1LOSA

Crystal structure of orotidine monophosphate decarboxylase mutant deltar203a complexed with 6-azaump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
SRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords orotidine monophosphate decarboxylase
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
total genus 80
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1losA00
2A7RA 1DKWA 1LBMA 2ZZ3A 4P2VA 1U5JA 3W1LA 2CLFA 3HGSA 2C16A 2I9EA 1SR9A 1GZGA 3EXSA 2H90A 3W83A 3PBUA 3EX2A 5DELA 5F2MA 1DJQA 4XBSA 4IMGA 1GT8A 1EWDA 1ONRA 1C29A 4Z1BA 3W7CA 1HG3A 4PODA 5KTLA 3P80A 1EPXA 1P5BA 1TV5A 4H3DA 4P61A 1ZAJA 2Y7FA 1NF0A 4LOCA 1H7NA 4IMCA 4S2CA 1W31A 4OHQA 1W54A 1I4NA 4DBDA 4IPIA 4RXFA 3DI1A 2OX1A 4GBUA 1I2RA 1R30A 4NX5A 1LLWA 1XDMA 1YXDA 4IXHA 4UTTC 4XQ6A 1DBTA 5EPDA 3N2XA 4DO5A 1QCWA 4UMBA 1RPXA 4AXKA 1QOPA 1GYNA 4AH7A 1OYBA 3L68A 4IJBA 1EEPA 4WXYA 1O5XA 3N9SA 2P0OA 5L9FA 3W1QA 3KAOA 5CPOA 4S2BA 3UWVA 4O8RA 1UB3A 2EHHA 4RV8A 2ZRZA 4JTSA 3NQ8A 4JX6A 1SZFA 4X22A 3PUOA 5D2TA 3W74A 1EX5A 5HMSA 1PV8A 1YPFA 1TPFA 3M44A 4UTHA 5D2XA 3LXCA 4UNKA 3KVKA 4IPJA 1D9EA 5F4WA 2ZZ4A 4LRTA 3MHGA 3NPWA 2CFFA 3F4NA 4N02A 3B06A 2PE4A 3LCLA 1LROA 3G1DA 3P67A 2NX1A 4MFDA 1NAL1 2CLKA 5AHIA 4E2BA 3MP3A 1QO2A 4Y96A 3G1SA 2FFCA 1OF6A 4BI7A 2H3BA 1G67A 1W5NA 3VI2A 5D2WA 5AN7A 2GUUA 3BO9A 3DFPA 4GUJA 3PSVA 3QW3A 4H4IA 1TPH1 3P8IA 1VYRA 3P60A 2BLEA 4UTIA 2XFWA 4X2RA 3GDLA 3TW7A 4O50A 2B4GA 4CNOA 5AHNA 1Q6QA 1UBSA 4NJIA 3W23A 3NQFA 2CW6A 4TO8A 5LKYA 1YADA 1TPB1 1OK6A 2ZZ6A 1GVFA 1A53A 3IRDA 5FEZA 3SY5A 4IX2A 3L5MA 2ALDA 1KM4A 1TSIA 3L9CA 4PC8A 3FFSA 2HTMA 1H7PA 2B7QA 3CLMA 1F05A 4FXRA 3C2OA 5E0KA 2FTPA 2DP3A 1VS1A 2DJLA 1QDSA 4RZ5A 3GDTA 1ZJIA 5FF2A 4HNVA 3UWYA 1H61A 1T96A 1WBHA 1VQTA 2FPYA 4ZQRA 1FDYA 3MI2A 5MHBA 1GOXA 5U4NA 3G22A 2BX7A 3WFAA 1H7WA 1KM2A 4M19A 5BMWA 1MZHA 4O1AA 2CWNA 1PCWA 1ME7A 2YYUA 5DLCA 4AF0B 1DV7A 2QEZA 2V2DA 4Y9AA 3RNDA 3W87A 1GQNA 4UFJA 2E09A 3DHFA 3G24A 1LOLA 3STEA 1G4EA 4LNYA 4RX0A 4OT7A 5I3FA 3A21A 3B0UX 2NX9A 2ZFAA 1Q45A 3R12A 5D37A 1KFCA 4NX0A 4UR8A 2Q3RA 1ICPA 1LDCA 2ZZ5A 1MEIA 3W73A 2QJIA 1SO4A 5D03A 2F84A 1EP2A 4DQWA 5AHLA 5HR7A 3HGOA 3LV6A 1G69A 1SU5A 4FX8A 1R2RA 4MLJA 3PR2A 4HN4A 1VR6A 1O60A 4R53A 5KITA 1LOSA 2CLMA 3IGSA 1ML1A 3L2IA 3QH2A 4LVBA 5SWUA 2RHGA 2XN2A 5HULA 3BG3A 1WXJA 3MBDA 1TV8A 3W2NA 4O17A 5LNSA 3TC6A 1JR1A 1A5SA 5LGZA 5G4WA 3G1FA 5AC8A 2QJGA 3N73A 3LGEA 3ABQA 2VC6A 3BLFA 4O1BA 3NDOA 4O19A 3P84A 5AYXA 3O63A 4N6FA 4LC8A 3EWZA 4MIMA 3W1AA 3P62A 4FNSA 4TIMA 2HS6A 3S5ZA 4IX0A 1S3HA 4O14A 3LM7A 4Y8FA 4RK8A 1SO6A 1KTCA 1TTQA 2CU0A 4BI6A 3FEMA 5C6MA 4WOZA 5J5DA 4O18A 3MP5A 3W6YA 2ZTKA 2CZEA 1GVQA 3LX9A 3BW4A 1OYAA 2JKEA 3CM4A 3W7EA 3DU0A 3MI6A 3W7QA 3O8AA 1OFAA 2Z1BA 2ZA3A 2NXHA 1SZNA 2Y89A 3FYOA 3L0KA 4AMAA 1RQEA 4BR1A 1X6UA 3LRKA 1VCGA 2W0UA 1I2PA 4CCCA 1KBIA 1YXYA 3TR2A 3ANYA 2QDHA 3OVQA 1IXPA 1C8VA 4HSOA 3HG3A 3WK2A 1WAUA 3B05A 4XWUA 4KKXA 1R46A 4UFIA 3MP4A 4UIOA 4A3UA 3H53A 2NLIA 1T99A 4MOZA 5AHEA 3RU6A 2CZDA 3IIPA 4PA8A 4PL2A 3GXTA 1WOAA 2E68A 2D73A 2RDTA 2TYSA 4JTIA 4K7YA 3QMTA 4OBTA 5CGQA 1MEWA 4N6EA 4EF9A 3MMTA 4X9SA 1FWSA 3UWWA 2PC4A 4ZZ9A 3W72A 3E96A 5HNRA 5GVJA 2YFOA 4OQVA 1H7RA 3NL5A 3EX3A 3MHFA 3O6CA 1OYCA 1IIHA 1JQXA 3CC1A 2TPSA 3NO5A 4JTTA 1JCYA 2I1OA 4TX9A 1TTPA 2JKPA 3TC7A 3STGA 2H6RA 1XXXA 3GLCA 4JTHA 3DKLA 3P5YA 2EPHA 3W86A 3SIZA 3S42A 3S1VA 3CEUA 3WJYA 1IXOA 2NXIA 4AHPA 3C56A 4JS3A 4NNBA 5FF4A 3AO0A 4NT0A 3W9ZA 2GVGA 3NL6A 1HO4A 2J9YA 2G96A 5D09A 1Z48A 3Q94A 3FOKA 5DCEA 4O4WA 1FY6A 1F2JA 2A6LA 1PIIA 5D2VA 2A6NA 3P8JA 4FIRA 1KTBA 1I2QA 2V2HA 3L66A 4FX7A 5CZTA 2V30A 3LHVA 5G2IA 1XI3A 3LLDA 4X3ZA 3LCIA 3GNDA 3H54A 1L6YA 1M5WA 4M6VA 2J6XA 1IF2A 1ZAHA 4M7TA 1OG0A 2GQAA 5FEPA 3UXAA 3NPUA 3R8RA 1TPDA 1XFBA 5FI8A 3SW6A 1RZMA 4POCA 5D38A 1X1ZA 4Z0SA 3Q2DA 4ZMGA 5HUPA 3F03K 3NQGA 4AWUA 3LCWA 4MVAA 2HS8A 1I2NA 3L5LA 3KX6A 2YSWA 1KA9F 3NOEA 4UXDA 3SI9A 1XBXA 2B7OA 1AMKA 3EXRA 3NQVA 2NV2A 4UFMA 1WBJA 4YCPA 3TQKA 4HSNA 4JYEA 1TRIA 3EB2A 4O15A 5A5WA 1XDLA 3FKKA 3M1ZA 1FCBA 1I8JA 3GYEA 4PCFA 3EWBX 4JYFA 3M9YA 4GC4A 3O6YX 4AHOA 3M5VA 4K38A 3JR2A 3NM3A 4K36A 2XN0A 4CQ9A 3OBKA 1GVSA 3ZS4A 2QCFA 3W7JA 1TQXA 2Y88A 3CT7A 3KXQA 2JKAA 1A5CA 1XCFA 5BRBA 4TMCA 3CIXA 4KWWA 2GQ9A 3EEGA 1FBAA 3O1NA 1AL8A 3L0NA 1P1XA 5TQLA 1XBZA 1O4UA 2J27A 2X1SA 4GWEA 4IMEA 1TJRA 2ZZ1A 1H60A 3DH7A 2ZZ7A 1D3HA 3OEXA 3MO7A 4AWSA 1OX6A 3T44A 3HG2A 4LTSA 2QCEA 1R2SA 2RDUA 3IIZA 2JK2A 4NJKA 3C4UA 4Q32A 4FXSA 6TIMA 1B4EA 2ZRWA 3R2GA 4LY8A 3TW6A 3KVMA 5CZJA 4DEFA 4Z1DA 5K4ZA 3TSDA 1ME8A 4K39A 4MUZA 5HR6A 1WDWA 3WJZA 1UASA 1X7FA 2ATSA 2R94A 1CW2A 2ZA1A 2WO5A 1RVGA 2WNNA 3GXNA 1SQ7A 2VEMA 4G1KA 4Y6GA 4E38A 1K8ZA 3E49A 3I6RA 2Y7EA 3P61A 1YDVA 1KBJA 5AB3A 1H1YA 3DBPA 2NXGA 4UTMA 3KRUA 1S5TA 3M47A 1QPRA 3BLIA 2WNZA 4NJGA 1A5AA 1QWGA 2R14A 4WJEA 3M43A 5A8GA 3GIYA 1YXCA 3G3MA 4O28A 3LCXA 5AC7A 4JTUA 2V81A 3P5ZA 3MHUA 3WK3A 3GB6A 3STFA 5K9DA 3PUEA 4CQ8A 1S5VA 4JTKA 2EKCA 1OFBA 4LT9A 1J5TA 4NVTA 3W2KA 3QMRA 3NPVA 3UD6A 1ALDA 3UYCA 