3PZQA

Structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 with maltose and glycerol
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
357
structure length
357
Chain Sequence
FRFIGSNNYYMHYKSNRMIDSVLESARDMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVFGVPEGISNAQNGFERLDYTIAKAKELGIKLIIVLVNNWDDFGGMNQYVRWFGGTHHDDFYRDERIKEEYKKYVSFLINHVNVYTGVPYREEPTIMAWELANELRCETDKSGNTLVEWVKEMSSYIKSLDPNHLVAVGDEGFFSNYEGFKPYGGEAEWAYNGWSGVDWKKLLSIETVDFGTFHLYPSHWGVSPENYAQWGAKWIEDHIKIAKEIGKPVVLEEYGIPKSAPVNRTAIYRLWNDLVYDLGGDGAMFWMLAGIGEGSDRDERGYYPDYDGFRIVNDDSPEAELIREYAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a novel hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1
rcsb
source organism Thermotoga petrophila rku-1
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family
total genus 155
structure length 357
sequence length 357
ec nomenclature ec 3.2.1.78: Mannan endo-1,4-beta-mannosidase.
pdb deposition date 2010-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3pzqA00
3RM8A 2QPUA 2XTKA 4CN1A 3ZSSA 1JG9A 1L0PA 4YHEA 5IXEA 3RM4A 4HPHA 2VZTA 4JHZA 1SMAA 3NIYA 1PX3A 2EXOA 3CUFA 3WEMA 1B9ZA 4K68A 1XYZA 2VRQA 1EDTA 2VZVA 2VZOA 1W91A 5BROA 4YN5A 1DWGM 1LQ0A 3G6MA 2YDQA 4QCEA 5DO8A 3WEZA 4P7NA 3K4DA 2J62A 4UQDA 3SUVA 4P8WA 1JYVA 2J25A 1VEMA 5D8WA 1GOMA 1I1XA 3CZ8A 2ZICA 1TR1A 4E8DA 2XWDA 3AIVA 1PBGA 2ZX5A 4W86A 1CECA 3IJ8A 4BS0A 2X0HA 4UNIA 1KWGA 3ECQA 2WB5A 1V02E 1ZBKA 2WANA 4MB3A 5FKYA 1UHVA 3AHZA 3U7BA 1W9UA 3VDAA 1SMDA 3EYPA 4MNLA 1EQCA 2A3HA 1AMYA 4P7QA 2VZSA 1QNSA 3MUY1 4J27A 4ZXLA 4AW7A 2HVMA 2XVNA 4IPNB 2XUCA 3PZUA 2WWDA 1A47A 3L4VA 3W82A 1R86A 3ALGA 1WDPA 5A6LA 2E0PA 1N82A 4OOUA 2XGIA 3GXDA 2XG9A 3WNPA 2D3NA 3RJYA 3WDJA 4IISA 3ZIZA 1UD4A 4H04A 4D71A 5I6SA 5A2CA 3NSMA 1CGTA 3VIOA 2VRJA 1OCQA 2Z1SA 5JUVA 3M07A 4P8UA 1Z32X 4ZEPA 5A8NA 4NSBA 3FAWA 4ACYA 1C92A 4W89A 4R5EA 4CU6A 5D9MA 5A6BA 1MWOA 5GQBA 3W27A 5A3HA 1R8LA 1ZS2A 2WVVB 3EMZA 1JAEA 1KBKA 4HMCA 5DFAA 3VTRA 2VO5A 3K8KA 2PBOA 2Y4SA 3G6LA 4W87A 2W63A 1E5NA 4JL2A 4S3KA 2BY3A 3ARWA 1UKSA 1FA2A 3OLDA 3ALFA 3RCNA 3ARTA 1HIZA 2O9OA 4AIOA 5JBDA 4C7DA 5I0DA 1HKMA 3EDKA 1RP8A 1E4LA 3W6LA 2VC9A 4D72A 1E56A 1UYQA 2JFEX 1DWHM 4AZIA 2B31A 3VINA 5GPRA 2MANA 1V02A 3CHEA 5JIWA 1QBAA 3EDDA 4TTUA 3UG3A 5ABHA 2OWWA 1MW3A 1QVBA 3MO4A 2VMFA 4WSJA 1NWUA 1XCXA 1UH3A 3DHUA 2VT0A 5LYRA 2XM1A 2XYLA 2DQXA 3VOCA 3CIVA 1V6WA 4V28A 2J77A 2VR4A 3VPLA 2WSPA 3ARPA 4D1JA 1OBAA 4LQ1A 2J4GA 2VX6A 3VUPA 1C3FA 4XB3A 1MQRA 3CHCA 1EGZA 3MANA 1JZ5A 2BY2A 5F7UA 3QGVA 5CXPA 1GQJA 1VENA 2OYKA 1CBGA 1KFWA 2XHYA 4HA3A 4N42A 5DT5A 2Z1KA 1GHSA 3CHDA 5AC4A 3AHYA 4AIUA 4AEEA 4Z2KA 1XH1A 1UR9A 2ZXAA 2EPLX 1CXFA 2ZOXA 5CLTA 4UFLA 3VGHA 2WAGA 3THCA 5BXRA 2D23A 1D7FA 4FLQA 4QDMA 1YHTA 3BSGA 4A3YA 3AXIA 1J18A 1NM9A 2XPKA 1NQ6A 2DSZA 4OIFA 2A3EA 4J3WA 3VD5A 1WZAA 2BHYA 2CETA 2WWCA 5M17A 3VD4A 3RPMA 1OIFA 1GOOA 1WE5A 2V3GA 5I24A 3ZJ7A 3GBEA 1CXEA 1E73M 2UY2A 4BQ4A 4W88A 3RMEA 1B3XA 3B9EA 3VKKA 3GH4A 2W61A 2WHJA 1CGVA 1DWFM 4FLRA 3T08A 5A94A 4XX6A 3ARSA 5D4YA 3CBWA 5KZ6A 3KL5A 4EAMA 3EMCA 1TVNA 5BXPA 1QBBA 1VFFA 3POCA 3A6OA 2EQDA 2BY0A 1V0MA 3AXHA 3L4TA 4R27A 3PZ9A 1H2JA 3GDBA 2FH6A 1K9FA 2QLYA 2YDSA 4OOZA 3WMCA 4WK9A 3WUFA 4H41A 4KGLA 3AS2A 4L4OA 4UZSA 5A95A 1WAWA 3SCQA 3AIQA 1G94A 1HL9A 3RIKA 2E4TA 3N1AA 1B3ZA 5A6AA 2J7EA 3BAIA 1PPIA 1M01A 2W67A 2DH2A 1HJSA 2FGLA 5M5DA 5HDRA 3AROA 2CBIA 4WKFA 4AIEA 3QOMA 4DUWA 4AD3A 3WL0A 1QI2A 5D9OA 1OT2A 3AI0A 1WB0A 1PEZA 3W37A 1E6SM 2VRKA 3MMUA 2XWEA 4OBSA 2BFGA 4XV0A 5C71A 1V3IA 1XH2A 3LPOA 3HMCA 2CHNA 1BFNA 4WSKA 5FL1A 3BC9A 5TD4A 5IFTA 3N04A 1GONA 4PMDA 3VO0A 2J7BA 1UZ4A 3WENA 1WCGA 3K8LA 1VIWA 1HVXA 1W2VA 3WKZA 4AD5A 1DTUA 1JF6A 3UCQA 1LF1A 1W1YA 3POHA 5A8OA 1CDGA 1SYTA 5AYBA 2XJ7A 2OSXA 3WDHA 3U5UA 3VIIA 1XSJA 4H8UA 7TAAA 5A2BA 1UKPA 1JD7A 1ISWA 4J7RA 1HNYA 3LPPA 2QPSA 1EIBA 5DEZA 3AIEA 2FDMA 3SCWA 1MFUA 1UD2A 4PRWA 3TOPA 1JZ3A 2YBUA 1H3GA 2AMGA 4PUDA 3GYCA 4IPLA 1BYBA 1IV8A 1CGUA 4L4PA 1BVNP 4PEEA 1TUXA 5ABFB 1HJVA 3OIHA 3A47A 1XD1A 5FCZA 4MAZA 3VVGA 1J01A 3MS8A 1H0IA 2PI6A 5GNZA 3DHPA 4TOQA 4U2YA 3U57A 3WMSA 3FHAA 4URIA 2WNWA 3F4VA 3L4YA 2CYGA 1ZJBA 3K8MA 1WDRA 2G3MA 2JEQA 1MW0A 3AS0A 3VIGA 4Z2LA 4XZWA 1GOWA 4LX4A 2D3LA 4WKHA 1HJXA 2J8GA 3WF3A 4MDOA 3WQ6A 5LA1A 2VZUA 3RJXA 3PZQA 3M6DA 4J28A 1QI4A 3GH7A 1W1TA 4MB1A 1J0YA 1KBBA 3EDJA 2WYSA 3FNDA 3WQWA 2DT3A 2WM0A 3K46A 1LLOA 2PC8A 5I77A 4FLSA 1GUVA 2EBNA 5CGTA 1LJYA 4AY1A 4MADA 1GOIA 1Q4NX 4EE9A 1CWYA 1V0LA 3CMGA 4PMXA 2OWXA 4AZGA 1MQPA 1VFMA 3O2LA 4M80A 4UOZA 2V3EA 2WVSA 2YLLA 1LWJA 3CHFA 2OLHA 3OGVA 1QI5A 2YL5A 2VX5A 2VL4A 2CCRA 3MMDA 1NWTA 1WO2A 2GK1B 4MJ4A 4WJXA 5A6SA 5LA2A 1WP6A 1EQPA 1HKKA 4JZ5A 4E4PA 2A3AA 2X2YA 1E55A 1M53A 1C8QA 1JD9A 1BGAA 1KCLA 3B9DA 1KGWA 1OIMA 1KWKA 2VCBA 4ZE5A 2JALA 4FLOA 2JEPA 4MNJA 1H1NA 3M46A 3AFBA 1JNDA 1NP0A 4GI8A 4PSRA 4PTWA 4UZUA 3L4ZA 2Y24A 4OUEA 1HL8A 2O9PA 1XV8A 3K1DA 4CD8A 2WLZA 4GO9A 5E70A 1VRXA 4W7VA 1GOQA 1IT0A 1E71M 1W3HA 3AMGA 3VIMA 2DIEA 3ZJ6A 4MTVA 4OZOA 4F79A 1K9EA 4PMUA 1EHNA 3RILA 4GI6A 2RGLA 4CCDA 2C8NA 3L4WA 1SFSA 1RD6A 2NSXA 4W85A 