3PZQA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 with maltose and glycerol
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzqA00
3GNOA 1BYAA 3CZ8A 1HJSA 3EDEA 1EA9C 3AMCA 4TX8A 2E8YA 5JBFA 2WZIA 4D71A 2GUYA 3WQ8A 3GDBA 1JDDA 1TCMA 1U33A 2XWDA 5FL0A 1EDQA 3D3AA 3SCUA 1J18A 5EB8A 3CUJA 3GXFA 1UYQA 1ISXA 1JYNA 1UKTA 4NF7A 1ITCA 5M03A 2GVYA 2XVNA 2WLZA 3PZ9A 3WH7A 4U31A 4MAZA 4RE2A 4C7FA 3VDHA 1Q6EA 3BAKA 3WH6A 3WEOA 3VIIA 2ZXDA 2A3AA 2WNWA 1WDPA 1H49A 1C8YA 1NWRA 1V6WA 1BLIA 1IZJA 4PEEA 5A6JA 1HL9A 3AXHA 1ODZA 5CGTA 2ZUUA 2VQTA 5D9PA 3CTTA 2X0YA 2ESCA 2CCRA 4TVUA 1HN1A 1QBBA 2WVUA 4AIUA 1FFQA 1GHRA 1CXKA 3THDA 3ZJ6A 3A4AA 2VC9A 3PZQA 4CD7A 2V5CA 5ABGA 2XYLA 1FP8A 3GTNA 1W2PA 1HVQA 4H8UA 1E72M 1CXEA 2XVPA 2CIPA 2WCSA 3L2LA 1VFOA 2BHYA 1MFVA 2EXOA 3K1DA 3VIJA 1C92A 1WZLA 4W88A 2B31A 2D22A 1V3IA 3U5UA 3WENA 1CDGA 3GBEA 1I75A 3L4YA 3AHTA 5M3WA 1J0ZA 4PSRA 3O9NA 5C70A 2VVSA 4MPKA 2ZX7A 3ZR5A 3NCOA 9CGTA 3ZO9A 4UQEA 4CUCA 4MNJA 4U5KA 4GZIA 2UY5A 1H4PA 3TTYA 1UWTA 5A6LA 2BNJA 3VMOA 1SR0A 3AISA 3W6LA 2BY3A 3BAJA 4JFWA 1CLVA 3ZJ7A 2W66A 2X0HA 4S3JA 1HKJA 3AS0A 3TOPA 2C8NA 3VO0A 1KB3A 2D20A 2E8ZA 2DSWA 2XG9A 4UQBA 1UH4A 1WO2A 5JBDA 3SCNA 4V2XA 1OD8A 3AZSA 4CN4A 5D4YA 2OYMA 4JFTA 1E6PA 1W1YA 3L4ZA 3O2LA 3PZMA 5GQBA 3HMCA 1LL4A 3VPLA 2DT1A 2BV9A 3MV11 1NARA 2F2HA 1E4IA 2EPNA 2TAAA 2DSVA 4Z2KA 2WLYA 1M53A 3WDHA 3OA5A 4U33A 1HKKA 1E0WA 2W67A 1GUVA 1LWJA 2ZUVA 5I24A 4JL1A 2WMHA 1GOMA 1VJZA 2NT1A 4U5IA 4JKLA 1ZB5A 3N04A 1XH0A 2OYKA 3WNNA 3AIVA 5E6YA 4UFLA 3T2QA 1JFXA 3F5LA 3CH9A 5ABHA 5A6BD 1QNSA 1VBUA 3WDPP 3NUKA 1QVBA 1OGGA 2BFGA 1W1PA 5D9MA 4GXPA 3SUWA 3W25A 1M7XA 1CYGA 3EBVA 4M82A 3NDZA 4PMDA 3ARXA 3VUPA 1C7SA 2ZXQA 3AS3A 4GIAA 4A3YA 3CUGA 4BQ5A 1FP9A 5CPSA 4W5ZA 2E4TA 3S2CA 3BGAA 2FHCA 4K68A 5HXMA 4EE9A 4P8WA 4D6DA 4AISA 3PZVA 5A6BA 3UG3A 2YDRA 3SCRA 3AMKA 4HMEA 3VD9A 5D9NA 2BY2A 3MV01 1TVPA 1PIFA 3EMZA 1UKPA 2WBKA 3MMUA 3G6MA 3KEHA 1V6UA 3T08A 4Q7NA 2Z1KA 3UG5A 4W89A 1W9UA 4U2ZA 2VUYA 2J7BA 3IANA 2PB1A 4ATLA 3CZLA 2JF7A 4KGLA 1HF6A 1ZBVA 3AICA 3GNPA 2J7EA 4DWSC 2YA0A 4LX4A 1HX0A 4F9JA 4GINA 4KRTA 2D3LA 2WVTA 3WUFA 4DWSB 3ZJ8A 4CN6A 2QHAA 2GDUA 1UR4A 4R27A 1V02E 3RM4A 4XB3A 3L4UA 2WAGA 1JF6A 3NSMA 4ZXOA 1U30A 1TFVA 1ESWA 1H1NA 5A1AA 1QOXA 3W27A 3VIHA 1BPLB 3WNMA 1E56A 4WJXA 1C91A 4MDPA 4PCTA 1PAMA 3NDYA 3W24A 1MVYA 1LL6A 4BF7A 4B9YA 3OBAA 4HA4A 4UOJA 4UZSA 2XGBA 5EBAA 3JUGA 1V02A 2DSZA 3VOCA 1Q6DA 1KR0A 1EHAA 1CXLA 1UD2A 2WZEA 2FHFA 2WHJA 1QNOA 4XZBA 3PTQA 3SCPA 1E4LA 4RE3A 3M07A 1BVNP 1E4MM 1K9FA 2IUZA 4FLSA 2EEXA 3DYOA 1OGSA 1UR1A 2CERA 5HPCA 3CZJA 4WSJA 5M17A 4DWSD 1MW0A 3CPUA 1D3CA 5I23A 2YBUA 3GNRA 3K4AA 4YPJA 4AIEA 3WL0A 3SIMA 4AD1A 2WBGA 3ZJKA 3UR7A 1G1YA 2CBJA 5FL1A 2VI0A 1GQLA 1E6SM 2O92A 2WB5A 1DWAM 1CPUA 3RMEA 3AHZA 1UR2A 2ZOXA 4E4PA 2DIEA 1EDTA 3VIPA 3GYCA 2IXVA 4QCFA 4X0NA 4DWSA 4ZEPA 1E0XA 2WC7A 1QI4A 1MXDA 2XVLA 4W8AA 4MB1A 3VNZA 1XHGA 4M24A 4QCEA 3U7VA 1E70M 1HNYA 3VX1A 1VBRA 3GXMA 1W3KA 1R86A 4HPHA 1DEDA 1NP0A 1UH3A 2NSXA 5EFDA 1MXGA 4H2CA 1KXTA 3II1A 4JIEA 3AXIA 1H0GA 4MB5A 5DFAA 1E1FA 3APGA 2WSPA 1UUQA 4V27A 3BMWA 1EXPA 1E0VA 1UD8A 4LYPA 2VVNA 5AC4A 3EDJA 4W7UA 1NOWA 3A6OA 2ZX9A 2UWFA 3MUZ1 2GFTA 4ATWA 2W62A 2VCAA 2WCAA 1US2A 3EDFA 4UQ9A 2V3GA 1PZ2A 4W8LA 2VZVA 2WWCA 4GZEA 3ARUA 4QP0A 3AIRA 3AMLA 5LA2A 3BC9A 3ZT5A 4NSBA 4WLCA 1HJWA 1VJSA 4TTGA 1H0IA 1UA3A 4CD8A 1MW3A 4FLOA 5A6MA 2D2OA 4ATDA 1CGTA 3IJ8A 4CCDA 4YN5A 1GQKA 2ZX6A 4PTMA 1PPIA 2D0GA 2VCBA 1W9PA 3SCSA 1QI2A 3UR8A 1BGGA 3VIFA 1C3FA 5A2BA 3L4XA 1J0IA 2EQDA 3VD4A 2OSYA 3UCQA 1W3HA 1VFMA 1PBGA 3VX0A 1UKOA 4P7QA 3VD3A 3AZRA 4HU0A 2ZWYA 1JXJA 2YL6A 3WD1A 2DEPA 4BZYA 3W0KA 1PX3A 1WKYA 3GH5A 2DGAA 1VF8A 4RL3A 5IFTA 1UR8A 4UFIA 1A47A 3OIHA 2D0FA 6TAAA 2XVGA 1W9XA 3WY1A 4MB4A 5AYBA 4PMNA 3M46A 1ZBKA 4UQAA 2G3IA 3A47A 2NW0A 3MMWA 3SEPA 5ECUA 2WXDM 1WZMA 2F8QA 4KH2A 4U3CA 2XWEA 1TG7A 1C8QA 4X9YA 1NP2A 2XTKA 4GO9A 1PEZA 1R87A 3WKZA 3WDJA 2Y8KA 1J0JA 2VX5A 3BSGA 4LYRA 3OGRA 4P7LA 4D6GA 1KWGA 1J10A 3WIJA 4AYSA 2VR4A 1JD9A 1U2YA 2CKSA 4HMCA 5GNXA 2XFFA 4JHZA 3WL1A 1EDGA 1M01A 3O6AA 4AZHA 1X6LA 2YL9A 1BGAA 1QPKA 2VR5A 3OZOA 4UFMA 2XPKA 3W4RA 1ITXA 1GOOA 3MSGA 1ISYA 1EQPA 3VM5A 4E8DA 1M04A 4JCMA 4PTXA 3VMNA 1HJQA 4KWUA 2YLAA 5CZKA 3GXDA 1K9EA 1W9BM 3VILA 1QW8A 2D3NA 4UNIA 2VZSA 3W26A 1C7TA 1E9LA 3PN8A 4HOXA 3MO4A 3QOMA 1BHGA 5A95A 1W9DM 4URIA 1V08A 4QFUA 2YA2A 3SUUA 3B9AA 4UZUA 1OSEA 4MAVA 3AI0A 1DP0A 3LPFA 3POCA 4U2YA 5GNZA 3WUBA 1PX8A 5EFFA 1RD6A 4AD3A 1GJUA 2ZE0A 2O9TA 3FY1A 4D1IA 2CKRA 3CUHA 4HOZA 4TVCA 3RJXA 4AEEA 2OSWA 4HTYA 1KCKA 2V3DA 5A2CA 1EO7A 5JUVA 3SCVA 3AIBA 5A6AA 5IXEA 3HJEA 2PBOA 1FH8A 1VRXA 3OZPA 2G3JA 2QMKA 1R7OA 3L4WA 3U5YA 3FN9A 1PIGA 3MU7A 1V0MA 3OLIA 4JFVA 4EANA 4D72A 2WHMA 2XHYA 3PHAA 4JZ5A 4YHEA 5CSUA 2HISA 2OLHA 3SCWA 3PTMA 2Q8XA 1UOKA 4GQRA 3WF0A 1B0IA 1JYVA 1W1VA 4HZ7A 3N9KA 1X6NA 1XRVA 2XIIA 1K6AA 1XC6A 3IJ7A 1WDSA 5IHRA 4D1JA 1E6QM 1AMYA 1SMAA 5GPRA 3ZM8A 1WNOA 4W87A 1UD6A 3CIVA 4IISA 2YIHA 2J7GA 