3CV7A

Crystal structure of porcine aldehyde reductase ternary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
325
structure length
322
Chain Sequence
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDVPRDAGHPLYPFNDPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
publication title Structure of aldehyde reductase in ternary complex with coenzyme and the potent 20alpha-hydroxysteroid dehydrogenase inhibitor 3,5-dichlorosalicylic acid: Implications for inhibitor binding and selectivity
pubmed doi rcsb
total genus 102
structure length 322
sequence length 325
ec nomenclature ec 1.1.1.19: Glucuronate reductase.
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3cv7A00
4NKCA 2PDIA 1S1RA 1T40A 3R8GA 4XZMX 1K8CA 3BUVA 5JH2A 1FRBA 2PDGA 3WBYA 2F2KA 1MZRA 5LIXX 5JH1A 2IPWA 4WDXA 3UZZA 2R24A 1UR3M 3GHTA 3N6QA 3CV7A 2IKHA 2WZMA 3LNMA 1T41A 4ICCX 3FJNA 2FVLA 2HE8A 4IJCA 2DV0A 4DBUA 1X98A 1ZQ5A 3O0KA 5LIWX 3MB9A 2FZBA 2PDQA 4PUWA 1EL3A 1PWMA 3GUGA 3GHRA 3BV7A 1AH4A 4H7CA 2IQ0A 2IPGA 1Z9AA 5HNUA 1Z8AA 4LBRA 4IJRA 3LN3A 4JTAA 2PDNA 4DBWA 2FZ8A 2ACRA 1MI3A 4YS1A 3Q65A 2ACQA 1IEIA 1RY0A 3O3RA 3M4HA 5AZ0A 1US0A 3LQGA 2PZNA 4XZHA 3C3UA 3LZ3A 4L1WA 1QRQA 2NVDA 4GA8A 4XAPA 1X97A 2HE5A 2IKJA 4EXAA 4HMNA 4IGSA 4DZ5A 4AUBA 3V36A 1S2AA 4QBXA 4XVDA 2BP1A 2FZ9A 2PDKA 4LAUA 4YU1A 2PDJA 3U2CA 4Q3MA 1ZGDA 4WEVX 2P5NA 2PD9A 3M0IA 4LBSA 2PDPA 1AFSA 4F40A 2PDYA 2PDXA 1VP5A 3T42A 5LIUX 2IKIA 4WRHA 2IPJA 3V0TA 3GHUA 3ONCA 1ZUAX 3BURA 3LENA 4LB4A 2PEVA 1QWKA 3Q67A 2HV5A 1J96A 4HBKA 2PDBA 3ONBA 4RPQA 4XK2A 1JEZA 1YNPA 4DBSA 2R9RA 2IQDA 1VBJA 3UG8A 3G5EA 1M9HA 2I16A 2HVNA 4XZLX 2WZTA 2PDWA 4PRTA 4WDWA 4JTCA 4PMJA 4FALA 1XGDA 3DOPA 4PR4A 1LWIA 4EXBA 2HDJA 3UWEA 5LIKX 4JIRA 4PRRA 4GQ0A 4YVPA 1PYFA 1RY8A 3V0SA 3VXGA 4GACA 3UYIA 4XO6A 4WDTA 4I5XA 1SM9A 1X96A 1ADSA 3CAQA 2DUXA 4GCAA 2CLPA 4JIHA 1Z3NA 3EB3A 5HA7A 3CASA 3CAVA 3LZ5A 2F38A 1XF0A 2PF8A 1LQAA 2AGTA 3WCZA 1YNQA 2C91A 2QXWA 5LIYX 3BCJA 3EAUA 4PUUA 3RX3A 1Q5MA 1Q13A 3WG6A 3UZWA 1S2CA 1PZ1A 3GHSA 1C9WA 2PDHA 1AZ1A 4H8NA 1AH3A 3F7JA 2I17A 2ALRA 4R9OA 4WGHA 3WBWA 3M64A 1EXBA 4JTQA 4FAMA 4GQGA 4GIEA 4JTRA 4ASTA 2J8TA 1GVEA 4JIIX 3UFYA 4WDUA 2HVOA 1OG6A 1EF3A 2IS7A 1AH0A 2PDCA 3FX4A 3LBOA 5DANA 3CV6A 1XJBA 3B3DA 3R94A 1HQTA 2ISFA 1IHIA 1Z89A 3RX2A 1HW6A 3H4GA 4YVVA 2INEA 2PDUA 4Q7BA 1AZ2A 3WBXA 3MC5A 3QKZA 3H7RA 4ZFCA 2FGBA 4LB3A 4LAZA 4OTKA 3UZXA 3KRBA 2PD5A 3V0UA 3R7MA 3ERPA 4JTDA 4MHBA 3S3GA 4XO7A 3NTYA 3D3FA 1MRQA 4XVEA 5HNTA 3R8HA 4QR6A 2FZDA 5AZ1A 4FA3A 4QXIA 2INZA 2BGSA 3G1RA 5KETA 4XZNX 3R43A 2VDGA 4L1XA 3COTA 5M2FX 4JQ4A 4JQAA 1RALA 4JQ2A 1ZSXA 2A79A 3EB4A 2ACSA 2IKGA 2PDFA 1YE6A 2PDLA 4YVXA 3R6IA 2ACUA 3RX4A 3P2VA 3UZYA 3LD5A 3LUTA 4XZIA 3H7UA 1A80A 4JQ1A 4G5DA 3LQLA 1PZ0A 1S1PA 2DUZA 2PFHA 3DN5A 3UGRA 3V35A 2BGQA 5C7HA 4FZIA 3UP8A 1YE4A 4JQ3A 1PWLA 1R38A 3N2TA 2NVCA 2PDMA 3CMFA 4GABA 3LEPA 2HEJA 1EKOA 4QX4A 2IPFA 3R58A
chains in the Genus database with same CATH superfamily
3I6RA 4RDVA 2J7FA 3C2OA 3U3HA 5AC5A 3UWWA 1VBHA 4D6FA 1V6VA 2R91A 4F2TA 2F2KA 3SM0A 5GJPA 3MUCA 2QCCA 3T8LA 2VNCA 1D8WA 1TQXA 1BTMA 4LC8A 2V3DA 1OVDA 2DIKA 5C70A 1ZS2A 2R24A 3M0JA 3FGCB 4UTIA 3P81A 1VBGA 4L61A 4QDMA 2HRWA 4GGHA 1U30A 4UC5A 4X3ZA 4O52A 2HE8A 5IDZA 2P1FA 4L6DA 1EX5A 1Q7ZA 4QNEA 3RM9A 1R9YA 2BZNA 3MB9A 1SO4A 4Y8EA 2CIPA 3RDKA 1SW7A 4PSPA 3CQKA 2XGIA 3KVJA 1R3QA 1YEYA 2Q71A 1FWAC 2GGJA 2DP3A 4GJIA 2FTPA 2FHBA 3UPWA 3RF9A 1HJXA 2O7SA 4FLRA 4HHLA 3TQKA 4Q4KA 1YTKA 4U10A 3QKEA 3HTWA 1D3HA 2VEPA 2ACQA 4TVCA 2UY4A 3LHVA 3QH2A 1HO4A 2YXOA 3VAVA 2VEIA 4JOMA 3W6YA 1QOQA 2NVDA 3VGBA 3C2VA 3FY1A 4ZENA 3WF0A 3IJIA 4Q7IA 1XH2A 5A6JA 4K1GA 1E72M 2V5DA 1YTEA 1S2AA 2ABAA 3EEGA 3F4NA 3I4KA 4AW7A 2VWTA 1AW2A 1UP3A 4H9MA 4H7VA 3AHVA 2NUYA 1EZ2A 3W86A 1UR0A 3FAXA 1GW1A 3LM3A 3OZYA 1AJ2A 1Q6RA 1TSIA 4BK9A 4JDBA 4HP5A 4Z1AA 3BLPX 4Q4PA 4U4MA 4R7OA 2BASA 3WF2A 4ZQPA 1OFPA 5A5WA 2QULA 1A47A 2QUNA 3VC6A 4W8LA 3WO8A 2VR5A 2CZFA 3EWDA 3KWSA 1E70M 3AJXA 1JEZA 3SUTA 1IGSA 1KRCC 1SJBA 3FOKA 2R9RA 3WK2A 1KCZA 2W92A 2A4AA 2PAJA 3NZGA 1SFLA 4H4IA 1R85A 4PRTA 4IIBA 1PX4A 4BI7A 4JTFA 3IACA 3KTXA 2HDJA 2UZ9A 4XX6A 1YIXA 5C2XA 4A8RA 1VEMA 5L6UA 4JN8A 5K9CA 2WLZA 4YCOA 4DZIA 2YB4A 1X96A 5E1QA 1R2SA 1W56A 1BLIA 3TWBA 3WQWA 3VE9A 5CZTA 2OSYA 3CT2A 3PJUA 1LQAA 2QUUA 4GXMA 5CG7A 1VR6A 1WZLA 2QXWA 3POCA 4DF0A 1GCYA 4O54A 3CZ8A 5I03A 2PLCA 3N9SA 4K38A 4AIEA 1L9WA 3B9OA 4DN1A 1OT1A 3CO4A 4EE9A 5KZEA 4H19A 4HYWA 4WGHA 3WQCA 1XBYA 4LWWA 3N6JA 4WZHA 2XH7A 2NQLA 3L2MA 5LZLA 1ZLPA 2OX1A 1BD0A 5HDRA 2Y89A 2X16A 2YX0A 4LOCA 3VX1A 1GOKA 3BE7A 7ENLA 3KLKA 2Y6ZA 2C79A 3RYSA 3CO8A 1Y5WA 3TROA 3S6DA 3N2OA 1EF3A 2ZXDA 3C3NA 3O8AA 1JRBA 1W1ZA 1HGWA 4OBSA 2J6VA 3NJ3A 2W6RA 3VINA 2G96A 2CC0A 1OFRA 1KC7A 1QI5A 2RDWA 1AL8A 3I3BA 4AD5A 4H8HA 1QAPA 4AYSA 2J7BA 3UWVA 3WMBA 3ZMRA 2J62A 2ZADA 1NAL1 1KR0A 3TCEA 4IZGA 2CLKA 3PWAA 2OLAA 1Q4WA 3IRDA 3SCOA 3BMVA 1IT8A 1HP4A 5TD4A 3BOXA 2BBFA 3IVTA 4AC7C 3V0UA 5DELA 3W7MA 5HQEA 2ZRYA 4PUJA 1DKWA 4OWGA 4XUGA 4KWUA 3W74A 1R2RA 1H09A 2Z1BA 3AWOA 3I4EA 