4AD4A 3HN3A 2Q8XA 1CGXA 4GQQA 2CITA 1L8NA 1V0NA 5HBFA 1Y7VA 3EBVA 4PMRA 1NP2A 1KXVA 5FL0A 2WMKA 1E0WA 1J12A 4UFHA 4B16A 4JKKA 2WMFA 1NOWA 4EK7A 5HXMA 1PIGA 2VX4A 1V08A 1RP9A 3KWXA 5DMYA 1U2YA 2G41A 4JFUA 2D0FA 4PBGA 3AMKA 1QI0A 2WZEA 2WC7A 1HVQA 1TZ7A 5I79A 4PMOA 1D3CA 4DWSC 4KRTA 1FFQA 4H2CA 4MDPA 4TVUA 5BYWA 1J11A 3N18A 1HJQA 2HISA 1V3JA 5KEZA 1RH9A 3VIHA 4CUCA 2VUYA 5D9PA 2GFTA 4W7UA 1UA7A 3AMCA 3VD9A 2G8ZA 4N0RA 1CPUA 1K6AA 5I78A 1UR0A 1TCMA 3WFZA 3WQVA 3II1A 1W9DM 4HTYA 4GINA 4HU0A 4AYSA 3T2QA 2VJXA 1E0XA 2WKGA 2WHMA 1FOBA 2FHFA 4M81A 1ODZA 3ARVA 1E5JA 2CKRA 2G3NA 2XIBA 1E6QM 3NDYA 5DF0A 3W28A 1BYAA 1I75A 1B0IA 1JF5A 2ZE0A 4PCSA 2W4XA 1UWRA 3WDIA 1HF6A 4HU8A 3T0BA 2CPUA 8A3HA 3PZIA 1W3KA 3BLKA 1CGYA 2E9LA 1Q6FA 2DSVA 2YBTA 1JDAA 4D6FA 5D9NA 2J7HA 2WMJA 3AZRA 3VIFA 1CIUA 1FH9A 4JHOA 1MVYA 5BCAA 3F5JA 5C70A 3MKKA 3WELA 3BGAA 6TAAA 3FHQA 1H0GA 4CU7A 1XYFA 4AWEA 4X0VA 3UERA 1CNVA 2WVVA 3EMQA 3ZM8A 3WH7A 3PZTA 4D6IA 3PZGA 1WDSA 1DEDA 4BF7A 1ISYA 2UY5A 1TVPA 5GNYA 1R7AA 3MUAA 5E0CA 1OD0A 1K9DA 3VX1A 5AC5A 2YA0A 3GXFA 2W62A 2QV4A 3I3BA 2X1IA 1ISZA 5CPQA 2E9BA 1J0ZA 2A3BA 5IHRA 4UCFA 5FIPA 4AZ5A 2V3FA 1UQYA 4W8BA 5CPSA 3PBGA 4CVWA 3WNMA 1R87A 3A4WA 3BH4A 4S3JA 2AOSA 3MU7A 4F9DA 1H5VA 3WFLA 4PCTA 2WCGA 3ARXA 4HPGA 1V6XA 1XSKA 2QF8A 1EOMA 1MW1A 4BQ3A 3FW6A 2VVNA 1JYNA 2G4FA 1GOKA 4M24A 2DIJA 3UG4A 1OGSA 2WC4A 2GDUA 2ZUVA 4GO8A 1JFXA 2D1ZA 3LPFA 1ITCA 2WCSA 3ZOAA 3IAPA 4B9ZA 1E6PA 1H11A 3S6TA 4MPKA 1R7OA 1ZBCA 3SCNA 3AISA 2J75A 4PYSA 3OLIA 1HKIA 1ZB5A 3W0KA 4LXFA 1HN1A 1V03A 3WQ4A 3BMVA 4V2XA 5A6JA 2YL6A 1C93A 1G01A 4GZJA 1J10A 3WNNA 2EPOA 1PAMA 1GNXA 4M56A 1DHKA 3A4AA 4U5IA 1MFVA 3OGRA 7A3HA 4PTMA 2ZXQA 3VX0A 5CSUA 4Y7EA 3T09A 4B15A 4GIAA 4F9JA 1C8YA 3N12A 5JBEA 1ISVA 3IANA 4D6JA 3ZR6A 4MJ2A 3MSGA 2WBGA 3VNZA 3VGBA 3F5LA 3JUGA 3W53A 4D6HA 5BWFA 1BAGA 2CXGA 2F2HA 2XFFA 2CESA 1GPFA 1UWSA 4AZCB 4TX8A 2VX7A 2DT1A 1Q6DA 1WZLA 1R85A 3OGSA 1TMQA 1UR2A 2J8FA 2F8QA 2CBJA 1QHZA 2VOTA 3VDBA 1WZKA 1JZ6A 1KGXA 1OGBA 5CSYA 3WBEA 1GVYA 4UFIA 4PMZA 4HOZA 3WEOA 4AZ6A 5DT7A 4AISA 1VEPA 2EO7A 3ZO9A 5HPCA 1XHGA 3OA5A 1HP4A 1B90A 3PZNA 3SCVA 2WPGA 3PTQA 4LYQA 2WSKA 3CZEA 4H8VA 3AICA 4AD0A 2D24A 4DWSA 4NF7A 1G0CA 3AOFA 5EB8A 4AZBA 2W66A 1UD6A 1EDQA 1E9LA 3VMPA 5AY7A 4CU8A 1E70M 1E1EA 4W8AA 1HT6A 3VNYA 2C0HA 4UOJA 1EXPA 2CHOA 3ZMRA 1C8XA 5D8ZA 3CUIA 3KZSA 4M8UA 5A1AA 1JDCA 1MYRA 1BLIA 2GDVA 3TP4A 1CGWA 2WHKA 2YIHA 4HMDA 4ML4A 2BNJA 1JZ8A 2GJRA 1OWQA 1J9YA 3L4UA 1W1VA 2GJXB 4JFWA 1FH8A 3ARUA 4BQ5A 4BCEA 1LL7A 3TA9A 3PZVA 4QAWA 4W7WA 2RGMA 3OBAA 5BRPA 2YA2A 3BMWA 3L2MA 4MNMA 1E4MM 1JXJA 1BYCA 4UQEA 4TVCA 3WD3A 2XFRA 1B1YA 1V0KA 4QLKA 2ZX8A 1K9TA 2CBVA 1F4HA 2V5DA 3O9NA 2YOCA 1W3JA 3OB8A 1H09A 2XIIA 5CZKA 4NRRA 1KR1A 1ZBWA 2WMIB 2VR5A 4QLLA 5M3WA 1V6VA 4P7LA 1QW8A 4TUFA 4X9YA 5A6BD 4DM1A 3EDFA 1JZ7A 4MB4A 2WCAA 1QHPA 1X6NA 4D6EA 1V3LA 1OB0A 4PMNA 1BVZA 9CGTA 3AHXA 3NSNA 5EMYA 2JIWA 4B3LA 2XVLA 1P6WA 1TA3B 1EHAA 2D22A 2FHCA 4NI3A 2GVYA 3DYPA 3MMWA 2UY3A 3QHMA 4J3TA 1UUQA 1EH9A 4Z2JA 4GXPA 5ABFA 4Z2GA 1VFOA 2BVYA 2E8ZA 1QI3A 1QNOA 1OINA 1DWJM 1EO5A 1KGUA 5ABGA 3AYRA 2VQTA 2ZXDA 3OLEA 2BS9A 4U3AA 1UR4A 1E6RA 2ZUMA 3AS3A 1AQHA 3TTOA 3HJEA 3VGEA 4HOWA 1UR1A 1HKJA 4B3KA 2ZUUA 5A2AA 4M1RA 2D0HA 2PBGA 3VIKA 3PHAA 3O6AA 3DYMA 4UQAA 2W92A 3WUGA 4MAVA 4P7RA 5EFDA 1WKYA 3AS1A 3AZSA 3GNPA 4CN4A 4IUGA 4WF7A 5JBFA 3MUIA 1E3XA 2WMGA 3WH8A 3T0AA 3SCPA 2EPMX 2IXUA 2IUZA 2FGZA 5ECUA 3ARYA 1E6ZA 1QPKA 3TTYA 1FFRA 4QFUA 2WZHA 3N15A 1KXTA 2NT0A 1G1YA 3D5HA 3VM7A 2QMJA 2WZIA 1M03A 4LYPA 2BVTA 4OJYA 1ODUA 4FF5A 1W9XA 3VILA 4PMVA 2VCCA 3UG5A 5E0FA 3QOKA 4JFVA 4X0NA 3AQUA 1LL6A 1BF2A 1V3MA 3IJ7A 1C7SA 5A8PA 3OZPA 3SEPA 1J0JA 1GHRA 2PB1A 3SUTA 3NUKA 2DSWA 4JCLA 2OSYA 1LG2A 1YQ2A 4P8XA 2TAAA 1W9PA 4J3UA 4M29A 1DWIM 1XRVA 3W81A 2WC3A 2J79A 2WXDM 3KE0A 5A6KA 3PN8A 1BHGA 2ESCA 1UWTA 4GZEA 2DEPA 3WIJA 4DUVA 1J0HA 1G9HA 2WKLA 1IZKA 2DSUA 5ABEA 4UQBA 3BAWA 3WY1A 1XSIA 2XM2A 4J3XA 1KQYA 2Y2WA 1UD8A 3APGA 4UOQA 2XSBA 2Y8KA 1UH2A 3FXYA 4AD1A 1ECEA 2WMIA 1B3YA 3LMYA 3GXMA 3TONA 3CGTA 4U31A 5E6ZA 1KB3A 3DC0A 3SCRA 1HJWA 3LPGA 2UWFA 4JIEA 3BAYA 1E4IA 3WQ5A 1EA9C 3U5YA 4JCMA 1QNQA 3AIBA 2XSAA 4C7FA 2BXZA 4U3CA 1UZ1A 2AAAA 2GJXA 1AQ0A 6A3HA 1C7TA 2V3DA 2XVKA 3WNKA 5CJ5A 4H8HA 4BZYA 2QMKA 1B31A 2BXYA 4M82A 1B3VA 1CEOA 3IK2A 4OKDA 3ZJ8A 1GQKA 3ARRA 1F4AA 1JZ4A 2VCAA 3TTSA 3GXIA 3PTMA 3WUEA 3OG2A 2FH8A 1ISXA 3IAQA 4HMEA 4ZXOA 1GVIA 1EO7A 2Y5EA 1KXHA 4UR9A 3AYSA 2D20A 3D3AA 4YHGA 1JAKA 3N11A 4AEFA 1CXIA 4D6DA 1JI2A 3F5KA 3VD3A 1E6XM 1U30A 1V6YA 1CLVA 2DH3A 4KRUA 1BTCA 2F61A 4D1IA 2XFYA 2A3CA 2ZXBA 3WF0A 2J74A 1J0IA 1CTNA 3AJ7A 4GQRA 1XCWA 4W5UA 1BYDA 5HNNA 3AIUA 3DECA 5I2UA 5CQ1A 1PIFA 4D6CA 3WNOA 2WW5A 2V5CA 3GZAA 2WVTA 1UKTA 4RL3A 1QNPA 5I5RA 2J7DA 3MSDA 1IZJA 3WQ8A 2Y8VA 2ZWYA 4RE4A 3WH9A 2PWFA 4WLCA 3WD1A 3SUSA 2NW0A 1E43A 1CYGA 1W3LA 1Q6EA 1H49A 1AVAA 1PZ2A 3VMOA 2QHAA 5EFFA 2BVDA 1E3ZA 1CXLA 4QP0A 4AZ7A 4E8CA 2DT2A 3WDRA 5JIPA 3NDZA 3WF2A 1QNRA 3BLPX 3MV01 2JIEA 4J3VA 2JE8A 4TVDA 3VM5A 1WPCA 3VGFA 1NH6A 2DDXA 2J7GA 5IHSA 4UFMA 1MW2A 1B3WA 2O9RA 3PTKA 2EJ1A 