1LOSA

Crystal structure of orotidine monophosphate decarboxylase mutant deltar203a complexed with 6-azaump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
SRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords orotidine monophosphate decarboxylase
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 80
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1losA00
3FYOA 2QUUA 4Z0JA 1K8XA 5LHFA 3W1MA 3EXRA 1O95A 4A2SA 2RHGA 5AC6A 4WQ6A 4O10A 2GUUA 3W7RA 3GX9A 3KRZA 4ZQPA 1HG3A 1TIMA 1OHLA 3MI2A 5D30A 2E6DA 1GPWA 3W85A 4IMEA 3EWBX 1E51A 1KFJA 3HG4A 1DVJA 3IIVA 1U5JA 3N19B 1UBSA 3L2IA 1LCOA 5FI8A 2Z2UA 3SW6A 3W3OA 1S5TA 6ALDA 3FIGA 4JGDA 3F4WA 3EXSA 3I7QA 5DLCA 4K7YA 4BWLC 4MJZA 5LNRA 3KXQA 2RDWA 1D3GA 4K38A 2I14A 4E2BA 4HPJA 3FJLA 3W1RA 2FDSA 1FDJA 4Z1BA 4UTIA 2A7NA 4MYAA 4MVAA 1R47A 1UASA 1LYXA 3BG9A 4CCEA 4K37A 4O13A 1MZHA 3MHGA 1U83A 4P61A 1VYRA 3NZ1A 4LT9A 1G4EA 4XZ9A 3TQKA 1DHPA 3IIPA 4HNVA 3NM1A 4GJ1A 4N4PA 1JVNA 3GB6A 1LRQA 3MBFA 2YZRA 4JTIA 4LS2A 5DBTA 3JS3A 3CIXA 3CWOX 4HN4A 4IX2A 3TC6A 4OV4A 1VZWA 3MWAA 3CWNA 1XUZA 3LHTA 2R94A 3TJXA 4JTFA 2CLHA 4X2RA 2A1YA 3RFAA 3KVJA 5K3VA 3MMTA 4N9CA 5I3IA 2A0NA 3P81A 4ZMGA 3GXPA 2QCMA 2VKZG 1WXJA 2BX7A 3L21A 5DBUA 3RK8A 1TJRA 4M7SA 3OVRA 3Q94A 5HWNA 5C5YA 3SECA 5E93A 3S1WA 3HGJA 3I65A 3FEMA 3PS7A 1VR6A 4WXYA 2BLEA 4FB7A 2CZDA 4PEKA 3W7MA 1TQJA 1W5OA 4IMGA 3GDTA 2A7PA 3DHFA 2OCZA 4IPIA 4NJKA 3WK2A 4YWIA 1KLZA 2XFWA 4PC8A 3TV8A 1QO5A 5DY2A 1DQXA 4TX9A 2E5BA 5DCEA 1YADA 1OK6A 2NUYA 1SQ7A 3W23A 3NPXA 1JRBA 1GYNA 2J9XA 3PM6A 2VFHA 1PHWA 4N9EA 4O8RA 3W6YA 4XKYB 5F2GA 2F7FA 3P80A 3IRDA 3P84A 3GR7A 4AHQA 5D02A 2RKXA 4IUOA 3USBA 5SWUA 3MYPA 5G5IA 1JQVA 4FNQA 4FNTA 3HF3A 4AF0A 1IF2A 5FESA 3GNNA 1F73A 1D9EA 1SO5A 3GDMA 3W7LA 3TU9A 1Q6QA 5U7SA 2NV2A 2Y63A 2H90A 3G8EA 1SPQA 3G22A 2JKAA 1W5PA 3G3DA 4FIQA 2VEMA 1PE1A 3UQNA 1M7PA 4LVBA 2Q3OA 4XBKA 3H53A 2A4AA 1OABA 3A22A 4NT0A 3TA6A 1GT8A 2FPVA 1AW5A 3QEZA 1XC4A 1OYBA 3WJXA 