3PZQA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 with maltose and glycerol
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
molecule tags Hydrolase
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzqA00
1BTCA 1WO2A 4Q22A 2VX6A 1JI1A 1LWHA 3HJEA 4AD0A 4W7WA 3WD3A 2BHYA 4GQQA 5I0DA 2YL9A 3CPUA 1LL6A 4BZYA 2FDMA 2J79A 3RM8A 1OD0A 5BWFA 1MXGA 1H5VA 1UD8A 5DO8A 1L0PA 2PF0A 1OGSA 1FA2A 1Q6CA 3AIVA 5D4YA 1GUVA 3GXMA 2WHLA 2CKSA 2G8ZA 1UR4A 1UH2A 4KMQA 2EQDA 4PCSA 1XV8A 2XSAA 1CXFA 2FHCA 2JIEA 3HU7A 5D8WA 5HDRA 1OB0A 4D6EA 2CHOA 4U33A 4UFIA 3VOCA 1C8XA 5E6YA 2PWDA 1JZ2A 3RM4A 3QOKA 2YDSA 4TVDA 4QLJA 4PMZA 3ARWA 1HX0A 3PTKA 4CGTA 1HL8A 2WCSA 2E8YA 5LA2A 3WQ8A 3AIEA 1JGIA 3ZQ9A 1C3FA 1NWSA 2VL4A 3RILA 1OINA 1QOXA 3ZIZA 1J9YA 2XHYA 3U7VA 1OSEA 2A3BA 2XFRA 3OZPA 1HJSA 4BF7A 2A3EA 2F61A 2BS9A 2E0PA 1W3LA 4X9YA 1JFHA 3CZLA 3I3EA 2VZTA 1UUQA 5CSUA 4PN2A 3VNZA 2VJXA 5EFDA 4P7QA 3FAXA 4N0RA 4ZE5A 4DWSC 3AJ7A 3WUEA 1HVQA 4HMCA 3SUUA 2EPNA 1V6VA 3VM7A 4DM1A 1MXDA 3AXHA 3VD3A 4PBGA 4MAVA 5A3HA 2CBIA 3WBEA 1OWQA 4MADA 1KGXA 4LYQA 2GJRA 3ARVA 1Q6GA 1PX4A 2VZSA 2YL6A 1H41A 3A3HA 2QLYA 1CGWA 3VU2A 1NQ6A 2GDUA 1MVYA 1XGZA 4HZ6A 2AAAA 2A3AA 5A6SA 1GW1A 4W88A 3WMCA 2J7HA 5E0CA 4W87A 1PX8A 1GVIA 2ZX9A 4TUFA 2VVNA 1B3VA 2F8QA 1CXKA 2J62A 3WL1A 2NT1A 5IHRA 2VR4A 2EEXA 3WIJA 2VNCA 1C8YA 1MW3A 4AMCA 2GJPA 2WK2A 3A6OA 2PC8A 1HKMA 2ZUTA 4OIFA 5BXTA 5A69A 2ZUVA 3TTOA 3NYDA 4XUYA 1K9EA 1MQQA 5A1AA 1WE5A 1WNOA 3RJXA 1UR9A 4AZ6A 1R7OA 2YA2A 1E6ZA 1DWHM 1UWTA 3UERA 3EDFA 1VFFA 4QCFA 2VRQA 2C7FA 1UA3A 4UTFA 5CGMA 2V3FA 2JF7A 2WHMA 1H0GA 1W3JA 4V27A 4KH2A 3AMLA 4PMXA 5EFFA 4D1JA 3NJ3A 3L4TA 4PMQA 4FMVA 2J74A 5GNZA 2DIEA 3WEZA 4LX4A 1U2YA 1CPUA 1QI2A 1UD2A 1V3IA 1GOOA 4CD4A 1Z32X 4HZ8A 1PPIA 8A3HA 1H0IA 2D24A 1EA9C 1V3HA 3VGGA 4CN6A 2WMJA 1R7AA 4H8HA 2ZUSA 5I6SA 1LL7A 2Z1SA 2NSXA 3J7HA 3MV01 3WH6A 1UD6A 2WMIA 3KZSA 2DSWA 1VBRA 5A8PA 1FP9A 4U5KA 2VC9A 2BFGA 3BC9A 1DHKA 2XVLA 3K46A 5ABFA 1V02A 3W6LA 1PIGA 1KQZA 3A4XA 2AMGA 1CGTA 1ZU8A 3EMCA 3W37A 2VUYA 1C7TA 2RGLA 1QPKA 5BCAA 2VQTA 3L4WA 1GORA 2WC3A 4HP5A 3QHMA 1J0KA 1DWJM 4AXNA 4J3UA 3T09A 1W2PA 4W8LA 2GFTA 4UZSA 4FLOA 3BH4A 3SCUA 1GCYA 3L4VA 3CTTA 2J4GA 3O2LA 3AHXA 4D1IA 2DPEA 4EANA 4E8DA 2YLAA 2J47A 2WZIA 3UG3A 4OJYA 5D8ZA 1QNQA 3VTRA 4BQ3A 1E40A 1OM0A 2BNJA 5C71A 1UR8A 1XSKA 1V6XA 2J78A 1E6SM 3WH5A 2YDQA 3NSXA 3WQ6A 3QHOA 1V0KA 4OOZA 3SCRA 3KEHA 4BA0A 3GM8A 3POCA 4A4AA 1NWRA 4AZCB 1HJWA 3ARYA 2E9LA 2O9OA 1NH6A 2J7FA 4D6DA 3ALGA 1CXEA 3WF3A 1CXLA 1MYRA 3W27A 3GDBA 2VZVA 3SCPA 3K8MA 4AD5A 2VURA 2CETA 2BHUA 3M07A 2GUYA 4UCFA 4OBRA 1B3YA 4E4PA 3PZ9A 1JDAA 1M03A 1V3MA 3NDYA 3ZSTA 4C7DA 4DWSA 3EDEA 3GBEA 1KXVA 1ZBWA 4NI3A 1SR0A 4TOQA 3FHQA 2DSUA 1JXKA 3VPLA 3GXFA 1DWGM 4CUCA 1CIUA 1WDQA 4JHZA 5CPSA 5A94A 3T0AA 4UOZA 4AD1A 2VOTA 2VX7A 4BS0A 1X6LA 3DECA 5M03A 1MWOA 2QMJA 1DP0A 5BXRA 4UQDA 3AQUA 1XD0A 1AQ0A 4AIUA 3O6AA 1AQMA 1NP2A 2WMGA 4UFMA 4WK9A 4WKHA 1HKIA 5AY7A 1R86A 3U7BA 2XM2A 1E72M 1B3ZA 1C93A 3BAIA 4MAZA 5DT5A 1C7SA 4QDMA 4B15A 2CYGA 1XCWA 3F5JA 5ABHA 3OZOA 1EOMA 2HVMA 1B90A 1U33A 3N12A 4M8UA 3NCOA 5A6MA 2EPOA 3TA9A 4BQ2A 2E40A 4U3AA 1C92A 3SUWA 1L8NA 1LJYA 1WB0A 2XWEA 3PZNA 1R8LA 1E6QM 2E8ZA 3WF1A 3CLWA 4JCLA 3AROA 4PCTA 2E9MA 3ZO9A 3EDDA 1UOKA 2NT0A 1W91A 1NOWA 4RE3A 4CU8A 1HF6A 2DSVA 1FP8A 3DHPA 4W5ZA 3KL5A 1YHTA 2QPSA 3VGHA 2DT3A 2ZWZA 1CEOA 5A6AA 6A3HA 4DUXA 3K4AA 7A3HA 1PEZA 4D6FA 1KWGA 3U5UA 3F4VA 3AIBA 4J7RA 2WAGA 4M82A 4QP0A 5A2CA 3D5HA 3AZTA 1GHSA 3AIWA 2V38A 2XJ7A 1WAWA 2IXVA 2UY3A 4WKFA 2PWGA 4PTMA 1X1NA 2WSKA 4FLSA 3FN9A 3AS2A 1CLXA 5JBDA 1W9PA 1CENA 1MW2A 1Y7VA 2ZUNA 5D9NA 1UQYA 3HMCA 4GO8A 4HOXA 1HJXA 4L4OA 1H49A 2Y5EA 4LYPA 2VR5A 3ZJKA 1UZ1A 1BHGA 3WMBA 4QLLA 2OWWA 1D2KA 4M56A 3MMWA 4GO9A 2DT2A 3PZIA 5BRQA 3WD4A 4ATDA 1TZ7A 2ZOXA 2VMFA 2VQUA 3VM5A 3PN8A 3VMNA 2YOCA 1OCQA 1QHPA 4HA4A 4P8UA 4BQ4A 2F2HA 4XB3A 3QHNA 3VIFA 4JAWA 2V5DA 4JL1A 5A8NA 1TR1A 2EBNA 1W9XA 4MJ2A 4DUVA 2YL8A 1CZ1A 4LYRA 3VIKA 1J01A 3WD2A 3PZMA 3T2PA 1GQIA 3UG5A 5AC5A 1AMYA 3BAWA 4NZCA 3EMZA 4ML4A 5M3WA 1UR2A 3GH7A 2WWCA 3WD1A 1EDQA 5GNXA 3GBDA 1IZKA 2ZX7A 2ESCA 5A8MA 4B9YA 3VD4A 2CCRA 3IANA 1KWKA 1A47A 2ZXDA 4ZEPA 3WDJA 1RPKA 2D22A 2XG9A 2FH8A 3ZJ7A 3W53A 4D6CA 1JZ8A 1W1PA 3AI0A 1WDRA 1UD5A 3WH8A 1PIFA 1CTNA 3WNLA 2PWEA 1RP8A 1D3CA 3VX1A 4JZ5A 2ZXAA 3VD7A 4Z2JA 3SCVA 1UWSA 1V03A 3OBAA 2OYMA 2QMKA 1HL9A 3ZSSA 1E15A 2G41A 1KCKA 3WDQA 4AEEA 3T08A 1UKTA 4TX8A 1JF5A 3PTQA 3N9KA 4ZXLA 3KE0A 1UWIA 2G4FA 3EDKA 1VIWA 1NWUA 3CBWA 3OGSA 1WKYA 1ZBVA 2XSBA 3D3AA 1K6AA 3UCQA 3M7SA 2BVTA 1UWQA 5I77A 4HU0A 1J0ZA 3BAXA 1G0CA 1JZ6A 4H2CA 3WENA 1AVAA 1CDGA 1FHLA 4EK7A 4DUWA 1H1NA 5DF0A 4RE4A 4U31A 3L2LA 5E9AA 1XYFA 1GQKA 5HNNA 1ZBKA 3ARTA 1HKJA 1PBGA 1W9VA 3ECQA 3SCSA 1E6XM 4DWSD 4AZCA 3BSGA 3NUKA 1LQ0A 3WNPA 2D20A 2ZXBA 3L4UA 3N04A 4PTWA 1BYAA 3FW6A 4MJ4A 5FL0A 2ZX8A 1GPFA 1PAMA 3CUGA 1F4AA 4AZBA 1W1VA 4UOQA 1GOKA 1P6WA 5A95A 1E71M 3MANA 2XTKA 5A6BA 3M6DA 1E43A 1FFQA 1E5JA 2X0YA 3VD5A 3CZ8A 2PWFA 