1KM6A 1FCQA 1VC4A 3NQ6A 3PSWA 1LP6A 5EKYA 3S6DA 3NNTA 3MUXA 5IBXC 3MYPA 4IUOA 1KFEA 1TB3A 3QMSA 3GAKA 2WSQA 2V2CA 3DHDA 3GR7A 3PG8A 2C14A 3BW2A 3S1UA 3M5XA 1KM1A 1OJXA 2QF7A 1K7FA 3S5NA 3TAKA 2VFHA 4AF0A 3NA8A 4YXGA 3W7GA 1GG0A 4CCDA 2Q8LA 3UZ5A 1YYAA 3BVJA 4AHQA 5G1TA 1LRNA 4RXGA 3H55A 3PBWA 3LCFA 3LXAA 1ZFJA 3E9AA 3K30A 2NZLA 2QAFA 2WPBA 4CNPA 2GVLA 1S5WA 3B4UA 1KLZA 1E51A 1OK4A 2G5WA 3S5YA 4O11A 1JVNA 2QUVA 4O0KA 3HPSA 3TJLA 2A5HA 3S1XA 3C2EA 3CEPA 4A2SA 1YTEA 1K02A 3O16A 5T26A 1OFOA 5H2ZA 5CZSA 3TNOA 1JUEA 3UWQA 4CNNA 3O15A 2C18A 2BSLA 5J5RA 4C1KA 4JD4A 5LNUA 1AL7A 2PRLA 5HWNA 4AAJA 4R33A 3RK8A 1M7PA 1FWTA 1KLYA 3HG4A 1FX6A 4NQ1A 4ADTA 4O53A 4FNTA 3W7KA 2PRHA 2YZRA 2RH9A 4HT3A 3WJWA 5E93A 2H8ZA 5D33A 3TKFA 4DBEA 1B57A 1XBVA 4FNQA 4MZ1A 4HNTA 1RQBA 1IIGA 1J2WA 1YLVA 3M5YA 2YDAA 3LI1A 1TQJA 1GVRA 3R5EA 5K9XA 2E6DA 3LCGA 4QIUA 5CSSA 4Y90A 4CCEA 4EIVA 2Y70A 4J9JA 2BXVA 5TBOA 5CPLA 2NX3A 4WUIA 4OWGA 1JCJA 4LV4A 3B03A 1DOSA 2ZCGA 1BKSA 1DVJA 1N8FA 2B7NA 4WXZA 2RDWA 4KFPA 4QQ3A 3PBVA 5D30A 4WY0F 1XUZA 3I7SA 2DJXA 4XBKA 2YW3A 4QAIA 1F74A 1G4TA 3UPWA 3C61A 3QM3A 1JRCA 3KVLA 3EXTA 3KRZA 3QRHA 4MJZA 1JQVA 2VFDA 1KM5A 5DCBA 4N4QA 4QNEA 2E5DA 3EX1A 1W3TA 4LRSA 2Q8ZA 4UTJA 5K2ZA 3MI3A 3OA3A 4JN6A 1LRQA 2X1TA 4HIBA 2J9XA 3DAQA 4HNUA 1PVNA 4UTWA 3LV5A 1QMLA 2R8WA 2Z6JA 4UFHA 3TQVA 4ORIA 4BWLA 5BOOA 3DKJA 3G8EA 2CZ5A 4RZ6A 4JICA 5H91A 3SSJA 3NQ2A 5K3VA 5D32A 4GNJA 1JUBA 2VOMA 4O10A 1WYIA 5EY5A 3QEZA 3FS2A 1W8SA 3VCRA 2E6YA 3GK0A 1LORA 2C15A 1VPXA 4WY0B 1N55A 4XTDA 3O6DA 4JTGA 3L0GA 3HO8A 3UQNA 3EWXA 5DXYA 4YL2A 4GFSA 4N4PA 3LHYA 3P82A 1BWKA 2AQWA 4UTLA 1WOBA 3W70A 2VFIA 3TSBA 1SW3A 5CPMA 3VNDA 3TJXA 1ZAIA 3BG5A 4MY9A 4XUGA 3ABRA 3IIXA 1MXSA 1IGSA 2DORA 3LHTA 1NF7A 5AC6A 3DGRA 4NNCA 1K7EA 1W37A 1NFBA 3EWUA 2NWRA 3P7YA 3ATYA 4LU0A 1Q6RA 5K7JA 1GVOA 4LVFA 3T7VA 1AK5A 1T8XA 1OFDA 2WOQA 3TFCA 2VELA 3W7MA 1PHWA 3FYPA 4A21A 3G1HA 4NJJA 4DF0A 4ZQMA 1Q6LA 2GOUA 2I14A 1A50A 4DO6A 4DXVA 5KZDA 1SSGA 1OFQA 3SR7A 5D04C 3W76A 4LVAA 3UWUA 2QJHA 2R91A 3CU2A 1FDZA 2ABAA 3NL3A 5LZLA 4HNNA 2C6QA 1TPVA 2VFFA 3LTYA 1KM3A 5AHMA 1WQ5A 1OX5A 4FNUA 2DU2A 3CIWA 5LSMA 3JS3A 3NL2A 3GKFA 2C13A 3HJZA 3GR8A 2VFEA 3MWAA 3QQ0A 1SO5A 3NQ7A 2DZVA 2B7PA 1TTJA 5ABTA 4KFOA 2G95A 3OHIA 4FHAA 1G4SA 4XTIA 3W1MA 2DZXA 3L21A 4MZYA 1KTNA 1ADOA 2PRMA 1Z42A 1LCOA 1JJKA 3W7PA 1QAPA 4JIQA 4Z1CA 3A5VA 3HBLA 2E77A 2YX0A 1JCMP 2E1DA 1TPWA 1TCDA 5CKSA 3BK0A 4YWIA 4U4MA 1G7VA 4DF2A 3G1AA 3NQEA 1W5QA 2CZFA 4GUGA 5F2IA 3V75A 4K6AA 3R89A 2Y61A 4FNPA 1L6SA 1BEUA 4DPQA 1ZALA 1PCKA 3W85A 2QUUA 1VGAA 1H50A 4WD0A 3TQ0A 3RMJA 2E5CA 3ELFA 4JNMA 5CG7A 4NU7A 5EMUA 2EF9A 4LS0A 4LWWA 3KOFA 1UJPA 2OJPA 2E6AA 2RKXA 2TRSA 4OU1A 3QSRA 4MJMA 4EOUA 3LBMA 3W7NA 5I3JA 3QF0A 1GEQA 3OVRA 5G2HA 4HPJA 1TPEA 3VE9A 3INPA 2DZTA 1YTDA 3EX6A 3SZ8A 4O54A 2W79A 3NZRA 3LTPA 1VJIA 3NQMA 3OG3A 2Y62A 2AGKA 1VCVA 3BG9A 3HPXA 3QSTA 1KFKA 5K4XA 2ABBA 2J9ZA 1TYGA 1P0NA 4GUHA 3THAA 1VYPX 2A0NA 2FPTA 4UTTA 4E0CA 1QFEA 3LRMA 3M0ZA 5F2GA 5CPNA 1ZHAA 2VENA 4I7WA 4JX5A 2WJZA 1KFJA 4ZQOA 3DFQA 5DCDA 2WSRA 1I2OA 5I3HA 3W7HA 1TRDA 1HL2A 2QUTA 3G1VA 3W1NA 2Q3OA 2Z6IA 3DFOA 4E2DA 4M6PA 5KMYA 1JUKA 4IMDA 4ZQPA 4ADUA 1GWJA 4XKYB 5CZ0A 1O94A 4D2JA 5DBUA 3NR0A 1P4CA 1ZNNA 1FQ0A 4UFKA 1K3UA 4QM1A 4RJEA 1N7KA 4DELA 3TFXA 2QAPA 5AYZA 2ZRUA 1UUMA 5KINA 1HTIA 4EVZA 4QISA 2FB2A 2Y7DA 5FF7A 2CLOA 3A23A 3QZEA 1Q3NA 3RLUA 4M5PA 3EX4A 3I7QA 4RCXA 4CLMA 4M7SA 4N9DA 4K7VA 6ALDA 2A7NA 3T55A 5I3GA 5KSWA 1VZWA 2HMCA 2QCLA 3GDKA 3WJSA 3PC0A 5G5IA 3LI0A 1TTIA 3TDFA 3ABOA 3G0SA 4Z1AA 4ICNA 2A1YA 4LUJA 1P0KA 2DZSA 1RR2A 1FCVA 5U7SA 2KZHA 2A85A 4ADSA 4K8HA 2V5LA 1U83A 2WSYA 4MY8A 3HF3A 5DBTA 2DZPA 2JBMA 2ZZ2A 2E5BA 2J88A 3NQAA 3ATZA 2QCMA 3G1YA 4FIQA 3SFKA 5F4XA 1MSSA 3NVTA 2X30A 3EKZA 1L6WA 3L65A 3NQDA 1DORA 3CTLA 3FA5A 1JULA 1TMHA 4Q33A 5D02A 3NG3A 1H51A 2ZDRA 1EUNA 4N9CA 1FWNA 4KFNA 5KZMA 1GYLA 1TIMA 4OV4A 2UV8G 2O7QA 3W2JA 4NZJA 1F7BA 1YDOA 1IXNA 5DN1A 4MYXA 2HSAA 3QQ1A 4QSHA 3PUDA 4ALDA 3LHZA 7TIMA 4L4LA 4FEZA 3EKLA 1GG1A 3KHJA 8TIMA 3M41A 3GZ3A 1Z44A 2ZTJA 4OE7A 2O7SA 2ZRXA 4WQ6A 1B3OA 3LCHA 3HMJG 4IXXA 2YXGA 4NZFA 4IWWA 3LB0A 3LERA 3IIOA 1FXPA 5EBUA 4MLRA 3VFLA 3M7WA 3TROA 1SZGA 1WA3A 1SW7A 3LRLA 1LZOA 1PE1A 3EWYA 3DXIA 4ZQCA 3TX9A 1R47A 3QPYA 2E6FA 4AWTA 2QKFA 1SZEA 1XUUA 4JDYA 2VEIA 4FF7A 1M7OA 1C9DA 3RFAA 3F4WA 4OV9A 4OGZA 3E12A 4UTKA 1JCXA 4YCOA 1H7XA 5BMXA 2BWGA 4Z0JA 1LBFA 1MO0A 3N2MA 5HWJA 4RZ4A 3CB8A 4QITA 5AOUA 3A22A 5G4EA 4IOTA 1I45A 5FF3A 5K9CA 1UCWA 3S9YA 4WZHA 2EAWA 3TMQA 1W3NA 4XZ9A 1XKYA 3A9IA 3PAJA 2QCNA 5F2LA 3DFSA 4O13A 5LGXA 1ICSA 3T40A 2QCHA 1SUXA 3IEBA 3QW4B 1XM3A 3RLVA 3LLFA 1GJPA 3TCEA 1W5PA 2P10A 2OMAA 3E02A 3GX9A 4TR9A 2C1HA 4ONVA 1QPOA 1LM1A 2ZA2A 3OIXA 4JXCA 5LNVA 4WY0A 2QCDB 5EYWA 2NV1A 3A24A 3FKRA 1FXQA 2Z2UA 2X2GA 4ZQNA 4L4MA 3O06A 4I9AA 1A5BA 2OT1A 4UC5A 1VCFA 4N9EA 3HG5A 1NEYA 5FF0A 1FUYA 1QPNA 3USBA 5HJLA 1H62A 1LYXA 1G4PA 1KV8A 4FNRA 3FJLA 3QC3A 1VH7A 3LDVA 2A21A 1DJNA 5LNRA 4JX4A 2CLEA 1RD5A 4QNWA 4Q4KA 