4Y96A 3EWYA 4WOQA 1OX6A 3W7PA 2NV2A 5AC8A 1OYBA 3O6YX 4XWUA 3KRUA 4IMDA 1JUEA 3H53A 5AYZA 3W83A 1W5NA 5AHIA 2B7QA 4N6EA 3O6CA 4BFAA 2HTMA 3QW4B 5IBXC 1GT8A 2C0AA 1PS9A 5LHEA 1KM3A 2JGQA 2Q3OA 4ICNA 2A4AA 1XL9A 1OYCA 5FI8A 1KV5A 3MBDA 1RQEA 1FUYA 2A6LA 4FNTA 3R12A 4MLRA 4WY0A 4LV9A 3WK3A 3PSVA 2GJLA 3W1XA 4JS3A 1K8ZA 5CPNA 4UC5A 4JNMA 3GDMA 2ISVA 3TW7A 1FY6A 3GXPA 2E6DA 1VS1A 4Z0JA 4JGDA 3EB2A 1G4EA 2J88A 2Z2UA 3HMJG 4UIOA 1OABA 2QCCA 1QCWA 2QCFA 4IMCA 2X1RA 4HSNA 3M41A 2C14A 1MXSA 4O12A 1GYNA 4WXZA 3TFXA 4KWVA 1HUVA 4Z0SA 1O60A 3BO9A 1KBIA 3LBMA 5AYYA 3CB8A 3BLFA 2Q8LA 2Q3RA 4RLIA 1HFBA 2NUXA 3B05A 3K30A 4GUFA 1H7XA 3GNNA 1O94A 3CM4A 4MIMA 5A8GA 1Y0EA 1ME9A 5I3HA 1VCFA 3Q2DA 3OVQA 4YMZA 1K03A 3L5MA 3THAA 3YPIA 4XZ9A 2VELA 3W3OA 3LCHA 3PB2A 3F03K 3T44A 5D2WA 3VKJA 2ABBA 2VFHA 2J9ZA 2X30A 2YW4A 3MWAA 3PBYA 1LROA 3BW3A 3TUUA 4P61A 3UD6A 1DJNA 3G1FA 3LCIA 4MJZA 3A21A 1TPEA 8TIMA 4M7SA 1K7XA 1F73A 2QCLA 3G1XA 3M16A 4QITA 3HGRA 3PB0A 1FWRA 3LGEA 3KRZA 3W7KA 4JTFA 4UFLA 4ZQPA 3S0CA 4MY8A 1SZGA 3W7QA 3GDRA 3TMLA 2Z6IA 5KMYA 4N9DA 1W31A 4A2RA 4UFHA 4JTEA 4M5PA 4ZL1A 1LRTA 1BTMA 3L9CA 3S5ZA 3UY8A 2ZBTA 1IXPA 2V30A 3N19B 4D2JA 3RMJA 3EXSA 5KZMA 5H91A 1VYSX 3ANYA 2BX7A 5HR7A 4UXDA 2BXVA 1YPFA 2AGKA 4JYDA 4KFNA 2E1DA 4B5NA 4LOCA 1JCLA 5C5YA 4PH6A 1QWGA 2B7OA 1VLIA 2QUVA 5EY5A 4YLWA 2O7QA 3NM1A 3DGRA 4DELA 2Y6ZA 2Y7EA 4AF0A 2A21A 5D09A 3IIOA 3W71A 3W9ZA 3EX6A 5DELA 2OT1A 2PCQA 3TROA 3W1TA 5FEZA 3L5LA 1W8SA 1GVFA 5AC7A 4DF2A 1TPWA 3W76A 5HMSA 3EX3A 5D37A 4ALDA 4LTSA 3NZRA 4A21A 2QCMA 2E68A 2W79A 5DBTA 1TV7A 4A29A 4AHPA 4QQ3A 2P10A 5EMUA 3S9YA 1KFJA 6TIMA 2ZRVA 3NM3A 3C2OA 4A2SA 3TR2A 1Z44A 3G8EA 1H7OA 3QMSA 4I7VA 4CQ8A 3CIWA 3L5AA 3FJ6A 2Y61A 5AC6A 4NZFA 1GVOA 2V5LA 1X8FA 4UMCA 2ZRYA 1DOSA 1D3HA 1Q6RA 2NUWA 1LCOA 2ZQ0A 3HG2A 1YPIA 1KM1A 1Q45A 4LNYA 1EB3A 4K7YA 3W85A 4MOZA 3W7DA 3TC6A 1EX5A 3W7GA 4DPPA 2QCDA 1DBTA 2Q8ZA 3A24A 2GJNA 2H90A 4TMBA 4FXRA
chains in the Genus database with same CATH superfamily
4GYJA 1GYLA 3VABA 1SFTA 4KRZA 4H9YA 4JTAA 1VD6A 2A7NA 2IS7A 3PZNA 4UOZA 3CTLA 3GTFA 3LOTA 2IQ0A 1IR1A 1JUKA 3A47A 2CNCA 3Q37A 1Q6CA 4L80A 5FESA 1C9DA 4AAJA 3CHCA 4GH3A 1GZGA 4IISA 4WRHA 4XZLX 1XLLA 1MZRA 1QWKA 4ZOBA 1MW1A 3LBOA 3R0DA 3T08A 1GWJA 2E8YA 4KH2A 2PDLA 4MNMA 5I79A 3BV4A 5DFAA 1VZWA 3E5PA 4PUEA 1EA9C 4JD4A 3SGUA 3MP5A 2QQ6A 2J25A 2G0WA 1GOQA 5H1WA 4HK7A 4US5D 3VKDA 4HK5A 5CSSA 3TLQA 2VDIA 1W9XA 4X63A 3MKKA 5A8OA 4H2HA 4I9MA 2XSXA 5DCDA 1O5RA 1HJQA 2D2OA 2C91A 2X41A 4IFKA 4NVTA 2H6RA 3UR2A 1HKWA 3W6LA 8A3HA 1L2QA 1VCVA 2QCEA 4Y7EA 3EDKA 3MKCA 4C5YA 3G3MA 4PMRA 4D72A 3VUSA 1HX0A 3AU6A 5MHBA 4FX6M 4RV8A 1UD8A 1J8VA 4HZ7A 4FXJA 4GYPA 1CW2A 4MWAB 2UZ9A 1EIBA 4F0KA 3KDNA 3KFTA 4Y9NA 1FBAA 1WV2A 1V3MA 2VEKA 1A3XA 4LUSB 3NQ7A 5JBFA 3PZGA 3SCVA 4ML4A 3BK0A 3SUVA 3FYPA 2PDQA 3AMDA 1YW1A 4JTGA 4XAPA 4A22A 3WELA 1XIMA 3WFAA 1JYNA 1R6WA 2Q09A 4MTVA 4BEUA 5D4YA 2XDFA 4GVGA 4DO4A 3ZFHA 1RCQA 3GDKA 3MJYA 3D3FA 1TFVA 3GQYA 2Z27A 3U2CA 4YN5A 2HV5A 4MUZA 4HJFA 5TBOA 1TCMA 1Q6OA 4FS9A 1FWWA 2DZWA 3PUGA 4LX4A 3G2GA 2GJXA 3H24A 1XLGA 2W3ZA 3OGVA 1HL2A 3AJXA 4DYEA 5I78A 3WK1A 2DP3A 1W2PA 1X38A 2ZX7A 2PZ0A 1DQUA 4J3XA 4E2BA 1OC5A 3PTKA 2BSLA 2A3EA 4PL2A 1PSCA 3F4CA 4MB5A 2EQDA 3NQAA 2ATSA 3ITYA 4QDPA 1OVDA 1RH9A 1IF2A 3H4XA 1XP3A 4XK2A 1BKHA 2MNRA 4MLJA 1KCLA 3IIXA 1NDZA 4M6QA 4ERIA 1IQ8A 1XM3A 2WZEA 3PPHA 1ISZA 2HNEA 1Q6DA 1Y5WA 2DU2A 1UB3A 2PDNA 3CT7A 1NAL1 3B0PA 1BEUA 5FJPA 2V6AA 1EEXA 2WLYA 2ZVRA 4LUYA 2ATMA 2GSEA 5G5IA 3T8LA 1FWGC 4F4RA 3P67A 1IXOA 5AVNA 1ELSA 