3PZQA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 with maltose and glycerol
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
b'FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
molecule tags Hydrolase
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzqA00
1NARA 3WEOA 1TFVA 4D6JA 2Y5EA 3KL0A 4HA3A 2VT0A 3KL3A 3N04A 3NIYA 2CETA 1GQJA 4NF7A 4GZEA 1J0YA 3PTQA 5C70A 2BXZA 1B3XA 4N42A 3OGSA 1GUVA 1UHVA 1J12A 2VC9A 2YL8A 3VKKA 1QBAA 3GNOA 2GFTA 1BYAA 4AEEA 4D6EA 3AOFA 2CHNA 1V3KA 4HA4A 4S3JA 1CGXA 3RIKA 2XSBA 4WKFA 3WUEA 4D6FA 2V3FA 2PC8A 1EOKA 1G1YA 4M82A 4MNJA 2VX6A 1XC6A 1CXEA 3W37A 1BPLB 1KBKA 2XG9A 3UETA 2PWGA 1ISYA 3AS1A 1TVNA 2JF6A 3RPMA 2XSAA 2WVVA 3IAPA 4OUEA 1WO2A 1FP9A 4YPJA 2ZX7A 4AW7A 1JDAA 6CGTA 1DWAM 1CENA 3T2PA 3W29A 2V3EA 1PJ9A 1E6NA 1SYTA 3AIQA 3SIMA 4WSJA 1UYQA 2DIEA 4AD3A 5I79A 4CD7A 3L2MA 4HZ6A 5BRPA 4HA1A 2G3MA 3CLWA 3HU7A 4ZENA 2X8RA 1E5NA 5A1AA 3PZTA 1A3HA 2Y8KA 3MMWA 2EQDA 1DEDA 3VIJA 1XSJA 5DT5A 1UKSA 4FK9A 4JL2A 5A6BD 3WQ4A 3VIIA 3WEZA 4D1IA 1HKKA 4F79A 2WSPA 1XSIA 4CU8A 2Y8VA 3VGHA 1VRXA 1TA3B 1RD6A 3T09A 3NSXA 4P8XA 2BVTA 3GZAA 4NSBA 4U3CA 4GI8A 4B3LA 1E9LA 3BAYA 3F5JA 3FHAA 1CNVA 3N9KA 1VEMA 1JF5A 2WC4A 5CPQA 1OGGA 2IUZA 3AMLA 4W85A 3EYPA 3OGRA 3VM7A 4AZHA 1PIFA 4PBGA 2JF7A 7CGTA 2QPSA 2UY2A 3K4AA 3KWXA 1CGWA 3AROA 3AYSA 2DT0A 2XYLA 3WH5A 3KZSA 1MXGA 1WE5A 1UR4A 1W2PA 4GINA 1ZU8A 1MW3A 1OIFA 3POHA 2B31A 5EBAA 1XD0A 3O2LA 5A6JA 3I3EA 2ZE0A 3VGGA 3VTRA 3PZUA 1VFUA 2WHKA 4M56A 4HZ7A 2PWFA 1GZJA 4PRWA 5M5DA 3OZOA 4AWEA 1SFSA 3IJ7A 4PMVA 2E40A 3VMPA 4C7FA 1QI2A 1OWQA 1E6PA 3AXIA 3SEPA 4V27A 3AHZA 2PBGA 5A6MA 5ABHA 2VZVA 1E3XA 1JAKA 4X9YA 2DT1A 5A8OA 3B9DA 1J10A 4D1JA 3WL0A 3AMGA 2E0PA 4CD8A 1QNPA 4ZXOA 1UR0A 4QAWA 1JGIA 9CGTA 2G4FA 2WCGA 4DWSB 1LWJA 1QNQA 4Z2JA 2GJXA 4TVDA 2VMFA 2DIJA 1TCMA 3WQ6A 2FGZA 4AEFA 3HJEA 1C8QA 5M17A 1BVZA 2X2YA 1F4AA 1QHOA 4XUYA 3ZT5A 1W1VA 2W92A 4EKJA 2Q8XA 1HVQA 1V6YA 4AXNA 1IZJA 4FLRA 3NJ3A 5E0FA 1CIUA 1B3ZA 3MV11 4PN2A 2OLHA 2EPMX 1CYGA 4YN5A 3TTOA 4CU6A 5BXRA 1GNXA 2WBKA 1ISZA 2YIHA 3CUIA 1XCWA 1UZ1A 1CLVA 2XUCA 3W82A 1CXIA 4FLSA 3CUHA 2YKKA 5BRQA 3N11A 4AIEA 2NT0A 1JYXA 1ESWA 4HMEA 3AHXA 4DWSC 2W5FA 1XH1A 3MUZ1 3QHOA 3SCSA 5C8BB 2PWDA 1NOFA 2BNJA 2J79A 1J0KA 1Q4NX 3MMUA 1E0XA 1DTUA 4UZSA 4GO8A 1JI2A 3OLGA 4OOZA 3VIGA 5E09A 2J78A 2J7HA 3UERA 1JAEA 4XV0A 1HKIA 2VURA 5CZKA 3AFBA 1E56A 4NRRA 5A8NA 3KL5A 1EQPA 1JYVA 1BG4A 2WMFA 4J3TA 1HNYA 1DWJM 4PSPA 4KMQA 2W62A 3WH8A 3CZJA 1X6NA 1BVNP 1BYBA 1GOWA 2DT2A 3WNLA 1HP4A 1CGVA 5A95A 1QW9A 3W38A 1JF6A 4GZIA 1UA3A 1UWUA 3SUSA 1J0ZA 4LGXA 2ZUUA 1B3YA 3PTMA 1GOOA 2CYGA 5FCZA 1GQKA 4XZWA 4AZCA 1R85A 2CHOA 1UD2A 1KXQA 4BZYA 3PN8A 1M7XA 2WHJA 1LL6A 4HP5A 2CKSA 2ZUWA 3MO4A 4WF7A 1JXKA 1JYNA 2XGIA 3AIBA 1CLXA 2OWWA 3L4WA 1W9VA 4NRSA 5BYWA 2F61A 1HX0A 4NZCA 2UY5A 1HJQA 1HKMA 1JZ5A 3FHQA 3VX0A 4KGJA 2DH3A 1ISWA 4UCFA 1E6ZA 2E3ZA 4F66A 1HXJA 4TVUA 2J75A 4JHOA 4B9ZA 3EDKA 1V3HA 1RP9A 4N0RA 3WBEA 4AYSA 2WVUA 3M07A 2VCCA 2GK1A 4CVWA 1I1WA 3U7BA 1W1YA 1ECEA 1VBUA 3GH5A 1KXHA 3GDBA 2E9LA 1C90A 2AAAA 1KCLA 3BXWA 4W87A 2RGLA 2O9OA 3RCNA 1B9ZA 2ZUNA 5D4YA 4DWSD 1E6RA 3N18A 5A94A 4B3KA 4BQ4A 4RE2A 3F5LA 5HOSA 3TTSA 3M46A 1FA2A 2X0YA 3GBEA 3WQVA 3T0BA 4UQCA 3MSDA 3WELA 4Q22A 1KR1A 2WMIA 4ZE5A 4C7DA 3EMZA 3VIHA 2YDQA 1C7TA 2VR5A 3OBAA 1HJUA 2WM0A 2E8YA 5A3HA 2DEPA 1HF6A 2XWDA 1H0GA 1V0NA 3PHAA 3L4YA 2VX7A 2DQXA 1IV8A 1B0IA 1WZAA 1DHKA 1Q6EA 1GQIA 2HVMA 3W81A 1V0MA 1UWTA 3ARSA 1VB9A 4MADA 1E73M 2J74A 1KXTA 3WY1A 2VVNA 3CZGA 2XFYA 1UZ4A 2G3JA 3GXFA 2FH6A 5JIWA 3FAWA 2BXYA 4UOQA 4FF5A 1E5JA 5CLWA 3WD0A 2VX4A 4W89A 2AOSA 1UQYA 3WH6A 4UOZA 5FL1A 1N82A 4HOZA 3ARXA 3AS3A 4MDOA 1ISXA 1E3ZA 3VINA 1D7FA 2BY3A 4D72A 3GXDA 1MW0A 1S46A 1CTNA 2XVNA 1QHPA 1EA9C 3VIFA 3VD3A 4YHEA 3AZTA 1PX3A 2BY0A 3VILA 1E1FA 1QNRA 3WIJA 2JIEA 4GQQA 3WFLA 4OJYA 3CUJA 4B15A 3WF1A 1NWTA 4ACZB 1GONA 2OYLA 5HDRA 1Q6CA 2CBVA 4J3SA 2ZUSA 3B9AA 3LPOA 1CECA 3ZJ8A 1QBBA 1JZ4A 1VFFA 5GPRA 3CH9A 3S2CA 2E8ZA 1CGUA 1W9UA 2W61A 3U5YA 1E6QM 2XTKA 1JD9A 2J8GA 2W63A 3TOPA 3AMKA 4ZE4A 3RJXA 3VU2A 4FMVA 3EMQA 2VZSA 4QLLA 1LLOA 2QMKA 3IJ9A 1B3WA 4J3VA 4JCLA 5AC4A 2VOTA 3WFZA 1EO7A 4S3KA 2VQUA 2O9RA 1M01A 5CSUA 1HJSA 3AXHA 2WCAA 5JBEA 2CBUA 1C8YA 1RPKA 2QF8A 3VD4A 3CZEA 4UTFA 1KGWA 1H4PA 5FIPA 3NUKA 1G94A 4X0VA 1G01A 3BGAA 4J28A 1B3VA 2J7BA 1Y7VA 1LL7A 1XHGA 1LF1A 4IPNB 3VUPA 3W26A 1KWKA 4ZFMA 2CITA 1W9PA 4EAMA 3SCWA 1BGGA 1VEOA 4D6HA 4PCSA 3AS2A 3NDZA 4QDMA 3D3AA 3WNNA 4TXEA 4EK7A 3AIEA 5A69A 3CHEA 4M81A 3WENA 1BYDA 1X6LA 4JCMA 4MJ4A 3W27A 3VOCA 2XM1A 8CGTA 2DT3A 1LG1A 1PPIA 3PZ9A 1G5AA 3BAWA 1K9TA 3ZSSA 1UR8A 5A6LA 2ZXAA 4B9YA 2PBOA 3EDFA 3G6LA 1VEPA 4JL1A 4GPNA 1H2JA 3CBWA 4W8AA 3M7SA 2DPEA 1TUXA 1MXDA 4M24A 1US2A 3BSGA 5CPTA 4A3YA 1XCXA 3MUAA 4TUFA 3FY1A 1NH6A 3TTYA 1EXPA 3ZO9A 4MTVA 3ZR6A 1FFQA 3FXYA 2EPNA 2J7DA 5EMYA 5BXTA 2WSKA 2BS9A 2IXUA 1ZBKA 4J7RA 2WXDM 1NOUA 1SMAA 1WP6A 5LA2A 2YJQA 1UA7A 4CU7A 1KQZA 2EXOA 1XH2A 2BY1A 4OOUA 3VD7A 2EPKX 2TAAA 2VX5A 1WKYA 