3BXWA 4H04A 2J75A 4UFJA 4CD5A 2WLZA 1M7XA 1PZ2A 4U2ZA 3ARRA 2XFFA 3CIVA 4CCCA 1E9LA 3F5LA 5CQ1A 1B3XA 4D6GA 3VGBA 1R87A 1US2A 3AS3A 1VENA 1JZ7A 5TD4A 3MMUA 3WNKA 2MANA 2WPGA 2Y8KA 4UQEA 5F7UA 2W5FA 5D9OA 3ZM8A 1UR0A 4FK9A 2D0GA 2JIWA 3WF2A 2CERA 2JE8A 4GXPA 5CSYA 4J3VA 4AEFA 3T2QA 2BY2A 3OGVA 3SCOA 4E8CA 5CPTA 4HA3A 4OZOA 3RM9A 1Q4NX 4GQRA 2YBTA 5CJ5A 2FHBA 3ZMRA 3GXIA 4OKDA 1M01A 1CNVA 3B9EA 3VIJA 4PUEA 1H4PA 2XIBA 1ITCA 4EKJA 2CEQA 4AWEA 3WY1A 1NOUA 2ZUUA 2OYKA 2YBUA 3N11A 2JALA 3GXDA 1JZ3A 3WELA 1DEDA 2CXGA 2J77A 2W4XA 1FH9A 4AC1X 1SMAA 3FY1A 2OLHA 2BVDA 2IUZA 3G6MA 2PI6A 2ZICA 3OA5A 4IISA 4C7FA 1J11A 3OLEA 4PTVA 1XH1A 4MB5A 1TA3B 4AIEA 3SEPA 3W81A 2OSYA 3WQ5A 4JHOA 3WUFA 4IPNB 4D6HA 4UQAA 3W28A 1ITXA 1JD9A 4W84A 3VMPA 3IAQA 3W24A 1O6IA 2WZEA 3GNPA 5FD0A 4W8AA 1QI3A 1JXJA 3AS0A 4UFKA 1TVPA 1JNEA 1QW8A 4AW7A 1TVNA 4MB1A 2C8NA 1O7AA 1DTUA 1BAGA 2VT0A 5KZ6A 4PMDA 3SUVA 2J7EA 2J25A 1E6NA 2X09A 3WEOA 2DT1A 1WPCA 1BGGA 5I23A 1BYCA 4WJXA 1W3HA 1BVZA 4N42A 3CMJA 3E1F1 1HT6A 3W26A 1CGVA 3ALFA 1W3KA 3EYPA 4UFHA 1LF1A 4HMEA 4W7VA 2DEPA 4GI8A 1VAHA 3AZRA 4ZE4A 4TTUA 3IK2A 2V3GA 3ZT6A 3K1DA 4W5UA 3SCTA 4MNLA 5HOSA 1IZJA 4GZIA 4GI9A 2WNWA 2O9PA 3NSNA 4AZIA 3CGTA 2JEPA 2WSPA 4ATLA 1E0VA 1QBAA 1I1XA 2PWHA 3VMOA 1V0NA 4H8UA 1M04A 5E70A 4TXEA 4JKMA 4H7VA 4PMYA 3VDHA 4BQ5A 1ECEA 4JFSA 4HU8A 3GH4A 3DYPA 4CKQA 1KR1A 4F79A 4NF7A 4RE2A 3OG2A 3PHAA 1E4NA 1V6WA 2VI0A 2G3JA 4AYSA 1B0IA 1VFMA 4PRWA 2WB5A 5LA0A 5A6KA 4LXFA 1ESWA 3CZEA 3RPMA 4AIOA 5HPOA 4FF5A 2EXOA 5FIPA 1KXQA 3FAWA 4U5IA 3AISA 1E73M 3N15A 2EPMX 4PTXA 1JYXA 4QFUA 1E0XA 5FL1A 2V3DA 3SCNA 1QNRA 1HP5A 5JBEA 5CGTA 3VNYA 2X1IA 5JIPA 3EMQA 4X0NA 2Y8VA 3CO4A 1G94A 2VX4A 5HXMA 2UY4A 3VINA 3VDBA 1WZMA 1NP0A 3PBGA 3SIMA 2EJ1A 3MUY1 4YHGA 1FH7A 3T2OA 3WL0A 4PSRA 1WCGA 3WQ4A 2ZIDA 3ZR6A 1W9DM 2QF8A 5C8BB 1EXPA 1KR0A 2DH2A 1XRVA 1IT0A 2C0HA 2UY5A 2ZX5A 2Q8XA 2WBGA 1OBAA 1B30A 1WZKA 3L4ZA 3WNMA 3AYSA 2VZOA 3CUHA 1JDCA 4W8BA 4KGLA 3VGDA 1BLIA 1N82A 3BSHA 5A6BD 1CXIA 1RD6A 4UFLA 1UR1A 3VIGA 3AIQA 3II1A 3KWXA 1B31A 2W61A 1HNYA 2J8FA 1LLOA 2WANA 4M24A 4URIA 2VVSA 4MTVA 1OIFA 5DMYA 1J0IA 1AQHA 1G5AA 1E1FA 4WIWA 1GOQA 3GTNA 3WDPP 3VGEA 1F4HA 2W62A 3VDCA 2WLYA 2E4TA 2NW0A 4UQ9A 4OUEA 1CECA 3PZOA 3A4AA 3MUIA 1K9DA 4ZENA 4W7UA 1OGGA 1TCMA 1TMQA 4XZWA 2E3ZA 1HKKA 1W9UA 5M17A 1ISVA 1V0MA 4UR9A 1BSIA 1JYWA 4PMRA 5CG0A 4GZJA 5I2UA 4H41A 4XX6A 3B8SA 1V6YA 4JFWA 3SUSA 3MSGA 2WWDA 3AICA 3W25A 3ZT7A 3BLKA 3MKKA 3NIYA 5D9MA 1PX3A 3ARUA 4OBSA 2DT0A 2CPUA 1UA7A 1BFNA 1QBBA 2WC4A 1CWYA 2D0FA 1JDDA 2D23A 1UKSA 4QLKA 3K4DA 2ZWYA 3LPFA 3TTSA 3VIIA 3BMWA 4HOZA 1TFVA 2ZUWA 1DWFM 1KB3A 4AD2A 1GJWA 3LPPA 3OLGA 3QR3A 4LGXA 1B2YA 1XHGA 3TTYA 4AZ7A 2BY0A 1KFWA 4M81A 6TAAA 3CHCA 3L2MA 3WDIA 3FXYA 1ISYA 1E1EA 3VO0A 4EAMA 3A47A 3MSDA 4MNKA 2UWFA 5ABGA 2WW5A 2XVGA 1EQCA 2OSXA 2CNCA 2WXDM 2FGLA 3RCNA 1E3XA 4MB3A 1ZJBA 3ARPA 1EHNA 3BCFA 1V3KA 3ZOAA 2W67A 3AZSA 2Y2WA 2G3MA 4WSKA 1TA3A 4DM2A 3I3BA 3T0DA 2WVVB 1W1TA 2OYLA 5DEZA 4W89A 3S2CA 4KWUA 5CLTA 5DT7A 5GPRA 5BROA 1B3WA 1H11A 3GNRA 2XYLA 4QAWA 3QOMA 5EMYA 1VEOA 4HOWA 3MU7A 1OT1A 1QNSA 4Z2HA 3DHUA 1E6PA 4PYSA 3T0BA 2D3LA 3IJ7A 1KBKA 3WD0A 2EO7A 2GK1B 4UQCA 1BG9A 3BMVA 3WEMA 3WDHA 3U5YA 3K8KA 4CCDA 4D6IA 1QHOA 1JF6A 1I75A 3AMDA 2BVYA 2WCAA 2ZXQA 3HN3A 3ZR5A 1MQRA 1FH8A 4EE9A 2GDVA 3F5KA 1J0JA 2VRKA 2J7GA 2VCCA 3CZKA 4ACYA 2G3IA 3LPGA 4P7LA 1QW9A 4IPLA 3THDA 2QV4A 2GJXB 1E5NA 1W9BM 3CMGA 1UH4A 1VBUA 2WBKA 1RP9A 3AMCA 4A3HA 4IM4A 1HP4A 4M80A 5IHSA 1J10A 1NWTA 4ACZB 4PMVA 5JBFA 1GONA 5JIWA 2X2YA 1TG7A 1XSIA 2HISA 1E6RA 4DWSB 1VEMA 4KGJA 4XV0A 1W2VA 1D7FA 5IFPA 5I5RA 1BGAA 2PB1A 3WH9A 3U57A 1UH3A 5AYBA 3NSMA 1V3LA 2RGMA 4CD7A 2XGIA 4P8WA 2VTFA 1JNDA 3MUAA 3N18A 4MPKA 3WNOA 1KCLA 3ZT5A 3THCA 3AHYA 3ZJ6A 3MV11 4JFVA 2DSKA 2CIPA 3POHA 3BLPX 1GZJA 3CZGA 2J7BA 2ZUMA 3VGFA 4JIEA 1BQCA 1M53A 1VFOA 5ECUA 1K9TA 1JAEA 3RIKA 1UQZA 2WCGA 3UR8A 4J3SA 3ARSA 3CHEA 2DIJA 5I24A 5C70A 3GH5A 1TE1A 2YA1A 2J7DA 4L4PA 1VFUA 3UEQA 1SFSA 4R27A 1HJVA 1EIBA 3RJYA 5E0FA 1UD3A 1E70M 1ZB5A 4CD8A 1GVYA 1XCXA 4Z2GA 4HA1A 3WFZA 2D0HA 3CZJA 1Q6FA 2DDXA 2JF6A 5AC4A 1WZAA 4IUGA 2D2OA 4GZEA 3VILA 4S3KA 4P8VA 2XM1A 4UOJA 3WNNA 1J18A 5LA1A 2WVSA 3PZGA 4LQ1A 1V02E 1JG9A 3CUIA 5BXPA 2VX5A 4JKLA 1US3A 5CLWA 4GIAA 2CBUA 3WBAA 4AD4A 1UYQA 3MUZ1 1OT2A 1CLVA 1J0HA 1GQLA 1ZJAA 2XVKA 2WMKA 4NRRA 1SYTA 3WKZA 3TONA 3ARXA 1NOFA 4MB4A 3W38A 1JZ4A 3AS1A 1E4LA 2J8GA 2UY2A 2OSWA 4J27A 1VEPA 3UESA 4Z2IA 3NDZA 5A2BA 1ISWA 5CPQA 3TP4A 3RMEA 1EGZA 3OGRA 4PUDA 3TTQA 1MW1A 1EOKA 2VCBA 2CBVA 2YL5A 3G6LA 5A8OA 2XVNA 2XFYA 1G1YA 1BG4A 2IXUA 1W1YA 1MQPA 2W92A 4F8XA 4U2YA 2EPKX 1EH9A 2O9RA 1IV8A 4AISA 4UQBA 4W86A 3WUGA 3KL0A 2OWCA 1WZLA 3N13A 3AMGA 1LG2A 3N17A 4HZ7A 3CH9A 3BAKA 3EBVA 5GQBA 5IXEA 2D1ZA 4B3KA 1KQYA 1CGXA 3I3DA 4W93A 3SCQA 3TOPA 1JIBA 1VB9A 1HVXA 2ZE0A 3W29A 1ISZA 1CBGA 1VJZA 5EB8A 4TVCA 4CU6A 3S6TA 1EQPA 3BAYA 3ZJ8A 4AZ5A 1JYNA 1B9ZA 1R85A 4WSJA 4PEEA 1KGWA 3RO8A 4H8VA 4HPHA 1GOWA 2CBJA 2TAAA 2BY1A 4TX6A 