3WMBA 1GORA 2PWEA 2ZUSA 4AD2A 1HJUA 2XGBA 3ZT5A 1PX4A 2GUYA 3WDPP 4DM2A 2X8RA 3SCSA 2W5FA 2CIPA 1MQQA 2E9MA 4NZCA 4KH2A 2O92A 1XC6A 4HZ7A 3AHTA 3EDEA 3CTTA 2YLAA 4FMVA 1GW1A 1WZMA 1CZ1A 3CH9A 2BY1A 3RO8A 3ZT6A 3I3EA 4CD7A 1BG4A 3BAKA 2JF6A 4UFJA 2W91A 1EDGA 1KR0A 3BAJA 1EOKA 1E15A 1JDDA 4RE2A 1KQZA 2BHZA 3VIPA 2VI0A 1OT1A 2PWDA 3NCOA 4DUXA 1QHOA 1FHDA 4XUYA 4H7VA 1E4NA 4EKJA 1JL8A 4PMQA 1ZL1A 4JFSA 3SUUA 4KGJA 4TXEA 1X1NA 2EEXA 4GKLA 7CGTA 1UG6A 3WH6A 1VJZA 2G3JA 4DWSD 1JFHA 1JXKA 4J3SA 1J0KA 1E6NA 2WMHA 4AZHA 1TE1A 1DP0A 1Q6GA 2ZIDA 3SCUA 1TFVA 1V3HA 3RDKA 4TTGA 4PMYA 4U2ZA 3CZGA 5LA0A 4PTVA 3ZQ9A 1PJ9A 3AIRA 3AIWA 4JKMA 1O6IA 2CBUA 3CLWA 4OBRA 5A8MA 1BG9A 2X05A 1LWHA 1VF8A 1I1WA 4MB5A 5I3DA 1UA3A 1AQMA 3J7HA 2VVSA 2DGAA 3UR7A 4W84A 3K4AA 4W8LA 2PWGA 5CG0A 1B30A 1TG7A 5E9AA 1D2KA 3QHOA 3WNLA 3MV11 4CD5A 1GJUA 2PWHA 3CZKA 1NARA 3L2LA 3KL0A 2J7CA 3ARZA 1NWRA 4A3HA 4XZBA 1ESWA 3CZLA 2OWCA 3N13A 1PX8A 1MXGA 1UKOA 3B8SA 4UQCA 1E72M 1VJSA 1JZ2A 4ACZA 2WK2A 3WSUA 8CGTA 2V38A 3WH5A 5BXTA 1HP5A 3T0DA 3ARQA 4CN6A 2CERA 3SUWA 1E0VA 1OM0A 2ZUTA 4QLJA 4NRSA 3VU2A 4RE3A 1UR8A 4U5KA 4AXNA 4UQ9A 4Q7NA 2C7FA 2ZX9A 3ZSTA 3FAXA 2ZUNA 4CD4A 2YL9A 3AZTA 3CPUA 2ZX6A 1JIBA 2J7FA 3AXXA 3BCFA 4UFKA 2OSWA 4FK9A 1UD5A 3E1F1 5FOOA 1ZBVA 3N17A 3NYDA 3VGDA 1B2YA 2BV9A 4LGXA 1UOKA 1CXKA 3VD7A 2E3ZA 3CZJA 2CNCA 4ATDA 2D0GA 2EPKX 3WBAA 3W25A 1CLXA 2ZWZA 4ZFMA 4P7OA 4E2OA 4PSPA 1XD0A 2G3IA 4JKLA 5E6YA 4HZ8A 2ZX7A 4PTXA 4AZCA 3AHVA 3NSXA 1VBRA 1GCYA 2VQUA 3OLGA 3CUGA 3PZMA 1UKQA 1Q6CA 1US2A 1JI1A 3CO4A 2D2OA 1H4PA 1FP8A 1KCKA 2X0YA 1X6LA 5A6MA 1BGGA 2DPEA 1A3HA 5HPOA 1HXJA 2JF7A 2O9TA 3VDHA 4DWSB 3KEHA 4BQ2A 4ATLA 3SURA 2WBKA 4WIWA 3BAXA 4IM4A 4BA0A 2UY4A 2XVGA 4HP5A 1W2PA 3QR3A 5A69A 4AC1X 1BQCA 5AYIA 3W4RA 2CKSA 5E09A 1UH4A 3DYOA 6CGTA 1VEOA 2YL8A 1CXHA 1GZJA 3W38A 1XGZA 3VIJA 1DWAM 4ZENA 3BXWA 3GM8A 3WN6A 3B9AA 4F8XA 2YA1A 2NT1A 3ZJKA 3VGGA 1PZ3A 1CENA 4ATWA 5HOSA 5EBAA 1GQIA 3SCTA 4CD6A 2WHLA 3CUHA 1E1FA 3W6MA 1W9VA 3RM9A 4HZ6A 4CVUA 3W26A 1UD3A 2OYLA 3VMNA 3GBDA 4HA1A 4CKQA 5BRQA 5A8QA 3OZOA 1WNOA 4V27A 1XH0A 2VNCA 4P8VA 3THDA 2IXVA 3U7VA 4JL1A 1C91A 3TTQA 1KXQA 5GNXA 3SCOA 1GJWA 3GTNA 4PUEA 1W1PA 3T2PA 5CGMA 2ZUWA 3A3HA 2VTFA 1OSEA 4W93A 2WVUA 3AMDA 1LL4A 2E40A 3T2OA 1FH7A 4C7GA 1NWSA 1UWUA 1VBUA 1V3KA 3WD2A 3FY1A 2YDRA 3FN9A 2GK1A 1UWIA 1OD8A 3GH5A 3SIMA 1QW9A 5FD0A 1HX0A 4GZIA 5IFPA 1M7XA 4JFTA 4TX6A 4AMCA 1NOFA 4UTFA 1O7AA 1UQZA 3AMLA 1C90A 4CGTA 3GNRA 1W32A 1OGGA 2J47A 1RPKA 1V6UA 3BSHA 3UETA 3WUBA 1QOXA 1VFUA 1JYWA 3CUJA 2YKKA 1G5AA 1H41A 4CCCA 3ZT7A 1TA3A 4LYRA 2E8YA 4KMQA 4HOXA 3BCDA 3N9KA 3ZR5A 1GQLA 1BSIA 3S2CA 2WLYA 5BXSA 3GNOA 1E40A 1VB9A 5I23A 4GPNA 3UEQA 3W29A 1VAHA 4GI9A 3HU7A 4Q22A 5IDIA 4D6GA 1ZU8A 1FP9A 3WDQA 3L4XA 3MUZ1 2GSJA 4WKAA 2DT0A 4HA4A 4ACZB 1ITXA 4PN2A 5CLWA 2DSKA 3KL3A 3WF1A 4W5ZA 3WF4A 1LG1A 2J78A 3NJ3A 4Z2IA 1MXDA 3UESA 4CCEA 4A4AA 4EANA 1JGIA 1S46A 2OYMA 3QHNA 1JNEA 1SR0A 1US3A 1BPLB 4MNKA 1M04A 2BHUA 3CMJA 1UWQA 2CEQA 3WD0A 4ZE4A 1W9BM 3IJ9A 5C8BB 2EPNA 2XVPA 4U33A 1FHLA 3M7SA 1WDQA 3PZOA 4F66A 2YJQA 3WD4A 1JYXA 4JAWA 3VDCA 3I3DA 5CPTA 2VURA 4LPCA 3UR8A 1NOUA 4KWUA 5M03A 2X09A 4YPJA 2PF0A 2GJPA 3A4XA 4Z2HA 2FHBA 3WL1A 4QCFA 4B9YA 1ZJAA 3W24A 1U33A
chains in the Genus database with same CATH superfamily
2XTKA 4CN1A 3M0VA 2Z2UA 3IARA 1H61A 4L1XA 1PX3A 2EXOA 3CUFA 1F9CA 1PDZA 1XXXA 4LV4A 4K68A 2VRQA 1QPOA 2VZVA 1GVRA 1W91A 4YN5A 1DWGM 1LQ0A 4QCEA 5DO8A 3GG7A 2J62A 3BOFA 2Z00A 4UQDA 3TXZA 1J79A 4P8WA 1BD0A 1OG0A 3UWQA 2J25A 1I1XA 4ZOAA 3W83A 1TR1A 4E8DA 4GJIA 4YJ5A 3PF3A 2VP8A 4KWOA 1PBGA 4JYEA 1NFGA 1CECA 4LF2A 4NILA 5HAOA 4UNIA 3FSUA 4Z42C 3AO0A 1KWGA 1XLFA 3ABQA 4MYAA 4AC7C 1UHVA 3NO1A 1XRTA 3U7BA 2HWGA 4LNYA 3LERA 4MNLA 1T41A 5AYZA 4F4RA 2VZSA 3NXFA 4ZXLA 4AW7A 2MNRA 4JQ4A 3HGRA 4IPNB 3LGGA 2QEZA 4IGNA 5FF4A 3USZA 1A47A 4EXAA 2POTA 3KHDA 3W1NA 2XG9A 1R2RA 3IGSA 2OPJA 3SADA 3ZIZA 4H04A 3L0GA 1K8YA 1CGTA 3NSMA 5C5YA 3IK4A 1OCQA 3M07A 3SW6A 4K8HA 3D47A 4ZEPA 3VFLA 4RJEA 1E51A 4W89A 4R5EA 4Q4OA 4O4WA 2FZDA 1MEHA 1MWOA 3W27A 1DIEA 2IPJA 1ZS2A 2ASHA 2QJJA 4RNIA 3MUXA 3VTRA 1TJPA 2R6OA 5FF7A 2VO5A 2VFEA 4JYDA 1FWAC 1XLDA 4JL2A 2IKIA 1QJWA 1UKSA 3UA4A 2WPBA 1TV7A 5U7SA 2HZGA 4XKMA 3VOGA 2YXOA 1QT1A 2NWRA 2OFJA 1RP8A 3G0XA 2JFEX 1EXBA 1W8SA 3R1ZA 2MANA 4HNLA 1Q6LA 1QBAA 4TTUA 1AG1O 1AJ2A 3V18A 1F8MA 2OWWA 1ME7A 4WSJA 1NWUA 1XCXA 1DJWA 1P6CA 2VT0A 2XM1A 2DQXA 3VOCA 3EPMA 2CZVA 2J77A 5CSSA 5I3KA 3VPLA 5TQLA 3DBNA 4LQ1A 3LOTA 4KFOA 4XAGA 3RO6A 2D73A 3QGKC 1PKYA 3VUPA 1C3FA 1I60A 1S2TA 3CHCA 4O1CA 2E6AA 4IIHA 3LU2A 5BZAA 4X2RA 5FSEC 1VENA 2XHYA 2PDGA 1OK6A 4N42A 5HNTA 2H9AB 2AL2A 2Z1KA 4RPPA 3ES7A 5AC4A 1JCTA 1EL3A 2ZXAA 1CXFA 5CLTA 4UFLA 2WAGA 2OOFA 3UXDA 4A3YA 4HCDA 1MO0A 3ABOA 2DSZA 3BV4A 1T5AA 3N6JA 4J3WA 2BHYA 1XL9A 4WXYA 4BR1A 4KPLA 4H9MA 2V3GA 2X1SA 4LNCA 3U2ZA 5I24A 3GBEA 4OU1A 3GDMA 1NDYA 4CQBA 5MKGB 3G3MA 3KVLA 5CJNA 5FJTA 4Q4QA 3T08A 4XX6A 3ARSA 5FEZA 4H1ZA 3CYJA 1SFLA 1YE6A 3EMCA 1TVNA 1CB2A 3H26A 1MEIA 1Q45A 3DUGA 1VFFA 2EQDA 4NT0A 3L4TA 1C29A 2XISA 1DPMA 2B7QA 3FJ6A 4FXFA 1H2JA 1TVLA 