3CV7A

Crystal structure of porcine aldehyde reductase ternary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
325
structure length
322
Chain Sequence
b'MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDVPRDAGHPLYPFNDPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title Structure of aldehyde reductase in ternary complex with coenzyme and the potent 20alpha-hydroxysteroid dehydrogenase inhibitor 3,5-dichlorosalicylic acid: Implications for inhibitor binding and selectivity
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 102
structure length 322
sequence length 325
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3cv7A00
3V0SA 5HA7A 4JQAA 2IPJA 4JTRA 3V0TA 5HNTA 5JH2A 3LUTA 3M4HA 1J96A 4H7CA 4R9OA 3U2CA 3UG8A 1HW6A 2HEJA 1PWLA 2FVLA 1AFSA 2PD9A 3WCZA 2DUXA 3Q65A 1X98A 3CAQA 5LIXX 1MRQA 2BGSA 3UGRA 4GIEA 3MC5A 4YVPA 3N6QA 4PUUA 4QR6A 2BP1A 3EAUA 2ACQA 2INEA 1S2CA 3CMFA 3H7UA 3D3FA 3FX4A 1ZSXA 2PDQA 1VBJA 3V35A 1IHIA 2PEVA 4ICCX 1S1RA 1Z3NA 1AH3A 4HBKA 1EL3A 4WEVX 4WRHA 4MHBA 2FZBA 4LB4A 3O0KA 1PZ1A 2ALRA 3G5EA 4ZFCA 3G1RA 3R7MA 3M0IA 1YE6A 3H7RA 1X96A 4GQGA 4PR4A 3DOPA 1AH4A 1Z9AA 2IKHA 1LWIA 2IKIA 3WBYA 4PRTA 2PDIA 2I17A 3KRBA 1AH0A 2WZTA 4DBWA 1MZRA 4JQ2A 4HMNA 4XZIA 3UP8A 4EXBA 1QRQA 3VXGA 4AUBA 5LIYX 1C9WA 2ACSA 2C91A 4NKCA 1FRBA 4GA8A 2PDUA 3BUVA 1UR3M 2IQDA 3LQGA 3N2TA 3LQLA 5KETA 2NVCA 2IKJA 4JQ3A 2HV5A 4L1XA 4JTDA 3O3RA 4PRRA 1Q5MA 5JH1A 1OG6A 2HE5A 3R94A 2BGQA 1K8CA 1QWKA 4WGHA 2FZ8A 4LAUA 4L1WA 1US0A 2PDFA 4JQ4A 4IJRA 4LB3A 3F7JA 3BURA 5AZ0A 3BCJA 3LEPA 3RX3A 5LIWX 2ACRA 3UZZA 2PD5A 3DN5A 3V36A 4XO6A 4XZNX 3NTYA 2HVOA 3BV7A 2PDJA 2HDJA 3GUGA 2PDNA 4LBSA 3ONBA 4EXAA 4JTAA 5C7HA 2HVNA 3CAVA 4FAMA 1EF3A 1MI3A 1XGDA 2PDHA 3UZXA 2J8TA 2FGBA 2PDMA 3WG6A 1YNQA 2VDGA 1T41A 4XK2A 2PDKA 4JTQA 4FZIA 2FZDA 4GCAA 3R58A 3QKZA 1PYFA 4OTKA 2HE8A 4WDTA 2DUZA 2PDGA 1EKOA 3RX4A 4DZ5A 3UZYA 5M2FX 1PWMA 4Q3MA 4JIHA 2INZA 3CV6A 1AZ1A 2PDYA 1YNPA 5HNUA 2IPWA 3LENA 4I5XA 1XJBA 2F2KA 2NVDA 2ISFA 3COTA 4XZHA 4Q7BA 1AZ2A 3LBOA 2PF8A 3EB4A 3Q67A 4PUWA 4ASTA 4FA3A 3WBXA 1PZ0A 2PZNA 3MB9A 2P5NA 3R43A 2QXWA 3LZ3A 4LBRA 3T42A 2PDCA 2PFHA 1IEIA 2IQ0A 2PDBA 4YS1A 3UWEA 1ZQ5A 1T40A 2WZMA 3CASA 5AZ1A 4PMJA 3H4GA 3V0UA 3S3GA 4QX4A 4QBXA 2DV0A 3GHRA 4JQ1A 4YVVA 4XO7A 2IS7A 4GABA 4DBUA 4F40A 3GHUA 1LQAA 3UFYA 4IJCA 4WDWA 5DANA 2ACUA 2PDLA 2F38A 3R6IA 4LAZA 3R8GA 1GVEA 4YU1A 1A80A 1ZGDA 4XVEA 3UZWA 2IPFA 1S2AA 3CV7A 3FJNA 1Z8AA 4QXIA 1Q13A 3RX2A 1VP5A 2R24A 1ADSA 2PDPA 3P2VA 4JIRA 3M64A 4WDUA 4XZMX 4FALA 2IPGA 2CLPA 3C3UA 2FZ9A 1R38A 2I16A 1JEZA 4H8NA 1RY8A 1Z89A 1HQTA 1RALA 4XAPA 4XZLX 3LD5A 1YE4A 4GACA 3LN3A 4GQ0A 1XF0A 1RY0A 5LIKX 3B3DA 2PDXA 2AGTA 1ZUAX 3LZ5A 3EB3A 1X97A 4RPQA 1SM9A 2R9RA 4JIIX 3ERPA 5LIUX 3ONCA 3WBWA 1M9HA 3GHTA 4DBSA 2PDWA 3R8HA 2A79A 4IGSA 4WDXA 4JTCA 4YVXA 3UYIA 1EXBA 2IKGA 1S1PA 3GHSA 3LNMA 4XVDA 4G5DA
chains in the Genus database with same CATH superfamily
2XIJA 3F2CA 4PE8A 1E72M 1JD7A 5A3HA 2JKPA 4A05A 4M6VA 3SCTA 5CEWA 4JTTA 3M0MA 4HU3A 1GPFA 3U2CA 2ZADA 1W1B1 3RGTA 1PWLA 1H63A 1GONA 1DIEA 4BR1A 4IQLA 3JZEA 1SPQA 3HBLA 4LY4A 2DUXA 1H5YA 1XIDA 4LUJA 1TR9A 2BGSA 3ITCA 1UC4A 4JHOA 4M51A 4YVPA 4PMOA 3ITOA 4YTRA 3A24A 1IGWA 3WLTA 1T6MA 3WLLA 4ZSTA 1OEPA 2E5DA 4O14A 7XIMA 4UZSA 3U5UA 4TVUA 4IXXA 3LHVA 1K9DA 3VNLA 3NQCA 1E5JA 1QHOA 1ELSA 3DFHA 2FZBA 4TOQA 3SY8A 2NXGA 4A29A 3ZJ8A 4AX6A 1X1NA 3VYLA 4IQDA 4DF1A 4YPJA 3ZXWA 2PMQA 4P7RA 1BHGA 1CB2A 1W5MA 1XLMA 3B9EA 3PM6A 1UZHA 1XSJA 1AH4A 2Y88A 3MMWA 2WXDM 4JTHA 2VFDA 1NWSA 4NQ1A 1UPMB 2V82A 3UJSA 1JCJA 4JTIA 3WLPA 1JGMA 5A6SA 3AMGA 3DU0A 4LFYA 1XGZA 3KBSA 5IM51 3S1GA 1QT1A 1UR3M 5CPMA 1UIOA 2VURA 4Q7IA 1W1VA 2P8CA 2NVCA 5CQ1A 3G6MA 3QHNA 3SRDA 1Q6RA 1BG9A 2BVWA 4UR8A 3E0LA 4NRRA 5H2ZA 5FF3A 4DUXA 3GVRA 4JEQA 3ZR5A 3H55A 4A3UA 3KBWA 1QWKA 3NQAA 1FDJA 4PN2A 1PZ3A 4J40A 1F05A 3S46A 4KFNA 3B0UX 4UBPC 3T81A 4DYKA 2Z2AA 4B9ZA 1PX8A 4HYWA 3BCJA 3VO0A 1KB3A 1OCNA 3VC5A 5IDIA 1Q4WA 3TSMA 1GOWA 4JYEA 1NWRA 4E4FA 3WUFA 5A95A 4XO6A 1FFRA 1CTNA 5C71A 3PBMA 4O19A 4I9AA 3UESA 1KBIA 3DG6A 4KF1A 3EKLA 2HVOA 4W7VA 3BV7A 2YA0A 3MCMA 3JUGA 3TYDA 4N42A 1F4AA 1P6CA 2HBVA 4EXAA 3VKDA 4XG1A 3S8HA 1R6WA 2XPKA 3BO9A 5E0CA 1W1IE 2J8TA 3VNKA 3GNRA 1VFLA 1XLGA 1LT7A 1AW5A 4YLWA 3KOWA 3M0HA 2DH2A 4TX9A 4IIBA 1XFCA 4AMAA 1GZGA 2HTMA 1PV8A 3D3AA 3IGSA 4WSJA 1RSCA 1YDVA 1GCYA 4MZYA 4DUOA 4K37A 2W27A 5JMUA 2PDGA 4C6KA 3M5ZA 1EKOA 5B7ZA 4O12A 3OG3A 1DXEA 5FESA 3LM7A 4WY0B 1FOBA 4D1JA 2QPSA 3VOCA 1QPNA 1EA9C 2KAUC 1MQRA 2Z00A 1OINA 3TROA 1JZ2A 3CV6A 1IT0A 3FW6A 5BOOA 4GVHA 1OX5A 4NZ1A 1FX6A 3I3DA 3USBA 1I0BA 2F6UA 3HGJA 2PTXA 2ZA1A 4QROA 2OFJA 1U33A 4QG9A 4Z1AA 4C6PA 4H9VA 1MXDA 2OO6A 3KL0A 1GGOA 2DVXA 3EB4A 3NM1A 2YSWA 5EA9A 4QITA 5J5DA 4AZCA 3EOUA 3KVLA 3KBVA 4V27A 4UTMA 4M0XA 2E9MA 2NQ5A 4FI4A 2KX9A 5LNRA 1UHVA 3W7IA 4O16A 1WZLA 1B5TA 4GZJA 3WUBA 3CPRA 4LGXA 1US2A 3AIEA 3F5LA 3M5YA 1H49A 2GQ8A 4ZCWA 1JUEA 1SSGA 3F4NA 1JYNA 3CZJA 4O8RA 1IEIA 1NARA 1PCKA 4JFSA 3LYEA 3L0NA 4CNSA 2YCLA 4Q6XA 1IIHA 1TMQA 2PTYA 4GUHA 