3LHUA 4ZVJA 1IXQA 3T4CA 2VKZG 3LXBA 2QR6A 1HFBA 2EGZA 4LS1A 2P1FA 4MFEA 2CLIA 3W2LA 4B5NA 3GDMA 4GUFA 3WK0A 5DXXA 1G6CA 3PVFA 3UY8A 4MZ8A 4UTUA 4FB7A 3C2FA 5AHFA 3TUUA 3NGJA 4DPPA 3WJXA 1K8YA 4AEOA 2ZBTA 4PL1A 3BARA 3G8RA 3Q37A 3GVGA 1ZENA 3C52A 3YPIA 2C3ZA 2ATMA 3IVSA 4PTNA 4JEQA 3ZR4A 3G0UA 3PF3A 5F1UA 2GQ8A 2OZ0A 3O07A 3HPZA 4O1CA 1L2UA 1B4KA 1TV7A 3ZWTA 4JGDA 4O57A 4R34A 3UXDA 3TMLA 4O0ZA 1LTDA 2V5BA 4JDBA 3PULA 3B04A 1JCNA 3NEVA 3TA6A 1KV5A 3F1QA 4GJ1A 2IQTA 4A22A 3S1WA 5LHFA 1EWEA 1VHNA 5C55A 2X1UA 1PHQA 4DO4A 1HUVA 3HQ1A 3Q58A 3TAOA 3NZ1A 3ABSA 3UY7A 1EUAA 2X16A 2DZWA 3NPXA 4FO4A 2FB3A 2BTMA 3N34A 3HGJA 4MYAA 3TIMA 1OFRA 1QNVA 3HIJA 2RFGA 4O16A 1L9WA 3W7RA 3BGGA 1KW1A 3PM6A 4BI5A 1PL9A 1V5XA 5D2YA 4TU1A 1OHLA 3FJ6A 1VLWA 4EWND 3DFNA 4NXSA 1GTHA 1SFJA 1AW1A 3ZFHA 1JRBA 2ISVA 4GRSA 1XL9A 1OFPA 4HPXA 4PFMA 3W75A 1KFBA 4ML9A 4M6QA 2YW4A 3RF9A 4JTEA 3C0JA 4S1FA 4YMZA 3VE7A 2FDSA 4UUIA 5C54A 1O5KA 4ZL1A 4U28A 2WV8A 2BZNA 3IGXA 2H8XA 4PEKA 4AVFA 3P74A 2AAMA 3DZ1A 2A4AA 2G97A 3GNNA 3GKAA 1AW5A 4NXKA 4LVGA 3MW7A 5I3KA 2YYTA 1SW0A 1X1OA 4WX2A 2J24A 2NUXA 3KFTA 5AFDA 3LBCA 2WKJA 4NUWA 2YPIA 4JIPA 4QJ1A 4NJHA 3N19B 1F6PA 1NVMA 2Y6ZA 1XBYA 3SECA 2PURA 3TXVA 4IQLA 2ZYFA 4DF1A 4W9TA 4JY8A 2FPVA 1KFLA 2A7PA 3CQ0A 2OCZA 4XKYA 2NWSA 1M6JA 4UNLA 2QDGA 3MYOA 1AG1O 4LV9A 3SJ3A 3VKJA 1BTMA 5HWMA 3CWOX 4GUIA 5D05A 4H6KA 1R2TA 1OX4A 3LHWA 2V82A 3IIVA 2WNQA 3PBYA 1EB3A 1H63A 4UCGA 3UWZA 1OVDA 3B8DA 3G1XA 1YTKA 3I65A 3R13A 3OVPA 5FEWA 3TXZA 4A29A 3M16A 1RV8A 3U8GA 3S8HA 4JY9A 4A2RA 2A2IA 1B9BA 3BPWA 3CHVA 5C5YA 3I7RA 2YR1A 2FIQA 1FDJA 4O52A 3W7DA 3W71A 1K03A 3IGUA 3BGJA 3TV8A 4N9BA 3LOTA 2ZRVA 1QR7A 4TMBA 1ZY9A 4MY1A 4RKAA 1W1ZA 3W1PA 1D3GA 1K8XA 4GXMA 3I68A 3TE9A 3A5FA 1EIXA 1WX0A 4YLWA 4BFAA 3O05A 3CPRA 1QOQA 3IVTA 2FQIA 2B0MA 1DQXA 4KWVA 2VEPA 2ZRYA 1H7OA 5TIMA 3DENA 1ZCOA 3C3NA 3NAVA 2JGYA 4EF8A 1LRTA 2H3DA 4NNAA 2NUWA 1Y0EA 2Y63A 1ICQA 1NSJA 2CLLA 3BV4A 2GPTA 5F1VA 3QYQA 2VEKA 1GTEA 3MJYA 2XN1A 2YGYA 5IBXA 3THQA 1TO3A 3IV3A 4O12A 2V8ZA 3L67A 1AW2A 4GE8A 5AYYA 4Z08A 3MBFA 3M6YA 1QO5A 4LS2A 5BW6A 2DZUA 3C2VA 2GVJA 1F76A 5BNKA 1O95A 3C8FA 2TMDA 4K37A 3PY2A 3B0PA 4BF9A 1W56A 3G0XA 3U6WA 4JYDA 5EL1A 3W84A 2V0TA 4LUIA 3W2UA 1THFD 2LLEA 1F5ZA 5G1YA 4LW7A 4C1LA 3SGZA 3S0CA 3M5ZA 1GPWA 2QCGA 3HB9A 1KM0A 5IM51 3T78A 1W0MA 2ZQ0A 4WOQA 4UTWC 1TJPA 1V7YA 3LTSA 3N9RA 2WQPA 2VFGA 3PWAA 4BWLC 1DL3A 3KRSA 3G3DA 1W3IA 3QJAA 4LC6A 1EA0A 4O1DA 1HO1A 2Y7GA 3W88A 1OX4B 2GJLA 2C0AA 1G7UA 5DY3A 2YFNA 5E1QA 3W22A 3WK1A 2GJNA 1SO3A 3AJXA 4PH6A 3W7OA 2VXNA 3FLUA 3HOJA 1XC4A 4UR7A 3DI0A 4MPQA 5KZEA 1VRDA 1K7XA 3GAYA 2Z0IA 3NM1A 4JTLA 1Q6OA 1SFLA 4IGHA 3W1XA 3NYZA 1H5YA 2F7FA 3UPBA 3ZWSA 5I3IA 2TSYA 5HUOA 3BW3A 3W1UA 4UFLA 3GDRA 3PS7A 1EP1A 2Y85A 2QCCA 1T0OA 3W2MA 1LOQA 1CX9A 1YDNA 3CWNA 5HQEA 1VHCA 3W3OA 1TREA 5L6UA 3HGRA 3W1RA 1X8FA 4MKNA 4R7JA 4I7VA 1CI1A 2QCDA 5G2WA 1FWRA 3DFTA 1TPC1 3STCA 1W5OA 1DQWA 1EP3A 3TU9A 1ME9A 2FJKA 3TK7A 1OF8A 2C19A 4JR5A 3G18A 2W6RA 2ISSA 2PCQA 2ISWA 2YCEA 2NUYA 3C2RA 1LBLA 1RQHA 1LLZA 4UMAA 2OT0A 3TSMA 3PB0A 1FCUA 1F73A 3N14A 5FEXA 2V9DA 3BLEA 4I7UA 2CLHA 4N2YA 3W07A 1MEHA 1UUOA 1TPUA 1FWWA 1VLIA 3UZJA 2X1RA 1JCLA 4JTJA 3PG9A 3D0CA 4CQAA 4UMCA 5LNWA 3QFEA 3S5OA 3EWWA 4RLIA 3TH6A 3UNDA 3JRKA 5EA9A 3E0IA 4LVDA 3NXFA 3NQCA 1W5MA 3C6CA 4FX6M 4HHPA 4RR4A 3P81A 1OABA 4O4VA 1SPQA 5DY2A 1DHPA 3W1TA 1VYSX 4ORMA 1H1ZA 3U2OA 4BK9A 5LHEA 3V1PA 1YPIA 1QPQA 1PS9A 3B0VC 4HKPA 3W7IA 5FESA 4AB4A 3SGUA 1BWLA 3W7LA 5HINA 3QPZA 3L5AA 1Z41A 2FLIA 3GXPA 4JTFA 1J4EA 3KVJA 5F4SA 3FIGA 5C2XA 3N3MA 1F6KA 4IMFA 3PB2A 3IVUA 1OFEA 1SSDA 5CSRA 4K8EA 1WV2A 2JGQA
chains in the Genus database with same CATH superfamily
1LBMA 3EOLA 4HTBA 2ZZ3A 1KCZA 1U5JA 3W1LA 2CLFA 5FSEC 3HGSA 2I9EA 1GZGA 4MB4A 2H90A 4JKKA 2OSYA 3PBUA 1X7IA 4DBUA 4F0LA 1VFLA 2PMQA 1TIWA 1HG3A 5KTLA 1ZAJA 2Y7FA 4S2CA 1W31A 4OHQA 5AECA 2XH2A 4RXFA 2XDFA 4KESA 4GBUA 1I2RA 3G1RA 1EPVA 4LFYA 4GH1A 3U0HA 5EPDA 3N2XA 4DO5A 1RPXA 3FCPA 4UQEA 1TA3B 3AHVA 4D8AA 5EGRA 4WXYA 1PZ3A 5I5RA 1AA1B 3LUTA 3LMZA 1LF1A 5CPOA 4S2BA 5T9CE 3GBEA 2PLMA 4PB4A 2FH6A 4QE4A 4JX6A 4YVXA 3TJ4A 5IDIA 1TPFA 2Z24A 4NP7A 1Y5XA 1BSIA 3LXCA 1DWHM 4IPJA 1S5NA 2ZZ4A 4AX6A 3NPWA 2GDQA 4ERIA 2CFFA 5JBDA 1NU5A 3PWGA 1YNYA 3WN6A 3BJFA 4UZUA 1O66A 1E43A 1EXBA 4LCQA 3QTPA 4BI7A 1OF6A 3VI2A 1J10A 1WUFA 2NQJA 1XG4A 2P53A 4GUJA 1SJCA 3W82A 3ZJKA 3P8IA 4GABA 2UZ9A 3W4RA 3DC8A 4Z2GA 4WCJA 1V51A 3CMFA 4X2RA 2BNJA 4XAPA 4O50A 1Q6QA 1JDDA 3USZA 3OP2A 3N11A 5LKYA 1TPB1 3GVRA 4IX2A 2ALDA 4ATDA 2E1WA 3FFSA 3UA4A 1H7PA 5TD4A 3LPGA 3CHDA 3PANA 3EOUA 2WVVB 1Q4WA 3AJ7A 3UXIA 1I75A 3CIVA 1WKEA 3F7JA 4I9TA 3KOYA 4O1FA 1VS1A 2WMIA 1QDSA 3GZAA 4FXJA 1WBHA 1EO5A 5JUVA 2PS2A 1EZWA 2F8QA 3A47A 4QEEA 1QRQA 3E6EA 3WEOA 1GOXA 3WZ0E 1W1IE 1HGWA 3G22A 3UR8A 1H7WA 5C8BB 2DT2A 1XH0A 2XIOA 1ME7A 2WMKA 5DLCA 1DV7A 5REQA 2EPMX 3OBEA 1GQNA 2CWXA 4L1WA 3DHFA 4Q8MA 4GQGA 5I09A 3B9NA 1O6IA 1ZBWA 4S3FA 2GSJA 3QOMA 1MEIA 2QJIA 3CLWA 4F0MA 4DQWA 4REQA 1X39A 5AHLA 