3ARYA 4PMXA 1O6IA 4PMQA 1P6WA 1TVNA 2WK2A 4BQ4A 1KXHA 4B16A 2EJ1A 3T2PA 1AQ0A 4DUXA 7CGTA 2FH8A 3WNLA 4M8UA 3MMDA 3VD5A 3RCNA 3F5KA 2W91A 4PTVA 3WDQA 3ARTA 3GXIA 3RILA 4D6HA 3VKKA 3SCOA 1LQ0A 1JNEA 2FGZA 4B9ZA 1MW1A 2J77A 3N11A 4N42A 5BXRA 1E43A 5CPQA 1E15A 3QR3A 3G6LA 1IV8A 1XGZA 2VRJA 4PUDA 3WQ6A 3B9DA 4ACYA 1DTUA 5ABFB 1F4AA 5A6KA 3AQUA 2EPMX 2CPUA 4W84A 1NOFA 4BQ3A 3ZIZA 1CXHA 4AZ6A 4OZOA 3U7BA 4AZ5A 1CNVA 4GZJA 3GZAA 4WKHA 5DF0A 1QHOA 1G01A 1M03A 4CVUA 5HPOA 1ECEA 4PMVA 1JF5A 4PRWA 5DMYA 1B9ZA 4M80A 1DWJM 3W6MA 1Q6GA 3WQWA 1NWSA 2A3EA 4Y7EA 1JYWA 1H11A 2G3MA 3VINA 2PC8A 3NSXA 1RPKA 2J47A 4UOZA 4HOWA 5BYWA 2J7HA 3ECQA 2A3BA 2CBVA 3IAQA 1K9TA 1TA3B 4BS0A 4Z2LA 1WPCA 2DQXA 4J3XA 5I2UA 1ODUA 3UETA 2GJRA 1WDQA 3VGDA 3TP4A 3BCFA 5FKYA 1ZBCA 3T2OA 3WMSA 1OD0A 3EMQA 1AQMA 1NWTA 3VIMA 2O9PA 1E6ZA 1FH7A 1KQYA 4W93A 4AZCB 3AIQA 5LA1A 3BAWA 3WF4A 4H04A 3HN3A 2ZWZA 3K8MA 1CBGA 5EMYA 2VX4A 4BCEA 4J27A 2J7DA 1XSKA 5E9AA 3WDRA 3CUIA 1JL8A 1NWUA 3A4WA 4H8HA 4W7WA 3BCDA 2VRQA 1JZ5A 4LXFA 2VX7A 3ZMRA 4CCEA 1HVXA 4S3KA 3VDBA 2BVTA 3VGBA 3OLEA 1XD1A 1VEOA 4XV0A 4Z2JA 2DT2A 3UG4A 4FMVA 3WMCA 4YHGA 3UESA 4P8XA 2RGMA 4HMDA 1V03A 1J0KA 1UZ4A 3RM9A 1FA2A 3NYDA 4NI3A 3ALFA 1IZKA 3KL5A 1LLOA 1I1WA 4AIOA 4F66A 3VIGA 4AZGA 3MSDA 3BMVA 2BHUA 2QPSA 2UY4A 2EBNA 2ZUSA 3THCA 4UTFA 4MJ4A 4AD2A 1XV8A 1WB0A 4GI8A 1DWFM 2GSJA 1UQZA 3B8SA 3MS8A 1C8XA 1BFNA 1QNQA 3BAIA 1TA3A 3E1F1 1KQZA 3T0BA 1UG6A 5A69A 1JIBA 5BRPA 4OBRA 5LYRA 1CXIA 2BXYA 3K4DA 4LYQA 3TA9A 1UWRA 1CGWA 4AZCA 4XUYA 1CGUA 2QMJA 2WMFA 1WZKA 3MUY1 2XVKA 2WVVB 1VB9A 2AOSA 5FD0A 4HA3A 1A3HA 1TUXA 3A3HA 3WNKA 3BLPX 5C8BB 4OIFA 1GVYA 4BQ2A 1H5VA 3WMBA 2WKLA 2VTFA 1XH2A 1PX4A 4HU8A 3WFZA 4DUVA 3GM8A 3LPOA 3CLWA 3WN6A 5IFPA 1MQQA 6A3HA 2DT3A 2E9BA 4AC1X 4Z2IA 3AIUA 2RGLA 1KR1A 3OGSA 1HP4A 4WKAA 2G8ZA 5DT5A 2CETA 3K8KA 1D2KA 2VL4A 2ZX5A 5JIWA 3KE0A 1UR9A 1RP8A 2AAAA 2C7FA 4GKLA 3TONA 5CG0A 2VURA 2XFYA 1GNXA 2CBIA 2V38A 1UWQA 4IM4A 3N13A 5F7UA 2PWGA 3SURA 4A4AA 1Q4NX 2G41A 2J79A 1E55A 3WD0A 1LJYA 3A4XA 3ARRA 1L8NA 4AD0A 4V28A 1J11A 1UWIA 3EDDA 4MJ2A 2ZUNA 3KWXA 3CO4A 3AMGA 3AS1A 3RIKA 1B31A 1B90A 1R7AA 2VX6A 3ZSSA 1CWYA 2WYSA 2DH3A 1FH9A 3ARVA 1Q6FA 4WSKA 3VNYA 5A8NA 1BYBA 1CGXA 3CMJA 4W86A 4UCFA 1H41A 4AD4A 1E6NA 4C7DA 1R85A 1G5AA 5D9OA 1VFFA 4ZE5A 1EGZA 2WVSA 2XSAA 5E0CA 3S6TA 7TAAA 4XZWA 4C7GA 2WMIB 2GK1B 1LG1A 4RE4A 3WQVA 3WF2A 1BVZA 1OT1A 1CIUA 1NQ6A 1NH6A 1E6XM 3PZGA 4TUFA 5BRQA 1BTCA 3IJ9A 4N0RA 5E6ZA 1JZ4A 2VT0A 3W81A 2WANA 2UY3A 1WCGA 2BY1A 3AHVA 3AMDA 3N1AA 2ZXAA 3GH7A 4J28A 1HXJA 1ISVA 4AZ7A 4R5EA 1CGVA 1EO5A 4HPGA 1CEOA 2WC4A 2YDSA 4ML4A 5I3DA 2XM1A 3ZT7A 1GQJA 1WDRA 3GH4A 1DWHM 4E8CA 2OSXA 3DHUA 3NIYA 1UA7A 1B30A 2E9LA 1ZBWA 2J7CA 2WWDA 2XJ7A 2YLLA 2WHKA 3L2MA 3DYMA 2O9RA 2X05A 4PMUA 1MW2A 4NRRA 3T0DA 1V3KA 4CU6A 1B3VA 2WCGA 1FOBA 1VEMA 2QF8A 1OM0A 2VCCA 4JAWA 4TOQA 4MB3A 3DHPA 5A94A 2W63A 4CD6A 4GI6A 4CN1A 5CLTA 4IPLA 1KXVA 5AY7A 1FHLA 5BXPA 1J12A 2CHNA 4ZFMA 2WC3A 3VMPA 7A3HA 2WMIA 2GK1A 1QW9A 3I3EA 1TR1A 2W92A 2CESA 3WFLA 5IDIA 3WDIA 1JDCA 4KGJA 1E6RA 4JFSA 2ZX8A 8A3HA 4P8UA 4PN2A 1JD7A 1CTNA 4B15A 5D8ZA 2ZXBA 2WKGA 1GONA 4UR9A 5DT7A 5CGMA 1HIZA 1MYRA 1Q6CA 4HZ6A 3SUSA 5FIPA 3RPMA 8CGTA 3VM7A 1EH9A 1JG9A 2J74A 1GOKA 1E4NA 5BCAA 3KZSA 5BXTA 2X09A 3WNOA 1K9DA 1HT6A 1XSIA 3LPGA 5D8WA 3EMCA 2PF0A 2PWFA 1OWQA 3L4VA 5I5RA 1VENA 4PMZA 3SCQA 2CYGA 1J9YA 3EDKA 1GW1A 1OBAA 3NJ3A 4ZENA 3K46A 5KZ6A 1V6VA 2Y24A 1PJ9A 5HBFA 3W38A 1V0NA 4ACZB 2J62A 5M5DA 5A8QA 1UKSA 1GOIA 4P7OA 1I1XA 2DSUA 4CU7A 1S46A 1KGWA 3VGGA 4F79A 3ARSA 3OB8A 2YL5A 3WEZA 3WF3A 3ZR6A 5A3HA 4TTUA 2O9OA 2FGLA 2JEPA 4J3VA 5KEZA 3QHOA 3J7HA 3NSNA 4PBGA 1SFSA 3ZQ9A 3VDCA 5AC5A 3BLKA 1LG2A 2XUCA 1HJUA 1OINA 4PTWA 4L4OA 1H2JA 2CXGA 1CLXA 2DSKA 3CHEA 4M29A 2WMKA 1BSIA 4QDMA 4AEFA 2DH2A 4CU8A 2PWDA 3QGVA 1E3ZA 2J4GA 1JXKA 3ARZA 4MDOA 3WSUA 1WAWA 3N18A 1DWIM 1JAKA 1KWKA 5TD4A 2JE8A 1CENA 1EIBA 3WH9A 1CZ1A 1UWUA 3DYPA 1UD5A 2ZICA 1IT0A 4HP5A 4MNKA 2EPOA 3FNDA 3BH4A 1GVIA 3B9EA 5CLWA 1E73M 2ZUWA 4F8XA 3FAWA 4DM2A 1VFUA 3W28A 4Z2HA 4TX6A 1GZJA 5BXSA 2AMGA 1BG4A 1KFWA 2QV4A 5BROA 3SCTA 1R8LA 3WD4A 3VGEA 4PUEA 4WKFA 2WW5A 3U57A 3AXXA 1GOQA 1GQIA 2CEQA 1ZS2A 2VNCA 4J3TA 4D6IA 4CKQA 5IHSA 1EOMA 1QI3A 2A3CA 2GDVA 3HU7A 1BF2A 1KGUA 5LA0A 4GO8A 3VVGA 2XFRA 4ACZA 3AROA 4PCSA 3TTQA 4W8BA 2X8RA 4GQQA 3W82A 4OUEA 1ISZA 1V6YA 1GJWA 4AW7A 5E09A 2W61A 4X0VA 3MKKA 4W5UA 3WF1A 1OT2A 2J8GA 2JF6A 3WBEA 3KL3A 1YHTA 1JDAA 4PMYA 4P7NA 4P8VA 1JZ8A 4OJYA 4PMOA 3WH5A 1ISWA 5CJ5A 4H8VA 3L4TA 1BYDA 3FAXA 4CD4A 1VIWA 1BG9A 2Y4SA 1E71M 2DPEA 3D5HA 1B2YA 3QHMA 4JCLA 2FH6A 2CNCA 1RP9A 4FK9A 2HVMA 3M6DA 1W2VA 1E40A 3F5JA 3RM8A 2J75A 1LF1A 4AY1A 1ZJAA 3W37A 2V3FA 2E9MA 3VIKA 3MUIA 1AQHA 3MUAA 2WZHA 1UH2A 5I0DA 4Z2GA 2PBGA 3CZKA 2PI6A 3BAYA 2GJXB 2BVDA 3OG2A 4LGXA 4MADA 3ARWA 4JL2A 4JKKA 5A8PA 3CHDA 4WIWA 5ABFA 4PMRA 1EOKA 4UOQA 3WNPA 1HJVA 1PZ3A 1UHVA 5I77A 1OIFA 2Y2WA 4PSPA 4KRUA 1HKIA 1QI0A 3N17A 1JZ2A 1QHZA 4H7VA 3AHXA 3BXWA 5DEZA 