1T40A 3R0KA 3ZJ7A 4BWLA 1OT1A 1E40A 5F2MA 2G5WA 4GI9A 4LJ3A 1JF6A 2X42A 4CNTA 4ZTYA 4LUYA 3I3EA 4W5ZA 1QO5A 1LQAA 4DJFC 3E6EA 4MUZA 1VPXA 3WDHA 3VIPA 1HIZA 3A4WA 4B16A 2HPIA 4O0ZA 5E09A 2WQPA 4LAZA 2J7EA 3QY6A 4BWLC 1XPGA 2PU0A 1SFSA 2IPFA 1UWSA 1S2AA 3MKCA 2QCEA 4J5NA 4DNMA 3NL5A 3ITYA 3H4WA 2D2GA 3W7OA 4BK9A 3G1YA 1U22A 4RE0A 1UD2A 2V5JA 4OUIA 2YCKX 2J8FA 2VL4A 3O2LA 1E1EA 5A6AA 3G1SA 1U2YA 3FAXA 2WC3A 1V8EA 4XWUA 3AUJA 3CTTA 1HKKA 1JI1A 2R8WA 4MPQA 1EYWA 4XZLX 3H6OA 3O6CA 4S23A 4W89A 3STCA 1B54A 4PBFA 1HNYA 3W1XA 3TOPA 4O57A 4P8VA 2VRJA 1IYXA 4MY1A 3OBAA 4RDYA 3QZAA 1PXGA 5EMYA 4D6HA 1ML1A 3KHDA 4DNHA 2Y6ZA 2WM1A 4GMEA 3UXLA 4RK8A 2BY3A 3UA4A 1E9LA 4DY1A 1UP2A 4CVWA 5LGXA 5D02A 1IZJA 1OGBA 4HJFA 3EB2A 2J24A 5A8OA 3B8VA 1OK6A 4I9JA 3IIXA 5HA7A 3W76A 1BEUA 4WCJA 3M0XA 5HNTA 3OZYA 1ZBKA 4YIWA 5JBFA 3BMXA 1W31A 4LOCA 1V7AA 2DIKA 3VGBA 4E2DA 1HGWA 1AFSA 4Z2GA 5EKYA 4GBDA 1R46A 5LIXX 3OU8A 3SCNA 1MRQA 1GQJA 1V02A 3UPWA 3WJSA 2AQWA 3GB6A 4EKJA 4AD0A 4Z2JA 4LX4A 3I4EA 2XVKA 4KEVA 3B8IA 3DCPA 3GDTA 2AAMA 3GR4A 1JYVA 3LRMA 4KFPA 4B15A 3KL5A 2CKRA 1I4NA 1QK0A 3QLDA 4UQDA 3APYA 3VZZA 5A2CA 4FF7A 1XFBA 1PZ1A 3KXQA 2BODX 4IF2A 3I7SA 2CEQA 3PZGA 3G1RA 3R7MA 3N2MA 2V2HA 4DXVA 1RCOB 1S3HA 2IKHA 4QLKA 1XD1A 3L4WA 1B90A 1MZRA 3SR7A 1ADDA 3ZLFA 3IS4A 1E9IA 1DQUA 3UP8A 1Z69A 3BCFA 1HJSA 1VD6A 2JK2A 2PWHA 4GX9A 1R9YA 3L7RA 1F5ZA 2VQUA 4B4FA 4PH6A 1J9YA 1I45A 4LC6A 4OU1A 4WVXA 5JH1A 4GXWA 1TTQA 3W7KA 1MZHA 3WNPA 1AW2A 4ATLA 2D1ZA 2B7OA 1DQWA 1GVFA 1LROA 4IMDA 3LTSA 4H41A 2DT1A 4HHPA 2PSNA 2ZQ0A 2BB0A 3QW3A 5A2BA 3L5MA 1IEVA 5DN1A 1UUMA 4C7DA 4C1KA 3E5PA 1QNRA 2OKOA 5LIWX 1UP3A 4IHCA 4NNBA 4J9JA 1G5AA 3IEBA 3S5NA 2FH6A 1LQ0A 1YPFA 2GWNA 1FWEC 4QP0A 2BXYA 2WANA 3AAMA 5EYWA 1EGZA 1WYIA 1C3FA 1SU5A 2VOMA 4QISA 4NY2A 1IXOA 2HVNA 5G2WA 4CN1A 4IFKA 3I7RA 2DSVA 3WKZA 2DW6A 4EP8C 1TZZA 3TFCA 3HF3A 3MW7A 4UNIA 3CZGA 4US6A 5HJLA 3EWUA 4QJ5B 5BXRA 1DEDA 1LT8A 3K2GA 2XN0A 3LGGA 2WMIB 3WH7A 4WXZA 1CGTA 3OBEA 1XBZA 1VRDA 4IJBA 3CZ8A 3DHPA 2CBUA 3T0BA 1A5UA 4H9ZA 2PWEA 4JTKA 3MWCA 1D3CA 5AHIA 1N7KA 1K9FA 2OX4A 3QGVA 2REQA 3WEZA 2INZA 4NYYA 1PB0A 3CIVA 3E0VA 3SGZA 3C0LA 1IE7C 4LF2A 4GKTA 2HK1A 4LQ1A 1VCVA 2IPWA 5C9XA 2WWDA 8XIAA 3N3MA 4WX2A 4NJKA 4MKSA 4F66A 3BAJA 3VK5A 3TH6A 3N04A 4ADUA 4NRSA 3W82A 4E5TA 3SIMA 3BAIA 3TN3A 1PZ2A 2WHKA 2VR2A 5XINA 1XLBA 3MANA 4Q4OA 3A4AA 1PZ0A 4BY3A 3R12A 3GSMA 1M03A 3W71A 1ZAHA 3KRZA 3M9YA 3W75A 2OLHA 1UKPA 4W4QA 3M46A 4C6NA 2C7FA 2PDCA 1UWIA 2RHGA 3WX7A 4GGHA 2TSYA 4ADTA 3DENA 4TXEA 3LPPA 1UMLA 3RPMA 4CEXC 3K4DA 2A3AA 4DF0A 2ZUUA 2WZMA 2FTYA 3LSCA 4DQWA 3RM4A 4O1CA 4GRSA 3OA5A 3B9NA 3TK7A 3G6LA 1EA0A 5K4XA 3VAVA 4HZ8A 2WK2A 3S1WA 4A3RA 2YDRA 1JXKA 2ZVRA 3ZS4A 4KWOA 5DANA 5BU6A 4MYAA 4UTWA 4L4PA 3OIHA 3MHFA 1F73A 4PTWA 4DWSD 1AMKA 4PFMA 4PBGA 2JEQA 4P61A 3C4UA 3QC3A 4QJ4B 3PZUA 2GYIA 5FJTA 1L2QA 3STGA 4ACZA 1Z8AA 1TV3A 3O06A 1H5VA 4HU0A 3SFKA 3F2BA 3M64A 4WDUA 2TYSA 3T08A 5J8LA 1UZDA 3B97A 4AH7A 4DWSA 4XAPA 3VDHA 1G7UA 1RP8A 3BG5A 5KZEA 5IRPA 2WVUA 2XISA 3EEZA 5TF0A 4OV9A 1W5NA 3RPDA 3MA8A 2I57A 3CH9A 3EB3A 3EPNA 3OODA 2C19A 3CGTA 5HJYA 4C6DA 3ERPA 4AIEA 3N12A 1W1ZA 3RM8A 1E70M 1NOWA 5HQLA 1V3MA 3O7UA 3WJXA 1QHZA 3GBEA 4NZ3A 4AFYA 4JTCA 1W17A 1VFOA 3TOYA 3R13A 1EXBA 1THFD 1FDZA 1NTHA 3VKJA 5CSUA 3TC7A 2CFFA 3ARVA 3V0SA 1SFTA 5HQMA 2IPJA 2BASA 5A5WA 3S47A 3IUIA 1R0MA 1W0MA 3ELFA 3TJIA 3VUPA 3W23A 2AL2A 5FD0A 4UNKA 2C71A 3GC2A 3XIMA 3P61A 1OYCA 4UOZA 1H1YA 3OVQA 3WDPP 1XICA 3KVKA 4AZBA 2W62A 1E0VA 1VEOA 3QFWA 1MFUA 3BW3A 4S38A 1EWDA 1ECQA 2J6XA 3D3FA 3U48A 3MSYA 4IFOA 3KBJA 1EDTA 2ZTJA 1C9DA 4GVIA 2ZTKA 1TWSA 1EEPA 2CLIA 4UMCA 4XISA 3SCQA 2EPOA 1IQ8A 4GH1A 4AHPA 2YA2A 3WQGA 2YYTA 4ZFCA 1BWLA 1FWIC 4PCFA 3WMBA 3QPYA 4HMDA 4B3ZA 2CCRA 3QN3A 3W22A 5I3DA 4UR9A 1ZALA 1OY0A 3O05A 5AVHA 3W1LA 2J66A 3F4VA 2XGBA 1HVQA 1NAL1 1W2VA 4CD4A 2C91A 2DJXA 4A6GA 3I4KA 3HGOA 4IP7A 3U9IA 1OSEA 1X8FA 4MGGA 2JQXA 3S9YA 4XZ9A 3RMEA 3LHZA 1C8VA 4MWAD 3TC6A 2WBGA 1UC5A 3GYCA 1Y0EA 5HUOA 4I5RA 3GDKA 5AHEA 5L9FA 4WGHA 3PUDA 2W79A 4PMYA 1WKEA 3W7EA 3NA8A 2PDFA 2NXIA 4JQ4A 3WQFA 1BGGA 1V5XA 1KV5A 2BHYA 1K7FA 1TE6A 2FTWA 3GNOA 1N8FA 1XYMA 4CQCA 3QVQA 1M01A 4MWAA 3TE9A 3G0SA 3MO7A 3LX9A 3M0JA 3THDA 4KEMA 3M16A 4LUIA 4JTAA 1X6LA 3O1NA 3EX4A 2ZCGA 1K02A 3FGCB 3UZXA 2BNJA 4EACA 3URQA 2BZNA 3N25A 5HWMA 3I3BA 2DSUA 1F6PA 2OGYA 1VKFA 4PODA 3WG6A 4HD5A 5KTLA 1TVPA 2WMFA 3UXDA 8CGTA 4LXFA 3TNOA 2ZXBA 2FZDA 1TVLA 3Q4DA 3NXLA 1ESWA 3BQ5A 3CQJA 3R25A 3NGJA 2Q8ZA 3IANA 2VFGA 1CB7B 2VX6A 3SQMA 3SCRA 1C90A 3FYPA 3T8QA 3NPWA 1OFQA 1PWMA 3VX1A 4BI6A 2RKXA 4I7WA 3U6WA 4HHMA 4AMCA 1H11A 2PLMA 4RCXA 3C8NA 2CC0A 5DY2A 1SO5A 4IICA 1XJBA 4H9MA 3IJLA 2E40A 1F3TA 3WLJA 1NQ6A 1KRAC 1H60A 4NNAA 2Z2BA 1OCQA 2VC5A 1PAMA 5LSMA 3IJ9A 4YHGA 2ZA2A 1A5SA 1F3WA 2QJMA 3M6DA 3Q67A 4EPDC 3GX9A 5I6SA 2R6OA 1DJQA 3FA4A 5DLCA 2X16A 1H62A 3W1RA 1HKIA 3OVPA 3D47A 4H8UA 3PZTA 3L4ZA 3VOFA 1J0HA 1Q8JA 2VUYA 1QPQA 4O1FA 2IUZA 1TO3A 5LA1A 4O0KA 3OTRA 3FYOA 3HIJA 2OZ0A 3PBGA 4DO5A 1TJRA 4L4OA 1V79A 5JU6A 1UKTA 3UF9A 1U5HA 3J7HA 