3HGOA 1JFXA 3BSGA 3EDFA 3CH9A 1VR6A 1O60A 2CLMA 4AVNA 3KL3A 4LVBA 2XN2A 5HULA 3BG3A 1R3QA 1XLEA 3GU1A 4XIMA 3W2NA 4GXPA 4O17A 1EGZA 1JGMA 4C6PA 3FVDA 4U5IA 4AD4A 4PBGA 2VRJA 3N73A 2QS8A 1R5YA 5KEZA 3E2RA 3FAWA 3OW1A 1CGYA 3GC4A 4XAZA 3O63A 3FX4A 2QUMA 4LC8A 3EWZA 3W1AA 3BJSA 4FNSA 3KTCA 4WJ8A 4A6GA 1XHGA 1S3HA 4AY1A 4RK8A 4PRWA 2CU0A 3GFZA 3DDMA 5J5DA 4O18A 1XGZA 2CZEA 2VGGA 1E3ZA 2QPXA 4DXXA 1HKIA 4M51A 3CM4A 3DU0A 3CQKA 3O8AA 4IIFA 2Z1BA 2ZA3A 3BSHA 1X6UA 3LRKA 2W0UA 1CXHA 2AOSA 3NYDA 3TR2A 1DJXA 3ANYA 3N4FA 4HSOA 3WK2A 3VNIA 3B05A 5CGTA 3SEPA 1JF6A 1KR1A 2VT0A 1Q2SA 3IANA 2O92A 4HPHA 1GZJA 1W1B1 4HBKA 4IPLA 3GXTA 1WOAA 3MSGA 4OBTA 2D73A 2FZ9A 2TAAA 1JIBA 4X9SA 3UWWA 1EBHA 1QWKA 1QOXA 5GVJA 3R10A 2YFOA 3ARRA 3NVDA 3TC3A 3MHFA 4RZBA 1VENA 1OYCA 1S1RA 1IIHA 4C7FA 3CC1A 2VC9A 1JCYA 2I1OA 2VVSA 3R8HA 1E1FA 1G01A 3STGA 4JTHA 4J4KA 3SIZA 3S42A 3WJYA 3QR1A 4R7WA 4C6JA 3WQPA 1KRCC 3AO0A 1DJHA 4E8GA 3VUPA 2G96A 1XLCA 1W3JA 2C0HA 4IQDA 5DCEA 1L0PA 2YB4A 1FY6A 3C0QA 4GY1A 1F2JA 3CUFA 1PIIA 5D2VA 2FVMA 1LG2A 1H09A 2V2HA 3E0VA 5CZTA 5G2IA 4UQDA 3GNDA 1M5WA 2E8ZA 3S2JA 1NELA 1OG0A 1XLAA 4H7ZA 1I6NA 4C65A 2QIIA 1XFBA 5FI8A 3BL3A 1J0ZA 5D38A 1E0TA 3Q2DA 1UKQA 3F03K 3H7VA 4XSMA 3APTA 4JIRA 1JNDA 3IJ9A 1DJGA 2PWFA 5DFAA 4Q8OA 2X09A 1RCOB 1AMKA 1TZ7A 1R3RA 5AZ1A 1A5UA 5IXEA 2QMJA 4TVCA 3S2MA 3N25A 3FGCB 4QJ3B 2XWDA 4JYEA 3EB2A 5A5WA 1FCBA 3GYEA 1PTAA 3M5VA 1C9WA 5RUBA 3GNXA 4XX6A 4B5XA 3PZNA 4E5TA 3U4FA 4JQ4A 3ITCA 3KXQA 4TMCA 5HAOA 4GY7A 5BWFA 4M0XA 3AZTA 3EEGA 3URBA 3GY1A 1AL8A 2RJGA 1P1XA 1QI0A 3OB8A 5TQLA 2X1SA 3WSUA 1D3CA 4GWEA 1NDWA 1XH1A 2NQ5A 1D3HA 2XFYA 4UQAA 1DP0A 4XD6A 4HYVA 2QCEA 1RK6A 1HX0A 1DWJM 3KDNA 4C7DA 6TIMA 1B4EA 1IZCA 3TW6A 2QHAA 2I5QA 3U2ZA 4GKLA 4MB5A 5A8MA 3WMCA 3RR4A 3UVAA 1WDWA 1UASA 4WR3A 1UQYA 3LNPA 1CW2A 3WFLA 4MWAE 1XSKA 2WO5A 4WVXA 2BVYA 2WNNA 1SQ7A 2VEMA 3V5OA 3P61A 3AHYA 3Q65A 5AB3A 1PKMA 4H9XA 4EPEC 2NXGA 4UTMA 2GGEA 2YA0A 2P3ZA 3T2OA 4GG9A 1A5KC 3UCQA 4P5UA 1A5AA 3ZJ6A 3MUAA 1Z3NA 4A3RA 1QWGA 4WGHA 5CC6A 3J7HA 3KUMA 4M1RA 1X1NA 1H0GA 3WLRA 3WF0A 4QJ5B 2GSHA 3P5ZA 3PUEA 2GQ3A 4JTDA 4LT9A 3PZQA 4NVTA 4RE4A 4TVDA 4D6JA 4I8YA 2D2GA 3KWSA 3NQ6A 5A6AA 1RHCA 3CXOA 3DIPA 3MUXA 4AZGA 4IUOA 3GAKA 2J75A 2WSQA 1TCMA 2XSBA 3H2OA 1R3WA 2C14A 3BW2A 3S1UA 4RDZA 1KM1A 3ARPA 2EPNA 3TQPA 3NA8A 3W7GA 2QVNA 3S2CA 3ZVHA 1YYAA 3D46A 4AHQA 5A6MA 1LRNA 3ZOAA 2Z7GA 1XINA 3K30A 2NZLA 1SJAA 3WH7A 1OK4A 4DLFA 4O0KA 3VD4A 3THUA 3ARUA 3IAPA 4V1XA 4XAGA 3CEPA 3HV9A 2F6UA 1EHNA 4PTXA 1M3UA 4GIYA 1OD8A 5H2ZA 5CZSA 3TNOA 1KC7A 1ONXA 1JUEA 1MDLA 3VINA 3GVWA 5CQ1A 2HNHA 3K46A 4B5WA 4C1KA 5ABFB 3URQA 1O68A 3IK2A 5HWNA 4AAJA 4R33A 2YJQA 1XIGA 3RK8A 1FWTA 3IV8A 1DPMA 2QV5A 4O53A 2HISA 2YZRA 4GNVA 4L5ZA 4HT3A 3WJWA 4ZE4A 2VX7A 5E93A 3MANA 3EWCA 3VIGA 1XBVA 3HQOA 1YLVA 3M5YA 1TQJA 3RN6A 3UR2A 5K9XA 2GUBA 4I5RA 1MQQA 1SJBA 3VOGA 2ZX6A 1CT5A 2Y70A 4G7FA 1V03A 5JVLA 4DM1A 1EEXA 5TBOA 1JDFA 3AHXA 4WUIA 4OWGA 1JCJA 4LV4A 2GUYA 2Y8UA 1BKSA 4E2VA 3B8IA 2VM8A 1FTXA 1WXYA 4WDTA 2DJXA 3VNYA 4QAIA 2PDIA 1OT1A 4W93A 5LIWX 1KD0A 3C61A 1R87A 1EFZA 4XK2A 4ROPA 3QRHA 5A6SA 1JQVA 1DE6A 1MDRA 3IS4A 3VMOA 4PMVA 3GG7A 4URIA 5K2ZA 1REQA 1OIMA 4LUSA 3OA3A 2NSXA 1LRQA 4HIBA 1SYTA 3IJ6A 2OB3A 3LN3A 3BLKA 2Z6JA 4GPNA 6XIMA 5BRQA 4ORIA 3QOKA 5BOOA 3DKJA 4C6IA 2CZ5A 3NQ2A 5K3VA 3UJRA 4PUKA 3WH5A 1JUBA 4O10A 2PTZA 1BF6A 4Z2LA 3KM8A 4PRTA 4L9XA 2PP1A 3FS2A 1PDYA 3VOFA 1E9IA 3VDHA 2C15A 4XTDA 2FH8A 3LPFA 4JTGA 2BOFX 3L0GA 1V0KA 3LD5A 3EWXA 2V5DA 4QLKA 4C90A 4JHZA 3ZYZA 1VFHA 1ZP3A 3UCCA 3TSBA 5CPMA 4MY9A 3ABRA 2DORA 4PYSA 2P76A 2FZDA 4HJWA 2YXXA 4HK6A 2YLLA 2JF6A 1XRTA 5K7JA 4O0QA 3LM3A 1AK5A 3ABXA 1T8XA 4JFWA 2Z2AA 1AFSA 3A64A 5FJOA 1POKA 1TJ0A 3G1HA 4NJJA 4DF0A 2GJPA 2X7WA 4ZR8A 1Q6LA 3UGVA 1QJWA 3VNZA 2Y8VA 4OFCA 3SR7A 1FH7A 5D04C 3UWUA 2R91A 3CU2A 3NL3A 4HNNA 3PTKA 3WQVA 3LTYA 4W85A 4KCTA 2WC3A 1WQ5A 4FNUA 1FP9A 3BZGA 3T2QA 1UR4A 3GR8A 1IEQA 4EPBC 1SO5A 5C7HA 2DZVA 5ABTA 7A3HA 3W1MA 4FHAA 1KWGA 1EJ7L 1E6NA 4MZYA 1P48A 1OB0A 4C6FA 1V6UA 2PRMA 1LCOA 1JJKA 4NILA 5JMUA 2DZBA 5E09A 4JIQA 3A5VA 1CZ1A 1JCMP 2POZA 2ZUMA 4DAIA 2PWVA 2H9AB 3B0XA 1TCDA 1UIPA 4DF2A 3G1AA 5LYRA 1F61A 4A35A 1GOWA 5F2IA 3KS5A 4C1NA 3DX5A 1I1XA 1HT6A 4KPLA 3LG3A 1PCKA 1UKSA 3C0SA 1CNVA 2P88A 4FP1A 1OCQA 3UJSA 1BKHA 3ELFA 4CD4A 3WEZA 5C9UA 4NIRA 1KBLA 1QNQA 1TV4A 4LS0A 1RAKA 1UJPA 2E6AA 4OU1A 3WDPP 1V02A 1GOKA 3W7NA 2WW5A 1WXZA 3LSCA 3MWCA 2UWFA 3DCPA 2BY0A 3GFYA 1TPEA 5JIPA 2AKMA 5I23A 1PZ0A 2V67A 4HD5A 3SZ8A 4W84A 1P6WA 3NQMA 3AROA 3TYUA 3HPXA 5CBBA 1KFKA 1RCQA 5K4XA 2ABBA 3SSZA 2YCLB 1TYGA 3U2CA 1P0NA 4GUHA 3THAA 2ZXDA 2F9RA 3PZ9A 2DSZA 1JDCA 1FHVA 3M0ZA 4MKSA 2VENA 5A2BA 1XYAA 4PZVA 1KFJA 4ZQOA 1ZBCA 2WSRA 1F9CA 3BOFA 1OBAA 3W7HA 1TRDA 1PZ2A 2Q3OA 3LEPA 3MZNA 3W37A 5KMYA 1GWJA 4XKYB 1T41A 2A3HA 4R9OA 1MMFA 4XAFA 4UFKA 1E9LA 1UUMA 3TEVA 2QF8A 1HTIA 4IISA 4JN8A 4QISA 2Y7DA 1XIMA 3QZEA 3QZ6A 1Z69A 1Q3NA 3B4YA 1J0KA 3EX4A 4RCXA 4CLMA 4N9DA 1WDPA 1GUVA 1ZGDA 2QCLA 3V0SA 4HMEA 3G0SA 4Z1AA 