3S6OA 3W07A 3OPSA 1WBJA 3AXKA 2FH6A 9RUBA 1K9FA 2CFFA 2YDSA 4UNLA 3C3UA 3WUFA 5C9ZA 4UZSA 4KT2A 3W7OA 3AIQA 1G94A 4PA8A 4PB5A 2GVJA 2E4TA 3N1AA 3EWWA 1JR1A 2NV2A 4C1LA 1RJRA 3BAIA 1M01A 1FVPA 1YYAA 4O16A 2FGLA 3HV9A 3S0CA 3AROA 1A49A 3DEQA 4WEVX 4DUWA 3NQBA 4AD3A 4YXGA 1X1OA 2HJPA 1OT2A 1WB0A 4U4MA 3FDGA 3KBJA 3W37A 3ZR4A 1S5WA 1A5LC 3LS9A 3LENA 1LBFA 1BF6A 3FVDA 4GHRA 4IT1A 2QCHA 3LPOA 5I06A 3UWZA 3ZLGA 5TF0A 2YCEA 1GONA 4PMDA 3EX4A 2VC6A 4DO5A 4O0KA 1PS9A 1UZ4A 2Y7DA 3P6LA 4XKYB 2TODA 1HVXA 3FEQA 1MRAA 3UNDA 4AD5A 3SY1A 1HW6A 1LF1A 5A8OA 2A7RA 4KWSA 1IXOA 2XJ7A 3W22A 1OFPA 2Q09A 3L23A 3LI0A 1XSJA 4H8UA 4IMDA 3GLCA 4QG6A 4J7RA 1EIBA 3FLUA 1VKFA 2V8ZA 5HWNA 4QHRA 4FR1A 3TOPA 1JZ3A 2CZEA 3PBWA 5G1YA 3VNKA 3N2OA 2FYMA 3BPWA 1F7BA 1EPXA 3GW0A 1M68A 2WNQA 2OZ8A 4B2DA 2CLHA 2AL2B 4AIBA 3UCCA 1XCFA 1R0MA 2XH2A 1X39A 3FIGA 5AHIA 2X7VA 3RYSA 1XD1A 2E5CA 1H0IA 3UWUA 3U57A 4I9TA 3NDOA 4US5A 3S1WA 2YW4A 3IJLA 3PNUA 3MJMA 2QT3A 2G3MA 2JEQA 3W70A 4RZ5A 3G1FA 4XZWA 4E38A 2B0MA 3AXMA 3IRDA 1DV7A 5CBIA 5CZTA 1DE5A 1O5RA 3WQ6A 1H51A 4WJEA 3R2GA 2YCLB 1QI4A 3CO8A 3RITA 1KBBA 3EDJA 3FNDA 3K46A 1LLOA 1ICSA 2AQWA 1A0DA 3ZFHA 5CGTA 1LJYA 5REQA 3SI9A 3QMTA 4AY1A 1Q4NX 3W1UA 3H53A 4EE9A 1KBLA 1V0LA 4PMXA 1L9WA 4A8NA 4C5ZA 3OHIA 4GVIA 5FF3A 3DI0A 1XQKA 4GXMA 1M7JA 4UNKA 1EWDA 1A5MC 3CHFA 3T81A 4MYXA 1VBGA 2PZNA 2YL5A 5DY3A 2VL4A 3MMDA 4DYKA 1NWTA 2G50A 1GZ1A 1WO2A 2GK1B 4IMCA 4MJ4A 3FGCA 1X1ZA 2Z27A 5H8MA 4I7UA 2A3AA 5D37A 5ENLA 4LS0A 3VNMA 1M53A 1C8QA 4JQ2A 1OIMA 3FOKA 4MY1A 4JEQA 4JHMA 4W4QA 1B4EA 2PWVA 3DFQA 4NZJA 4PSRA 3L4ZA 1D3HA 4EIVA 1SJAA 1XV8A 4GO9A 2V67A 1VRXA 2NQLA 1QFEA 5D32A 2BGQA 3VIMA 1IIGA 4J40A 4MTVA 1S5TA 1H1YA 4F79A 4MSSA 1EHNA 2XH7A 2RGLA 1DHPA 1SFSA 2YW3A 3TSBA 1RK5A 5FSDC 4I8YA 1RJPA 4HT3A 1T96A 1V0NA 3H7UA 4RDVA 5HBFA 2E5BA 3DCPA 1Y5VA 1XLCA 1FWRA 4B16A 3SSZA 1XIHA 4EK7A 1PIGA 3WG6A 3IIZA 3H70A 3KWXA 5DMYA 2JKAA 2D0FA 1FWTA 3RGTA 1JQVA 4PC8A 1UPMB 3GDRA 4Q8QA 3W7IA 1E0UA 4K1GA 1DJQA 1ZJHA 3PPCA 4PMOA 4DJFD 3WK3A 4KRTA 2J88A 1V3JA 4UTWC 1RH9A 3VIHA 3LHWA 3A64A 5BU9A 5D9PA 5JMUA 3VD9A 2G8ZA 2J13A 3REQA 5I78A 4M51A 1UR0A 3WFZA 4HD5A 4N2YA 2INEA 4NNAA 4QAIA 4GINA 4AYSA 3RLGA 3K1GA 2VJXA 3S2JA 4PL1A 4ZOEA 1C9DA 1E5JA 2G3NA 5DXYA 4BWLA 1BRLA 1KFBA 5DF0A 3EX6A 1BYAA 3IGXA 3B8VA 3NURA 4PCSA 7PTDA 5BW6A 4A05A 2YBVA 1OC6A 1B3OA 3WDIA 2CLLA 1HF6A 4HU8A 3T0BA 4J2MA 3PZIA 3OVGA 1CGYA 1F5ZA 3APYA 1KBIA 3PB0A 1O68A 2VEPA 1JDAA 2WMJA 3CV1A 4JHOA 1IEVA 4TMBA 5BCAA 5C70A 1H50A 5DANA 4B5UA 3BGAA 6TAAA 1H0GA 4NZ1A 4CU7A 1K4HA 1ZAJA 3TR2A 2HPIA 4NZFA 4Z08A 4GUFA 2WVVA 3EMQA 3ZM8A 1VLWA 1ZTVA 3B4YA 2DU2A 1IGSA 4C91A 5GNYA 1IEWA 1PL9A 2OEMA 3MCOA 4IIEA 5LNUA 2IKHA 3W2NA 2YXGA 5HINA 5AC5A 1BWLA 3GXFA 1WOAA 3BCJA 3KOWA 2QV4A 4J4KA 1ISZA 2CZFA 1OYBA 3N2BA 2F6UA 3N25A 1Q8JA 2V3FA 4J35A 4WD0A 3CUXA 4HNOA 3TCEA 1ZPTA 4OBTA 5J5DA 1H5VA 3M6YA 4PUNA 4NAFB 2IQTA 2PURA 1SM9A 4M24A 1PV8A 1V7AA 3QZEA 1P5BA 4H6QA 3PUGA 1M7PA 5EMJA 1D7KA 2WCSA 3DIPA 3TN3A 2FPYA 3SCNA 1FWNA 3AISA 4K3ZA 5FF0A 1HKIA 3LA4A 3WQ4A 3BMVA 3BK0A 4V2XA 3WJXA 1RSCA 4WOQA 1C93A 3HBLA 4GZJA 3A5VA 3URAA 1PAMA 1GNXA 3TJLA 1TMLA 2ZVRA 4U5IA 2AKMA 5HNUA 2HXTA 2V82A 3R10A 3TYEA 3T09A 1ECQA 3N12A 1PWMA 5JBEA 4PCFA 3IANA 4H6RA 4D6JA 1GPWA 5K9CA 1H7RA 1OVDA 4FHAA 2WBGA 4ZO7A 3VNZA 3M0KA 4G1NA 3VGBA 1AMKA 5XIMA 4D6HA 2CXGA 2F2HA 3CL7A 1KM5A 1UWSA 4AZCB 2VX7A 2DT1A 4O1BA 1Q6DA 2A1YA 1XDLA 1DBTA 1SSGA 4FNQA 1I2RA 4GCXA 5HANA 3QTPA 2CBJA 1QHZA 3S47A 1WZKA 1OGBA 1XYCA 4UFIA 3CQ0A 3ME3A 1EGMA 1T8QA 3V75A 4AISA 1YMYA 2EO7A 5HPCA 1XHGA 2BOEX 4Q7BA 4HNVA 1YW1A 3N34A 3PTQA 3TWBA 2Y5JA 2BXVA 2GQ8A 3DX5A 1IT7A 2CZDA 1XYBA 4H8VA 3AICA 4DWSA 2DZXA 1KV8A 4AZBA 2W66A 4Q4SA 4QS6A 4UTTA 3C2RA 3CV6A 5AYXA 1K02A 1HT6A 2X41A 3VNYA 2VD8A 3HPAA 1EJUC 4M8UA 5D02A 1MYRA 1FKWA 3TP4A 2YIHA 4ML4A 1RCXB 1JZ8A 2GJRA 1OWQA 4Q33A 3T40A 1R30A 3ES8A 1FH8A 4KF1A 3ARUA 3VNDA 2I16A 1LL7A 4CCZA 3CL8A 4QAWA 4W7WA 1FWJC 2PGRA 2YA2A 3BMWA 4PUKA 4MNMA 3LCWA 1BYCA 4MUPA 1B1YA 3KUMA 4QLKA 4IIFA 4PRRA 2OQYA 2V5DA 4NAFA 2R1LA 2XIIA 4S3DA 3BW3A 1KR1A 2VR5A 1SO6A 1QW8A 3QZAA 4X9YA 2PE4A 4HCHA 4JIRA 1Z8AA 3BZJA 2WCAA 3BQ5A 4D6EA 5EMYA 4B3LA 3NL5A 1TA3B 4JQ3A 4MLJA 2FHCA 3R0DA 2GVYA 4OFCA 3DYPA 1SZNA 4J3TA 4K1WA 3RX4A 5CEWA 2F9RA 1U5HA 1EH9A 2XDFA 3MCNA 3KCJA 4O54A 3R8RA 1UIOA 4UCGA 1QAPA 5HMSA 1W5PA 5HK4A 3VNIA 1POJA 3S2MA 3NQ6A 3EWDA 2ZUMA 4E3TA 3VGEA 4HOWA 2HEJA 3P93A 6ALDA 3PHAA 3B9NA 2W92A 4MAVA 3R11A 3JZEA 3NO5A 1JCMP 3Q58A 2OEJA 3GNPA 4POCA 3TVAA 3RMJA 2ZTKA 4L5ZA 5I02A 3MUIA 5HUOA 3F4CA 3GFYA 3GDKA 4DJDC 5ECUA 2FGZA 3ARYA 1FFRA 4O19A 2QJGA 4P5UA 4X63A 3K13A 4Q4PA 2OGJA 3C6CA 5FJUA 4ZB2A 3PM6A 3TW6A 3M0XA 3PNZA 3AU6A 5I09A 5EYWA 1BXNA 4L4LA 2NQZA 1LL6A 1V3MA 4OE7A 1TE6A 2JKEA 5C9RA 3NUKA 4IJCA 4ZOCA 3UG8A 3FYPA 4JTTA 4P8XA 2TAAA 4J3UA 2ZDSA 3P3BA 4O0ZA 3JR2A 2E6FA 2FMNA 3SSJA 3PN8A 1BHGA 4GZEA 4M6VA 2DEPA 4JN7A 4DUVA 2WKLA 4PGLA 4XAPA 5ABEA 2TSYA 3S2LA 5KETA 3TYCA 1XSIA 3QRHA 1M1BA 5CG7A 2Y8KA 1UH2A 4Q6XA 1ONEA 3LXCA 1NQKA 2WMIA 4GC4A 3GXMA 4FXRA 1DTNA 2JKPA 3KS6A 2PZ0A 1X96A 1HJWA 2UWFA 1E4IA 1WXYA 4Q7IA 5DRCA 