4YN5A 3PTMA 1OD8A 3A4WA 1HJUA 2A3CA 3IAPA 1UHVA 3W6MA 1TUXA 2XPKA 5EBAA 3CUJA 5I79A 2BXZA 4E2OA 1KBBA 2X8RA 2X05A 4C7GA 5FCZA 1X6NA 4Y7EA 3DC0A 1K9FA 5CXPA 5AYIA 1EDGA 1EHAA 2BXYA 3VUPA 1E4MM 5BXSA 4A3YA 3AHVA 4M29A 2W63A 4JL2A 1FFRA 3WMSA 2BV9A 4AZGA 2DGAA 4OOUA 4P8XA 2PBGA 3OLIA 1BF2A 2VCAA 2G3NA 1VJSA 1JI2A 4U3CA 4Z2KA 1CYGA 4B16A 2WVTA 4MDOA 4MDPA 1ZL1A 1E3ZA 4W85A 1QHZA 2V5CA 1DWIM 2DH3A 2WVVA 1GOMA 1QVBA 3GYCA 3SUTA 4WLCA 5BYWA 1JAKA 5ABEA 1GHRA 3BCDA 2FH6A 2E9BA 1MW0A 3VIHA 4Z2LA 1A3HA 3B9DA 2YDRA 3WUBA 1G9HA 1QNPA 4GI6A 2YIHA 2WKGA 1BYDA 1WP6A 5E6ZA 4QCEA 1KGUA 3VVGA 2GK1A 3W0KA 1HJQA 2WMHA 3AIUA 3AOFA 5FOOA 4M1RA 1JYVA 1XC6A 4TVUA 4F66A 3MS8A 4YPJA 1V08A 5A6LA 1UKPA 4J3TA 2YKKA 4LPCA 1PZ3A 3UR7A 1XYZA 3B9AA 1HIZA 5I78A 2VRJA 1KXTA 2JFEX 4KRUA 3L4YA 1XH2A 4JKKA 3OIHA 3MMDA 4S3JA 3DYMA 1SMDA 1QI0A 4PMOA 2GJXA 5HPCA 2DQXA 2BHZA 2WVUA 4MNMA 4V2XA 3SCWA 4UZUA 2GSJA 2YLLA 5DFAA 1E4IA 4P7RA 1C8QA 1ODUA 3MO4A 2W91A 3WF4A 3IJ9A 4D72A 5BRPA 1LWJA 3APGA 1Q6DA 3WDRA 4AD3A 4HPGA 4ACZA 9CGTA 3JUGA 2OWXA 1GJUA 4CVUA 2WKLA 3OB8A 1C91A 1NM9A 2W66A 1H3GA 4JCMA 3ARZA 3WFLA 3RDKA 4HTYA 6CGTA 2X0HA 3GNOA 4J3XA 4B3LA 3PZVA 4J3WA 2XIIA 2CITA 1V6UA 5FKYA 3VKKA 1U30A 1BYBA 3WF0A 2Y24A 4TTGA 4J28A 4Q7NA 3DYOA 1EDTA 1CGYA 1CXHA 4CVWA 3W4RA 3BGAA 4P7NA 1H2JA 4FLRA 1V3JA 1UKQA 4B9ZA 3L4XA 7CGTA 1GNXA 2GVYA 2ZX6A 4JFTA 2J7CA 3UETA 1MFUA 3AMKA 1WDSA 7TAAA 3SURA 1UG6A 3VIMA 1ZS2A 1UWRA 1BPLB 3LMYA 4ZXOA 2WC7A 3AHZA 5A8QA 5M5DA 1XH0A 1JFXA 5LYRA 1GOIA 1VRXA 3LPOA 1LG1A 2YJQA 2QPUA 3PZTA 4PSPA 2WYSA 3WSUA 1LL4A 4F9DA 2B31A 2WM0A 4HMDA 2WHJA 4UNIA 3WQWA 5HBFA 2WZHA 4PMUA 3VIOA 2CESA 5IFTA 1UWUA 1FOBA 1OIMA 4V28A 4NSBA 1QNOA 1XD1A 3CHDA 3VDAA 1JZ5A 1BVNP 4FLQA 3VX0A 3GZAA 2DSZA 1MFVA 3UG4A 3M46A 4ATWA 3O9NA 2YA0A 1KXHA 1UD4A 1RH9A 3K8LA 1V0LA 1E0WA 1QI4A 4CCEA 4AZHA 2XVPA 3IJ8A 1UKOA 1H09A 2WMFA 2VO5A 3CHFA 2EPLX 1JD7A 2Z1KA 1E55A 3VD9A 1PJ9A 4F9JA 3PZUA 5GNYA 3AXIA 2Y4SA 1DWAM 3QGVA 5I3DA 1JL8A 4XZBA 2FHFA 2D3NA 2WMIB 1ZBCA 1HN1A 4NRSA 3W82A 1I1WA 5IDIA 1EO7A 1HXJA 4ZFMA 5ABFB 2QHAA 4GKLA 3PZQA 1WDPA 2WHKA 4AY1A 2XGBA 4YHEA 3AFBA 3EDJA 3VIPA 3AIRA 8CGTA 1Q6EA 5A2AA 3CUFA 3BAJA 4D71A 1YQ2A 4CD6A 2CHNA 1B1YA 1FHDA 4K68A 1G01A 4CN4A 2XUCA 1EO5A 4X0VA 1ODZA 2XWDA 4P7OA 1W32A 3WN6A 2JEQA 4PMNA 5A6JA 2BY3A 5D9PA 1J0YA 4D6JA 1J12A 4RL3A 4WF7A 5JUVA 5KEZA 1GQJA 3AXXA 1UZ4A 4R5EA 3FNDA 3AYRA 2V3EA 1C90A 2O92A 1QI5A 2O9TA 3AHTA 3FHAA 3ARQA 1XSJA 2CKRA 1NARA 4GINA 1ISXA 2VZUA 1OGBA 5CZKA 2A3HA 4MNJA 4CU7A 4GPNA 3OLDA 4CN1A 1E56A 1S46A 2AOSA 4KRTA 1VF8A 4BCEA 4JFUA 3WH7A 2PBOA 2FGZA 3N1AA 5E09A 1CGUA 3WQVA 4WKAA 3KL3A
chains in the Genus database with same CATH superfamily
3RNDA 4Q22A 4PEKA 1JI1A 1VC4A 3HJEA 4MF4A 4W7WA 3M5ZA 1NDYA 4FOJA 2YXOA 3A22A 3P5YA 1LL6A 2XH2A 2J79A 3W7JA 3VNMA 2XIMA 1F61A 2WJEA 3WK3A 1M6JA 2WHLA 1UR3M 3NQBA 2NV9A 3NQGA 2JIEA 3HU7A 5D8WA 2Y7GA 4U33A 2Z7GA 4AXKA 4B2DA 1JZ2A 3QOKA 2ZRXA 4TVDA 3XINA 5B7ZA 3G1FA 4QLJA 2RJHA 3KLLA 3WLNA 3KCLA 1F9CA 4GOAA 2E8YA 5LA2A 1HKWA 1PWMA 1TV5A 1JGIA 4GCAA 4MJZA 1OINA 3E12A 1J9YA 1L6WA 1LRQA 2XHYA 2R8WA 2A3BA 1F8MA 4L1XA 5ABTA 2X2GA 1XLMA 5KMYA 2E0PA 1W3LA 1JFHA 3I3EA 2E6DA 5CSUA 4GVIA 4P7QA 3SI9A 4NG3A 3AJ7A 1G67A 2PDBA 1UP2A 4PCNA 3VM7A 4PBGA 3NVTA 5A3HA 1TJ2A 2VEPA 4MADA 1TRDA 1LQAA 3A21A 3E38A 1BKHA 1Q6GA 2VZSA 3A3HA 1H41A 1AH3A 4S3EA 4XD5A 3GQYA 3GY1A 2GDUA 1H7RA 3HQOA 1VHCA 1ZFJA 4HZ6A 2AAAA 4GUGA 2FGBA 4GYPC 2PWVA 1FY6A 1Q6QA 4W87A 1L8PA 2KAUC 3KBNA 3LGDA 1VBGA 1GVIA 1HG3A 4I9AA 2ZX9A 2PD9A 3HG4A 3WL1A 2I1OA 5IHRA 2EEXA 1Q5MA 5G2HA 2OQLA 1MW3A 4AMCA 1T7LA 1EWEA 4MIMA 3GFYA 5CPNA 3S1WA 2VP8A 3DENA 3DZ1A 2GJNA 4DBEA 1MQQA 5C9RA 3H24A 3RJXA 3TCSA 5CC6A 1UR9A 2NUXA 4AZ6A 1PTGA 7PTDA 2YA2A 4FEZA 3B06A 2X7WA 1DWHM 4LWWA 4QCFA 1UA3A 2JF7A 1RJRA 3LI0A 2WHMA 1H0GA 3DG6A 4GVFA 1I45A 3AMLA 5EFFA 3LMZA 4D1JA 6XIMA 2HDJA 2J74A 4LX4A 3TK7A 4GG9A 1CPUA 1UD2A 3NDOA 1V3IA 1UIOA 5CZ0A 1XLJA 1PPIA 2OT1A 4BJHA 1DORA 1VLIA 1VJIA 4CN6A 1W31A 5PTDA 5LIKX 5I6SA 1LL7A 4MYAA 3HPSA 2A7NA 2Z1SA 1AW5A 2INFA 4DPQA 2OZTA 3J7HA 3MV01 3SSZA 3RX4A 2DSWA 1Z3NA 4U5KA 3PUEA 2BFGA 2IKJA 2XVLA 3DESA 5AHNA 1V02A 3W6LA 3P5ZA 4WD0A 1CGTA 2WC3A 1DWJM 4UTTA 4J3UA 2PS2A 2E6YA 3URAA 4W8LA 3CAVA 2PDJA 2GFTA 3C4UA 4YTSA 3CMFA 3PR2A 1ADOA 3O2LA 3AHXA 4D1IA 2VC7A 2J47A 3GU2A 1LUCB 2Z2UA 4OJYA 1EKOA 5K2ZA 4S23A 3INPA 4O18A 1E40A 2I17A 4TR9A 3JVAA 1UR8A 1V6XA 2J78A 4MM1A 3VYLA 4QAIA 2DZAA 4IL0A 3WQ6A 3HG3A 3EKGA 3SCRA 3KEHA 4EPKA 1OFPA 4EXAA 4AZCB 3GUGA 1HJWA 2R24A 2O9OA 2J7FA 3ALGA 3H2OA 1NFPA 1AD4A 4GABA 1A3WA 3W27A 3R7MA 1EXBA 3GDBA 2VZVA 4AX6A 1O5QA 1PHWA 3K8MA 4M6QA 1U5HA 4IJCA 4OV9A 3WQDA 3N6JA 5CBJA 4DI8A 1JDAA 2PODA 2PU1A 2DY3A 3NDYA 3H22A 1XIIA 3E02A 3EPOA 3LI1A 3FHQA 2DSUA 2JK2A 3NPXA 4H9TA 3UA3A 4ZL1A 2QUUA 5C0QA 4UOZA 3GK0A 2VX7A 3H12A 3MP3A 2VOMA 5CC3A 1MWOA 1DP0A 5F1UA 3U6WA 1XQLA 4JNZA 5BXRA 4FR6A 1RV8A 3O6AA 4GYPA 5FF3A 1AQMA 3LERA 4UFMA 4WOZA 4RLIA 1OF6A 5AY7A 1W3IA 4Z0JA 5DCEA 1R86A 3DGBA 1A5OC 3SGZA 