4FR1A 4DO4A 3P82A 2PLKA 5FJIA 2BVYA 1W56A 5CZSA 4Z1YA 1EP1A 4XKMA 1TX2A 1YTEA 2CLMA 2CLKA 3S3GA 3SECA 4X60A 1GEHA 1IEWA 1XIJA 1O1ZA 3VGGA 4DBUA 4V28A 3NDYA 1DIOA 1E3XA 3C2EA 3VNMA 4JIQA 4H6RA 2NV2A 5M1TA 2GDVA 1LRQA 4R53A 5LXEA 3LGEA 2PDLA 4AISA 4DM2A 3OGSA 3QYSA 3NYDA 4TQTA 1ISYA 2XWEA 1XH2A 3WF2A 1SYTA 2CLHA 3RHGA 3W2JA 4L4MA 4Q8QA 1TJ0A 3LPOA 4NJJA 3GXIA 3VZXA 3MDUA 1G4TA 1EEXA 3BVJA 2YZRA 1QNOA 1W9DM 4J35A 2ZBTA 2V68A 2WNWA 4H2HA 3NL6A 4DZAA 4FALA 1V6VA 1BVWA 4ALDA 3NQBA 2GSEA 3OB8A 2J78A 5XIAA 3FSUA 3LHYA 3TJXA 2C13A 1WXYA 2V3DA 3LN3A 1Q6QA 4BHYA 3HGRA 3T2PA 3C2YA 1ZUAX 2CHOA 4TIMA 4AAJA 2UY2A 5G2HA 3SN0A 3MYOA 3GRIA 4NF7A 1UD6A 3WL1A 1BQCA 1OC5A 2ISDA 3ONCA 4PEKA 4Z0SA 5G4WA 1JCTA 4JHZA 4C6FA 1RJQA 4PMVA 4CN4A 2WKJA 1POKA 2W91A 4LY8A 1PIIA 2F6KA 4MY9A 3BW2A 4LAKA 5BU9A 2NSOA 4FB7A 1A50A 3W7PA 1HKMA 1S1PA 2Z1SA 3PTQA 3WLNA 1NQKA 1VYPX 5I77A 3UXKA 1EJVC 4AU0A 1ICSA 5FSEC 4ZO7A 3AXIA 3HV9A 1R85A 1WAUA 3FV9A 4J1OA 1RJRA 4J3VA 5M03A 1QWGA 1DIKA 3SUWA 3HZ3A 3GXPA 3PR2A 4KRZA 3E2QA 5FA5A 3Q65A 3VI2A 2NQLA 4N6EA 1CXEA 3AXXA 4Q4QA 4HNVA 4A21A 2WJFA 4GIEA 1NVMA 3F5JA 4C6IA 4RKAA 1MYRA 4UFJA 4NX0A 4A3HA 1XQKA 3FYYA 5HMSA 4TMCA 1CLKA 1FWHC 3C0SA 1HJVA 5I7GA 3WF1A 3IIVA 4M7TA 4OV4A 3TTSA 1GKRA 1XCWA 3IAPA 4M7SA 3SUTA 5AC5A 1VHCA 1Z3NA 2UBPC 1JVNA 4V15A 3KP0A 3APGA 1TPFA 3IJIA 4AXNA 4QQ3A 1BQGA 3FSTA 4AX7A 1WXZA 4C90A 3H22A 1GOOA 3H2AA 4LTSA 2ZC8A 4L9YA 4HOXA 1LWIA 2JF7A 1PX3A 3R2GA 3UY8A 2Q3OA 4FP1A 2GVEA 1D3GA 1X1OA 1NM9A 3NXFA 1W8SA 1E71M 3MBDA 1E0WA 1QJWA 4W87A 1PO9A 3O6DA 3THQA 2IQDA 2VZTA 1EJUC 3HJZA 3N2CA 3LQLA 1XLAA 2ABBA 2YGYA 5C0QA 1VFFA 2I5QA 1LOQA 1XYZA 1AL8A 3GQYA 1V6XA 2PWFA 3PNUA 3S2JA 4DN1A 4HVXA 1T5AA 1I9CB 2WSKA 4JIPA 1DXIA 4FNQA 3N11A 1UQZA 5C6MA 1O5KA 2CIPA 3I65A 1UR0A 1W3JA 1YKWA 2NUYA 5D37A 4Q6JA 2HCVA 2J7FA 3ORWA 4QE4A 1KLZA 3ZVHB 2DT0A 5AZ0A 3RX3A 3LB0A 1ME7A 3BLFA 4FOJA 3V36A 4Y6GA 3CH0A 1TRIA 2O9OA 3AMDA 2FPYA 4J3SA 6REQA 4KWWA 4W8BA 1UZ1A 2AQOA 4F3HA 1XLDA 4ZOAA 3B06A 4C6EA 2FLIA 4LANA 3ABSA 1J4EA 3V1PA 4GC4A 4IP5A 3C0JA 5F4XA 4EK7A 2PDMA 4X9SA 4NAEB 4L9ZA 4PRWA 4J3ZA 4H6QA 3TXZA 2H9AB 4X61A 2UY3A 1VF8A 1ZJAA 4L1GA 3W7DA 1LRNA 4O53A 3THCA 2GJXA 2YX0A 3PPCA 3I7QA 3XINA 4KEZA 3QKZA 4O28A 3WL0A 1L6WA 2Y89A 1PJ9A 2Q71A 5CBJA 1Q3NA 1B3WA 4NG3A 1G7VA 3TKFA 4PGLA 3UD6A 2R1MA 3VC6A 3WJYA 1VH7A 2XVGA 2VFIA 1O5XA 5HPCA 3KOZA 3UJRA 1P1MA 2R1PA 1A4MA 1Y7VA 1D8WA 2VRQA 3COTA 3NPVA 5HINA 2ZRWA 3UZ5A 2XHYA 2EPKX 2TRSA 2B7QA 3QY7A 5FL0A 2Y4SA 3JW7A 3W9ZA 1R5YA 5DF0A 1R86A 5DMLA 4HGXA 2QJHA 3WUGA 3NZ1A 2A5HA 1VBRA 2I5IA 2F8QA 4MAZA 4NZCA 4UTTA 2WOQA 4DJDA 3Q37A 2Q01A 3E2VA 3IK2A 1J0JA 3OZMA 5AYXA 4D6IA 2A3CA 4M56A 4N9EA 3NG3A 3FXGA 2NQJA 2DZTA 2OT1A 2DIJA 4YMZA 2WNQA 4H4IA 1PKYA 1UOZA 3AJXA 2ZRVA 1TR1A 2HJPA 2QIIA 3PUOA 4UTTC 4PA8A 3QZEA 5FJUA 3IUDA 1KFCA 4JPGA 5IOBA 3EWYA 1HP4A 1K3UA 4UQEA 3EX6A 1VLWA 4GABA 3T4CA 1GVRA 2WZHA 4WJ8A 6ENLA 4UNLA 3HPXA 1YMYA 4DYEA 4XAGA 3QR3A 1NY1A 2FFIA 1J6PA 2XTKA 1NF0A 1E9ZB 3EWDA 3EDKA 1A5KC 4O1DA 4CN6A 5D05A 3MVIA 2WMGA 4TX6A 5I3JA 5ECVA 2OSWA 1YXCA 3UA3A 4MKVA 4BJHA 1OX4B 2BHZA 3E49A 3IJDA 2XU2A 2XFWA 2A3EA 5CLWA 2E09A 1RD5A 3B0PA 4XZMX 2CLPA 1VJZA 1A0EA 2QCLA 2FZ9A 1XLFA 3TQ0A 3B4YA 3TN5A 3CUFA 4XD6A 3IJ8A 3QV6A 3MBFA 4LVDA 1VRXA 4GQQA 3P67A 5FSDC 4H00A 4HSOA 3GDRA 2YBTA 5CAKA 3DIPA 3H24A 4EWJA 1MEWA 3GD6A 4UMBA 4GVGA 4TO8A 4HCHA 2J27A 2FZMA 3UW6A 2P53A 4X9YA 3NZRA 2E1WA 4RNFA 5A8NA 5CPQA 3LPGA 3TWBA 3LXBA 4ZENA 1VFHA 3R8HA 2NT1A 4CQDA 1UA7A 1DXFA 4Y9NA 5I24A 1DIDA 4LYKA 4G7EA 2WZIA 1VS1A 4GFIA 3A12A 2POTA 4JICA 5DBUA 3CZLA 3SN1A 1ODZA 3N19B 1B30A 2P0OA 7REQB 2AMXA 1KBKA 2V2CA 1MWOA 1VBGA 2WLZA 3G77A 1V6YA 2D3LA 1ENUA 1XBXA 4S3FA 4CD7A 1KM2A 1Q63A 3LK6A 1W5PA 4XAZA 1BF6A 2X1IA 1HT6A 4MG4A 1SFLA 4J28A 1B4EA 3VTRA 4EPEC 1X39A 4L5ZA 2NVAA 4E38A 4QR6A 3T0TA 3UJEA 4D71A 1GJPA 3PBUA 4QEHA 1UG6A 4S3KA 3UNDA 3OLIA 4UQCA 3FX4A 3F2DA 4JYDA 3BARA 4ZMGA 4NL1A 4GOAA 4J2PA 4B91A 4MF4A 3UR8A 3S2LA 1JDCA 1UP0A 2XUCA 2V6AA 4PL1A 1HF6A 1V6WA 1BXBA 2I7GA 3VIOA 3CB3A 1JI2A 2CHNA 3LCLA 4BF7A 3KBMA 1ZZMA 2BLEA 2BGNE 4GQGA 4H04A 2OSYA 4JX4A 5E1QA 3FA5A 3U8GA 4FX7A 4DBWA 4I9TA 4QCFA 2VDIA 4HMNA 5A69A 5EFFA 3BMVA 4IQEA 4C6MA 3FDGA 3ALGA 4C1LA 3U2OA 4GA8A 4Y9OA 1S2WA 3AROA 1GOIA 1DJXA 3CUGA 3ENLA 3VIJA 4NIRA 2OWXA 2IKJA 3LTPA 2HV5A 2GZXA 1L8NA 1MUMA 3FJ6A 3WNMA 1DV7A 3YPIA 3MO4A 1Q5MA 2QDGA 4PCNA 2PC4A 2WCSA 3L23A 3WQEA 2A21A 2CETA 3LLXA 2C0AA 3PZMA 2ISVA 3NEHA 3FDKA 1K8ZA 3CYJA 2BVTA 2FZ8A 1WKFA 3ZFHA 4LAUA 1OIMA 2CYGA 3N34A 2Y5EA 3KCLA 3ABOA 3HO8A 1B57A 1VENA 3TA9A 4AIOA 2Z7GA 5B7YA 3BAWA 3UZZA 2J6VA 2X1UA 4P5UA 1OWQA 3PSWA 3GG7A 3S6OA 4FOKA 3URBA 3HV8A 2RDUA 1G9HA 1TV8A 1UH2A 4I8YA 5E5CA 3RR1A 4OBTA 1ZLPA 3AHXA 4XTDA 3QSTA 5D09A 3DDMA 2XGZA 3KP1A 5DT5A 1EF3A 1OC7A 4AIBA 2E25A 3HPZA 3QTPA 4PYSA 2VWTA 2FGBA 2YB1A 4N6FA 4PB4A 4H7VA 2VDGA 4U33A 4CQAA 5C2GA 2QS8A 3MUXA 4UTFA 5LNWA 1D9EA 3NDZA 1QPOA 4UR7A 3DFSA 3W83A 3SZ8A 3AIVA 4LYQA 4UTIA 4V1YA 4MUPA 3TJ4A 2ZC1A 3HTWA 3GFXA 1M7PA 2ONEA 4Q3MA 1BTCA 1W9PA 4HPXA 5CSRA 5CZTA 1R3YA 