1E72M 8A3HA 4DUVA 5CXPA 4JHZA 5E70A 4DM1A 4B16A 2IXVA 3WD3A 3I3BA 4AZ5A 2CKRA 5FKYA 1FP8A 1JXJA 1UR9A 3OB8A 5I0DA 2WBGA 2EPOA 4ATWA 1XD1A 3EDEA 4PTWA 1JNEA 1UQZA 3L4UA 3SCOA 2DSVA 2X0HA 1U2YA 4H8HA 5A8MA 2WZIA 2X05A 4JFVA 2CXGA 3VVGA 2BFGA 4W7WA 1R86A 1L0PA 1WDSA 1DWFM 3GNRA 1AVAA 4HU8A 2J25A 5I77A 4MNMA 1G0CA 1X1NA 3ARYA 1H5VA 1LJYA 3TTQA 3AMCA 1BTCA 2OSXA 2VI0A 1WNOA 3BCFA 3UESA 1KFWA 3AIWA 3PZNA 2XVGA 5A2AA 3WMBA 4UQBA 1WCGA 1E6XM 1ZB5A 5I23A 1V6UA 3U57A 2WC7A 2O92A 3SCUA 3VNZA 4UNIA 4CGTA 2QLYA 1I75A 2W91A 1P6WA 3EDJA 3RJYA 5ABFB 1WB0A 4U3AA 1HN1A 1NP2A 1V02A 1R8LA 3OIHA 1MFVA 4MB5A 1HL8A 3POCA 1HT6A 2XGBA 4P7RA 3WMSA 4IPLA 1FFRA 4D6IA 1JZ2A 1UD8A 7TAAA 2VCAA 1OB0A 3VGEA 1NQ6A 1OINA 1MFUA 1WDRA 4PTMA 5BCAA 3UG3A 2YOCA 3WEMA 4H04A 2WAGA 1PEZA 1W9BM 3WDPP 3AYRA 2ZX8A 5HNNA 2G3NA 3WH9A 4PTXA 3W6MA 1G9HA 1OD0A 2QV4A 1R87A 4JFTA 3CMJA 2WWCA 3HMCA 2ZICA 3WDQA 4K68A 4AISA 4PMYA 3FNDA 1B2YA 3MS8A 2QMJA 2CIPA 1NWSA 4QLJA 3PZQA 3CHDA 3CTTA 5GNXA 3L4VA 1CEOA 1KWGA 3THDA 4W93A 5TD4A 3DHPA 3WNMA 2FGLA 1JD7A 1OGSA 2WVTA 2E9BA 1UH2A 1PZ2A 1XYFA 3LMYA 3ZOAA 4EE9A 3GYCA 1VJZA 1FHLA 3OLDA 4CCCA 4OIFA 4JAWA 3DYMA 5E6ZA 2E9MA 3LPFA 4UQDA 2D0GA 2X1IA 3AXXA 5E0CA 4LYPA 1QI0A 5IFTA 2Y4SA 3SUUA 4AD0A 2ZX9A 1C3FA 4H2CA 4Q7NA 2JEQA 4W7UA 1K6AA 4UQEA 1E1EA 4AIOA 1VFMA 2WVVB 3S6TA 1B31A 5DF0A 2BV9A 2W66A 5GQBA 1K9FA 4Z2LA 3BAKA 2GVYA 3GXIA 5GNZA 4IISA 1H09A 2D24A 2EEXA 4QP0A 4BA0A 1EHAA 3FAXA 4BS0A 2XVPA 5A2CA 1UWSA 3WBAA 3VNYA 1J0JA 1QVBA 4TX6A 1HP5A 2VRKA 1UKTA 4L4PA 1BFNA 1UWQA 1HVXA 3IK2A 3WUBA 5JBFA 3CUFA 4P7NA 3QGVA 4BCEA 1KXVA 4UQAA 4QLKA 2W4XA 4BF7A 3OG2A 3QR3A 1WPCA 3DYPA 2PI6A 3UR8A 4R27A 1LL4A 3I3DA 3CPUA 3CMGA 4V2XA 1HJWA 2YBTA 4HOWA 1ZJBA 6A3HA 4MDPA 3ARPA 5AC5A 3DYOA 2GUYA 4GI9A 4JFSA 1O6IA 1VFOA 4MB3A 1B90A 5CJ5A 3BH4A 1GCYA 4MB4A 2WB5A 1LQ0A 2ZXQA 2OSYA 3VGBA 1CPUA 1M03A 2CESA 2J77A 1F4HA 3ALGA 4HPGA 4AD2A 2D3NA 4P7OA 3SCPA 5EB8A 4OBRA 3WDIA 3WUGA 3SCTA 2DDXA 3NSMA 4AZ6A 3F4VA 4AD5A 1H49A 3A4XA 5CG0A 5I24A 5IXEA 2VRJA 3WDJA 3QOKA 1HL9A 1E4IA 1B1YA 1IZKA 1NWRA 1OSEA 1E6SM 1PIGA 1UR1A 2VVSA 5D9MA 4U5IA 1TZ7A 1B30A 2NSXA 3CHFA 4TX8A 5F7UA 1KR0A 1DWIM 3PZGA 2DSZA 4FLQA 3ARVA 4PUEA 2CBIA 4UOJA 3VDAA 3WD2A 2W67A 2ZWYA 2DSWA 3E1F1 4HMCA 3N12A 2V5CA 4J3XA 3THCA 3N17A 4AC1X 3F5KA 3UEQA 1VENA 1OGBA 4CN1A 2YA2A 1JIBA 1EIBA 3O9NA 3LPGA 3VIPA 1PZ3A 2ZXBA 3AS0A 2D0FA 3GH4A 1JZ7A 4MNLA 1ZBVA 2GSJA 4QCEA 1UOKA 3W24A 4H7VA 2A3AA 3WF0A 5CSYA 3GNPA 4CD6A 2VR4A 3ZMRA 4URIA 2OWXA 4LQ1A 2GDVA 4AIUA 3RM4A 4Z2IA 3BAIA 5DEZA 4UFMA 3CO4A 4ZEPA 2YBUA 4AZ7A 3PTKA 1FOBA 2X09A 3BAJA 4PUDA 3K46A 1UH4A 1CZ1A 1E4LA 1GW1A 3EMCA 1TR1A 2XHYA 1HIZA 2GJXB 3B8SA 4U33A 1SR0A 2XJ7A 2FDMA 2WZEA 2EO7A 1M04A 1OD8A 4GXPA 3VDHA 2JE8A 2WNWA 4RL3A 5IHSA 3AHYA 1KQYA 2A3CA 4KRTA 3N13A 2EBNA 1E55A 1JG9A 3A4AA 3OLIA 4D6CA 1GOKA 1TA3A 3ARQA 1BAGA 2QHAA 2VQTA 5M3WA 2WMKA 5D8ZA 1VF8A 2J8FA 3UG4A 1TMQA 1JFXA 1US3A 3CHCA 4Y7EA 3DHUA 4KWUA 1JZ6A 2JEPA 4AD1A 1XYZA 5D9NA 3A6OA 2GJPA 1E40A 1J0IA 1V02E 2A3HA 4DM2A 2XM2A 4OBSA 3ZT7A 2PWEA 2J7GA 4M8UA 3VGFA 4JIEA 1JZ3A 1H1NA 4U5KA 3MV01 1J18A 3G6MA 4P8VA 1GVIA 4GQRA 1W3KA 3NSNA 5HPOA 1H3GA 3OLEA 1HKJA 3ZQ9A 1XH0A 4GI6A 1H0IA 1CDGA 2FHBA 2YLLA 3WF3A 3PBGA 2VZTA 1R7AA 4J3WA 2WCSA 2YDSA 3VMNA 3SUWA 4MJ2A 2J47A 2NT1A 3WUFA 2E4TA 3N1AA 4DUXA 1GORA 4HMDA 2ZUTA 3VO0A 5FD0A 3CUGA 3ZJKA 1W3JA 1MWOA 1W1PA 3JUGA 5A8QA 4UQ9A 2DH2A 4C7GA 4PYSA 3RM9A 4ZXLA 4F9DA 4AZCB 5ABGA 1E4MM 1UWRA 2QPUA 3N15A 1UKPA 3ALFA 2ESCA 1KGXA 4H8UA 1J9YA 3W0KA 5AYBA 2WK2A 4X0NA 3WDHA 3A4WA 1MQRA 3MANA 3WSUA 1GHSA 1GOQA 1QHZA 4YHGA 4DWSA 1AQ0A 1CGTA 1QOXA 4PMOA 1KGUA 2XFRA 4GIAA 2BHUA 4ML4A 2AMGA 4RE3A 1E0WA 2PB1A 3II1A 3ARTA 3AIRA 5CPSA 2GK1B 2D22A 5JUVA 3FW6A 2YL6A 1L8NA 3CZKA 1K9DA 2HISA 2GDUA 1MVYA 3AICA 3MMDA 4TTUA 1BLIA 4TOQA 2EJ1A 4CD4A 1W3HA 4P8WA 2G41A 3SCNA 2C8NA 1BSIA 1EDQA 1AQHA 1I1XA 4LYQA 4PMXA 1OT2A 4UFKA 1ITXA 2WMIB 3K8MA 3ARRA 2V3GA 3TA9A 5BXSA 2Y24A 2BHYA 1QI3A 4JFUA 4CN4A 2WW5A 1E70M 2NW0A 1OIMA 4ATLA 2VUYA 1E4NA 2A3EA 1JZ8A 5IFPA 1BGAA 5LA0A 3SCVA 3D5HA 3FN9A 1C7SA 3WN6A 4CCEA 4OZOA 4P7QA 4CKQA 4UFLA 1FH7A 1TVPA 5DFAA 1MYRA 3NCOA 1ODZA 4XZBA 2WWDA 4E8DA 3ARZA 3W25A 5BWFA 1HJVA 1JDDA 3RO8A 3GH7A 3BLKA 3AIVA 2CERA 1J01A 5FL0A 1JI1A 3ZT6A 3ARWA 3RMEA 4W88A 1UH3A 1BQCA 5I78A 1CXFA 3BLPX 4U31A 2V38A 3UG5A 3RM8A 5A8PA 3W28A 2J4GA 1QW8A 3NYDA 2FH8A 2RGMA 3VX1A 3AIUA 3PZVA 1QI5A 1U33A 3T0AA 2WLZA 1E43A 1GOMA 1W32A 1MQPA 1ZS2A 3BAXA 4DUWA 1XV8A 4E2OA 3AZSA 1WDPA 2WANA 1ZBCA 4WKHA 4XB3A 3SUVA 2V3DA 5D8WA 1W9XA 1YQ2A 2WMGA 4UFHA 1NM9A 2UY4A 4UFJA 4PMQA 3ZJ7A 1WZMA 2ZX6A 1QNSA 1BYCA 4BQ3A 1D3CA 4E8CA 4PMUA 2C0HA 2XVKA 3IAQA 3BSHA 5AYIA 3MUIA 1Q6GA 1O7AA 1V3LA 4A3HA 4BQ2A 1M53A 2XFFA 2JALA 5D9OA 3GTNA 1CXLA 2WKLA 3VD9A 1C93A 1DWHM 3VPLA 3PZIA 1PAMA 3U7VA 1LG2A 1QNOA 2CCRA 3SUTA 1NWUA 4GKLA 4JKLA 1CXKA 2VRQA 4GZJA 3WH7A 4EANA 4TVCA 2J62A 2UY3A 2UWFA 2VZUA 4ATDA 5A2BA 5FOOA 3AQUA 2G8ZA 2XIBA 4AY1A 1EGZA 2VJXA 4HOXA 3K1DA 2FHCA 1GJUA 1AMYA 3ZM8A 1R7OA 