1POKA 3ZXWA 1GOKA 3QOMA 4GBUA 4AY1A 1VFFA 2EXOA 1FXQA 3UNTA 3HO8A 2ZXBA 3MT1A 3RHGA 3T05A 3L2IA 4Q8OA 3C2RA 1Z69A 5EMKA 2G4JA 4V15A 7ODCA 3BG5A 1FA2A 3AQUA 1OFBA 3LSBA 3WQDA 4Y8EA 1TIWA 3B0UX 3EPMA 1H09A 2JKEA 2YCKX 3CL6A 3T40A 3WO8A 2D20A 3SCQA 4M3PA 1E1FA 3W7JA 2PWDA 1SZEA 5GNYA 1I0BA 1PXGA 4PZVA 3WBXA 1C7SA 3RR4A 1VEPA 2XWDA 5FJRA 1H63A 1IE7C 1OB0A 2FHCA 2YBUA 3B9OA 4AH7A 4F2BA 2G95A 4QE1A 5LA1A 4XX6A 5JMUA 3OVGA 4AVFA 5K9DA 2FHBA 1L6FA 1I9CB 1XBVA 3WJWA 4QG9A 4KEZA 1DHPA 3SJ3A 2QV4A 3OA3A 3LDVA 3VZYA 4WUIA 3OLEA 4UB9A 4AEOA 3QC3A 4M29A 5F1UA 1V51A 4PSRA 2PWGA 3MMDA 4UZSA 4C6NA 4AD3A 4H7ZA 5AB3A 3HPFA 4BA0A 4AHOA 2AAAA 2G3FA 3MV11 1J0JA 1W9UA 2XSBA 3CQJA 3NQ2A 4WEVX 1F7BA 3C6CA 2PS2A 8XIMA 1CXFA 2WM0A 3R7MA 4MNLA 1SPQA 4OOUA 1TPFA 3IK2A 3UERA 2DSKA 5A94A 4D6GA 2QCNA 3CWHA 3IJ8A 3R79A 4PUNA 4J35A 2WSRA 1KCKA 2Z24A 4HYWA 1P6CA 4PCTA 3WH9A 2Z1KA 3WDPP 2YXOA 3KCJA 1SO5A 1U30A 4WGHA 4XVEA 3TJLA 4CVUA 2PC4A 1OM0A 1HT6A 2POZA 3T0AA 4HA0A 1AMKA 4GNVA 1IGSA 4I9JA 1HL9A 2QR6A 3CUJA 1MSSA 3QGVA 1A47A 1ONRA 4L5ZA 1R3SA 4O0ZA 3CAQA 2BVTA 3CV7A 1Y8BA 3W2NA 1E9ZB 2FJKA 4Y90A 1TWWA 1EUNA 3B0VC 4ZMGA 2FMNA 3ITOA 2UWFA 5D38A 3V0UA 4K8GA 5LNWA 1YTEA 1XH1A 3PFMA 4NILA 3VNDA 4XAYA 3ZJ8A 3T09A 4AC7C 3PZ9A 4ILSA 1WZAA 2NQHA 4V27A 2EO7A 3VO0A 4R88A 2UY4A 1FFQA 4ZGYA 1GHRA 3CH9A 1TRDA 3LU2A 5EMMA 3UWEA 1W1ZA 4WY0F 4DY1A 1UCWA 1RCXB 1C7TA 1EF2A 4E4PA 3M7SA 2D3NA 3PZVA 2CLPA 3T1GA 5FF7A 1OCJA 1VEMA 2AQVA 4DBDA 4PRTA 4W87A 3M47A 4K8HA 4ZQRA 3EWXA 1JZ8A 4ATWA 3WQGA 2J6XA 4LB4A 2CLIA 1JYWA 1IIHA 2JF6A 1EC7A 4POCA 4QEHA 1F3XA 3DN5A 3EA2A 2QJNA 3VIOA 3UJSA 6XIMA 4P8WA 5CJ5A 3QRHA 2X1IA 3NTYA 1QO5A 4UMAA 3BLIA 5C2GA 2QW5A 4UQCA 3U3HA 4K1WA 2A3HA 2AL2A 5MKGA 3A4XA 1R2SA 1JZ3A 1LL7A 1EPVA 3HIJA 1OADA 3R11A 3VZXA 2QEZA 2XIIA 3V18A 3R94A 4MZ1A 4WSKA 2ALRA 3FSUA 3IJ9A 3DCPA 5HULA 3VXGA 3W7EA 4PBGA 5ECVA 2GK1B 5I09A 2IQDA 3JW7A 1V02A 3PAJA 3OIXA 3WUEA 4HHLA 2H9AB 3NDOA 1FH9A 3L4ZA 1LRNA 1BF2A 5LZLA 4D1JA 4BWLC 4LAKA 4Q6JA 2NSXA 5B7ZA 3LXCA 3LPGA 1PZ2A 4WSJA 3SR7A 2RJHA 1YYAA 5FF4A 1IEVA 1LOSA 1ZRQA 2PP3A 4NZ3A 5FJOA 4V28A 4WKFA 3VTRA 3W1UA 2FB3A 5GNXA 3QW3A 4BF5A 3TTQA 4NJHA 4CD8A 1XYAA 3K8LA 1PJ9A 3MP3A 2YGYA 4H1ZA 1LDCA 3GU2A 4K8EA 3IEBA 1R5YA 2VC5A 3PF3A 5B7YA 1VENA 4W7WA 4P7RA 5AYXA 4BQ3A 4LU0A 2MANA 1DPMA 3TXZA 3RYSA 4JX4A 5DQPA 4IQDA 4H9ZA 1YXDA 3ELFA 4NZ1A 1W9VA 3LHTA 2V3FA 3UCQA 3HQPA 2HZGA 2A3LA 4MY9A 4RNJA 2NUYA 4DJDD 2ZRZA 3W2MA 3ONCA 3SCRA 4I5RA 2PU1A 1DWIM 1PIIA 3P0WA 4GACA 3HG3A 3DHFA 2WWCA 3DFYA 3TU9A 1EP2A 1ISXA 4O28A 4CQ9A 1Z3NA 1V3IA 5F4XA 1H7PA 4RZ5A 3QHOA 2VUNA 4HPNA 1RUSA 3B4UA 2P3ZA 4Z1YA 3PUEA 4KCTA 1W6TA 1D9EA 4PTWA 3FN9A 3BLLA 3LNMA 1CLKA 4R85A 4Y9OA 2Z1VA 2ZE0A 3B0YA 3H70A 4JTRA 3E0VA 3H2EA 1XS2A 1QW9A 3VD5A 3V35A 2QF8A 1V6XA 4KGLA 3WJSA 1LBLA 4HSOA 3BLEA 1LLZA 1LLOA 4UTTA 4ZOCA 2QUUA 2FDSA 2Y8KA 4JTQA 4IFKB 1UWIA 3PANA 5K4ZA 1PAMA 3QV7A 4O57A 4Y9MA 1RP8A 4DUOA 2XGZA 4IMAA 4DF0A 3ID7A 4A3HA 1DL3A 2KX9A 3AS0A 2DGAA 4EF9A 6ENLA 3WSUA 3VDBA 1O12A 3R10A 4C6IA 1FWFC 1UJPA 2E9MA 2XGIA 1R3WA 4GQRA 1K77A 4DBWA 3KOXA 3SCTA 5CPSA 3W88A 4YVVA 2F61A 3C5QA 1ZJBA 3I4EA 4PMYA 1BVNP 3BCDA 3FS2A 4CD4A 2DEPA 4O17A 2YA0A 3ES8A 5CH9A 4O1DA 1T7LA 4J27A 1R9YA 1OC6A 1F4AA 5LA0A 2YL5A 3LV6A 3GZAA 1XF0A 2XIMA 1OFDA 1ZHAA 4Q8WA 4IGMA 1ITXA 3M0IA 4OUIA 1LRQA 1UH4A 1EZ2A 3G3DA 2WPBA 3GB6A 2YL6A 1FWTA 4GVIA 1GKQA 4DJED 5LGXA 1TVPA 1TV8A 5LIWX 3UR7A 1TRIA 3EEGA 3CYJA 4CNPA 4B9YA 1UWAA 1R47A 2R94A 2XSAA 1Z48A 2EGZA 1GVEA 3TTYA 3MUAA 2WB5A 3GR7A 4HMNA 1S38A 2B4GA 2FH6A 5C0QA 