1G4EA 2XM2A 1HQTA 1E72M 3OZMA 3FX4A 1C93A 3NQEA 1G69A 4HNOA 5I7GA 5DT5A 4M3PA 2CYGA 3PB0A 2EHHA 1Q6RA 3F5JA 4HU3A 3TC6A 1KFEA 1B90A 4ERIA 3N12A 4R53A 1QCWA 3KBJA 3UY7A 3VCNA 4A29A 5A6MA 4IFKA 3N2XA 1VD6A 3FDGA 3WMLA 1KTBA 1WAUA 1WB0A 2XWEA 4ADTA 3PZNA 2J9ZA 1S2UA 1R8LA 3NM1A 2PLMA 4JCLA 4WOQA 3WF1A 1XYMA 4O12A 1W91A 1IXQA 3N4EA 1HF6A 4KT2A 2DSVA 3KBMA 3LX9A 4W5ZA 2BG5A 2QPSA 3VGHA 2DT3A 6A3HA 1SFLA 2XISA 4HYRA 3FJ6A 1KWGA 3U5UA 4ONVA 5G4HC 1JPKA 7REQB 4IQLA 4JPGA 3AZTA 3TQPA 4NP7A 4FOUA 3W1AA 4GC4A 3GG0A 2OLAA 2OQHA 2V38A 4O1BA 2PMQA 2IXVA 2PWGA 1OX6A 3B3DA 1TV7A 1FWBC 1W9PA 2DZUA 2Y62A 4R34A 1HKVA 1F5ZA 1H51A 1W8SA 2PDQA 5I00A 1S5MA 1HJXA 4L4OA 2Y5EA 4AG0A 4IZGA 3DN5A 3M0HA 4HGXA 3A23A 4WUIA 2O7SA 4IHCA 2B4GA 1S5NA 1IXPA 3CWOX 3LK6A 2QXWA 1NSJA 2WKJA 1TZ7A 2VQUA 3HPZA 4L1WA 4K36A 2OEMA 2YCEA 3T78A 5G1YA 2L5HA 3OP2A 3NL2A 1X6UA 3OYXA 1CZ1A 4LYRA 3VIKA 4C6FA 3O6YX 5K4XA 1XLDA 2VFDA 3EEZA 4N9BA 4F2TA 4NZCA 3EMZA 4ML4A 2HRWA 3GH7A 3RLGA 1QASA 2C1HA 2ZX7A 1PWLA 3VD4A 2BDQA 3PFRA 3IANA 3IJLA 1KWKA 3UJRA 4CQ8A 4ZEPA 1RPKA 4O8AA 5DRIA 2PTDA 3UXLA 2XG9A 4FOKA 5HNUA 3S5ZA 2FB2A 4Y96A 4B5XA 4IMEA 5D38A 3WNLA 2PWEA 1RP8A 3HJZA 5CPLA 4JZ5A 3H2FA 4UMCA 4BWLC 1V03A 3TR2A 3E74A 1I60A 3QY8A 5TF0A 4ZQRA 1TWSA 5BOFA 2V67A 1KCKA 3WDQA 1U1JA 4J2PA 3T08A 1VBJA 3OODA 4Y9OA 4ZXLA 2G4FA 1TRIA 3EDKA 3LHUA 1EIXA 1NWUA 4NNAA 2XSBA 4IH3A 3UCQA 2J24A 4H9UA 5K9CA 3WK0A 5AHFA 3LRKA 1UWQA 4AHQA 4IQJA 1LUCA 4WY0B 3FA5A 4H2CA 5HMSA 3TYZA 1RUSA 2HV5A 4HYVA 2POZA 4DUWA 4RV3A 3UZWA 3UWQA 4WJ8A 1XYFA 2VEKA 3HGJA 1KBLA 3LQLA 4EXBA 3MVIA 2QCMA 3ZVHB 3HPFA 3OHIA 1JGMA 4DWSD 4AZCA 3FIGA 3KOFA 3PJTA 2Q01A 1LQ0A 4ZO8A 4XQ6A 4L80A 2ZXBA 4LY8A 1R3TA 1EYWA 4C6DA 4PTWA 3C0QA 4R9OA 3QYSA 4FXJA 3U9IA 2CLPA 3OU8A 3CUGA 3O0KA 4H8NA 2CZFA 1W1VA 3ZFHA 3K13A 4HNCA 1JCJA 1GVFA 3MANA 5DLCA 3KDNA 1WUFA 1E5JA 3VD5A 2PWFA 3TIMA 2J75A 2WLZA 1PZ2A 1S3TC 4U2ZA 3V0UA 1PSCA 1U1UA 5IBXA 1E9LA 5CQ1A 1EBHA 4D6GA 1DE6A 2WQPA 1R87A 1E0UA 5TD4A 4ZB0A 3QZEA 2W5FA 3T8QA 3ZM8A 1R2TA 1UR0A 1IE7C 2D0GA 1EP3A 3WF2A 2CERA 3ONCA 1IR1A 3IUDA 4J3VA 3T2QA 1JPIA 4HA3A 4PBEA 4GQRA 2YBTA 3C2VA 3ZMRA 1YDOA 3P84A 4I8YA 1M01A 2X16A 4IJRA 1DJHA 1H4PA 3IRDA 1XKJA 1ITCA 4EKJA 4WXZA 2P1FA 1NOUA 2ZUUA 2JKAA 2OYKA 2Z24A 2JALA 1DEDA 2J77A 1H1ZA 3CL6A 4AC1X 3PULA 3CQHA 1NAL1 3WJWA 2BVDA 3DFTA 1LTDA 4OHQA 4QIUA 4Q8NA 2KZHA 4LUJA 1QK0A 3N4FA 2J9YA 4R7WA 3BG3A 4MB5A 3F1QA 2C1IA 4IPNB 1FDJA 4UQAA 3W28A 1ITXA 3RO6A 4L6DA 2HEJA 4O0ZA 3CT7A 2JKPA 3DXIA 3GNPA 2GDQA 1JCLA 1QI3A 3G1SA 3OBKA 3WBWA 4GYJA 4DJDA 2WNNA 4MB1A 1O7AA 2B7NA 4JN6A 1DTUA 1BAGA 4ICMA 1ZGDA 2HJPA 3ABOA 3SUVA 2J7EA 5BRBA 5FEZA 1A5BA 3GXTA 3KLKA 2V0TA 2PUZA 4Q4PA 4WJXA 4RNIA 3CMJA 1HT6A 2HVOA 1AUSL 1CGVA 3W26A 3ALFA 4GA8A 4FZIA 3BUVA 3IARA 4QSFA 1TPFA 4ROQA 4GI8A 4DZ5A 2REQA 2PDXA 2GGEA 4MNLA 4GZIA 5C55A 4C6IA 4Q6XA 4O8RA 3NSNA 1E0VA 2DZBA 3VMOA 3IRSA 4H8UA 4I5UA 2A1YA 3TXVA 1JUBA 3NVDA 2ADAA 1G4TA 4JKMA 4BQ5A 3B8UA 1UUOA 4JFSA 3OG3A 4KWSA 3DYPA 3TE9A 4F79A 4RE2A 1W1ZA 2ZCGA 4AMAA 2D2HA 4AYSA 3UP8A 1VFMA 4X9SA 4QITA 1ESWA 5DX7A 4S2CA 4ZMGA 1TMLA 3RPMA 3SRKA 4AIOA 1SJAA 1KXQA 3AISA 3P67A 2C6QA 1A50A 3N15A 3JS3A 2Q71A 3VZZA 1RQEA 3N3MA 1JYXA 5T9CE 1E0XA 2FZBA 3IGUA 4DZIA 2V3DA 4JTIA 3N4AA 3SCNA 3W74A 1HP5A 5CGTA 4GKTA 2X1IA 3NAVA 1PCWA 4X0NA 2Y8VA 3DFYA 4AUBA 3CO4A 1G94A 1JPDX 1VQTA 2ISFA 4M1BA 1KBJA 4I5XA 3WLPA 2EJ1A 3MUY1 4DJEC 4Y2WA 1XLGA 4Q8QA 3MKVA 4CNTA 1QPQA 1IYXA 1WCGA 3G0SA 4WY0A 2D69A 1XRVA 2Q8XA 1TIWA 1MEWA 3AYSA 2VZOA 3KW3A 2XIQA 5DY2A 2DW6A 4KRZA 4YWIA 1BLIA 3U4FA 2PF8A 3AAMA 4UFLA 3PJUA 3ZVHA 1BXBA 3II1A 1EUNA 3DI0A 3USBA 1Y5WA 1HNYA 2WANA 4QR6A 4R88A 2QIIA 1LOLA 2P0IA 2VVSA 3WG6A 3M41A 5DMYA 1AQHA 1G5AA 4IGNA 2XGZA 1GOQA 3GTNA 3WDPP 1SSGA 4S2BA 2W62A 2WLYA 2NW0A 4UQ9A 1P48A 4PCPA 3PSWA 1EX5A 3MUIA 4LF2A 2F38A 1D9EA 1FWFC 1OGGA 3QC0A 3W02A 4XAGA 1HKKA 1W9UA 1V0MA 4UR7A 1BSIA 1JYWA 5DELA 4PMRA 3NZPA 2XH4A 3FEQA 1GW9A 3R43A 5I2UA 3DKLA 1T8QA 3B8TA 1QAPA 3SUSA 3GVGA 1K7XA 2WWDA 1MDLA 3AICA 2IW0A 3SAZA 4ZB2A 3B4UA 3ARUA 4ZBCA 4OBSA 3MUCA 3IIOA 3VKCA 2CPUA 3NGFA 4V15A 1A5SA 2P53A 1RBAA 4X63A 2WSRA 3EKLA 4MG4A 3VE9A 5C54A 1VYRA 4NX0A 3FJ4A 4EWND 3QBUA 3VIIA 3ITLA 4HOZA 2ZA2A 3FJLA 2XN1A 1FX6A 5CJMA 4O15A 2BY0A 4CCZA 3L2MA 4DLMA 3FXYA 1IEIA 2QAFA 3VO0A 2I9EA 3MSDA 2ZADA 2QUMA 2UWFA 4E5TA 3C2RA 1O95A 1EQCA 2WXDM 5FF0A 1E3XA 4MB3A 2Y85A 1V7AA 1UASA 2W67A 1Z89A 1QW7A 4XK2A 1W1B1 3BMXA 4S3CA 3LUTA 4Y9NA 1GOXA 1JRCA 4DM2A 2ISWA 3I3BA 4IG2B 3T0DA 1UC4A 2VYOA 3C3NA 4W89A 5CLTA 3QEZA 5BROA 1K7EA 3S9IA 4I9JA 3EX1A 4RR4A 2Z1BA 4C1LA 1A0EA 1OT1A 4Z2HA 3ATYA 1KBKA 3C0JA 3UNDA 2OR2A 3RFAA 4TX9A 2QULA 2CLMA 2R1NA 2GOUA 4XZLX 1XIGA 1R3QA 4FX7A 4JYFA 3T4WA 1G7UA 3W84A 3PPCA 4MZ8A 1JF6A 4Q4KA 2ZQ0A 4TV6A 3HN3A 5HULA 3ZR5A 1KM0A 1FH8A 1Q6LA 3KCOA 3LNPA 3SRFA 3F5KA 4LYKA 2VRKA 2VCCA 3ZWSA 2A85A 3SB0A 1QW9A 2GJXB 1E5NA 1W9BM 2P8CA 3CMGA 1VBUA 3AMCA 1BRLA 1F3EA 4DJFD 1I9CB 1OFDA 4YVXA 2PGWA 5JBFA 1XBXA 3BLEA 3L23A 3UFYA 1A5LC 1XSIA 4RX0A 4DWSB 