5JIPA 1GVYA 1YHTA 2WZHA 1V6WA 3WKZA 1GPFA 5A6KA 3WQ5A 4U2ZA 1V0KA 1VBRA 1PX8A 3ZJ6A 3T0DA 1J11A 5BROA 1TG7A 3TONA 3M6DA 1Z32X 1BHGA 4H8VA 1U30A 3WQ8A 3RDKA 1CXHA 2WC3A 4MB1A 2OYKA 2FHFA 1HJXA 1JDCA 1W3LA 4JZ5A 1C92A 1GJWA 5I5RA 4JFWA 3MSGA 5KZ6A 4F8XA 1W1TA 4CCDA 1KCKA 2CEQA 4W84A 5ABEA 3QOMA 2VO5A 4M1RA 1OT1A 1Q6FA 2VTFA 3AMDA 2WMHA 4V28A 5LYRA 3MUY1 4P7LA 5EFFA 1V3JA 4PEEA 4Z2GA 1ZJAA 2PF0A 1XRVA 4AZIA 4WK9A 3SCRA 1V0LA 1V08A 4ACZA 1WZLA 1MQQA 3SCQA 3AJ7A 1EDGA 1VIWA 4D6DA 5JBDA 1W9DM 4JKKA 4D6GA 3IANA 1ODUA 1A47A 1NOWA 1UG6A 2DGAA 3EDDA 2ZOXA 1LWHA 4P8UA 5E6YA 4HTYA 5A6BA 2CPUA 3VD5A 1RH9A 1BG9A 1DP0A 1W91A 3KE0A 6TAAA 4NI3A 3WD1A 5HBFA 4UZUA 4KGLA 2ZXDA 4TTGA 2VZOA 1UKQA 2ZIDA 2VL4A 4UFIA 3VIKA 4PCTA 3VIOA 2D0HA 1EO5A 4CUCA 2OWCA 3T2QA 3ZR5A 3L2LA 2Z1SA 3BMWA 5CGMA 2YA0A 5I2UA 1MW2A 1SMDA 3EBVA 4HZ8A 4IUGA 2WKGA 3CGTA 1C91A 1BF2A 1UD4A 2ZX5A 3U5UA 1E15A 1EQCA 3PZMA 1OM0A 3GM8A 3TP4A 2WYSA 3L4TA 1ZBWA 3K8LA 1EHNA 3O6AA 5A6AA 4MPKA 3CIVA 2XVLA 2Y2WA 2YA1A 2WPGA 3APGA 4LPCA 3VMOA 5A6SA 3W6LA 2WMJA 2ZWZA 4BQ5A 2D20A 2XPKA 3VGDA 1JL8A 2O9TA 1Q6DA 1OBAA 3W4RA 1H11A 4KRUA 3T08A 4CVUA 2JIWA 1VAHA 4LX4A 1V6VA 4Z2HA 5I6SA 3VDCA 1H41A 3AISA 1UUQA 3OA5A 2MANA 3AHVA 4ACYA 4LYRA 4AZGA 3ZSTA 4OKDA 1NP0A 4AZBA 1UWIA 1QI4A 2OYMA 4MAVA 3QHNA 3WNOA 1V6XA 5CLTA 4D71A 2ZUMA 3WNPA 1FHDA 3J7HA 4M29A 4HPHA 1VJSA 3WD4A 3ECQA 3WF4A 1W2VA 3K4DA 3K8KA 2BY2A 1JYWA 2VCBA 3ZIZA 3KEHA 2F2HA 5HPCA 3BMVA 1PX4A 5IHRA 5HXMA 1GHRA 1V03A 3AZRA 2O9PA 4CD5A 2WHLA 2ZUVA 4WLCA 2YLAA 1ISVA 5CQ1A 5IDIA 2WHMA 3W53A 3PZOA 1CWYA 2DSKA 5M03A 3GXMA 4FLOA 3RILA 2YDRA 4GO9A 4KH2A 4J3UA 2YL5A 3LPPA 3UCQA 2BVYA 4QFUA 2OSWA 2GJRA 4W5UA 3MU7A 4MNKA 3ARUA 4U2YA 1FH8A 4R5EA 3WQWA 3VIMA 4W86A 1RP8A 2C7FA 1EH9A 2BHZA 2JFEX 2J7CA 4MAZA 3WMCA 7A3HA 2V5DA 1XSKA 4W8LA 3BC9A 1C8XA 3NDYA 1EOMA 2BVDA 4H41A 4W8BA 1FH9A 4RE4A 4WKAA 1XGZA 4CN6A 2D2OA 3L4XA 4M80A 1JFHA 3VM5A 3A47A 4WIWA 3UR7A 2WVSA 1EDTA 1V3IA 2A3BA 4PMDA 1DWGM 1KBBA 5D9PA 1QPKA 5CGTA 4Z2KA 1CGYA 2DSUA 3A3HA 3L4ZA 2XWEA 3WNKA 5I3DA 1CBGA 1UKOA 3CZLA 5AY7A 1D2KA 2D3LA 4PTVA 2J7EA 3CZ8A 5C71A 1UD3A 2F8QA 4HU0A 3IJ8A 5E9AA 1K9EA 4PMZA 1GQLA 4PMNA 3WDRA 3T2OA 1PBGA 5EFDA 3GBDA 4QCFA 4PMRA 2PWHA 5KEZA 3VDBA 3WL1A 3DC0A 4F9JA 1WDQA 1OCQA 5LA1A 1WZKA 1IT0A 3OGVA 2J7FA 4UR9A 1UD6A 5BXPA 5DO8A 4JKMA 4W7VA 3BCDA 2CBJA 4L4OA 4LXFA 1ITCA 5ABFA 1ZL1A 5GNYA 4XX6A 2VNCA 3HN3A 5ECUA 3SURA 1UD5A 1GOIA 5DT7A 2XIIA 2EPLX 4WJXA 4E4PA 4J27A 1JNDA 3AI0A 2Z1KA 3WF2A 4IM4A 4PSRA 2CNCA 3OZPA 4AMCA 2YL9A 4WSKA 2G3IA 1WAWA 4A4AA 1UR2A 1TE1A 3AHTA 1V3MA 2WLYA 3MKKA 3QHMA 1AQMA 1J0HA 4W5ZA 2D1ZA 3DECA 1E71M 4AD4A 1KB3A 1E0VA 5DMYA 1MW1A 2D23A 3B9EA
chains in the Genus database with same CATH superfamily
4JQ3A 3KVJA 3ABQA 3BLIA 4N02A 4JEJA 3EXRA 1IR2A 3NIYA 1EEPA 3XIMA 3QR0A 4ALDA 1ME7A 1J0YA 4DPQA 4GGBA 4TU1A 2BXZA 3UPBA 4Y6GA 4QSFA 2ISVA 3OGSA 1GUVA 4QQ3A 3V0SA 1O5QA 3FVDA 1SVDA 3OEXA 4A8IA 1QBAA 3CLMA 1B3OA 3UNDA 3S9ZA 2VM8A 3WLJA 2CHNA 1VJIA 1G4PA 5K9CA 3EA3A 4S3JA 3LHVA 3PY2A 3KDOA 3RIKA 2OX1A 2P3EA 2XSBA 3UBPC 2A4AA 2CLLA 3C8FA 3OBKA 1G1YA 3STPA 4M82A 3LMZA 2PSNA 4XKMA 3FKRA 4IPJA 2R9RA 1A50A 4A8NA 3EX3A 2NX3A 3CM4A 2I57A 3RPMA 4NJIA 4EACA 3IAPA 3DDMA 3D3FA 1N8FA 1BWVA 2ZX7A 1JDAA 3D46A 1AK5A 3UY8A 2PDWA 1JUKA 2VC5A 3SIMA 3S1XA 1UYQA 1SZFA 6REQB 3PUGA 4NYUA 1YEYA 4LW7A 4R3UA 4QHRA 4M6PA 4CD7A 1PIIA 5BRPA 3U3HA 3CLWA 2PDJA 3G1RA 1E5NA 3KBSA 1FVPA 5A1AA 4NILA 2P0IA 2VGFA 3MMWA 4HA0A 4CQBA 3EAUA 3BGJA 1XIIA 3M4HA 1EP1A 1EJ7L 3QPZA 1DEDA 3AXMA 3ONCA 1XIBA 1DBTA 4MSSA 5A6BD 3WQ4A 3B06A 2PTZA 3IJDA 4F79A 1XSIA 4LF1A 1J5TA 3GG8A 3H2NA 4NSBA 4U3CA 5AOUA 3UCCA 1E9LA 3U6WA 1CNVA 3GG7A 3N9KA 3DOPA 4ERIA 2IUZA 1EJTC 3AMLA 2BP1A 3P7YA 4NVTA 1G67A 2QAPA 3VM7A 3REQA 2G96A 7CGTA 3QV7A 2BZNA 1UPMB 2IKHA 1IE7C 3GUWA 1TQJA 1XL9A 2Q71A 1UR4A 1ZU8A 1U1JA 5C9XA 1UOZA 1EJXC 1SO4A 2XN2A 1XD0A 3HGJA 1F3EA 1TUFA 3O15A 4AY7A 1SPQA 2ZE0A 1L6FA 5FF7A 3C2YA 4GE8A 2YDAA 3WFAA 1GZJA 1Q7QA 4HYWA 3N6HA 4PMVA 4GMEA 4GUIA 4C7FA 1QI2A 5D04C 4V27A 2PBGA 1HO4A 1VHNA 1NDVA 4K38A 3FK4A 3MC5A 4CCZA 2ZA1A 4KCTA 1FWHC 3UQNA 4XTIA 3NNTA 3LRKA 1PYMA 1ZCOA 4JIPA 3GSMA 4Y96A 1EJWC 1XF0A 1OX5A 3B0VC 4CD8A 1TELA 1UR0A 4A29A 2QGHA 4DWSB 4TVDA 3AAMA 3H7VA 3T07A 2DZWA 4AEFA 4RPPA 4H6RA 3GNNA 2QJNA 3NR0A 3HJEA 4Q7BA 1C8QA 3EA1A 3EGJA 3BLEA 4UTJA 1OABA 4XUYA 4QIUA 5LIXX 2Z00A 3WJXA 4JIIX 3M0ZA 1CIUA 1IR1A 1WXZA 2OLHA 3C2FA 5EPDA 4YN5A 3TTOA 4D8ZA 4CU6A 3LXCA 4O1AA 1E51A 4IFRA 2YIHA 5LNRA 1S1RA 1A49A 3NQDA 2DFAA 2XUCA 5BRQA 4C6OA 4MY9A 1W8SA 2HNHA 3AHXA 2VEGA 4DWSC 3SFWA 3Q37A 1XH1A 3W72A 4B4HA 4QJ4B 2PWDA 2WNQA 1SJAA 1QXLA 5H6HA 1NOFA 2BOGX 2PTDA 2C15A 3CAVA 4IP4A 1J0KA 1A4LA 2X30A 5XINA 4OECA 1Q4NX 4Y8EA 1A5MC 2Y7EA 4OOZA 1JCMP 1JAEA 4XV0A 3NXFA 4NRRA 3KL5A 1JYVA 2HS6A 1DWJM 4PSPA 1TCDA 2B7OA 3V1PA 3ID7A 1IXQA 4O8RA 4GZIA 3WZ0E 4HVXA 3SUSA 1RSCA 4AF0A 4LGXA 1J4EA 1I4NA 3PTMA 5G4HC 1JUEA 1TJ1A 1M7OA 2CW6A 1TE6A 1S5VA 3COTA 3B8TA 1KKRA 1SW7A 4OHQA 2PMQA 3W7GA 3N2OA 5I06A 1IIGA 