3WLJA 2FZMA 1Q7QA 2A85A 3V5CA 4ADSA 9XIAA 4NAFB 2PD9A 1J96A 8XIMA 3G2GA 4CNUA 2DZPA 2JBMA 4C60A 2E5BA 2QT3A 3NQAA 4I9JA 3SFKA 2E7FA 4ZB0A 1ZUAX 3L65A 1L6WA 3NQDA 3VOCA 1CXFA 1CCWB 2ZDRA 3ALGA 5KZMA 2UBPC 2UV8G 3GW3A 2O7QA 4H8NA 3VMPA 4NZJA 2CBJA 3VZYA 1V6XA 1YDOA 3H21A 4KGJA 3PUDA 1K9TA 3VDAA 3KZPA 2R6OA 5A6BA 4QDWA 4UWMA 3EKLA 4FMVA 7XIMA 3QGVA 3NWRA 3M41A 4RE3A 2D23A 3ZSTA 2ZTJA 4OE7A 3M0XA 4CKQA 4ZO9A 3SIMA 1B3OA 3KE0A 3G6LA 2IXVA 5DMLA 1NP2A 3EEZA 3TYCA 2V6AA 3IIOA 4H8VA 2D20A 4MM1A 2BS9A 4QE1A 3RX2A 2PTWA 1DWAM 2Q01A 3LRLA 3QHOA 1XICA 5C9RA 1PSCA 3KOZA 3DXIA 3BAIA 3F5JA 4Y8EA 3H70A 2E6FA 2QKFA 1SZEA 1XUUA 1E72M 1M7OA 3BUVA 3F4WA 1E6ZA 3NTYA 1JCXA 3EDJA 1LBFA 1RCXB 3FEQA 1JXKA 3CB8A 5AOUA 3Q67A 1CPUA 1I45A 5DQPA 4PTVA 5K9CA 4HP5A 4WZHA 3K1DA 2EAWA 1NOFA 1C7SA 3S5SA 1VFOA 1XKYA 3A9IA 4YYCA 1V0LA 1SMDA 4WJXA 5LGXA 1XRVA 3T40A 2QCHA 1XM3A 3RLVA 3BANA 1GJPA 2WJFA 2XVLA 4XO6A 2P10A 2OMAA 3GX9A 2I9UA 4LEFA 2ZA2A 3AS3A 2HEJA 1ADDA 5LNVA 5ENLA 4WY0A 3FKRA 1JCTA 4XZIA 4ZQNA 5FL0A 3O06A 4I9AA 2OT1A 2EG8A 4UC5A 3HG5A 2I5GA 1FUYA 1QPNA 4XSLA 3USBA 3UW6A 1V3KA 3TW9A 1UZ4A 4QS6A 1P6BA 3WBYA 1VH7A 2A21A 1DJNA 3VILA 4JX4A 4D1IA 4IGMA 2DGAA 3LHUA 4ZVJA 5G1MA 3ARTA 2VRKA 3N2CA 2VWSA 2QR6A 4LS1A 3W2LA 3E0FA 4ATLA 4DYJA 3PVFA 2PWUA 2VDHA 4DJFD 2HJPA 2MNRA 3THDA 4B3ZA 3MCOA 4EPKA 4DPPA 4PL1A 1EX1A 3C52A 2YIHA 4LXFA 3PZUA 2GQ8A 5CLTA 2PP3A 3B40A 1L2UA 1B4KA 1BVNP 4CD7A 3ZWTA 3N29A 4R34A 4J3SA 3N6JA 1WZMA 4O0ZA 1W1TA 3UR5A 4MWAD 5BXTA 3AYSA 1PAMA 3H7RA 3L4YA 1JI2A 1KV5A 1UMLA 3F1QA 2I57A 2IQTA 2WC7A 4W5ZA 5LHFA 1FWCC 3TYDA 1EWEA 1CIUA 3MVTA 3R6IA 2X1UA 5FJUA 1V6YA 5A8OA 3CJPA 3UY7A 2XPKA 4KRTA 4WSKA 4BZYA 2X16A 1SJDA 4DJFC 1IV8A 3N34A 3HGJA 4MYAA 3TIMA 1OFRA 2WQDA 1AJZA 3TVAA 4Q8UA 1PL9A 4P7OA 3DFHA 3WENA 4GCXA 4GZ7A 4NXSA 1JPIA 1AW1A 1PIGA 4GRSA 4AD5A 1PKLA 2PDXA 4ML9A 4M6QA 1JZ6A 4MG4A 4MWAC 3AU2A 4QRNA 1JAKA 3C0JA 4YMZA 2D69A 3VE7A 4CVUA 3IJ8A 1O5KA 3N15A 4FZIA 4IJCA 3GVVA 4ZO8A 5A94A 4DWSC 2A4AA 4GD0A 3GNNA 3GKAA 3AC0A 2FGZA 1YE6A 1AMYA 3MW7A 5I3KA 5C9XA 4Z2KA 3VMNA 3A3WA 1X1OA 3LGGA 4WX2A 3S2LA 4J2PA 2NUXA 3MKVA 4UZSA 3PJXA 3K8MA 4JIPA 4NJHA 1PX8A 4RUBA 3N19B 3WF3A 1F6PA 3VM7A 2Y6ZA 4CN6A 2PURA 2QJMA 4QLLA 4C5ZA 2PGRA 3ALFA 3CQ0A 3WD2A 4L1XA 2OCZA 2QDGA 1AG1O 4LV9A 1WP6A 4WLCA 2E9MA 2OODA 2OLSA 3IACA 4H6KA 1OX4A 4C6LA 3IIVA 1I0DA 3ITYA 4M8UA 2IQDA 3GNPA 1OVDA 3B8DA 3G1XA 1YTKA 3TLQA 3R13A 4BF7A 4GZJA 4ZGYA 4GJIA 3RM9A 3SBFA 3RRAA 5HNUA 4DJDD 2FTWA 1U30A 4PB3A 1MZRA 3GSMA 3A4AA 3HPAA 4K68A 5C5YA 2FIQA 2FJUB 2PDFA 4CUCA 2KX9A 2WMIB 1IEIA 1J93A 3IGUA 3BGJA 4NYYA 2ZRVA 3JU2A 3CZLA 4XZHA 3KWXA 1K8XA 1WZLA 1EYWA 5HOSA 3N12A 1VKFA 3TE9A 4DBWA 4BFAA 3O05A 3HQPA 1BPLB 1LWIA 4CNTA 1QOQA 2FHBA 3QTGA 1PX4A 4OIFA 3BV7A 5REQB 1H7OA 5TIMA 3M0LA 3SCSA 3VOJA 1ZCOA 2VP8A 3RO8A 4EF8A 2H3DA 1GW1A 4E2OA 2NUWA 1NIUA 1UZ1A 4ICCX 1Y0EA 4Q3MA 4C6NA 2XGBA 3BV4A 5F1VA 1GTEA 2XN1A 4ZENA 4DJDC 1F3XA 1ODUA 3L67A 2OEMA 3CHEA 4GE8A 1TE6A 2PF8A 5BW6A 3WBAA 1A3HA 3WLHA 1XYMA 1UPPA 3BJTA 4REQB 2TMDA 4K37A 3I4EA 3CK5A 4W8LA 2DT3A 3W84A 4LUIA 1THFD 2LLEA 3GH5A 2GK1A 4C1LA 4FF5A 3S0CA 1MI3A 2PWDA 2ACQA 2IPGA 1C8XA 2ZWYA 1TJPA 2XH4A 3SUSA 2VFGA 1DL3A 1L6FA 1ZJHA 1W3IA 3CGTA 3AMGA 4GACA 1EA0A 4O1DA 5C2CA 5HNTA 2OG9A 2C1IA 1NWTA 2Y7GA 4QE5A 2GJLA 2PDMA 2XSXA 5E1QA 2DIJA 5A69A 3IUIA 2GJNA 4DUOA 1CGUA 1ZU8A 2PI6A 4S23A 4J7RA 3DI0A 3SN4A 3OYZA 3L2MA 4CQDA 2GL5A 1M68A 2BY1A 2IKHA 4IGHA 3W1XA 3LYEA 2XVKA 3IJDA 5F7UA 2F7FA 5I3IA 2D1ZA 3RU8X 3BW3A 2WSKA 3BOXA 4QP0A 3KHDA 1K8CA 2Y5JA 3S2NA 4EAMA 4LALA 4GO8A 6REQA 1LOQA 3UYIA 3WNNA 3S6TA 2GDVA 1VHCA 1TREA 1YE4A 4W88A 3HGRA 4R7JA 3FJNA 4I7VA 4HCDA 1J0YA 2ACUA 1FWRA 2CNCA 1WKFA 3CYJA 2V3FA 1W5OA 1DQWA 5AYBA 1EP3A 3TU9A 2GVYA 3TK7A 1OF8A 1HZYA 1TJ2A 2ISWA 3QZAA 2XGZA 1HKJA 3I3EA 2NUYA 3C2RA 1LLZA 3TSMA 2PDNA 3FXYA 3PZOA 2CLHA 4GKTA 1MEHA 1UUOA 3GS6A 2X1RA 1VEMA 5GNYA 5IDZA 3AYTA 3URNA 3QFEA 2WKLA 3WQDA 4DB7A 3EWWA 3CYVA 4LB4A 4LVDA 3P3BA 3APGA 2ZC8A 4E4FA 4LUYA 2BHZA 1GQLA 1OABA 2VMFA 4WRHA 1UP3A 4ZTYA 4QDMA 2PDQA 4H83A 1H1ZA 1KFWA 4BK9A 1ODZA 7TAAA 4HKPA 3W7IA 2B31A 1BWLA 1Q66A 5HINA 1XYCA 1Z41A 3GXPA 2GSEA 2Z29A 4R3UA 3FIGA 3NO3A 3S9ZA 1DYSA 1HL9A 1X6NA 1V3HA 1UR8A 5EMYA 3PB2A 2XJ7A 3LSBA 5CSRA 3KOXA 2A7RA 1VEPA 2Q6ZA 3DUGA 3OZMA 4L7ZA 1XSJA 5DX7A 5IHSA 3W83A 3H8AA 3EX2A 1S2CA 1EDQA 4NHVA 3AS2A 2Z1WA 1DJQA 4XBSA 1NQKA 1EWDA 5PTDA 1A0DA 3MUCA 3OOQA 1EPXA 1XISA 2AQOA 4H3DA 4P61A 3TLLA 4AD0A 2W61A 5HQLA 1NF0A 3AXMA 1IEWA 3SQLA 4IIGA 5HANA 1OGBA 2R82A 1W1PA 4US5D 2OX1A 4B4FA 1XDMA 1ISVA 4IXHA 3SFWA 4UTTC 3OHMB 4XQ6A 2PGFA 4YIWA 1S2TA 4UMBA 3ZR5A 2ZX7A 3NDZA 1OYBA 1ZS2A 3C5QA 4IJBA 2PP0A 1WKYA 4LUTA 4MNJA 4K8GA 4F9JA 3N6QA 3KAOA 1NTHA 2DPEA 3UWVA 4O8RA 4PMYA 3C0LA 3OIHA 3VNLA 3WD3A 1GNXA 4X22A 3PUOA 1EX5A 3QHNA 5HMSA 5I00A 4GQQA 2PZNA 4JKLA 2QDEA 3AIWA 2G0WA 4D6IA 1D9EA 1XYBA 4XB3A 4LRTA 2WCAA 2EPKX 3KL5A 3GTHA 4HA0A 4YHEA 2GGGA 2J7HA 2INEA 2PE4A 3LCLA 4U31A 1LROA 1UA3A 3P67A 5CC5A 1FWDC 1WDQA 4MFDA 1UWUA 2VCCA 2YLAA 5AN7A 2GUUA 