4JOMA 4WDUA 5AZ1A 4C7FA 4U3CA 4JEJA 2AAAA 4NUWA 6A3HA 1M41A 1QTWA 2BGNE 2PDLA 4WR3A 5CJ5A 4H8HA 4KEZA 3VOFA 4BWLC 1S2UA 2DZAA 1B31A 4M82A 3UPBA 3WQCA 5IRPA 4IFOA 1UP2A 3HIJA 1JUEA 2TMDA 1U1UA 2WJEA 4RDZA 3ZJ8A 1GQKA 3OQEA 2DP3A 1F4AA 1JZ4A 2VCAA 4YTSA 4Y6GA 3G8RA 4S2BA 1ISXA 3C0QA 4ZXOA 4X3ZA 1EO7A 1N7KA 1ME9A 3KBVA 6REQB 2D20A 1YX1A 3C2EA 4UTWA 4AY8A 4EVZA 4D6DA 3LZ5A 9XIAA 4EPBC 2GSEA 2IQ0A 3D6NA 3WQDA 3GK0A 5C6MA 3QR0A 1J6PA 1DVJA 4DUOA 2F61A 1R9YA 2ZXBA 1O5QA 2J74A 1CTNA 3AJ7A 1IEXA 3T7VA 1XR2A 3W7QA 1KV5A 4V1YA 1FWWA 5T8GA 4QSHA 1DJYA 1KM2A 1FWDC 3MYPA 4DJED 2EG6A 3S1VA 5I5RA 2J7DA 3ITOA 3MSDA 1VBJA 2ZWYA 3USBA 3S3GA 3EWXA 3WD1A 3CPRA 3A3WA 1OCNA 1E43A 2KZHA 3NM1A 4E8CA 3WDRA 3FSTA 1QNRA 4NAEB 4DNMA 3GC2A 2VEMA 2QIWA 4KCTA 1MW2A 4RDWA 1XIEA 1XFBA 1IE7C 2YZ5A 3WMBA 1GORA 4JTEA 3LG3A 3GAYA 3E2SA 5CPMA 2GUYA 1O5XA 5HR6A 4MJZA 3H2FA 3TMQA 4DM2A 4B5VA 1QPNA 2IPWA 2W5FA 2YGYA 1MZHA 4NZCA 2HROA 1LORA 3D46A 2GQAA 1UW9A 1Q8AA 1E1CA 4QJ1A 1VPQA 3EDEA 2AMXA 2YLAA 3DU0A 3GHSA 5FA5A 2FQIA 4PFMA 4J1OA 4Q8WA 4F48A 3I3EA 4CD7A 1BG4A 2YB1A 5HMFA 3EGJA 1RVKA 1EDGA 2OQLA 1KR0A 3LUTA 1EOKA 4QE4A 1JDDA 4Y96A 2PWDA 3EXSA 3TC6A 3MWCA 3TXVA 1BRLB 3MJYA 1Q2SA 4C6FA 1TPFA 2FZMA 1ZL1A 5FJIA 5D2XA 4TXEA 7CGTA 2EF9A 4RKAA 1VJZA 3F1QA 1LRQA 2QZRA 1WKEA 1A5OC 1Q3NA 1XIIA 3LZ3A 2WMHA 1AFSA 1TE1A 1SUXA 2OLSA 3EX1A 3SCUA 4LYKA 2P76A 1TZ9A 3SFKA 2H8ZA 3ZQ9A 2CWNA 4GG9A 2CBUA 3CLWA 2X05A 1BG9A 2P10A 2PDCA 2ZZ7A 2YFOA 4GBUA 1L2UA 2Z2BA 4S1FA 3CC1A 4MB5A 5T9CE 1UA3A 3J7HA 3HGSA 3H2CA 3UR7A 1XYAA 5GVJA 2YPIA 2PWGA 3FYOA 3FXGA 3TKFA 3KVMA 3WNLA 3VCRA 1IR2A 1ICQA 3KL0A 2J7CA 2VGFA 1NWRA 3W7HA 4XZBA 3CZLA 5CAKA 2FJUB 4FZIA 4CNOA 1UKOA 3AYVA 3XINA 5DBTA 1JDEA 2ZKMX 2ATSA 1P7TA 3WSUA 5K4ZA 1JCXA 2V5KA 3WH5A 2NZLA 3ARQA 3KBSA 5M2FX 1YPFA 3BG3A 2ZUTA 2ZRWA 5JH2A 4RE3A 3BG9A 3DAQA 2QQ6A 4GIYA 2C7FA 3LNMA 1HQTA 1VCFA 4EAYA 4JY8A 2YL9A 3TN6A 3KAOA 3CMFA 3HZ3A 3OZMA 2ZX6A 3DC8A 3SGGA 1JIBA 1VLIA 4OUIA 3BCFA 1EJTC 4HHHA 2BV9A 3P8JA 2QUVA 3VD7A 2E3ZA 3V1HA 1W3NA 4HKPA 2OZ3A 2QJMA 4ATDA 2GGIA 4GYPC 3W25A 1M65A 2DY3A 1V51A 4PSPA 2FB3A 4HZ8A 4B5TA 3TNOA 3C2YA 4PTXA 2QW5A 3CH0A 3NSXA 1VBRA 3PZMA 1GCYA 1US2A 4PUWA 1Q6CA 3KX6A 1QOPA 5EGRA 4HHPA 2VEIA 3V3WA 4R9XA 3LXAA 1QUMA 1H4PA 1FP8A 1KCKA 2XN1A 1X6LA 3DBPA 1A4MA 2Z0IA 2C1GA 1JUBA 5D03A 1E1CB 4JIHA 3BAXA 4IM4A 2UY4A 4TU1A 4HP5A 3QR3A 3TLLA 3VC5A 3W4RA 1TCDA 5HNRA 3LB0A 4RW5A 1DQUA 3W38A 3E0IA 4IMEA 4KFNA 4DBUA 4ZENA 3IWPA 1Z69A 3S42A 2LLEA 4F8XA 2NT1A 3ZJKA 2NV9A 1PZ3A 1F3EA 1CENA 4ATWA 5EBAA 2WHLA 1W9VA 4CVUA 3EXRA 4CQAA 1EBHA 3DZ1A 4G9PA 5A8QA 4NXKA 4C60A 4V27A 4QS5A 1W0MA 4AYGA 4P8VA 3THDA 3U7VA 4DY1A 2Y6ZA 4QJ5B 3S8HA 3NQVA 2XIJA 5ABTA 1GEHA 3AMDA 5B80A 1YKWA 2Y61A 3LEPA 4C7GA 2W9MA 1NWSA 2C18A 4WDWA 4M6QA 3ITCA 3FY1A 2DUAA 4V15A 1UWIA 5FJJA 4O13A 4UTJA 1EEXA 1Z7AA 4JPGA 5FD0A 5IFPA 2VELA 4TX6A 2VFHA 1O7AA 1UQZA 3Q45A 4HNNA 3UY7A 4GACA 4GABA 1GWJA 3BSHA 4YTQA 3UETA 2BASA 4H9ZA 1QOXA 5HJLA 3UJFA 3QC3A 1DYSA 2YKKA 1ENUA 2QCFA 3E2QA 1TPC1 4LYRA 2E8YA 4CQCA 4HOXA 1GQLA 1BSIA 3GNOA 4DZAA 1E40A 3E0FA 1VB9A 2J9ZA 3W29A 1DKWA 4XO6A 4Q22A 1YEYA 4D6GA 4RZBA 1X7FA 1RV8A 4IGSA 3LX9A 3GU9A 4HA4A 1ITXA 4PN2A 2F84A 2G95A 1BKSA 1LG1A 2J78A 4WGXA 4IPPA 3NJ3A 4A4AA 4FXSA 1RQEA 3BLDA 4UWMA 4TIMA 2PTYA 2QUUA 2UBPC 1US3A 3CJPA 3S5SA 1M04A 2G4JA 2QCGA 1YDNA 2ZQ0A 1ZALA 1UWQA 3WD0A 4FS9A 4N6EA 3SDOA 4U33A 4OGZA 2BTMA 3LGDA 4Q8VA 1AW1A 3WD4A 3VDCA 3I3DA 3LK6A 5BOFA 4E6MA 3UR8A 4AVNA 3M0MA 4O50A 5AFDA 2GJPA 3A4XA 4Z2HA 2QJHA 3FCPA 4MGGA 1U33A 4HQVA 3RM8A 3GB6A 3LRMA 4IMFA 4AH7A 3ZSSA 4YHEA 3MY9A 1QW7A 2VZTA 4JHZA 3WEMA 1PE1A 3O6YX 1XYZA 5IDZA 2ZA1A 1DOSA 4XBSA 3TYUA 3C52A 4NVTA 4MY9A 4P7NA 3SUVA 2Z1XA 3LMZA 1CCWB 4PEKA 4DB7A 1GOMA 4H7CA 4MWAE 2PDPA 2ZICA 4DQWA 1NJJA 3N3TA 2C15A 4PCNA 3DFHA 1KM1A 1JCNA 4LVFA 1JPDX 1OZQA 1TWDA 2ZX5A 3KRBA 3PANA 2NSOA 1XBZA 1Q7ZA 3IJ8A 4EXQA 4RZ6A 4BS0A 3EXTA 1BWKA 1UC4A 1W17A 5E93A 2WB5A 1VBHA 5AHMA 4QRNA 3NYZA 1V02E 4IQLA 4N02A 1W9UA 4MJMA 2PTDA 4DBSA 2ABAA 3UCDA 2FFIA 1EJRC 3LV5A 4P7QA 4A3QA 3MI3A 3M43A 1KKRA 4QXIA 4DAFA 2XUCA 4HYVA 4RV3A 1R86A 3BJFA 3ALGA 1WDPA 3GR7A 5A6LA 1UZDA 3GVWA 3GXDA 1SO5A 3RJYA 1UD4A 4WCJA 3HMJG 5I6SA 3VIOA 4ZQOA 2VRJA 1XG4A 1YXYA 4MKVA 4FEZA 4EWJA 4L61A 4P8UA 1Z32X 3EOOA 4NSBA 1P43A 1LCOA 4G5DA 2A3LA 4ZQRA 2HS6A 4JX6A 2QDEA 5A3HA 1R8LA 3IIPA 4ZZ9A 1JAEA 2REQA 1S39A 1KLZA 4GZ7A 5IOBA 5G5IA 2ZCGA 3H21A 2WQPA 1E5NA 3UYIA 1RLDA 4S3KA 2ISWA 3OLDA 3LSBA 3T4CA 2V63A 4AIOA 1H60A 1HKMA 1QK0A 1E4LA 4Y9MA 3H24A 4D72A 5CBJA 3BOLA 3UZ5A 4E8GA 4H8NA 1MMFA 2B31A 3CHEA 1S1PA 1YADA 3HG3A 3UG3A 3APTA 4O12A 4GA8A 1QVBA 1J6OA 2VMFA 1SZFA 1ZAIA 1O4UA 1UH3A 3OYZA 3HGJA 2XYLA 3WJSA 4Y9AA 3B8UA 3E5BA 5K7JA 1KM3A 1GVEA 1LQ2A 4D1JA 8XIMA 2A0NA 4WRHA 3V16A 4LUJA 2VX6A 2BOGX 3NPXA 1US0A 3WQEA 3MANA 3KWSA 4FP1A 1B54A 3QGVA 2NVCA 4NHVA 3GW3A 4UTHA 2PDWA 3L68A 2I9EA 1FBAA 1RPXA 5AHNA 1AD1A 2QCNA 3ABSA 3ISIX 2RH9A 2ZOXA 2NXHA 5BXRA 3THCA 2QCLA 4QDMA 1XLGA 3AXIA 1NM9A 4HJWA 2QF7A 1NQ6A 3G1YA 2Q8LA 3W87A 1WZAA 5M17A 3EOLA 1FKXA 1ZLPA 1B3XA 2WHJA 3WX7A 2GUBA 3SQMA 4IPJA 1ZQ5A 2UZ9A 