1IHIA 2FFIA 2R1KA 2ZXQA 1QATA 2LLEA 2VHLA 3PJWA 4LVBA 2QAFA 4RDVA 4KKXA 3VM7A 4AFYA 4H7VA 3IAQA 4CU7A 5CQ1A 3Q94A 3TNOA 3GKFA 3W2UA 2PRMA 1Z41A 3LCXA 4WJEA 1XRSA 5BRBA 2J27A 3WDQA 2X40A 3BZGA 4C91A 4QSFA 5I77A 1PPIA 4UFIA 3W7CA 1A5SA 5AHEA 3BLPX 2J66A 3ARWA 4KEMA 1MW0A 3R8GA 3AHZA 3BSGA 3N2BA 4IIDA 4DI9A 3LNPA 3MKVA 3HB9A 4XBSA 4QG6A 3C0QA 4KIEA 1I1XA 3U57A 2ZFAA 3ZQ9A 1HJWA 4HNVA 3E12A 4UOQA 1WKYA 2E5DA 3A64A 4YVPA 5BROA 2GVEA 1GZJA 3RU6A 5AFDA 4KWWA 4HVXA 2QHAA 2RDUA 1YXYA 2W6RA 5DT5A 4L1WA 4QS5A 4PN2A 3F2DA 3KXQA 1I4NA 3BPWA 4UCGA 1BWLA 2OVLA 5AYBA 4GO9A 3E0FA 1TYGA 4HHMA 3SCSA 5E9AA 2PFHA 2GUYA 2PSNA 9CGTA 1QNOA 1EHAA 1RV8A 3VNZA 1E9LA 4UR7A 4AWSA 2QYGA 4S3FA 1DE6A 2QJHA 3VA8A 1F6KA 4FF7A 1Q8JA 1NARA 1QPQA 2DZAA 3U0HA 4XD5A 3UR5A 1G7VA 3V1PA 1JDAA 4HMEA 3Q65A 3O0FA 1D3CA 2DY3A 4TVCA 3GIYA 1OGSA 1WKEA 3R0KA 4KPLA 3A4AA 3PWAA 5FAJA 3ZM8A 3UZ5A 1OQFA 1D7FA 2WCSA 3B97A 4H9MA 3VOHA 3LHWA 2BY0A 3B04A 2G41A 4W4QA 5D9PA 2WMFA 4LCSA 3OZPA 1K4GA 3GNOA 3ZOAA 3G6LA 2V5BA 5HNNA 2OGJA 4UTTC 1RK6A 4E4FA 1VC4A 1LG2A 3THUA 2Y4SA 3S6OA 1TJPA 4GNJA 4S39A 2ZUVA 4P7NA 3H2NA 1HNYA 2J9XA 3RJXA 2YZ5A 3PTMA 2ISDA 2X1TA 3WDRA 2ACSA 2OSWA 4F2TA 1WB0A 4CN6A 1RBLA 4GVFA 1TTIA 2DSUA 1SO4A 4UTWC 3TAOA 1KKRA 2PGRA 1I2PA 3W0KA 2PAJA 1UA7A 1TPDA 5HQMA 1QBBA 2CLKA 3KVJA 4ACZA 1PUDA 4DWSA 4V1XA 3BDKA 3S8HA 1G5AA 3O05A 3TVAA 2OKTA 3THDA 4GXMA 4XO6A 3NDZA 3B8DA 3LBCA 2PD5A 3USBA 3BLKA 4IPJA 3I7RA 3FY1A 4PMOA 3KRSA 1YXCA 3H22A 5HWNA 3Q4DA 1J6OA 4DQWA 4NYUA 1DWFM 5H6HA 1AW2A 5LXEA 1SMAA 3LGDA 1TPC1 3LENA 4S3GA 3KHJA 4P8XA 5ABFB 3TC7A 1XG4A 1HF6A 1DV7A 2YKKA 1X6UA 3EX4A 4FB7A 2CYGA 2NV1A 4M6PA 1QPRA 3GTNA 3AIBA 1H5VA 1Q8AA 2YDQA 3CUXA 2NT1A 4B2DD 2JQXA 1E6SM 1FWBC 4D8AA 3ICJA 3A3HA 2FTYA 4UTHA 4REQA 1ITCA 1KLZA 1YDVA 2XHYA 3E38A 4DJFA 4ZA0A 3TSMA 4XG1A 4EKJA 4FIQA 4WXYA 3AWOA 4NJKA 3RUBL 4C65A 2DIJA 3BAYA 5CZTA 1XUUA 3O0KA 5H8UA 2PGFA 5G2HA 1GQKA 3WUGA 4Q8NA 1B3XA 3KOFA 1U1HA 3FIGA 1FWCC 3EX2A 4JAWA 3M5VA 4G7EA 2B81A 3WF3A 2EJ1A 4OUEA 3OHIA 1CXEA 2PPGA 1YX1A 3TW6A 3SQLA 2OX4A 1ISYA 3SQSA 3W1RA 3MSDA 3ARZA 4W7UA 4EXBA 4QE5A 1HL8A 3L4TA 1A53A 2AL2B 1P43A 1LBFA 4J3SA 2WCAA 3MZNA 1MZHA 4WDWA 4O14A 3C3NA 3PBGA 3UF9A 1SW7A 4EP8C 1OT2A 3KTCA 2VKZG 1PX4A 2B7PA 4WR3A 4W89A 1K8YA 3W74A 2IKGA 2PE4A 2VGGA 1E6RA 4G1KA 3IVTA 3GIPA 3UCCA 2Y7DA 4GIEA 2PDFA 3NG3A 5IM51 4MF4A 2CKRA 4AHQA 1E6QM 5HWJA 3W7NA 4MKNA 1X6LA 4JFSA 3GC4A 5CZ0A 3RO6A 2GL5A 2Z6JA 2I1OA 4M6VA 3FKRA 3QZ6A 2P8CA 1V8EA 1AMYA 2VCAA 4GE8A 3MP4A 4N2YA 3NO5A 2P0OA 3W70A 3MS8A 2WSPA 3WNPA 3W82A 3GFYA 1F05A 4DUXA 1KM2A 3GHRA 4EIVA 2H8ZA 1RXOB 3SN4A 4DEFA 2BNJA 1BYCA 3QSRA 3TQKA 1HZYA 4KMQA 2W66A 1BTCA 2WO5A 4L4PA 1VRDA 1TO3A 2HPIA 4LRTA 4IGHA 3SY1A 3T07A 2VTFA 3LEPA 4WDXA 4LJ3A 2CC0A 2EF9A 4IL0A 2Z1WA 3MJMA 1H61A 3H2MA 4H8HA 2TSYA 3FAXA 3CTTA 5E6ZA 5F2LA 3TKFA 1OX5A 2DUXA 3WF0A 1XCFA 3W53A 1B54A 1J18A 2FHFA 4IIFA 4JY9A 4UFMA 2QVNA 4Q6XA 3R6IA 1H1ZA 2Z7KA 2C7FA 2HBXA 2ZC8A 1RY0A 3LRLA 1OD8A 2XIJA 3DAQA 1C90A 1I45A 3MO4A 4FI4A 4NT0A 5C7VA 5HA7A 2CBJA 5ECUA 4NP7A 2Y85A 3W84A 2UY2A 4YU1A 1R38A 4AB4A 3KUMA 3BAXA 1B9ZA 2Y8VA 3AXKA 2XM2A 4B15A 5C55A 2BV9A 1TVNA 1F4HA 1QFEA 4O15A 5DMNA 2GVJA 1DJQA 1PKNA 3CPGA 1THFD 3STPA 4GI4A 4LYQA 1DJZA 1S2UA 1MNZA 4P5UA 5RUBA 4WF7A 3ITVA 4JXCA 4IP7A 1ME7A 3CAWA 4IM4A 2VENA 3TQPA 3A5VA 3WQ8A 4HN4A 3BLDA 1KGWA 2I16A 4W8BA 3VGGA 4GKTA 4KETA 3CPUA 4R9OA 3VGBA 3GBEA 4IG2B 3VNLA 3TAKA 3DI0A 2JALA 4AMCA 3KLLA 1ICQA 2Z0IA 4H7CA 1IGWA 2FFCA 1HJUA 1A5KC 4IXHA 4UQDA 1V03A 3S5NA 3GXMA 2IMRA 5DRIA 1A5MC 3RU8X 