3U48A 5E0FA 1MRQA 3DFPA 3OLIA 2IPWA 2BGNE 3KS6A 3QW3A 2V5CA 1TPH1 1VYRA 2VDGA 2X41A 1HKKA 4UTIA 3UJFA 3POCA 3GDLA 3TW7A 1KRAC 1UBSA 5LA1A 4NJIA 1UH3A 3V35A 3NQFA 2ZZ6A 1GVFA 3HV8A 5FEZA 3IRDA 1D7FA 3L5MA 1TSIA 3L9CA 4ZB2A 2HTMA 4PMZA 3EMZA 4KEMA 2ZADA 4DO7A 3B8TA 3TZNA 3C2OA 2DP3A 2V3GA 3IGHX 4XAYA 2DJLA 3QV7A 4RZ5A 3K5XA 4I8DA 3GDTA 3W27A 3SDOA 3DBNA 1GVYA 3UWYA 2FPYA 4ZQRA 2J7BA 3MI2A 5MHBA 3PZMA 3VD9A 1W1YA 2CPUA 1KM2A 1OGGA 5BMWA 5ABGA 4US6A 1XCXA 4W5UA 2QEZA 2NVDA 3RNDA 3ZVHB 2CXGA 3M0YA 1LOLA 3SN1A 3STEA 1E5JA 4DVOA 3RIKA 1O5QA 1JL8A 4LNYA 4CQCA 1EBGA 1BYDA 3LQLA 1F3EA 1UP2A 4A8IA 1M03A 4BHYA 2ZFAA 2OXNA 1Q45A 3T0DA 5D37A 2WMHA 1KFCA 4NX0A 1XLKA 3UGRA 2DY3A 1W91A 3W73A 1SO4A 5D03A 2F84A 1EGMA 1EP2A 1O5RA 4J28A 4XD3A 7ODCA 3LV6A 1G69A 4Z2IA 4MLJA 3SRHA 3PR2A 2DSKA 1OCNA 3TOYA 1ONWA 4E8DA 5KITA 1ZBKA 4ML4A 1ML1A 1QUMA 3W6MA 2J74A 1M7XA 1EF2A 2WHMA 4QAWA 3TC6A 2HE5A 1A5SA 3BQ5A 5AC8A 1IE7C 3ABQA 2VC6A 4DAFA 4ZA0A 1SVDA 3NDOA 4PMRA 1PIFA 5AYXA 3APYA 5DRCA 4TIMA 2QGYA 3K4WA 4R5EA 3PPCA 4PE8A 4MNKA 1KBKA 4RPPA 1SO6A 2WJEA 4BI6A 1WDDA 5C6MA 4WOZA 3MP5A 2DEPA 2WCGA 3CMJA 2OR2A 3DFYA 4H6RA 2XM1A 1OZMA 3ZLFA 2ZX8A 3MI6A 1REQB 4LUSB 3ONBA 3K1GA 1MFUA 4QTGA 3OGRA 1VCGA 4NY2A 3VABA 1KBIA 2QDHA 3OVQA 1IXPA 3L4WA 3LBOA 4YTSA 4X2PA 1R46A 3H53A 2BBFA 4FOKA 3M0VA 1VD6A 4HYRA 5AHEA 3VGBA 1XRSA 3VIJA 2E68A 2RDTA 3MSYA 2XH7A 3ITVA 1MEWA 4N6EA 2E3ZA 3DG3A 1NOUA 3W72A 4L1GA 2CCRA 1VF8A 4YWSA 5LA0A 2WJDA 1R7AA 1JQXA 4NI8A 4ATWA 4OKDA 4TX9A 1XLFA 2KAUC 2DW6A 4DBSA 1JDEA 1XXXA 5CPQA 2EPHA 1VB9A 3QGAC 3W86A 2PB1A 2NXIA 4AHPA 3C56A 4JS3A 2CETA 5FF4A 2GVGA 1SM9A 4D9PA 3NL6A 3WLOA 1Z48A 3UWEA 4O4WA 4A05A 2ESCA 1UW9A 2A6LA 3KBNA 2WHKA 4FIRA 1KTBA 3PTDA 3RPTA 3LCIA 1FH9A 4RV3A 4KCVA 2DW7A 2BVWA 1UZDA 2GQAA 2J62A 5GPRA 5FEPA 4Z2JA 3UXAA 2DIEA 4PMOA 1TPDA 3BLPX 4GQBA 4POCA 4B9YA 3AHTA 3R0UA 4ZMGA 3CASA 4AWUA 1I2NA 5H6HA 1KA9F 3NOEA 4GCAA 4UXDA 1H41A 2OZ3A 3SI9A 3E0LA 4XUYA 2B7OA 4BS0A 4M3PA 3NQVA 1RY0A 1Q6GA 2NV2A 2Y1HA 4YCPA 5IRPA 1ISYA 4RNIA 2GLKA 1UR1A 2ZIDA 1XDLA 3FKKA 2X40A 4IT1A 3M9YA 4GC4A 3M0IA 3JR2A 4K36A 4CQ9A 4IPPA 4XZMX 1TQXA 2Y88A 1Y65A 4C1NB 3ITGA 2IS7A 1C3FA 2E25A 3AXIA 1FBAA 3O1NA 3I3DA 3FAXA 3AOFA 1EJSC 4HOZA 4IMEA 1H60A 1EC9A 4DJEA 3ZIZA 3VNKA 4IGNA 3DHPA 4RW3A 3HG2A 4E3VA 2RDUA 2JK2A 2WVTA 5KETA 5D9MA 1EJXC 3KVMA 4NSBA 2OYKA 4AQLA 2WLZA 3WJZA 2R94A 3F4VA 3CUJA 5HK4A 4MKVA 5FJJA 1H4PA 3M64A 3ARSA 4Y6GA 1T40A 2GWGA 1HXJA 1NM9A 4HTYA 1KBJA 4FI4A 3AS1A 4AEFA 3SCOA 4C7GA 4HZMA 5HJYA 3NO1A 5D4YA 1V3JA 3L2LA 1QPRA 1RALA 5LIYX 2XISA 3CUZA 1AVAA 3U3HA 3D3FA 2WHLA 4RDWA 4EXBA 1RY8A 4GO9A 3WL0A 1US3A 4DYKA 4O28A 4JTUA 2V81A 5M5DA 4BA0A 3M0MA 1S38A 4CQ8A 2XIIA 4MB1A 4JTKA 2CZVA 2EKCA 3MO4A 1J5TA 2UY4A 3QMRA 3NPVA 2P0IA 2YBUA 3S83A 1DIEA 3PSWA 1LP6A 5EKYA 2JE8A 3S6DA 3NNTA 1QNSA 1GOOA 1KFEA 1TB3A 4LGXA 3DHDA 4QG8A 4C6DA 1A3XA 2QF7A 1IWPA 3PUGA 1YX1A 2ISFA 3TAKA 4DUXA 2XHYA 1GVIA 2Z2BA 1GG0A 1BLIA 3T05A 4CCDA 5XIAA 2YZ5A 1M41A 4MB3A 3O3RA 5A1AA 3WF4A 1B3WA 5DRIA 3VIOA 3LCFA 3LXAA 5BROA 1E51A 1V6TA 2GGIA 2QUVA 1QTWA 4JIIX 5BRPA 2WPGA 2Z1XA 5EMKA 1XD1A 3C2EA 3N6HA 3O16A 5T26A 3T81A 1MWOA 2JQXA 2BSLA 3H23A 5J5RA 7PTDA 1AL7A 2HBVA 3VDCA 4D71A 3H2AA 4LQ1A 1XLDA 3K4DA 2R1KA 1FX6A 2WMJA 4NQ1A 1RD6A 4FNTA 2PRHA 1BXBA 2RH9A 5DO8A 3CUHA 3RGTA 5D33A 3TKFA 1FRBA 3MT1A 1B57A 2BXYA 1HGYA 3VGGA 3VD5A 4WKAA 3W29A 4KWSA 4J9JA 4UOJA 4H01A 1GKPA 2FVKA 1TR9A 3QV8A 2ZCGA 2F6KA 2P5NA 3T1GA 2HE8A 5EFFA 3QGKC 3WMBA 1PWLA 2AMGA 4FPSA 3PBVA 4WY0F 3I7SA 1F74A 4F40A 3UPWA 1J2BA 3P14A 3QM3A 3KVLA 2XIQA 3EXTA 3G77A 3KRZA 4PMUA 5HATA 1S5MA 3VPLA 3MI3A 4A4AA 3HFTA 1HIZA 1OC6A 2FZBA 3BURA 3WDRA 5KZ6A 4PR4A 3QN3A 4UTWA 1W8GA 3CUIA 2VZOA 3TQVA 1HF6A 1FWFC 3R58A 4PGLA 1UUQA 2ZWZA 4RNHA 4IFKA 4RZ6A 3MSDA 2HNEA 1OGSA 3B8UA 5D32A 3SCWA 2OO6A 4H6EA 2J13A 4R27A 3WNLA 5EY5A 1EJUC 4NZ3A 4RDYA 3KW3A 3MU7A 2CESA 3RPMA 1EZ2A 3RMEA 2QUNA 4WY0B 3CTTA 2PLKA 3W6LA 2E67A 2DUZA 3AICA 2PDGA 5DXYA 4IIDA 2D0GA 3QC0A 4AY8A 1WOBA 3N1AA 3W70A 1XLGA 2VFIA 1SW3A 4JHOA 4PUDA 3VNDA 2F61A 1ZAIA 3BG5A 4GYKA 3BLOA 1WDRA 2Z4GA 2VD8A 1G0CA 1SZRA 4H8UA 3ORWA 1AJ2A 2WOQA 3W7MA 1PHWA 5HNNA 1CB7B 3VOHA 4CN1A 3VZZA 1DWIM 1QXLA 6ENLA 1UC5A 1E6XM 2GOUA 4S38A 2JFEX 3DGBA 3LU2A 1SSGA 2PWGA 1OFQA 3C8NA 5I07A 2EKGA 2BMBA 3SURA 2QJHA 4QGCA 2OOFA 3SQSA 3GTIA 3STPA 5LZLA 3EB4A 1B3XA 1JYXA 3MDUA 2EBNA 1XIHA 4EANA 3OZOA 1T5AA 1E4MM 3ANVA 1Q6FA 2XINA 3I4KA 3WQEA 2DU2A 1UR2A 2JEQA 4F0SA 3AIRA 3ONCA 4P7LA 4HNOA 3HJZA 1UWSA 2VFEA 3MWAA 3UJEA 4IHCA 3OHIA 1XIDA 4AZIA 3TN3A 4JHMA 1QAPA 4DNHA 2PEVA 3FNDA 2E1DA 1UD6A 1A0CA 4YWIA 3ABZA 1EC8A 2G3FA 3NQEA 2CZFA 4GUGA 1M01A 3SO7A 1FKXA 3R89A 2FKPA 3CV1A 4FNPA 1RJPA 3TA9A 4JTRA 1ZP4A 1GQIA 5I79A 4W4QA 1VGAA 2E40A 4PBEA 2OLAA 4JNMA 1UPMB 1QHOA 3OU8A 4NU7A 5CCZA 1U1HA 2BOGX 1P43A 2OJPA 4CD6A 3CAQA 3U7BA 3CHCA 4MJMA 4EOUA 3BAXA 1XIIA 3OVRA 4KS0A 3ECQA 1QK0A 3VE9A 1J0HA 1RVKA 2INZA 4O54A 2W79A 3NZRA 3HM7A 3LTPA 2Y62A 2AGKA 1VCVA 3BG9A 2QMKA 3WUGA 4TUFA 2BHYA 3WH6A 2A0NA 1UZHA 