2ZICA 4NJIA 1LG2A 5M3WA 4HNLA 2WCAA 3PB0A 2J77A 2VCBA 3KBNA 1Q85A 3A9BA 1RLCL 3W7GA 1S5VA 3KW3A 1J0KA 3U0HA 1QO2A 4FK9A 1REQB 3NOYA 4PCSA 5I3GA 2VEIA 3OYZA 1EPXA 1OG0A 2DORA 3GS6A 4BF9A 2XH7A 4ICMA 3LSBA 5JVLA 3P60A 1FHUA 2OYLA 1J01A 3WELA 4JY9A 1H7RA 4QE5A 4UOJA 1TPWA 2O4MA 3A4JA 2QXWA 3APTA 3PNZA 3VNZA 4PMUA 1EHNA 2D2OA 4MM1A 4LBRA 3W1MA 4YCPA 4PBEA 3MUY1 2PF0A 4RDZA 5CBBA 2ZZ5A 1D7KA 3R89A 1D8CA 4S3GA 4JR5A 1R87A 5K3VA 1HGYA 4OQVA 2HS8A 2OPJA 4N9BA 1TA3A 5DCEA 3VD7A 5D8ZA 3CC1A 4NAEA 2OVLA 4LUSA 2H9AA 4RJEA 3T7VA 4GJIA 3OHIA 1UMYA 1JD9A 4IJCA 1UWQA 2D2JA 3BLDA 2OX1A 1GTHA 4S3BA 4KH2A 2CU0A 1UBPC 3W2NA 3PFRA 5T9BG 1GJWA 3P3BA 1RK5A 3CHDA 1RH9A 3WF3A 1KC7A 2HZGA 1JF5A 2I9EA 3FCPA 2JGQA 3AWOA 4JNZA 4GCXA 3W1UA 1R3VA 3NFUA 2E4TA 1MDLA 3A23A 2CWNA 1RVGA 2C14A 3L66A 4FXJA 4HTBA 4YTQA 2H8XA 2PDPA 2Q8XA 3T40A 2ODOA 4KW2A 1HL2A 3OQ8A 5AYBA 1X7IA 3W87A 3W72A 2EF9A 3LD5A 3LXCA 3RO6A 1HZYA 4GQ0A 3LU2A 2DVTA 3NQVA 3E2RA 3TCSA 1XM3A 3WF0A 1UUQA 3WLKX 2GGJA 3VFLA 3LERA 5T8GA 2R9RA 3WQ6A 2WJEA 2QJGA 3WFAA 5K2ZA 1LOLA 3ZQ9A 4L65A 4WXYA 3VOGA 1Z6KA 1EUAA 1PYMA 2A7RA 3S1UA 2BBFA 5J04A 3IV8A 2XSBA 5FEZA 4UTKA 2P76A 1FXPA 5C2CA 1SZRA 4I5UA 3UWUA 1OFBA 1A5OC 4D72A 4ZZ9A 3ITXA 3SI9A 4JQAA 2DU2A 3S5YA 1J79A 1TV2A 5HUPA 4UFHA 1M53A 2PP3A 1SZNA 3CL7A 3HPSA 4F48A 4HA0A 1U83A 2VHLA 4LRTA 1JDEA 3OZOA 4IMAA 2DJLA 2OLSA 2VMFA 1VLIA 1XC6A 3PG8A 3Q58A 3T8LA 3PZIA 1PDZA 3CAQA 2GPTA 3VIHA 1DORA 4PUUA 1GG1A 2P3EA 3UCCA 3QQ0A 2BP1A 2CBVA 5D03A 4NYUA 2Y61A 2INEA 2Y85A 3PJXA 5JXQA 1JZ4A 3G0UA 1XPYA 3GY1A 3P0WA 5HDRA 5A6BD 2F84A 5FF4A 2WWCA 3WMSA 4YWIA 4GZ7A 3NVDA 1UD4A 4WSKA 3MY9A 3O0KA 1QDSA 2C1GA 3ARPA 3NDOA 1VPQA 4J3UA 2YFOA 3K8MA 3FN9A 3LLFA 4IPIA 2VJXA 4X2RA 3T44A 4ERGA 3F4DA 5ABEA 1D2KA 1L2UA 4POCA 2WC4A 1EJXC 3HG5A 4GJ1A 1WDPA 2ZYFA 3HB9A 4JTGA 2G3FA 4HNCA 2BV9A 4NXKA 4EXBA 1JCXA 1E0TA 3UZJA 1XCFA 4NKCA 5A6BA 2EGZA 1O6IA 2X1SA 5FJRA 2ZUSA 4DI8A 5DY3A 4LVFA 3G2GA 4HHLA 2WSRA 5CG7A 1KA9F 4FLSA 3IVTA 1UOKA 5G2IA 1QCWA 4D2JA 4XKYB 3B9OA 3G18A 4IUOA 2B7PA 1SO6A 2VO5A 2OQHA 3UVIA 2GL5A 2WHLA 3AS1A 5KITA 1W3KA 5A8QA 3S83A 5C70A 3TDFA 4GY1A 2X09A 3O15A 5FF2A 7REQA 3L2LA 4ZFMA 5CPLA 1T99A 2Y62A 1L6GA 3RF9A 3MUZ1 1XIHA 3FLUA 1IWBA 2ISSA 4IG2A 4Z42C 5LA0A 4S2BA 1RXOB 1XIGA 1RCXB 2J62A 2CNCA 4LUTB 4XBKA 5HR7A 1X7FA 1V51A 1C7TA 1SUXA 3TCEA 3ONBA 5LZLA 2Y5SA 4IZGA 4GI6A 4B2DA 5T91A 4NT0A 2PLCA 1S5NA 3QM3A 4QLLA 1XG4A 4GUJA 4A3YA 2VEMA 1GWJA 1JL8A 2YL9A 4HU4A 3EGJA 1FTXA 1L0PA 4RV8A 3BGJA 3W53A 2BXVA 1VGAA 3GC5A 3S6TA 2ZZ1A 3LV6A 3AYRA 3C0QA 4H6KA 3EKZA 3KZPA 2DUZA 4HNTA 1MMFA 1VR6A 4U28A 4MB4A 4G6CA 3SUVA 1XX1A 3TV8A 4AQLA 3AUOA 4K39A 2YXOA 2FB3A 1GUVA 2IXUA 5A6KA 2G3NA 2Z27A 1EXPA 3PHAA 3R5EA 1R3TA 3P74A 3OVGA 3RITA 5IFTA 1YBQA 1E1FA 1FWAC 4AF0A 1P0DA 1WKDA 1WOBA 3E5BA 2V81A 5FAGA 1V03A 3TA6A 4V33A 2PGEA 4Q7BA 1WO2A 3E1F1 4E2OA 2ZE3A 1TTJA 4R34A 3W74A 3DZ1A 3IRDA 4Q8VA 4ORMA 2G4JA 4DAIA 1XKYA 2DZAA 3RR4A 3LBCA 1AA1B 4BZYA 3WK3A 1SW7A 2O56A 3GLCA 3WBXA 1MUWA 4GJJA 1OFEA 2AAAA 4NZ4A 3XISA 3L4UA 1FY6A 6XIMA 5EMUA 4UTJA 5EBAA 4P8UA 5IBXA 3N4AA 4QIUA 2J8GA 2ATSA 3WLRA 2OWCA 5PTDA 3ES8A 4O11A 1E6PA 3KTCA 4FLOA 1EJSC 4I6KA 4ADSA 1GHSA 1BWKA 3BAXA 5GVJA 3LS9A 7TIMA 4I7UA 1HO4A 1OF8A 2WQDA 3NWRA 1VHNA 3RLUA 5AHMA 2WB5A 5D9MA 2GOKA 2TAAA 3WD3A 3ISIX 4AZGA 5IBXC 2GVJA 3QOMA 1A5AA 4JAWA 3NPXA 4AZ5A 3LLDA 2D0FA 1EBGA 2J47A 3V75A 1GVOA 3UWWA 1A0CA 4DJEA 4YU1A 1E6QM 3W84A 1ZGDA 4XVEA 3R1ZA 3U2ZA 1JULA 1UW9A 1TWZA 4DELA 3HPFA 3VFCA 2X7WA 4ZR8A 1XH0A 5HR6A 3DC8A 4H2CA 4WK9A 4C1NB 4FLRA 2BY1A 3UVAA 1QBBA 1ZRQA 3C3UA 3DI0A 3K13A 4U4MA 2PGWA 4GVFA 1XLLA 2YJQA 1OF6A 3L12A 2ATMA 1A5BA 5EFDA 1CX9A 1OYAA 3M7SA 2JKAA 1YQ2A 4R7OA 1FKWA 2Q8LA 4JTEA 3CEUA 3CTLA 3VMNA 1V4YA 2V5BA 3WBWA 3PSVA 5DXXA 1OIFA 4MMWA 1JUKA 3BLLA 4AZCB 2WNNA 2P0IA 3W02A 4XVDA 3CQHA 4X63A 2B0MA 1MQPA 4JEJA 4MFDA 4DAFA 5JBEA 3DGBA 8TIMA 3VD5A 1WKYA 4B5SA 1B3OA 2HNHA 3ITGA 3BQ6A 5K9XA 4C6LA 1I8JA 4ACYA 3V7PA 3TVAA 3TW7A 2EBNA 4DUVA 3GDMA 2FKPA 3B9DA 5CAHA 3GIYA 3EX3A 3P5YA 4RXGA 3P80A 3ARTA 2XM2A 3NSXA 4JN6A 4MB1A 3E74A 4P7OA 2PS2A 1FXQA 1RA5A 1SMDA 5F2IA 4O0QA 3KOYA 4RE2A 3S9ZA 3H23A 4LEFA 2ZX9A 4JL2A 2PODA 1VFTA 3E9AA 4M8UA 5JIPA 4JTJA 4OOUA 1IXNA 2Y63A 3IVSA 1TUXA 2HROA 3ARRA 3N2BA 2PDQA 2RDXA 1JR1A 4RXFA 1YPXA 3GVWA 3QBUA 6A3HA 2VP8A 4GG9A 1DJIA 4I90A 2OZTA 5JUVA 4LB4A 3TN4A 6TIMA 3P14A 3O0FA 5LGZA 3BZJA 1GYMA 4ZE4A 1J6OA 2NT0A 1IF2A 4PRTA 1MW3A 1CEOA 3HOJA 3S5OA 3NQMA 4ZSUA 5E0KA 2HRWA 3UT0A 3OPSA 4A8IA 1E6NA 1QRQA 2VEPA 2YDQA 1AVAA 2ACSA 2VZOA 2E6FA 3TSBA 1C92A 3L4VA 3T09A 3C52A 3IJQA 4O18A 3BUVA 3S1XA 3CO8A 3H2FA 5KETA 4N02A 1LCOA 4JQ3A 4LCRA 3GWQA 4FSAA 2QQ6A 5BWAA 1ZJIA 1BD0A 1NF7A 3AMLA 3V5CA 2XDFA 1PDYA 5KSWA 3M1ZA 3KAOA 3I68A 3OP2A 3TAOA 4FNUA 2NW0A 2YZ5A 1VQTA 4UQ9A 4L1WA 4AYSA 4IJRA 3L2MA 1IZKA 2VZVA 2A3HA 4H19A 3F7JA 2G3MA 2WVVA 3LEPA 1E9YB 3NSNA 3PJWA 3P81A 3DN5A 3NSMA 4XZNX 1A0DA 2X30A 3AICA 1RHCA 2PDJA 4Q4MA 4GISA 2RFGA 5U4NA 3LCXA 1MW0A 1BYCA 3EA1A 5A6JA 4AD5A 1EOMA 2GUUA 1TCMA 1WNOA 2UV8G 2E28A 2Z25A 4L80A 1XDJA 3DYPA 3HMCA 