4LS1A 4G6CA 4I3GA 1W2VA 3R0UA 1D7FA 5I5RA 1LZOA 3NOYA 3TFXA 1V3LA 2PDFA 1H1YA 2TYSA 2XGIA 4O0KA 3W7EA 3LD5A 3QQ0A 4F40A 2H6RA 3WNOA 1KCLA 1O60A 1VCVA 3AHYA 3ZJ6A 4JFVA 2CIPA 3ATZA 3CZGA 4RUBA 2TODA 3L5AA 3VGFA 1XQKA 2ANUA 3F4CA 5ECUA 4EPBC 2HNEA 4GUIA 1YXCA 2EF9A 1QR7A 3CHEA 4WZHA 1R9YA 1XM3A 4JTHA 4A8RA 3BK0A 1HJVA 4Z1YA 1EIBA 4ZSUA 5E0FA 1E70M 3E9AA 3UZ5A 2YCLA 3MO7A 4CD8A 4Z2GA 4KIRA 4HJWA 3WFZA 3MW7A 1TPWA 4QS6A 7ENLA 1A5NC 3S1VA 4V33A 1WZAA 2F6XA 3VILA 4RW5A 1Q3NA 2DUAA 3OVRA 4UOJA 3UQNA 5LA1A 2WVSA 1LWIA 4CNSA 2VX5A 5CLWA 3GIPA 1EEXA 1X1ZA 1TZZA 3MUZ1 4Y90A 1CLVA 4K7VA 1J0HA 4V1XA 2Y6ZA 4JTAA 2XVKA 4LNYA 4NRRA 4O16A 1EJTC 3AS1A 1E4LA 3TU9A 2UY2A 3F2CA 5LIUX 3THUA 1VYSX 1ISWA 1OX4B 1VRDA 4N7QA 2X1UA 1GWJA 3V5OA 5CPQA 4LT9A 4HB7A 1C8VA 1PKYA 2HS8A 3K2GA 1NDWA 3T07A 5HAOA 3Q37A 2YL5A 3G6LA 1K4HA 4KCUA 7ODCA 4CNOA 4A2SA 5LGXA 4RDYA 3LU2A 3N2MA 1MQPA 4LAOA 1S3HA 1TPH1 1GYMA 2OLSA 5FJOA 3R25A 3LQGA 5I09A 3CL7A 3N17A 3DG7A 3S1GA 5K4ZA 1R3SA 4M7SA 3SFKA 4PRTA 5IXEA 4B3KA 1KQYA 1CGXA 3CPRA 3W7QA 3TOPA 1JCYA 3HTWA 5CJNA 2QZRA 4JIHA 4RZ6A 1ISZA 1YDVA 5T26A 1VJZA 1JUEA 4CU6A 3S6TA 1EQPA 2PTYA 3ZJ8A 4DO4A 1B9ZA 2HTMA 1KM6A 4JXCA 1OCNA 4DI9A 2F6UA 3LN3A 3Q94A 4HPHA 1GOWA 3T6CA 5EGRA 4JGDA 2FPYA 2CBJA 4GE8A 4YN5A 3PTMA 4QISA 3IAPA 3QMRA 1FWEC 4GFIA 1UHVA 2V2HA 1TWDA 1TUXA 4Z0SA 2XPKA 2DFAA 3CUJA 4LEQA 2INEA 1IWAA 4E2OA 1KBBA 4DN1A 3O6DA 2X05A 4C7GA 5FCZA 5CZJA 2GUBA 2CWNA 3H2EA 2PFHA 1RBLA 5AYIA 1EHAA 5AHEA 1E4MM 1KFBA 4PUKA 4MFDA 4GJ1A 3QVQA 3L66A 4UUIA 4ZO7A 2X1SA 2WOQA 4B3ZA 2PBGA 1GVEA 2FVKA 1X39A 2G3NA 4MWAD 2OGYA 1P0NA 1N8FA 3HPAA 4Z2KA 3VNLA 4MDPA 4BEUA 1ZL1A 1E3ZA 4OV4A 3GAKA 2FPVA 3DBPA 2DH3A 4IG2A 3GD6A 4L9ZA 4WLCA 5BYWA 3BCDA 2FH6A 2E9BA 1XI3A 3I4EA 2WZTA 3B9DA 3HB9A 5D33A 1BTMA 3WUBA 3RLHA 2YIHA 1BYDA 4O1EA 4QCEA 2HBVA 3W0KA 4F0LA 1HJQA 2WMHA 3AIUA 4M1RA 3WCZA 4FAMA 4YPJA 4HCLA 4JTGA 4DXVA 1LP6A 1TWZA 1XUUA 3B9AA 3CJPA 1PKMA 3UBPC 5JH2A 4YS1A 3OVQA 3MDUA 3SN0A 3L4YA 5AC7A 5F4WA 4JQ2A 3MMDA 4PMOA 2EGZA 2GJXA 2WVUA 4V2XA 3SCWA 2E1DA 2YLLA 3ANVA 5DFAA 1XYAA 2NQJA 1ODUA 2QJNA 3APGA 1Q6DA 2YXGA 3WDRA 3GVWA 3JU2A 4JIQA 4CQAA 4GUJA 3SR7A 1ALDA 2WKLA 2XZ7A 3CQKA 2W66A 1HL2A 1IGWA 3LHYA 4A2RA 4O10A 4F0HA 4JTJA 1XINA 3RDKA 5J04A 2V82A 1EB3A 3CEPA 3GNOA 3IJDA 3DOPA 3VKKA 4US5D 3DYOA 1EDTA 1ITUA 2FZ9A 1XYLA 4XKYB 4PUUA 4H9XA 4CVWA 4YMZA 2FZMA 1V3JA 1UKQA 3BJSA 3L4XA 3UCCA 3SIZA 5LXEA 3GW0A 4ML9A 3GX9A 3ABSA 2GVYA 4PRRA 2OVLA 4DNHA 3GVQA 2SFPA 1T40A 1RQBA 1WKDA 3V0TA 3I7SA 3R6IA 1SGJA 1XH0A 4GVHA 5M2FX 3IV3A 3LPOA 3MCNA 2BBFA 2QPUA 3TQKA 3W1LA 3VKDA 4PSPA 3WSUA 2TPSA 4AWSA 2C1GA 3FFSA 2WM0A 5HBFA 3MCMA 4RE0A 3GTIA 4PMUA 3DU0A 3VIOA 1KM1A 3TWAA 5IFTA 3A9BA 3BANA 3MZ2A 3BG9A 2FQIA 1VCGA 3OYZA 3VDAA 1JZ5A 1BVNP 3VX0A 4WY0F 3MKCA 1XXXA 3O9NA 4HT3A 1RH9A 3BW4A 3MBFA 3K8LA 4AZHA 1JDFA 1MO0A 2XVPA 1OG0A 1OX4A 3MMTA 4JTUA 3IIVA 1XPYA 3D47A 1JD7A 1E55A 1TJ0A 4N6EA 4YIWA 5GNYA 4BKNA 5BMXA 1GPWA 1DWAM 3VKAA 1TUFA 1NFBA 3QM3A 2FZDA 3V3WA 1EC7A 4ZOAA 3S5SA 4D9PA 1HN1A 2GJLA 4GD0A 2R1KA 4JY8A 4C6OA 1EO7A 1PHQA 2XINA 4ZFMA 3MY9A 3M0VA 1LM1A 2R94A 5DCBA 1WDPA 2WHKA 2XGBA 3V0SA 4UNKA 5EKYA 1IXNA 3AIRA 1Z41A 2OG9A 8CGTA 4PL1A 5EYWA 4D71A 2W9MA 2X1TA 1FHDA 4I9MA 1G01A 2XN2A 5A5WA 1ZZMA 3RLVA 3E2SA 3G0UA 4KF1A 4AY7A 2XWDA 3N6HA 4P7OA 3GTFA 1YPXA 4JY9A 5H91A 5BNKA 5D9PA 3PUOA 3QZAA 3ERPA 3UVIA 1G4PA 3L67A 1J12A 1MUMA 3EWUA 5JUVA 4FP1A 4QBXA 3FS2A 1AQFA 4KEUA 1JPHA 4RNHA 3GS6A 2LLEA 3TAOA 3MWAA 1WXJA 2VZUA 2A3HA 1MMFA 3OLDA 4CN1A 1E56A 1S46A 3W72A 1R3YA 4FIQA 3BCJA 4JFUA 4FX8A 5L6UA 3RR1A 1EFZA 3CAKA 3N1AA 4AWTA 1CCWB 5E09A 2FHBA 3KL3A 2BGQA 1BTCA 2PRMA 2AMXA 4O57A 4GRSA 2BHYA 2AAMA 5I0DA 2YL9A 3AJXA 5LZLA 4BZYA 4M0XA 1IGSA 2FDMA 3WLQA 4DEFA 3CLMA 2CC0A 5BWFA 2JGYA 4GZ7A 4A21A 1XBZA 1H5VA 2CLOA 1O94A 4DXXA 2PF0A 4X61A 1BXCA 4A3RA 1Q6CA 1YDYA 1YPFA 5TIMA 3LLXA 3GXMA 2W6RA 2CKSA 3ID7A 1EPXA 1OK4A 4X3ZA 1XFCA 4QG9A 3MWCA 3UY8A 1PE1A 1DIDA 1W0MA 3RG6A 2CHOA 3GWQA 4UFIA 4UTWC 1ICSA 4QX4A 2PWDA 2PGRA 4NNCA 4UTIA 3HGSA 4PMZA 1F3WA 1GEHA 3ARWA 1HL8A 4Q6JA 1K8CA 3WQ8A 3AIEA 3ZQ9A 4K37A 1C3FA 3RILA 3P0WA 1OSEA 3OZPA 1HJSA 2F61A 3ORWA 2BS9A 2PDWA 3ABRA 2VJXA 4LAUA 5EFDA 1TSIA 1R3RA 1FCUA 1HVQA 2IQ0A 1V6VA 1MXDA 3VD3A 4O52A 2CBIA 3H53A 3NXFA 3EA2A 3EPMA 1XLIA 2I14A 2YL6A 5G2WA 3OQ8A 2QLYA 3KHJA 3VU2A 1V5XA 1NQ6A 3ZXWA 4J2MA 4OECA 4ZR8A 4EPDC 2A3AA 4OWGA 5A6SA 1GW1A 3RITA 3WMCA 3KRBA 2J7HA 5E0CA 1J6PA 3M5XA 1O1ZA 3E5PA 3NFUA 1PX8A 3U2EA 3LG3A 1GG1A 4IXHA 1SO5A 4TUFA 1RY0A 4ECLA 2F8QA 1CXKA 4MLJA 3NZ1A 2F84A 2BGSA 3CYJA 3MHGA 3WIJA 2VNCA 2DUZA 1C8YA 1AJZA 1IF2A 3NURA 1HKMA 2ZUTA 2Q8ZA 5A69A 4O1CA 1P0EA 2ZUVA 1EP2A 1A5MC 1CW2A 2QS8A 1JDEA 1K9EA 3O05A 1WE5A 4L1GA 2NX3A 1P0KA 5HJXA 1R7OA 1EPVA 4DY1A 5D37A 4WDUA 1FWIC 1XRTA 3PUGA 3GW3A 2A4AA 4DQWA 1AK5A 4B92A 2FJUB 5KETA 4V27A 4KH2A 3TYDA 3P8IA 3NJ3A 4C6BA 3VC5A 4PMQA 4FMVA 4JTRA 2GWGA 3N29A 3TYAA 4HN4A 1U2YA 1QI2A 4Q8WA 1GOOA 3S6DA 2PP3A 1Z32X 5B7YA 4HZ8A 1ZQ5A 8A3HA 3F2DA 5CPOA 1EA9C 2Z2AA 