3IIOA 1L9WA 3DH7A 4O53A 4R34A 1LBLA 4JTEA 4RX0A 3SY5A 5AHIA 1DJNA 2CLLA 3ELFA 1QPRA 5D03A 3KVKA 1YTKA 1ICSA 2QJHA 4WY0A 2CLFA 1HFBA 1KM3A 5HWMA 2QAPA 3M1ZA 4UTTA 5FF2A 4MLRA 2FIQA 4JY9A 4JDBA 3S5NA 4UTLA 3QC3A 2OT0A 4FX8A 4ADSA 3C2RA 3GIYA 4JTKA 1DBTA 3R2GA 4NJHA 3QW4B 1LLZA 3G1FA 2PRMA 1TPC1 2EPHA 5AC7A 4GBUA 1NVMA 3L0NA 3HGRA 2ZZ5A 3WJZA 1K3UA 2XN2A 4O1DA 1A5BA 1OX5A 1OX4A 2DZVA 2ZZ3A 3DFQA 3IVTA 4HNTA 3BGJA 4IOTA 3O6YX 1MSSA 3TFXA 1PHQA 2CLIA 4AWTA 3G1AA 3QFEA 5HULA 3NGJA 3RMJA 4ZQNA 3BARA 1OFOA 3BG5A 1ADOA 2X30A 3W2KA 1ME8A 3UPBA 5BMWA 3BO9A 4UMCA 3OBKA 1GVFA 2V9DA 5D2TA 1C9DA 1H7RA 4IXHA 4S1FA 3G1SA 1FDYA 1FCQA 1IIGA 4WJEA 3MHFA 3OHIA 2FFCA 5F1VA 1JUBA 4DQWA 1TRIA 3MBDA 4UR7A 5J5DA 4LOCA 5LNSA 4QAIA 4U28A 3O6CA 3VKJA 2VC6A 3UZ5A 3M6YA 3N9SA 5K9DA 2H3BA 4LVFA 2AAMA 4O1AA 3RLVA 1G67A 1H7XA 2A85A 1KTCA 3HB9A 3M5ZA 4N9BA 4Z1CA 5BNKA 4MZ8A 5F2LA 3S8HA 3GXNA 4LS1A 2G97A 3IEBA 4A21A 4O0KA 2RDTA 5TQLA 2GJNA 1RR2A 1C8VA 3I6RA 5HMSA 1P5BA 5K4ZA 1AL8A 4JTJA 5KMYA 3W7NA 3B0VC 3DKJA 3RF9A 3TAKA 1YDNA 5I3GA 3W75A 3NG3A 3R8RA 4EWND 1PCKA 1BEUA 1P1XA 1TSIA 2VEIA 1F5ZA 2ZQ0A 1KM1A 4ZQRA 1O5XA 2QDGA 4KFPA 2DZXA 3NO5A 4LRTA 1T96A 1ICQA 3NQ2A 3W1PA 4A3UA 2PC4A 2E6AA 1EUAA 4UMBA 5C6MA 4JEQA 3CLMA 2ZA2A 1XBXA 1GG1A 1M5WA 4JX6A 4NJGA 1J4EA 1Q3NA 3VE7A 1VYSX 3HPXA 4O0ZA 4JYDA 3UXDA 4CQ8A 3E12A 1Z41A 2H8XA 3M41A 1VGAA 5FEWA 2BTMA 1T0OA 3MP5A 4LVDA 5AC8A 4JTSA 3GLCA 1T99A 4MY8A 3W7QA 3G1XA 5FEXA 5D09A 1SO4A 1S5WA 4FO4A 3W83A 1VCGA 1QOPA 3SGUA 4GUIA 3TROA 1HO1A 1TTPA 4RLIA 4LW7A 5MHBA 1KFKA 1QNVA 1ZAJA 3VCRA 1I2NA 5AHLA 2B7OA 4YCOA 1TQXA 3UY8A 1L6SA 3SFKA 1IXOA 3HG2A 3UZJA 5I3FA 1QO2A 3ABQA 8TIMA 1MEWA 4O18A 1TTJA 3NL5A 1EUNA 2QCCA 1AMKA 3NQDA 4ONVA 3KVLA 2TRSA 4GFSA 4Y90A 3DFNA 4OHQA 3SZ8A 3LV5A 3TSMA 2PRHA 4AMAA 3EWUA 1TTQA 3MW7A 1P0KA 5K9CA 1SW3A 3SI9A 2AQWA 5KSWA 1R30A 4O28A 1K7EA 2WO5A 5K2ZA 3CQ0A 3P5ZA 4WOQA 2LLEA 3IIXA 4AB4A 3N73A 3DZ1A 2ZTJA 4NXKA 1JUKA 2WPBA 2C14A 3G0SA 4MFDA 