3IUHA 2QCEA 2R1MA 4UR7A 1HX0A 4NZCA 2UY5A 3ZLFA 3I6EA 3TX9A 4A8LA 4A3UA 4LEQA 2AL2A 4BWLA 2J8TA 5HQLA 3SM0A 2VYOA 3S2JA 3SRDA 3ISIX 5FJTA 3H4GA 4JHOA 5HA7A 4B9ZA 3JZEA 2VD9A 3TLLA 1ICSA 1V5XA 4GX9A 1QWGA 1XLDA 2VCCA 1Z44A 3LBOA 2V8ZA 4E0CA 1YE4A 1YPIA 1C90A 1M9HA 4REQA 3BXWA 2RGLA 1FWRA 2UZ9A 4PUJA 1B9ZA 5A94A 4B3KA 3TTSA 2GGJA 3N9RA 2X0YA 3T0BA 5XIMA 2ALRA 5REQB 4UQCA 2Z7GA 3LI0A 1VKFA 1S2TA 4Q22A 1KR1A 1XDJA 3EMZA 3VIHA 1RQEA 1L2UA 2R82A 2VXNA 4E3TA 2XWDA 2C79A 1DIDA 4QROA 5CZTA 1DHKA 3W81A 4JYDA 3HGRA 3T0TA 4JIRA 1I8JA 1PHWA 2A2IA 3CZGA 3ENLA 2YXXA 2XFYA 3RITA 1BD0A 3BZGA 2Z2UA 1VBHA 5JIWA 3QKZA 4C6LA 3IGUA 3MI2A 1E5JA 2W27A 3P5YA 3WD0A 3TW6A 3URBA 1UW9A 2C6QA 4NIRA 5FL1A 5BNKA 3AS3A 1E3ZA 3VINA 4DXVA 2BY3A 1E9ZB 1MW0A 5I03A 1CTNA 1QUMA 3VNLA 1ME9A 4GVFA 5HJXA 4YHEA 3LLXA 1QOPA 4OTKA 3IJIA 1XWYA 1PX3A 2BY0A 1GYMA 4UBPC 2ADAA 4DYKA 1T8XA 2JIEA 2QDGA 2HCVA 4OJYA 2PU1A 5AYYA 4MWAD 1O66A 4NHVA 8RUCA 2QCLA 5HDRA 4J3SA 2HPMA 1O94A 3TYAA 2HK0A 4C6IA 2Z6IA 1CECA 4ZVJA 3CH9A 4DHGA 2E8ZA 1CGUA 4HNOA 1E6QM 3ZR4A 3VE7A 3AMKA 4ZE4A 2OODA 2NZLA 1HUVA 3LV5A 3TSBA 1OZQA 2VZSA 3NQEA 1XPYA 1EJRC 3IJ9A 1B3WA 4MZYA 2DZTA 1VC4A 3VDGA 3GFYA 2VQUA 4V1XA 2L5HA 2O9RA 5CSUA 4JTCA 4YTTA 1L6YA 3AXHA 1C8YA 3G1YA 3LK6A 4P61A 3RLGA 3W74A 3MHFA 2QF8A 1UR3M 1A5OC 1KGWA 3H7RA 1TYGA 1TJ2A 3QZ6A 3LSCA 1G01A 1LF1A 3G8EA 1KCXA 1ZAJA 2QDEA 3E02A 5L9FA 3O6YX 3HFTA 4EAMA 4ZCWA 1VEOA 3AS2A 3VNMA 2OTDA 3XINA 3WNNA 4B3ZA 3AIEA 5BU6A 1TJPA 1GZ1A 3SR7A 4PUUA 4JTDA 3RF9A 1BYDA 3CYVA 4FP1A 3STGA 1XJBA 2AQOA 4JCMA 1XW8A 8CGTA 4DAIA 2DT3A 1LG1A 1MEWA 3BAWA 3AYVA 3MVTA 1SJDA 2ZXAA 1OCNA 1A53A 1Q6RA 2PBOA 3EDFA 1WOAA 1QO5A 3IV3A 3C86A 3G6LA 1VEPA 4IJRA 4JL1A 3MBFA 1W54A 3R12A 3CBWA 3YPIA 1RUSA 2DV0A 2DPEA 1TUXA 3LQGA 1K8XA 1XCXA 4TUFA 3H2AA 3CL8A 1PE1A 1EXPA 1YDVA 4CEXC 1F2JA 3JS3A 3PF3A 1R3TA 2WSKA 4AWUA 1ZBKA 2C1HA 1NOUA 1TIWA 1SMAA 3CWOX 5LA2A 3B8DA 1AH3A 4NAEA 2BY1A 2BTMA 2TAAA 2O7QA 3N29A 5LKYA 3V18A 5C55A 1MI3A 1MUWA 3UPMA 4Z1AA 2IQ0A 4B16A 4I9TA 2SFPA 3I3BA 5FKYA 1J2WA 3S0CA 3NPXA 1JXJA 3OB8A 4DJFD 5CC6A 1RV8A 2EPOA 4N6EA 5ENLA 4ATWA 2CHRA 1UP3A 4GHRA 3FDKA 3SCOA 4XIAA 2A6LA 3TK7A 2X0HA 3EX1A 4AFYA 5LNSA 4KERA 2WZIA 1PO9A 1RZMA 4JFVA 2BFGA 2ZRVA 1D3HA 4YMZA 1L0PA 4G7EA 4FNPA 1FWSA 3GNRA 1NAL1 2J25A 2Y85A 1X1NA 3ARYA 4L6HA 2WNNA 1DKWA 1LJYA 2OSXA 2VI0A 5DBTA 3AIWA 5A2AA 2GWGA 1E6XM 3STCA 1T5AA 1ZB5A 3RX2A 2Y8UA 1X96A 3TJLA 2E68A 3BZJA 3SCUA 3VXGA 2IPGA 3SQSA 3PNUA 4L4LA 3QN3A 2E5CA 3EDJA 2ISSA 4Y9MA 3UNTA 1V02A 6ENLA 1R8LA 3OIHA 4MB5A 1HT6A 4DEFA 2VGBA 3FYOA 3NGJA 2VCAA 2OKTA 3W9ZA 2Y7DA 4LCQA 4PTMA 2X0SA 1RCOB 4H04A 3L2IA 3SO7A 5HNNA 3GY1A 1G9HA 1OD0A 3R0DA 2DUAA 4AISA 4PMYA 5F1UA 3FNDA 1B2YA 2E09A 2QAFA 3B04A 2C71A 4PFHA 1GG0A 3CQKA 4HGXA 1XRSA 4QLJA 1L2QA 3CHDA 4OFCA 3L4VA 4FNTA 4C90A 3DHPA 1P43A 2FGLA 2Z2BA 1JD7A 1RY0A 3DENA 3BOXA 3R5EA 3V3WA 4WVXA 4MOZA 3U2OA 1UH2A 3BCJA 3ZOAA 3QMRA 5I3HA 4ZTXA 4EE9A 2WPBA 3GZ3A 2ZDSA 1VJZA 3VNDA 3OLDA 3W7MA 4JN7A 4OIFA 3DYMA 5E6ZA 4AY8A 4UQDA 4Z0SA 4GCAA 3GNXA 4HK6A 3AXXA 4LAMA 3NXLA 1EFZA 1K70A 3SUUA 3NQGA 4Q7NA 3LBMA 3E0VA 3M47A 2QUTA 4J1OA 1O12A 1RPXA 3A5FA 1VFMA 2WVVB 1EJSC 2J88A 1T8QA 3W7CA 1UC4A 3IK4A 5A8GA 1EZWA 3GVGA 3GXIA 1H09A 4QP0A 1O95A 2V2DA 3FAXA 2X40A 2XVPA 1QVBA 4LSBA 3ONBA 1XINA 4WGHA 3N2XA 1UWQA 4RNHA 3WUBA 1W1ZA 3FSUA 3MYOA 1D9EA 3R43A 3H8AA 1QJWA 4IMEA 1XKJA 3OG2A 3GXNA 4DBWA 5I3KA 5FJUA 3QBUA 1LL4A 3I3DA 3CMGA 4V2XA 3STEA 1HJWA 4HOWA 3QC3A 6A3HA 3PP7A 2ANUA 3T55A 3G5EA 3DYOA 2GUYA 1O6IA 3KRUA 1B90A 3W22A 2D73A 3BH4A 4IL0A 2PRMA 4HK5A 1CPUA 1M03A 5HWJA 4P7OA 2HPIA 4OBRA 2DDXA 4NZ1A 3NSMA 1W5QA 1KCZA 1WBHA 4JXCA 2DVUA 3KHJA 1OSEA 3B05A 2E67A 5E0KA 4JX5A 3CHFA 4I3GA 4TX8A 3NQ2A 3T1GA 3OVRA 3WQFA 2V63A 5F7UA 3L5MA 4HN8A 3D6NA 1JCXA 4FSAA 3VKAA 3CEPA 3G1DA 4UOJA 3A24A 2ZWYA 3QEZA 3W1QA 2V5CA 3N4FA 4J3XA 1RVGA 4NZ3A 3LERA 3QY8A 1OGBA 4CN1A 1JDEA 2WQDA 2JGQA 2NXHA 1IXNA 2ZA2A 2A1YA 2J6VA 3LPGA 3E2VA 3AS0A 2D0FA 4HK7A 3M0JA 4M6UA 3B9NA 5LIUX 2EGZA 3MBDA 2YCLB 4L7ZA 3ZMRA 2OZ0A 2OWXA 2GDVA 1LRTA 2V5BA 4DJDD 4ZEPA 3MSYA 4H3DA 5IDZA 1GVEA 1FOBA 4PRTA 4ZB0A 3W2JA 3WG6A 4PUDA 3K46A 3PJTA 1CZ1A 1LT8A 3NM3A 2GJXB 1SR0A 2FDMA 1ONWA 2EO7A 1M04A 1Q3NA 2GUUA 3M9YA 2JE8A 3KLLA 1SZRA 2WNWA 1UB3A 3SGGA 1TTJA 3AHYA 3W1XA 3BO9A 3QY6A 1UZHA 1KQYA 2A3CA 3JVAA 4AVNA 4IQEA 5D2WA 3LZ5A 1W5NA 3ABXA 3V5OA 5LHFA 3HMJG 4YTRA 3F7JA 1R9YA 1IXPA 3O07A 3FFSA 1FWDC 1OX6A 2J8FA 3UG4A 4AX6A 1AUSL 1US3A 4R9OA 5M2FX 4WXYA 4O53A 1E40A 4LUTB 1J0IA 2A3HA 3K2GA 3P8JA 4U5KA 4IICA 1Q5MA 3MKVA 4GC4A 1W3KA 2XN0A 3W7JA 3NSNA 5HPOA 1HKJA 2G37A 2WJDA 4F2BA 3HPXA 2FHBA 3S2NA 4XBSA 1V51A 2YDSA 4MJ2A 2FVMA 5HATA 5AECA 3V4BA 2E4TA 2NXGA 3OVPA 3MCOA 2CLPA 3WK2A 3HFYA 4ILSA 5HMFA 2ZUTA 2WZMA 3QR1A 5FD0A 3ZVHA 1W3JA 1W1PA 3JUGA 2DH2A 1RR2A 4ZXLA 3QPYA 2GGGA 4AZCB 1E4MM 4PBFA 4NASA 4A35A 1D3GA 1R5YA 4MUPA 1Q6LA 1ZQ5A 1KGXA 4H8UA 2OZ8A 2PA6A 3W0KA 3ITXA 2WK2A 3A12A 4X0NA 4DJFC 1B5TA 3A4WA 2QCHA 3T81A 3LDVA 1GHSA 4G9PA 3THUA 1QHZA 4XAGA 5M1TA 