2EPKX 3CHCA 1V6XA 2QPUA 1KXQA 4ZXLA 2WMGA 4J3SA 1GCYA 5A8MA 2WHLA 1GPFA 2E40A 1JNDA 3T0AA 4GI9A 1ZL1A 1JZ6A 4QLJA 2J7FA 3ZOAA 1JFHA 4MTVA 3FHQA 3IK2A 1G0CA 3AS2A 1OCQA 4W85A 2D24A 5E0FA 1SMDA 1V3LA 3PZOA 5A6SA 4NZCA 1YQ2A 2YDQA 3OLDA 3CHFA 2E3ZA 3BAXA 4UQCA 1L0PA 5JIPA 3CMGA 1RH9A 2Z1SA 1HKMA 2G4FA 4OBSA 1DWGM 3F4VA 4DM1A 3I3BA 3OLGA 2GJPA 1QBAA 1V0KA 2BXZA 1XCXA 2VZUA 3AZTA 3AIEA 3IAPA 2YL8A 1GOWA 2OWXA 4OKDA 1CECA 4H41A 5HOSA 1Y7VA 1J0HA 2W4XA 2GJXA 2CHOA 4U3AA 3RDKA 1J01A 1X1NA 2Y8VA 3FHAA 2UY2A 3VD7A 4QAWA 2CBUA 3WH8A 5BWFA 1QNPA 1ZU8A 2X2YA 4WK9A 3AJ7A 1F4HA 1Z32X 2VO5A 4E2OA 3VU2A 1OB0A 1V0LA 5CSYA 2J8FA 3KL0A 2BHZA 2XIBA 4F9DA 1ZJBA 4UFKA 1KGXA 1MWOA 2Y5EA 1JZ7A 3BSHA 3PTKA 3N15A 5CPTA 2D0HA 3AYSA 3RJYA 4D6FA 4HA1A 2JIWA 1V3JA 2ZIDA 4WF7A 4AMCA 3PZTA 1W3LA 2WM0A 2DIJA 1QI5A 4OOUA 2WSKA 5CXPA 1QNRA 1FFRA 3WQ5A 4JHOA 1BYCA 5I78A 3POHA 4ZE4A 4MNLA 4W7VA 2W5FA 3VGFA 6CGTA 3WD2A 3ZSTA 2V3EA 1XYFA 1NM9A 4FF5A 1XYZA 4BA0A 4TXEA 1D7FA 5C71A 2A3HA 1XD0A 1B1YA 4XX6A 3WBAA 1MQRA 4M1RA 1WE5A 1V3HA 1QHPA 3QHNA 1JAEA 1DHKA 5A2AA 3VIOA 3TTOA 1TMQA 1VAHA 1HJXA 4CGTA 2BVYA 2PWHA 1FHDA 1XCWA 1UD3A 2WVVA 2FDMA 1SYTA 4M81A 1UKQA 4CD5A 3PBGA 2VOTA 3CGTA 3AOFA 4L4PA 4D6CA 1UR0A 1J0YA 2FHBA 3CZGA 4B3KA 1MQPA 2OYLA 1EQCA 2NT0A 4IPNB 3WUGA 1C90A 1E1EA 1JYXA 1B3ZA 3PZNA 4D6EA 1AVAA 1W9VA 5ABEA 4J7RA 1W3JA 1E5NA 3W53A 4AWEA 1B3WA 5I6SA 1H3GA 3UERA 1VEPA 2XM2A 3ZT6A 1GHSA 5E70A 1XH1A 1E3XA 5I79A 2DDXA 5HDRA 5HNNA 5GNYA 3CBWA 1B3YA 2X1IA 3TTSA 2VRKA 3QOKA 4NRSA 3ARPA 2XGIA 1UD4A 2OWCA 3AIWA 4HZ8A 2C0HA 2J25A 4B3LA 2OWWA 1B3XA 1C93A 1E5JA 4D6JA 3T09A 3WELA 2YKKA 3GBDA 5CQ1A 3PZUA 5A8OA 2IXUA 1MFUA 2VQUA 4FLQA 5JBEA 4UFHA 1WP6A 2JEQA 3RO8A 3OGVA 1HL8A 4UFJA 2YOCA 1JGIA 1UQYA 2VZTA 1UZ1A 4A3HA 1CXFA 3VGHA 3ALGA 2BS9A 1W32A 1US3A 4QLLA 1UWSA 3LPPA 3LMYA 2F61A 1KCLA 3WQ4A 1XSJA 4OOZA 1LL7A 4P7RA 3ARQA 4CVWA 1LWHA 4QLKA 2EPLX 4KMQA 3VTRA 1KBBA 1HP5A 2ZUTA 3DECA 3SUTA 2E0PA 1JZ3A 2WMJA 3K8LA 4JFUA 1G9HA 1OGBA 1W91A 4AZIA 2DT0A 1O7AA 3DC0A 2YJQA 5FCZA 1H09A 4J3WA 2CITA 1GORA 3FXYA 1OIMA 4UQDA 1NOUA 2ZUMA 1BQCA 4DUWA 3UEQA 3MANA 4M56A 1EHNA 3WEMA 3FW6A 3AHYA 1TE1A 2PWEA 1V3MA 2YBTA 2D1ZA 4PYSA 3W29A 2WPGA 3VDAA 2VZOA 4AZBA 4EAMA 1BAGA 2VMFA 4JKMA 5DO8A 4Q22A 1JI2A 2YA1A 4J3UA 4TVDA 2G3NA 3CZEA 3AYRA 3CUFA 5FOOA 2BY0A 3SUVA 5AYIA 2D23A 3PZIA 4MNMA 3AFBA 4IUGA 1TZ7A 2XSBA 3N12A 1JI1A 1N82A 4EKJA 1CGYA 2QLYA 4GPNA 2JFEX 2V5DA 4CCCA 1KBKA 3WD3A 3I3DA 1WZAA 4AXNA 4EK7A 2JIEA 4FLRA 2MANA 2JALA 1W1TA 2J78A 2VJXA 1G94A 4LPCA 3M7SA 3WUEA 3EYPA 4LQ1A 4AD5A 2EO7A
chains in the Genus database with same CATH superfamily
2OO0A 3EDEA 4R9OA 2PP1A 3F4WA 3DHFA 2R91A 3W85A 4TX8A 5JBFA 3WQ8A 4UUIA 5C2XA 3GDBA 1TCMA 1R9ZA 2G4JA 3MHFA 1Q8AA 1EDQA 3D3AA 4LUTA 5EB8A 3CUJA 3GXFA 1UYQA 4GFIA 1CW2A 2RDTA 4MUZA 1JYNA 4ZBCA 2E67A 3N73A 4KWSA 2V63A 2XVNA 2WLZA 2F6UA 4TQTA 1E0UA 4MAZA 4RE2A 1Q6EA 3IIVA 3WEOA 1WDPA 5F1VA 4FNQA 1XIEA 4HKPA 3SQMA 5HR7A 5C9WA 1IZJA 4Z1AA 2GOKA 4DQWA 3P0WA 3UFYA 3W7GA 5DQPA 5CGTA 5KZDA 4TVUA 1HN1A 1QBBA 4DXXA 3SW6A 4CD7A 1ADSA 4X2PA 1VYPX 1HVQA 4H8UA 1E72M 1VFOA 1MFVA 3K1DA 2PPGA 2VENA 4PZVA 2FVLA 1KRAC 1CDGA 1I75A 3L4YA 4AAJA 1MMFA 3O9NA 1SFTA 2VVSA 3CTLA 3KBNA 3NCOA 3PS7A 3OVQA 1C9WA 1HUVA 2PA6A 2OXNA 4S3FA 3DFTA 4U5KA 1LT7A 2PDCA 2UY5A 3MDWA 3LY0A 4ZZ9A 3FXGA 2BNJA 3PF3A 3VMOA 4O4WA 3E38A 1SZEA 4JFWA 2P88A 3ZJ7A 1U5JA 2W66A 2X0HA 2C15A 4US5D 3TOPA 4C6DA 4C6KA 1OFAA 1EP2A 1ELSA 5EBUA 4YTSA 1VD6A 1Q6OA 3UXAA 4HNTA 3G22A 4NZFA 5JBDA 3SCNA 2GQ8A 3KS6A 4H3DA 3B04A 1EX5A 1ZPTA 3N19B 1ZAHA 4ZA0A 2G37A 4X63A 3BDKA 3L4ZA 2ISDA 5GQBA 3HMCA 1LL4A 1LRNA 3ITOA 3VPLA 2C14A 3HG5A 3EPNA 2EPNA 1SJAA 2I16A 2TAAA 2DSVA 4Z2KA 4AHQA 1M53A 3WDHA 3PJXA 1GUVA 3GKFA 3SB0A 3KRBA 4U5IA 3WNNA 3AIVA 3PSWA 3T2QA 1DE6A 4ROPA 3S46A 3F5LA 4KRZA 1FQ0A 3S5SA 1QNSA 1VBUA 5A6BD 3NUKA 1QVBA 3U6WA 4K2SA 3W25A 1M7XA 4A3UA 2Y89A 3NFUA 4GC4A 7PTDA 4G5DA 4JTFA 2ZXQA 3W7DA 1ZSXA 1PE1A 4BQ5A 1O5KA 4WY0A 3BANA 2PWVA 4IGNA 3S2CA 3T42A 4K68A 4AISA 5MHBA 2HK1A 3CL8A 4AWSA 1JQVA 4IXHA 1UKPA 2WBKA 1OADA 3GVGA 2E09A 3KEHA 1KA9F 3UG5A 3E2SA 2J7BA 2CU0A 2FGBA 3IANA 4ATLA 3RXZA 3GG7A 5EGRA 3RUBL 3GFZA 4OT7A 1HF6A 1EJVC 4F0HA 3C0JA 2YA0A 4F9JA 3VNLA 2V9DA 4KRTA 4ZCWA 2D3LA 1TPFA 4O16A 4DWSB 4JYEA 2HS8A 1TPDA 4KWVA 3WQOA 4Z42C 3CPRA 3MW7A 3PVFA 5FEPA 3W27A 4WJXA 4MDPA 1PAMA 3NDYA 5ENLA 3WX7A 4BF7A 3T07A 1QW7A 4C91A 2RDWA 4YWSA 4UZSA 4XKMA 3SY5A 2OFJA 3EB4A 4NUWA 4NVTA 3ZVIA 2V2DA 2WHJA 3IIZA 4XZBA 3SCPA 1DJWA 1E4LA 4IMDA 4RE3A 3TEVA 1BVNP 3LCXA 1TV3A 2H6RA 4LVFA 1XUZA 1J6PA 2ZZ1A 5HPCA 3K2GA 4LBUA 3DX5A 3RLUA 5M17A 4DJFC 4LT9A 1MW0A 4FR6A 3W2KA 5I02A 5LZLA 1XUUA 3NM1A 3GNRA 4H6RA 2P5NA 4H00A 2WBGA 1MUMA 2QJHA 3TE9A 4MIMA 2CBJA 3QSRA 1GQLA 1E6SM 2O92A 3K1GA 5CC3A 3UYIA 2FFIA 4AWTA 5CEWA 4H9MA 4DWSA 3TW6A 1E9IA 5EMLA 1QI4A 3TXZA 4W8AA 1XHGA 4M24A 3IIPA 1D3GA 1HNYA 4WY0F 3VX1A 2YBVA 3GXMA 3LHVA 4H9XA 1TVLA 3AO0A 3WLPA 1DEDA 1UH3A 3COTA 2ZZ2A 5EFDA 3UP8A 4K7VA 2CLPA 3UJFA 