2XGIA 4E0CA 1DIOA 1QFEA 1VAHA 1ZHAA 3NSNA 3ZJ7A 4JX5A 2EPOA 5DCDA 2GGHA 4FR6A 1I2OA 5I3HA 1JZ4A 3RCNA 4HA1A 3W1NA 2Z6IA 4E2DA 4ZOEA 3S46A 1MQPA 2QGHA 4ADUA 3R11A 2A3LA 1ZJAA 2PZ0A 1FWAC 1JAEA 3EDKA 1OADA 1ZNNA 1QHZA 4DELA 4Z42C 1DTUA 2UY5A 3TFXA 3FSUA 5AYZA 2ZRUA 5C9ZA 2IKJA 1UD2A 2VI0A 1BQGA 3RLUA 1YKWA 3I7QA 1RBAA 2EG7A 1J11A 4M7SA 4BCEA 5AZ0A 2A7NA 4GQRA 5KSWA 1VZWA 3ZT7A 1FHDA 1TTIA 3TDFA 1O1ZA 4HK7A 3ABOA 2WMFA 5T9BG 3UP8A 4ICNA 5CAKA 2ZC1A 2IPFA 1P0KA 1E4IA 1FCVA 1L8PA 5U7SA 2F38A 2V5LA 1U83A 3OQ8A 4MY8A 4MNMA 3HF3A 5DBTA 1I1WA 1LWHA 2J88A 1TV3A 3IRSA 2QCMA 3G1YA 4UNIA 4FIQA 4J3ZA 2R1MA 3R8GA 2Z00A 2X30A 4J35A 1EQCA 4DX3A 1DORA 4D6DA 3THCA 1TMHA 4LBSA 4V1YA 1B1YA 3MCNA 1EUNA 1TWZA 2F6XA 4L4PA 1GYLA 3MVIA 3QR3A 1IXNA 5DN1A 4MYXA 1PZ1A 4BJHA 3QQ1A 4QSHA 4ALDA 5I77A 3WQ5A 7TIMA 4L4LA 4FEZA 2J7CA 1GG1A 3UZYA 1WKDA 1J6OA 4UQCA 4FLOA 3E1F1 3HMJG 3DECA 3AYVA 4IXXA 2YXGA 1KRMA 4AEEA 2E0PA 8RUCA 3LB0A 3LERA 1FXPA 2PGEA 5B7ZA 2OEJA 4MLRA 5D9PA 3VFLA 4M24A 1WA3A 1LZOA 1XCWA 1B2YA 4W89A 4Y9NA 2HDJA 4TQTA 1A49A 3UCDA 3A12A 4AWTA 1ZB5A 4GISA 4B16A 1IZKA 3E12A 1E5NA 1ZZMA 2R1LA 2E4TA 4N42A 5HWJA 4CU6A 4RZ4A 4AZ7A 4ZEPA 3A22A 2WZEA 4C6EA 3GDBA 4IOTA 3GNOA 4PSRA 2G4JA 3S9YA 3MS8A 3C3UA 1CXKA 2WYSA 3WQCA 4XZ9A 3PAJA 3N4AA 2QCNA 1BG9A 3DFSA 2YOCA 5C9WA 4O13A 2YL6A 5GNXA 3IEBA 1IZJA 3TCEA 1JI1A 6REQB 3QHMA 3E02A 3EOEA 2YDSA 2ZUWA 3WX7A 4JXCA 1BRLA 3HURA 5EYWA 2ADAA 1WCGA 4DY1A 4X0NA 2ZXAA 2PDPA 1A5BA 1VCFA 3R25A 3H2NA 4B2DD 2D0FA 2DVXA 3FJLA 1GW9A 1BYCA 3LDVA 3VKKA 1V7AA 5CGMA 2CLEA 1RD5A 3T4CA 4DI9A 2PBGA 3LXBA 1HFBA 1H2JA 3EA3A 2P1FA 2GGJA 3HZ3A 4G7EA 4GUFA 3TP4A 3GIQA 5DXXA 1O12A 1XV8A 3UY8A 4GYPC 4MZ8A 4S3KA 1G9HA 1XSIA 1ITQA 1IWAA 1KNWA 4KIEA 4PUNA 3EMQA 3BARA 3G8RA 3UG5A 3Q37A 1UOZA 4H00A 3P2VA 2ATMA 1CEOA 2VURA 1A5NC 3IVSA 4PTNA 3WNKA 3CZEA 3UG3A 3PF3A 5CPSA 4F0RA 3O0KA 1F8IA 1TV7A 3EB3A 3WDHA 4JGDA 3UXDA 2NLYA 1GOMA 2VX4A 4JDBA 4H1ZA 3PULA 1ISZA 3B04A 3E38A 5AVNA 3NEVA 1NWRA 3MKCA 3GTNA 5DT5A 1LJYA 4A22A 3LY0A 1PB0A 3SRFA 1D8WA 3B8WA 1VHNA 4QCFA 4DO4A 5HPCA 3WNMA 2VOTA 3TAOA 3H4GA 3PZVA 1EUAA 3KBSA 1E6QM 2OU4A 2FB3A 2BTMA 2W92A 3O6AA 4S3EA 3HIJA 4HN8A 3QFWA 4BKNA 3H2CA 1KW1A 1UIOA 4BI5A 3W00A 4OECA 4TU1A 3N13A 3MQTA 2VQUA 4DNMA 2PWEA 3FJ6A 4AYGA 4EWND 5LIXX 1GTHA 1SFJA 3WCZA 4JTAA 1XL9A 4NZ5A 3W75A 2D2JA 1VEOA 1RP8A 4ZOBA 1ZBVA 5C54A 1BTCA 2WVSA 3OQEA 1JPDX 2C7FA 2BZNA 2J8TA 4LUTB 4PEKA 3H2EA 3WMLA 4AVFA 2G97A 2O9TA 4KCUA 4F48A 3W28A 2POTA 3CQIA 4NXKA 4LVGA 3WLTA 4Q8WA 3VNMA 3TZFA 2CLPA 2J24A 3B9DA 3KFTA 4GY0A 1Z32X 3BXWA 3LBCA 2WKJA 4X63A 4QJ1A 3EMCA 3OODA 2V3EA 4LAZA 3ANUA 4QQUA 1XBYA 2VX5A 2NV9A 4IQLA 5FIPA 2OO0A 3AZSA 3ISIX 4W9TA 3RG6A 2A7PA 4AXNA 3AMCA 1C93A 1J5SA 3KTSA 4XV0A 3SJ3A 1BTMA 3JUGA 9RUBA 5A8QA 3MZ2A 5FAGA 3PBYA 1EB3A 3GR4A 1CLXA 5M3WA 4BQ2A 3I65A 2IMRA 3VUSA 3S47A 1MW0A 4Y2WA 3U8GA 3O2LA 5A6JA 3S8HA 1PPIA 7REQA 3ZT6A 4A2RA 4GBDA 4JL1A 2Z27A 3S9IA 1B9BA 3BPWA 3VGHA 1AZ1A 2X2YA 3CHVA 2WZMA 3WG6A 4AW7A 4CD5A 4UQBA 5CBJA 2YR1A 3RJXA 4GI8A 3WQWA 4Q7NA 1E0UA 4JIEA 4HQVA 2NQHA 1IGWA 3W0KA 3V0TA 2Z28A 4TMBA 1ZY9A 1U5VA 1W1ZA 5DMNA 3VCCA 3UNTA 1EIXA 1WX0A 4YLWA 3CPRA 3AI0A 1IR2A 3NSXA 3AHZA 2FQIA 2B0MA 4OJYA 4D6HA 1BFNA 3HTWA 2OOGA 2YL5A 2ZRYA 4WF7A 3T0CA 1LRTA 4Q4MA 4NNAA 3GD6A 3WLIA 1UOKA 4D6FA 3H22A 2CLLA 2GPTA 3QYQA 2VEKA 2YB1A 1I0BA 1QBAA 3OZPA 2YGYA 1AQMA 4IFRA 1TO3A 9CGTA 4HGXA 4UOZA 2Q09A 3AQUA 2G41A 1AW2A 1S2WA 1EL3A 2QYGA 1KCKA 3MBFA 1QO5A 2DZUA 4KT2A 3FY1A 1O95A 3C8FA 3PY2A 4YJ5A 4BF9A 3G0XA 3U6WA 1JDAA 2V0TA 3AUJA 1GK8A 1F5ZA 4X9YA 5G1YA 4LW7A 4OUEA 4NG3A 3SGZA 1OCBA 3SUUA 2QCGA 3HB9A 1KM0A 2GWNA 4XVEA 1MUCA 4WOQA 5HDRA 3V16A 1V7YA 2G3NA 1W1VA 2WQPA 3PWAA 4M82A 4BWLC 3CMGA 3G3DA 4LC6A 4GA8A 1RJRA 4DXKA 4V28A 1JPMA 1AUSL 2YFNA 2EO7A 4JQ3A 4H04A 1XDJA 4AD2A 3CV2A 3WH8A 3SCNA 4PH6A 2VGBA 1XC4A 3LK6A 4ZODA 4GVIA 4TX8A 3KZSA 3AMKA 3LPPA 3QQWA 4JPGA 3QXBA 3GAYA 4KQNA 2W62A 1UR3M 2Y24A 2ZUNA 1ISWA 1E55A 1H5YA 4P7RA 2CBIA 1S3TC 1PKYA 2FDMA 1AD1A 2WC4A 2OWXA 5I0DA 4L6HA 4PMQA 3W3OA 4Z2HA 1NFPA 1EJTC 3TTSA 4MKNA 3HPFA 3U5YA 1CI1A 3VGFA 4A3QA 1AJ0A 3DFTA 2W5FA 1YPXA 3STCA 2OKOA 1R85A 1JPHA 4JR5A 1L8NA 4GJJA 2PCQA 1MW1A 1PTDA 3CQHA 2XH0A 2W63A 1LBLA 1RQHA 4UMAA 1P7TA 2OT0A 1IT8A 3OBAA 4C6OA 5GJNA 1MRAA 1K9FA 4Z1YA 4I7UA 4N2YA 2C79A 1TPUA 1FWWA 1VLIA 1VFTA 2D3NA 2Y0FA 4DI8A 4Q4SA 1XG3A 1US2A 3GH7A 3S5OA 3IJIA 3AWOA 3ZM8A 2WSPA 2ALRA 4GZEA 3NQCA 1IEXA 1W5MA 2NT1A 2VO5A 3C6CA 3D3AA 4HHPA 3DG7A 4PMNA 2CKSA 4QSFA 1K1DA 3PP7A 1V4YA 3PJWA 5DY2A 2X0HA 1VYSX 2HQAA 3WL1A 4ICMA 1JYNA 3N9KA 2ZUUA 1V93A 4LNCA 2NQ9A 4QROA 3OLDA 1UROA 4Q7BA 2A79A 3BAYA 4JTFA 1E73M 3GUWA 3KVJA 3TTYA 3N3MA 1UD3A 2JGQA 1NDYA 1DKWA 3WBXA 2ON3A 3MV11 3SAZA 4AMCA 2C16A 1SR9A 5BU6A 3CPGA 3EXSA 1R86A 1WZKA 1B0IA 4HPGA 1P6CA 1CLVA 5DELA 5F2MA 4KRZA 4IMGA 4CEXC 1GT8A 4DLMA 4HHMA 1RP9A 1ONRA 1C29A 4Z1BA 3W7CA 1TVLA 2PDWA 4RW5A 3OLEA 4EK7A 5AC5A 4W86A 1I4NA 4IPIA 4P8UA 3UERA 3DI1A 1BSLA 3SCRA 4NX5A 1YXDA 1XH2A 2OZ8A 5D9NA 1QATA 5HJXA 4AXKA 3H4XA 