1CGTA 4PMOA 4IH3A 1AQFA 1XG3A 1DJWA 1RHCA 4F0SA 2YFNA 1E1CB 4YTQA 4GUJA 1X6UA 3FW6A 4AVFA 1F9CA 4I6KA 1L8NA 1K9DA 2HISA 2VKZG 3E0LA 3CT7A 1ZNNA 5F1VA 5FSDC 4CD4A 1W3HA 4P8WA 2G41A 4JY8A 3SCNA 1BSIA 1EDQA 1AQHA 4QNEA 1J8VA 1FWCC 4PMXA 4RZBA 1QATA 4UFKA 4WZHA 2WMIB 3QZEA 3PSWA 1BWLA 4P2VA 4JFUA 1PWLA 4LTSA 1A0DA 4CN4A 2NW0A 2A3EA 3CL7A 4FR1A 1TTQA 1Z42A 2QCDB 1MUCA 2HVOA 1S2UA 4UTIA 4K36A 3VAVA 1SFJA 1F7BA 1RBLA 2HBVA 3MI6A 3P93A 3I7SA 3WLHA 3H54A 4GY7A 4R88A 4UFLA 1WAUA 3WJSA 3GLCA 3AU6A 4MKVA 4RZ6A 2PEVA 1ODZA 4PZVA 1HJVA 5BWFA 3GH7A 3BLKA 3DC8A 1BEUA 1JRCA 2CERA 2Z24A 2WSQA 3P81A 2PWVA 3ARWA 3V0TA 2P53A 4W88A 3RLUA 4O16A 3TIMA 3AALA 3CPRA 3VCNA 5I78A 3BL3A 1CXFA 3BLPX 3MY9A 4U31A 2V38A 3UG5A 3RM8A 4MWAA 4I8YA 1QW8A 3ITGA 5H8MA 4R7OA 2PDBA 4PB3A 2ABBA 2WLZA 1X1ZA 3W2MA 1GOMA 2J13A 2ISDA 1QASA 3CTLA 3BAXA 4DUWA 2CLMA 4E2OA 4WKHA 2GSHA 3EWDA 2NWRA 3HQPA 3UWEA 3ANUA 2V3DA 4H6EA 4C1LA 2NLIA 4Y9OA 1U1HA 4GABA 4IGHA 4BQ3A 1P6BA 4IFKB 1E0TA 1R6WA 4UTWC 1GVRA 1V3LA 1FWWA 2XFFA 2JALA 3LM3A 3LNPA 1VYSX 2AQWA 4IHCA 1CXLA 2ZVRA 1DWHM 3VPLA 4BF5A 2CCRA 3SUTA 1ADOA 1NWUA 4GZ7A 3CB3A 3CPGA 4EANA 1XLMA 2UY3A 1AL8A 4ATDA 1UUMA 5FOOA 1WXYA 2W79A 1EGZA 2VJXA 4HOXA 1ADSA 3U2CA 4F0HA 2PD9A 3OODA 1R3YA 1YHTA 2PZNA 2WZHA 2ATMA 1F6KA 2Y62A 3WQ5A 1PX8A 1J11A 5BROA 2NSOA 4YU1A 4KEMA 1AW2A 3AUJA 4MLRA 1U30A 4PE8A 3TV8A 3MKCA 4QAIA 4F8XA 1R3SA 1TMLA 1KCKA 3NVTA 4W84A 2CXEA 1OT1A 3DFSA 3AMDA 1NSJA 2YR1A 1AFSA 5LYRA 4GYPA 5EFFA 5J5RA 1EBGA 2F6UA 4HPNA 1PZ0A 3R79A 2FTPA 4WK9A 5AC6A 4JTJA 1V08A 4ACZA 3SECA 1EDGA 1VIWA 1WKEA 4HU4A 4C6DA 1UG6A 1A47A 2DGAA 1LWHA 2BWGA 5E6YA 4Q8OA 1M6JA 1TWZA 1RH9A 1BG9A 3KE0A 6TAAA 3VC5A 3PG9A 3DU0A 4BFAA 4KWWA 4TTGA 1OCJA 2VL4A 4O52A 1EO5A 4CUCA 5HAOA 3W73A 3L2LA 3BMWA 2YA0A 1DE5A 2ZVIA 4IUGA 4O1FA 4Z17A 3CGTA 1BF2A 2GQ9A 1U5JA 3DN5A 1H51A 1E15A 1EQCA 3GM8A 3TP4A 2WYSA 3W07A 4WUIA 4BF9A 3O6AA 5A6AA 4MPKA 3P62A 2XVLA 4EPDC 2Y2WA 3GKFA 2WPGA 4LPCA 5D05A 3OA3A 1GT8A 3A9BA 3L21A 2D20A 2FZNA 2XPKA 1JL8A 4PL1A 2EKCA 3T08A 3B0PA 2PPGA 1TTPA 2JIWA 4B4FA 1VAHA 1K8CA 4HB7A 2PCEA 2X7WA 1KM1A 3AISA 3NQAA 3OA5A 3AHVA 3APTA 1LRQA 1UIOA 3S1UA 1BKHA 4LYRA 5HUOA 3ZSTA 1EF3A 4PUNA 4OKDA 4MPQA 4LV9A 1XUUA 4D2JA 4G7FA 4MF4A 1QI4A 2OEJA 2OYMA 2VDGA 4GC3A 3RR1A 2ZUMA 1UROA 4DO7A 4HPHA 3LUTA 3WD4A 4LY4A 3PNZA 2BY2A 4Q4RA 3UJRA 1OEPA 4Y9AA 4K8HA 3ZIZA 1QAPA 5HPCA 1AJZA 3G1XA 2ZADA 3IVUA 2HRWA 1OC7A 4FO4A 1GHRA 4LVFA 5EA9A 5HXMA 4TMCA 1NVMA 3SGUA 2ALDA 3S2LA 2ZUVA 2FMNA 3K4WA 4HSNA 4C6NA 2WHMA 2P5NA 3PZOA 2DSKA 4GH1A 4FLOA 4H19A 3W1LA 1ZAHA 3RILA 1LM1A 2WJFA 2ZRWA 3RPDA 4RV8A 2GJRA 1HQTA 2QVHA 3ARUA 4C6JA 1TRIA 3MMTA 3TYDA 4MYXA 3E2RA 3WQWA 1TV2A 2D2GA 2C7FA 1EH9A 2BHZA 1IGWA 2AL1A 2JFEX 3EWZA 1FCUA 2OLSA 1YNPA 2A85A 7A3HA 1XQLA 4PUMA 3BC9A 3WLPA 4EPEC 1C8XA 1XYCA 3NDYA 2BVDA 2HROA 3WLSA 3F1QA 1XGZA 4CN6A 2D2OA 4M80A 3VM5A 3A47A 1DWGM 3CWNA 1S3HA 3A3HA 3R8GA 4DXXA 1IWAA 2P50A 3EB3A 1UKOA 3DAQA 5AY7A 3W7HA 3M16A 4KFPA 5TAOA 3DHDA 3W23A 3V1HA 3V0UA 4UNLA 7TIMA 4O0ZA 3O06A 2ZRXA 4HU0A 1DIEA 1K1DA 4QCFA 4MLJA 1AJ0A 1K3UA 3KTSA 3S5OA 2QS8A 1QO2A 2PRHA 3C2VA 3LEPA 1WDQA 4HNTA 3NVDA 3S9IA 1R30A 3DFYA 3OGVA 1OYCA 3CO8A 4GX8A 4DVOA 4JN8A 3BCDA 1EYEA 5ABFA 1SM9A 1XUZA 3HN3A 3KAOA 4LUJA 4AUBA 3LXBA 3OZYA 2GOUA 4B5TA 2EPLX 4XO6A 4IMDA 3XISA 4YYCA 3LI1A 3IUDA 5HQMA 2Z1KA 1NDZA 3BLFA 1OG6A 3PFRA 3H4XA 4GISA 2YL9A 1NDWA 2G3IA 3BV7A 3WK0A 1V3MA 3ITYA 5KZMA 2YB1A 2CZ5A 2FB2A 1J0HA 4IGMA 3HV8A 3DECA 3QYQA 4MFDA 1MW1A 3TN4A 2ACSA 3UA4A 4GVIA 3PWAA 3KL0A 1GVSA 1PSCA 2VT0A 3N04A 3GHRA 2CETA 4NF7A 3QGKC 3PTQA 4S3BA 3UF9A 1LOSA 2J6XA 4Q8NA 4B90A 3FA5A 2YL8A 5FAJA 3GNOA 4D6EA 3AOFA 1RBOB 3NQ8A 1V3KA 3ERPA 3CL6A 4HA4A 3VOHA 1F3WA 1CGXA 3BG3A 1O5XA 4D6FA 2ODOA 2PC8A 1L6GA 1EOKA 4DJDA 1E0UA 2INZA 1FQ0A 1XC6A 3W37A 1BPLB 1KBKA 1R3RA 2XG9A 2E6FA 1Z9AA 2VEFA 3AS1A 3T78A 2NVCA 3KBJA 2YCEA 3R0KA 3EX2A 1WO2A 1TMHA 3MUCA 4YCOA 5LHEA 3W29A 3TXZA 1E6NA 4NI8A 4S3GA 2DIEA 1H1ZA 4X22A 3BW4A 1TX0A 5LXXA 3L2MA 3U2EA 4HA1A 3GTIA 2XFWA 1JR1A 3I68A 3L12A 5HNTA 1A3HA 5EYWA 3L7RA 3AU2A 2ZCGA 2GWNA 2I1OA 3G0XA 4NZFA 3VIJA 1ITUA 2F84A 3IPWA 4FK9A 3HQOA 4NUWA 4D1IA 3N6QA 3W7DA 3TJ4A 2VOMA 1J96A 2CLFA 3FEQA 4GJIA 1Y65A 3T09A 3NSXA 4RX0A 3OW1A 2PP3A 2H8XA 3LQLA 4FHAA 3FHAA 1DIOA 1Q8AA 4HCDA 2C3ZA 2OG9A 3HGSA 1JF5A 2WC4A 5CPQA 1XRFA 1S5MA 1PIFA 4G1NA 2GLKA 2QPSA 2UY2A 3FXGA 3K4AA 3AROA 4KEUA 2XYLA 3TN6A 1YX1A 4U10A 3WH5A 3KZSA 2WNZA 5E5CA 1W2PA 1KFJA 4GINA 3BGGA 2RJGA 2C1IA 1MW3A 1OIFA 2X1UA 3UWVA 3POHA 4QG9A 2B31A 1PDYA 3KDNA 5EBAA 5A6JA 3AC0A 3I3EA 3VTRA 3TAOA 2WHKA 2VDIA 3TROA 4GNKB 4PRWA 3OZOA 4H9ZA 4AWEA 5AVHA 3AXIA 3SEPA 1A5NC 1CI1A 2DY3A 4QISA 4JDYA 5AHFA 4FNUA 3W70A 1JAKA 4U28A 5CAKA 1U1UA 3KM8A 4ADUA 1J10A 1VS1A 3DBPA 3WBWA 4D1JA 2Q8ZA 4AG0A 1KBIA 2Z26A 2E0PA 3PPGA 4ZXOA 4QAWA 3KBMA 3P60A 4Z2JA 2VMFA 3MWCA 3WQ6A 5I3IA 3MO7A 4JNYA 4L5ZA 2CLKA 5M17A 4R53A 2X2YA 1F4AA 4IXXA 3TW9A 3HGOA 1VCFA 1WKDA 4H9XA 1HVQA 1Q65A 1IZJA 4FLRA 5E0FA 1SO5A 2R6OA 4WQ6A 2FKPA 1QU4A 1K6WA 2FJKA 