3II1A 2Z1BA 1H0GA 4MB5A 3W01A 1THFD 4RZ5A 2CWXA 2OOFA 3APGA 2E77A 3E49A 3GNXA 4V27A 2POZA 1JCYA 2PGWA 3SQLA 1F2JA 3V5CA 1XLAA 2ZX9A 4RDWA 4G1NA 5AOUA 2W62A 2WCAA 1MEHA 3NPUA 2WWCA 1NFBA 1QPNA 6TIMA 3KBJA 3BC9A 3BQ5A 4NSBA 4N6EA 4K7YA 4XO6A 1HJWA 1TV4A 1VJSA 4HSOA 3UF9A 1O1ZA 3O16A 1JQXA 4ATDA 1CX9A 1DHPA 1S2VA 4IP4A 4IJBA 4CCDA 4NNAA 2HPMA 2D0GA 3LLDA 1YIXA 1EJ7L 1ZJHA 4N02A 2GQ9A 1VFMA 2PD5A 2RFGA 1PBGA 1SZNA 1UKOA 1Q6QA 4DVOA 3DC8A 2DEPA 3U4AA 1TWIA 3W0KA 2Y85A 1BTMA 2P0OA 2DV0A 3IRDA 3STPA 3W1QA 3VOIA 1XLFA 2D0FA 3NQAA 4AVFA 5FF3A 2XVGA 5AYBA 1R2TA 5M1TA 2IKHA 4Q8QA 4TMCA 1DJXA 3IIOA 4XBKA 3MMWA 2I9UA 3SEPA 3CLMA 2WXDM 2FIQA 2F8QA 4U3CA 2XWEA 4DLFA 4X9YA 2XTKA 5KSWA 2NQLA 2VFHA 4HNNA 4HSHA 1LQ2A 2DVTA 2OEKA 4EPEC 3CJPA 4LY8A 1FDYA 2WOQA 5FJPA 3UR5A 3QY7A 1JD9A 4L6OA 2E25A 1EX1A 4HVXA 1H7RA 2CKSA 4GQBA 4HMCA 5GNXA 4Q8NA 1Z44A 3VKBA 3QGAC 1S2UA 3NPXA 4AZHA 1F05A 4YNGA 1IWPA 1I60A 1QPKA 5D2XA 3L68A 3A22A 1GG0A 1EJSC 4QG9A 2BSLA 1GOOA 1AZ2A 2HCVA 3VM5A 2QPXA 4K39A 1K70A 2EF9A 4WEVX 4JCMA 5BMXA 1HJQA 1QWKA 4LWWA 5CZKA 3GXDA 5F4SA 4UTMA 1QW8A 2GZXA 3I7SA 2VZSA 3MTWA 3TV8A 4LUJA 4ERGA 4HOXA 1UPMB 3NL6A 3SSJA 2EG6A 1MRAA 5A95A 1W9DM 4URIA 4QAIA 1V08A 4QFUA 3RU6A 4UZUA 5D2TA 4C5ZA 4U2YA 3LSBA 4QRNA 3VABA 1XQKA 1K7FA 1RD6A 3UWVA 4O0ZA 4AD3A 3I7QA 1OC5A 3NG3A 4D1IA 2CZFA 3H22A 4HK5A 4TVCA 4AEEA 4K1WA 4MZ1A 3LM7A 4O57A 2A6LA 1KTCA 2C0AA 5IXEA 2PBOA 3OZPA 2J66A 3OTRA 4JEJA 3AYVA 4CNPA 3O05A 3FN9A 1DJYA 3MU7A 3AYTA 3NOEA 4C1NB 2ONEA 3M0XA 2POTA 1H1YA 3MHGA 4NASA 2TSYA 3WF0A 3NM3A 3ICJA 1W1VA 4DF1A 1SVDA 2EJAA 2XDFA 3TQVA 1K6AA 2GVJA 3W74A 4GCAA 3IJ7A 1CB2A 4IPPA 1LUCB 3TYCA 3ZM8A 2J27A 4W87A 1W8GA 2YIHA 2J7GA 5F2IA 3ARYA 3HG4A 5BW6A 3LV5A 2Y0FA 3FJLA 1AQ0A 4DUXA 4QHRA 1P0DA 2FZ9A 4ZQRA 1GT8A 3RCNA 2W91A 2NX9A 2V69A 3LBOA 3HV8A 3WDQA 3B0VC 3RILA 4IHCA 4YVPA 5AVNA 3MYPA 5J04A 3FEMA 3HPFA 4Q8MA 4DB7A 1IEVA 4GX8A 1JNEA 2FGZA 2V5JA 1G4PA 1MW1A 2XFWA 4ICMA 1H7PA 2ACSA 4JIQA 1A3XA 2ZYFA 2OMAA 3EOSA 3H2EA 1HFBA 2YPIA 3G6LA 2QR6A 4PUDA 4XAFA 3H7RA 1X38A 4PE8A 1F4AA 1XLBA 1FDZA 3S2NA 2NQ9A 2EPMX 5HQMA 2P3EA 4BQ3A 5HMFA 2QCCA 1GZGA 1GYMA 4HPJA 4XK2A 4GZJA 2A1YA 1XLGA 1PKNA 1KRCC 1AW1A 1LUCA 2JQXA 5DMYA 3WJXA 1U1UA 3UPBA 1MDLA 1NWSA 2A3EA 1JYWA 2R14A 2Z29A 1RPKA 4UOZA 3GW3A 4L1WA 3T4CA 2CBVA 1XG4A 4ZO9A 2QUMA 2DQXA 5HUPA 5I2UA 2QNEA 1F3XA 3UETA 1TE6A 3VGDA 1TIMA 3T2OA 1OD0A 3HPSA 3BE7A 1NWTA 3BMXA 2O9PA 1P48A 3AIQA 4EF8A 3R43A 3BAWA 4V15A 4DJDA 2ZKMX 3K8MA 2QVHA 1CBGA 4DN1A 2PCQA 2ZBTA 4J27A 1CB7B 1LWIA 4OHQA 3WDRA 1JL8A 3DCPA 4LXFA 4DLMA 4QJ4B 3OVRA 3ZMRA 4CCEA 1HVXA 3GO2A 1JPKA 2GVGA 2UZ9A 3SSZA 4XAZA 1PO9A 3OLEA 2PDPA 3TWAA 4IMGA 4Z2JA 2DT2A 4CQ8A 3UESA 3UJEA 1FA2A 5C7HA 3ALFA 4LYKA 1HGWA 4H01A 4NJKA 3MSDA 1P4CA 3BMVA 4MYAA 2QPSA 3C86A 2OT0A 2UY4A 2A7RA 2GPTA 1GWJA 1AD4A 3THCA 3IVSA 2XZ7A 1EJWC 1F61A 1ZNNA 2GSJA 4LTSA 4C6PA 3KDNA 5CBJA 4IGMA 1DJGA 3PG8A 4BR1A 3ZWTA 2RKXA 4LC6A 4LCQA 4J1OA 5F4WA 1JIBA 3B05A 3BV7A 1PS9A 5BRPA 3URNA 1Y5XA 2BBFA 1UWRA 3LXAA 3VOHA 1OG0A 1XYBA 1U22A 1OFRA 2WMFA 1F6KA 3P61A 4R88A 3GUGA 1VB9A 5HWNA 4ERIA 2IQTA 1TUXA 2DVUA 1KLYA 4REQA 5G5IA 3ITVA 3GVQA 3RX3A 3DGRA 4KKXA 1XQLA 3CPGA 1ICPA 4Z1DA 3C6CA 3WMBA 4Q8OA 3WFZA 1C9DA 3TQ0A 4ZO6A 3VFCA 3WN6A 2GYIA 1YPXA 3NEHA 2E9BA 1SU5A 4AC1X 1KR1A 1HP4A 1Y5VA 4PTNA 4H7ZA 3W1XA 4JX4A 2FQIA 2QVNA 3KM8A 1RP8A 2C7FA 1O1HA 3OVPA 3TONA 5CG0A 3MB9A 3PP7A 4NKCA 2XFYA 3ANUA 2Z6IA 2V2HA 3D3FA 2PWUA 2V38A 1UWQA 4IM4A 1RBAA 4WGHA 2PWGA 4L5ZA 4O28A 1OFBA 3SURA 1RR2A 2GUUA 4MF4A 4IIHA 4F0SA 2INFA 2E68A 2J79A 5C9UA 3CQKA 3TW9A 5CZJA 2J24A 3TLQA 4AD0A 4XBJA 1J11A 1GOXA 1RY8A 1TMLA 4YIWA 4MJ2A 1VJIA 4RXFA 2Q3OA 4E38A 5F2LA 3AS1A 3RIKA 4JTSA 2V2CA 1R7AA 2VX6A 3N4AA 5EY5A 4Z17A 3GHSA 3A3XA 4N9EA 2DH3A 1FH9A 1AJZA 3ARVA 1J4EA 4OV4A 4ENLA 3P5YA 3GYEA 4O1AA 3N4EA 1KBIA 3WBYA 3GKAA 4ZMGA 3IJLA 3CMJA 1H41A 3Q4DA 4XAPA 3ZVHB 1RA0A 3ONCA 1Z42A 4JTEA 1R85A 3R0DA 5EMJA 4ZOBA 3M44A 7TAAA 1GPWA 3QQWA 4XZWA 5D38A 2GK1B 1LG1A 4RE4A 3SN4A 3IJQA 3WF2A 1BVZA 1OT1A 3KOWA 4F40A 4YTTA 2HRWA 4I8YA 5BRQA 1BTCA 3IJ9A 1JZ4A 4XO7A 2CC0A 2BY1A 3NZGA 3GH7A 1LBLA 4AZ7A 1AH4A 1EO5A 3PBVA 3R0KA 1GQJA 1WDRA 3GH4A 2P53A 5BWAA 4UWMA 4MY8A 3DHUA 3NIYA 3LGEA 4WXYA 5AB3A 2Y5SA 3NVDA 2DIKA 1KV8A 1ZBWA 2XJ7A 4RR4A 3L2MA 4Q4SA 1LBFA 1LRQA 1XLDA 1V3KA 4WSHA 1B3VA 1HGYA 1XR2A 2XGZA 3CL7A 3TCEA 4BFAA 2TPSA 1FOBA 1K3UA 1GKQA 4XZ9A 4IICA 1XP3A 5KZMA 2CZEA 4MB3A 1MNSA 3VKJA 3QFEA 1Q3NA 3B4UA 4CD6A 4GI6A 1JRCA 1Z3NA 1QR7A 4IPLA 1PZ0A 1KXVA 1FHLA 3PPHA 1W1IE 2GK1A 1G7UA 5DMLA 2QCEA 3W1RA 4X3ZA 3UR2A 4NX5A 5LNSA 1AH3A 3HFYA 4UR9A 5DT7A 2WZMA 5FSDC 3UY7A 1HIZA 1IWBA 1Q6CA 5AZ1A 4XZHA 1AW5A 2C79A 3D6NA 4HMNA 3QW4B 2H8ZA 2J74A 5CZSA 3JS3A 2O4MA 2DZAA 1M41A 1K9DA 4K1GA 1OFQA 2D73A 1UCWA 4G7EB 2PF0A 2PWFA 4LAOA 1RALA 3MKVA 5SWUA 1AH0A 3LZ3A 1VENA 5T9CE 3SCQA 1J9YA 2X7WA 5FEZA 1GEHA 4RNIA 5HBFA 8XIAA 1V0NA 1S1RA 3B97A 3UWUA 5A8QA 3UZWA 1GOIA 1DV7A 1N8IA 4O0QA 1ZP4A 2HNEA 4JYFA 4F79A 2BLEA 2PDQA 3GY1A 4UTKA 1EJUC 