4Z0SA 4FIRA 1NWRA 4FO4A 1C3FA 5GPRA 4E4UA 4F2UA 4ZR8A 4CQDA 4GKTA 3PJXA 2XFYA 1C7TA 2DVTA 2E40A 2QJNA 3WLTA 1VRXA 2O9OA 4C1NB 1QR7A 3AXKA 3W87A 2QZRA 2WSYA 1O5QA 2OWXA 1JI2A 3EX3A 1IEXA 1JZ8A 5AHEA 1R3WA 5DEZA 4JICA 3CEPA 3N12A 3WEOA 3NPWA 1OHLA 1XYAA 4HJWA 3UXAA 1X1OA 3DYOA 3SW6A 4CQ8A 5MKGA 4Q8NA 2FLIA 4AVOA 1J5TA 4PTMA 3PJTA 4U5IA 4AY7A 4NNBA 3HB9A 1J0JA 3G22A 2ZA2A 2I5GA 4E8CA 1ODUA 1WV2A 1QBBA 1JCLA 3VE7A 3SUUA 4XG1A 4B2DA 3Q4DA 2VZSA 4GMEA 5FACA 5D33A 3CAWA 3VNYA 1P1XA 5B7YA 3E1F1 1EUNA 2WJEA 1KM1A 1PE1A 2G3MA 3FIGA 5DY3A 2GLKA 2OMAA 1UA3A 4MM1A 3PZVA 3T8QA 1QI4A 1V0NA 3WBYA 4H83A 4RNIA 1BYBA 1LWJA 3ZJ8A 1FXQA 4JEQA 3O7UA 4FNTA 3V7PA 1TVPA 2ZTKA 5CPNA 1GT8A 4A8NA 2I1OA 4QM1A 3LNMA 2V81A 3AS1A 4LCQA 1GG1A 3BCFA 1ME8A 3E12A 4ORIA 2RJHA 3FJ6A 1ZHAA 1S2UA 4IL2A 2Y62A 2F7FA 2G3FA 5KZ6A 3WLOA 4DY1A 4MNJA 4W89A 2ZVRA 3R0DA 5E93A 3KM8A 1UWIA 1JPMA 1X6NA 1UYQA 2OYLA 2GOKA 3VD4A 1DBTA 4Y9OA 4AMAA 1W2VA 3A23A 1MI3A 4LUIA 2XH4A 2W63A 3MP4A 3AAMA 3NQDA 5HR6A 1EJRC 3OBAA 3BW4A 5KSWA 4DJDA 3M07A 2PZNA 2ZUSA 3TFCA 5C2CA 1SQ7A 1X1ZA 3PB0A 3W9ZA 2Q3RA 2WK2A 2Y61A 1W0MA 2B7PA 4KEUA 4L6HA 3ARTA 4FOKA 5J8LA 4O1CA 2JBMA 3VMOA 1CX9A 2RFGA 4P5UA 2VFFA 2OODA 2A3AA 4UFKA 2YCIX 2D24A 3AFBA 3NZQA 4PUKA 3Q45A 1D3CA 1VH7A 4H41A 2DIEA 3VGFA 1L6GA 4JDYA 1FWBC 4OQVA 3DI0A 3PWGA 3CMJA 4HN8A 3T42A 1K7XA 2HSAA 3GHUA 3N4AA 5JVLA 1TVNA 4XAZA 2BODX 1N8IA 4OV4A 1IGWA 2GUUA 1KTCA 2NXGA 3QV9A 3IJ9A 5BU6A 5CGTA 5CBJA 4WXZA 1KM4A 4GLEA 3OHMB 2JF6A 1TIWA 1BHGA 3P3BA 4TVDA 2YB1A 4IIGA 5CZ0A 1W1YA 1C8QA 4CLMA 2D0FA 3UXIA 4WDWA 2DEPA 3W1AA 4WSJA 1E1EA 2Q6ZA 4O1AA 3VDAA 2J7GA 3G0SA 2WMIA 1DORA 3N11A 3LI1A 1KCKA 2Z4GA 5F1VA 4OOUA 2D0HA 3ZT6A 4Q8TA 3UT0A 4UR7A 1XG3A 3M5VA 3UJFA 2QCNA 3GNPA 5CAKA 2Z00A 4A2SA 5HA7A 1UJPA 5MKGB 3BG3A 3OGRA 2O92A 4XTDA 4PA8A 4E8DA 4JYEA 1YHTA 1OSEA 1H62A 3UCQA 1JCXA 3SQLA 3EDKA 5A95A 2C91A 4O4WA 2VCBA 2OEMA 3GB6A 2VFGA 2QUMA 4B5TA 3G6LA 3VYLA 1DIOA 5CC3A 2QCDB 4H9VA 4S3JA 4PUUA 1F4AA 1PPIA 1J4EA 3DFNA 3NEHA 3AXHA 3NM3A 1A5AA 2DT1A 1I8JA 2RHGA 3L65A 4CQBA 3M0LA 4JHMA 3VNLA 5D30A 2Z24A 4DBDA 3HU7A 2XIMA 3P5ZA 2I5IA 4F0RA 3VKKA 5A69A 2I14A 1WKFA 1HL2A 5KEZA 4PMQA 3BARA 5JIPA 3FW6A 4ZO9A 5LNVA 2QVNA 4W7VA 1PX8A 1E6NA 1DJXA 1EC9A 4IX0A 4MJZA 3NQVA 3OLGA 2CBIA 4JNYA 3K8MA 3M5ZA 4R85A 1Q45A 1EXPA 3DFHA 4JFSA 4DJDD 3ABOA 3CV1A 4IIDA 4XAYA 1O60A 3II1A 4K3ZA 3BJSA 3GRIA 3V5OA 2YOCA 4DM1A 2CITA 1ZAHA 2YDAA 3H7RA 5EBUA 3FXYA 1ISWA 1CGYA 5AY7A 4BHYA 4LUTA 4UXDA 2DUAA 4GI6A 4GINA 3VI2A 1NJJA 2ZIDA 1ME9A 3AMKA 4IIFA 4XZNX 5F4XA 1GHRA 2D2OA 3ZM8A 1VJSA 2JEPA 3L67A 4KWSA 3WNKA 4IT1A 5D09A 2ZA1A 4B3LA 3ALGA 3LPGA 4NUWA 2ZUNA 6XIMA 4WR3A 1RALA 3W76A 1I45A 5FSDC 2OVLA 2RKXA 3PBUA 4X2RA 3RHGA 4LT9A 1U5JA 3BGAA 3IS4A 4NZJA 1N8FA 2IXUA 4JCMA 2XPKA 2BOGX 3KOFA 1A80A 5FI8A 1R30A 3E0IA 5EMYA 3ID7A 4GY0A 3AIQA 1Q4NX 2ZXQA 4LVAA 2P8CA 4D8AA 1AQFA 5H2ZA 3DGRA 1NP2A 2QGYA 1UUMA 1XLHA 4LV4A 3CQ0A 2J4GA 3MA8A 3KZPA 1L6FA 5HQLA 4OUIA 3ITYA 5F4SA 3PZTA 3V16A 1R38A 3WF4A 4LAMA 1XPYA 3L2LA 4OVXA 4Z2JA 1XW8A 1EKOA 4KFNA 2BNJA 3UPBA 2GGGA 1UUOA 4O17A 3SCQA 4EAYA 3QPEA 2YDQA 3P93A 1HIZA 3A24A 2FZNA 1CWYA 2WMFA 2GGHA 2ZRWA 3WBEA 3WJWA 2D20A 3SDOA 4DYKA 1EEXA 1QHPA 3DESA 4KPLA 3EDDA 4NJIA 5MF5A 1F9CA 2VDHA 3EB2A 4N6FA 3TLLA 3VCRA 1LLWA 2X1TA 1X38A 2YA0A 2WMIB 3B8SA 3S1GA 1VCVA 4PZVA 4KCTA 4UNIA 1G4PA 4WDXA 4GNKB 1WAWA 2ZRXA 5CSUA 1Z6KA 3KP0A 3VUPA 1VF8A 1UR3M 3N6QA 1W5QA 4Y6GA 1CLVA 1EB3A 1TPUA 1NU5A 3U2OA 3RPDA 3GTFA 3RCMA 1MNSA 1FCVA 4XIMA 2I9EA 4QRNA 5BZAA 1TJ0A 1BYDA 1PO9A 1LRQA 4ZQNA 4TMBA 1PWMA 1V6YA 1F6PA 1RLDA 5D9NA 4LH8A 1AH4A 1H1NA 4WCJA 1QBAA 1Z9AA 3TA6A 3MHUA 3MSRA 2RDXA 3M7WA 4KRZA 2OG9A 4IMDA 1I0DA 1JQVA 2X42A 4HQVA 1VCGA 3UQNA 5M5DA 3IIXA 2HVMA 2NVAA 4GZEA 8XIAA 2XVNA 1U5VA 2CHRA 3BW3A 4A3HA 3HBLA 4JTHA 4Y8FA 3QLLA 1KFBA 1EPXA 3H4XA 4DZ5A 2VC5A 1F6KA 4Y2WA 4P7RA 5DFAA 3SI9A 3CIWA 3F5KA 1ZFJA 2XUCA 3RLGA 3RO6A 2DZUA 1WNOA 1ZGDA 4JAWA 1DTNA 2I9UA 3N14A 2VJXA 2ZUUA 3WF3A 3LK6A 2H3BA 1TJ1A 2V67A 1E6RA 2JGQA 1BF2A 1XGEA 3WUGA 2J24A 1K7EA 5LHFA 1DVJA 3THUA 4B91A 4HU4A 5C55A 1EC8A 2TMDA 1Z41A 4BQ4A 2PDYA 3R11A 3CPGA 1ITUA 1I2NA 3MVIA 3PTKA 3GG8A 3PVFA 5ABTA 2HNHA 4M1RA 4LY8A 3MU7A 2X30A 2VURA 1JNDA 2WMJA 4H9TA 3KL3A 4JZ5A 3ONBA 5I02A 4LUTB 2C1GA 3ARQA 2WHLA 3A3XA 5J5DA 3LERA 1PDYA 4IMCA 4DLFA 5DF0A 3FHAA 5CPTA 4LRTA 3W7JA 3LLFA 1VBJA 2J9YA 3KS6A 3SN0A 2HVNA 4IP5A 3GTHA 4B16A 5ABHA 2PRHA 3U7BA 1KBJA 1UKTA 4JIRA 4B15A 3E5PA 1MXSA 1ZL1A 4MWAE 4O50A 3LCXA 2VI0A 4O14A 3B03A 3ORWA 4WDTA 1TZ9A 3AMLA 4MF4A 2OKTA 5DXYA 4HCLA 3RPTA 3SUVA 4O19A 1SPQA 1ADSA 4UQCA 3MWAA 3TQ0A 4YTTA 3OW1A 2F6UA 3OG2A 3EB3A 1ZY9A 4CUCA 4XIAA 3CIVA 2IW0A 2GDQA 2PF8A 2A85A 2QV4A 3GKFA 2VC6A 1ICSA 4EPKA 1LBFA 5J04A 2J7EA 1UJQA 4Q8UA 3L9CA 1H51A 4E2BA 2BX7A 1Q13A 1FH7A 3GM8A 3VNKA 2EHHA 5HAOA 4PULA 3MV01 1W2PA 3M5XA 1VS1A 2ZE0A 2XZ7A 3ZSSA 1EXBA 3K4AA 4FAMA 1SZRA 3S2LA 3GG7A 3MZNA 3KOWA 2ZZ2A 4UUIA 1W1B1 3P61A 3LGDA 5FJPA 1YDYA 3ZJKA 4GYKA 3WEMA 4QCFA 2WQPA 1E71M 5LXEA 2WVTA 2YGYA 2HBVA 1GEHA 3SCNA 1NOWA 2EEXA 3NR0A 1TR9A 3WF1A 