5FF3A 3VK5A 1JQVA 4L6HA 3FDKA 1ADOA 1BKSA 1L2UA 2WMKA 1GEQA 4E6MA 3T2OA 1GW1A 2A7PA 1QI3A 2DH3A 1LWJA 1XQKA 1XISA 2EBNA 5C70A 1FDZA 4X2PA 1UP2A 4PE8A 2HK0A 3IAPA 4ZTYA 2VO5A 4QGCA 3AHVA 1IXQA 1XV8A 2CZEA 4MPKA 1JXJA 2DFAA 4DB7A 1PIGA 3ZR4A 4Z1CA 4PGLA 4GI6A 2ZE3A 1NM9A 4L4OA 4QISA 4H01A 1KV8A 4ZB5A 5HNRA 1TQJA 1YEYA 3LRMA 2NSOA 4IUGA 2A5HA 3N9SA 1CYGA 3MDUA 1IEXA 2OMAA 4JTLA 4X2RA 2WQPA 4HPXA 1XGEA 1R2TA 4GQBA 3PNUA 2A2IA 3L2LA 4N9BA 1VFSA 1F74A 3TWAA 2NV2A 2D69A 4S38A 2QT3A 3O6YX 4IMDA 1JUEA 1TA3A 4AQLA 3FXGA 1WUEA 3AZTA 5GJMA 2WVUA 4M6UA 3QW4B 3D5HA 1K8CA 1ONXA 1GVIA 2Q3OA 2DV0A 1RQEA 1FUYA 1TUXA 2R24A 5I00A 4P8VA 5AZ0A 5FD0A 1ZTVA 1K8ZA 2V3GA 4DYJA 4UC5A 1RJRA 3GDMA 1XGZA 2QDDA 1FY6A 3GXPA 1EH9A 1UOKA 2P0IA 4Z0JA 1M9HA 3EB2A 1G4EA 3B3DA 2J88A 2Z2UA 4UIOA 2QCCA 1QCWA 2QCFA 5CSUA 4JKLA 3BQ5A 2X1RA 3E2RA 1UR3M 3MCOA 4HMDA 5JVLA 4O12A 2ADAA 1EBHA 3TFXA 4KWVA 3IV8A 4Z0SA 1O60A 4CN1A 4EXAA 2TODA 4W7VA 2G37A 2QUNA 3AIWA 3B8VA 4UQAA 1F61A 2OGYA 4ERGA 3QOKA 4GUFA 1H7XA 3VM5A 2E7FA 1O94A 3CM4A 4YHEA 5A8GA 1Y0EA 2GZXA 4GISA 1UQZA 1VCFA 4AZBA 4XISA 2OPJA 1LQ2A 3F03K 5D2WA 3ZVHB 1GKRA 2J9ZA 4GZEA 3MWAA 3PBYA 1WDPA 3UD6A 3LZ5A 2ZX6A 1TPEA 3RILA 1K7XA 4PMXA 4PCNA 1VEOA 3W6MA 2GGEA 4QITA 3HGRA 3S0CA 1ECEA 1E70M 1SZGA 2I56A 3GDRA 5JH2A 3BURA 1W31A 1CENA 1UKPA 1LRTA 3QZAA 3S5ZA 3AIEA 3CLWA 4F3HA 3WH6A 2IKIA 3W25A 3RMJA 5KZMA 3ANYA 1K9DA 2BX7A 1P6WA 3QTPA 3VIIA 3GR4A 4KFNA 3EDJA 2BFGA 1EJUC 5C5YA 1F6YA 5A6SA 3UZYA 2O7QA 3NM1A 2Y7EA 5CSYA 3ZZ1A 1A4LA 1KWKA 2A21A 3A3XA 2V5CA 3EX6A 2PWHA 3TROA 1W8SA 4KWOA 3U4FA 4QLKA 5AECA 3EX3A 5D37A 5BOFA 3I6EA 3ITXA 5FIPA 1H49A 1YNYA 3QR1A 5DBTA 1ZZMA 3FDGA 4AHPA 1QW7A 4QQ3A 2OYMA 6TIMA 3NM3A 3TR2A 2RJGA 3QMSA 3RRAA 4I7VA 3GD6A 4YS1A 1UWSA 2XVPA 4ZE4A 3L5AA 3WF1A 2Y61A 4RW5A 2CESA 4PMNA 1DOSA 1D3HA 1MW3A 4FOUA 3W38A 2FVLA 1Q45A 2YXXA 4K7YA 4W5UA 3W85A 2CXEA 2FKPA 1WKFA 4MOZA 3W7DA 4TX6A 4B16A 5HPCA 1EX5A 3W7GA 1XCXA 4I3GA 3QY6A 4D1IA 3T0CA 1X7FA 2RDWA 2VM8A 3TA6A 3P84A 2FZBA 4D6HA 3QR0A 4XV0A 3AALA 2XFRA 1JD9A 3CZEA 3LXBA 3MB9A 2INEA 3T42A 2ZIDA 3NEHA 4KERA 3S1GA 4YCOA 4EX4A 3VGDA 3BOFA 4H9TA 3N6JA 5JBEA 1TPUA 1L6WA 1QAPA 3M44A 3AO0A 3L66A 2ZADA 1TTQA 3MA8A 4JFTA 3GTXA 1Q2RA 5LGZA 2WMGA 5KTLA 1XBYA 3ONBA 2V69A 1ZBWA 1SYTA 4HGXA 4Z2GA 4RPPA 1J0KA 1QHPA 2J79A 3WBYA 3FEQA 3GHUA 3UP8A 1DIOA 4E0CA 1JYXA 3HFYA 1EEPA 1LUCA 4LS2A 2NLYA 5JQ9A 4AZCA 4LFYA 2WZHA 3G24A 4Q3MA 4ZQOA 4LAZA 1XYLA 1YNPA 1F3TA 4JDYA 2DZXA 3WLRA 1REQA 1QI0A 4GX9A 4ZENA 1M1BA 1PDZA 3WDHA 5KSWA 1VRXA 3F4WA 3AIQA 2VC6A 1VJIA 3RX3A 3F5JA 4ZQMA 1OD0A 4S2CA 3VCNA 1RVGA 3N17A 3SZ8A 4MPQA 2WNZA 2GFTA 5BOEA 1C8YA 4G7EB 2BG5A 4JIIX 1UWRA 5DEZA 3PZUA 3MY9A 3STEA 1VYRA 4NYYA 1WDRA 1JDCA 1EA0A 3LQLA 1SJCA 4ZODA 4C7GA 1XW8A 1QTWA 1BSIA 3N13A 4WGXA 3LB0A 4A35A 4XO7A 2CLMA 2WJEA 3N18A 2YCJA 3UG4A 5IOBA 4KEUA 1M7JA 2VRQA 5JBDA 4QDMA 3DFHA 3F7JA 4Z2IA 2F9RA 3RO8A 2OR2A 3FGCA 2GQAA 3TDFA 1O5XA 1S5WA 2QCGA 3SJNA 4GOAA 3NOYA 4IH3A 5HMFA 5A6TC 3PY2A 4JN7A 4MSSA 1HKIA 1TMLA 1NWRA 3SFKA 4EF8A 3E2VA 3B8SA 2VFDA 3BLOA 4D6FA 3SGZA 3NZGA 4N02A 1P5BA 2IUZA 3OJGA 1U5HA 1P1XA 1RK5A 3WLPA 2A79A 4GQQA 3H21A 4GCXA 4HT3A 1IR2A 1JVNA 2XFFA 3EMQA 9XIMA 1ONEA 4AD2A 4KESA 2OWWA 3BGAA 3ZJKA 1UD6A 4U2YA 1NP0A 4LY8A 4BQ5A 1RD5A 4NUWA 1XICA 3SURA 4IOTA 3R4IA 1FDYA 1LQ0A 1M03A 1IT8A 1CPUA 3VD9A 1V6UA 2W91A 1BRLA 4YYCA 1GGOA 5AC5A 3W23A 1LJYA 3GG7A 4OIFA 5DY2A 4GK8A 2IKJA 2J7CA 1C3FA 4MB3A 3KLKA 3PWGA 1MXGA 3BJFA 1PYFA 4J4KA 1X96A 3TMQA 1KFBA 1TR9A 3HPXA 1GPFA 5AOUA 5E93A 1E3ZA 1XIBA 3ZWTA 2NVDA 1YDOA 