1LWJA 5LKYA 3TONA 1UASA 2VGBA 1KM6A 4V2XA 4MFEA 3IV3A 2VENA 1KCLA 4OTKA 5I00A 4WGXA 1VCGA 2WHJA 4AWEA 3F03K 1JFHA 2YKKA 4AW7A 2FJKA 2V9DA 3A3XA 4WF7A 3HGSA 2XIMA 4LPCA 4UTHA 5M2FX 1WP6A 1G1YA 1BAGA 1ZP3A 3NZQA 5I07A 1WZMA 2ZX8A 2GSHA 3O63A 3H7VA 4XX6A 3RRAA 4CNPA 1KFKA 1YNPA 4FPSA 1CBGA 4IIGA 4GX8A 4PULA 4NZ5A 5A6MA 4GYPA 1XRTA 2H8ZA 1Y5WA 2RAGA 3URAA 1ZJBA 1YW1A 1W1TA 3ZLGA 4MADA 1P0KA 4F0LA 2NQ9A 3FAWA 4Q8NA 2QT3A 3QHOA 4HA3A 1WXJA 1MXGA 5A8GA 4ASTA 3VOJA 3H2EA 1JIBA 4UCFA 3IACA 4GYPC 1EIXA 1WDDA 1YDNA 2ZZ2A 3A3HA 3AIQA 3PUEA 3QOKA 2PA6A 4TMBA 3W1TA 4LUTA 4IPPA 3S5SA 2E6DA 3I10A 3CLMA 1W1YA 3FNDA 3TYZA 2NX1A 3FKRA 4NUWA 1AJ2A 3ECQA 3VCCA 1EGMA 3PP7A 3EMZA 4GGBA 3MSGA 3RN6A 1BYAA 3H12A 3EKGA 3V1HA 1XR2A 4HA4A 4W88A 1JDDA 4XIAA 1SJAA 4XO7A 2LLEA 4Z0JA 3RCNA 1J11A 3NIYA 4F40A 1JNDA 4MJ2A 3WDIA 3MJMA 3KDNA 4YYCA 2X0SA 2R1LA 5EL1A 3RK8A 1OX6A 3HA1A 1VZWA 4IFKB 4DLFA 4M81A 1YHTA 4GQBA 1OVDA 2QCDA 3MMTA 3WENA 3WJWA 4ZO9A 3MCOA 3R8GA 5LHEA 1GW9A 3ZJKA 2VXNA 1TJ1A 2C6QA 2DZUA 5D2TA 3WLIA 6PTDA 2X1RA 2OG9A 3KE0A 2HXTA 3A21A 4XD5A 3TQKA 4DLMA 2CLLA 4IIFA 1UKOA 4ZO8A 4RLIA 4ZOEA 2HBXA 1LWHA 2BS9A 1HKWA 4Z1CA 2REQB 3L0KA 3OLEA 3ABQA 5A6LA 3GTIA 1EDGA 1Q2SA 1RY0A 3B3DA 4LVAA 4E2VA 5AFDA 1M65A 3MQTA 4Z1BA 3PZNA 3K4WA 4D9PA 3GNPA 4GYJA 5LIUX 1TPH1 1XRFA 2DEPA 2Y5JA 3S2CA 4FNPA 3DKJA 4HPHA 2WMJA 4W86A 1T8QA 1DQXA 2FTPA 4WUIA 1WDQA 1NELA 4YVXA 4FEZA 3L65A 1V08A 4Q8WA 2IKGA 1RP9A 3ARSA 5DMMA 3GHSA 3BOFA 1EZWA 4GO8A 3N17A 4H01A 5EY5A 4PMDA 3QY8A 2CPUA 3VNDA 3VMPA 2QIWA 3T0DA 3PUGA 1XQLA 3A22A 4ZOCA 3LUTA 3M44A 2QCGA 3LHTA 3VIIA 2A85A 2ZZ6A 1W3NA 5CGQA 1MVYA 3B4UA 3P0XA 3QR1A 4ZE5A 3G1DA 1A5LC 2PD9A 3P6LA 2OZ3A 3AIUA 4J3TA 4ZTXA 1X98A 4AB4A 3T07A 1RK6A 3MC5A 5GPRA 3ARZA 1Z7AA 5FAJA 4P2VA 1OK4A 1E56A 3K1GA 2CERA 4IMFA 4J3WA 5DMNA 3H21A 1W37A 5CGMA 5BZAA 5BW6A 2VC7A 1O66A 4GE8A 2E5CA 5M5DA 1IHIA 1W54A 2PEVA 1YADA 1H51A 5GJMA 3RU8X 1XUZA 1WV2A 3TLQA 2XIIA 4C1NA 3RNDA 4US5D 1EFZA 1JJKA 5FIPA 1GOXA 4AD4A 1U30A 1DTUA 4D6GA 1GW1A 3VILA 1UZ4A 1WDRA 3KRBA 4Q8PA 2JALA 4ACZB 1CW2A 3SSZA 2CKSA 1XSKA 3G1FA 1I2QA 2MUCA 3STFA 3LXAA 1Q6OA 4AWUA 3N2TA 4GPNA 1F4HA 1LBMA 1UR1A 2XWDA 4DWDA 4FO4A 3PPHA 4LBUA 4DWSB 4OT7A 1BVZA 3R94A 3UXAA 3FJLA 1KW1A 4XSLA 4C6BA 1MNSA 1WUFA 4WQ6A 4DF2A 2ZDRA 4KETA 4ZXOA 2ZRYA 1QW9A 3KOXA 1XINA 2JKEA 3E0IA 3STEA 3POCA 3EDDA 4B90A 4PUMA 3BURA 3MYPA 5I79A 2QNEA 2Y7FA 2ON3A 3QHMA 1ZS2A 3IJ7A 2NLIA 3OA3A 1R30A 3TXVA 3G1XA 4P8XA 1JZ7A 3NTYA 3GO2A 1AQMA 5CPTA 1WZKA 4AZHA 1BXNA 4Z2LA 1B9BA 1Q2RA 3QV8A 4N0RA 2OU4A 4C60A 1LZOA 1KGXA 1PX4A 3B8DA 1ADOA 1QOQA 2AL2B 1GOMA 2W6RA 2V3FA 2PUZA 1TCDA 3WQ5A 2JIEA 3D6NA 2V69A 4UQAA 4I6VA 1K4GA 3U7BA 2WHMA 3HG3A 1LYXA 2QCNA 3U4FA 2Y24A 3EDFA 3WDRA 1FH7A 1PYFA 4IIDA 1CGYA 2DT3A 3AWNA 1MQQA 2P1FA 1VJSA 2ZUNA 2WAGA 4CQ9A 4WDTA 3PB2A 4D1IA 3QMTA 3S0CA 2E5BA 3WYZA 4H7ZA 3T0CA 5A2AA 1UPPA 1YNYA 4ZQNA 3SAZA 2C18A 5F2LA 1G01A 1J12A 2A6NA 3B40A 2DQWA 4Y9PA 2PC8A 1AZ1A 5C9UA 3VD4A 3HQNA 3RILA 1TPDA 4OOZA 1TUFA 2J9XA 4GUIA 3FY1A 1QMLA 1CXLA 3N9RA 5HOSA 4HKPA 2WM0A 2J9ZA 5KZDA 1KFWA 4OUEA 3RU6A 2PGFA 2HK0A 1DP0A 3WNNA 2PF8A 1QATA 4HJWA 1LL6A 4WY0F 3B0VC 2NWSA 2A6LA 3SCPA 4IPNB 5LYRA 1M1BA 2OO0A 3W2LA 5EGRA 3DBNA 4N2YA 1AD4A 3SM0A 1TKKA 1OADA 1JXJA 2ZA3A 2HNEA 1MNZA 2PWDA 2G50A 1LTDA 2C16A 2E9BA 4WIWA 5LA2A 4JNYA 2B31A 1GVYA 2OOGA 3GVGA 4MDPA 4O13A 2E77A 1WAWA 3ID7A 5K9DA 3W81A 3C8FA 4F2BA 2NUXA 1ZQ5A 1SO3A 2CXGA 3WQPA 4UXDA 4CD6A 2O7QA 4PCPA 1MO0A 3MPGA 4TV6A 1UA3A 4WSHA 1YDYA 2YPIA 3CUIA 4MWAB 5HWJA 4TUFA 4ERIA 3B04A 3R4IA 4MPKA 2O92A 4GHRA 3W85A 4HOWA 3G3DA 1F2JA 3MP4A 4LALA 4J3XA 2GVGA 1K6WA 2GUBA 4IGNA 3SFWA 4XZBA 3OGRA 3U4AA 3ZT7A 3JS3A 1V02E 1B31A 1OC6A 1Q45A 2X0HA 1OZMA 3RCYA 4F0HA 1JZ3A 4D6DA 3OEXA 4PTVA 1FP9A 4E2BA 3SCSA 3SDOA 3EOLA 4BEQA 2Z29A 1V0KA 4K7YA 4L61A 1CLXA 1QR7A 2OZ8A 2I56A 1K03A 4CCZA 1MRAA 4GXMA 1E15A 3V5OA 3W6MA 3U2EA 3CQIA 1YE4A 3MS8A 4ATWA 5C9ZA 1KWKA 3LTYA 4GACA 3BTNA 2YBVA 5F1VA 2PDXA 2E3ZA 3IGHX 4JFUA 1CPUA 4K8HA 3ES7A 4QG8A 4Q4SA 1OGGA 3SJNA 3DGRA 2Q6ZA 1UBSA 2XYLA 3JR2A 5I2UA 3MP5A 4F0SA 1DL3A 4FNRA 3ZYZA 1NWTA 1O7AA 3A64A 1J0ZA 1BKSA 4EWND 3H8AA 4M3PA 2EXOA 4W85A 3M6YA 2GVYA 1W1A1 2ZRUA 5ECUA 2XVLA 2Y0FA 5CPNA 5C55A 2OEKA 5E93A 5H8UA 3NVTA 4LT9A 4O1AA 3UCQA 2F9RA 3E0FA 3WK2A 4HK7A 2UY4A 1X1ZA 2Z26A 1GOKA 2VGIA 1JRCA 2QCHA 2WKGA 4Q22A 3GNNA 2O4QA 3VD3A 3GW3A 3DKLA 1F3XA 2OELA 1CXFA 2VKZG 4H6EA 3UWZA 4ICCX 1IWPA 2VNCA 1AH3A 4C91A 4OZOA 4GQRA 3N3TA 3ZT5A 1JPHA 3R8RA 4OKDA 4DO6A 4BS0A 3W7RA 4YYFA 1ICQA 2ALRA 3WSUA 1PEZA 3NZPA 2FPVA 2PRMA 2EG7A 3DH7A 3UQNA 4GKLA 1W5QA 1ITQA 2Y7DA 5KZ6A 4JKMA 1W3TA 2QV4A 1UYQA 3DERA 5I78A 2JIWA 1FQ0A 4KERA 1WDSA 2C8NA 2XGIA 1PVNA 5MF5A 1KXTA 5LIYX 5ABHA 3KOFA 3PTDA 5AYIA 1TMLA 4ZQPA 3T05A 1FDYA 3ABRA 3A5FA 3II1A 3TQVA 3CBWA 1W9BM 2DZBA 4KCWA 3VIMA 4HYRA 3H2NA 2AKZA 1OG6A 4R9XA 3WQ4A 1SMAA 1HKVA 4YWSA 1NIUA 5DMYA 2IXVA 2Z1BA 2C1IA 2NQHA 2QMJA 2Y1HA 2FIQA 4UFLA 5BNKA 2GQ9A 5EMLA 3SADA 4JCLA 2GQ3A 2WMKA 2ZZ3A 1H41A 3WD4A 3G0XA 1CXKA 4MY8A 3WLQA 3H26A 1UCWA 3EPOA 1W32A 4LBSA 