3QY6A 2PGWA 2OWCA 1Y5VA 1V7AA 2V6AA 2FDSA 1FP8A 1HFBA 1G1YA 4JTIA 4UZUA 3EPMA 4XBKA 1R46A 4G56A 1JAKA 1U1HA 4U5KA 4LCRA 5FA5A 1RUSA 3XISA 4RJEA 2YCLA 1W9PA 2PWHA 2VUNA 1JF6A 1WAUA 3URAA 4ORMA 4X0VA 4Z1DA 7TIMA 1YPXA 4M6PA 3DECA 1X6UA 4CU8A 3RXZA 4YIWA 4QS6A 2DH3A 2ZCGA 5XIMA 1I60A 4N4QA 4IMFA 2VC7A 1V93A 2P50A 5I00A 3QMTA 5DBTA 2FMOA 5M2FX 3WK3A 3OG3A 3W7NA 2ACSA 3VOHA 2A3BA 1YTDA 4N9CA 3B06A 3FA5A 3UXKA 2WC3A 1HVXA 5IFPA 3BZGA 1AJZA 4YVXA 7A3HA 1G9HA 4Z1CA 4YWIA 5D2TA 3SY1A 3W07A 4Y9PA 3V1HA 3HV9A 3WFAA 3S9IA 1S5TA 3N73A 2VC9A 4CQCA 4YJ5A 4UMBA 3OYXA 2QJJA 3GS6A 1L6WA 1S2TA 2PFHA 2X1UA 3HPZA 4IXXA 3TJLA 5D05A 5BOFA 1O5RA 1W3TA 2G4JA 4LQ1A 5T91A 1J0KA 3IJ6A 3TYBA 3HN3A 4BI6A 2ZZ7A 2G3JA 3GU1A 2QR6A 1FTXA 1ZALA 3TTSA 4BA0A 1Q2SA 2Z1KA 1BKHA 5E0FA 2Q8LA 2VZUA 2JGYA 3PC0A 1OCJA 1O68A 3SSZA 2WNNA 5D38A 1PCKA 3LMYA 4I90A 3I65A 1KM6A 3CQIA 2FIQA 3S1WA 3BUVA 1CXIA 5JH2A 2ABBA 3IGUA 3B8VA 2PDGA 4L4LA 3UR7A 4A6GA 5LIXX 3UJRA 1H63A 4GUJA 4LYQA 2E8ZA 3O6CA 3MZ2A 3CZKA 1PKLA 3S2CA 3SUWA 2EPKX 3UR2A 3SFKA 5BW6A 5CJMA 3C2YA 1VPQA 1MMFA 3CZLA 4LY4A 4ZOEA 1P0BA 5ECVA 1GVYA 4Q22A 3PZNA 5D2VA 1LOQA 1XCWA 4FLQA 5LNUA 4OKDA 2QYGA 4GXWA 4RE3A 4WY0A 3CHEA 4XBJA 3MCMA 5BYWA 5FF2A 3QEZA 4RNHA 1H7XA 4DUVA 3URNA 3MANA 1XLMA 3GR4A 1SFJA 1WYIA 4IPIA 2V0TA 2ACRA 3EMQA 4HNVA 1RY0A 1TWIA 2YBVA 1HJVA 4C90A 3M4HA 3KEHA 3HQNA 3UYCA 1SVDA 3LQGA 3FA3A 1AK5A 3OLDA 4KCWA 3N3TA 4PB4A 2Z7KA 1NP0A 2GK1A 3GIYA 3H54A 2OJPA 3DYPA 4N0RA 1CB2A 1OM0A 3S6TA 3UZ5A 4XVDA 3DFSA 4ZQCA 4O10A 1JUEA 3P14A 1K9EA 2PDKA 2PDJA 4RKAA 2FPVA 1B3VA 1FWGC 3BC9A 5JBEA 4F0HA 1VJIA 3WYZA 3ANUA 4MADA 3ZJ7A 4LRSA 3UU0A 3TVAA 5C9XA 2W3ZA 2YL6A 3BLIA 3C0LA 2PDXA 4FMVA 3N6HA 1ZCOA 5HK4A 3OODA 2VZOA 5BU9A 5REQB 4LB4A 4E3VA 4D6HA 3GTNA 1J2WA 4Y9AA 2CKRA 3ICJA 1R87A 5J5RA 2VGFA 3MDWA 3KLLA 2G5WA 5G2HA 3V4BA 1XR2A 2TPSA 4QG9A 4AD4A 1A5LC 1SO3A 2PDBA 1YXYA 3G6MA 4MG4A 4XZBA 3F5LA 2CWXA 5EFFA 4YPJA 3UWUA 1HVQA 1EJWC 1S5MA 3DERA 3FN9A 1Y7VA 3PTDA 1HN1A 1UBSA 2JF7A 2PDWA 3GTIA 4TXEA 3UWQA 5BWAA 3TOPA 4GC4A 4PMJA 4PH6A 4R88A 2J9ZA 3HG4A 4KESA 4V28A 4NZCA 3T0DA 3NYZA 4S3DA 1ZAJA 4PN2A 5I77A 3Q94A 3W2JA 3A4JA 1M7XA 3C0SA 1K4HA 1RPXA 4JN6A 4GACA 1JDFA 2VRQA 3AIRA 4S3KA 4LVGA 3TYAA 3BMXA 1R8LA 2MNRA 1A0EA 3G1VA 2VENA 1H61A 2BVWA 2KZHA 2C14A 1R5YA 3CASA 3OU8A 3CAVA 1QPQA 3AHZA 1N8WA 4GVIA 1UD2A 3A4XA 1CGTA 2W67A 3QHNA 4BEQA 4LUSA 2ZRZA 5HMSA 3FDGA 1THFD 1KFKA 1CGXA 4G7EA 4IUOA 1O5KA 2PF0A 1WXYA 2Y1HA 3DZ1A 3LPOA 2E9BA 4PBGA 3AHXA 3M64A 1FWHC 4IXHA 2PA6A 2Z2BA 2GJPA 5EL1A 3TYDA 4AZ7A 3NZ1A 1EA9C 2CCRA 1NDYA 4HPNA 3TA9A 4RZ5A 4UTJA 3EWBX 3CQJA 3QW3A 4IGHA 2EJ1A 4WDUA 2HVOA 3LB0A 1TPDA 4DBEA 2YCJA 4X2PA 3SCTA 3BAXA 1UC4A 1XIJA 4J28A 2DVUA 8A3HA 4D9PA 4A29A 1PHWA 3WJXA 1UWRA 2Z29A 3EA3A 3VM5A 1RSCA 4DI8A 1HQTA 1ML1A 1H60A 3WX7A 3C8FA 2WCAA 1XSIA 3OYZA 2VR2A 4PL1A 5HNNA 1A3WA 1RVKA 3PZGA 3A9IA 3IUIA 1VFFA 3FKKA 4GYPC 1ZBCA 1K6WA 4Q7BA 1AZ2A 3NQ6A 4WY0B 4OBTA 5G4HC 1V6UA 4GG9A 4RNFA 5LA0A 4OFCA 4V33A 4ZB0A 3WFZA 1C91A 5A6BA 3H21A 3W7QA 4I7VA 4O0QA 4CNOA 1ITCA 2OQHA 5ABFA 4XO7A 3DBNA 4DXXA 3QZAA 5HMEA 1LWHA 4MNKA 3UJ2A 3LSBA 4QR6A 5GNYA 1X8FA 1XLIA 1UB3A 1XISA 2Q8XA 5AYBA 3R43A 7PTDA 2DZAA 2GK1B 1U22A 2WHMA 4IFKA 2ZKMX 2ZXBA 2X0SA 1KA9F 2AKMA 3K46A 2J7DA 1JR1A 4ZXOA 2A6LA 1LF1A 4AMCA 2ZZ1A 1YDVA 4EACA 1EHAA 1E3ZA 3RCNA 1GQJA 1NM9A 1DQXA 3GX9A 3W1MA 2CETA 2DORA 3RU6A 1ALDA 3KRSA 3SGGA 2BGQA 2PC4A 3W7OA 4M5PA 5BXSA 1KWGA 3ZLGA 1NWTA 2CLLA 4WSKA 2Z1VA 3ARXA 5FEXA 2HK0A 3PAJA 5G2IA 3P67A 4ICMA 1QASA 3TZFA 4IISA 2J8FA 1EP3A 1JJKA 1RCXB 3E0VA 2WCGA 1PZ2A 4C5YA 3C0JA 1L8NA 2JKPA 4Y90A 4F0SA 3OOQA 3IIZA 1NOUA 1R6WA 4KEZA 4LF1A 3TAKA 2W61A 4MPQA 1E0WA 2VEFA 4HSHA 1DIEA 5CQ1A 3C61A 4N9EA 4JTLA 3ARVA 3BTNA 2QVHA 2C16A 1EWDA 1MW1A 3WFLA 4S3CA 1XLFA 2Z0IA 4H1ZA 4GYFA 1T0OA 2CBVA 2MANA 3TMQA 4O1EA 3G18A 1IZJA 3GW3A 5C6MA 1M53A 4DWSD 2OGYA 2YZRA 3GUGA 3QR1A 3GHRA 3GLCA 2OT0A 2UY3A 3GTXA 4EK7A 4LUSB 3L5AA 2MUCA 2GQAA 1PV8A 1W32A 2X7WA 2ZTJA 1GG0A 5EB8A 3GYEA 1HNYA 4G7EB 1QNOA 5CC6A 4CN6A 1K9DA 1E4LA 1KBLA 3EXSA 4LF2A 4NSBA 1JNEA 2QCHA 1HG3A 1TIMA 2PLKA 5AZ0A 2GZXA 4LXFA 1NF0A 5JQ9A 4IG2B 1H49A 1WZKA 3TW9A 1JVNA 2VFHA 2BSLA 2PTYA 1TV7A 3HGOA 4NF7A 4F0LA 4F0MA 3TU9A 3HO8A 4GNVA 4ZL1A 1XXXA 3S4TA 4QBXA 1EBHA 1K8ZA 4ZODA 3GE7A 2XIOA 1O6IA 2JIEA 3F5JA 3P74A 2BXYA 4Q3MA 1GOQA 4CU6A 3PBGA 2OSXA 4GHRA 3EMZA 4LAOA 2EJAA 3HPFA 4LFYA 2CLIA 1GJPA 1CECA 1VFTA 1XRTA 3PZQA 1ZNNA 2ZDSA 1GVRA 3BOFA 3W7PA 3LGGA 1I4NA 5HATA 3OLEA 2CLHA 2TYSA 1P0DA 1EFZA 4HVXA 4Q6JA 3LCIA 4WKAA 2VKZG 3PPCA 1IR1A 1P0NA 2BXVA 2FB2A 4HBKA 1RA0A 1XD1A 3AXMA 5CJNA 2VMFA 4M6VA 5ABFB 2P53A 4K8GA 1RJPA 1L2QA 2AMXA 4DBSA 5IFTA 1ISZA 3AOFA 5EFDA 3B0XA 3BLEA 1WPCA 2CEQA 2O56A 4C1KA 2YZ5A 3P80A 3BMWA 2AKZA 2X09A 3HZ3A 1FQ0A 4TU1A 4UCGA 2YIHA 1WDWA 2VHLA 3NQAA 4CD8A 1XGDA 3DOPA 2CXEA 2QUTA 2WV8A 1FVPA 1AVAA 3CPRA 1XLDA 1A5UA 1PYMA 3O6DA 2ZX7A 3ITGA 4YXGA 1Q6DA 3L4TA 3N25A 1M5WA 1R86A 4UTTC 5AECA 2E77A 4PTNA 4N2YA 1Q8AA 1D9EA 2XIQA 1W5NA 1Z3NA 3VCNA 3ZR4A 2DZSA 1X8CA 2Y5SA 1G5AA 4ZMGA 4NX5A 4IFRA 2WCSA 4H6RA 