1UG6A 3H2CA 3BC9A 5MF5A 2PF0A 3NYDA 3PNZA 1F8IA 1VP5A 2X16A 4AIEA 3CQIA 1GVRA 1F76A 3HPSA 2GOUA 3WQOA 5I06A 4N4PA 3WQWA 4IMGA 2OLAA 1PX3A 3LY0A 3EZ4A 2ZOXA 3LUTA 5EBUA 1XHGA 2XN2A 3MUXA 1QK2A 2RHGA 4O0QA 4J3VA 3UPWA 5CBJA 5JU6A 4UTFA 4PMQA 1DTUA 3C2FA 4LB3A 4UR9A 1J0ZA 4XZMX 3KVMA 4C6PA 4GWEA 5XIMA 3WYZA 2VCBA 5EFFA 1W1B1 4UMBA 2D1ZA 4FALA 1MMFA 3WDJA 4KQNA 2QJGA 1DEDA 1ODZA 3EKGA 3BGGA 4TX8A 1XC6A 2R9RA 2VURA 1J93A 1KFEA 4AG0A 2ON3A 3FNDA 3QTGA 1PZ0A 1JYVA 3DENA 3GIQA 3W29A 3U6WA 4Y6GA 5LSMA 2VR2A 3VE9A 3I7SA 3NJ3A 3PHAA 4NAEB 4RUBA 5CSRA 1UJQA 5IXEA 3MI6A 1FQ0A 3LTYA 3Q67A 4BCEA 4ZFCA 2R14A 3KDOA 4F79A 2QPUA 3OG3A 2QDEA 3EWDA 2E25A 1I2OA 2W0UA 3P0XA 2CLHA 3M5XA 1AJ0A 1Q7QA 3GW3A 5CCZA 2AOSA 3M1ZA 7REQA 3O1NA 4MMWA 4IT1A 5D9OA 1FHDA 2FGZA 4Y9PA 3W01A 3LYEA 4JIQA 3B03A 5A5WA 1G4TA 1JR1A 1FCBA 4B5VA 2V38A 2PF8A 1QRQA 1LT8A 3RG6A 3BOXA 1P7TB 3NSMA 3OHMB 1H11A 2R91A 4KFOA 6REQB 3ABQA 1B31A 4JBRA 2WZTA 2DW7A 2XIQA 3FCPA 3WBEA 4C5ZA 1GYMA 3AZRA 3P3BA 1J9YA 1YMYA 4PTDA 5U4NA 2P8BA 9RUBA 4JIRA 3B06A 3QY8A 4DO5A 2X7WA 4JTUA 3S3GA 4CLMA 4HNTA 4U3AA 1OIMA 2GQ3A 1KXVA 2PBOA 1W9BM 2ISFA 3QLLA 4B3KA 4K38A 1TA3B 1RSCA 3PBWA 2VFGA 1LORA 2HVMA 1NFPA 1S2CA 1HP4A 1ADDA 1R7AA 2X2GA 1TSIA 4UUIA 1ITQA 2NX1A 3K46A 3L7RA 2VCCA 5L9FA 4Q4MA 3AYVA 1E9IA 4G5DA 4FNUA 1E5JA 3MO7A 1Q6QA 3VC5A 1NOUA 2OEKA 5D9NA 2FH8A 2XZ7A 2YDAA 4DZAA 3GC2A 1GJUA 4FAMA 4XUGA 2CBIA 1XYFA 3NL3A 2Q8XA 4I7WA 1CT5A 3BSMA 2WJFA 5C9RA 3MVTA 3V16A 3CIVA 4AX6A 2E5CA 3TYEA 1AFSA 3NQGA 3EOEA 3PG8A 1KD0A 3NAVA 1YPXA 3GKAA 3KS6A 1ZFJA 1TWSA 3CK5A 4CCCA 4LCQA 1DJYA 5FF0A 3VFLA 3RCNA 4HU4A 1VGAA 3U7BA 3ARYA 1BXBA 4D6CA 4K1GA 3R8RA 5BWFA 4WK9A 4B4HA 2OLHA 3N9KA 1HGYA 4M8UA 2V81A 2OYLA 5CG0A 4INFA 3NGFA 1OIFA 3B4YA 3V7PA 4R34A 2ZZ6A 4MY1A 4JTCA 3DU0A 4MM1A 5FJTA 3TYDA 4NI3A 1WZMA 1ZNNA 2AAMA 2QCHA 2W63A 2CHNA 1M41A 3VOFA 3H54A 3S1VA 1RZMA 1GQLA 5CPTA 4GMEA 5BRPA 2EPHA 2ONEA 3CUGA 4DM2A 2VQTA 3XIMA 1B1YA 1YRRA 2PP1A 3O15A 2OTDA 5HMEA 1W3NA 3VMPA 1H62A 3PR2A 4DWDA 2VYOA 3ARVA 3GXFA 2PLJA 4AISA 4KCUA 4AD1A 4UQEA 2OU4A 4GRSA 3G1DA 1GJPA 4K3ZA 3G8RA 2GQ8A 3ARXA 4LF2A 1OG0A 4O16A 2J8GA 3GY1A 4P7QA 1N8WA 1G7UA 4J1OA 1ICPA 3USZA 1M68A 2J75A 5FF2A 2ZUUA 2G3JA 1L8PA 1E0WA 2ALDA 4A3QA 5DT7A 1TWIA 1FWEC 3VOJA 4YCPA 1UD5A 4QJ1A 3DG3A 2W61A 5KZ6A 4QNWA 1UROA 3NQMA 4PA8A 3SRKA 3RN6A 4MG4A 5E0KA 5A6LA 3BW2A 1J11A 1V6VA 3R2GA 2OYKA 4Q4RA 3M07A 3URBA 2V5KA 2JIWA 1DVJA 3V4BA 3DC0A 2XPKA 4HA4A 3UWQA 3H2OA 2XINA 3UR8A 4DUVA 3LPPA 4TV5A 5BXPA 2YXGA 3JR2A 3NPUA 1EOMA 4XIMA 1SZNA 4EOUA 4JKMA 2E3ZA 1NEYA 3QGKC 3GR8A 4D9PA 3HF3A 4XKYB 1B5TA 3DFNA 4RZ4A 4YIWA 1Z6KA 5IDIA 2CXGA 3MUY1 3WG6A 3RX2A 2PURA 3DX5A 1GOIA 1M01A 3P5ZA 4K37A 4O8AA 1AJ2A 3ZSSA 4HSHA 1WOAA 4LUIA 1HJXA 3KP0A 3VPLA 3L67A 1UZ1A 4LC8A 3S5OA 3W87A 1P0EA 2WYSA 1O1HA 2BWGA 4JIPA 2YR1A 3VMOA 4HCHA 1RD6A 1UZ4A 4IQEA 3U9IA 3A23A 3AXHA 4AW7A 1A5UA 1S2WA 4O11A 1PX8A 2F84A 1LWIA 3S9ZA 2Z1SA 3P8IA 1W5OA 4JL1A 3GHSA 2BOFX 1FFRA 4LBSA 3AS1A 3KBNA 3KBSA 4GC3A 3W24A 2J4GA 3CWOX 4J3WA 1YQ2A 3LTPA 3OB8A 2CCRA 5F1VA 3MUZ1 2NQLA 1HKKA 1Y5XA 3OLDA 2AMXA 3VC6A 3BANA 3TYAA 4XAGA 4GUJA 5A8PA 1WE5A 4HPJA 4FOJA 4MWAE 1M04A 1BGAA 5ABGA 1LL4A 1XKYA 3BMXA 3TEVA 1G0CA 1W8GA 4QS6A 1Q4NX 3QEZA 1W56A 2VGBA 4U3CA 3ES7A 3RMEA 3IRDA 2JKAA 3RR1A 4O1CA 1P48A 1ZPTA 2B0MA 1A5NC 6XIAA 1U2YA 4TR9A 1H7NA 1VPYA 4B5SA 3SRFA 1XYCA 1JDDA 2J7HA 3XINA 4F0MA 2WPGA 2DDXA 4JTKA 2DVTA 1QT1A 1RJPA 2VWSA 5FACA 3VIJA 4GIYA 1IWBA 1JG9A 1QOQA 1GZ1A 1JDEA 4DAFA 2O9TA 3S5YA 3OBEA 4XSLA 5F2MA 1I1WA 2WMIB 3OLGA 2VQUA 