1UKOA 1VBGA 1SR0A 4AH7A 4O8AA 3PPHA 1XLBA 1EEPA 4G1NA 1O5XA 3N9SA 4LY4A 2P0OA 4C6CA 5L9FA 2FVLA 2V68A 1CB2A 3QKEA 1Y8BA 2JF7A 3MV01 2EHHA 2ZRZA 4IP4A 4HZ8A 4XO7A 3RXZA 4DZHA 3NQ8A 3W74A 2AL2A 3B9OA 5FJTA 1UJQA 1QK2A 1PV8A 4GHRA 4XBJA 3MDWA 3AFBA 3M44A 4KEUA 4GYJA 3QY6A 4Q8NA 1Q13A 4RL3A 2PSNA 3F4NA 2HWGA 1RH9A 4LCRA 4P8VA 4JFSA 1KB3A 2NX1A 1NAL1 2CLKA 5AHIA 4E2BA 3EWDA 3G1SA 1TELA 3SJNA 2H3BA 5D2WA 1Z7AA 3BO9A 3CT2A 4H7CA 4MGGA 4L61A 4ZFCA 1JFHA 4H4IA 3MMUA 4A3YA 3PBGA 4Q4RA 4FALA 3T2PA 5I24A 5CEWA 2FHCA 1DTNA 2B4GA 1KKOA 3ENLA 1PEZA 5AHNA 1B5TA 2BASA 1OM0A 4CU8A 1OK6A 1S2VA 3TN6A 1A53A 2XZ9A 4Q8QA 4DJEC 4MMWA 1KM4A 2XWEA 4LJ3A 4B3KA 4HMCA 3CLMA 5DANA 1HVXA 4FXRA 1H5VA 3VKAA 1AQ0A 2GJRA 2WNWA 4QBXA 1E6SM 1F4HA 4AIEA 5FF2A 4HNVA 1KWKA 1H61A 1UD5A 3S6OA 1FDYA 1MYRA 3WLSA 4X61A 4AZ6A 2PTYA 1VPQA 3G5EA 4P8WA 1V3LA 3WFAA 2BX7A 4ZSTA 4M19A 2WLYA 3VC5A 1MZHA 3TTOA 4BY3A 4O1AA 1JZ3A 1TWIA 1MXDA 4Q7IA 4Y9AA 1DJZA 1LT7A 3W87A 4CD8A 3P93A 4UFJA 2E09A 3G24A 4IIEA 4GLEA 3T8QA 3TOPA 3GH4A 3HU7A 4RX0A 4XD4A 1F6YA 3A21A 5I3FA 1XX1A 3B0UX 1E4LA 2MUCA 4H6QA 1RK5A 3OJGA 2VD9A 5M2FX 1S39A 1ICPA 2ZZ5A 3PTMA 2PD5A 1V0NA 2DQXA 1R2RA 4HN4A 1KO0A 1XLJA 5ECVA 2O4QA 3L2IA 4W7VA 3BICA 1ZLPA 1TV8A 1CLKA 2NW0A 5LNSA 3LQGA 5LGZA 4C5YA 3LZ3A 3A4JA 3G1FA 4XKMA 2QJGA 3WBEA 3LGEA 1V79A 4O1BA 4O19A 1UWAA 2C1GA 4S39A 4N6FA 1NQ6A 1FOBA 3AISA 1X38A 4S3JA 3S5ZA 3GBDA 4IX0A 1C91A 4ES4A 1XGDA 2B81A 4Q22A 4O14A 3LM7A 1IWBA 5MKGA 4Y8FA 4NZ4A 3PZTA 1KTCA 4PCTA 1I60A 4GINA 4CVWA 2ZTKA 4LANA 1GVQA 3G6MA 4XISA 4NZ1A 2D2HA 3BW4A 1K4GA 1D2KA 2VVNA 3TNBA 3CZGA 2DSVA 1OFAA 2NXHA 2Y89A 4W7WA 3FYOA 4AMAA 4BR1A 1RQEA 1X97A 1HVQA 1I2PA 3KP0A 3R0KA 5A2AA 4IFKB 3ZVIA 3SADA 1WAUA 2OWWA 4XWUA 3BCFA 4A3UA 2QW5A 3MP4A 4UIOA 2NLIA 1EF3A 1K9DA 4Q6JA 2FHFA 2CZDA 4PA8A 5E9XA 1ZTVA 3VKCA 1R3SA 3FV9A 5CGQA 3RM8A 1FWSA 1OD0A 3E96A 1H7RA 3FN9A 3NL5A 3EX3A 4R85A 1KGUA 1W9PA 3O6CA 3MUY1 1Q65A 1TTPA 2RAGA 4HOWA 3Q4DA 2JKPA 1ITUA 4BEQA 2D24A 2PLCA 3P5YA 2Y4SA 1W9DM 3CEUA 1IXOA 3GU2A 2G50A 4NNBA 4NT0A 2UY2A 2JEPA 4C6KA 1HO4A 2J9YA 3WLLA 5D09A 1CGXA 3KBMA 3WLMA 4BQ4A 1B30A 3L66A 1I2QA 2V30A 4GI6A 3LLDA 1CDGA 3H54A 3WF1A 2J6XA 2J78A 1IF2A 1ZAHA 4M7TA 5DMYA 3NPUA 1CGVA 3R8RA 3SW6A 1TE1A 3LCWA 3KX6A 2YSWA 3KCJA 3BLLA 1XBXA 3OA5A 2BHUA 2D3LA 3EXRA 2HXTA 3E5PA 2I17A 3VIFA 1B3VA 1WBJA 2ACSA 4OUIA 3TQKA 4V27A 1XP3A 4HSNA 1KGWA 4O15A 2IQ0A 1JF5A 4PCFA 5IOBA 3EWBX 2SFPA 4JYFA 1DIDA 3O6YX 4INFA 3TN4A 3NM3A 3ERPA 5GNZA 5HMDA 2JIEA 4L64A 5BCAA 1EKOA 4M56A 3RM4A 1Z9AA 1N8WA 4KBXA 3ZS4A 1UWQA 2Y5SA 1DE5A 3CT7A 1DJIA 5BRBA 4G5DA 4KWWA 2GQ9A 3ZO9A 2PGWA 3SCQA 2WZHA 1PYFA 2OYMA 2W4XA 2J27A 4MDPA 4L4OA 4AISA 1TJRA 2ZZ1A 4V15A 3PFRA 2ZZ7A 3OEXA 3B97A 3MO7A 3BSMA 4DJFA 3PJTA 3SQMA 3D47A 5FACA 2FFIA 3PPFA 1WO2A 4L56A 4NJKA 3DG6A 4XIAA 4Q32A 3CZJA 2NT0A 2REQB 3T07A 4IGSA 5HPOA 3R2GA 4LY8A 3RLHA 2XUCA 1T7LA 4Z1DA 3CZKA 4PTMA 1LQ0A 2WVUA 1ME8A 4LAMA 4K39A 4GYFA 5HR6A 4R7OA 2ATSA 3WLKX 3ZXWA 3ITOA 2ZA1A 1GOQA 1Q5MA 4MWAA 4GH3A 4G1KA 3I6RA 2Y7EA 1YDVA 4D6CA 2R1NA 5T91A 3EZ4A 5B80A 2V69A 1S5TA 3KRUA 3M47A 4DWSA 2DT0A 4QJ4B 3R79A 2QXWA 1ZJBA 4NJGA 4B4HA 4B5SA 1H11A 3WQ6A 1R3YA 3NOYA 3TTQA 1RXOB 4WJEA 2VC5A 3M43A 1YXCA 2PDYA 3EDDA 2VR2A 4EAYA 1BXNA 3FW6A 3ITTA 3WK3A 2PTXA 1EYEA 4OTKA 3VOIA 3WDQA 1S5VA 5HQMA 2XTKA 1KM6A 3GO2A 1FCQA 1VC4A 4JOMA 4YU1A 2W67A 1HP4A 5IBXC 2J8GA 1YDYA 2V2CA 1KRBC 4ERGA 3GR7A 1OJXA 3VD3A 2CHRA 1KQYA 3UBPC 3ZZ1A 5CBIA 4AF0A 1IR1A 4OVXA 4YXGA 4MNLA 3CUGA 2YA1A 2Q8LA 3UZ5A 3BVJA 3OO2A 5G1TA 4I5UA 4UBPC 3PBWA 3SRDA 6XIAA 2DUAA 3I6EA 4PMDA 1ZFJA 3GWQA 1PXGA 4CNPA 1S5WA 1CBGA 3B4UA 2G5WA 3S5YA 4YHGA 3TYEA 1XPYA 1AQHA 1BG4A 4PULA 3OVGA 3TONA 1UWTA 1YTEA 4IP5A 3ZMRA 1HN1A 1OFOA 1AODA 4CNNA 2G3IA 3O15A 2C18A 3FXGA 4LH8A 2OWCA 4JD4A 4YVVA 4GIAA 5LNUA 3WQGA 2PRLA 4A8RA 3URAA 1TWSA 2BOEX 2ACRA 2QULA 4KIRA 1M7PA 3HG4A 4ADTA 3SUVA 4GIEA 4L6DA 5CC3A 3O7UA 4EXAA 4MZ1A 1RQBA 4AZBA 1GVRA 5C0QA 1ADSA 3M0HA 1U1UA 5CSSA 1SGJA 1H49A 4YTUA 4CCEA 3MTWA 4EIVA 3MMDA 5M17A 2BXVA 3L4TA 5CPLA 4DJDA 1MW3A 2PCEA 3B03A 4CN4A 1DOSA 1RBOB 4MHBA 1DVJA 4HA3A 2B7NA 2RDWA 2YCIX 3BCDA 4XBKA 2YW3A 4R9XA 1JRCA 4IICA 3BLDA 4U5KA 4MJZA 1KM5A 5BYWA 5DCBA 4TVUA 4N4QA 4QNEA 3EX1A 4H41A 4DWSD 2VR5A 4U10A 2V38A 4JN6A 1W2PA 2X1TA 4E6MA 2J9XA 3DAQA 3EGJA 4HNUA 1PVNA 3WQFA 3LV5A 2R8WA 3RITA 3SSJA 2WM0A 1YNPA 3O9NA 1V0MA 1WYIA 3RX4A 1E9YB 1W8SA 3VKBA 2D2OA 5H8MA 2DVTA 1BRLB 1VPXA 4LX4A 1KXTA 3HO8A 2CEQA 3UQNA 1XC6A 3KCLA 4YL2A 4N4PA 3P82A 2AQWA 1JD9A 1X6LA 3MUZ1 3BAKA 1W9UA 4KERA 3KBWA 3TJXA 2C8NA 1IGSA 3M46A 3GC5A 2OSWA 3H26A 4JZ5A 3AMDA 1Q6EA 3KEHA 1NF7A 5AC6A 3EA2A 4ZBCA 1PDZA 1TWDA 5CJNA 1Q6RA 5I06A 1EA9C 4G7EB 4LVFA 4ERAA 2CHNA 3FYPA 4EXQA 4A21A 4ZQMA 3RR1A 4L65A 1FFRA 1POJA 1JNEA 2I14A 1K4HA 3FJ4A 5FA5A 4DO6A 4DXVA 5EMMA 2X0SA 4C6BA 1W32A 1FA2A 2DSUA 4F9DA 3W76A 4H7VA 3OTRA 3R94A 2Y2WA 3E74A 1GOIA 4EACA 2HK0A 1FDZA 2ABAA 5ABEA 3CL8A 2C6QA 4DHGA 3OGVA 4D8LA 1HJWA 4XZWA 5C2GA 1QASA 3CIWA 2Q71A 5LSMA 3PHAA 3GKFA 1DJYA 4GK8A 1IQ8A 2OKTA