3CL8A 1PYFA 2OO0A 1V3HA 5HATA 2FLIA 1A0DA 1R7AA 2PTWA 1REQB 4HD5A 5D2YA 4A8NA 3SQLA 3WO8A 2NV2A 4GJJA 4QGCA 2NSXA 2OGJA 4KWOA 5AHMA 3KZSA 1E1CB 1VBRA 4M5PA 1FP9A 1OQFA 3ZLFA 1PIGA 1KQZA 1XCFA 2G50A 2IPFA 1UIPA 2R1LA 3EMCA 5BCAA 1EP1A 2PDLA 1GORA 1A5AA 4E2BA 1J0KA 1XC4A 4AXNA 3LRMA 3MHFA 4UZSA 4X60A 3EWXA 3EZ4A 1GCYA 3L4VA 4IXXA 3CTTA 1YE4A 1RLCL 4H19A 3W7HA 3MYPA 2YLAA 2WZIA 3CK5A 3NR0A 1TWWA 3UR2A 5D8ZA 4DBDA 4BQ3A 2WNQA 3S47A 4DJFA 4Y9AA 4UTWA 4TIMA 1W6TA 1NJJA 4RCXA 4OOZA 4BA0A 3QQWA 3POCA 4A4AA 1ONEA 1NWRA 2PDIA 3MP4A 4A6GA 1NH6A 1CXEA 3PBUA 1M7OA 3FYOA 4L6HA 2VDHA 3QLDA 3R2GA 4Q33A 4PB5A 4H6QA 4LV9A 2CETA 2BHUA 2GUYA 4QG8A 4UCFA 4IMCA 4E4PA 1A53A 4NXSA 3N73A 3TLLA 3O63A 1V3MA 3ZSTA 4C7DA 5DANA 3GBEA 3ONBA 1SR0A 5LKYA 1EGVA 1AJ0A 3S46A 1JXKA 3GXFA 3GG8A 1DJXA 1TQJA 4B2DD 4CUCA 4X22A 1HO1A 5A8GA 1WDQA 4ZFCA 2Y7EA 3NQVA 5A94A 2YR1A 3PK7A 3T0AA 8XIMA 1Y8BA 4BS0A 2QMJA 1K3UA 2W79A 4GLEA 4OBTA 3KRSA 3UG8A 5I06A 3NQMA 4AIUA 1TPVA 3SQMA 4QNEA 4XO7A 4WKHA 3KTCA 1P0DA 4ALDA 1ADDA 3U7BA 4I6KA 3BAIA 3O3RA 4IGHA 1VFHA 3GYEA 3KUMA 1S1PA 4GUFA 5ABHA 3OZOA 5I3JA 2FMOA 4OE7A 2PRLA 4PGLA 2YDAA 3NCOA 2GOKA 2EPOA 3LLFA 1IHIA 2OZ0A 2E40A 2ZKMX 3R94A 1C92A 2ZVRA 3SUWA 3TN3A 1L8NA 4Q4SA 3PVFA 4E4FA 2E68A 1AH4A 4EXQA 1E6QM 1WBHA 2E8ZA 3MB9A 3CLWA 2PPGA 3QFEA 1UOKA 3MI3A 3P81A 4ZQOA 4LUSB 4RE3A 3MHUA 3O07A 4FNSA 1L2QA 1MRQA 3TW6A 3TZNA 5A6AA 4RZ5A 3CTLA 4DUXA 2ZTKA 3F4VA 3AIBA 1C9DA 2GGHA 3FKKA 4NNBA 3PWGA 4JN7A 1XISA 4QP0A 5LHEA 2E6AA 5CAKA 4DBUA 2XJ7A 5J5DA 2UY3A 4HSOA 4ZVJA 3I10A 4FLSA 1LBMA 5JBDA 2QJGA 4Y8FA 3KP1A 5U7SA 2ZUNA 1FWGC 3LCIA 3O06A 3HMCA 5G1TA 2VUNA 2YCJA 1GVQA 1DOSA 2VR5A 1UZ1A 4I8DA 4C6LA 1ME8A 2QQ6A 1D2KA 4CLMA 4M56A 3B05A 2FVLA 3UGVA 3EB3A 1TELA 4LVDA 3UXKA 2YX0A 3SZ8A 3SECA 3I68A 1QPRA 4P8UA 2F2HA 4FO4A 2G0WA 4JAWA 4ZOBA 3GNXA 3W7NA 1TR1A 1ICPA 4DUVA 6ENLA 2YL8A 5FEXA 1A80A 1J01A 4BEQA 1TJPA 3HO8A 3STEA 3WLJA 1RPXA 4JTSA 2A21A 1DE5A 4IP7A 1H61A 2W0UA 3PBVA 4XBJA 3WD1A 1J96A 2QGHA 4C60A 1UW9A 1MI3A 5A8MA 4Q4MA 2CCRA 4U28A 3R79A 5J8LA 3EOOA 1XKYA 1A47A 2ZXDA 3WDJA 2D22A 1EBGA 3W53A 3WLOA 1GK8A 1E1CA 1PIFA 3OVPA 3HG2A 3F4NA 2WJDA 3CU2A 2VC6A 1UZHA 1ZAHA 4IX0A 5F4SA 3N2CA 5REQA 2EKGA 1UWSA 3SCVA 4KWVA 3OBAA 4XVDA 3DX5A 2BMBA 4BR1A 1E15A 4AEEA 1B4KA 1UKTA 4U4MA 1QRQA 3B0PA 4FHAA 1IQ8A 2WJFA 3CBWA 3OGSA 1WKYA 3M43A 1K6AA 3M7SA 5FACA 1LOSA 3EWBX 2Y88A 4G7EB 5I77A 5DCDA 3IV8A 5DMNA 1J0ZA 1DJIA 4ZTXA 1G0CA 5C6MA 4ERAA 3WENA 1FKWA 1AVAA 2GSEA 4E2DA 1NVMA 4CQ9A 4PL2A 1TTIA 1F6YA 3L2IA 4RE4A 4U31A 3L2LA 1MEIA 1WQ5A 3BGJA 1GQKA 3RHGA 3BURA 3K30A 3G1DA 4WJEA 5HJLA 5FAGA 3SCSA 1E6XM 4K39A 1T6MA 1PXGA 1EL3A 4M6VA 3A9IA 3B0YA 2NWRA 2ZX8A 1KC7A 2VFIA 3CV7A 4MLRA 3OZYA 4AZBA 3E5BA 4UOQA 3M0IA 5DMMA 5A6BA 3M6DA 1TPUA 1FFQA 4UMAA 2X0YA 3S2MA 3BXWA 2WJZA 2VR2A 1V51A 3ARRA 3KP0A 3T9PA 1YTEA 3AS3A 1VENA 2DUXA 1M3UA 5HINA 1JZ7A 4K1GA 3MMUA 4EP8C 1PL9A 4UQEA 5F7UA 4H2HA 5H8MA 1W17A 4WDXA 1N55A 1US0A 3H7RA 4AEFA 4HK6A 3V1PA 4HHLA 3SCOA 3CXOA 3FGCB 3RM9A 4H6EA 4ZOEA 1GJPA 4OKDA 5I03A 1IXOA 2P8BA 1K6WA 4PUEA 4FNUA 4QDWA 1RCOB 4HHHA 1B3OA 3H54A 2QKFA 5AYXA 3TCEA 4QQ3A 3CQIA 3N11A 4B90A 4I7UA 3GXDA 3G5EA 1IEXA 1YKWA 3WELA 2CXGA 3TN6A 3BARA 2W4XA 1FH9A 5C2GA 1U83A 4B5UA 1GTEA 1M5WA 3PJWA 2GVLA 4YU1A 4A05A 1KA9F 4LUSA 1TA3B 2YZ5A 4AIEA 1XIJA 2J27A 2OSYA 5H1WA 3TZFA 4PB3A 4D6HA 1QO5A 1JD9A 4W84A 1MRAA 3IAQA 2CZDA 5AHIA 3W24A 1O5KA 1EJRC 3AC0A 5FD0A 1E9YB 4W8AA 1JNEA 3BJTA 2FTWA 5D03A 3H2NA 2C8NA 4FNTA 3H2CA 3QKEA 2BX7A 1V6TA 2J25A 3HG5A 4A3QA 1E6NA 2J88A 2X09A 4LUIA 1Q8JA 1WPCA 1BYCA 3BOFA 1BVZA 4RPPA 3E1F1 1U22A 3K1GA 1W3KA 3QJAA 1LF1A 3MJMA 2ZZ5A 4MFEA 4W7VA 2DEPA 3ZYZA 3KXQA 1T41A 3AZRA 3ZS4A 3IK2A 3KBWA 4F3HA 3K1DA 4W5UA 3SCTA 3K5XA 3RXZA 1YYAA 2O9PA 3DFQA 4ATLA 3L65A 4MMWA 1KKOA 4DVOA 3CB8A 4K1WA 4TXEA 4K7YA 2CU0A 4PODA 1ECEA 4GC3A 1RJQA 3GH4A 2AL2A 1NF0A 1I0DA 3PHAA 2PA6A 1ZP4A 4UBPC 1F07A 3UWYA 4E4UA 1DJYA 3W76A 3RCYA 2G3JA 3WQPA 4AH7A 3L5LA 1QATA 4XIMA 1ONXA 2WB5A 4C91A 3VOHA 3SFWA 5A6KA 4LXFA 3CC1A 1SJDA 3SY5A 1H50A 5HPOA 3EWYA 3A64A 4GNJA 2GQ3A 5D02A 4DZHA 4KEVA 1XGDA 3NM3A 4NJIA 5KINA 2CW6A 2C91A 4JQ1A 4QFUA 4B5NA 2Q8LA 4JIPA 3FLUA 4RDVA 2XIJA 5BW6A 1QNRA 3U4AA 5JBEA 3S1UA 2UY4A 3N9SA 3VINA 3NL3A 1NP0A 3BE7A 1GYNA 1FH7A 3T2OA 1R0MA 2PGEA 5FA5A 3WL0A 4DYEA 5CSRA 2PLKA 3ZR6A 3V4BA 2QF8A 3T7VA 3UJ2A 3NG3A 5C8BB 3KRUA 1VFSA 1FTXA 1LQ2A 2ZX5A 2YZRA 4LS0A 3L4ZA 4W8BA 4KGLA 5K7JA 4XTDA 4L65A 1N82A 3BSHA 1CXIA 1Q2SA 3P62A 3FKRA 1B31A 2W61A 4YYFA 3G2GA 1Q2RA 1VKFA 1ZUAX 3DFNA 1OIFA 1J0IA 5FF7A 5BU6A 2CLHA 3L0KA 3BLOA 3PZOA 2ON3A 3RF9A 4ASTA 4XBKA 1TCMA 1D3HA 2VGBA 1ISVA 4GH1A 4UR9A 2Z28A 5AC8A 3H70A 1X97A 1UZDA 4GZJA 3SN1A 3B8SA 4YTRA 1P7TA 4GXWA 3GIYA 4DNMA 2QUNA 4CQDA 4IIFA 3PPHA 5EA9A 3H7VA 4MHBA 1AW2A 3TYUA 3ZT7A 3MKKA 3NIYA 3STPA 4YVVA 2B7OA 5D9MA 2DT0A 4JNMA 3AO0A 4JD4A 1UA7A 1QBBA 2WC4A 2JBMA 3FGCA 2D0FA 3C8FA 1JDDA 4PTDA 1UKSA 3IK4A 3REQA 4AX7A 2ZWYA 2O4QA 2OODA 3FYYA 4JNYA 1TFVA 1LRTA 1OHLA 1Z6KA 4IIBA 3VUSA 2QCHA 3OLGA 