1JCJA 2F38A 1XF0A 4H9UA 1UQYA 2X1IA 3LI0A 3TE9A 1YNYA 3DFPA 4O11A 3S42A 1W1IE 2QMJA 4TTUA 1AQHA 1YLVA 4FLSA 1BGGA 1Q8JA 5A2CA 3UW6A 2PDHA 4L6OA 1V02E 4J7RA 4QJ3B 3WQDA 2I17A 1UW9A 5HPCA 2E8YA 1HGYA 5I24A 2V63A 3S0CA 4H9XA 4UZSA 1DJZA 2PC8A 1J0IA 1E4IA 5AHLA 5IBXC 2YA2A 4G6CA 1KM2A 1EC7A 4LEQA 3UETA 2OEJA 4GX9A 3UNTA 1MUCA 1NSJA 3A47A 3HG5A 1CYGA 3PZOA 3EDEA 1MVYA 3QFEA 1AH0A 5DRIA 3I7SA 1V3HA 3IGHX 3PZUA 1B3XA 4K39A 3BL3A 3GNXA 1GNXA 2F6XA 4P7LA 1W8GA 4UTKA 1TPWA 1TV5A 1TPVA 4JNMA 4F2BA 1FA2A 2DQWA 4KETA 3RR1A 3B3DA 2UY5A 3T55A 2R1KA 2CPUA 3IIOA 3WLQA 4NZ3A 1JZ3A 4UBPC 4PODA 3KL5A 3QKZA 3HIJA 1B4EA 3SECA 3WNLA 2XFWA 3XIMA 3TONA 3RK8A 3ERPA 3KBMA 2ASHA 3RU8X 2YFOA 3BLOA 4PYSA 2EKGA 2D0GA 5I3JA 1DIDA 1J12A 1P6WA 2NT0A 3PBVA 5A8PA 2INZA 3DU0A 4U3CA 2DSVA 2GDUA 3FYPA 4GIYA 4LANA 3L0KA 4AAJA 4QAIA 3M5YA 2WPGA 3CBWA 3CUIA 4PCNA 2I5QA 4CU7A 3WMLA 4DJEA 1FCUA 4P8VA 4JTTA 3TNOA 4CD4A 1RD6A 3DEQA 3N17A 3F4WA 1W1VA 3HMCA 2O9TA 4R7WA 3B97A 3ZVIA 3O06A 4IOTA 1CXEA 3APYA 3EGJA 5FOOA 3DHUA 3K5XA 3FYYA 2QUVA 4L56A 2ZC1A 2XTKA 1K6AA 1EJSC 3ALFA 3GR7A 1H7PA 4D6EA 1EJVC 1W9DM 4ZOCA 5F4WA 4GH1A 2GQ8A 1CB7B 1CGUA 4GQRA 4D6JA 1B31A 4CN4A 1MSSA 4JYDA 1G4TA 1UKPA 2DDXA 2BTMA 4LVFA 3N1AA 1XBVA 2NSOA 3W25A 4ATWA 3RMJA 1XRVA 8XIMA 2D69A 1RBAA 1DPMA 2OOGA 2PP1A 2XVLA 3IJDA 4AZBA 1SR0A 2TODA 3W7KA 2WJFA 2ADAA 4C6MA 4EIVA 5B7ZA 1YMYA 2WJZA 1K8CA 1IIGA 4Q8MA 4POCA 4YWSA 2EO7A 1MZRA 4RCXA 4PMOA 4HSOA 1EZWA 3VABA 2JFEX 3VUSA 1BTCA 1JL8A 1UZ4A 3DXIA 2ZA3A 3R79A 3WMCA 3WLPA 2Z2AA 3MJYA 4HYVA 2NV9A 1T41A 3VILA 4RV8A 2FVLA 1Z32X 3EWUA 2P0IA 4OU1A 3FVMA 1ZAIA 2HISA 3SRHA 3WEZA 1YW1A 1V8EA 2FZBA 4C6NA 3VIIA 3T4CA 1QJWA 2WBGA 4J3UA 3BO9A 1PTDA 1UHVA 2NQZA 1PXGA 1GJUA 2CZDA 4R27A 1EBGA 1JDCA 1LL7A 4OHQA 3WH5A 1R3RA 3G24A 5D8WA 1V03A 3VIFA 4E2OA 3BCDA 1B3OA 1UPMB 5C0QA 1XQKA 4GX8A 1IXQA 3SADA 4Z1YA 4AD2A 3SN4A 1JF5A 3QMRA 3WIJA 3M16A 2QCFA 4DX3A 1C8XA 3GDRA 3R0KA 1GOOA 1EGMA 4XD6A 4RZ4A 5ABGA 4V1XA 4UR8A 3CAKA 4D6GA 4WY0F 4I9MA 1PBGA 1B9BA 2JEQA 1JCYA 1UWUA 4O12A 4QITA 5G1MA 2X1RA 1FWSA 5K9XA 2BHYA 3AI0A 4OZOA 1LOLA 2WVVB 1DJYA 3E3HA 1V3LA 3MS8A 4DF2A 3B0UX 1XIGA 4FEZA 3IJ8A 1F3XA 1JD9A 3EBVA 3UD6A 1TPH1 2FVMA 4A3QA 3AUOA 2BVTA 1UWQA 5LHEA 4IHCA 1Q6GA 1VGAA 1NH6A 3AUJA 1VP5A 3C56A 2C71A 1A0CA 2IPJA 4I9AA 3ATZA 2R94A 3OA5A 1DQUA 2SFPA 3VNMA 2PEVA 2CWNA 2Y24A 1H3GA 3AIVA 4M1BA 3WQ4A 5K9DA 1RH9A 4Y9NA 1XH0A 2DZTA 4CCEA 3LRLA 4GYPA 1REQA 2HPIA 2OOFA 3BAJA 3M0YA 3ZT7A 4Z1BA 1PCWA 3T0BA 1UQZA 1U1UA 3PZMA 1J0YA 3GUWA 4JTCA 4BFAA 3WUBA 1LL4A 2P8BA 1KFJA 4W86A 2CHNA 4NXSA 3UCCA 1QATA 4ZBCA 3GZAA 2ON3A 3SIZA 4DLMA 3SBFA 5I23A 4NY2A 3MUY1 4K8HA 4ZO7A 3S2MA 1X6LA 1L2UA 2GSHA 3HJZA 1HKKA 4ROPA 4I8DA 3W1XA 4NZ5A 4IQDA 5HMDA 2Y70A 4M56A 3GXTA 4NJHA 1CGWA 1XDLA 4C6DA 4CKQA 1G4EA 3ZWSA 4HZ8A 3EDFA 1BQGA 1RQEA 2UV8G 1P6CA 4GIAA 3GFYA 3L4YA 1T6MA 1KFLA 2GSJA 4AIOA 3UESA 8TIMA 5EMJA 2QDEA 4CNTA 4KIRA 2VX6A 2EPHA 5HOSA 4I7WA 1QHZA 1H1ZA 1UOKA 4CEUC 3L5MA 1AA1B 4PFHA 1PIGA 4GY7A 3HPSA 3CZEA 2QIWA 3WL1A 4YLWA 1RK6A 1GKQA 3UY7A 4DO5A 2YXXA 3AHYA 2VGBA 2B7NA 4ERGA 3XINA 2E6DA 3R10A 3A6OA 3VZZA 5AB3A 1ADOA 1ZP3A 2PDCA 3BSHA 1M01A 2AL2A 4AZCA 4MMWA 3LBOA 3GXIA 3TJ4A 4PTVA 1P1MA 4Z42C 2GJNA 1IIHA 3WQFA 4ZGYA 4ML9A 2O55A 5HUPA 3TX9A 3RX2A 2OO6A 1DJHA 2PSNA 5CPMA 1F05A 2F84A 2J79A 1ZJAA 2A7RA 3S5ZA 3PUOA 4RR4A 5CC5A 1TJPA 1O5XA 4F0KA 4WKHA 4OTKA 3UZXA 2UBPC 1S39A 3T2PA 4XD3A 1E73M 1LROA 5D02A 1VHNA 1R7OA 3D6NA 1V02A 3RRAA 5BMXA 4OJYA 4HNLA 1HX0A 3KCLA 5AZ1A 5JU6A 3CH9A 1M68A 5LYRA 4GWEA 1KGUA 2FVKA 2VUYA 3VO0A 3DYMA 2W62A 3L4WA 4MJ2A 1U5HA 1XLKA 4HYRA 3V5CA 5TQLA 4HKPA 2D3LA 3C2FA 3OVRA 1Q7QA 3OGSA 4IPJA 2YSWA 4BS0A 2WZIA 1YE6A 3SY5A 4DAIA 3P8IA 3W28A 1KTBA 2XSAA 1QNQA 2RAGA 3E6EA 4UOQA 1Q63A 1CI1A 2BOEX 4WJ8A 2BG5A 3BGJA 5IXEA 2X05A 3VDBA 1QOPA 4BQ2A 4C7GA 3ZFHA 3DN5A 3UGRA 1GKRA 3VA8A 3V5FA 2C8NA 3AYSA 3R12A 3VK5A 4HCHA 4QDPA 3RLVA 4GRSA 3N34A 5BROA 2O7QA 2A7NA 3SQMA 1HO1A 4WJXA 4N42A 3WLRA 1F3WA 1KQZA 1PZ3A 4PMXA 1XBZA 3QR0A 4WUIA 1XKYA 2YL9A 4ZOBA 3O2LA 1Z48A 1GZJA 5DT7A 4DHGA 4PRWA 1UH3A 2V82A 4P8XA 1OFBA 1W3NA 5CPQA 4I9TA 3N4EA 4LX4A 1RP8A 1OZQA 1W3JA 2VXNA 2E4TA 5A6TC 3ITXA 1F07A 4Q4MA 2V5KA 1RZMA 1HJUA 3BW2A 5AYXA 3FYOA 3AZTA 1QW9A 1KLZA 3L5LA 3S6OA 3CV7A 1OD8A 4TMCA 3PSVA 2J8GA 2ZRUA 3K30A 1BG4A 4XBSA 4C1LA 5AHNA 3QPYA 2DV0A 5LIWX 3O0KA 4MUZA 1FH9A 1KCLA 2O4MA 3F4VA 4UTTA 3AO0A 3QC3A 1VHCA 2G50A 1A53A 3NDYA 2WPBA 1N7KA 3ITTA 2QKFA 1GVQA 4HOXA 1S2VA 6REQB 1GQIA 4GGBA 3W7LA 3KW3A 5XIAA 4P7QA 3BG9A 3GVGA 4K1WA 2QCEA 3AIEA 1OX6A 3LBCA 4L9ZA 1U83A 4DB7A 3NIYA 3ZLHA 3QW4B 4ACYA 4FS9A 4DUOA 4M6QA 4M7SA 3A3HA 4XZHA 2NWRA 1FWNA 1HKJA 1UD8A 2XN0A 3W82A 3IK4A 3N4FA 1MDLA 3PTQA 4DPPA 5K3VA 2POZA 4IGSA 2ZOXA 1E1CA 4OGZA 2PTZA 3URQA 4LSBA 1RA5A 3O0FA 3H2MA 4AYGA 4N7QA 3LHTA 1TTIA 4EPEC 3VMPA 4D1IA 3DDMA 5IBXA 1EEPA 3KX6A 3ATYA 4LAUA 3U7VA 1W5OA 3LG3A 2QDHA 3PZ9A 4JY9A 1LG2A 2AL2B 4AZCB 1X7FA 4D2JA 4YTSA 3PS7A 3LCWA 1I6NA 3LXCA 3QGVA 4EKJA 3V75A 1BF6A 2DSZA 1J79A 3W23A 2PU0A 3URBA 3GVWA 3M43A 1W9UA 4E6MA 3MI6A 1JXKA 1MNZA 