4ZXLA 3RRXA 3PJTA 3CAVA 5CJ5A 1H3GA 3CUJA 2OODA 4LS0A 5HXMA 1MI3A 2A3LA 1V7YA 3K8LA 3QC0A 1GPWA 2J79A 3WQCA 3LOTA 1FCBA 4NP7A 2OCZA 4X2PA 2JEPA 2QMKA 3W86A 1ISXA 5CJNA 5BYWA 4D6CA 1S38A 3QW4B 1EX5A 2EQDA 1RPKA 4KKXA 2J7CA 3R58A 3AFBA 5C5YA 1H4PA 3GH5A 4HZMA 1KGUA 1EYEA 3KFTA 2GDQA 4O52A 2QJJA 3G24A 4ZEPA 1S2TA 4AY8A 2WPGA 4UOQA 1HJQA 3EWZA 3EOEA 3WLMA 1XIBA 4DZ5A 5BRQA 4OFCA 3FEMA 4IMGA 5H6HA 1WX0A 3M5XA 3CL8A 3PPFA 4UCGA 3KM8A 3EDJA 3DHFA 1CI1A 2X0YA 4KRUA 3BG3A 3UWQA 3A4XA 2RJHA 3SSJA 3LENA 4HPNA 3BPWA 4UTWC 1N55A 2QCFA 1U1JA 1LOSA 2VEKA 2P50A 3QQWA 4U2ZA 3SUUA 2PP1A 5RUBA 3AXKA 5I23A 1UWAA 5A1AA 4B92A 5C2XA 3EWCA 1XYAA 1W9VA 1PTGA 3JU2A 3NUKA 3PK7A 3W1NA 3BWWA 1B3ZA 2XFFA 2DH3A 3MB9A 3CAWA 4ZODA 2O7SA 3FIGA 4KMQA 9RUBA 3R43A 3PZOA 4CNNA 2J75A 4W5UA 3T42A 4DWSC 2WVSA 3C6CA 1H1NA 2VOTA 2ZVIA 4L6OA 4MB5A 1SJBA 2VELA 1DJNA 1UQYA 5HMDA 1TQJA 3MI6A 1UR4A 1QI3A 3WQOA 3R11A 5AZ1A 4JFVA 3GNDA 3ZMRA 3GFZA 5I3KA 5T9CE 5D30A 4RNIA 2ZX7A 3W0KA 5BWFA 2NX9A 2W0UA 2D2HA 4JQ1A 1ICPA 3N13A 3UJFA 3Q94A 3KUMA 5DRCA 2PAJA 1XBYA 3LCFA 3S6DA 1HL9A 6REQB 2VEGA 4G8TA 3UFYA 1EIBA 3CPUA 1TPUA 1K4HA 1UJPA 4Q32A 2PP0A 1Q6FA 1XI3A 3VVGA 3RCMA 1EWEA 5CZKA 5MKGB 1NDWA 3L4XA 3CHFA 3BZGA 4O50A 8RUCA 4TX8A 2E1DA 3N6HA 4JXCA 3UZWA 3H54A 3N15A 3GXNA 1QU4A 1RQEA 3VKCA 1QXLA 4EXQA 2GJXB 2QF7A 3QKEA 2R24A 1KXQA 4Z2IA 4ML4A 1FWJC 5HAOA 4BQ5A 3L68A 4DYJA 4AZ7A 3ALFA 1Z41A 3NO5A 4GY0A 5JIWA 2I16A 5ABTA 4BQ3A 1E4NA 4PB3A 3GG1A 3IK4A 3VE9A 4HYVA 4B5XA 3CUZA 4EAYA 4JCMA 2ZWZA 4WOQA 3B0XA 3POHA 2B81A 3R0DA 1FWGC 4K1GA 4NX5A 4R5EA 1OM0A 2J7GA 3LZ5A 1N8WA 1BWVA 3EMQA 3TX9A 1XLCA 1W9UA 4XIMA 3PZVA 2HMCA 1YEYA 3BW4A 3S1VA 2VX4A 2PDWA 1EJTC 2FFCA 3L0GA 4IGSA 2I14A 3QMRA 5KZMA 3ZSTA 4MOZA 4ZQMA 3D46A 1W3HA 3ZWTA 1G67A 3LCIA 2V67A 1EQPA 1P48A 1FBAA 4FXSA 4O17A 3U3HA 3W73A 5EMJA 4REQA 3C61A 4QHRA 3EXSA 1J96A 1GK8A 4H7CA 1XXXA 1GVQA 1C29A 1JDFA 3GXFA 2BHUA 1JCNA 1JUBA 4GD0A 5D9OA 2XG9A 3HU7A 1CZ1A 5REQA 3ZT6A 4Q8MA 3UJ2A 5CPOA 3B8SA 1V77A 3AJ7A 3RJXA 5FF0A 1RA0A 1OBAA 5AY7A 1QI5A 4CLMA 1KXVA 1WA3A 3AIWA 1ITXA 2GOUA 2GGGA 3GXDA 1R9XA 3NR0A 4ORIA 3UG4A 4MWAC 4G56A 1V3JA 3AYSA 1EL3A 5CBIA 1T96A 2Z1KA 3EYPA 2PBGA 3B0YA 4S3CA 5FJPA 1P7TB 1C8YA 4XUGA 4FIRA 2W66A 3LMYA 3GTFA 3RIKA 1QK2A 3UR7A 2ASHA 4UQBA 3TTYA 2V30A 4WKFA 4PUNA 3QV7A 5CG0A 1JGIA 1EH9A 4MZ8A 3C3NA 4HMEA 4Q33A 1Y8BA 1GYNA 1DHKA 3DI1A 4JTDA 1ZBWA 5CC3A 1KM5A 3URNA 4KFOA 3MI2A 1C8QA 2HE5A 2ZFAA 2BG5A 2JFEX 1XIIA 2BGQA 1UR8A 1W3IA 2G96A 2CZDA 3W7NA 4AEOA 2JE8A 3VIFA 5K7JA 3CZKA 1RQBA 5TAOA 1L6FA 3DFNA 1SR9A 1B3VA 1QTWA 3DFTA 1Q6DA 2Z0IA 4HPGA 4FF5A 1MSSA 4QDMA 2GJRA 3ARQA 6ALDA 4G7EB 4F79A 1RBOB 3W7CA 4ZQRA 3F1QA 2HPMA 3WZ0E 4BKNA 1SFJA 2VC6A 4N4PA 1W3LA 1KD0A 4F9DA 2D20A 3ME3A 2Z4GA 2PDHA 5LHFA 3W1PA 1IT8A 2MANA 2PZ0A 3AHYA 1A5NC 3PJUA 4E8GA 3W38A 2QDHA 5L6UA 2DW7A 1YNQA 1XD0A 4XK2A 4H9UA 4M24A 4GCAA 3SCUA 5BRPA 4MB3A 2ZKMX 4A8RA 2OLAA 2PTDA 4LAOA 9CGTA 3QGAC 2GDUA 4AD1A 1VC4A 1TPB1 1TWDA 2J25A 1G6CA 2OMAA 3B8UA 3BH4A 1TELA 4RZ5A 3BCDA 3QF0A 4JIHA 4F8XA 2QEZA 1V0MA 3M0VA 3QQ1A 4A22A 3BJFA 1V6TA 3W2MA 5EMMA 3C5QA 4I5XA 2W92A 1JCYA 2ISFA 2WZEA 4AEEA 3UGVA 2OTDA 4GNJA 4U2YA 1HFBA 2F6XA 2QDEA 4PMRA 3LBOA 4MSSA 2XH2A 1UUOA 2ICSA 5C7VA 2HSAA 3OLGA 2XZ9A 5FOOA 3KTXA 1HX0A 1VYSX 1EX1A 3DFPA 4DHGA 5GNXA 3TEVA 1YLVA 3EWXA 3CT7A 1Q66A 1UKQA 2QDDA 1DVJA 1AQ0A 1W6TA 4IH3A 1GQLA 2YW4A 1IT7A 3GU2A 3NCOA 3ZIZA 3W01A 4HOZA 1TVNA 2OKTA 1Q8AA 5F7UA 1TREA 4QS6A 3UG3A 3DG7A 3CL6A 4NAFB 3GU9A 3C86A 3CIWA 2BDQA 2QUMA 3DECA 4ENLA 4CQ8A 4BEUA 2Z1XA 3W07A 3W7LA 1K1DA 5GNYA 4QTGA 1GNXA 1LRTA 1EOKA 1Q7QA 1RZMA 1GEQA 2XN2A 1SR0A 3MMDA 1Y5XA 5CC6A 3LCHA 3N2OA 1K77A 3OGVA 4W9TA 3PBVA 1S5MA 5F4SA 3VOHA 2WO5A 2CBJA 1ZENA 5EB8A 3TTOA 3SCOA 4RZ6A 5GQBA 2V0TA 4FNSA 1Z42A 1SJCA 2X1TA 1NSJA 3OJGA 1H7WA 1GVEA 1B0IA 1ISZA 4W8LA 1LLWA 2EAWA 1QUMA 1CGUA 1Q7ZA 2E7FA 4H83A 4HHHA 3SQSA 4AHOA 1PIFA 3RUBL 4BA0A 3U57A 5A94A 2EEXA 1NDVA 4RZBA 1E4IA 4XBSA 3KS6A 4LVBA 4OGZA 4B4HA 4DJFD 2A4AA 1BYDA 1TRDA 3LHWA 1M5WA 3AOFA 5AHFA 5FEXA 1A3XA 2FGLA 4LNCA 4JFTA 3LMZA 2VFHA 4Q8TA 3H53A 4WKAA 3GH7A 3L67A 1TTPA 3UR2A 1ONXA 4XUYA 7A3HA 4RPQA 4Q7NA 4JIIX 2AKMA 4D8LA 5BXPA 2I1OA 2R91A 1XLKA 4K7VA 1FP8A 2EKGA 1M9HA 1HP5A 2FPTA 1MFVA 2A79A 3GIQA 2OYMA 2A2IA 3IIPA 3TUUA 4WDXA 3CB8A 1NFPA 3IARA 3S2NA 2CESA 3TC3A 1TZ9A 4DJFA 2X8RA 1ME8A 5AKQA 4HCLA 3SCWA 4FR6A 1KR1A 3GBDA 4LW7A 1FUYA 4MZ1A 5AHLA 1DHPA 2ZUMA 1EJ7L 1JPIA 2QW5A 3LNPA 1E43A 3V0TA 5JH2A 4LCSA 4JS3A 2QVNA 3C2OA 1ALDA 5D2VA 4R9OA 4LSBA 3VMOA 2VWSA 2QAFA 4IIHA 3MHGA 1EO5A 2DSZA 1HW6A 3TJLA 5CZJA 1QASA 2YFNA 3ZSSA 3MUIA 1VEPA 4NVTA 4Y2WA 2QUNA 2PRLA 3VKBA 1UKSA 3DUGA 1JQXA 4ZQCA 4HT3A 1KCZA 2ZXAA 1TA3B 5MKGA 4OBSA 1QBAA 3TYAA 4NASA 1AW1A 1MDRA 3UBPC 3L21A 2CLFA 3H7UA 4M19A 3GZAA 4M6QA 2FHCA 3ITVA 3A13A 4M6UA 3GM8A 2V3GA 4LUSB 3DC0A 3QFEA 1R2TA 3SY5A 4MKNA 5DQPA 4MLJA 2BY0A 3KCJA 3FHAA 4FMVA 4HBKA 4WOZA 2PCQA 3DYOA 4I8DA 3AHZA 4QGCA 1XHGA 3E2SA 1ONRA 1BTMA 4X22A 1YE6A 3VE7A 1X96A 4FLQA 4B9YA 1Z9AA 1AQHA 1XIMA 4YTTA 2DT2A 1CLVA 2G0WA 1H61A 1IEQA 2VZUA 