3CBWA 2Z7KA 3KL5A 5KZ6A 3RG6A 4Z0SA 2GOUA 5HATA 4Q8TA 4R27A 3N4AA 3P8IA 3I6RA 4I5XA 3UGRA 2WM1A 4WXZA 1UMLA 1TTQA 3GDBA 3N2TA 3JU2A 2ANUA 2QLYA 5H8UA 4OOZA 3GHTA 3ZYZA 2V5BA 3WMCA 1W8GA 3GC5A 4KGLA 1KRCC 3TOYA 4AMAA 3GIQA 2PRLA 3HJZA 3MVTA 2O4QA 4O28A 3W75A 1V77A 7XIMA 1PPIA 2A7NA 3FKRA 1KCXA 3QV8A 2DZBA 4LB3A 5M5DA 3SJNA 4ERGA 2BODX 5HDRA 4JIQA 4AIEA 4WKFA 2OVLA 5D2YA 1QI2A 4HNCA 1PEZA 1E6SM 4HCLA 3MMUA 2XWEA 4H9XA 2BFGA 3GUGA 1A5KC 4XV0A 5EY5A 1HFBA 5LGXA 4JTFA 1V3IA 1XH2A 1TX2A 4FA3A 3HMCA 1BFNA 4WSKA 5F2MA 5TD4A 3NPVA 3W6YA 3N04A 1TX0A 1Q65A 2J7BA 3TJIA 2ZBTA 2R24A 1EKOA 2VR2A 1DIKA 4ZQCA 5H1WA 1DTUA 1JF6A 2NWSA 1W1YA 3SJ3A 1CDGA 4QEHA 1LM1A 4AG0A 4XAFA 4KCVA 2SFPA 3C86A 3M16A 3MKCA 5A2BA 1OX6A 4F0MA 3W1LA 2I57A 5DEZA 1YPIA 3AIEA 4FIQA 4C6EA 3JS3A 2YBUA 3UWEA 2J27A 4PUDA 1ONWA 4IPLA 4GY1A 3E0WA 2BX7A 3ABZA 3BQ6A 3O06A 3MDUA 1BVWA 3H2MA 1BVNP 4PEEA 1REQB 5ABFB 5LIYX 1HJVA 3HOJA 3MZNA 1ZCCA 3BG5A 1J01A 3OVPA 3M5VA 4H83A 2PI6A 4U2YA 3WMSA 3NNTA 3N2CA 2NVDA 3LI1A 1ZJBA 3K8MA 3AS0A 2GPTA 4Z2LA 1GOWA 2OZTA 4K39A 3STPA 3T55A 3TMLA 1HJXA 3WF3A 4I8DA 2PD5A 4YYFA 3M6DA 3MP3A 5T26A 2YYTA 1BQGA 4Y2WA 2DZTA 3LHZA 1QO5A 2C1HA 1OJXA 3WQWA 2DT3A 2ZRYA 2WM0A 4IIDA 4LCQA 3CT7A 5I77A 4QQ3A 3PC0A 3G77A 4Q4RA 4BI5A 4EF9A 1UASA 3V4BA 2RAGA 4GBDA 2QCMA 2ZVIA 3CMGA 3MKVA 2GQ9A 2MUCA 3O2LA 3OVRA 2V3EA 2WVSA 3G1SA 3NZQA 1XM3A 4MWAC 3OGVA 1QI5A 3MSYA 2NUXA 5K9XA 3BGGA 4GY7A 3NQAA 3H54A 3UYCA 4WJXA 1O1ZA 1FWGC 1WP6A 3CB8A 4N4QA 4DPQA 3R8HA 4JZ5A 4O17A 4E4PA 2X2YA 4F2TA 1GYMA 2QAPA 4RCXA 1P1MA 4C6PA 3N14A 1PYMA 2RKXA 2G96A 2JALA 1RCOB 2I7GA 2HTMA 4MNJA 3GZ3A 3SM0A 1YTDA 5DN1A 2DFAA 1RBAA 1NP0A 4GI8A 3TLQA 3NVDA 4UZUA 2VGGA 2I9UA 4OUEA 3PR2A 5CAHA 5GJPA 4CD8A 2HVOA 4W7VA 4PTNA 3MPGA 1E71M 4BJHA 3ZJ6A 4OZOA 3SO7A 3VE7A 4ROQA 3R8GA 3U2OA 5A8GA 2VXNA 4CCDA 4F0KA 1RD6A 3EPNA 3HN3A 2PRHA 2Q8XA 1CGXA 4GQQA 1DXEA 4FNPA 4KEMA 1Y7VA 4PMRA 3GTXA 4IZGA 1NP2A 5FL0A 2WMKA 1E0WA 1TPEA 4DO7A 4LUIA 1WUEA 4ZFCA 4JKKA 2WMFA 5A5WA 4B4FA 1UP0A 2QUNA 1RP9A 2DW7A 4Y9OA 5FEWA 1ITQA 4LEFA 1OFEA 3LXBA 2WZEA 1F6PA 1TZ7A 5CCZA 4FNRA 3B8WA 4TVUA 1UBSA 3R7MA 1J11A 1G69A 4QX4A 2HISA 4CUCA 1BXBA 3RAOA 3D0CA 4I7WA 4N0RA 1CPUA 1IIHA 1RK6A 1TCMA 3WQVA 3EKGA 5D2TA 2PLCA 2FDSA 1W9DM 4PR4A 3IGUA 1E0XA 2VM8A 2WKGA 2WHMA 1FOBA 3N73A 2OT1A 4NG3A 1OC5A 4XZ9A 4QITA 3SY5A 3M9YA 2O7SA 3MP4A 1GYLA 1I75A 2L5HA 1D8CA 2ZE0A 1XIFA 3QC0A 4AX6A 4CNSA 2NXGA 3L65A 4JGDA 4O53A 4K7VA 1W3KA 3BLKA 1EGVA 3DESA 4Q3MA 2YBTA 5D9NA 4C1NA 2QJIA 3AZRA 3OOQA 2QAFA 1CIUA 1FH9A 4G1KA 3MKKA 2PLMA 1XYFA 4F0LA 3MCMA 4QNEA 1CNVA 4MPQA 5DMNA 4L9XA 3WH7A 1XYLA 4D6IA 3I4KA 2GYIA 1JGMA 2BBFA 4B92A 1DEDA 1GW9A 4GNVA 3EWUA 3URNA 2VYOA 3MUAA 2CLIA 1Q13A 1RD5A 5EPDA 3NQMA 3PPGA 5I7GA 3W7RA 2HNHA 3UNTA 2W62A 3TNBA 3G18A 3I3BA 4XBKA 5CPQA 2E9BA 3CIXA 1J0ZA 2RJHA 2RDUA 3BW2A 3Q94A 5IHRA 2YCJA 3RLHA 1UQYA 1X98A 3PBGA 4JTAA 1HO1A 3A4WA 4LWWA 2FGBA 3ATYA 1HZYA 3MU7A 1XUUA 1XS2A 2ZRZA 4IX2A 4L80A 2Z29A 3ARXA 4PCTA 4E3VA 2WJZA 4A2SA 1YRRA 1ICPA 2G4FA 1GOKA 1SJDA 1WXJA 3UG4A 2CC0A 5CC6A 1XDJA 2PCEA 2ZUVA 4GO8A 3G1DA 2D1ZA 1ITCA 1H7NA 1AQFA 4B9ZA 3IAPA 3BJSA 4WJ8A 5I07A 1P0KA 2BZNA 1R7OA 2FTWA 1ZBCA 3MMTA 3I7QA 1U1HA 1KRAC 2E1DA 1AJZA 3OLIA 3GR8A 2PF8A 1HN1A 4DJDD 1V03A 4RNHA 5G2IA 2JBMA 5D33A 3TCSA 1G01A 1RBLA 1J10A 4QG9A 3TJXA 1MFVA 3EWBX 4A35A 1FCQA 2ZXQA 3STGA 5CSUA 3H2EA 4Y7EA 4H9UA 5HUPA 4B15A 1VHCA 4PULA 4JTKA 4HK6A 1GOXA 3P7YA 3E9AA 4HMNA 3QY6A 3MC5A 3W23A 1A5SA 3K30A 2HQAA 3E02A 3F5LA 5LNRA 1BAGA 1PTDA 3NXLA 2X40A 4NZ5A 2CESA 1OF8A 4S38A 1Y5WA 1WZLA 1AH0A 2PP1A 4WUIA 1R85A 4L6DA 2F8QA 1XICA 2NUYA 4N9CA 2VOTA 3VDBA 4XZNX 1JZ6A 3TAKA 1TZZA 5CSYA 2PUZA 3URQA 2AL1A 4PMZA 4A6GA 4UTUA 5KMYA 3OJGA 3W73A 4HOZA 1UMYA 5DT7A 2YFNA 1KO0A 1BKHA 1TTPA 4XD5A 3V5FA 1Z6KA 3HQOA 4LYQA 1BSLA 3RRAA 3QMSA 1IXNA 2D24A 1P0DA 4L9YA 2FVLA 4NF7A 3CASA 3AOFA 5LNVA 3IJ6A 1PKNA 1S5MA 2E6DA 3GDLA 3MP5A 1F8IA 3DG3A 2YZRA 2QNEA 4CU8A 3THAA 1L8PA 4AXKA 3GG0A 2NX1A 1PCKA 4YLWA 1RA5A 2BSLA 3MWAA 4W8AA 2C0HA 4DPPA 4UOJA 5LKYA 2O56A 1C8XA 2NQHA 3CUIA 3W76A 3KZSA 4DXXA 5A1AA 3QFEA 1JDCA 4XD3A 2GDVA 1KKOA 2OKOA 1ELSA 3L4UA 4JFWA 2XINA 4AWTA 4GI4A 3SN1A 1XIBA 2RGMA 1XBXA 4AEOA 4IFKB 2VDGA 3SAZA 3CV2A 1DL3A 3KDNA 4QDWA 4TVCA 2RHGA 3G3DA 4FXJA 3EWYA 3S5YA 2YOCA 3IUIA 1ZP4A 1H09A 5CZKA 1P1XA 4NRRA 4QM1A 1ZENA 4IL2A 6REQA 3VXGA 4TUFA 3STCA 4AF0B 5CH9A 3SN0A 1J2BA 4DM1A 3LTPA 3PG9A 1EYWA 3W7KA 1TPWA 1EJWC 4NYUA 1ZNNA 5J5RA 1CLKA 4A29A 3LTSA 2JIWA 2XVLA 3G2GA 2JQXA 4MWAA 2Y85A 2UY3A 3QHMA 3L5MA 4Z2JA 4GXPA 4QE1A 1VFOA 4S3GA 1PSCA 2P5NA 1VFLA 5KZDA 3MA8A 1DWJM 1EO5A 2FLIA 2WQDA 3WCZA 4EF8A 3AYRA 1MSSA 5ECVA 4LSBA 1XLMA 1AW2A 1OZMA 1UR4A 1AQHA 1A4LA 1HKJA 1A5BA 3QV7A 2ZUUA 4QE5A 5A2AA 3ZWTA 3RCMA 5AN7A 3VIKA 5KZEA 3JZUA 4UQAA 1M3UA 3AS1A 4MMWA 4YVPA 2XGZA 1LBLA 1O94A 1QNVA 3NVTA 3WH8A 1LWIA 2EPMX 2P3EA 1OY0A 2HS8A 2IPGA 1QPKA 3TTYA 1H5YA 3T9PA 2Y0FA 3CAQA 4YYCA 4JTSA 5JXQA 1TV5A 3ITVA 5AC7A 2WZIA 1M03A 1FX6A 1SJCA 3KOYA 3FA5A 5J8LA 5E0FA 3QOKA 4JFVA 4X0NA 3AQUA 1EC8A 5HA7A 1C7SA 5A8PA 5C2CA 5K2ZA 1KFKA 2Z7GA 2PB1A 2DSWA 3HTWA 1D3GA 5C9WA 