3UWWA 1ADOA 4Y9NA 3J7HA 3GIQA 3H70A 5HUOA 1SFSA 3DFQA 3TX9A 2GJLA 3ZQ9A 3QLDA 5DCEA 3VDCA 3BLKA 4E6MA 4LNCA 3TLLA 2XUCA 4PTWA 4EVZA 4RZ4A 2CXGA 4PB4A 1W3TA 3ZFHA 1UIPA 1BSIA 4EPKA 3S9ZA 4GE8A 1E3ZA 3TJLA 3E2RA 3CV6A 3N18A 4XZNX 1DWIM 1JAKA 3WK1A 5TD4A 1QASA 4MJMA 5AECA 3UWQA 3DERA 3TNOA 4C1LA 4WZHA 3G0UA 3VKDA 1E73M 4G7EA 2GL5A 1VRDA 3W28A 3DUGA 3BCJA 2FB3A 3DI1A 3MO7A 1Q8JA 1YBQA 3SCTA 1VYSX 2WW5A 3AXXA 1TELA 1GOQA 1GQIA 2QUVA 2CEQA 1ZS2A 4J3TA 4D6IA 4CKQA 1ZGDA 1EOMA 4N9DA 3HU7A 3W7MA 5LA0A 3E6EA 3U2CA 5EA9A 3LOTA 4W8BA 1IT8A 4QSHA 2BB0A 3P62A 4GQQA 1DQXA 1OFOA 4B4FA 3TYDA 1P0KA 1WDDA 3K13A 3H26A 4JTKA 4X0VA 3TU9A 3S2JA 5LXEA 4KCWA 2JF6A 3B8TA 1ZY9A 4P7NA 1I9CB 4C6LA 1J8VA 4KEVA 1W1ZA 4H8NA 3WH5A 1ISWA 5CJ5A 1BYDA 1EP3A 4CD4A 3GUWA 2Y4SA 2DPEA 1B2YA 3LM3A 4B92A 2AQWA 3BUVA 4US6A 3C0SA 4OU1A 3M6DA 3GNDA 1E40A 4QXIA 1ZUAX 3F5JA 4MVAA 3HIJA 4J4KA 1EXBA 1ZJAA 3G1FA 2UBPC 2V3FA 2E9MA 2E1DA 2YXXA 3WZ0E 5C6MA 2XIJA 1UH2A 5I0DA 3CZKA 5H2ZA 3G0XA 3KRSA 1KFLA 3PC0A 3WLHA 5A8PA 3CHDA 3KOXA 3G77A 4MJZA 4EF9A 1E9YB 2JKEA 1PZ3A 3AU6A 1Y8BA 3B9NA 1XYMA 1GVQA 1H63A 4MY1A 4KRUA 1QI0A 1QHZA 4H7VA 3AHXA 2EPKX 1V6XA 4RXGA 4E3VA 1KXQA 2ZC1A 3TR9A 2IKJA 1GCYA 3KFTA 4LVBA 2QJIA 5FAGA 5CCZA 1ZL1A 1JZ6A 4QLJA 2J7FA 1N8FA 3ZOAA 3PK7A 4MTVA 3FHQA 4BEQA 3AS2A 4W85A 3R58A 4A21A 3W7CA 3GXTA 3P6LA 2QW5A 2FVKA 1K6WA 1YQ2A 2YDQA 1H7OA 4FXRA 3KX6A 2E3ZA 5JIPA 3CMGA 1HKMA 2G4FA 1VCGA 4OBSA 5CBIA 4B2DA 3I3BA 2JKAA 1FTXA 3W1LA 2VZUA 4QROA 2YL8A 1GOWA 4LU0A 1R2SA 1YXCA 1R2RA 5HOSA 3V3WA 1W17A 2W4XA 5C2GA 3C3NA 1J01A 2Y8VA 3LMZA 2IKGA 2VO5A 4E2OA 3CIXA 2J8FA 4OVXA 5K7JA 3M7WA 1JUBA 1HZYA 1AMKA 1W5MA 1W5QA 5HJLA 4NL1A 2DQWA 2W9MA 1ME7A 3H7VA 4JTGA 4KQNA 5FF0A 2ZIDA 4WF7A 2WM0A 1S3TC 4CQDA 2DIJA 3NL3A 1QI5A 1RCQA 2DZPA 4UTLA 3T1GA 1Q7ZA 3QZEA 1QNRA 1OQFA 1KTNA 4JHOA 3OO2A 5K9XA 1EPXA 4ZE4A 5AC8A 4W7VA 3VGFA 3CIWA 3RITA 3ELFA 2FPVA 4LV4A 1XYZA 4R34A 4TXEA 1W8SA 1B1YA 4PRRA 4UMBA 1IIHA 4HSNA 4H9TA 1YNPA 1F07A 2B7OA 3W86A 3VIOA 3TTOA 2YZ5A 1S5MA 4JX6A 1JCMP 1FHDA 2DFAA 1WDWA 5HMSA 3B40A 1KM3A 3KTSA 5EKYA 4HNLA 2O4QA 3CGTA 4L4PA 3C3UA 4S3BA 1UR0A 3MYOA 2OYLA 4IPNB 1C90A 1E1EA 2MNRA 2V82A 4UTTA 5LIKX 3FGCB 1AVAA 3BLOA 1W9VA 3MCNA 1YE4A 3W53A 8RUCA 1TWDA 4FI4A 4XD6A 4PCFA 3UERA 3RAOA 1MSSA 5AHIA 2YCEA 2DDXA 2IMRA 4ZOCA 2X1IA 3MI2A 2A4AA 3N2XA 4LAZA 3ARPA 4GISA 1FUYA 4DBDA 1TTIA 4HNUA 1C93A 1AUSL 1GZ1A 2PDKA 4RK8A 3PZUA 1QK2A 4FLQA 3SY8A 4NAEB 4C1KA 1XI3A 3PJUA 4B5TA 5LHEA 5JBEA 5HNUA 3BWWA 1Q45A 4CCZA 1EJRC 4MM1A 1CXFA 1G6CA 4JTHA 1W32A 3FS2A 3MJYA 3GU1A 4QNEA 3QYQA 3WQ4A 2YW4A 4OOZA 1LL7A 4AY8A 9RUBA 3FYYA 4IL0A 5HWJA 3ARQA 5LGZA 3U2EA 1T6MA 1P6BA 4BHYA 1R0MA 1KBBA 1HP5A 1VHCA 2ZUTA 1N55A 3A23A 2E0PA 4L9ZA 3QY8A 4QJ1A 3K8LA 4JFUA 4GVHA 3CWOX 3JRKA 4FIQA 3TSDA 1XBYA 3UZJA 2DT0A 2BMBA 1H09A 4K37A 1OIMA 4W9TA 4M56A 3SBFA 2FMOA 3U2OA 3AHYA 6REQA 1ME9A 2OEMA 1WV2A 5CKSA 2D1ZA 4PYSA 4U4MA 1IT7A 1LYXA 2NZLA 2OQLA 4YYCA 4LB4A 1YTEA 1ML1A 3FCPA 2B7QA 1YKWA 1N8WA 3LHUA 3FYOA 4HCLA 4DNHA 1TZ7A 2ON3A 4LW7A 4WCJA 4EKJA 2QLYA 3QSTA 1WA3A 1NQKA 2A79A 2R8WA 2HK0A 3GVRA 1F9CA 4EK7A 2JGYA 5KMYA 3S47A 2EKCA 1X8CA 4C6FA 3NR0A 3BJFA 1VFTA 1QOQA 4B5UA 1S2TA 4LF2A 4E2DA 4H2HA 3CZ8A 1AA1B 1HJSA 4G9PA 3LCFA 3AMCA 4GBUA 2E8YA 2OR2A 2QZRA 4RDZA 3H2NA 2NV1A 5U4NA 3SCUA 4Q7BA 1J18A 1JUEA 4MLRA 3R94A 1UKTA 4NF7A 1ITCA 2GVYA 1UP0A 4S23A 1OX5A 4DELA 3PZ9A 1XW8A 5FJIA 2HVNA 2CLMA 3VE7A 3BAKA 1IEXA 2I9EA 5DCDA 1LRTA 2A3AA 1H49A 2OEJA 2YFNA 5HULA 1BLIA 3GDKA 3L0GA 1MNZA 4E3TA 1HL9A 2YZRA 3AXHA 3QVQA 3S83A 3SQSA 3CTTA 2X0YA 1VKFA 2ESCA 2CCRA 4M6PA 2R9RA 2YCLA 1YXDA 1J5TA 1FFQA 1GHRA 1EYWA 3ZJ6A 3A4AA 3E0IA 3MDUA 5ABGA 3CEPA 3WFAA 1WZLA 4W88A 3H6OA 2D22A 4O53A 3RLHA 3WENA 3TFCA 3GBEA 3E5PA 3OZMA 1TB3A 4XIAA 3AHTA 5B7YA 4MPKA 2ZX7A 1O66A 3W1PA 3RLGA 3TW7A 3HFTA 3P81A 4UQEA 3EA3A 2P1FA 3TQPA 1FWEC 3BOFA 1E1CB 1H4PA 1O4UA 2PE4A 3TTYA 2AL2A 1X7FA 1WXJA 1UBPC 2ACUA 2BY3A 4IMCA 3IGUA 3EZ4A 3TYEA 4E4FA 2E6FA 3R12A 5K4XA 2HPIA 3VO0A 3CAQA 1KB3A 2XG9A 1UH4A 2P3ZA 3O63A 2VFDA 1GYNA 5IRPA 4IOTA 3GD6A 3C0LA 4JDYA 1HW6A 2BV9A 3W6YA 1NARA 2F2HA 3R89A 4NNCA 3MZNA 1P0EA 3PG9A 3OA5A 4U33A 2ZUVA 1KFCA 2WMHA 1XH0A 3EKLA 3BLEA 1EFZA 1JFXA 2R6OA 4IQDA 5ABHA 1SO6A 1W1PA 5D9MA 5DY3A 3SUWA 4UXDA 4M82A 3NDZA 1IEIA 3I7RA 1F7BA 3V18A 1X8FA 1XLLA 3R79A 1VLWA 2PEVA 1NF7A 5K9DA 3MZ2A 1QPOA 2FLIA 2XIMA 3UPWA 2NXIA 5HXMA 4EE9A 4D6DA 3HGJA 1KCZA 2CLFA 2YDRA 1ALDA 2Z26A 3AMKA 4HMEA 2XH4A 3MV01 1TVPA 1RXOB 3EMZA 3G6MA 3SDOA 3PJTA 1JCJA 3T08A 2Z1KA 4NJHA 5C5YA 1EUNA 4FA3A 4IIBA 3HURA 1FXQA 2J7EA 4KW2A 2KAUC 5I3IA 3ZJ8A 4MWAB 5FEWA 3EEZA 1UR4A 1TYGA 1W56A 4R27A 3DKJA 1V02E 4XB3A 4GWEA 3L4UA 1M65A 4HNOA 1JF6A 3NSMA 4ZXOA 2CHRA 1U30A 1PKLA 1ESWA 1PZ1A 1HQTA 3VIHA 1TCDA 1BPLB 1C91A 3BW4A 3W24A 3MI3A 3USZA 2F9RA 2GGIA 2PZ0A 1KKRA 4HA4A 4MGGA 2V5KA 3HGRA 1V02A 4O8AA 3KHJA 3VOCA 1Q6DA 1KR0A 4BWLC 3ITGA 3HG3A 1TV7A 3HBLA 4IFKB 3PTQA 4L80A 3UJRA 1E4MM 1K9FA 4KS0A 5L9FA 2EEXA 3AAMA 4WVXA 1UR1A 2Z1VA 1U1JA 