4FNPA 4LC8A 4TMCA 4JD4A 3EWZA 1C29A 4R53A 4N02A 3HQ1A 3LOTA 2CWNA 4EOUA 4Y8FA 5CZSA 4PCFA 1TPEA 3KRSA 1GVOA 4AHPA 4UFIA 2AGKA 3FLUA 1QR7A 4OE7A 4Y9AA 3LGEA 3UWVA 1TPB1 2WNZA 1IIHA 3B04A 1W8SA 2ZTKA 4JY8A 2HS6A 3QZEA 5HINA 3N3MA 4A22A 4FX7A 4NUWA 5U4NA 3BW4A 4ICNA 3E96A 5H2ZA 2WSYA 4DBEA 5D2WA 4DF1A 2QCHA 4HKPA 1O4UA 1TPUA 1P0NA 1G6CA 1V5XA 3LRKA 3O07A 3EX3A 4Z1AA 3FFSA 2ZZ6A 1SZFA 4M6VA 2Q8LA 2TMDA 2BZNA 1A5CA 2YYTA 3BW3A 5EBUA 1VJIA 5BRBA 1VCVA 3Q58A 5IBXA 2CZFA 4MLJA 3UWZA 1JCLA 1JULA 1LM1A 3CM4A 1CX9A 3UWWA 4JICA 2Z1BA 3G1DA 5G1TA 2DZWA 4WD0A 4CNOA 5D33A 3S5OA 4FF7A 3W7JA 5T26A 3TX9A 1WYIA 3EX6A 4YMZA 3PBWA 4NZJA 3INPA 1AG1O 2BSLA 5C2XA 1FY6A 4N6EA 2Y7FA 5F4XA 3EEGA 5G2WA 4XKYA 1H7NA 4BFAA 3T7VA 1TMHA 4YL2A 1ALDA 5KZMA 2Y89A 2YPIA 2C0AA 5DCDA 1QMLA 5DY3A 1DL3A 2E09A 2YCEA 4UIOA 3GXTA 4ORIA 1JCYA 2OZ0A 5AB3A 5CPMA 1YXYA 4X3ZA 4QSHA 3O63A 4UCGA 1YPFA 1W1ZA 4GWEA 3UYCA 2NLIA 2DORA 2YYUA 1SW7A 3W7DA 1OYCA 4WOZA 3W1XA 1THFD 3I68A 2J6XA 4PL1A 1DORA 5G2HA 1GVSA 2TSYA 2WOQA 3STGA 3ABSA 4HSNA 1PIIA 4NNAA 2P10A 4Z08A 2NV1A 1FCUA 4KWWA 2P1FA 1IXQA 3WJWA 1IXPA 1H61A 2GJLA 3P8JA 1ICPA 2NWSA 4IXXA 4UNLA 3S6DA 2QUTA 1GOXA 1GEQA 1JCNA 1EP3A 3E9AA 1L2UA 4H4IA 3C2FA 1Y0EA 1R2SA 1SUXA 5C54A 3IV3A 3A23A 3PB0A 4MOZA 5DN1A 3LRMA 2WSRA 2ZRZA 2XN0A 1N55A 1A53A 2A7RA 3PBVA 2CLEA 3CEPA 5AYXA 2C1HA 4JTUA 4RV8A 3DFTA 4O16A 5ABTA 3ZR4A 3PULA 4UTWC 2H8ZA 1GWJA 2NX3A 3TMLA 1VLWA 3U6WA 1XDLA 4NVTA 3B03A 3Q37A 4U4MA 1EX5A 3B8DA 2ATMA 2GQAA 1AW2A 5I3KA 4J9JA 4NQ1A 3TW6A 2DZSA 2UV8G 4JYFA 2W0UA 3G1YA 1OF8A 2FB3A 1YYAA 1H62A 1NFBA 1W3TA 2WNQA 4R33A 4ORMA 3L5AA 3A5FA 2R8WA 5FEZA 4WY0F 4DF2A 2EF9A 3W84A 3DFOA 4NNBA 4OBTA 4DO4A 1F05A 1XM3A 2QCNA 1A5AA 3P61A 3TCEA 1WAUA 2Y7GA 1WV2A 3MI3A 1SZGA 1L6YA 2Y88A 3CPRA 4HSOA 3NOEA 5D2XA 2YFOA 3AJXA 3OVPA 3UD6A 3Q2DA 4N4QA 1JCMP 1X7FA 2E68A 4BI6A 3OEXA 3LDVA 1X6UA 3EWYA 3PSWA 5F4WA 3TR2A 3EB2A 2C19A 3CT7A 2A2IA 3KAOA 1DKWA 3M5YA 3CU2A 1W56A 5EYWA 3SGZA 5HUPA 