2WSQA 3LENA 3AIBA 1ITXA 3H8AA 4R7JA 1TVLA 2O0TA 4X9YA 2VVSA 4MGGA 3WD2A 3KRUA 1XIFA 3AIUA 3BZJA 3PUDA 1B0IA 1N55A 1Y8BA 3PANA 2B81A 1NDVA 4X9SA 4GXPA 2IQDA 1WA3A 4JHZA 3G5EA 1BVZA 3C8NA 5KMYA 5FF7A 2OB3A 3EX6A 1U1JA 4JTJA 1KV8A 3ZVHA 3P60A 1OCBA 4D71A 3LRMA 2VZTA 2OEKA 4R9XA 5AYIA 2BXZA 2XFFA 1DIKA 1K8XA 2R8WA 4MJ4A 2AQVA 3N3MA 3QJAA 4Z2HA 5DQPA 5BRQA 1PYFA 3KVKA 1B3WA 1GOMA 4ADSA 4NI8A 4I5XA 3A5FA 2QJMA 1A50A 3SN1A 1RCOB 3ZXWA 1XM3A 2ATMA 1VLIA 1K1DA 3N18A 5F2GA 3H24A 3ZIZA 3TTOA 4MYXA 3G8RA 3FS2A 4GYJA 3VDCA 1ECEA 4HA0A 4NU7A 2BMBA 3RLHA 1K70A 4MSSA 3WQPA 4L80A 1O12A 3LM7A 4CNPA 2QHAA 2YL8A 3R13A 3WZ0E 1UIPA 1AZ1A 3WQOA 3RCYA 5EKYA 4JTQA 3W84A 1KTNA 4W5ZA 3TC3A 4J3XA 2Y7DA 1OY0A 4JTRA 5LSMA 2Y8UA 4ASTA 3P7YA 1PKNA 5D2WA 2RDUA 3HFTA 1G7UA 3STCA 3M1ZA 1XG4A 2WO5A 2R1PA 4UNKA 3ZR6A 5DANA 4I8YA 2VP8A 3EKLA 1JZ7A 4JTEA 4L65A 3L21A 1MWOA 5C9RA 4OOZA 2PU1A 1CPUA 4QQUA 4Q33A 1EHNA 2CZVA 5BXPA 3CUHA 4BWLC 5HQMA 4BQ5A 2OX4A 1IQ8A 2V69A 1KFEA 1OYBA 3G2GA 4HTBA 1GVSA 3QQ0A 3L0GA 1CLXA 2QF7A 1BYAA 1JIBA 1UWTA 4CCCA 1DWHM 5FD0A 1CGVA 4UFJA 3B04A 1S3HA 3GXDA 2Y7EA 4EXQA 3VM7A 4K2SA 3LU2A 2A6NA 4AZ6A 2EPMX 4FI4A 3SCUA 3COTA 1E1CB 2J27A 3NPVA 5JBFA 3STPA 4JQ4A 1E9ZB 2VFDA 3WH8A 1E40A 1SU5A 3BDKA 1FWFC 3NZPA 2Z1WA 3EB4A 4KRTA 3KWXA 4JGDA 3VU2A 5C9UA 4AEOA 1H1YA 1AD4A 3IV8A 1UZHA 3L68A 3U4FA 3CS2A 3UEQA 1B3ZA 4M29A 3T09A 3H7UA 2R1NA 4H6EA 7REQB 2YCKX 4EVZA 1PIIA 3ZR5A 3WLNA 4ZQOA 2DSKA 5A6AA 4GO9A 2OO0A 5FJIA 1TREA 4TX9A 4EX4A 4RL3A 1TFVA 2GVGA 4HPXA 3UZJA 2A0NA 4JX5A 1E55A 2XU2A 1A3XA 4MKSA 2HEJA 3ABXA 4UMAA 4HHHA 5KINA 3ARWA 5A8GA 4AB4A 3WDPP 2Q01A 4M51A 4M7TA 2C1IA 3PHAA 3E0LA 3BJTA 1LZOA 4V27A 4W4QA 2V68A 4ZQRA 4W85A 1S38A 1UP0A 1F76A 3ZVHB 2HPMA 4IMEA 3BXWA 4LS0A 2GVYA 3NVTA 1LBMA 3VCCA 4EWND 3UNDA 1GQLA 3MI3A 1M7PA 3VOJA 3QZ6A 4QE4A 2QGHA 4HZ7A 5KZMA 4KF1A 5T8GA 3GHTA 3G1FA 1I2QA 3OEXA 2ISWA 2IKHA 3TR9A 4RV3A 3A9BA 4ICCX 4PEEA 4DBUA 4GJ1A 1QPKA 4N9BA 3CC1A 4B92A 4YTQA 2PDQA 4PUWA 4R53A 5A8OA 1H0IA 4CGTA 2VEKA 1DXFA 5EGRA 3T2QA 4A8IA 3LCFA 4LVBA 5DCEA 2PE4A 4CNNA 5T26A 4KRUA 4DUXA 2WWCA 3RO8A 3OA3A 3EWCA 2O9RA 1NDWA 3ZJ6A 5BMWA 2PBGA 3WJSA 1JZ2A 4G9PA 4A8LA 3C3UA 3LZ3A 3EXTA 4I9JA 1R3VA 3NVDA 4PTWA 3IUHA 1TPFA 4HCDA 3W7IA 2ZUVA 3VZYA 1JYNA 4CN1A 1B54A 1MO0A 4YU1A 2DFAA 3AZRA 1OINA 2WC4A 2CZEA 2P5NA 4W84A 4LU0A 1OX5A 4C6QA 5A6SA 4FK9A 4Q4RA 4LBSA 1V0LA 1FX6A 4HPJA 2CNCA 4XKYA 5D03A 4JBRA 2WMGA 3DH7A 2IKIA 3NOEA 4WRHA 3LS9A 3T05A 4DNMA 4AFYA 1TA3A 4LYKA 3CU2A 1V08A 4WXYA 3BLLA 1BYCA 4HK7A 1S46A 1J6OA 2YLAA 1J96A 3GXFA 4IICA 1KBIA 3NQ7A 4PCSA 2C7FA 1XV8A 4H8VA 4XK2A 4PEKA 4ZTXA 3FEMA 1KXQA 1M9HA 4TUFA 5ECUA 4WIWA 5CCZA 4PE8A 1J2BA 4U28A 4MKVA 3NDOA 3VNDA 5CH9A 3QV6A 4FALA 2FKPA 2V2HA 5FF0A 2WB5A 4ZO6A 3PFMA 1TTJA 3UWEA 3AHTA 1VD6A 1KD0A 3BG5A 3A64A 1LL6A 1OYCA 3SGZA 4J3WA 1TUXA 4FXRA 4TIMA 2OYMA 5DXXA 3SFWA 4XO6A 4UTFA 5AC4A 1VBUA 1F7BA 1YKWA 2E9LA 1OFOA 1VBRA 1TX0A 1U33A 4UB9A 5FF3A 1TRDA 4NVTA 4ALDA 4NNCA 4I6VA 1SZEA 1VYPX 4MJMA 3TQPA 3K8KA 4REQA 2V9DA 3OVPA 3TDFA 3W27A 2VO5A 3RX3A 1B1YA 5H91A 2Z26A 3L4UA 2X7VA 4KCUA 4UTWC 1YXDA 2PBOA 3MMDA 4BF9A 5LNWA 3MYPA 2VWSA 1B90A 3RJXA 1MDRA 1TJRA 4B4HA 1GORA 3W71A 2WHJA 4XZ9A 1NQKA 4MDOA 3AS0A 4GIRA 4HSNA 4OECA 4Q8WA 2G3NA 1EOKA 1H7OA 3UPMA 4C6EA 4JFTA 3H2EA 1EYWA 2HS6A 3LYEA 3RGTA 4F66A 3GH7A 4GJJA 2NW0A 3W6MA 4H9YA 1MYRA 1OG6A 1NELA 1OC5A 4FIQA 5FESA 3T0CA 4JFWA 1ZRQA 4IGNA 1FBAA 2C15A 3GFZA 3AROA 3WD4A 2EG7A 1ENUA 3U2EA 4GY1A 4Q8VA 3R94A 3VGEA 1CLKA 1Z89A 3VIKA 5I09A 1MW0A 3H4GA 4MY1A 2RGLA 1LRTA 3PZIA 2ZVIA 3ZYZA 1VJZA 3GK0A 4GQBA 3HG2A 4AXKA 4C6FA 4FF7A 5TBOA 4BJHA 4B3ZA 4J3ZA 3GIQA 2VD8A 1R2TA 2PD5A 2YPIA 4O8AA 1QNSA 5CPOA 3VZXA 3QTGA 2E6AA 4WD0A 3NUKA 3D3FA 3F4CA 4RW3A 1TZ7A 3LCLA 4MDPA 1QNVA 3CQHA 2ICSA 3CUGA 2WVSA 2VFIA 1J6PA 1OB0A 3PSWA 4HD5A 1HXJA 1RQHA 1NFPA 4Q8PA 1OFAA 1HUVA 5FJOA 1KRMA 1V77A 2X2GA 2WLYA 4JQ2A 3WELA 1HKMA 5I79A 1T96A 2DH2A 2NX3A 2PDFA 4OE7A 4RZ6A 1NVMA 1HT6A 1SW0A 4AD3A 2Z27A 4IQEA 1VFUA 4S39A 3Q58A 4J35A 5CAHA 2VM8A 1YADA 2RUSA 1UD3A 2CLOA 3P2VA 1RR2A 4XKYB 3T07A 2WZHA 3LUTA 1OJXA 4XZIA 3GSMA 2V3FA 3IUDA 4QNWA 4GVFA 1UR2A 4G5DA 4FXFA 4OV9A 3NG3A 1VCFA 3EOLA 5GNZA 3PK7A 5EMUA 1TA3B 4UQ9A 3R4IA 5JUVA 1MUWA 2WAGA 1DE5A 3UF9A 1UC5A 1UWAA 2WXDM 2ZUTA 1XLEA 5KZDA 2CZ5A 1EQCA 2PDMA 1XIEA 1MEWA 3MMUA 1WX0A 2V5CA 4WOZA 2GPTA 1Z69A 3B4YA 2XHYA 4U31A 5A1AA 5T9CE 2QEZA 4I5RA 1JYVA 1DJGA 4FF5A 4KBXA 1LT7A 3G3DA 3R8GA 2XWDA 1SUXA 4UR9A 1WZAA 9XIAA 5E6ZA 1Q6FA 1BFNA 3UA4A 4J27A 4NT0A 2WYSA 5K2ZA 3FVDA 3VIHA 2E5BA 3F4DA 3TYEA 4Y7EA 4DEFA 1I2OA 2Y0FA 4P7OA 1Y0EA 1GZGA 4O13A 5AN7A 2BY3A 3QM3A 1H7NA 4PCPA 1SGJA 2XIJA 1CXFA 1NEYA 4D6CA 1RJRA 1EL3A 3CUXA 4GOAA 2ZE3A 2XFRA 4P8WA 1MXGA 2IQ0A 3MUXA 2IPGA 4KQNA 2ZWYA 4REQB 1WDSA 4LBRA 4I5UA 5CC7A 4JTAA 2PDNA 3MT1A 5E5CA 1CBGA 1OC7A 3BLFA 1ZBVA 3UCDA 4RNJA 3MKKA 4UWMA 4ZB2A 4L9XA 3MSDA 4TTGA 4A3YA 1UUQA 1QT1A 3AYTA 3M41A 1M65A 4O1BA 2IKJA 4EXAA 4RE0A 3SQSA 4JCLA 5BXTA 3G0UA 2Q3OA 2O9PA 1POKA 3S9YA 1F2JA 3WDRA 1WKDA 3I3DA 1UD6A 3U2CA 5F1UA 3DFQA 3THQA 2EG8A 2OSWA 