2V9DA 1VPQA 3ARRA 1E9YB 3EX1A 3UG3A 1DORA 4WX2A 1SW0A 3W07A 3ABSA 1OZMA 4LANA 4ONVA 2J24A 4NI8A 1F6PA 2XYLA 2I14A 3IACA 4FHAA 4I5XA 3O6AA 3QPYA 4MADA 4E38A 1JCJA 3JVAA 4S3BA 4PMUA 3WQ5A 4YTTA 4J9JA 4N0RA 2ASHA 3BAKA 1GCYA 1WXJA 3WBWA 2V2HA 4FNQA 1BRLB 1TVLA 4ZBCA 2QNEA 2PBGA 3N2TA 5TF0A 3H4WA 4QE4A 1RLCL 3T8QA 1UR4A 1KKOA 1V3LA 4WZHA 1K9TA 3WLQA 2R1MA 4QAWA 1QDSA 1TZZA 1Q13A 5BMWA 3W26A 2FB2A 5ENLA 1GTHA 2KZHA 3KCOA 1KBJA 3FHAA 3PTDA 1Z7AA 4ZXLA 4CD7A 5HNTA 3BMVA 4IX0A 1PDYA 2Z28A 3AIVA 1DHKA 5K3VA 1JCXA 4MGGA 1Q2SA 3N4FA 5TAOA 4F0SA 3I3EA 3N1AA 3W1PA 2CLLA 3G18A 3CEPA 3TJ4A 1EIXA 3E49A 3RCMA 3W7OA 3WL0A 1EDGA 3BICA 4US6A 1PHWA 2JE8A 3GYEA 4XZBA 4FNPA 3HJEA 4QFUA 3KBMA 3HTWA 5C2CA 2HRWA 2WW5A 4MYXA 2VUYA 3U7VA 1J2BA 2CZVA 2J9YA 2WXDM 1U33A 3SSJA 2WM1A 2YYUA 4L7ZA 3V1HA 3WQ6A 3UU0A 4IPNB 3SUWA 3P81A 1XR2A 4CCDA 1K6WA 4ICMA 1E6PA 1PWLA 1BG9A 4FXFA 3GYCA 4LVAA 1ZGDA 1Q6LA 4DHGA 1KFKA 1W5QA 3VKCA 2NQ9A 1XPYA 1I2RA 9XIAA 4GA8A 3MU7A 3M6YA 4E3TA 3AU2A 1VKFA 1UWUA 3UZZA 1W2VA 4NZ4A 2OT0A 4W93A 3AHYA 3ORWA 2E6FA 4H6EA 1W3IA 4XD3A 5HUOA 1XLHA 2KAUC 3GNRA 2Z1BA 3ZLFA 1SSGA 2GLKA 4LW7A 3TE9A 2H3DA 1HJSA 1EFZA 3IJLA 3VNYA 1EWDA 4J40A 4GJJA 2VVSA 1F07A 1T96A 1QOPA 4S3CA 1QASA 1H0IA 1TJ0A 2PLCA 4BS0A 4HP5A 1A5BA 4AYSA 1AA1B 2QULA 1GKPA 3IGSA 4QJ5B 1GG0A 7XIMA 1F5ZA 3MMWA 3R43A 1NQKA 3VDGA 2VGFA 3KM8A 3LA4A 1MVYA 4RE4A 4Z17A 1QPKA 3WKZA 3B9EA 1LG1A 3VINA 1I75A 3R5EA 2BASA 3NIYA 3EPNA 1JCMP 5G1YA 5CXPA 4GCAA 2QAPA 1L6GA 3U48A 1XLKA 2Q6ZA 5LNUA 2REQB 5CGMA 1EGVA 1US0A 3T9PA 3UQNA 1PWMA 3PZMA 2J8FA 1JRCA 5U7SA 4L56A 4IIGA 4MAZA 4ZE5A 3TONA 3WK0A 2GJPA 5BRQA 3W1LA 4DBEA 2POTA 3EOOA 2DT3A 3S4TA 1EPXA 2E4TA 3FKKA 3TSDA 4AVNA 1R3VA 2CZ5A 4W8LA 1RQHA 1S2TA 1TJ1A 3DFOA 2FZMA 1CECA 3MZ2A 5JH1A 3VU2A 4BK9A 3GM8A 1EJVC 4DWSD 4X22A 4B4FA 2ACUA 1EO5A 4B3LA 1W1TA 3UGVA 4Q7BA 4DO6A 4GD0A 1XUZA 4GYFA 1ZBCA 4TXEA 4BF7A 1CXKA 4C7DA 1C8QA 3W2KA 1CB2A 5DMLA 1JNEA 3TW9A 1B9BA 1US2A 3EYPA 2C0HA 2NZLA 2ZX9A 2PWEA 3CQHA 3TJXA 4HOWA 5TNVA 2J47A 2CBVA 4DYKA 1BSLA 3Q45A 5AY7A 2X1UA 4FPSA 4IJRA 5DANA 2WKGA 1O95A 3T78A 3GWQA 3CLMA 4NX0A 1N8FA 3WH7A 1ISVA 4ADUA 1W5MA 3BL3A 4IP4A 1UPMB 4UNLA 4KCVA 4UTLA 1U83A 1J4EA 1HVQA 2WLZA 1NF7A 4DJFD 1CGVA 4PL1A 3TSBA 2VX7A 2XG9A 1POJA 3WENA 4NJJA 2OZ0A 1VPXA 1VAHA 3IIVA 2F6KA 1WDDA 2ZRXA 4NASA 4OBTA 4LUJA 4PMVA 4JR5A 1ALDA 4UR8A 4XZWA 1XH0A 1PCWA 2D0HA 4FLSA 2PRHA 2D2JA 4QNEA 1SJAA 1SZFA 1V79A 4P2VA 4AY7A 4HZMA 3BCJA 5M17A 3KVLA 3E96A 4YTRA 1JPHA 2CLOA 1FHUA 3AI0A 1JGIA 4AY8A 3LHZA 1XFCA 4L65A 1QHZA 3WJZA 5HANA 3KS5A 3D6NA 2WVVA 2FPVA 1OJXA 2PDUA 4MB4A 3HG4A 4HKPA 3F2CA 3APGA 1GPWA 3UXDA 3IUHA 2NXHA 2PTXA 1S2AA 2Y63A 1ZCCA 2NQJA 2Q01A 3AIUA 5CJNA 3ALGA 3DGBA 3SN0A 1AW1A 1VJSA 3UA4A 1R3TA 3ENLA 1EC8A 3ZJ6A 3M0JA 1PCKA 5I07A 2VD9A 2YJQA 3LERA 1J0IA 4IIHA 4GABA 3ARSA 1IZKA 2BP1A 3KOWA 3E5BA 1OFOA 3PPCA 4M82A 2O0TA 4QJ4B 1SO6A 3V36A 4L1GA 4OBSA 4FO4A 5JUVA 3AYRA 4LUTA 2NQ5A 3RLUA 4U2ZA 5D2XA 2C1HA 3SI9A 4NNCA 3QKZA 2ZWYA 3IIZA 2HVNA 3HV8A 3QV8A 1P0NA 1SQ7A 1WXYA 2HVOA 4R7WA 3C52A 4QLLA 3OPSA 3FYOA 3QYQA 1EKOA 2FTPA 1BQCA 2CW6A 4J3ZA 2WHMA 1JJKA 3NOEA 4LYKA 1KM6A 2CKSA 1OFAA 2HPMA 2HEJA 1JPDX 4G6CA 1G94A 4OWGA 3K8KA 1E15A 4ES4A 4WQ6A 3P14A 3EGJA 4DPQA 1Z42A 3IV3A 4JTHA 2VEMA 5I02A 4CD5A 1VBRA 1YE6A 4GQGA 1KC7A 4EPBC 1SR0A 4AZ6A 2OZ3A 3TN4A 1OZQA 3BARA 4PUJA 2VI0A 1B3WA 2WMJA 1PKYA 2Z2BA 4BY3A 3NA8A 4U10A 1EDTA 4ZO8A 5XINA 2OKOA 3A6OA 2JK2A 2YDRA 3C0JA 1E3XA 4CU8A 2IPGA 1GQNA 2YB4A 3GH4A 2J13A 8CGTA 3PFRA 4JTTA 2ZVIA 3QFEA 3CGTA 3RPMA 3SM0A 1JZ4A 