1FRBA 3QR3A 1KM4A 3UA4A 1O66A 1B2YA 1XHGA 3TTYA 4AZ7A 1PTDA 4NASA 4A8LA 2HXUA 2AQOA 4RKAA 1V79A 1XR2A 4MYXA 3B8IA 3QGAC 4N4QA 1XL9A 2OSXA 3QV7A 3RCNA 3V18A 4PUJA 1EHNA 4DJDD 4HNLA 1TA3A 3OA3A 2WVVB 1EWDA 2OYLA 5DEZA 3S2CA 2NX9A 2NVCA 4BHYA 4CQBA 2XYLA 3IGHX 3AUOA 4HOWA 3UZZA 1GQNA 3UJFA 1QNSA 3DHUA 1E6PA 1YXYA 4PYSA 1ZJIA 4QS5A 4ICCX 3BMVA 1W5OA 4D6IA 1QHOA 4HJFA 1OFAA 3ES8A 1I75A 1TR9A 3FSUA 2WCAA 2FZ8A 5DRCA 2GSHA 1KLYA 1X8CA 3TLQA 1XRSA 4ACYA 2FKPA 3LPGA 3THDA 2O4MA 3RPDA 4G7FA 2VDGA 4QJ5B 7TIMA 1UH4A 1XLKA 2ZYFA 4GUHA 4C6EA 1RP9A 1HP4A 4O1AA 2VWSA 2PC4A 2A3LA 3FVDA 4M80A 3CIXA 1J10A 1NWTA 1GONA 3FDKA 5C7HA 2Q6ZA 5JIWA 4LUTB 3E0VA 2X2YA 4MY1A 1P4CA 3P8JA 2V6AA 1E6RA 3HPXA 2YSWA 1OEPA 4XV0A 1G7VA 4DYKA 5HJYA 5IFPA 2PTXA 2PB1A 2Y5SA 3WH9A 5HMDA 5EPDA 5AYBA 4R3UA 2QCLA 5H8PA 3NZRA 3O8AA 1XICA 2VTFA 4MPKA 3QR0A 2R9RA 4NT0A 3ZT5A 3TN5A 2DSKA 4L64A 4Q8TA 2YW3A 4MUPA 1VFOA 4E3VA 3RIKA 4YYCA 1TX0A 3UR8A 5F4XA 2DIJA 3LY0A 1EJSC 5I24A 3GH5A 2BSLA 2J7DA 2HROA 2XSXA 1SFSA 1SW7A 3QF0A 1W56A 5G2IA 3GTHA 1XCXA 3G1RA 4IFKB 3C0SA 1Q6FA 3JW7A 1X7FA 4C6CA 4IUGA 1SW0A 4AVOA 1OC6A 4S3KA 4Q4QA 5F2GA 1V77A 2FFIA 1J18A 3DG3A 3OIXA 4L9YA 3PZGA 4LQ1A 1DYSA 2DZXA 4JKLA 5G4WA 3HGOA 3WBAA 1F6KA 1SM9A 1ZRQA 2Z0IA 3U2OA 4XZNX 3OPSA 1GQLA 4XUGA 3AU6A 3TONA 3ARXA 4MB4A 2QT3A 1YPIA 1FQ0A 4J27A 4Z2IA 3NDZA 1DXEA 1FWWA 3RMEA 1EGZA 3A13A 4PUDA 3IIXA 4RJEA 1EOKA 1Q13A 1GKQA 2CBVA 3NA8A 4G2DA 1F7BA 5A8OA 1BG4A 4IT1A 1W1YA 2IXUA 2GQAA 2ZBTA 4QNWA 2EPKX 1EH9A 4UQBA 4H9VA 4E2VA 1BD0A 2PEVA 4W86A 2OWCA 1EZ2A 2RFGA 5HUPA 2C19A 1U5JA 2Z6IA 4DELA 3I3DA 1VB9A 2VENA 2ZE0A 4KIEA 3SRDA 3W29A 1LBLA 4R85A 1CBGA 2QVNA 4S3BA 5F2MA 5CGQA 4IFOA 5HA7A 1JYNA 2DW7A 1R85A 3HFYA 4WHBA 2GGJA 3SJNA 2QDGA 4UTJA 4JX4A 5E1QA 2W3ZA 1H5YA 4TX6A 3OBEA 5LNUA 1HJUA 4KETA 2A3CA 1YLVA 3W1PA 2Z29A 2BXZA 2ZZ2A 2X8RA 3FJNA 1KFKA 1X6NA 1XBYA 4Y7EA 2NQHA 4J35A 3DC0A 4P61A 3HBLA 1EDGA 3VUPA 5TNVA 1R9ZA 5BXSA 3H26A 4S39A 4JL2A 4H83A 4AZGA 1JULA 4O0QA 3D0CA 2QF7A 3GUWA 4Q7BA 5AC6A 3UGRA 3LDVA 1BF2A 1VJSA 4UC5A 5B80A 2HVNA 2Z6JA 2GVEA 5HNTA 4QSHA 1CYGA 3GO2A 3KFTA 5CC5A 1QHZA 3VA8A 4ORIA 3TSDA 2WVVA 3GYCA 1UUMA 1SZEA 5AZ0A 1EJUC 3W70A 1GHRA 2Y63A 4GBDA 2Y89A 3I4KA 3NPVA 1MW0A 1Z42A 1H7NA 3VIHA 3GXNA 1A3HA 1QNPA 2BP1A 3QSRA 5DMLA 4MWAC 3ME3A 1KGUA 3VVGA 3DFOA 1JYVA 1XC6A 3PTDA 3MS8A 1UKPA 5BWAA 4Z42C 2V81A 3SY1A 3UR7A 3ABZA 3TR9A 3TJ4A 4DJED 1KXTA 2JFEX 2VGGA 3MUXA 1DJWA 1RVKA 1QI0A 2ISSA 4MNMA 1SR9A 4A35A 1ZPTA 1JQVA 1ME9A 3ZLHA 2VEGA 2E6FA 2W91A 3FA3A 3KBSA 3DHDA 1Q8AA 5BRPA 3PM6A 1LT7A 2G95A 1FCBA 4HPGA 4DUOA 1PS9A 3GFXA 2OJPA 3W7LA 9CGTA 3MSRA 4LUTA 2CZVA 4Y6GA 3OB8A 1C91A 1H3GA 3ARZA 1AD1A 1IT8A 5EMJA 1BF6A 3DHFA 2DJXA 3EOUA 4WR3A 1YNPA 2ZZ4A 5FF2A 4B3LA 4O19A 3QW3A 3W83A 2ABBA 5CBIA 1O68A 4YVPA 5FKYA 1F74A 1M1BA 3WF0A 1U30A 1YW1A 3ZVIA 2Y24A 3GLCA 4GY1A 4G9PA 3CM4A 1JPMA 1A5CA 3W1NA 3R1ZA 1CGYA 2OOGA 2PDPA 2ISVA 2CHRA 3DFSA 4S3FA 3W4RA 3BGAA 4EIVA 1H2JA 4FLRA 4B4FA 2X42A 1UB3A 1GNXA 3DFHA 3P0XA 2ZX6A 3M0JA 1OABA 3UU0A 3TVAA 3W2LA 7TAAA 1UG6A 1ZS2A 1S2TA 2WC7A 1THFD 5M5DA 4OTKA 5LYRA 1JRBA 1VRXA 3DAQA 3N2TA 3ANUA 1W8GA 3PZTA 3R4IA 2WYSA 1NY1A 1EC9A 1PKLA 4XZ9A 3KM8A 4F9DA 3FCPA 3BVJA 2WHJA 4FB7A 1ZSXA 2WZHA 4Y9PA 4JIRA 3VNKA 2CESA 3E0LA 4O13A 4BI6A 4KW2A 5XINA 4FF7A 3UNTA 3PBMA 3MZNA 4V28A 1QNOA 3FYPA 3LHZA 3SO7A 1XIBA 1R2RA 3CHDA 1KFJA 2CZEA 4LB4A 2Z1WA 3W73A 3BICA 4ATWA 3R89A 3NQFA 1EEPA 5BMWA 4QTGA 2WSQA 1UKOA 1H09A 2WMFA 4C6JA 3T44A 1MNZA 3A4JA 2EPLX 2Z1KA 4DB7A 1PJ9A 3AXIA 3BL3A 3QGVA 4D2JA 3U2ZA 1JL8A 1WDDA 2IS7A 1OFQA 3G8EA 4XZBA 3TEVA 1ZAIA 2D3NA 2WMIB 3BZJA 3F4DA 3P93A 1ZBCA 1XDLA 3W82A 3LOTA 3KCJA 4HNVA 2V68A 1BQGA 1EUAA 5ABFB 3QKZA 3ITTA 4GKLA 3LLDA 3PZQA 2Y1HA 1JCNA 1GVOA 3GHUA 3AFBA 3EDJA 1HTIA 1OVDA 4CEXC 2I5GA 3VIPA 4S3AA 2VEFA 3JZEA 3WLIA 2J13A 4EOUA 2XFWA 2REQB 3WZ0E 3TQVA 3BAJA 2ASHA 4WGHA 5JMUA 1Q4WA 1PUDA 1FWCC 4JR5A 3N14A 4PC8A 1AH0A 4CN4A 4XO6A 5E0KA 3LRLA 3GSMA 3KBVA 1EO5A 3TC7A 4X0VA 1XW8A 2RH9A 5DBUA 1RA0A 1Y5VA 1W32A 3WN6A 2JEQA 5A6JA 4NILA 4O11A 1J0YA 1G6CA 4WF7A 1GQJA 1M7JA 2G3FA 3I6TA 3FNDA 3AYRA 2V3EA 1C90A 2O92A 2EG8A 2QJIA 1GYLA 1OGBA 3OOQA 5CZKA 4CU7A 3RR4A 4GPNA 1TREA 4LBSA 4QJ1A 1VH7A 6TIMA 2AOSA 3UZXA 3G77A 3EKZA 1VF8A 2J6XA 3TMQA 3COTA 1DIKA 1ADSA 1ME7A 2CLFA 4QM1A 1F8IA 3TW7A 4TMBA 2DJLA 1WO2A 2VX6A 3DUGA 3P7YA 1ZNNA 3GKAA 2EAWA 2P88A 1M7PA 3RM8A 5LGZA 3WK2A 4L56A 5CEWA 4JEQA 1TV3A 1XIDA 2Z25A 4GMEA 1UD8A 2AKMA 5DO8A 1L0PA 2V69A 3AIVA 3CEUA 5D4YA 1GUVA 1R3WA 2G8ZA 4C5YA 3M44A 3WQFA 4KMQA 2P3EA 1XV8A 2XSAA 1CXFA 4HHPA 5HDRA 1OB0A 4D6EA 5FAJA 4MKVA 1C8XA 1SVDA 4KCTA 3W2JA 5FF4A 3RM4A 2NWSA 5HWJA 2VDIA 2XU2A 4H1ZA 4UWMA 3HURA 1HX0A 3CQJA 3T55A 4CGTA 2WCSA 4WGXA 3HIJA 2DP3A 4YWSA 2HBXA 1NWSA 1QOXA 3ZIZA 3GE7A 4CNPA 2RDUA 1VP5A 2XFRA 4BF7A 1OCBA 2A3EA 3WJXA 4Z1AA 2AL1A 2I7GA 4X9YA 1AFSA 4GNKB 1DBTA 1UUQA 4KS0A 4PN2A 3W2KA 4GX9A 3FAXA 3W1QA 4ZE5A 1BVWA 3WUEA 4HMCA 2EPNA 4NQ1A 2BB0A 1SU5A 4DM1A 3GDMA 3R12A 5D2TA 2NQ9A 2YBVA 1KGXA 4LYQA 