2EAWA 4Q4MA 3KOZA 4FNQA 1F3TA 2WBKA 5B7ZA 4GG9A 1ISZA 3CUIA 2VFDA 1XCWA 4X9SA 1F74A 2Z7KA 1CLVA 1GTEA 3ITVA 3W82A 1CXIA 4FLSA 2YKKA 1XYLA 4AIEA 2NT0A 5CPMA 1BXNA 2W5FA 4LBUA 4H8NA 3MUZ1 3SCSA 3SRHA 5C8BB 3CIXA 3NTYA 3R8HA 3W75A 4RK8A 2BNJA 2J79A 4PULA 4OV9A 1DTUA 3NAVA 4GO8A 4O0KA 4H7ZA 1VQTA 4JX6A 2J7HA 3BG9A 3AFBA 1E56A 3SY1A 1EQPA 3GKAA 1VPQA 4JGDA 1HNYA 4ZBCA 3OPSA 3HPFA 3WH8A 2OELA 3UYIA 2V9DA 1GOWA 3QYSA 2YW4A 1CX9A 2DT2A 2Z1WA 3I6TA 3WNLA 1JPHA 5A95A 1QW9A 4G1KA 1UA3A 3SIZA 1UWUA 4NNBA 1J0ZA 3G22A 2ZUUA 4R33A 3MWAA 1GOOA 3G18A 5FCZA 1DTNA 5DCEA 3HM7A 4GUHA 2E6YA 2CHOA 3IVTA 3VKCA 4JTQA 1KXQA 4BZYA 4KW2A 1KO0A 2WHJA 4Q6XA 4J3ZA 5CCZA 4O19A 4UTTA 3U2ZA 3MO4A 4WF7A 1JYNA 2OWWA 1CLXA 3V35A 1W9VA 3FJ6A 4O1EA 3VX0A 4WJ8A 4KGJA 1NELA 2BSLA 1ISWA 4UCFA 3OJGA 1M7PA 3W86A 4HNCA 1W1A1 3H2MA 1HXJA 4TVUA 1L6WA 4KT2A 2WSYA 3EDKA 3ITOA 5C6MA 1AZ1A 4NT0A 2FZ9A 3M07A 4CVWA 4QEEA 2DUXA 5FJIA 1I1WA 4QG8A 1ECEA 5IRPA 4V15A 5PTDA 4LUSA 4W87A 1KCLA 4NP7A 4O50A 2BB0A 5D4YA 5KETA 1E6RA 1SW3A 4PTNA 1H7XA 3Q94A 3GBEA 1TWDA 3UFYA 5CBIA 1TWSA 3IGXA 1Q7MA 4C7DA 4KBXA 1LUCA 3R6IA 5JH1A 2E8YA 3E0FA 5LGXA 5C54A 4ZQPA 1IHIA 3B97A 3S6OA 5BRBA 1V0NA 3PHAA 3ZWTA 5CEWA 4KRZA 2DQXA 4H7CA 1MMFA 1ADDA 4DZAA 1IV8A 4L1XA 4JNMA 4LALA 5K3VA 1TKKA 1Q6EA 1GQIA 2HVMA 3BG5A 4NKCA 2Y6ZA 1UWTA 1TV5A 3ARSA 1RLDA 4LRSA 4MADA 1S39A 3MQTA 1KXTA 3WY1A 3CIWA 4QJ1A 1WKFA 1UZ4A 2G3JA 4RJEA 3TC7A 1XRTA 3M0XA 1N2VA 2FH6A 3NZ1A 1TPUA 5FJPA 5CLWA 1W37A 4FB7A 3OTRA 4XD5A 4C91A 1EIXA 1UQYA 1KFCA 4UOZA 3RO6A 4X2RA 4JTIA 1K8ZA 1H62A 5HQEA 3NFUA 3OVQA 2OT1A 1FX6A 3N25A 1LQAA 4Y2WA 3VIFA 3QM3A 1GZGA 4IT1A 4KQNA 2RHGA 4MKSA 2VFFA 3TR9A 3U48A 1E1FA 2Q01A 1I2RA 3WFLA 1OFOA 5AKQA 4B2DD 1Z48A 1I9CB 4B15A 3QF0A 3B8WA 3WF1A 3MP3A 2Z4GA 4DB7A 4L9ZA 3GB6A 3G1HA 3LD5A 1QBBA 2PZ0A 1JZ4A 5GPRA 2BGNE 1W9UA 1OQFA 3U5YA 5LIKX 2OB3A 1X7FA 2PODA 1DJHA 1JD9A 3M43A 1REQA 2W63A 3TOPA 3PS7A 1FWEC 3GDRA 3VU2A 2I14A 1X39A 1H1YA 3H24A 2Q09A 1IWPA 1LLOA 4QLLA 4S38A 1I0DA 1LCOA 1TWIA 4S3KA 2P10A 4AX7A 3L0KA 4LANA 2RDXA 2HTMA 1M01A 1YDYA 2PGWA 3QZAA 2XIMA 4LVDA 3JU2A 2WCAA 3S47A 1ZJIA 2QYGA 5IBXC 5JVLA 1R2SA 1RPKA 3KOFA 3CZEA 1TREA 4UTFA 3DESA 5LGZA 1IQ8A 4FXJA 3NUKA 2YPIA 1G94A 3KUMA 4X0VA 3G8RA 1B3VA 1FWNA 4A2SA 3W26A 2W0UA 4C5ZA 2CITA 1W9PA 5C2GA 1XR2A 2H90A 4RV3A 1BGGA 1ZGDA 2BX7A 4PCSA 1XBVA 3ELFA 4EK7A 4TXEA 4IMAA 2CLHA 2GPTA 5AHNA 3FDGA 3W84A 1X6LA 4DO6A 4DQWA 5C9ZA 4YVXA 4MJ4A 3KVMA 3B0UX 4NZ5A 3VOCA 3WLLA 1PPIA 2F2KA 3PZ9A 1UR8A 3F2DA 2D2HA 3H55A 3UT0A 5EMMA 2PTXA 4W8AA 1EYWA 1Q7ZA 1H61A 4Q4SA 3MDWA 3BSGA 3MUAA 4ZOBA 3BLOA 3PJXA 2ATSA 4HBKA 4KWSA 2BVWA 3ZO9A 4JNZA 3O1NA 4MTVA 6XIMA 4EWND 1YBQB 3ZR6A 3DFPA 4D9PA 4LU0A 3WLMA 3C52A 3S83A 4C6CA 4O12A 1QFEA 5T91A 4CU7A 3ITTA 1JULA 4HIBA 4OOUA 3KOXA 3LLFA 1P4CA 1W0MA 3GFXA 4FX8A 3U4FA 1EF2A 2CFFA 5JMUA 3C61A 4AZ5A 2CKRA 4HT3A 2QUVA 3GG0A 4LVAA 2WBGA 1UIPA 4UMBA 1W5MA 2GJLA 2GVLA 1J6PA 3PUDA 2ZE3A 2DZBA 1EP3A 3MP4A 1U2YA 2QDDA 1JCTA 1P0EA 5D37A 2E5BA 3OZMA 3H2FA 2CXGA 3VVGA 4UTHA 1W6TA 4FOKA 1DWFM 1XPGA 1AVAA 4HU8A 1YPXA 5I77A 4MNMA 4WY0B 4PEKA 1BTCA 4XBKA 3H22A 3GG1A 3UESA 1KFWA 3PZNA 5LZLA 4IZGA 5I23A 1KFLA 2CZEA 1M41A 4GXWA 1P6WA 1XI3A 3UVIA 2PFHA 3H23A 3DH7A 1NP2A 5HMSA 3E12A 4IPIA 2QJMA 2E5DA 3TEVA 2XGBA 2A79A 3WMSA 1B57A 3BURA 1FFRA 3HJZA 5HMEA 1JZ2A 1UD8A 3BW3A 4QDPA 1R9XA 1OINA 1MFUA 4BJHA 4DZ5A 2XH0A 1XIHA 5BCAA 3W7RA 6TIMA 1TIMA 4KCUA 2WAGA 4LJ3A 4JN6A 1PCWA 4IMCA 2G3NA 4PTXA 4TX9A 2QV4A 1R87A 2WWCA 3HMCA 1FKXA 3WDQA 4QX4A 3LHTA 4Q8QA 3MS8A 2CIPA 3M0MA 2CZDA 2VFIA 4QE5A 4OT7A 5GNXA 1CEOA 1KWGA 4W93A 4HNLA 5TD4A 3GTHA 3WNMA 4DJED 4AAJA 4PC8A 1X7IA 4P5UA 3RPTA 4IP7A 3G1SA 5D2YA 1PZ2A 4Q8MA 5TBOA 4QJ5B 1ONXA 2ZBTA 1FHLA 4XD4A 4CCCA 1XYMA 2E9MA 2ZZ5A 3IJLA 2X1IA 4LEFA 2ZTKA 4LYPA 1QI0A 5IFTA 1KLZA 2ZX9A 1TWWA 1C3FA 4DN1A 2JEQA 4W7UA 1K6AA 1E1EA 4KEVA 1T0OA 3O8AA 1BVWA 2C19A 4F48A 3H53A 2DZPA 4JYFA 5GQBA 1M5WA 4KFNA 1OF8A 1RVKA 3VKDA 4CNPA 2GVYA 2OOFA 5GNZA 3P67A 2V5JA 4IISA 4GIYA 4L4MA 2EEXA 3I7RA 4BA0A 4QNWA 1EHAA 3T44A 1UWSA 4NX0A 5C2CA 4TX6A 3TFXA 1HP5A 2VRKA 3CUXA 1D8CA 1UKTA 4UB9A 1HVXA 4QGCA 1T6MA 1EX5A 3NYZA 2NWSA 1GVFA 1DJZA 4P7NA 3B40A 3QGVA 3T4CA 4I9MA 3OYXA 4UQAA 2W4XA 4HHMA 3LXAA 3LGGA 5AC8A 3DYPA 3R7MA 2PI6A 3UR8A 4R27A 3CPUA 4H9VA 2YZRA 3JRKA 1AW5A 3HA1A 4JFSA 2DQWA 1VFOA 2XH7A 5CJ5A 2XH2A 3V5CA 3GRIA 1EBHA 1VP5A 2OSYA 3ANYA 3GR4A 1WDDA 2CESA 4IIDA 1F4HA 3IUIA 3IGHX 4F0KA 2D3NA 4FZIA 2GJNA 3QLDA 3DG3A 4GYKA 5EB8A 3EB4A 1AODA 4GIEA 3NL6A 3WUGA 3SCTA 1XM3A 1EC7A 4EXAA 3M0VA 3REQB 3GDLA 4FF7A 4AD5A 2VENA 3A4XA 3F2BA 5CG0A 5IXEA 1FDYA 4F40A 1HL9A 2PS2A 4HSHA 2BDQA 1E6SM 1UR1A 1TPC1 2VVSA 4N4QA 2PE4A 1B30A 4NXSA 5H8PA 3RLVA 2XISA 3HO8A 3E2SA 1IYXA 3EX4A 2CBIA 5C9WA 4I90A 3E1F1 4HMCA 4LNYA 4KWVA 2OEKA 4AC1X 3F5KA 1VENA 2YA2A 1JIBA 5L6UA 4ROQA 5K7JA 1EIBA 3O9NA 3VIPA 2OZ3A 2I5IA 3EXSA 1ZBVA 4MKNA 2ISWA 2A3AA 5AC7A 1DJQA 1UMLA 5CSYA 5HWMA 4ZO6A 4CD6A 3N2MA 3GFZA 3RM4A 5DEZA 2YBUA 4AZ7A 1G7VA 2X09A 3BAJA 3L5AA 3A9IA 4AHOA 