1KM3A 2VQTA 4QRNA 4HZ6A 2OR2A 4AUBA 4Y7EA 1QVBA 5H91A 3VCRA 3JVAA 1EJWC 1KWGA 3MVTA 3LQGA 1DWAM 3VGEA 5AYZA 1V0LA 4LCQA 1TV7A 4ZB2A 5AC4A 2XVPA 1J0IA 2QAPA 4MIMA 4ZB5A 5FL1A 3BGAA 4E3VA 2R94A 2WV8A 3N6JA 1GKPA 2ZXDA 1XYBA 3ZM8A 3VDGA 2Q3RA 1K8CA 4RW3A 2F2HA 1TMHA 1SJDA 3AS2A 3ZLHA 1ZTVA 5ABFB 4F9JA 5CH9A 2YCJA 3VNIA 1WBJA 3ZZ1A 5CJMA 3JZUA 2ACRA 2G8ZA 1QW8A 5T26A 1NFGA 4GNKB 4EPKA 1HL8A 2PD5A 3LM3A 3I6RA 3GUWA 3DBPA 1UH4A 1LLOA 3THUA 4FOUA 2P10A 5CCZA 5H8PA 1B3XA 4DJDC 5KEZA 3WF4A 3GAYA 2RDWA 3ABXA 4IT1A 4N9DA 4B5UA 4JIEA 1GYLA 2GSJA 1CT5A 4PTDA 3I6EA 3SIZA 5H1WA 1OT2A 2YLLA 1DJWA 2J7DA 4CCEA 1BKHA 3DFYA 2I9UA 4AXKA 2PDKA 2DZPA 2Q09A 1KTNA 3SRHA 4G7FA 4FZIA 1ZL1A 3LY0A 3OO2A 1GTEA 4JBRA 1GT8A 3AZTA 3LPFA 1K7XA 2WJDA 3SUSA 1P7TA 2E6YA 2QVHA 5MHBA 1XGEA 4WD0A 1J18A 3NQDA 3P5ZA 4L9XA 3VKAA 1QOXA 2YA1A 1E1CA 1K6AA 1KKOA 5FJOA 3K1DA 3VKKA 5K4ZA 2D73A 3T2OA 3GTHA 3VGFA 1OYBA 4KRTA 4JKLA 4OWGA 1A49A 1N2VA 1CWYA 3W3OA 4GXPA 2WSQA 4J27A 3MV11 5GJNA 3VX0A 4L56A 2DPEA 4S3JA 2VCAA 5D2XA 4QCEA 1FWFC 2Z6IA 4PMZA 3GR8A 2FHFA 2BOEX 2GVLA 4PUDA 3F4CA 4UC5A 1AG1O 2A7NA 1XYLA 5C8BB 3RXZA 4NJHA 4EIVA 3C2VA 4PUWA 4IM4A 4FNTA 4JTFA 4FA3A 4CU7A 2Z7KA 2YIHA 1PHQA 4R85A 3N9SA 3SBFA 1O60A 1JDAA 4LF1A 4S3DA 2OOFA 2GLKA 1TSIA 1XS2A 4HK5A 4Y8EA 1LBLA 3FXYA 1FCVA 4PSPA 2PFHA 4IGHA 1DBTA 4A2RA 5CGTA 2PDBA 4CNOA 3PBWA 3CM4A 3WEOA 3TQPA 5TD4A 3ZJ6A 5I3FA 4PFHA 1IEXA 3DXIA 2BFGA 1BXCA 1CENA 3ZVIA 4QM1A 1YXDA 3GAKA 4BI5A 2GFTA 4IG2B 1DWHM 3BE7A 3FS2A 3Q2DA 4QBXA 5HULA 2QR6A 3NAVA 1GZ1A 4YVVA 2XIQA 1F61A 4K8GA 1IV8A 3LBMA 3ANVA 3SURA 4Z1DA 3P8IA 5D38A 5A8MA 4UWMA 3M0ZA 5G4EA 1W8GA 4NILA 3NYZA 4WDWA 2VD9A 3WMLA 2ACUA 4B5TA 4JX6A 3N29A 4M6PA 4MJZA 3BSMA 2ZZ7A 1O68A 3IUHA 4MNMA 4HQVA 2MNRA 2Y7GA 3PY2A 4H9TA 3R6IA 4YJ5A 3M0LA 4JTLA 1ONEA 3ANUA 1OABA 1XIFA 4O15A 3HPAA 1NU5A 2D3NA 3G8RA 1E55A 1ZAJA 5FEPA 4XZWA 3L4TA 1OD8A 3MHUA 2SFPA 4PCTA 4RDWA 1VP5A 1SZEA 3GR7A 1XRVA 1E0UA 4IL0A 4IP4A 4TU1A 4EANA 4S1FA 2BTMA 4CCDA 2YW3A 1EQCA 4Y9MA 2DVUA 5ENLA 3OVRA 2RH9A 3MKVA 3VUSA 4AVFA 4NZJA 1YBQB 4AWSA 4YCOA 1R9ZA 4DI9A 4GUGA 4AF0B 4TTUA 2XJ7A 4RDVA 2R1KA 1YYAA 2CXEA 2XSAA 3GVQA 3S4TA 1XC4A 3CQKA 2PTZA 1FHVA 3MDWA 3QMSA 2EG8A 2Q02A 3UNTA 1QNSA 1JZ6A 4W93A 4NAFA 2CHRA 1ZCCA 1R7AA 5BCAA 1XW8A 2VEFA 4CVUA 4XV0A 5HATA 1M7XA 4IGMA 1KQYA 2HISA 3NQ6A 1Z32X 4YN5A 1D7FA 4Y8FA 1H2JA 4CUCA 4MYXA 3LI1A 7ENLA 4KCVA 1J8VA 5BRBA 4PUEA 2VCCA 2OEJA 5HNNA 2YDAA 3CIXA 2FVLA 1RR2A 3PVFA 3USZA 2ZX5A 1DJYA 4KQNA 2INFA 1R3RA 4PMNA 5CXPA 4XBJA 4W84A 2XH4A 4JZ5A 1E0XA 5AYYA 3BLKA 1QNVA 3E12A 2PWGA 5A6TC 1K9EA 1OB0A 2XZ7A 4AVNA 4FXFA 4QNWA 5GNZA 5AVNA 2WKLA 3REQB 1VBJA 2PURA 4WY0A 4UIOA 3PZQA 1L9WA 1KV8A 1WDWA 1XG3A 4H8HA 1GKQA 4Z17A 4NU7A 2FHBA 1JYWA 4TVDA 1HJWA 1GJUA 1HG3A 1EHAA 1E3ZA 3DFQA 2QUTA 2C1HA 2I17A 3M0KA 5IHSA 2YOCA 3MJYA 2OEMA 1K8XA 4XZIA 3MZNA 3FOKA 3N73A 2V5KA 2Y8UA 2PWVA 1B2YA 3T55A 2BMBA 4URIA 1YTKA 2BOGX 4GIAA 4RNHA 1UJQA 2VRKA 3WIJA 1LL4A 3MZ2A 3MSDA 1H7NA 3LRKA 1ZBVA 3NNTA 3PS7A 3AS0A 1QNPA 3VD9A 1P0NA 4HA1A 1BGAA 3C2RA 4X0VA 2QJIA 2EPHA 1US0A 4MAVA 3VCNA 1I2OA 3TYBA 3CEPA 1A5CA 4F2TA 4YTSA 3PANA 2QV5A 3CLWA 3R0UA 4E8CA 4GWEA 1FKXA 2D0GA 3GU1A 2PDNA 3WLSA 3O8AA 3GH4A 1TZ7A 1V3LA 4EPBC 1MEHA 3G1HA 4M82A 3QZ6A 5K9CA 3QYQA 3CYVA 3M0YA 2Z6JA 1EDQA 4C5ZA 1UD3A 4HK6A 2E0PA 4IL2A 1ISWA 1OFDA 4L7ZA 2FJUB 4ROQA 1ZHAA 4AVOA 2V5DA 1WUEA 4B5WA 1VFSA 3BAYA 1P0EA 3PTKA 2CW6A 1E73M 4K1WA 2G97A 1UB3A 5F1UA 1OCBA 2NV1A 4B3LA 3AC0A 4A3QA 4JGDA 1V3HA 1S2VA 4GBUA 2G95A 1MW2A 2E8YA 1DWJM 4BFAA 1ZPTA 4MJ4A 1V0NA 3SN4A 1O95A 2JF6A 2XH0A 4HZ7A 2PDYA 3WK0A 3CPGA 1D3HA 1M3UA 3GC4A 1XH1A 2ESCA 3GG0A 3ATYA 1U5JA 1FHLA 4JOMA 5TIMA 1M6JA 4ZVJA 1P43A 2YBUA 5TQLA 4EX4A 4RUBA 1AZ2A 1E6XM 3W6LA 3AHVA 1IZCA 4GK8A 3BC9A 3TR2A 8XIMA 5ABFA 1BF2A 5LNSA 3CV2A 1NWUA 4S2CA 4JN8A 4PUKA 4U5IA 3BXWA 3VM7A 1QFEA 4XTIA 4AY1A 3PWGA 4HMCA 3HJEA 4QJ3B 2EO7A 3UG5A 1HO1A 1AUSL 3TNBA 1WCGA 1P0BA 3KLKA 1H1ZA 3U7VA 2ZUVA 3V4BA 1XWYA 1RBAA 3NQEA 3GIPA 2PE4A 3N18A 2VVSA 3N9KA 4OHQA 2WVVB 3LCWA 5AC7A 3BDKA 1EZ2A 3H4GA 1DTNA 4NNCA 1UWUA 5E6ZA 4CCCA 1KRBC 3B8WA 2W67A 1I6NA 2O55A 3WNOA 1A5MC 3NQ7A 3SO7A 3AQUA 2V63A 2CZFA 5G5IA 1P5BA 2PLJA 1UR2A 2WSPA 1QOPA 5SWUA 5HPOA 4UFKA 4QAIA 3S42A 3OLDA 3TYUA 4OVXA 1I60A 4H1ZA 1F6KA 1GQKA 2PCEA 1PKNA 4EE9A 1YPIA 4HNNA 5D4YA 1ZB5A 3PTMA 3WUEA 4P7QA 4XD4A 1NDYA 3L5AA 1KTBA 4NI3A 2Y8KA 1XLEA 4JIRA 3RDKA 4PSRA 4JFWA 3NEVA 2W5FA 4C6OA 3KVJA 5I09A 3W28A 2VUNA 1EBHA 4L64A 1HTIA 1XYCA 1K7EA 4IQJA 3ICJA 2YL5A 4GO9A 4K68A 2Y70A 3Q45A 3WH6A 4BI7A 5F4WA 5DO8A 2RUSA 4C7FA 3GHTA 4AC7C 2EPNA 3QEZA 4UB9A 2YLAA 2D0HA 4AY7A 4ES4A 1KRMA 3DHUA 2OJPA 4LEQA 4D6JA 3UYIA 5IHRA 2QUUA 3M47A 3MV01 3UR5A 4PC8A 2GJNA 2C79A 4LU0A 3LNMA 2X41A 1V6UA 3N4EA 4G9PA 1CGXA 4A8LA 4JTRA 4K2SA 4KCTA 4XQ6A 2V3EA 4LAMA 1H0IA 1GORA 2XM1A 1XIEA 1MUCA 3DESA 3UG8A 3ABZA 4N4QA 4GIYA 1J2BA 4AC1X 2WMIA 1TQXA 2DP3A 1LL7A 4IUGA 1NJJA 1F8IA 5JBDA 4A2SA 1QI4A 2Y2WA 3CMFA 3RLGA 3F4WA 4U5KA 2VT0A 1NH6A 1ZSXA 4C6JA 4QEEA 3CMJA 2W9MA 1PTDA 1JCLA 3V35A 4QS5A 5CSSA 1S1RA 4R33A 