3CZJA 1O12A 3UZZA 3BG5A 4DWSD 2C91A 2H90A 1IE7C 5EYWA 4C6MA 1D3CA 5I23A 3WG6A 2YBUA 2J9XA 2HWGA 3K4AA 2Z6JA 4A22A 4Y8EA 4AD1A 1KBJA 1VYRA 1G1YA 2AL1A 3KVMA 4PB3A 4GNJA 2A5HA 1DWAM 5BZAA 4GABA 4KEMA 4N6FA 2GVLA 4K8EA 2DIEA 3GYCA 1ZLPA 1KFEA 1XIFA 1L6YA 4FF7A 3QV6A 3VAVA 1PWMA 3HJZA 4MG4A 2XVLA 4PFMA 3W7NA 2GGJA 4JXCA 1W3KA 3M0KA 1R86A 3PAJA 4OWGA 1MXGA 4H2CA 5MKGB 1KXTA 3GC4A 1YW1A 2DVXA 4JIEA 1F3TA 2FTYA 1FRBA 3LQLA 3WQFA 1XLJA 3BMWA 3GC5A 1E0VA 3IGXA 2VVNA 1N7KA 5AC4A 3EDJA 4IX2A 4WOQA 4S1FA 4IFKA 3N3TA 3EDFA 4W8LA 1FWNA 3QPZA 1N2VA 4O50A 4A8LA 3TK7A 3N6QA 3AMLA 1JGMA 3PUEA 2PDUA 1TTPA 3UJ2A 4ALDA 3PM6A 2WJDA 4LBSA 4DJFA 3NQ8A 1UA3A 3EWYA 1OFDA 1YDOA 2F38A 4HPNA 4PTMA 1PPIA 2VCBA 1W9PA 4BF9A 1QI2A 1L6FA 1MZRA 1DYSA 3QMRA 4QEHA 3SRFA 3L4XA 1J0IA 1F76A 2EQDA 2ZE3A 1I2PA 5E5CA 3VX0A 3WLOA 1HKWA 3E96A 5C7VA 3AZRA 4DO5A 3D46A 3PUOA 3DI0A 4NJIA 4QQ3A 3GH5A 2DGAA 3BW3A 3M0HA 1UR8A 3KRUA 4UFIA 3TNBA 6TAAA 3IEBA 1A0CA 3WY1A 3RPTA 3HV9A 4WDXA 3M46A 1ZBKA 1IHIA 3GDMA 3A9IA 3V7PA 1EWEA 3G1VA 2NX1A 4DX3A 1TG7A 3VI2A 5FI8A 4XD4A 2GVEA 4GO9A 3M16A 5ECVA 3OGRA 4P7LA 3N4FA 1W3NA 1KM4A 2PF8A 3BZJA 4LEFA 3OYXA 4FXSA 1PYMA 4S3EA 2XFFA 2Q8ZA 1CT5A 3N6HA 3E0FA 3ENLA 5LGXA 1X6LA 4JD4A 4JOMA 3PBYA 3NQ7A 3M0LA 1B3OA 3SFWA 2VR5A 3OZOA 4UFMA 4KETA 1TWZA 4E8DA 4CNNA 2DZVA 4MPQA 2CW6A 3G3MA 3W7HA 1YDVA 2P50A 3VMNA 3VNJA 2YLAA 4I7WA 3L0KA 3UJSA 3VILA 4J2MA 2ZCGA 4QG8A 1WXZA 4UNIA 3W26A 1E9LA 2F7FA 1FWJC 3F03K 3THAA 5TIMA 2Z27A 5G4EA 2NVDA 3DFSA 3NQGA 4J2PA 3AI0A 1DP0A 4MFEA 5GNZA 4CQBA 3WUBA 4M7TA 3JZEA 1XLMA 4AIBA 5EFFA 2ZE0A 3FY1A 3H4WA 3SZ8A 1UC5A 1OYBA 1SJCA 1KCKA 5H1WA 1IXQA 3AIBA 3T8QA 3CQHA 3FJ6A 4LB3A 2HJPA 3BGJA 3MT1A 2QEZA 2QMKA 1R7OA 1B4EA 1FWWA 3U5YA 3CM4A 1NJJA 4ML9A 4JFVA 1L6GA 4EANA 2CLEA 1XRFA 3PHAA 4JZ5A 4YHEA 4QM1A 3M5ZA 3SCWA 3I65A 4M19A 1UOKA 4GQRA 1XRVA 1WDSA 4IFOA 4D1JA 3S6DA 5E1QA 2DZTA 5GPRA 2WPBA 1LQAA 4IQLA 3CIVA 4IISA 2QKFA 2VEMA 4PMQA 2HBXA 1TVNA 1Z41A 2WK2A 3S5NA 4BQ4A 1K7XA 4Z08A 1FWIC 5LNUA 1KXHA 4B16A 2FH8A 3R0UA 2EGZA 1G7VA 3PUDA 4L9YA 4PTVA 2GOUA 3WQCA 5FJJA 1IYXA 2ANUA 5FESA 1XLKA 2FZMA 1O94A 3O8AA 4O4VA 1LQ0A 5AFDA 3A12A 1HO1A 3DENA 2QS8A 4GOAA 1E43A 3CC1A 2Z24A 5CPQA 3STCA 1GYLA 1K02A 3EWZA 1XKYA 1Q4WA 1SPQA 5ABFB 4B5SA 2CPUA 3RPDA 4W84A 5LIUX 3ZIZA 3QM3A 4RNJA 3S5YA 1QCWA 3WJSA 4OZOA 3N3MA 2XN1A 4AZ5A 3CV2A 1OZQA 3GTIA 4PBFA 4WKHA 1RVGA 1QHOA 1G01A 2MUCA 1M03A 3LXBA 4CVUA 4US5A 3HPAA 1X39A 2PURA 3BO9A 4I9JA 1QUMA 3VK5A 4V33A 3W7LA 1P0NA 3S9YA 3G2GA 3LCWA 4YCPA 1H11A 4NI8A 2G3MA 2JKPA 1XL9A 2BGQA 2PC8A 3MI6A 3NSXA 2PDWA 2J47A 4TX9A 4XKYB 5BYWA 1TRIA 1K9TA 3GU9A 4Z2LA 4ZGYA 3W1MA 3UWEA 2WV8A 1M9HA 4JPGA 1WDQA 2QCLA 3BCFA 4BI7A 4H6EA 3HPXA 3PSVA 1Q2RA 2BVWA 3PWAA 3T05A 4AZCB 3GFYA 3QLLA 3WF4A 4KPLA 4H04A 2H9AB 1KNWA 3HN3A 4GJ1A 4B3ZA 1YE6A 4BCEA 1XSKA 1OJXA 2E6DA 4F0MA 3CUIA 3A4WA 4H8HA 2NQ5A 1QJWA 3KLLA 3GAYA 2DU2A 4S3KA 1HL2A 3H2CA 2A85A 4CQCA 2BVTA 2HV5A 3IUDA 1PKMA 1VEOA 2PCEA 4FMVA 3WMCA 2Y1HA 4GHRA 2V30A 1J0KA 1UZ4A 4RDVA 3IV8A 2I5QA 5T8GA 4NI3A 2YCJA 1IZKA 2I57A 1LLOA 1XBXA 4G1KA 4ZR8A 1FKXA 3IWPA 4NP7A 1H50A 1X96A 4I8DA 3UCDA 1XV8A 1WB0A 1DWFM 2PLMA 3B8SA 4AH7A 4HU3A 1KQZA 1EEXA 1EYEA 2Y5JA 3H55A 4Y9AA 5A69A 2DZUA 2DUZA 4K8HA 5LYRA 1CXIA 2BXYA 4LYQA 3TA9A 3SJ3A 5DRIA 1CGWA 4AZCA 2VEIA 3EWUA 4JTCA 2OPJA 3Q2DA 2AOSA 2P76A 1OX4B 4RPPA 3A3HA 2VC6A 3WNKA 4E4UA 3QC3A 5C8BB 4NZJA 4OIFA 3FSTA 3GR4A 4C6IA 4EIVA 1H61A 3KTXA 3H4GA 3FJNA 5BU9A 2VTFA 3S2MA 1RZMA 3GM8A 1D3HA 3V5FA 4HHLA 5HNTA 6A3HA 2ZDRA 4NYYA 3AIUA 2RGLA 4LV9A 1K03A 2G8ZA 5DT5A 2R1NA 3K8KA 5D32A 1OZMA 2XIOA 1D2KA 1R3QA 1RSCA 2VL4A 1ZTVA 4QQUA 4H9ZA 2AQVA 4Q4MA 3O15A 5I00A 4IJRA 2CBIA 4LNYA 2FYMA 1S5WA 4QGCA 4DWDA 1FBAA 1XF0A 3C2OA 3A5FA 3OP2A 3HMJG 3WD0A 3R5EA 4A6GA 1REQA 4O13A 1XIBA 2FZNA 4IQJA 3KWXA 3QRHA 1VR6A 1A50A 3TZFA 3D47A 3WQDA 4AG0A 2YYUA 1EWDA 3ZSSA 4EP8C 4DBWA 4EPDC 3S1WA 2XH7A 1XPYA 3F2CA 1KLZA 3MPGA 4DY1A 1TR9A 1Q6FA 3VNYA 1O95A 4PL1A 3EXRA 1CGXA 3M0VA 3ZYZA 1QT1A 3B3DA 1E6NA 3VZZA 5BOEA 5D9OA 1V7YA 1VFFA 4ZE5A 1EGZA 2WVSA 3H2OA 1M68A 2XSAA 1U1HA 3S6TA 5J5DA 2OZTA 2WMIB 1XPGA 1FWRA 3CNYA 2CLHA 4POCA 1W6TA 4IG2B 1LOLA 4KCTA 3PZGA 1UJQA 5E93A 1YX1A 3B0YA 1AZ1A 4N0RA 2WZTA 3RF9A 3W81A 3W75A 1PYFA 2ZXAA 4LS1A 3W7KA 4IFRA 1ISVA 4R5EA 3PANA 1CGVA 1EKOA 3CUZA 3ONBA 4RZBA 1QO2A 4PEKA 5I3DA 3ZT7A 1DWHM 5XIAA 4E8CA 5G1TA 3UWYA 5H8MA 1B30A 4GMEA 5HQEA 5D33A 2OODA 2WWDA 1S39A 2WHKA 2VFFA 5F2GA 1SSGA 4NHVA 3SO7A 4CU6A 1TX0A 1RBLA 3KCLA 4Q8TA 4LUTB 6PTDA 2F6XA 2WCGA 1VEMA 3RX4A 2QF8A 1OM0A 3G8RA 2ZZ5A 4QS6A 3M6YA 2Y7DA 3KHDA 5LNRA 3RO6A 4CN1A 5BXPA 1L9WA 1J12A 2CHNA 4GQ0A 4QS5A 7A3HA 1A5NC 1GVEA 2WMIA 4LY4A 4XQ6A 3WFLA 3WLKX 1JCLA 5IDIA 3WDIA 4IG2A 5AC6A 1A5LC 5T91A 1DJZA 1BWLA 4HJWA 3PJWA 4GVFA 5D8ZA 1W5NA 3F4NA 4WDWA 3OA3A 1GONA 5AKQA 1DJIA 3SUSA 2IPFA 2VD9A 3RPMA 1XYCA 1ZCOA 1P1XA 4YMZA 3THUA 3VM7A 5F4XA 3NOYA 1GOKA 4IIDA 4Z1BA 3KZSA 3CXOA 3EPMA 4AY7A 3C2FA 4GUGA 3GG0A 4GUIA 4Q32A 1FWAC 1UP3A 5GVJA 5HMDA 2YSWA 3EX1A 