1GW1A 1ZLPA 2Z1BA 3PULA 5G1YA 4Q8PA 1A5KC 1TR1A 3B8SA 4U33A 2NUYA 2XJ7A 4AQLA 2WZEA 1CB7B 3KLKA 3VDHA 5FEWA 3FLUA 3FYPA 1JCJA 2Y63A 3N13A 3GD6A 3A4AA 1JG9A 4D6CA 1TA3A 3ARQA 1BAGA 2QHAA 5M3WA 1N8WA 1R3WA 4L61A 3ABSA 1IGSA 1TMQA 1QWKA 3FGCA 4RE0A 2PC4A 5EL1A 3CHCA 4L65A 1YYAA 1RALA 3DHUA 3FKKA 2JEPA 1NIUA 1XYZA 2GJPA 3PB2A 2XM2A 3CQIA 4IIBA 2F9RA 2J7GA 1TV3A 1PTAA 2X1SA 1H1NA 1JZ3A 1FDJA 1GTHA 5ABTA 4UR8A 3QTPA 2BMBA 1GVIA 2Q3OA 4X63A 4IIHA 3L65A 3OHIA 4IMGA 3ZQ9A 1XH0A 5AHEA 2E1DA 4AYGA 1R38A 3LZ3A 3G3DA 3NM1A 3PBGA 3VUSA 1R7AA 1FCQA 3PBVA 4Q8UA 4OE7A 4HSOA 1MZRA 1FXQA 2I17A 1J79A 1MEIA 3N1AA 3IARA 4GQGA 4HMDA 3RN6A 4XO7A 4AF0B 4XZHA 4CQAA 3ZJKA 2QXWA 1MWOA 3VZYA 1PUDA 2INEA 4C7GA 1PWMA 3RM9A 3KRSA 1S1PA 4F9DA 3EEGA 3HBLA 1UWRA 2HXTA 3UWUA 4S39A 4C6EA 1S2AA 3WDHA 3BJSA 2ZTJA 3NZRA 1WDWA 1GOXA 3WSUA 4YS1A 5BW6A 1GOQA 4YHGA 1BTMA 5HNUA 3HQ1A 3EOSA 2AL2B 3TMQA 2E6DA 1GW9A 2VFEA 2BHUA 2OKOA 4QSHA 1E0WA 2PB1A 4ZFCA 1K7EA 5G2WA 1X98A 2GQ8A 3ARTA 3ORWA 4IWWA 5CPSA 1XG4A 2OQHA 4Q32A 1W1B1 1F05A 4RKAA 3WBYA 3TZFA 4YXGA 4C6PA 2GDUA 4REQB 3LRMA 4ZODA 5A6TC 4DBEA 1MVYA 2R1LA 3AICA 3MMDA 4MYAA 4TOQA 2EJ1A 1F61A 1S5TA 4ORMA 2C8NA 2GQAA 1LOLA 1QPNA 1VFSA 1I1XA 1A5UA 4LYQA 2Y5SA 4EX4A 4BWLC 3K8MA 3ARRA 2V3GA 1OC5A 4Z0JA 2QJHA 3TA9A 4H1ZA 2PTWA 1QDSA 2CZFA 1BKSA 1DORA 1TQXA 4IGSA 4B5VA 1YMYA 1E70M 4DF0A 2VUYA 1E4NA 3QVQA 3EKGA 1BGAA 3BLDA 3NPVA 1JRBA 5K9XA 3G2GA 5AZ1A 3SCVA 4LCRA 1U5VA 3FN9A 1NTHA 1F5ZA 1ZCCA 5FF4A 3VCCA 4P7QA 2QUUA 4YIWA 1Q45A 4LBRA 4DWDA 5DXYA 4E8DA 1XICA 4YVPA 3CAWA 4Q4KA 4DLFA 5FL0A 1N7KA 3M0HA 1BQCA 3KX6A 1YNQA 3PTDA 3L23A 1KTNA 3DFNA 5A8PA 4B2DA 4KCWA 2J4GA 1CW2A 3NPWA 3AIUA 3PZVA 1QI5A 1U33A 1IT7A 1W32A 2HS8A 1ZS2A 4CQCA 4BI6A 1XV8A 5KITA 4JEQA 5MKGA 3MA8A 1ZBCA 2AKZA 4GBDA 4QE4A 5FJJA 3SUVA 3BSMA 4AU0A 1N8IA 1W9XA 4ZQRA 2B0MA 3WQOA 1NM9A 3WQCA 3ZJ7A 3E49A 3A3WA 2ZX6A 5CAHA 3S5YA 1BYCA 4O28A 1ZSXA 1XIDA 3W83A 4E8CA 1JPMA 1HGYA 3O3RA 3WLTA 2PP1A 4HQVA 3BSHA 5AYIA 2EF9A 3DCPA 1O7AA 3LX9A 4BQ2A 2I9EA 2OLAA 1C93A 1YNYA 1I2OA 5CGQA 1TPFA 1QNOA 2OGYA 3T42A 2VRQA 3DGRA 4H9YA 1Z7AA 4E2DA 5FF2A 1RCQA 2OU4A 3BLLA 2UWFA 3CYJA 5A2BA 3AQUA 4E5TA 2G8ZA 3GYEA 3K1DA 1AMYA 3ZM8A 4Z1YA 1R7OA 1MEHA 5JIPA 5FA5A 2OGJA 3LA4A 1DE6A 3P61A 4ZSTA 4U2ZA 1VBRA 4B5UA 1A0CA 3T0DA 2NUWA 1I6NA 3M6DA 3R0UA 5HR7A 4O4VA 4PCNA 3PB0A 5DLCA 3WQ8A 1EC8A 4MHBA 2FHFA 1HJXA 1JDCA 3RU8X 4WDWA 1C92A 1GJWA 1JDFA 1I2NA 2QT3A 8XIAA 1UPPA 3MSGA 4LS1A 3GU2A 2B4GA 1W1TA 1TZ9A 4OVXA 4OQVA 4LYKA 5ABEA 2VO5A 4M1RA 2VTFA 1XLFA 1IEIA 1UASA 2FTYA 1HGWA 4P7LA 4ICCX 3S1WA 1V3JA 1YXYA 1OFRA 3C5QA 2PF0A 3EWBX 1H7RA 4AZIA 1TPEA 2OZTA 4Q8WA 4F2UA 1V0LA 3LOTA 3SCQA 3LSBA 3G1VA 3GQYA 1QMLA 1DJXA 4ZTYA 2RDUA 3EDDA 5K9DA 2VEPA 3SB0A 3VD5A 1DP0A 4KWOA 3PPFA 1U5HA 2BGSA 2GGHA 3TE9A 3FJ4A 3L0GA 4PBEA 4POCA 1SO6A 4HN4A 2VZOA 2AMXA 2ZIDA 4NAEB 1UBSA 1F3XA 4PCTA 2D0HA 3LU2A 3ZR5A 4O18A 5CGMA 1SMDA 4HZ8A 1UD4A 2ZX5A 3PZMA 1TRDA 4ICMA 4I5UA 1ZBWA 4ZO9A 1EHNA 3O0KA 3M0IA 1CB2A 3CIVA 4BEUA 1XGEA 2J9XA 3SY8A 2WMJA 2ZWZA 1ZALA 3CQ0A 4K39A 4NXKA 3VGDA 1Q6DA 1OBAA 3W4RA 1H11A 2P3ZA 4KRUA 2JGYA 3BMXA 2Y88A 4G7EB 4Z2HA 5I6SA 3VDCA 3TU9A 4EIVA 2POTA 2IKIA 1BXBA 1UUQA 3MHUA 2UV8G 3OP2A 4XAZA 4CQ9A 1VFTA 4AZGA 3T0CA 1W1IE 2YZ5A 1NP0A 1UWIA 2C1GA 2KX9A 1R9ZA 4MAVA 1POJA 1O5RA 3WNPA 4MUZA 3J7HA 3TQPA 1TV4A 2VHLA 3NO5A 4AH7A 3ECQA 3WF4A 1W2VA 1Z6KA 3K4DA 3K8KA 5LIWX 4IG2A 4WGXA 4S3CA 2PP0A 1NFBA 3W2UA 4ENLA 3G3MA 3P5ZA 1V03A 3AZRA 1D8WA 1F76A 2EHHA 5T9CE 3MTWA 4LCSA 3UVAA 2OX4A 1V7AA 4Q4PA 3GX9A 3S3GA 4DJEA 3GXMA 2HK1A 1SZGA 3TR2A 4EP8C 4RW3A 2A5HA 1ONRA 4KH2A 1NU5A 1RJRA 1ALDA 2BVYA 4JDBA 4NX5A 3H4WA 2VEKA 5D30A 3K1GA 1I60A 1L8PA 4JY9A 2G4JA 4Z1BA 4R5EA 3E2QA 3VIMA 1W17A 3UWYA 5HINA 4MAZA 2V5DA 1PHQA 3QQ1A 3WK3A 1P7TA 3EKZA 1B4KA 4IGNA 3E5BA 1BRLA 1JFHA 1K7FA 3GDTA 1TSIA 2PDGA 4TR9A 5CC5A 4LVBA 4PMDA 1Q6QA 1XBZA 3N19B 4WR3A 4Z2KA 4IF2A 5SWUA 3R89A 4QS5A 3WNKA 1O4UA 2IPWA 4QXIA 1D2KA 4E4FA 1IIHA 4FNRA 1XBXA 2PDPA 4PTVA 5AHLA 3CZ8A 4TMBA 1UD3A 1A5AA 1K7XA 4XVEA 2F6XA 3GE7A 1ZJHA 2CLIA 1K9EA 1FWBC 5BOOA 4PMZA 1GQLA 4S23A 3C3UA 5KEZA 2PGRA 1MDLA 3URNA 1XYAA 4I7VA 1WZKA 4UR9A 4MIMA 5BXPA 4W7VA 4LXFA 3A4JA 1JEZA 4EXQA 1VHCA 2XIIA 4L80A 5BMWA 2V6AA 4E4PA 3R1ZA 3IIVA 3DGBA 1AG1O 5GJPA 2HZGA 4IM4A 3UXIA 1PCKA 2CNCA 3OZPA 4AMCA 4WSKA 1WAWA 1IXOA 1TE1A 4HPXA 3PBWA 2QQ6A 2ZZ4A 4O4WA 3WMLA 3W88A 3QHMA 4W5ZA 4MVAA 1E0VA 1LOQA 5DMYA 5BOFA 4LOCA 2C16A 1NARA 3FOKA 3WEOA 4L6DA 4O1BA 1I2PA 2I7GA 2Y5EA 4H01A 3S5NA 3TC3A 2VWSA 1F73A 1Q63A 3Q4DA 1EUAA 1X97A 3UW6A 3EWYA 4G6CA 1UHVA 2VC9A 1V79A 2GFTA 1VCGA 2DZXA 2NUXA 4N6FA 5F2IA 1J93A 4NAFA 4UIOA 1K02A 5F2MA 4ZQNA 4WKFA 7XIMA 3FA4A 3TMLA 3NQCA 2XSXA 4PB5A 5HK4A 5D2TA 1CXEA 4WRHA 1S2WA 3UETA 1ISYA 1Y5VA 2QULA 2JF6A 2XSAA 2J9ZA 4OUEA 2R1KA 3V75A 4ZO7A 1FP9A 4YPJA 3P3BA 3V5FA 1DWAM 4AB4A 1CENA 3VFCA 3T2PA 2P76A 4LRTA 1PJ9A 2Y61A 1SYTA 4WSJA 4AD3A 2R8WA 1EP2A 2ZRYA 4MY8A 1OF6A 4HZ6A 5C5YA 3IRSA 3W1PA 2X8RA 3CH0A 5TIMA 3PZTA 3APYA 4LBSA 2Y8KA 3MCMA 4DYJA 