2E5CA 3HA1A 4B5WA 3BPWA 2CZ5A 4PFMA 1CGWA 5CH9A 1KRAC 4J3ZA 1XGZA 4YCOA 4GGHA 4C90A 2AQWA 4K6AA 3TJIA 2O55A 2VVNA 1B3VA 1KM3A 1Q85A 5JXQA 3RRXA 2NT1A 3AWNA 3TA6A 2NLYA 3IVSA 2GJPA 2WK2A 3L0GA 3A6OA 4OIFA 4J40A 2A7RA 1WKEA 1LDCA 5A1AA 2QDHA 4O1DA 3NPUA 3B8VA 4JTFA 2PDMA 4JX5A 1LYXA 3C61A 3UERA 3EDFA 1XLAA 1VFFA 2VRQA 3MP5A 2C7FA 3KOWA 3EXTA 4UTFA 5ECVA 3HM7A 1TCDA 4R9XA 3VNJA 1W3JA 2NVAA 3THQA 4N2YA 2XDFA 3MQTA 6XIAA 1QUMA 1FHVA 3GR7A 2G37A 4AQLA 2RHGA 3V1HA 1UBPC 3VOFA 1EJVC 5GNZA 2DIEA 3WEZA 1NEYA 2HK1A 3W7IA 4CD4A 1H0IA 2D24A 3UXIA 2YYUA 2WMJA 4H8HA 4NIRA 2PDUA 1IZCA 4I6VA 3VFLA 1RJPA 3UJEA 4LH8A 2BOGX 5FSDC 5FSEC 2YCIX 1NIUA 3M4HA 5C9UA 1FUYA 3CS2A 1AJ2A 3GU1A 1UD6A 2WMIA 5JU6A 2Z27A 3KOXA 5A8PA 3BC9A 3K46A 1YRRA 5ABFA 2G5WA 1K4GA 3GXPA 3PNUA 4BWLA 2V8ZA 2V2DA 1BRLB 3W37A 2MUCA 2VUYA 2NSOA 1WXZA 3Q58A 1QPKA 2VQTA 3L4WA 4NYUA 4HP5A 3W7PA 2OXNA 3GHSA 3T09A 1W2PA 3NEHA 3ELFA 3BH4A 1LCOA 3UWZA 2WPBA 3UXDA 1YNYA 3KAOA 2DPEA 1WXYA 4E8DA 3UG3A 3G1YA 4P2VA 3RYSA 1QNQA 3T40A 2BNJA 5C71A 3BLLA 1XSKA 1UROA 4NZ4A 5I3FA 4CNNA 1E6SM 1H7WA 4I5RA 2IPWA 2YDQA 3NSXA 4FSAA 3M0LA 3DFPA 4B5TA 2VM8A 4RXFA 4MGGA 4KFPA 4WDTA 2XH0A 4H6KA 3EX6A 4D6DA 2RAGA 1F05A 1MYRA 5MKGA 3LGGA 1QWKA 1SW3A 1QO2A 3UT0A 3SRHA 3QV8A 3SCPA 2HSAA 1NDVA 4AD5A 4HQVA 2DORA 3NZGA 2EJAA 5EL1A 1B3YA 3PZ9A 2X40A 3EA1A 3P61A 2YCLB 2X30A 3EDEA 4BF5A 3IJIA 1KXVA 1ZBWA 3WLTA 3LXCA 3E2VA 3VKBA 2NQZA 3E6EA 4NZ5A 1CIUA 5CPSA 3R8RA 1X6LA 3DECA 2X41A 3QLLA 3G1VA 5JQ9A 3C52A 4UTKA 3AQUA 1XD0A 3NYZA 3DCPA 1AQ0A 3W86A 2VD8A 1NP2A 3VCCA 2WMGA 4L6OA 4C6QA 1HKIA 4GACA 2GUUA 3GZ3A 4GQGA 4O4WA 2BASA 1RLDA 4IUOA 4XD4A 2B0MA 1XCWA 3QH2A 3VOJA 2HVMA 3B8WA 1U33A 3LCWA 2AQVA 1LLZA 3PY2A 2A2IA 3EB2A 4BQ2A 4U3AA 5EBUA 3KS6A 1LJYA 2R6OA 3NO5A 4PCTA 2E9MA 3EDDA 1PTAA 4CU8A 1GGOA 4QE4A 1YHTA 1ZCOA 1TZ9A 4B4HA 4H3DA 2ZWZA 2IQTA 2OB3A 3U2CA 2J9XA 1L6FA 3E2RA 2WAGA 4M82A 2Y7FA 2P0OA 5A2CA 3NQ8A 4LCSA 2QCNA 4XAFA 3AIWA 1MUWA 1WAWA 2GGGA 3UZYA 2BXVA 4PTMA 1X1NA 3RLUA 2WSKA 4NVTA 1CLXA 1CENA 4NZ3A 3THAA 1MW2A 1Y7VA 3PBYA 4NX5A 2D2GA 2YFOA 4KBXA 1DTNA 1ZY9A 4JS3A 4GO8A 2PRHA 3EA3A 4UTHA 1BHGA 5TAOA 4YJ5A 2ZE3A 2PCEA 4JN8A 4J4KA 2EKCA 3B8DA 1O5RA 4GO9A 2DT2A 3UJSA 2V9DA 4AAJA 2P10A 2ZOXA 2VMFA 2ONEA 3VM5A 4BF9A 4GCXA 1XG3A 1I6NA 3VMNA 2YOCA 3QTGA 1R2SA 4M6PA 1XIMA 3MBDA 4XB3A 1M65A 4WSHA 3QHNA 4FPSA 4HBKA 3UXAA 3QRHA 3O15A 9XIAA 1A3XA 1XS2A 4KKXA 4OVXA 3T2PA 3UG5A 2ACRA 2HCVA 4K8EA 2PU0A 5AC5A 4LAZA 1P43A 5M3WA 1UR2A 2WWCA 1KKRA 3S2LA 1EDQA 1FBAA 5GNXA 4FXSA 4ENLA 3GBDA 3UWVA 1IZKA 4LVFA 5CPMA 3L5MA 4E8GA 2HS6A 4NI8A 7XIMA 2IMRA 1EA0A 4O14A 5K9XA 3AYTA 2QDEA 2FH8A 3HF3A 3UWEA 2TSYA 3VCRA 4D6CA 8RUCA 3EEGA 1WDRA 1TWIA 1UD5A 3WH8A 1L6YA 2JQXA 3LXAA 1D3CA 3L7RA 4GFSA 3VD7A 4F0SA 5I3IA 1X8FA 3CWHA 2OYMA 3NQ6A 2G41A 1WYIA 1OZMA 1FWSA 4UTTC 4LTSA 4HPJA 4TX8A 1JF5A 4JBRA 3PTQA 1K8XA 3SW6A 4IFRA 1ZBVA 3D3AA 4DJEA 3SBFA 4HU0A 1ZTVA 5IM51 3FSTA 1JZ6A 1OFBA 2O7QA 4AB4A 2VEIA 2Y61A 2ZVIA 1PDYA 3S0CA 4RV8A 1CDGA 1FHLA 4EK7A 2XZ9A 4S38A 1YE6A 3ANYA 2Y7DA 5DF0A 1K70A 2O0TA 5E9AA 1WOBA 4AHOA 3PPFA 5HNNA 3ARTA 1HKJA 1PBGA 4IOTA 1W9VA 2OEKA 4D8LA 2CLKA 4C5ZA 1O1HA 1VIZA 4IF2A 2FJKA 3NUKA 3WNPA 4FALA 4L61A 9RUBA 4LAMA 5TBOA 5LNWA 4UIOA 3UR5A 3N04A 1BYAA 1XRFA 3W7DA 2ZZ7A 1E9IA 4MJ4A 4XD6A 5FL0A 2OKOA 1GPFA 1IEWA 1PAMA 3V16A 1PZ1A 3NL5A 1P6WA 1KCZA 5A95A 1E71M 2PE4A 2XTKA 3L21A 1IWBA 5E93A 5I07A 2HPIA 1LORA 4H04A 4CD5A 1M7XA 4H9ZA 2CWXA 2VKZG 3LSBA 2XFFA 1E0TA 3PAJA 4CCCA 1XLCA 3F5LA 1J79A 1Q45A 2WPGA 3LENA 1VS1A 5DY3A 5D9OA 4FK9A 1FWTA 1MXSA 3R11A 1QTWA 5MHBA 3S9YA 4GXPA 5CSYA 2P76A 1YXDA 2BY2A 3RX2A 1TJRA 3OGVA 3OTRA 4E8CA 4OZOA 2V2CA 1Q4NX 1L2UA 4I7VA 2C79A 1CNVA 3B9EA 4NL1A 2PZNA 4BI7A 4E6MA 2XIBA 3W7OA 2XH7A 3V7PA 6PTDA 1S5WA 1TPEA 1XIHA 2BVWA 1JZ3A 4AF0B 4GY0A 2Z4GA 4DZAA 1SMAA 2OLHA 1QOPA 2FMNA 2IUZA 4JTQA 2PI6A 1PO9A 1VR6A 5T9BG 4FNRA 1IT7A 4IISA 2ATMA 5I02A 4C7FA 4FNQA 1J11A 3OLEA 1TTQA 1MZRA 1P0BA 4PUWA 3SEPA 2QGYA 3O0FA 4JHOA 2P5NA 2VGIA 2PDCA 4TV5A 4L4MA 1S5VA 4NJHA 4UTLA 1FDZA 2CFFA 3RAOA 4UB9A 4Q7IA 4ZB5A 3AS0A 4UFKA 1X96A 5KSWA 1TVPA 2VXNA 2ZRUA 4K38A 4AW7A 2QVHA 3Q2DA 3IUIA 1TV2A 4O28A 1KFCA 1EYEA 2VT0A 1KM2A 2I5IA 5KZ6A 4PMDA 4WDWA 2PDGA 3EGJA 4UNLA 2DT1A 4ZQCA 3B97A 1J2WA 4DF2A 4MJMA 3IIZA 1I2OA 1B5TA 5KZDA 4UFHA 1X98A 4O50A 1RR2A 3V5FA 3UD6A 5MF5A 4LC6A 1RXOB 1P6CA 2V3GA 2Z2BA 1SQ7A 5HOSA 3SGUA 3EAUA 3LHVA 1IZJA 2QUTA 4AZIA 2WSPA 2PWHA 4HNNA 1SO3A 3WYZA 5L9FA 2IKHA 5E70A 3SDOA 4MZ1A 1K77A 3VDHA 3EX4A 4XTIA 3W1UA 4HU8A 4I9TA 3P6LA 4JDBA 1KR1A 3D6NA 2ZC1A 3OG2A 3H55A 5EU9A 3QN3A 4GBUA 3BOLA 1V6WA 2VI0A 2OPJA 3M0ZA 3DGRA 1B0IA 3CO8A 4HSNA 5FEWA 4Q32A 1TO3A 5FIPA 4FX6M 3MSYA 1OCJA 4U5IA 3MVTA 5LNVA 1E73M 3EWDA 4PTXA 2VEMA 1UMLA 4EACA 3ZLGA 3LTSA 1KO0A 4ZSTA 1UPPA 2GYIA 3W1MA 1EJ7L 5HANA 4KPLA 3BZGA 4LV4A 4GXMA 3I7RA 1JQXA 2VX4A 4EPEC 5HXMA 1WZMA 1H62A 3SIMA 4YHGA 2ZTJA 2ZZ1A 1RBOB 5I3KA 1LOQA 4PH6A 4PSRA 2R1MA 4YTQA 2ZIDA 4IMAA 1FDYA 2C0AA 1QDSA 2E5DA 1EXPA 2C0HA 2UY5A 1B30A 3OEXA