4P7NA 4WZHA 3A5VA 1SZFA 4HSNA 2ZRXA 1K70A 1KCXA 4WRHA 2J7HA 2WBKA 1FCUA 3KVMA 1CDGA 3G5EA 4HB7A 3H7RA 2QCDB 3HM7A 1AMYA 2NUWA 4DEFA 4GIRA 1E51A 3MT1A 1XDMA 4PTNA 4O1BA 3WO8A 4JQ2A 4QQUA 1XLHA 4HN8A 2CITA 4Y9AA 3TAKA 1NP2A 4N7QA 1E5NA 1O94A 2PDUA 4UMAA 2PGRA 5IXEA 4NHVA 4E3TA 2NLYA 2UWFA 3P8JA 4BCEA 4CNUA 1VFUA 2DDXA 4MNJA 3O3RA 3CNYA 4PRRA 1FVPA 2BWGA 3GXTA 2YL6A 3LGDA 3FA3A 3BAKA 1K8YA 1CCWB 1PSCA 3SGGA 3UCDA 3W70A 1OJXA 3KWSA 2A0NA 1G4EA 4B5VA 3WJZA 3FK4A 1FWBC 2V38A 4NJGA 1OFPA 4KIEA 1A47A 1O4UA 2XIBA 1FWNA 1KQZA 1SW0A 3NURA 1TIWA 3PULA 5HMEA 4CEUC 2PWUA 1EJRC 4D8AA 5C9RA 3IRSA 3W2KA 2YR1A 4MTVA 2W3ZA 1S3TC 3LHUA 2FQIA 2JGYA 3D0CA 1TB3A 4A35A 2HDJA 1V3IA 2GGEA 1PPIA 1YRRA 3BLEA 3WD2A 2Z2UA 1WBHA 4FAMA 1UIPA 5FJJA 4OE7A 5FACA 5BMWA 1SQ7A 2EPLX 1JG9A 1CECA 3REQA 3AHTA 3UETA 4ML9A 1LBFA 3WDJA 2V5LA 1PBGA 1ITCA 3LDVA 1W9XA 2UY5A 1UWRA 1M7OA 4LV4A 1FWSA 3UEQA 1OGSA 1UD5A 1GG0A 2HE8A 1GZJA 1PL9A 2PU1A 1S5WA 3K30A 3UZYA 5J5RA 3QH2A 1O12A 4GZEA 1EB3A 3OIXA 4GNVA 1R47A 1EO7A 2GQAA 2VD8A 5CLTA 2TPSA 3CWNA 4HIBA 2GGHA 1F8MA 1F9CA 2NVDA 2OYKA 4X0NA 3SJ3A 3AZSA 1BVNP 3NGFA 1V93A 3EA3A 3QSRA 4RV3A 4DJEC 2YYUA 3A9IA 3WBEA 1HJXA 2D22A 3EOOA 3CU2A 2FVKA 2PB1A 3G8EA 2W4XA 3H4XA 1Q6CA 3VGHA 3TZNA 3WH8A 3BLOA 3IIZA 2JBMA 2NXHA 4OECA 3BK0A 2G4FA 3RLVA 2E68A 5I06A 3PG9A 2Y8VA 3EEGA 2L5HA 5EPDA 2O9PA 2WMHA 4MNKA 3HN3A 3W6YA 2B4GA 4Q4PA 2C0HA 2PBOA 1TPEA 1O5QA 5BROA 3CMGA 3QPZA 3TMLA 1XV8A 5HANA 1RJPA 2EJ1A 1XISA 5HMFA 1RUSA 3KEHA 2O0TA 4QX4A 4KS0A 3GHRA 2E8ZA 4Q8OA 4PEEA 5E9AA 2IS7A 2F61A 1ZU8A 4V1XA 4W8AA 3CJPA 4AD3A 1VIWA 5BXTA 3AI0A 2VDHA 4DPQA 2VVNA 4DB7A 1SZGA 1GOQA 2CZ5A 1QW7A 4KPLA 1US3A 5HQEA 1GVSA 2VX7A 3O6AA 2VGGA 4HU8A 3EXTA 4M5PA 1A80A 1ZCOA 5HK4A 3DYMA 1M41A 1BYBA 6XIAA 1EPVA 3MSRA 3VGDA 3W37A 3PBYA 1DYSA 4IIEA 4DJDD 3FJNA 4QXIA 1OZQA 5F2GA 2UZ9A 5CC5A 1TJ2A 2XFRA 5D9NA 1LDCA 4GINA 3P2VA 3VDBA 3QRHA 4DX3A 3AS3A 1PHWA 3LCGA 5ABGA 3WMCA 1I2PA 1JEZA 4H8NA 1P4CA 1RY8A 1MXSA 1DWIM 4Y90A 1RALA 2Z1WA 1HXJA 2H3DA 4ZGYA 1XBVA 4LYPA 1XF0A 3KLLA 1RBLA 5LIKX 3UWVA 3FVMA 3THAA 3ARYA 4CQBA 5I0DA 2EHHA 4R3UA 3MUAA 1QI0A 1X97A 5B80A 1A4LA 1KFJA 5CC7A 1DJZA 2YCEA 5CSYA 5EU9A 3CZEA 4ICNA 3DEQA 2DZXA 3P62A 1IIGA 4M1RA 4IPJA 3W1QA 1RQHA 2O9TA 3VINA 2J4GA 5E70A 5FF7A 4RL3A 4QDWA 2WSYA 5D8WA 4AYGA 4XD3A 3K8KA 3OBKA 5I03A 3RPTA 5HWNA 3FGCA 3HQOA 1I75A 2GWGA 1O1HA 3KRSA 3TW9A 3LRLA 4W7UA 4RE3A 3W24A 3B03A 1TTIA 4PB5A 4B3KA 3W7QA 4H3DA 3V18A 5AC6A 5D2WA 2QCCA 1H09A 1WOAA 2ZUWA 1L6YA 3N6QA 4M80A 5D9PA 3DFOA 1SW3A 3R79A 3N4FA 2VI0A 1PKMA 4S3EA 5IFPA 1F6YA 4R7WA 1S2CA 3BMWA 2NV9A 1PE1A 3W29A 3RJYA 7CGTA 1YX1A 1ZJHA 3W27A 4FX6M 3BGGA 4QAWA 1G0CA 2PI6A 3NO1A 1SO4A 3MKKA 2XFYA 2Z28A 1XUUA 3FFSA 4DXKA 1XLIA 4WEVX 1AL7A 2DIEA 1EP3A 1B4KA 4MHBA 4AZIA 1IR2A 5KMYA 2AL1A 3M0IA 1UR9A 5D32A 4E0CA 4IPLA 3EXRA 2TMDA 5DEZA 3F5KA 2Z24A 1KBBA 3GE7A 4TR9A 1BLIA 3AU6A 1PIGA 2E67A 2GGIA 1AD1A 3C2FA 3AIBA 5G1TA 3SRKA 1BSLA 2QGYA 3T4WA 3G1VA 2WVTA 1FH9A 4UZUA 3RAOA 1Y5VA 4H8VA 1C9WA 3AO0A 4KT2A 1R3QA 1A53A 4O4VA 4LS1A 3G1AA 4Q8UA 3TN6A 1Y65A 5E0FA 4IOTA 4ERAA 2V2DA 3NQFA 4PMXA 4L1XA 3PAJA 1XDLA 1T8XA 4CKQA 3NQ2A 4XAFA 2FH8A 3AIRA 4WLCA 2AMGA 1Z48A 3HFYA 1KRCC 3VOIA 3W00A 3SY1A 2HS6A 3AALA 1JNEA 1Q6GA 3BICA 1L6SA 4FS9A 5AHNA 2CLOA 3SRFA 1GQNA 3QPEA 2DZWA 3M43A 3D5HA 1Q65A 1RV8A 1U1UA 1ZP4A 3WFZA 2ZXQA 3TTQA 3W88A 3O9NA 1QHPA 4AG0A 1DE5A 5FCZA 3ZOAA 2CBIA 3T9PA 3KDOA 2NX3A 2HVMA 3ARXA 1F3EA 2EJAA 4O8AA 4ZOBA 2H90A 1F07A 1DKWA 4A4AA 3TW6A 4JTSA 4L6DA 3M7WA 3MMUA 4ECLA 3TLLA 1AQFA 1T41A 3TSDA 1N82A 4CU8A 1KNWA 4WR3A 1PS9A 2XSXA 1E6RA 1CXIA 2RJGA 1C93A 4PTMA 3DHDA 2R14A 5EBUA 4F0KA 1J0YA 2BOFX 4C6QA 2VC9A 3BLPX 3HMJG 4UUIA 2QPXA 3W7MA 2GJPA 4K36A 4O54A 3ANYA 4B5NA 3VM5A 3TWAA 5FEWA 1YDOA 4M1BA 2IW0A 1JZ8A 3VA8A 1ZNNA 4ATDA 3O16A 7PTDA 2J13A 4JN7A 3WNLA 3JRKA 4Q4KA 3L9CA 1S39A 2C3ZA 4AZ6A 1SVDA 1LUCB 2WW5A 4KGJA 4U3CA 2V5CA 4D6FA 1LG1A 1AJ0A 4GYKA 4KBXA 4MLRA 2NQZA 1QNQA 4FIQA 4I9MA 2KZHA 1CGWA 1OQFA 5FKYA 5IDZA 1TWIA 4ZA0A 3E0WA 2FMNA 3UU0A 3TFXA 5D33A 3W4RA 4U10A 4DXXA 4JNMA 1DPMA 3LI0A 3WBAA 2QJNA 1JPKA 4DZHA 2PZNA 1XRSA 4KWVA 2P5NA 3HURA 3WD0A 4WKHA 3CHVA 1KXHA 4GI4A 1AODA 3WN6A 1BRLB 2A1YA 4IX2A 1TYGA 3M5VA 3HQPA 3EPMA 2VFEA 4UFMA 5BOEA 3L2IA 5I3HA 1F7BA 2IQ0A 5AECA 4RNJA 4I3GA 1KKRA 4Z2HA 3E02A 3BG9A 5I02A 3WH5A 4IFRA 1KM0A 2EG6A 4DM1A 3QTGA 3UYCA 2DV0A 4LRSA 1TV5A 4IX0A 4IISA 1C7SA 3BSHA 1BSIA 2ZWYA 4Z2KA 4S3AA 3RYSA 1WZAA 2QUVA 5G4HC 7ODCA 5D2YA 1VPYA 4NSBA 2CZEA 3KRUA 5HBFA 2QZRA 1LQ2A 2G41A 3H70A 4CD8A 3KCOA 5AC8A 1NOFA 3CV7A 3IWPA 1FWCC 1Q13A 1KM4A 3B05A 3TU9A 2ADAA 1H7XA 4FX8A 1ADSA 3L5LA 4GH3A 3CQ0A 1J10A 3QR0A 3RM9A 1V3KA 3PAOA 5M17A 4ONVA 2OQLA 4K38A 4F0RA 2BSLA 3V16A 1JRBA 1XSIA 1Z89A 2BY2A 1HQTA 4DBEA 3E38A 1FWRA 2CLEA 3NL2A 1SSDA 2YCIX 3EMCA 3GG8A 3TYEA 4HTYA 2VFFA 1ME9A 2TODA 4YNGA 2VM8A 4PUJA 1DOSA 4US5A 4D8ZA 1G94A 3ZVHA 3UPMA 3TZFA 4EVZA 4KIRA 3WLHA 3ATZA 2ANUA 2X2GA 5I5RA 1Q7MA 3ZWSA 3R10A 1S2UA 4QG6A 3SGUA 4K6AA 3MU7A 2PPGA 1RAKA 2R1NA 2G37A 1KGWA 1W91A 4M29A 4QSFA 2DQXA 2X40A 5EMKA