3TYZA 1JPKA 3WF2A 2E28A 3EKLA 1KGUA 4GUHA 2BXYA 2HBVA 1R30A 4RJEA 3GXDA 2QIWA 1SR9A 1EOKA 5C7HA 2G96A 3CQKA 2YL9A 4C1NA 2VT0A 1SM9A 1YKWA 4FR6A 4JTSA 2XH7A 4A3UA 2WANA 2MUCA 5A6JA 5BXSA 2A7RA 4HOXA 3TH6A 3R0UA 5TIMA 3NQ6A 1BVZA 1VJZA 3QXBA 5KZEA 3S1WA 1ZL1A 4HZ8A 2Z00A 2HMCA 4Z1BA 2G5WA 4Z2JA 4Y9AA 5HR6A 4XD6A 6PTDA 2XIOA 1HO4A 1W3LA 2GGJA 3N15A 1KGXA 3LI1A 4GXPA 3ANVA 3FJLA 1UD3A 4B5WA 2NT0A 4DJDC 2CEQA 3HURA 4BKNA 5DX7A 2ZYFA 4OT7A 3OZMA 3W7IA 3TK7A 4BWLA 2P88A 2QDGA 3PZTA 1RBOB 2ACQA 2TRSA 1KTBA 5H8PA 3L4VA 3IK4A 3TA9A 1XDJA 2I57A 1H1YA 2NLIA 4PUDA 5BU6A 3MHGA 3FK4A 2BZNA 3VKBA 5HOSA 1MWOA 2TYSA 5G1TA 3BZJA 3S2CA 4Y96A 2Z2AA 4WOQA 5G4HC 1MI3A 4HPGA 5AHIA 3O6CA 2HTMA 2X0YA 5IBXC 1GT8A 3VFCA 1PS9A 3QFWA 1KM3A 2JGQA 3SUUA 3CMGA 1XL9A 5FI8A 2D3LA 3MBDA 4ICCX 4MLRA 2FMOA 4WY0A 4GGBA 2DIKA 3TN3A 3TTEA 2PD9A 3TWBA 3PSVA 3AUJA 2GJLA 2GJRA 5CPNA 2QJMA 1MXDA 1NU5A 1R9XA 3QBUA 2ISVA 5LA2A 3TW7A 3L12A 2E6DA 1CB7B 1VS1A 4LGXA 3LM3A 3ABZA 1G9HA 2CHRA 1E71M 4MDPA 3L2MA 5A2BA 4R9XA 2C14A 1CLXA 3WF4A 3ABXA 3FX4A 1XRTA 2WKLA 3KL5A 1RA0A 3UVIA 3BO9A 1KBIA 3KZPA 2VMFA 3UJEA 3UXIA 1VIWA 3BJTA 2W67A 2VRKA 2GGHA 4MIMA 1X6NA 1ME9A 5CAHA 4CEXC 4YMZA 4AYGA 3H7RA 4M1BA 2VELA 3W3OA 3LCHA 3PB2A 1J0HA 3RJYA 2X30A 2PC8A 5FOOA 3TUUA 2IPFA 4P61A 4ECLA 4URIA 1DJNA 3LCIA 3A21A 5I3DA 3QPEA 3VGHA 1F73A 1E0XA 2E67A 3PB0A 1FWRA 1IWPA 3UG8A 2Z6IA 4N9DA 1FRBA 5AKQA 2YCLA 3RAOA 4G1NA 4JTEA 4WSHA 4IQJA 1FVPA 3PTQA 3N19B 3ZIZA 1VYSX 5HR7A 4UXDA 2G8ZA 2BXVA 1YPFA 2AGKA 2OO0A 3T4WA 4D8LA 1E1CB 2E1DA 4ZB0A 3DERA 1JCLA 1HP5A 2B7OA 5EY5A 1PEZA 4DELA 3QN3A 5CPQA 3IIOA 4S23A 3W71A 3W9ZA 4PUWA 2OT1A 2PCQA 3L5LA 3AJ7A 1WXZA 2O56A 5AC7A 1TPWA 4RDWA 4GJIA 4ALDA 4LTSA 4TUFA 3PBMA 3UETA 1I0DA 3VDHA 1GHSA 3GUWA 1EJTC 4HPHA 5EMUA 1SMDA 3G8EA 2ZDSA 1FWHC 4PEEA 4CQ8A 4JQAA 8RUCA 4P7OA 4UQ9A 5AC6A 3EOUA 4NZFA 4C7FA 2NW0A 1QUMA 3WLNA 1E5NA 3A3WA 2ZQ0A 3HG2A 4E2VA 1YPIA 3VOGA 4EPKA 1KM1A 4GI9A 4NZ5A 5BZAA 3V0TA 3G1RA 2W5FA 2QCDA 1DBTA 4YVXA 2XIBA 3TN6A 1KXHA 4OOZA 1XIDA 1FHLA 2YA2A 4NG3A 4X60A 5FA5A 3MYPA 4WDTA 3UT0A 4ZQCA 1C9WA 2YLAA 3CB3A 2W4XA 3L68A 3E2QA 2YBVA 2CFFA 4QBXA 4OECA 4KWSA 4L9ZA 3VNJA 1SFJA 3BG9A 1Y7VA 4XAZA 1NWTA 4S3JA 4AF0B 1B0IA 4TV6A 3CZJA 3TYUA 1Z9AA 3QLDA 1IEIA 5FSEC 4L9YA 4KW2A 3IARA 3MTWA 3T4CA 2AQWA 3I68A 4LUSA 3STGA 3WX7A 3C3UA 3BXWA 2WVTA 3E0IA 3FA3A 3OBKA 1PO9A 2R6OA 4KRTA 3CUIA 4O52A 3ABOA 1DYSA 3JUGA 4N42A 4HTYA 4JL2A 1UMLA 4RE2A 1AUSL 3IUDA 4JICA 1IT7A 1YIXA 3R8HA 3CUFA 3GK0A 3GTHA 2CU0A 3MSYA 4MZYA 1UZHA 2BVDA 5HMDA 2W62A 1TV4A 4AU0A 2QMJA 4FA3A 1NFBA 4EAMA 3GH7A 3URAA 1PVNA 3M0XA 5DF0A 4E5TA 5M3WA 1RQBA 1E6ZA 5A3HA 2IKHA 2H3BA 1AG1O 3REQA 6ALDA 1XCWA 2QKFA 1KFCA 4ML9A 3ITGA 4FK9A 3O8AA 3MBFA 1V4YA 2P5NA 3M0YA 1AQMA 2EPKX 4DXKA 2L5HA 4HA3A 1W3JA 5CZJA 2YOCA 3NDYA 1DIDA 3L0KA 2DZBA 2P3EA 4LS0A 2ZUTA 1TJ2A 4H4IA 2VFEA 4QLJA 5I7GA 4H6RA 3CHFA 1VBHA 1GVYA 3L0NA 3P61A 3MVIA 2QMKA 3KBVA 3K8MA 2OQHA 5F2GA 4F0LA 4UTJA 2VD8A 1FWIC 1XC4A 2JKPA 1B3OA 3WMCA 4JX6A 1H3GA 3DECA 2G3IA 1RJQA 4CQBA 2A3BA 1WX0A 3VNKA 2ZA1A 1G6CA 2ZRWA 1HXJA 4XVDA 3BAJA 4IP5A 3VILA 2Q02A 4O4VA 2GVGA 4E8CA 4Q7NA 2B7NA 2WSKA 3L4WA 5F4WA 4K2SA 1QI5A 1UKOA 1XLBA 4GYKA 4F9DA 3HA1A 2HE8A 4CNNA 3VGFA 3VCCA 2WVVB 4V1YA 3LCLA 4L4LA 2TPSA 4FLOA 1EP3A 3NQEA 3S1UA 1U1JA 1QK0A 3UXAA 1L0PA 3S9IA 1VF8A 1R8LA 1XSIA 2F38A 4PB5A 4MVAA 4R27A 4JOMA 5BU9A 5C9ZA 1KQZA 3DHPA 1ZJHA 4Z2KA 1WCGA 5AHFA 2VEPA 3TCEA 3RPDA 4Q8QA 4UTWA 3S47A 4BI7A 2VX5A 4LEQA 1JFXA 3B40A 4ZQNA 2QZRA 6A3HA 4X9SA 2E8ZA 4RCXA 1KM4A 4W88A 1F2JA 1CBGA 1QR7A 