4DO4A 1SW7A 1YQ2A 4CNUA 1I9CB 1YTKA 1XRVA 3W81A 3LBMA 4FF7A 3AUOA 3UFYA 3EAUA 3A9BA 1EC9A 1GKRA 2E68A 5AVNA 3GTHA 3SY8A 6PTDA 3WIJA 2NV1A 1J0HA 3CHVA 1A80A 2AGKA 3MQTA 4J3XA 3H7RA 1KFLA 2Y2WA 1FTXA 3TC7A 3DXIA 1SFTA 8XIAA 3LHVA 4CQ9A 2A85A 4HTBA 3LMYA 4WHBA 3HV8A 3TONA 1TRDA 4NYYA 3V7PA 3VNLA 5E6ZA 1W1ZA 3OYXA 3SCRA 4IMAA 4UTMA 1M7OA 3LPGA 4ZO6A 4JIEA 3U5YA 4JN8A 1MZRA 3IV3A 3HO8A 3GUWA 4H6KA 2XSAA 4V33A 3VKCA 1UZ1A 3DN5A 3RF9A 2PDMA 2V3DA 3WNKA 1PDYA 3TW7A 3NQ8A 3R0UA 2QMKA 2BXYA 5D2VA 4LBRA 1CEOA 3LQGA 4OKDA 3FV9A 3STFA 3TYBA 1EUAA 3MTWA 3DERA 1YDVA 3BMXA 3WUEA 3BARA 1YNQA 3DKJA 2FH8A 3S5ZA 1GVIA 3IS4A 1KXHA 3TSDA 3PBMA 4MWAB 2C6QA 4AVOA 4YHGA 1JAKA 3N11A 3W2KA 4AEFA 3T07A 5TNVA 4M0XA 5CJMA 3W7DA 3F5KA 3TZFA 5E5CA 1VYSX 1U30A 3N6QA 1CLVA 2A4AA 3SN4A 1ALDA 4KRUA 1TPB1 3GXPA 1R46A 2FFCA 1NTHA 2OT0A 2XFYA 5CPOA 3WLTA 3ZWSA 1VR6A 4O1EA 1FQ0A 4W5UA 1BYDA 2I5IA 5HNNA 3FJNA 5XINA 3S9YA 3DECA 5H2ZA 5I2UA 1K77A 2YX0A 2G3FA 3PJXA 7ODCA 3WNOA 3VKAA 2OX4A 2QDHA 1X97A 2V5CA 4REQA 5IBXC 2DJLA 1XLKA 2ATMA 5KITA 4S3EA 4QSFA 4TV5A 3RRXA 3A12A 1IZJA 3MZ2A 4I7VA 4FAMA 4KEVA 3SUSA 1KD0A 3O6CA 2XFWA 3NGFA 4Z1CA 3OBKA 1PZ2A 3VMOA 4UTTC 3TX9A 1E3ZA 4BFAA 1CXLA 4QP0A 3WLRA 1GTHA 3WZ0E 1ONXA 3TE9A 2DT2A 4F2UA 3NDZA 3EB3A 3BLPX 2JIEA 4GOAA 1GEQA 2X30A 4TV6A 1DJZA 4TVDA 2TPSA 3WBYA 3LCFA 5IHSA 1RAKA 3CLMA 2F6XA 1GT8A 4PB4A 1KTCA 2VFGA 3VOIA 3P2VA 2EJ1A 3F4DA 1GGOA 4ORMA 1PX4A 3UJ2A 3WLSA 5EBUA 4RR4A 2ZA2A 2X8RA 5E9XA 4YVVA 4KH2A 5CZJA 5JU6A 2GVLA 2J6VA 4FMVA 2OODA 5AB3A 1R38A 2BY1A 1S2AA 3NA8A 1T6MA 1WAUA 3NQ2A 1EZWA 1IWBA 3PJTA 3BAJA 3URBA 1E15A 3WK1A 3F7JA 2CXEA 1KQZA 3QYQA 3VIPA 3C5QA 1QRQA 2FZ8A 2VI0A 3EEGA 5LNWA 1OT1A 1VD6A 3NEVA 1YNPA 4DIAA 3NZ1A 3UY8A 3NCOA 3PS7A 1G7VA 1FHDA 4C6IA 2R9RA 1XGEA 4PMQA 4JFSA 5LIWX 1B5TA 5K3VA 3SUUA 4KGJA 4KWWA 1ZUAX 3N2XA 4GKLA 1RR2A 1UG6A 4E2VA 3SFWA 1OFBA 4AZHA 4MY8A 1FDZA 2ZIDA 5LHFA 4TTGA 4PMYA 4DJFC 5LA0A 4PTVA 1A0EA 1PJ9A 3QY7A 4JKMA 4B5XA 4C1NB 4E5TA 3PB2A 3F2DA 4AHQA 2GGHA 4JX4A 1LWHA 2A21A 1VF8A 1NVMA 2E28A 2QV5A 2CW6A 3ICJA 3UZYA 3EOEA 4HVXA 3L67A 3KP1A 4W84A 3K4AA 4N9DA 4W8LA 1PUDA 3B97A 2A2IA 3TQ0A 4GFSA 1FXQA 1B30A 5E9AA 3QLLA 5CC7A 2HRWA 4CD5A 3PPFA 2WSRA 3CWNA 4HA0A 1PX8A 4ZL1A 4UQCA 1TELA 4UMCA 2WZTA 1JZ2A 4AWUA 2WK2A 4XSLA 3TZNA 5BXTA 3W1PA 2ZE3A 4CN6A 2B81A 4I9AA 3UPMA 4J9JA 4QLJA 3E49A 1MI3A 4U5KA 4AXNA 2EGZA 1XINA 3U3HA 1ONRA 3ZSTA 1PZ1A 1KTNA 2ZUNA 3ITXA 3PTDA 2PDKA 4RXGA 2ZZ4A 4UMAA 2DUZA 3AZTA 4D8AA 1QWKA 3PAJA 2J7FA 2WO5A 4GYFA 1XKJA 2OSWA 2OR2A 3B0UX 2EPHA 3N17A 3NYDA 1UOZA 1I2QA 4IL0A 4PE8A 3CZJA 2DJXA 4H9TA 4HK7A 4DLFA 4MZ8A 1DIDA 4K36A 4JTRA 2ZWZA 5AZ0A 3GU2A 1XD0A 4JKLA 3WLQA 3OZYA 1UJPA 4IFRA 3AHVA 3NL3A 1UKQA 4B5NA 5A6MA 1MUMA 5F2LA 1KM4A 2D2JA 4XAZA 2ISDA 4BQ2A 4OTKA 2NLYA 2E77A 3MBFA 5A69A 4G7EB 4AC1X 5E09A 5HQMA 1UH4A 1GZJA 2A6NA 1VFSA 1XGZA 1W37A 4HPNA 1WYIA 3SCTA 1GKQA 4CD6A 3CUHA 2I5GA 2CLOA 3RM9A 4HZ6A 4EPDC 3W86A 3VMNA 3GBDA 1LLZA 2V2CA 4WZHA 2IXVA 2Q3OA 5J04A 3TTQA 1KXQA 4IPIA 5GNXA 3SCOA 1B57A 4HGXA 4XO7A 5C7HA 1FDYA 1K8CA 3RCYA 5CGQA 1VFTA 2V0TA 1Z9AA 3NQDA 1FH7A 1Q66A 4XK2A 1VBUA 1TQJA 2PDIA 1TJRA 2E1WA 3M0HA 3FN9A 2GK1A 5F4WA 5I3FA 4ADTA 5U4NA 1OFOA 3P60A 4GE8A 4IHCA 1ML1A 3KXQA 4JFTA 1MDRA 1UUMA 2ZYFA 5BRBA 1NY1A 1C90A 4IP7A 3ITGA 1W32A 1OGGA 4OV4A 2J47A 1XBYA 1V6UA 4LCSA 5HQLA 2V5LA 3W7EA 3H2OA 4H19A 3CUJA 3B0YA 4NY2A 4CCCA 3FVMA 3V5CA 2QGYA 3TJ4A 4GQ0A 3Q4DA 3ZR5A 4RX0A 2VD9A 3S2CA 4OVXA 2WLYA 5BXSA 2BMBA 3ELFA 2DV0A 1RY8A 2FZ9A 5I23A 3GVVA 4GPNA 4X60A 3UEQA 3UR5A 5C9XA 3F03K 4GI9A 3BV7A 3HU7A 3QSRA 2WKJA 1ZU8A 1FP9A 1B9BA 4GK8A 3EB4A 3KOFA 1LT8A 2DT0A 4XVDA 4ZCWA 3QQWA 1W56A 4ACZB 3RR4A 4XZIA 4ZB0A 2DSKA 1S3HA 3BTNA 3KL3A 3VE9A 4O11A 3ATZA 2VC7A 4LAOA 4Z2IA 1MXDA 3GO2A 3P5YA 4CCEA 3BLIA 1W5NA 4IQJA 4FOJA 3LSCA 3VFCA 3W88A 1S46A 2QS8A 4AF0A 4DXKA 2KX9A 3QHNA 3Q67A 2VKZG 2BHUA 5GJMA 4KBXA 2O7QA 2PFHA 3DGRA 5HWJA 3OU8A 3SECA 3A4JA 3ABXA 3IJ9A 5C8BB 2EPNA 2XVPA 1FHLA 1DJGA 4Q8NA 3BWWA 3TC3A 2Z2AA 4F66A 4LS2A 3GU1A 4QROA 4B5SA 5CPTA 2X2GA 3B0XA 5M03A 2X09A 2RFGA 1KRMA 2NVAA 2FHBA 4QCFA 4B9YA 1MUCA 2CU0A 3WBWA 3EA2A 5D2WA 2OEKA 1L0PA 1X6UA 1BXCA 1TPVA 2XIOA 4HPHA 1SMAA 3NIYA 1GTEA 1NSJA 1EDTA 3W2UA 1OX4B 2VZOA 3AU2A 4GYPA 2WJFA 4DI9A 3G6MA 1GJPA 3K4DA 3GIPA 2CHRA 1J2WA 3HQ1A 2ODOA 1RY0A 2PDUA 1JYVA 1VEMA 4MVAA 5D8WA 3RPDA 3S1UA 5TBOA 3LLXA 5FF2A 3AIVA 4DEFA 4WVXA 1F05A 1YBQA 3ECQA 3W1TA 3B8DA 3M5XA 5K9DA 2GJLA 1HGYA 2WANA 3N9RA 4MB3A 4TQTA 4MIMA 4QR6A 1SMDA 4O8RA 1EQCA 1I4NA 4FPSA 3SRFA 4BI6A 2Z4GA 4LUSA 2XVNA 3GIYA 2CWXA 4PL2A 2WWDA 1S2CA 1FWEC 3SRHA 5PTDA 2PDFA 4D9PA 1PIIA 5B7ZA 5MHBA 4G6CA 4QGCA 5I03A 1N55A 2OELA 1MNZA 2HCVA 2JGYA 4D71A 4XSMA 3MDWA 4YL2A 2Z1SA 5XIAA 3UXIA 3V35A 3C0LA 3HG5A 2VHLA 3FAWA 1C92A 3EB2A 2ZZ3A 4CU6A 1W1A1 2GUUA 5A6BA 4ZOBA 5GQBA 4LANA 4YVXA 1KBKA 1TV4A 4RNJA 4HMCA 3U4AA 3RLUA 3ONCA 1CB7B 4GY0A 4LBSA 3K8KA 2Y4SA 2R94A 3DENA 3G6LA 2W63A 3QXBA 3TN5A 2BY3A 3ARWA 3ZLHA 1FA2A 1R3TA 4AHOA 1RVGA 3CEUA 2O55A 3ALFA 1XBVA 4GMEA 2VWTA 1KNWA 4O4VA 1HIZA 4DAIA 2O9OA 5JBDA 3C61A 2B7PA 4C7DA 2Y5SA 5D09A 3IUHA 1XPGA 2VC9A 1E56A 