3O07A 2ZWZA 3QXBA 2EPOA 2PGRA 3W53A 1WO2A 4PCTA 3IPWA 3WD3A 4IFOA 5AVHA 4LCSA 3W83A 3MTWA 2DY3A 5LIUX 5HWJA 2D2GA 4JPGA 4M8UA 2CYGA 2D23A 3EOSA 3UVIA 4J1OA 2V38A 4S3AA 1DJNA 1NDZA 1BWLA 1C8YA 3SO7A 1IV8A 3Q67A 1Q65A 1NFGA 2HV5A 3APTA 4L1GA 4INFA 2QMKA 2RDTA 3MW7A 1YDNA 3JUGA 3AISA 4U2ZA 4QQ3A 3ZT5A 4BWLA 1TWSA 4O28A 4OUEA 2HBXA 1W9BM 2J47A 1P0EA 3H12A 2OT1A 5DLCA 4UOJA 1F5ZA 4IWWA 3W73A 1H7WA 4XTIA 1RP9A 3S5NA 3K2GA 1UWSA 4FB7A 4G7FA 3DFOA 3VIOA 3WLJA 1MW3A 2HZGA 4YHGA 3M0KA 2OQYA 3S83A 2DJXA 2DU2A 2BVDA 1Q6QA 1ZJIA 2E25A 1A3HA 4B5VA 2DUXA 4NYYA 1XIDA 4GCAA 3GKAA 3TN4A 2H6RA 1EDGA 3WUFA 2LLEA 4K36A 5I3GA 5FL0A 3VFLA 1ZBKA 4RPPA 8CGTA 3CYJA 2AGTA 3WENA 3CB3A 3KVLA 2YR1A 5CZJA 4JR5A 3VNZA 1IE7C 4WGXA 1JAEA 4HB7A 2JK2A 4GZJA 1US2A 1D3GA 3U2ZA 2FZMA 2C6QA 3WD1A 4R9OA 5A2AA 2YJQA 5IOBA 1E9LA 1AUSL 5D37A 5M17A 2EGZA 1BXBA 4LNYA 1SSGA 2J66A 2DZBA 1BEUA 3MV11 4GQGA 3KHDA 3SAZA 1Q6EA 1ME7A 3FCPA 3NL2A 4FXJA 1FHVA 1F3EA 3ZO9A 2OZ0A 2G37A 2J8TA 4AEFA 3QC0A 3GVQA 4FX7A 4AY8A 3CUZA 4QISA 3L0NA 4DWSC 3ABQA 1CENA 4FP1A 1DJIA 2BS9A 3NQEA 5G1TA 3EKZA 4C7DA 4AX7A 3G77A 1KRAC 2AMGA 1XSKA 1V0KA 2PCEA 3WL0A 2Z1SA 4MWAC 3UVAA 4WSHA 5PTDA 3W2LA 2PDUA 3HGSA 3HPXA 1C7SA 4AQLA 4R3UA 4LV9A 3WNPA 3OZMA 1XS2A 3GDMA 4LB3A 3S5SA 3KRBA 3AYRA 3MPGA 4JFVA 3OJGA 2WM0A 4H01A 4JTDA 4QEHA 3CT7A 2DJLA 3DG3A 1JXJA 1T7LA 2OU4A 3O9NA 3G1RA 5F2MA 5KETA 1NY1A 1V6WA 3I10A 4L1XA 5H8PA 4F8XA 1JCNA 1X39A 3U4AA 1EP1A 2WNQA 4LYRA 1B5TA 3TFXA 2IKGA 5EBAA 2F61A 1PB0A 1PUDA 4OIFA 3CUJA 1TUFA 4L64A 2GOUA 2ISDA 1W1PA 4D72A 2KX9A 4HU3A 3NQBA 3KDOA 5A8NA 1QVBA 3U5YA 3SCRA 1JDAA 4S2CA 1IR2A 2PURA 5CJ5A 2WSPA 3CHDA 5HWMA 1DYSA 1V3MA 1MFVA 3AICA 1V6TA 4ERIA 2BY0A 3C86A 3PJWA 3UP8A 3VIPA 1PWLA 2A21A 4TX6A 3W24A 4PUDA 1AMYA 4GABA 2WJDA 3PPHA 4I3GA 1FDYA 2E09A 1G0CA 3CHCA 3FFSA 5E0CA 4L5ZA 1T5AA 1JCTA 1JYXA 1TV3A 4MAVA 3DG7A 1UOZA 2YLLA 4B4FA 3EWWA 3EXRA 4Q4QA 2E6YA 2DZWA 3QHOA 3V3WA 4NG3A 4US5A 5I3FA 5BNKA 3K4WA 1E4NA 3AMCA 3DC0A 3YPIA 3TC6A 1YPFA 3J7HA 2NLYA 1OABA 2FFIA 3FJ4A 4TV6A 1RXOB 3TYZA 2QPXA 1UPPA 4GZ7A 4XAFA 2BV9A 3RUBL 2ESCA 3FJNA 3MO7A 3TP4A 3AALA 2INFA 1LLZA 4X61A 2DSUA 5D2XA 4ML4A 2DT2A 3M44A 1KR1A 2W4XA 3GVRA 4JNZA 5F2IA 2Z28A 3IV3A 1WDPA 1C92A 3M7SA 1HL8A 1PTAA 4LJ3A 2WNZA 3NCOA 4MTVA 4LPCA 5AHFA 3TZNA 4FLOA 1KV5A 1A4LA 3T40A 1LP6A 1FFRA 3V1PA 1L6SA 4DO7A 1SO6A 4CVUA 3FAWA 5C5YA 4A22A 2I57A 1K7FA 3WNMA 1DTUA 2YW3A 3DIPA 1HKVA 4D8LA 4PB3A 1US0A 4KWVA 2CBJA 4HOWA 1R7AA 4UTWA 2E67A 3W1QA 2BHZA 4GA8A 3D5HA 4Q8QA 3RJYA 4MPKA 1TO3A 3B9DA 4ROQA 3GQYA 2REQA 2C19A 2FZ9A 4E2DA 2J6XA 2V3GA 1XYLA 3OBEA 3GXMA 2PMQA 4NI3A 3INPA 1XC6A 3LV5A 3B0VC 1XIBA 2H8XA 5AVNA 3NNTA 4PSRA 4YTRA 4JEJA 4ZO8A 1JPDX 3SEPA 2VOTA 4GUGA 5IDIA 4ADUA 3S46A 3MQTA 3VPLA 4K68A 5EPDA 2F2HA 1MUMA 2YYTA 2D1ZA 1JG9A 3S1UA 2VX5A 2VT0A 4ZE4A 5CGQA 2D73A 4G2DA 2CXGA 3L4ZA 2NSXA 3PBMA 1IXPA 2NUXA 4A21A 4IF2A 3VMNA 4L9YA 2X40A 1ZB5A 2PGFA 3M0VA 3DFYA 2WZTA 1LQ0A 1XP3A 3VNJA 3ENLA 1J11A 4JX4A 3PBWA 4GK8A 5A6LA 4Z17A 2I7GA 4NAEA 4W8AA 1S2WA 4PR4A 5TIMA 4TV5A 1DHKA 3KBNA 2A5HA 5LIKX 3EOUA 3AU6A 3E5BA 3B9AA 3PF3A 1NIUA 1G6CA 5ENLA 3CL7A 5H6HA 4ACZA 3CAQA 1I75A 3BPWA 4NYUA 4YCPA 1QNPA 3RIKA 1O7AA 2OYKA 3CK5A 3W01A 1HJQA 4IL0A 2WKLA 3LXBA 2OGJA 3HQPA 1XCXA 3IVSA 3W1RA 1IYXA 1W5MA 3ZWTA 3GG1A 1NFBA 3GXNA 3PFRA 2JQXA 3OLIA 2ZUWA 4US5D 4CEXC 3TKFA 5LIYX 1RJQA 5BOOA 3BAYA 2VVNA 5HJYA 2Y2WA 1IT0A 4C1NA 2QAPA 1HZYA 5I07A 3WG6A 4O18A 1S2CA 3Q2DA 1PZ1A 3GHSA 2QCGA 3AYVA 3JS3A 4ZFMA 3R0UA 3RITA 5C2GA 1BVNP 3MKVA 5CLWA 2QPSA 5AYZA 3TW7A 3SZ8A 4C65A 4LGXA 2PTDA 4FPSA 1XL9A 2BY2A 1HJSA 1LBLA 3N2BA 1RK5A 4BQ3A 3WNNA 9XIMA 1LM1A 3RLUA 4GBUA 3D0CA 1OGGA 1POJA 3DFTA 3L2IA 2CLMA 3FX4A 5TAOA 1ELSA 1M41A 1E6PA 1JCMP 3GDKA 3DG6A 1TELA 3VNIA 3T9PA 1I9CB 3SRFA 4QG6A 3AWNA 2VTFA 4KIEA 1GYLA 2KAUC 5CBIA 1M04A 1TWWA 3GXPA 3QY7A 1O94A 3QQ1A 3M0HA 4XSMA 3N13A 3M9YA 4C6CA 2CKSA 1W9VA 2HMCA 3KOYA 1V3KA 3G1XA 1M7OA 5C9ZA 1LUCA 1QI0A 3NTYA 4A35A 1MRQA 4RDWA 1VPXA 1KM5A 1A5BA 2HCVA 2WW5A 4UTHA 3W3OA 2H90A 4L4PA 4GISA 2GGEA 3GH4A 1EH9A 3W2MA 2Y7FA 3AS3A 1XBXA 3TK7A 5BRPA 2REQB 1ZSXA 5FL1A 5HANA 1DP0A 1BQCA 3CJPA 2P0OA 3WDHA 2IMRA 4UTUA 4E2VA 4PMYA 3G1YA 4QLJA 3NL3A 3AXXA 2E68A 4S23A 1UD4A 2J78A 3UG3A 4TQTA 2OELA 4PTDA 3LRKA 1EDTA 3D47A 1Z44A 1QDSA 2J25A 2VCCA 3ZS4A 5JIWA 4YN5A 4AVFA 2HNEA 1OWQA 3MSYA 5GQBA 1IF2A 1W91A 2PWEA 3EZ4A 4R5EA 3W2UA 5HMFA 3W02A 3W37A 4PBFA 1JPIA 4JKKA 3KBVA 4QE5A 5FF4A 1EIBA 1H41A 4N6EA 1OQFA 3QV8A 1WP6A 3W26A 3STGA 4AC1X 3CMFA 2WWDA 4AEEA 2EKCA 2XYLA 4IGMA 3IJ7A 4TR9A 1L6YA 1XDMA 4FR6A 1SJDA 4A05A 3BQ5A 3QR3A 3A4AA 3SB0A 3GYCA 3PR2A 4UQBA 4NKCA 4FNPA 7CGTA 1TPEA 2FB3A 3E02A 4Q4OA 4IPNB 1DXIA 2XVGA 1T40A 3GDBA 1XI3A 4QCEA 5FJRA 1GJWA 1CTNA 4HA1A 5LA2A 4Z2KA 1I1WA 4CCZA 2XIIA 4NAEB 3IGXA 4K37A 3W7HA 2IPWA 1BKSA 1ONXA 2P10A 2YCLB 4FNUA 3CWHA 4YTUA 3T08A 5MHBA 3DHPA 1GK8A 3GBEA 3BV4A 4GUIA 4ACZB 3NO3A 4HHPA 1XHGA 1XUZA 3QOMA 2O4QA 1UR8A 1M3UA 5XINA 3H23A 4BR1A 1CZ1A 4UTLA 3POHA 2EXOA 2VCAA 2AGKA 5EMKA 4H00A 4W7WA 3HQOA 1GOWA 4UFHA 1UZ1A 2VQTA 1EP2A 1VIWA 