5D03A 2ESCA 1HJVA 2BGQA 2NWRA 4AEFA 2FQIA 4CNUA 5F7UA 1Q4WA 3VCRA 4LUTB 1SO3A 2DJLA 4KS0A 3LI0A 4V33A 4NAFA 1NDWA 5EMLA 5LKYA 3PP7A 5A1AA 3HQNA 3RX4A 1CCWB 3G1VA 1SJBA 2ZX5A 2RGLA 2XM1A 1QPNA 4MYAA 3CZLA 4O54A 2VEGA 4MHBA 2QS8A 2GOKA 3DYOA 4LH8A 1FWAC 2GJXB 2GSJA 1LYXA 4Q4PA 1ENUA 2OQYA 4A05A 3EDDA 1BHGA 3DFPA 5BOOA 2RGMA 4EPEC 3ZWSA 4HHHA 5HQLA 3AXXA 4ZXOA 6TAAA 3PJTA 4KBXA 2GGGA 4NU7A 4UFJA 1OGGA 1DP0A 4BHYA 1UASA 4A8IA 3KRBA 3QHNA 5AHMA 4MWAC 4F0HA 1JCNA 3KEHA 1K7FA 5DMMA 3POHA 3SCWA 3K4DA 1UD4A 2X0SA 4IJBA 1MRQA 2Z7GA 1E4IA 3SGGA 2XISA 3P93A 1FKXA 3TR9A 1HKVA 3M0KA 3PULA 4NRRA 1I8JA 4GFSA 4PODA 1W17A 1UW9A 1XKJA 2HISA 3LSCA 2ZZ3A 3N29A 5LXXA 1PB0A 3XISA 1LLWA 2C18A 4M81A 3B9NA 4JYEA 3A4WA 1KFLA 3UNDA 3HFTA 4OQVA 3UG5A 2EKGA 3WL1A 5I23A 1QBAA 2GVLA 7TIMA 2VC7A 1NP2A 1U5JA 4H83A 4YHGA 4DX3A 3S46A 1XQLA 4EE9A 2PB1A 3W7LA 3FW6A 4DBSA 4JN8A 1M6JA 3CO8A 1FWNA 2ISWA 3N12A 1H1NA 2XVNA 4AWTA 3E1F1 3GS6A 2OCZA 1ZALA 2UY5A 3C2EA 3R1ZA 1LQAA 2RAGA 5F4SA 2BS9A 3WEOA 5HJYA 4I8YA 3QKEA 3PK7A 1E4MM 3SY8A 5C9XA 2WZMA 1O5QA 1NOWA 4GINA 4ZFMA 3RLHA 4O13A 1JFHA 3CASA 1DQXA 4UTIA 2EKCA 2PODA 5LYRA 1YDNA 1NQ6A 2R82A 4RE0A 2HS8A 1PKMA 3SFWA 1V0LA 3AAMA 2JFEX 4F40A 4FEZA 4Q8UA 3MHFA 2FGBA 3TXVA 4QQUA 4H04A 3DKLA 4M80A 1R46A 5E0FA 1EWEA 4B90A 3FHQA 1FDJA 3GNPA 4GPNA 1UD2A 4CVWA 1SU5A 5C9WA 2VDGA 5T26A 4WY0B 2WHKA 5DBUA 5IHSA 4HTBA 3AOFA 4HCDA 4S3AA 4C6BA 4WIWA 3GVVA 3GG0A 1ME8A 4IL2A 3QJAA 3L21A 2V8ZA 3N2CA 1KW1A 3W2JA 1YLVA 1E73M 4N9CA 2R1NA 4C6MA 4G8TA 5AHNA 3UJRA 2ANUA 4HBKA 3FA5A 3OO2A 4RPQA 3GUGA 4AZHA 4O1FA 3BMWA 4GZJA 4GFIA 1LWHA 2CLFA 4FR1A 1UKQA 3GVWA 1EJRC 4IPLA 3IANA 3AYTA 3PJXA 3PG9A 3NQDA 3A12A 2PRLA 2D23A 1LOLA 4OTKA 1A3WA 1OFEA 1WPCA 2Y24A 3NQ8A 4UTUA 1RP9A 1ZJIA 2W9MA 4A8RA 4HB7A 1K02A 1GQJA 1EYEA 4W5ZA 4GUIA 4B92A 2NXIA 1IEWA 1XLAA 1JAKA 1E6NA 3WQ4A 1S5NA 4JHOA 4TVUA 3FEMA 1WA3A 3BW4A 5EL1A 1W3TA 1MFUA 4M19A 3R13A 1A5CA 2PWVA 2VZVA 1DJWA 2VWTA 4Z08A 3W7MA 1UKSA 1XIHA 3ATZA 5KINA 2Y7GA 2YCLB 1J5TA 4H19A 2XVGA 3HOJA 1FCVA 1QVBA 4C6JA 2BXZA 5JIWA 1CWYA 2OFJA 3C2VA 1AQHA 1U22A 3K1DA 3GNXA 4K68A 1ZY9A 1WUFA 2PDKA 1RPKA 3QHMA 1XYMA 5LNVA 3SADA 4YL2A 3W7HA 4LAMA 1DKWA 3RRXA 4LT9A 4OV4A 3GLCA 4PBFA 2V2DA 1BFNA 4IPIA 4NRSA 2QPXA 3AC0A 1DJXA 4KCWA 3EOLA 1WKDA 2VX6A 3VD4A 3L65A 3SW6A 1ZBVA 4AX7A 3CO4A 3IJQA 4IMEA 2I5QA 4V2XA 3ERPA 4MFDA 1V3JA 2IXUA 3A9BA 1J6PA 3HBLA 1ZLPA 3NYZA 1CEOA 3DHUA 4DRSA 5XIAA 1KXQA 5DXXA 4AXNA 1KTCA 4IXXA 3LLFA 1FOBA 3PS7A 3NL2A 4R7JA 1S5TA 4DM1A 2WQDA 5DO8A 2D22A 2HROA 3VDCA 2YSWA 1ONWA 4N6FA 5MKGB 3UGRA 2QJJA 3UPBA 5TQLA 4M51A 3W2LA 3B8UA 3ZS4A 1K9FA 2R1PA 1EX1A 3DXIA 2WSYA 4NHVA 1RR2A 4ACYA 1UUMA 2QCDB 3WNNA 3OBAA 1OCNA 4P8UA 1OHLA 3OYXA 3V5FA 5FEPA 3G1SA 4M0XA 3CZ8A 1VFLA 2J74A 4O4WA 1QMLA 1VB9A 3W75A 3VGEA 3CZKA 3F5KA 3MANA 2ZTKA 4O1AA 1VYPX 3OG2A 3QH2A 1EHNA 3WD3A 2PTWA 4LAUA 1VHNA 2Z25A 1T41A 3P6LA 3OTRA 3EBVA 1SW3A 4JQ3A 4Q22A 2FZDA 3EDEA 5AN7A 1TB3A 1Q6EA 2CWXA 2Y8UA 2D0GA 1FWDC 3VNIA 3RM8A 1ZAIA 4H41A 4AUBA 1Q65A 2WBGA 1P0KA 1E6XM 3VDAA 1YHTA 4I7UA 3DG7A 5C6MA 1EDQA 1XI3A 1EC9A 1MNSA 2YFOA 4CNOA 3BV7A 4CN4A 3REQB 2X8RA 2PU0A 1TG7A 3OVRA 1N2VA 3CNYA 1XBZA 3CHVA 4U33A 4WVXA 4B9ZA 1X1NA 3P60A 1W1VA 2OQLA 1GUVA 5D05A 3I3BA 2GUUA 3N34A 1GOOA 3LK6A 2ICSA 1TTPA 3S5SA 4Y8FA 1S3HA 3TZFA 3R58A 2J7BA 4J5NA 4PMDA 3GXTA 2OWCA 1PTGA 5EYWA 1JEZA 2Z4GA 4PMJA 3H8AA 5BNKA 4LS1A 4GXWA 5M1TA 3RLGA 3NQVA 5HAOA 1J2WA 3TTOA 1PTDA 1OWQA 2OOGA 1FCQA 4C6QA 3UBPC 1Q5MA 4QX4A 3M7WA 2XN0A 3LTSA 5A69A 1W1YA 3NZPA 3AISA 3G6MA 2UV8G 3WLOA 1N82A