3WBXA 1DJXA 3BGJA 3W1QA 3TH6A 3VINA 1V02A 4RXFA 5C54A 3I7SA 3MO4A 1ADSA 2CZ5A 3DHUA 3FFSA 5LYRA 3S46A 3CIVA 4V28A 3NZPA 1XIMA 4AU0A 2QDGA 1ZJIA 4L1GA 3ARPA 4Z1AA 5K4XA 1OBAA 1NF7A 1PXGA 3UU0A 4XB3A 3W1AA 1G4PA 1G4SA 1MQRA 2J6XA 1EGZA 3ZZ1A 4PFHA 5F7UA 5CXPA 3LCHA 3QM3A 2OYKA 4HBKA 1CBGA 3PBUA 4HA3A 4NX5A 5DT5A 2GWNA 3UWVA 3AHYA 3P80A 4AIUA 1UR9A 4S23A 4QTGA 3UJRA 1QK2A 2D23A 1YHTA 3HURA 3BSGA 4UC5A 4IH3A 3WO8A 3W72A 2XPKA 3ABRA 4OIFA 2A3EA 1O95A 2CETA 2GOKA 3VD4A 3RPMA 1OIFA 1VCGA 1GOOA 4XAYA 1WE5A 1H63A 2QUTA 3ZJ7A 1CXEA 4GNJA 1E73M 2UY2A 2V2HA 4H2HA 4W88A 3S4TA 1P48A 3LTYA 1DWFM 4FLRA 5A94A 5D4YA 2ZFAA 1Q5MA 1EJXC 3NPUA 3GHRA 4EAMA 1EF3A 4X2PA 3A6OA 4JQAA 4FOKA 2BY0A 1F6KA 3P61A 3CAWA 1OABA 1SJBA 3ANVA 1VGAA 1OFAA 1X8FA 1ZZMA 1FWBC 1TJ1A 2ACQA 3NOYA 5LZLA 3NL2A 4L4OA 4JS3A 5A95A 5DCEA 1WAWA 1M6JA 2VGIA 2ZRUA 4MFEA 1HL9A 3RIKA 3PBYA 1UZHA 5A6AA 5LHEA 5H6HA 3H4GA 3NQFA 2R82A 3C2VA 1L2QA 3OO2A 3SZ8A 3QW3A 5C55A 3SIZA 2ZC1A 1XPYA 3LQLA 3DG6A 2C3ZA 2W27A 2Y62A 2GGEA 1S5NA 5D9OA 3C3NA 3HPXA 4LVGA 1LBMA 2VRKA 4KESA 4HU4A 1TR9A 3CV7A 3GVQA 4OBSA 1Z89A 2JGQA 3B03A 3KCOA 1R2SA 5C71A 2CHNA 4FNSA 4E4FA 1LOQA 4UBPC 1FWCC 2OOGA 5IFTA 4IQEA 3PULA 3QPYA 5D38A 3VO0A 1U1JA 5KTLA 1ZP3A 3WENA 1WCGA 3K8LA 3GHUA 1VIWA 4WOZA 4IIGA 4GVGA 5HULA 1LP6A 3C4UA 3UCQA 1TPH1 4KCUA 3POHA 4GLEA 2H9AA 4DO6A 2WZMA 4DLMA 4HSOA 2OSXA 3WDHA 4JTJA 3VIIA 3U8GA 1UKPA 1ISWA 2CLMA 1HNYA 3LPPA 4RV8A 1UC5A 2QUMA 4C6CA 1UD2A 1ZY9A 3WYZA 4IG2B 1H3GA 2IPFA 1DE6A 3IRSA 2AMGA 3SGZA 3WJZA 1VJIA 1IV8A 7ENLA 4L4PA 2IKGA 1IQ8A 1MXSA 3EPOA 5FCZA 4MAZA 3VVGA 4GGBA 4NI8A 3MS8A 5DCBA 1I6NA 3GQYA 4Q8OA 2GZXA 4URIA 2WNWA 2CYGA 3UD6A 3W2LA 4N9EA 4DF2A 1BTMA 3VIGA 4DF0A 4LX4A 4RPQA 1XUZA 2GQ3A 3KLKA 3K4WA 4QJ3B 4MDOA 1S38A 2OU4A 5LA1A 2VZUA 3PZQA 4J28A 1U22A 2PWUA 3GH7A 1F3WA 4MB1A 2WNZA 3GX9A 1J0YA 2QGHA 2WYSA 3CL6A 4RE0A 5I3IA 1G67A 4QG8A 2H6RA 4R53A 3AAMA 2PC8A 1SSDA 1QOQA 4FLSA 4MFDA 2OO6A 3GFXA 4PRTA 3NZGA 3L5LA 1GOIA 3P0WA 4DHGA 1CWYA 4FSAA 3MO7A 3L66A 1RJQA 2OWXA 4AZGA 1MQPA 1VFMA 3DFTA 1AA1B 4CEUC 4ZO9A 4PBEA 2D2HA 4M80A 4UOZA 4ZSUA 2PDHA 1VC4A 1LWJA 2OLHA 3UR2A 4NL1A 4C6QA 4B91A 1Q7QA 5A6SA 4OWGA 5LA2A 1K6WA 3N6HA 4IGMA 4IX0A 4S3AA 1EQPA 1AD4A 3KBWA 3EX2A 3ANYA 1FCUA 1K1DA 2B7OA 2ZA3A 3UPWA 4XKYA 1BGAA 1KCLA 3B05A 2TYSA 1FWSA 2VCBA 4ZE5A 5BWAA 1VZWA 3A23A 4FLOA 2JEPA 1ZGDA 3A21A 3VOJA 4C90A 1H1NA 3ITYA 1JNDA 1TTJA 1R3RA 4PTWA 2INZA 2Y24A 1HL8A 2O9PA 1DXFA 4F0SA 3K1DA 2WLZA 3MSRA 5AHEA 1IT0A 2DIEA 1GZGA 4U28A 3INPA 1JPHA 4PMUA 3H2NA 3W71A 3TK7A 1EJSC 2NSXA 2ZZ5A 4W85A 3V1PA 1UCWA 4M6PA 1L8NA 4IUOA 3EBVA 4LV9A 1KXVA 3BDKA 3UXAA 1J12A 1S3TC 3TN4A 2VX4A 4ZA0A 1V08A 1THFD 3CQKA 1OQFA 2HE5A 3G0UA 3A24A 4IG2A 3W00A 4RZ4A 3LCLA 4US5D 4XG1A 2OO0A 3W7NA 1OFDA 1HVQA 5I79A 4R7WA 4XBJA 5FAJA 4DWSC 1JCLA 3HQNA 4H2CA 5BYWA 3ONBA 1HJQA 1MUWA 2RJGA 4Y8EA 1E9IA 2GVGA 5KEZA 3C2FA 1T8XA 4NAEA 2VUYA 4H6EA 1XGDA 3OQ8A 1UA7A 3AMCA 4O18A 4GVHA 1Y5XA 2NQJA 4Z1DA 7TIMA 1K6AA 3LM3A 4KS0A 3W1MA 4YWSA 4L4MA 5CSRA 4ADSA 1TV8A 2ADAA 5REQB 3VCCA 4HN4A 3WLLA 1K03A 3U9IA 5F4XA 3KDOA 1TUFA 2Q02A 1ODZA 3ARVA 1XLAA 2CKRA 2XIBA 3NM3A 2HNEA 4FR6A 1E6QM 3NDYA 3W28A 3G1RA 1B0IA 4JIIX 1JF5A 5FACA 4JTDA 1UWRA 2PP0A 2PDQA 1DQXA 1KM6A 2YDAA 3CQJA 8A3HA 3QYSA 3BOXA 5DBUA 2E9LA 3UW6A 1EP2A 2DSVA 3QFWA 1OCJA 1H1ZA 4D6FA 2J7HA 1YPXA 3FYYA 4Y8FA 1XI3A 1ITUA 3F5JA 2QR6A 4KEUA 2OGYA 2XIMA 3HPZA 3WELA 3FHQA 3KFTA 1QU4A 2I5QA 1A50A 3L12A 3EWZA 4AWEA 3U2EA 4ADUA 1QPQA 2OKTA 1W5QA 2X42A 2E67A 4UIOA 1WDSA 4BF7A 1FCVA 1ISYA 2UY5A 2ZZ6A 4F0RA 1R7AA 4FX6M 1O5KA 3CAKA 4IQDA 3BSMA 1AZ1A 1K9DA 3KOZA 5LIUX 3VX1A 3LY0A 3JVAA 4HPJA 4MKNA 4JIPA 3MVIA 3QN3A 4CEXC 2A3BA 2R14A 3QPEA 4UCFA 5FIPA 4YMZA 4W8BA 3CU2A 3ZVHB 3WNMA 3PUDA 2HXUA 5KINA 3G22A 3BH4A 4S3JA 3GNXA 2AOSA 4F9DA 2WCGA 1GQNA 1V6XA 1XSKA 1MW1A 4BQ3A 4Q6JA 4A8LA 2BLEA 4LC6A 5I00A 2DIJA 1A0CA 1XISA 3FJ4A 1OGSA 2GDUA 3C8NA 1DIOA 4DF1A 4MWAD 1JFXA 3GAKA 1YXCA 1SZEA 3LPFA 1HL2A 2CLPA 1GVQA 4LT9A 1XX1A 4MPKA 3S6TA 2J75A 3C8FA 4G8TA 4PYSA 3R94A 2ZDRA 4UB9A 2QPXA 3EKZA 1ZB5A 3W0KA 4LXFA 3S2NA 2J8TA 2YL6A 5AHLA 2C1IA 3O1NA 3PY2A 4DXVA 1KC7A 3P84A 2EPOA 2ZRXA 5CZ0A 2P8CA 3GXNA 1HKWA 4XISA 3QGAC 3IIVA 5LIXX 4PTMA 1PKLA 3VX0A 3CK5A 3PSWA 3E3HA 1OCBA 4GIAA 3VNJA 4F9JA 4PODA 3QVQA 1ISVA 1HKVA 5DMLA 1WOBA 1RHCA 3ZR6A 2BG5A 4MJ2A 1JCYA 2J24A 3MSGA 1U83A 3JUGA 3O3RA 3EZ4A 3HGOA 2XFFA 1GPFA 5D30A 3H23A 1HUVA 4BHYA 3OGSA 4JTIA 3KTCA 4QIUA 2GSHA 1TWSA 4CQDA 4WDTA 3WQFA 3LCGA 2XH0A 1TREA 2VFDA 3O7UA 3B06A 2QVNA 3LLDA 3H12A 2WSKA 4FO4A 2PU0A 3CZEA 4XWUA 2FVKA 4AD0A 2NX3A 2ONEA 3W1XA 1KCZA 3VAVA 1EP1A 2I56A 3PSVA 1XIGA 1U5VA 3CUZA 1UD6A 2ICSA 3GFZA 3ZS4A 1E70M 3R13A 1EXPA 3PUOA 4F0HA 4KCWA 3ZMRA 4ERIA 2ZADA 3G24A 4QDPA 3GTIA 1CGWA 1EFZA 4ORIA 1SFJA 2BNJA 3O0KA 4Z0JA 1FWIC 1SR9A 3M0JA 1OADA 4BCEA 1WQ5A 3PZVA 3R43A 5BRPA 4HJFA 1N8WA 3I6EA 3ZVHA 1E4MM 1JXJA 4E2DA 4YTRA 4R9OA 4UQEA 1J4EA 3WD3A 4JTCA 2XFRA 1UPPA 3KTSA 1KFJA 3NGJA 4LEQA 3WK0A 2VEGA 3YPIA 1TTIA 2ZX8A 1K9TA 1XIDA 4NQ1A 1F4HA 2D69A 3O9NA 3OB8A 2WMIB 4QLLA 3UF9A 1J96A 3M1ZA 1R3QA 1X38A 4Q8MA 5A6BD 2G37A 3W7MA