3QYSA 4HMDA 6TIMA 4QTGA 4ATLA 3QN3A 3IAQA 1GW9A 3B8TA 4DBWA 3R5EA 4R34A 5GVJA 3SIMA 1LRNA 4BF5A 1KGWA 3LPPA 5I3DA 2BB0A 3UXDA 1VFMA 2E1WA 4AY1A 2E9MA 1O66A 1CCWB 5SWUA 2BLEA 4WOQA 1A5OC 5M3WA 3NSMA 2W0UA 5C8BB 1NF7A 2VOMA 3TTYA 1QW7A 3GO2A 3W38A 1FP9A 4C6KA 4UFLA 3S2JA 3BICA 3EA1A 2QCDA 4GI4A 3MP3A 3TJIA 2QT3A 4QLLA 2G8ZA 4MB4A 1E0XA 3ARRA 3JVAA 3ISIX 4FOJA 4ZEPA 1WBJA 5AYYA 1AFSA 2FDMA 3RAOA 1EWEA 4DO4A 4DWSA 2H8ZA 2J7HA 2X2YA 1E0UA 2BFGA 1SSDA 5HJXA 4XWUA 3QZEA 4IMGA 2GGIA 3F2DA 3SCSA 2G0WA 3B05A 1XUUA 3ABSA 3HJEA 4E3TA 1KKRA 3E96A 4TOQA 4XAGA 3M6DA 2PP3A 4MWAA 5TF0A 4ZVJA 2VRJA 5LNSA 4EP8C 1LUCB 1YNPA 3OHIA 3CTLA 1KQYA 2PTWA 4BZYA 1XWYA 2ANUA 1D7KA 1NWUA 3TN5A 4C6OA 4GVGA 1LJYA 4GD0A 1DWGM 4QJ4B 3VIJA 1OX4A 3TH6A 4FHAA 1YQ2A 1IWPA 2FJUB 1H5VA 3DAQA 2VR4A 4L4OA 5G2WA 4H6KA 1T99A 3VXGA 3CTTA 4O15A 1H0GA 3C6CA 1XIMA 1KM0A 2VD9A 3M47A 2GSEA 1J0ZA 1WUEA 2JKAA 5GJNA 4CVWA 4WQ6A 1LYXA 5FKYA 3FV9A 4C6BA 4DXVA 4LEFA 1IEQA 1JFXA 4QFUA 2NT1A 3PM6A 1QPRA 1OF6A 5I06A 5CSYA 1CW2A 4PGLA 3MHGA 3CWOX 1ZU8A 3PG8A 2PUZA 2D3NA 5EY5A 2Q02A 5FSEC 1OCNA 4HTYA 4J3SA 2P3ZA 3T0AA 3EX4A 1DV7A 4AX6A 1C93A 4GI9A 4DO6A 3MYOA 2OZTA 4JY8A 5CPLA 3USBA 3PG9A 3LTSA 2HK1A 3VGDA 3S1VA 2Z2UA 3RRXA 3K1DA 1TRIA 3NYDA 3OBKA 4AZHA 1WCGA 3NL6A 3EPOA 1JRCA 1RD5A 2PWFA 4MZ1A 1UA7A 1I2PA 3S5OA 3W00A 3AJ7A 4PMUA 5I6SA 3CEUA 4LS1A 4NJJA 3ANYA 1F8IA 4S2BA 1OD0A 2Q8ZA 2PS2A 3HA1A 1VENA 5HR7A 1TE6A 2ISFA 4DPQA 3IRSA 2P76A 1FKWA 1G01A 2A3CA 1JDDA 3UXLA 2PB1A 1VAHA 3MC5A 4ZE5A 5LKYA 1OYAA 2WMKA 8RUCA 4S3BA 3P5YA 4HZMA 3DGBA 3KTCA 4DXKA 4BEUA 5EMMA 3WQGA 2GQ3A 2NQ5A 2P88A 3C2RA 3HOJA 1XH1A 4MHBA 4YHEA 3GG0A 5LXXA 2NWSA 1XLJA 3ITCA 1ICQA 3NQ2A 3W2NA 3EEZA 4B2DD 1GOIA 2FZDA 2WANA 4FA3A 2VX7A 3B8UA 2D22A 1DEDA 4DJFC 3BLKA 2P3EA 3F2CA 1ITQA 1QU4A 2DGAA 4B5XA 3G3MA 4JQAA 1W1TA 4MWAD 3H2FA 3NWRA 4Q8OA 3I7QA 1RVGA 4K6AA 3CXOA 2DZPA 4JIEA 4LBUA 2YFNA 3W1UA 1F4HA 3L23A 1P4CA 5BCAA 3GNDA 2FHCA 3E2QA 4O53A 2C3ZA 4DWSB 3ABRA 2A3EA 3LQLA 1PZ0A 1TMLA 4NX0A 1HKIA 2WOQA 2DUZA 2RGMA 5C7HA 4KWWA 1IEVA 4FZIA 5FIPA 3P62A 3VD5A 2DW7A 1XFCA 1YE4A 1LOSA 1DWAM 3IIPA 3W81A 2ZZ4A 4MWAB 3ARZA 1XDJA 1KKOA 4B90A 3RNDA 3WD0A 2DPEA 3C0QA 5T9BG 1E43A 2V2DA 5E70A 1AL7A 1AQMA 2GYIA 1B2YA 2R82A 3PULA 4M81A 2HXUA 1RAKA 2C0HA 3G1AA 1HTIA 1JFHA 1XLLA 2XISA 1OX4B 1FRBA 1YRRA 5D2YA 2ZX8A 3TV8A 5JH1A 1M7JA 4IMAA 4J2PA 3ELFA 1OEPA 4JN7A 3OIHA 3S9ZA 4HNOA 4DYJA 4KEVA 4H7ZA 5BWFA 3E0FA 1GQKA 4GH3A 1C9DA 2CU0A 2WZMA 4IJCA 1EGZA 1TB3A 2G4FA 2VRKA 3W88A 4HMEA 2CHOA 4DZHA 4MB3A 4IFKB 1UR4A 3WLMA 4B3KA 1SW3A 4URIA 3BV7A 1GWJA 3H2OA 2DQXA 3DENA 5DY2A 2GVJA 2NUWA 1SFTA 1OFQA 4LALA 1VFSA 1OFDA 3VOGA 1JZ4A 4MIMA 4YS1A 2C18A 1NARA 2F9RA 2QCLA 2AQOA 3MBDA 1WKYA 1XYCA 3AIWA 2ZC8A 1HJWA 2QJIA 4U2YA 3M0MA 4KERA 3HM7A 2AOSA 4JKLA 1CXLA 4KGLA 3SSJA 5E9XA 4ZB5A 1IZKA 4Y9MA 4O16A 2WM1A 3GC4A 4LUYA 3LSCA 3W70A 2DVXA 3NEVA 3NSXA 3UJEA 1CXHA 2WKGA 1US3A 4AZIA 3LCGA 1WQ5A 2GL5A 3TEVA 1PHQA 2PD9A 2B7QA 2JALA 1DWIM 1FHUA 1TJ2A 5DO8A 1OIFA 1SMDA 3MO4A 3TUUA 4P8UA 5ABEA 3K8LA 3NQMA 4JD4A 1Q6OA 1EA0A 1XFBA 1TG7A 3WKZA 1MXDA 2WBKA 1V79A 2E5CA 3KL0A 2Z7GA 3PAOA 3ONCA 5CEWA 2XGZA 5HBFA 3MP5A 4RUBA 3S2NA 3PBYA 3W1TA 2Y7GA 4HIBA 2XM1A 4N02A 1QWKA 2XVKA 1GVFA 3VD9A 1UD5A 1IT7A 3D46A 3E38A 2GVEA 1MQPA 1QI2A 2WKJA 1AJ0A 3EX1A 4FXSA 1MW2A 3WY1A 1XLCA 3P6LA 3ARPA 2FJKA 1PVNA 3UG8A 2FHFA 3KRZA 1XLBA 4XZLX 1R3SA 1KNWA 5DMMA 3HQ1A 1FHLA 5D4YA 1AW5A 4F79A 1SZGA 2DIJA 2X1SA 4GFSA 3MMTA 1W37A 1RBLA 2F8QA 1XSJA 1EX1A 3KOXA 3KCJA 4MNLA 1WDRA 4DVOA 6TAAA 1B30A 1EGVA 2ZX6A 3W29A 5B80A 3KTSA 4PRRA 2ZYFA 3T4WA 4NZ1A 3AZSA 2OXNA 3NGFA 1AG1O 1SM9A 4RDYA 3QLDA 2QJHA 4M6UA 4CD6A 3BAWA 5GJMA 4JYFA 2XIBA 5H8UA 5CSSA 3NZRA 3WH9A 1ONEA 2QS8A 1CDGA 4FOUA 5CKSA 5FAJA 3BAIA 1J93A 5IRPA 4KS0A 2ZZ3A 3EAUA 4XISA 1E0VA 5I3HA 4IQLA 4QE1A 1W1A1 5HNRA 1UMYA 1Q5MA 5AOUA 3FSUA 3MCOA 3WLLA 3N15A 3STFA 1H5YA 3RG6A 2WSKA 2XH0A 3MCNA 3F7JA 2ISVA 1F3TA 4IPLA 4A2RA 1BAGA 1T8XA 4OBRA 4GIEA 5A2BA 3THDA 5I2UA 1QK0A 3G0XA 4C5ZA 3P82A 3QOKA 1EPVA 3TXZA 2ZBTA 4JIIX 2B7OA 1RCQA 2XH2A 5D32A 4JTGA 1ONRA 2UY2A 3CV6A 3G8EA 4CCDA 4BF7A 3E74A 3EOOA 4C6JA 5HWNA 1XINA 4Q6XA 4HN4A 1ISVA 3I6TA 4IIEA 6ENLA 3QHMA 3IJQA 1Q7MA 1YPIA 3WBXA 4NRSA 1DXEA 3IIVA 2FQIA 2WZEA 1K77A 1A5CA 4NNAA 2FGBA 2OKOA 4NILA 3O63A 4DRSA 2QPUA 4LW7A 1KB3A 4N4PA 4PUEA 3WK1A 3I6EA 1EJXC 4F4RA 1UMLA 3GC5A 2PRLA 2XINA 3KP1A 3LNPA 5HNTA 2GJXA 2UWFA 3W7DA 2EQDA 2BGSA 3ZZ1A 2J88A 1IZCA 1FFQA 3MUAA 2X41A 4HGXA 3JW7A 1W31A 2VDGA 4WF7A 2B0MA 1KLYA 1W9XA 1G67A 4J9JA 3EOEA 3BGGA 2A79A 2PRMA 2YL5A 3M6YA 4H8UA 2PCQA 3WK0A 5FCZA 1QK2A 4DUWA 2HWGA 1GTHA 2OPJA 2BHUA 4U3AA 2XWEA 5BOEA 3UZYA 3WSUA 2VQUA 4PMDA 5CBBA 2X8RA 2NXIA 5E9AA 2G41A 4W93A 2D2JA 4UTMA 4JQ1A 1P6BA 5CXPA 4YL2A 1FHDA 1TCMA 3K13A 3U5UA 4G1KA 4P61A 3U48A 1F61A 3GR8A 2YDRA 4WJEA 2A2IA 1E4MM 1JUKA 1VZWA 3E2VA 3SURA 1FXPA 4KWOA 2NVCA 3C4UA 3PPFA 3PUGA 5A94A 3ARSA 3U9IA 3LEPA 5GNXA 1KRBC 4EPDC 2GJLA 3SRDA 1PS9A 1ISXA 4WLCA 5CZKA 1WUFA 4IIHA 3O1NA 3UG4A 1F74A 4XZMX 3B9EA 1OBAA 3STEA 3A5VA 5EMLA 3SUSA 2GVLA 3U0HA 1DWJM 