5I5RA 3JU2A 4I7VA 5REQB 1LCOA 1OBAA 3NJ3A 3KBWA 4JQ1A 3WLNA 4GYKA 2Y24A 1PJ9A 4RDYA 2V67A 3W38A 3EGJA 5M5DA 1OFPA 3LG3A 1Q7MA 3SY1A 4P7OA 2DSUA 1S46A 2OLSA 1KGWA 3L5MA 2R1LA 3OB8A 2YL5A 3T81A 3BZGA 4GYJA 3WF3A 2JEPA 5KEZA 5KTLA 5AHEA 4GYFA 3W2NA 5AC5A 3EOOA 4X61A 1HTIA 1GVOA 2E28A 3GR8A 4ORMA 1EJTC 3VC5A 3CHEA 5CPOA 2QUNA 3M64A 2GWGA 4QDMA 4JQAA 2DH2A 4CU8A 2J4GA 1JXKA 1I0BA 1WKFA 1KM0A 2C1HA 2NQJA 3DG3A 3QQ1A 2JE8A 1EIBA 1QTWA 1P7TA 5HMEA 2ZICA 5CJNA 4MNKA 2EPOA 2ODOA 3GC2A 3PFRA 1GVIA 1Z69A 3BLLA 3VCNA 3FAWA 4YYFA 2RAGA 4PGLA 3WLMA 4GJJA 1GZJA 5BXSA 3TN5A 1BG4A 2QV4A 5REQA 1A53A 4WY0B 4K6AA 4PUEA 4WKFA 4QNWA 3TSMA 3QMTA 4JTRA 1L2QA 1QI3A 2GDVA 1BF2A 1KGUA 4GO8A 4CEUC 4J9JA 4CNTA 5FF4A 1BKSA 4JTUA 4PCSA 3TTQA 2OGJA 4XIMA 1VC4A 3TJ4A 1XJBA 3GZ3A 4LVAA 1GJWA 1XKJA 4RLIA 4AW7A 5E09A 3RYSA 4KFNA 1IXNA 2E5CA 3OEXA 3WBEA 3KL3A 1JDAA 3R4IA 5AYXA 2ZZ6A 4PMOA 1TV2A 1S2WA 2QDDA 2QIWA 1AODA 4P5UA 3PNUA 2ICSA 4Q4KA 2QJNA 3VYLA 3SI9A 4IQEA 4GXWA 1GVRA 1VIWA 1E71M 4A05A 3D5HA 3QHMA 3IVTA 9XIMA 4JCLA 2CNCA 2FFCA 5D09A 4ZFCA 1W2VA 3T4WA 1K7EA 3CEUA 1V79A 5FSEC 4K38A 3ATZA 4AY1A 3VIKA 3HQNA 3MUIA 3W7RA 1AQHA 4Z2GA 2PBGA 4NAFA 4CNUA 2GJXB 3ARWA 4J3ZA 3A9BA 1EOKA 2XISA 1R9XA 1HJVA 2Z2UA 1TWWA 4Z0SA 1A80A 4BI5A 2WJZA 3BXWA 1NF0A 3I6RA 4XZIA 4E8GA 1Z8AA 1NEYA 4TU1A 4ZXLA 3GSMA 4MLJA 3Q58A 4AFYA 4O1DA 1P5BA 4P61A 1JNDA 1VP5A 3OZYA 3LA4A 1PHWA 1ITQA 3VOFA 1EC9A 1XC4A 5CGQA 3CL6A 1JPMA 3MUXA 1EZ2A 3NQ6A 1OK4A 1JULA 5EMMA 4PULA 3BAXA 2Z1SA 3R1ZA 4DM1A 2DUXA 2INZA 3OLGA 1EP1A 2RH9A 2GJPA 1QBAA 1V0KA 1SQ7A 4AMAA 3AZTA 4V1XA 4ZQCA 3OQEA 2OWXA 6ALDA 1R3WA 3MWCA 1CECA 3CAVA 5IBXC 1Y7VA 3IGSA 3UU0A 2OQYA 3FDKA 2GJXA 3TFXA 2CHOA 4O0KA 1X1NA 2NV9A 3C8NA 1QNPA 3A13A 4WK9A 3AJ7A 1Z32X 2PTWA 1DVJA 1V0LA 2B0MA 5CSYA 3KL0A 3PPFA 1UW9A 1ZJBA 1KGXA 3W2MA 3ITYA 4JTIA 2PDXA 2ACRA 4QSFA 1OFEA 5CPTA 5AHNA 4A8IA 4LF1A 2JIWA 2DW7A 1AK5A 3PZTA 1MRQA 2VM8A 3D0CA 1FFRA 3LUTA 3K30A 1EGMA 3S2LA 2QT3A 2NWSA 2W5FA 3IJDA 5KZEA 4WXZA 2V3EA 3OOQA 1LLWA 1NM9A 3IJ6A 3L21A 4FF5A 4BA0A 4DAIA 1D7FA 4Z0JA 2R94A 5EMUA 3GXNA 3PTDA 1XGEA 4ZB0A 4DBSA 3CS2A 3W2LA 3RCYA 3NURA 1QHPA 3LCLA 4LS2A 4LVDA 1R46A 1T41A 3P2VA 1Z48A 1TMQA 1H7NA 1NELA 1HJXA 1UD3A 2WVVA 1UKQA 4PB5A 2VOTA 4YS1A 4O18A 4NZ4A 2YW3A 1LT8A 1A5BA 3KP0A 3AOFA 4S3DA 3U48A 4HCDA 3OHMB 5FEXA 4Q4OA 1J0YA 1UP2A 4JIHA 4B3KA 1MQPA 2NT0A 2R24A 2BP1A 1B3ZA 4KBXA 3TJXA 1W3JA 1E5NA 4AWEA 4M6VA 4M51A 2G50A 1FCVA 2GWNA 3N2CA 3ZT6A 3STFA 4EXQA 3WBWA 5I79A 1R38A 5GNYA 3CBWA 3NQMA 1MEIA 4NRSA 1I2RA 2O7QA 1UD4A 3ABRA 4YL2A 4HZ8A 2C0HA 2J25A 1DORA 2YKKA 4UTIA 1RUSA 4YU1A 4E0CA 2BOEX 4UFHA 1R30A 3IV3A 1WP6A 4K36A 5D37A 5B7ZA 3P84A 4W4QA 1SR9A 2J6VA 2VZTA 3G5EA 1NY1A 3UYCA 2DZSA 2GJNA 4A3HA 5FF7A 1UWSA 2F61A 1X7IA 3S1XA 4P7RA 4PUJA 2BOFX 4O11A 4QLKA 2EPLX 3OBKA 3VTRA 1KTBA 3IPWA 3HPZA 3ZS4A 3DECA 3OIXA 1ONRA 1JZ3A 2WMJA 1I45A 1BF6A 2PTXA 3NEVA 1IXOA 1DPMA 3QKZA 2HE8A 1LDCA 1G67A 5KETA 2YJQA 1GORA 1NOUA 2ZUMA 2AMXA 1QPQA 2OB3A 3UCCA 1EHNA 3WEMA 2DW6A 1TE1A 3ANYA 1V3MA 4EWND 2IQ0A 3L66A 2WPGA 2VMFA 4JKMA 1X1ZA 3MP3A 4UR7A 1F8MA 3EOLA 3H54A 4I3GA 3AYRA 2VGGA 2AGKA 3BURA 4S2CA 4GY0A 2HE5A 4IUGA 3STEA 3M43A 3IACA 3N12A 1N82A 1CGYA 4GPNA 2V5DA 1S2AA 3WLTA 4CCCA 2RJGA 4ICNA 1H51A 3UNDA 1OVDA 2HROA 1W1TA 1UROA 1QK0A 1Q85A 2EO7A 4Y2WA 4YWIA 1MUWA 4GA8A 2REQA 3WLLA 1EA9C 1RQEA 2W79A 1KW1A 2WZIA 4D71A 1JDDA 2XWDA 3GHUA 3UGRA 3UA3A 3KOFA 5C2CA 1M7OA 1XCFA 2PDJA 2R1PA 4AVNA 2INEA 4BKNA 4A2SA 3G1AA 2ACQA 4LOCA 5M03A 5H8PA 4O14A 1JPHA 1ZP3A 3TAOA 3TQKA 1WAUA 1EPVA 4C7FA 1EZWA 5JXQA 4IIEA 3OBEA 1BWVA 5DX7A 4KT2A 3VIIA 2ZXDA 1MZHA 2AAMA 3TN3A 1NWRA 3TOYA 1V6WA 5GJMA 2OX1A 3EX3A 4PEEA 5A6JA 1F5ZA 1ODZA 2ZUUA 1VFLA 2WVUA 1RJRA 1OCJA 2PLJA 2PGFA 3THDA 4H4IA 3PZQA 3FEQA 2XYLA 1FP8A 2OZ8A 3GTNA 3F1QA 2CIPA 2WCSA 3L2LA 1PHQA 2BHYA 4UTHA 2DORA 3HGOA 2B31A 3U5UA 4HYVA 5M3WA 1X1OA 2HXTA 2Y7GA 4PSRA 1XLCA 3ZO9A 2FKPA 2G95A 4CUCA 2V6AA 2PLCA 3W71A 4MNJA 1TKKA 3PB0A 4GZIA 2ABAA 2H3BA 1PV8A 3CQIA 3BQ6A 3LHYA 4ZO7A 5LNVA 4IP7A 3AISA 3KRZA 5BOOA 3W6LA 1CLVA 3KW3A 1AJ0A 4S3JA 4I5XA 2PDHA 2DJXA 2C8NA 2Y62A 2D20A 3DFPA 2E8ZA 1L6SA 2Y63A 4UQBA 1OD8A 2EG7A 3AZSA 4CN4A 2OYMA 3FV9A 3FKRA 4JFTA 4MKNA 1E6PA 1W1YA 3EX2A 3P8IA 3GS6A 1TWSA 3PZMA 5LXXA 3MV11 1E4IA 3W9ZA 2FTPA 4NIRA 1SW7A 4DJED 1DQWA 5HQLA 4NY2A 1LWJA 3EWXA 4DF0A 4JKLA 1ZB5A 2OYKA 3FA5A 3DN5A 2OZ0A 3AWNA 3EA1A 3CH9A 2V0TA 1OGGA 2BFGA 2YB1A 1TTJA 3FA4A 1XBZA 3QPYA 3EWDA 1CYGA 3EBVA 4KESA 3VUPA 4PCNA 1C7SA 1GVSA 1YXYA 4EXBA 2PUZA 3CUGA 1IF2A 4DUOA 5CPSA 1TPB1 3BV4A 2E4TA 3TYZA 2ISSA 3BGAA 1CI1A 3KS5A 1Z7AA 3QV9A 4ADTA 4NXSA 3UG3A 5I3GA 4JYDA 3VD9A 5D9NA 2BY2A 1PIFA 3NQFA 4GUHA 5ABTA 1BD0A 4REQB 2BZNA 4W89A 1W9UA 2DJLA 3E0VA 3TA6A 2W6RA 4Q8UA 3M5VA 2VUYA 5JMUA 3CZLA 3RX2A 2WO5A 4KGLA 1ZBVA 3AICA 3GNPA 2YCKX 1X6UA 4LS0A 4LX4A 1FWCC 1ADDA 4GINA 2D2GA 4LUSB 1UWAA 2WVTA 4CN6A 5DBUA 3NWRA 1H62A 2QHAA 1XIIA 2GDUA 3UWZA 1YADA 4R9XA 3KVJA 3VCCA 3LBMA 5HJYA 2WAGA 4IIFA 1H1NA 3T9PA 2X7VA 1JUKA 