1T41A 5AB3A 3F4CA 3VKJA 3L66A 2DUZA 3ZLGA 1XSJA 4XAPA 1VCVA 1UKSA 2VFHA 3VIIA 3VOGA 3N73A 3WEZA 1HKKA 1BSLA 1DQUA 5DY2A 2Y8VA 3VGHA 3IIPA 1ZAIA 1VRXA 2GVEA 1ZP4A 2BVTA 3GZAA 3KCLA 1W3TA 1FCBA 4GI8A 1R2TA 2WM1A 1H60A 1VEMA 3PBUA 3ABZA 5DN1A 3TUUA 4W85A 4GD0A 3TH6A 3P0XA 4XG1A 3DUGA 4AZHA 1X8FA 4PBGA 3N4EA 2JF7A 1FWTA 2VFGA 3HF3A 1CGWA 4JTHA 2QCMA 2OQYA 2PDIA 3BOLA 1MXGA 1WE5A 1YXDA 2QW5A 4MJMA 3BVJA 2PF8A 1JCYA 2VGIA 1PKYA 5E9XA 3DIPA 3UJSA 5KZDA 3W7KA 3O2LA 4N2YA 2AAMA 3FYYA 3VGGA 2QDHA 2PDHA 4M56A 2XN1A 4UMCA 5DMNA 3NA8A 1JCLA 1H7NA 3KBNA 1AL7A 1DVJA 1M3UA 2PWFA 3FSTA 3ZVHB 4W9TA 4Q8TA 4FEZA 4PB4A 1UUOA 3IJ7A 3RG6A 3VMPA 3AHZA 2VC7A 1ICQA 5ABHA 1E3XA 2HWGA 4ECLA 3SY5A 4X9YA 2DT1A 3EX6A 3WL0A 3AMGA 1OG0A 4F4RA 9CGTA 4LFYA 4KCVA 1LWJA 1QNQA 3NQ7A 5HMDA 4K7YA 1TCMA 3VK5A 3G0SA 2DZVA 2Q6ZA 1ZHAA 2ZDRA 2J24A 3ZZ1A 1KRMA 1BVZA 3L9CA 4K8GA 4Y9PA 4WY0F 4UTMA 4AXNA 3MJMA 3PAOA 3CAKA 4R34A 5GJNA 4IOTA 3I7QA 3HIJA 3DFOA 5BXRA 1GNXA 4NQ1A 3RU6A 3HG5A 1UZ1A 4WX2A 2P88A 3G1FA 1RA5A 3A13A 2Y89A 1JYXA 4C1NA 4HMEA 3WLOA 4ZQCA 2F6KA 5C9RA 1E0XA 5FAGA 3M1ZA 4ZGYA 4ICNA 1UBPC 1JI2A 3OLGA 3QXBA 3VIGA 2XGZA 2J78A 3DKLA 3UERA 3W7NA 5CZKA 5A8NA 5CH9A 4ONVA 1K77A 3RCMA 2YX0A 1BG4A 2WMFA 4WDUA 2W62A 2PDMA 1X6NA 3Q65A 1OVDA 1CGVA 1JF6A 3P2VA 2O4MA 1GQNA 4IJCA 2CYGA 1GQKA 1M65A 1R85A 3TJIA 3A5VA 4MJZA 1VPXA 3TCSA 5EY5A 3HPSA 3E38A 4MWAB 1P0KA 1LL6A 2PDFA 4HP5A 2CKSA 1C9WA 4EF8A 3WQDA 1OCBA 2ZUWA 2BODX 4O1CA 4NJHA 3UG8A 1JXKA 3UXDA 2XGIA 4DRSA 3L4WA 4NRSA 2F61A 1BQGA 1HJQA 3W7OA 4JTAA 1JZ5A 3FHQA 3B8IA 3CB8A 1E6ZA 2E3ZA 1T96A 2OT0A 4F66A 4YYFA 1PDZA 4GLEA 1TPDA 1LBFA 3HURA 1V3HA 3HG4A 3WBEA 4AYSA 2WVUA 1SR9A 2GK1A 3CNYA 1M1BA 2E9LA 2EKGA 3DX5A 2AAAA 1ZY9A 3UXLA 3T05A 4MWAC 3RCNA 2ZUNA 4DWSD 3N18A 5MHBA 2NLYA 3F5LA 2O7SA 1FA2A 3IV8A 3WQVA 3KW3A 1CLKA 2YBVA 3GVVA 1Z89A 3MSDA 3SQMA 2DW7A 2YDQA 2B81A 4ZOCA 3OBAA 1P1MA 2WM0A 5C7VA 3RHGA 5A3HA 2DEPA 3HOJA 2ZZ3A 1HF6A 1H0GA 4I5XA 2YSWA 1B0IA 4QDWA 1ZRQA 3H2OA 2PLKA 3NO3A 5CSSA 2ABAA 5LNUA 1SW0A 4JYEA 2PAJA 1V0MA 4AIBA 1I2QA 1VB9A 5G4WA 2Z29A 2VVNA 3P8IA 4WOQA 3P74A 3GXFA 3NURA 4JQAA 2QJJA 3NQBA 3FAWA 4LH8A 3K5XA 4UOQA 3P6LA 3PUOA 2AOSA 4W89A 3FS2A 2X16A 1OK4A 1N82A 2XIJA 4HOZA 3ARXA 2PLJA 2KZHA 4DELA 4A3RA 2PDUA 4J2PA 4LV4A 5BOEA 2XVNA 4BY3A 1EA9C 2QUMA 1F6PA 4PA8A 3AZTA 3PK7A 2AGKA 3KRZA 1CCWB 4O14A 3DFTA 2BASA 1QNRA 1UZDA 3WIJA 1KRAC 1A5LC 4IPPA 3SRFA 4UXDA 1JQVA 2NX1A 1VLIA 1EB3A 2QR6A 1W8GA 3TYEA 4ACZB 1GONA 2OYLA 3GR7A 3N2CA 2ZUSA 2QUNA 1DJGA 3B9AA 3LPOA 4PCPA 3ZJ8A 1XLHA 5AYZA 3S2CA 3BV4A 3RAOA 2XTKA 1O60A 1AJ2A 2J8GA 2WJEA 3RJXA 5EU9A 4FMVA 2GDQA 3EMQA 1E9YB 2UBPC 1X38A 1XYBA 4JD4A 3BJFA 3PG8A 4GYPC 4J3VA 1UP2A 1OX4A 1EO7A 3FVMA 3IIZA 3T4WA 1DIKA 1Q2RA 4E2BA 2C13A 3DFHA 1RJPA 2FZBA 3EWCA 3B4YA 1IEQA 2CBUA 5DX7A 3VKBA 3VD4A 3QTGA 1H4PA 3TOYA 1GK8A 1G7UA 3NZGA 2REQA 2X1RA 1FTXA 3BGAA 1AA1B 4CNTA 3MZNA 3PAJA 4DAFA 3ITCA 5E1QA 3VUPA 1KWKA 5F2LA 1XLAA 1TPWA 4DXKA 2R24A 1ML1A 2NQHA 4QE1A 4K7VA 3CV1A 4IXHA 3IRDA 3G1AA 3JW7A 3CEUA 4XKYA 1NFPA 4QDMA 3D3AA 2DJLA 5A69A 2FGBA 3CHEA 3H2CA 3HV9A 3IIOA 4M81A 3WENA 5FEXA 1RCXB 2JKEA 2V67A 2XM1A 2VD8A 2VUNA 4WOZA 1G5AA 1PYFA 3ZSSA 5A6LA 2TRSA 2AKMA 5HWNA 4B9YA 5HNRA 4FNSA 4OUIA 2G3FA 2OOGA 1H2JA 5I7GA 2WSRA 3E96A 5CPTA 3SBFA 4RNIA 1NH6A 5HANA 4XAFA 4E38A 4IIGA 1XLCA 4ZL1A 4M51A 3TTYA 2QEZA 3W7EA 1QT1A 3F4WA 1SFLA 1C29A 2J66A 2A6NA 3FXYA 2EPNA 2J7DA 5EMYA 1EA0A 1YPFA 5KINA 1ZTVA 2BS9A 4BHYA 2IPJA 1T40A 2WXDM 5JH2A 2YJQA 3NEVA 2VDHA 3H6OA 1UA7A 4IX2A 3LY0A 2EXOA 5CC7A 5KTLA 3VD7A 5J5DA 3ATYA 4O17A 4DUVA 4JHZA 5E70A 2QIIA 1ITQA 5CZJA 3RFAA 4GFSA 2ZZ2A 4MGGA 4DBDA 3STFA 4ZB5A 2IXVA 3WD3A 3V16A 1FP8A 3VZXA 2FPVA 3VC6A 1UR9A 3R10A 5I0DA 5D2VA 1XD1A 2FDSA 2YW3A 3EDEA 5LIYX 3W1TA 4ORIA 2QPXA 3LYEA 2DSVA 1Y8BA 2I5GA 4C6QA 1HG3A 5A8MA 3DXIA 4INFA 2X05A 1LTDA 4S3FA 1R86A 1A5SA 3OOQA 5LNWA 2G0WA 3UR2A 2H9AA 1TO3A 1G0CA 1H5VA 4QM1A 2H6RA 3TTQA 1U83A 3AMCA 1XP3A 1SSDA 1WNOA 4RLIA 3KOWA 1DV7A 2XVGA 1JJKA 3WMBA 3EPOA 2PTYA 4UQBA 2Q02A 4M0XA 3GIYA 1V6UA 2WC7A 4UCGA 2O92A 4CLMA 3VNZA 4UNIA 3SSZA 2QLYA 1I75A 4XSMA 1RK5A 4LC8A 3BQ6A 1EWEA 1ZP3A 3IVSA 1GYLA 4J5NA 3RJYA 5ABFB 1WB0A 1PKNA 4U3AA 1HN1A 3N34A 3ATZA 1EJVC 3WLQA 5I02A 3KWSA 2YCKX 3PSVA 3CS2A 4IPLA 1YDNA 4D6IA 1P5BA 7REQA 4GA8A 1OB0A 3VGEA 1NQ6A 2FB3A 5BZAA 1WDRA 4DYEA 1SJBA 2YOCA 1DJNA 4GCXA 1W9BM 3WDPP 5KMYA 4RZ4A 5DMMA 4IIFA 1EKOA 3WH9A 1OFQA 5G1MA 4JFTA 1YW1A 3T8QA 4FOJA 1MNSA 3EOEA 1RAKA 1YRRA 1PB0A 3CAQA 1VYRA 1J2BA 3PZQA 3CTTA 7PTDA 3ZYZA 3ZWSA 4EWJA 1HTIA 1IEXA 4LAOA 3LHZA 2A21A 4N9CA 3SADA 4MG4A 3RLHA 4RCXA 2JQXA 3GYCA 3WJYA 3GK0A 1Z41A 1FWAC 2XZ9A 3LPFA 3N4AA 1XBYA 2D0GA 2HXUA 2ZFAA 4ERGA 3C0LA 1JPIA 3A64A 2X41A 2GZXA 3NQ6A 3G0UA 2DZUA 3S5SA 1HKVA 2OO0A 4Z1CA 2BLEA 2V82A 4R7WA 4HNUA 5G2IA 2C91A 3S6TA 4F0MA 5DF0A 3KVLA 5T9BG 2W66A 4PTDA 1GWJA 2Y7GA 2ONEA 5IM51 1DYSA 4ZMGA 1LLWA 2D69A 3M5VA 4JIQA 4GUGA 2D24A 4LB4A 1CT5A 3WCZA 1TJ0A 2GL5A 3WBAA 1DHPA 1J0JA 3VNYA 2ZA3A 4DJDC 3KTCA 5EMKA 4MM1A 3GXPA 2B7NA