3VKDA 3QF0A 4MZ8A 1VKFA 2TAAA 5REQA 3E2RA 2GFTA 3ZQ9A 1M6JA 9RUBA 3V18A 3TSBA 5K7JA 1RBOB 3TNBA 4HK6A 3WH7A 1W6TA 1X98A 2XJ7A 2R6OA 4M0XA 1OGSA 4H9ZA 3GY1A 1W3IA 1VRDA 1WB0A 4O0ZA 2TSYA 2HTMA 3MMWA 5A6MA 3CH0A 3SCVA 3DHDA 3ZLFA 3OP2A 4QLKA 1QW8A 1W3KA 1W54A 1BSIA 1TKKA 1VYSX 5LA1A 4D8ZA 4L7ZA 2HS8A 1ICPA 3LOTA 3WLSA 2ALDA 1KBBA 2IQTA 4AU0A 3T2OA 3M0ZA 1FWEC 3F03K 3O6AA 1TQJA 3NURA 5I0DA 1XRSA 1JDEA 3IAPA 3W72A 4HNNA 1X97A 3TLQA 3N2MA 3QYQA 4IJBA 4DQWA 1TPB1 2G97A 2I56A 1FWCC 1Y5XA 1AW1A 1CNVA 1PAMA 3PNZA 3K4DA 3GNNA 1E5NA 1UCWA 2POTA 1J8VA 4RE2A 2ZQ0A 3SR7A 4WEVX 4Z2IA 4J40A 3W1NA 2PDPA 2HQAA 4F40A 4KGJA 4AHQA 3H26A 3P8JA 1E6XM 1KBKA 2OQLA 5HUOA 3LX9A 2BVYA 3ITVA 3UWZA 3QQWA 1ONWA 3KCOA 4HNCA 3CYVA 2QDGA 3EPNA 4B5UA 4LAKA 4H6QA 4NHVA 1AD1A 2XG9A 3E0WA 1BWKA 4F3HA 4ICNA 3S1XA 2FPTA 1VFLA 3AQUA 3EWYA 1ZCCA 3CM4A 2GJXB 4DIAA 3LDVA 2WVUA 2EF9A 4QGCA 2I16A 1JQXA 4WK9A 3WJZA 4K7YA 2OZ8A 3WLHA 5KITA 1XPGA 3W85A 6CGTA 2VDIA 4B9YA 2BY1A 4PMRA 1GZ1A 4DJFA 4W7UA 1RY8A 1IWBA 3THAA 3M46A 1PL9A 3NQCA 5A3HA 4GUHA 1TR1A 2NQHA 3GAKA 3N2XA 3QSTA 3P84A 1OGBA 3W0KA 2AAAA 3WLIA 2ZXAA 4LYPA 2X0YA 1QI3A 5DRCA 4DAFA 4DJEC 2AL1A 5EU9A 2OTDA 1JGIA 4HPGA 2NQJA 3EWZA 1E5JA 3P0WA 1VFHA 2ATSA 4PTXA 1K9TA 3AMGA 1JI1A 4CQAA 4DM2A 4GC3A 1OF8A 2PPGA 5DBUA 3OPSA 3ITOA 4ZOAA 3WLKX 3FKRA 3GBDA 1AH3A 2CERA 2ALRA 4LS2A 2IXVA 1A4MA 3PUEA 3WN6A 4KKXA 3RMEA 6ALDA 1B4KA 1JPKA 4NASA 2VL4A 2DT0A 3CMGA 1REQB 3LHZA 4MZYA 3U57A 5LGZA 1UASA 4O0KA 3PPGA 3BLDA 2W5FA 4O57A 5RUBA 3BSGA 4S38A 5A8MA 1ADDA 1SZNA 5K4ZA 2QV5A 3TTQA 1T8QA 4QG8A 4J2MA 3HURA 1TZZA 3T78A 2INEA 3VVGA 4JTUA 1VFOA 3LPFA 1O95A 2Y8VA 2E3ZA 4HPHA 2NXHA 3KFTA 4ZFCA 3QV7A 1AODA 4EOUA 4ES4A 1KGXA 1ZPTA 2Q09A 4NP7A 4JTKA 1A5KC 1HL9A 4DYEA 3LLXA 3N29A 3DHFA 3LGEA 1J5SA 3FNDA 3CPUA 4DELA 1ZENA 3NSNA 4HHMA 4PUNA 4ZTYA 4MY9A 1YDOA 3JZUA 4IM4A 4X0NA 4XKMA 5FJJA 3GD6A 1QPNA 4MKNA 1MEIA 4JFUA 2PDLA 7TAAA 1H2JA 4XB3A 1JUBA 2V2CA 1EIXA 1FWWA 4BKNA 3FJLA 3QRHA 1Q2RA 3O16A 2JKEA 1I0BA 3NPXA 4PB5A 3OVGA 4KT2A 1FOBA 3LD5A 2V3EA 1XYMA 4S1FA 3OO2A 3TCSA 1S1PA 5K4XA 4IG2A 1JPHA 1QCWA 3VIGA 4MY8A 4Z2GA 1DQWA 1GYNA 4J3TA 3GU9A 4MFDA 1R9XA 5DMYA 3DI1A 1ZBWA 3DX5A 4DJFD 2AAMA 1R9ZA 1ZP4A 4JQ3A 1SFSA 4AWUA 3BVJA 3C52A 3T7VA 1EJ7L 3B8WA 3WQ8A 3HG3A 1QO2A 4QX4A 2IPFA 2C13A 3OB8A 3K1GA 3TXVA 1J9YA 2XGBA 3VOFA 5CSRA 3EDJA 2PDIA 4V15A 1KFWA 1Q66A 2PWGA 3TSMA 1K4GA 2PWDA 4GUFA 3TJXA 1TWZA 1E9IA 3CWNA 1LG1A 3IK2A 1XYBA 4X22A 3VIMA 1S3TC 3UZZA 1K8YA 3FK4A 4ZCWA 1VPYA 4S3GA 1SJAA 5A6KA 4GZIA 2RH9A 3NM1A 3U8GA 3RM8A 4NZ4A 5D9PA 3IJLA 1XGZA 3AC0A 3H2NA 2Y63A 3LA4A 3EWXA 3I7RA 1N82A 1E6QM 1V0MA 5H1WA 2WQDA 4ZA0A 2DZXA 1RLCL 5JXQA 2XVPA 4KFPA 1OIMA 4B5WA 4NL1A 1A5MC 1H7RA 1KXVA 1XICA 2R1LA 3KS5A 3OIXA 4PMVA 1PDZA 1TTPA 2ZX9A 2DSWA 4NQ1A 4ZSUA 3WUEA 4IJRA 1BVWA 3LN3A 3I68A 4MVAA 3BH4A 3KUMA 2PGEA 4GCXA 3VKAA 1LLOA 4KH2A 4XSLA 2PLMA 3RFAA 4AD0A 1PTGA 2Z1XA 5A8QA 1P7TA 1UKQA 2W27A 1SJCA 1LORA 4HA4A 4MB5A 3FEQA 5FEZA 3USZA 4XAPA 1HKWA 1KXHA 1O4UA 2HE5A 4HMNA 4FR1A 3CNYA 3T6CA 4AUBA 3PTMA 3LY0A 3W7GA 3DUGA 3A3WA 1MQQA 3H7VA 3NO5A 1OFEA 2HJPA 5DX7A 5AHMA 2IUZA 2WNWA 3W6LA 1OZMA 1FCBA 1WXJA 3VGHA 2J75A 9CGTA 4NAFA 3R1ZA 4MAZA 1IXNA 4MFEA 3IANA 4FSAA 1PX3A 3QSRA 5E6YA 4NXKA 1MQRA 2PTXA 1A49A 2V5JA 1FDZA 1AMKA 5HINA 1KCXA 3WQ5A 3OTRA 1QPOA 1GPFA 4RPQA 4S3FA 2GWNA 1L8PA 5EA9A 4KW2A 2ZICA 3LHUA 1KO0A 5AC8A 3CZJA 4QJ5B 3GNOA 4IPPA 1Q3NA 2QJGA 5U4NA 5TNVA 7ODCA 3GU2A 1XLGA 1CXKA 1JD7A 1E56A 3O15A 5FJTA 3TQVA 1LWIA 4EXBA 3CV2A 3AMDA 3B9NA 1GKPA 1GYMA 4GQ0A 1EJUC 3AS2A 4YVPA 3V0SA 3ZOAA 1K9FA 2FGZA 3UYIA 2Y5EA 4FNQA 3WJYA 4ZSTA 3HV8A 2CLPA 4H2CA 6PTDA 3UBPC 2FFCA 1BGAA 2D2HA 4UIOA 1WE5A 3HF3A 4XZWA 1YNQA 2YKKA 4BI5A 4ZZ9A 3S47A 4XV0A 3GVVA 3H70A 1XQLA 1WKEA 4H3DA 1XYZA 3DKLA 4AWEA 3B0PA 5KTLA 5A6BD 4BY3A 1VC4A 4G1NA 1QHOA 4LC6A 4LTSA 2OLSA 1C9WA 1F6YA 4PMNA 1BXCA 3TYCA 4A4AA 2PWVA 2FGLA 4E4PA 4HOZA 5I5RA 3UA3A 3UY8A 4EPBC 5AC7A 3NGJA 5C71A 3B8DA 3N9KA 3BK0A 1WDQA 4IX2A 2OFJA 1OK4A 3NQ8A 4HZ6A 4RK8A 1K3UA 2EPNA 3NPUA 1ZZMA 4E4FA 3B0YA 2GUBA 3ME3A 5I78A 4J3VA 1EQPA 4BCEA 1H4PA 2V5BA 3FA4A 5G5IA 2VEGA 3CB8A 3UERA 4FX6M 4PFMA 4HU8A 4QHRA 1XJBA 3LV6A 2QW5A 3ARUA 1B57A 4MUPA 1W3LA 4P2VA 2CLFA 3NQGA 3BSMA 1IHIA 3FHQA 2BDQA 3LTYA 2PP0A 1UIOA 1DJQA 3MKCA 4UFMA 2ZZ5A 5L9FA 3NAVA 2V5LA 2J77A 3E9AA 1VB9A 3A12A 1EOMA 3RR4A 1GEQA 4K7VA 1E3XA 3RPMA 1BXNA 3EMCA 4GVHA 2A3LA 3WDQA 3R7MA 2TRSA 3BANA 3S3GA 4YYCA 3VFCA 4G8TA 4HT3A 4M82A 3SJ3A 5DMLA 1QOXA 3KBWA 1P7TB 1GVIA 4B9ZA 1S5WA 2FTYA 5AKQA 4AF0A 3ZSTA 4I6KA 1DHPA 3MBFA 2C1HA 2NZLA 1PEZA 2AQWA 1ZTVA 3CLWA 3NQFA 6A3HA 1UROA 4E8GA 4Z2LA 4WX2A 1P43A 1D8CA 4C6LA 3R6IA 1UH4A 4NAFB 3A4WA 1UKSA 4W8BA 4AXNA 3ES7A 1OK6A 2EBNA 2E5DA 3T0TA 4YNGA 1P0KA 4K8EA 3R2GA 4CQ9A 3OVQA 3OQEA 2A7PA 4DZAA 4CD5A 4M3PA 1VQTA 3VKCA 3KAOA 1EUAA 4C6PA 4UQAA 3H4WA 3B8IA 2WVVA 2R1MA 1XRFA 1GQNA 4Z08A 5HJLA 4EWJA 2FH6A 4TO8A 2ZDRA 3MUZ1 4JL2A 3R58A 1C29A 4UFIA 3W7EA 4IP7A 4ADTA 1LDCA 5AC6A 2X0HA 2QLYA 1S1RA 1XD0A 3GIPA 3W2KA 3ARYA 1IXOA 1FKXA 3A13A 3NO1A 4OT7A 1D7FA 1UR9A 3GDTA