3R8HA 3W76A 3WNMA 1E56A 4WHBA 3WLJA 4PCTA 4PUUA 1SZRA 1MVYA 3MBFA 2QDEA 1VLIA 1BXNA 3MCOA 1LL6A 3DIPA 1D7KA 4HZMA 1B54A 3QW3A 4UOJA 1U83A 4LJ3A 5EBAA 2CLOA 4RW3A 1EHAA 1CXLA 1ZQ5A 3ABSA 2WZEA 4PFHA 4AYGA 3C8FA 3H24A 1QNOA 3GR7A 3M07A 1JEZA 4KEZA 4DZAA 3Q67A 2IUZA 3M0MA 4HHPA 3DYOA 2NV2A 3KBMA 1POKA 2CERA 4MWAD 1FX6A 3CPUA 2O7SA 2A21A 1W0MA 2HVOA 1K4HA 4I9MA 4JTQA 4PUMA 4YPJA 2QXWA 4AIEA 3SIMA 1UASA 3ZJKA 3UR7A 4AF0A 3CHVA 3KBSA 2VI0A 4UR8A 3MC5A 3MQTA 2OVLA 2WB5A 3T78A 1QO5A 3EKZA 3AHZA 2ZOXA 4E4PA 3I68A 3VIPA 2R82A 4O10A 4LUSA 4X0NA 1E0XA 4JHMA 1BEUA 1MXDA 2PRMA 2D69A 2C1GA 3VNZA 4QCEA 1E70M 4H6QA 3DBPA 3LHZA 1IGSA 2ZA3A 1V8EA 3P5ZA 5CC6A 1OABA 2ALDA 4B91A 3UA4A 4HPHA 2NSXA 1RD5A 4R7JA 3ITLA 4FNUA 3V35A 4AWUA 4EAYA 2TODA 4MYXA 3TIMA 3EB2A 3DH7A 1V5XA 1E1FA 2WJEA 2WSPA 1UUQA 3P74A 4FOJA 1BKHA 4F3HA 5A8GA 4DJFD 4LYPA 3VNMA 1TJ2A 1ICSA 1NOWA 1ZFJA 4EXAA 4ATWA 4BWLA 2VCAA 3W7JA 3QTGA 4KF1A 1SW3A 2Q71A 4IT1A 4GZEA 1LTDA 3ARUA 4QP0A 3AIRA 5LA2A 3TYUA 3ZT5A 2PGEA 3H2AA 3RR1A 3AALA 3W7EA 3INPA 2Q8LA 1BVWA 4KIEA 4ZOEA 1KFKA 5A6MA 2D2OA 2Y7EA 1FWTA 2HBVA 5FJOA 3IJ8A 3H7UA 3UR8A 3DDMA 1BGGA 3VIFA 1C3FA 5A2BA 3P60A 3VXGA 3VD4A 1RCOB 4AUBA 3QV7A 3L2IA 4XTDA 2VFEA 3BTNA 3O6CA 4HU0A 2ZWYA 1RPXA 1PSCA 2YL6A 4BZYA 1PX3A 3JZUA 3EA2A 1WKYA 2EKGA 1XIHA 4RL3A 5IFTA 1A47A 3OIHA 2I7GA 3FKKA 3JW7A 1W9XA 4MB4A 2XINA 4QDPA 1MEWA 2FB2A 3A47A 3VCRA 2NW0A 1NDYA 3W70A 1UOZA 4FZIA 4UMAA 3O6YX 2H3DA 1WZMA 3T40A 5C55A 3LCIA 2CZDA 2PDLA 7REQB 1C8QA 2VR2A 1NP2A 3CAWA 1EL3A 1D8WA 4Y8FA 3I4KA 1R87A 3NTYA 3WKZA 4NXKA 2Y8KA 3WDJA 2VX5A 3BSGA 1US0A 3ZR4A 3N25A 1ZJIA 1DXIA 1J10A 2DZWA 2ZRUA 4G56A 4AYSA 2VR4A 3FX4A 1U2YA 3AXMA 4HTBA 1XDLA 4MOZA 2Z1XA 3RG6A 1EDGA 3R8RA 3O6AA 1UBSA 4Q6XA 4R7WA 1NTHA 3S1UA 3DFOA 4DHGA 1FWFC 2VC5A 3W4RA 3MSGA 1ITXA 1ISYA 1EQPA 2Y70A 5T9BG 2NLIA 1DJHA 1WKDA 3LDVA 3B8VA 1K9EA 1W9BM 4OFCA 3QZ6A 4WJ8A 1FWHC 3MO4A 4PC8A 3QOMA 3KCJA 1K8XA 3YPIA 3FDGA 6XIMA 4MAVA 3W7PA 4B90A 3W87A 3UY8A 1VCVA 2J88A 1J5SA 5I3KA 2O9TA 2CKRA 5G1MA 4HOZA 3RJXA 3B4YA 4AHOA 4I6KA 2FZBA 7REQA 5I09A 2DZXA 3L12A 4DPPA 5A2CA 1EO7A 3L9CA 3SCVA 4DZ5A 3P80A 3SGGA 4IP5A 5A6AA 2YXOA 3VZXA 3CYVA 3HJEA 1FH8A 1VRXA 1NDWA 4DYEA 3BG3A 2VEPA 1YBQB 1V0MA 3OLIA 4PUNA 1TPWA 1SZFA 4H19A 5TAOA 2D2HA 2WHMA 4E2BA 5IOBA 1SZGA 4KEUA 2HISA 1Q6LA 2Q8XA 1SM9A 4JICA 1B0IA 1JYVA 3NO3A 3BLDA 4HZ7A 5JH1A 1IQ8A 1X6NA 2XIIA 2AQOA 1XC6A 4GQGA 5IM51 4DI8A 2I5IA 4HYRA 1R9YA 1E6QM 1AMYA 2OGYA 1WNOA 1TJ0A 4KFOA 3G1XA 1M1BA 3AXKA 3FIGA 1ONWA 1P6WA 1LORA 3NO1A 2EJ1A 4KCVA 3WNLA 4M8UA 3DFHA 3C4UA 3MMDA 1KC7A 3VD5A 3H2MA 5G4HC 4DJEC 3XINA 4JS3A 2ABBA 3ANVA 3GXPA 1DIEA 2NUYA 3TC3A 2XU2A 1FVPA 2P0IA 3LENA 3SCOA 2WJFA 3ZLHA 4GGHA 4B9ZA 2QYGA 2BASA 1Z9AA 2FPYA 4N42A 5BXRA 3TKFA 1E15A 4NYUA 4FIRA 4L56A 1IV8A 4N9CA 3QMSA 2PD9A 4B5WA 5DELA 3KVKA 3WQ6A 4ASTA 3VC6A 4HK6A 1DTUA 4J35A 1NVMA 5A6KA 3DZ1A 1ENUA 1EF2A 3AQUA 1NOFA 2QCGA 1CXHA 5DLCA 2WM1A 1LOQA 3UW6A 3U7BA 1CNVA 1ONEA 4DZHA 2HS6A 3GZAA 3LV6A 3OG3A 3QGKC 1QMLA 1M7PA 1TZ9A 5DF0A 5HPOA 4PMVA 3VDGA 1JF5A 3N9RA 5DMMA 3QV8A 1OX6A 5C9ZA 1VBGA 1B9ZA 4G2DA 4M80A 4OBTA 3O07A 1Q6GA 3LGGA 1VS1A 1HO4A 4OE7A 2CLLA 3QZAA 1FCQA 1KFBA 3VINA 4GRSA 3ECQA 2A3BA 3IAQA 1YNYA 5LIXX 4BS0A 1WPCA 4J3XA 3GDRA 4QITA 4B5XA 5HJXA 1ODUA 2GJRA 3LHWA 4I9AA 1VHNA 5FKYA 1ZBCA 4GCXA 4IL2A 3EMQA 3DG7A 3VIMA 1XWYA 1XBVA 1DOSA 1FH7A 1S5TA 2Z7KA 1KQYA 2QJMA 1GJPA 3EB3A 4LRSA 2ZWZA 3ES8A 1B9BA 3FJ4A 4Y90A 2VX4A 1ZCCA 3KUMA 2V8ZA 3MWAA 2J7DA 1BSLA 1F3EA 2HDJA 2YCIX 1NWUA 1R3VA 3BCDA 1JZ5A 5LNWA 2VX7A 3EOEA 3N6JA 3QH2A 2C16A 4FXFA 1NSJA 3WLRA 4MWAC 1XD1A 2IW0A 4XV0A 1A5SA 3S5OA 4O1BA 2NVAA 7ENLA 2YFOA 2I5GA 5D04C 3W84A 1JCXA 3KL5A 4C6JA 1I1WA 4AIOA 4F66A 3EAUA 3QC0A 2V5LA 2BHUA 1WYIA 3M0JA 1PDYA 3TH6A 2ZUSA 4MJ4A 4GI8A 3UZ5A 4IIGA 5GJPA 1UQZA 4YCOA 2NUWA 1C8XA 1BFNA 3N34A 3E1F1 3T0BA 1BXCA 1UG6A 4JR5A 3T44A 2D2JA 2QQ6A 3DFYA 3Q45A 3VKCA 4OBRA 4ZOAA 4XVEA 3K4DA 4D8ZA 2RHGA 3BK0A 4GIEA 2QMJA 2HSAA 3NGFA 4FB7A 2VGIA 4I7UA 4DBEA 1A3HA 5E9XA 3LCGA 2IPGA 1A5KC 3SJNA 4X60A 3BLPX 4FO4A 3B03A 2QJJA 4WX2A 3LHTA 4PBEA 1XH2A 1PX4A 2ISWA 5HAOA 3U3HA 4HU8A 4DUVA 2AKMA 5HINA 3LPOA 4A3QA 3HO8A 1MQQA 3U8GA 3MBDA 3VOGA 3UPMA 1S2CA 4Z2IA 3OGSA 6XIAA 5G4WA 4IMEA 3IS4A 1U5HA 3L23A 2IPJA 2CETA 4WD0A 3PBUA 3V5OA 4ERAA 3DG6A 5JIWA 4JEQA 3KE0A 3GWQA 3WLQA 2AAAA 3JR2A 3P67A 4Q4RA 2QDHA 3O1NA 2PRHA 3GE7A 3MHUA 1GNXA 3CT2A 4GUFA 3SR7A 3SRKA 1KD0A 5F7UA 3P93A 4A4AA 4GX9A 2G41A 4I9TA 4ECLA 4C90A 4HNCA 5TBOA 1E55A 4YTUA 1S3HA 3A4XA 4X2RA 1L8NA 8XIMA 1AD1A 3GG1A 3OPSA 4DYKA 1UWIA 3EDDA 5I7GA 3N14A 4ROQA 3W7IA 2ZUNA 1KM6A 3IIXA 3AMGA 4JN7A 1B90A 1DXEA 3TVAA 2CFFA 5I3FA 4HU4A 2P8CA 2G0WA 2VGFA 3EXTA 3NQ2A 4F48A 4Q4PA 4Z1CA 2KZHA 2VWSA 3R8GA 3KWSA 2QIIA 5A8NA 2C13A 2IS7A 1BYBA 2OG9A 4W86A 4UCFA 4LCSA 5L6UA 4C7DA 1G5AA 4K3ZA 5I07A 4HA0A 3AJXA 6REQB 4DPQA 5LIYX 3GX9A 1YDNA 3WQVA 4S2BA 4ZVJA 1NQ6A 2BTMA 4O52A 4ZQMA 1LOSA 1E6XM 4QTGA 2GSHA 3PBMA 3ABOA 1NIUA 3W7OA 3WLIA 3R2GA 2WANA 4RCXA 1ZAJA 2UY3A