3TE9A 3DHDA 4LVAA 3TKFA 3B05A 1ZJIA 4BR1A 3W7KA 4JTLA 1ME9A 2X1TA 1KTBA 4UFLA 2NZLA 4BWLA 4IMDA 1M6JA 3QW3A 2NX1A 4EF8A 1VH7A 2Y85A 4RZ6A 4UUIA 3ZS4A 1AW1A 3TAOA 3B06A 2QKFA 4O1CA 3FA5A 3G3MA 4K6AA 5AFDA 4ZZ9A 4UNKA 5BW6A 2FJKA 3C3NA 4BK9A 2V81A 1VS1A 5D05A 4TMBA 1QAPA 2B0MA 4UTMA 3W88A 2ZYFA 3NQGA 2C13A 2E77A 2D73A 1HO4A 4CQAA 4UFMA 5J5RA 4K39A 1FDZA 3PF3A 3M9YA 1I2OA 3GZ3A 3G18A 1LTDA 1LDCA 1K8YA 2QUVA 2E1DA 4MY1A 3R89A 4O1BA 1OX6A 3GDRA 1VHCA 3ANYA 3GK0A 3NQ6A 4LRSA 1GTHA 4IPJA 3EXTA 3NQ8A 1KV8A 3FYPA 3FOKA 3W2NA 1H7WA 3E02A 3TMQA 4XWUA 1SSDA 4O4WA 1F6KA 3OIXA 4HNNA 2V2CA 3UNDA 2YX0A 4PTNA 3S42A 5F1UA 4FXSA 1XI3A 2CLKA 2NUXA 1PV8A 4ZQMA 3O16A 2WQPA 3NNTA 5CZTA 2QCDB 3LX9A 1TPFA 2ISWA 3BGGA 4FNRA 4IMFA 2EHHA 5CPLA 3TW7A 1OFAA 1HUVA 2Z6IA 3HJZA 4H3DA 1OVDA 2O7QA 4DPQA 4GUFA 1B3OA 3BV4A 3RNDA 3QF0A 1SR9A 4JS3A 5AOUA 1WBHA 2VFDA 2A21A 1YTEA 3CB8A 1EWDA 3N34A 1KTNA 4BI5A 4I7WA 3JRKA 4HIBA 2ZZ1A 1RQEA 2ALDA 3IIZA 4LVGA 3C56A 1YTDA 1QWGA 3P62A 2W6RA 4GNJA 4QM1A 3A24A 1TTIA 3M7WA 3PG8A 3C61A 3N9RA 4LWWA 4UMAA 2HTMA 4DPPA 3LBMA 3NL2A 3L0KA 2QDHA 1N8FA 1H60A 2Q8ZA 2EGZA 1KBJA 3T40A 1OK4A 3QM3A 1KBIA 4TU1A 3T44A 3P82A 1AK5A 1B4EA 4XBSA 4O54A 2QF7A 1H50A 3LHUA 1MEIA 2RH9A 3W7IA 1W54A 5L6UA 5BOOA 1JUEA 2BWGA 1TO3A 1TREA 4CCCA 4MFEA 3GAYA 2CW6A 3TJLA 3K30A 3WK3A 1B9BA 1YXDA 2JKPA 4P2VA 5CZJA 1Q6RA 1J2WA 4N6FA 3MYOA 1FWSA 1F6PA 2QCEA 3C6CA 4E0CA 2QEZA 3HPZA 4OU1A 2YGYA 4JX4A 3S1XA 1EA0A 4DO6A 1X8FA 2ZRVA 4JYEA 5HNRA 1FWRA 3E0IA 5HR6A 4I7VA 2GQ8A 4C1KA 3PSVA 3TXVA 1NSJA 2B7QA 2B7NA 3P5YA 3TQ0A 1UCWA 5CSSA 5DCBA 4GE8A 4YXGA 1R46A 2ZZ7A 3DU0A 1DV7A 1O60A 3W71A 3VI2A 5GVJA 3MP4A 4LUJA 4Z1DA 1OFPA 1KFEA 3S0CA 2TYSA 1UJPA 1PS9A 3HMJG 2X16A 1XFBA 2C3ZA 3AO0A 2DZPA 5CZ0A 4M19A 4CNPA 4RCXA 3LCXA 2V2DA 4PODA 1SZNA 3BVJA 5G4WA 3LV6A 4C1LA 3TQVA 5AHNA 1GVQA 3CEUA 2PRLA 4QISA 3A5VA 2WJZA 3L5LA 1FXPA 3W1LA 4XTDA 3LLDA 4LY8A 1GYLA 1N7KA 2X1UA 3S5YA 5L9FA 3NQVA 1K02A 2GQ9A 4K8EA 2YW4A 2WKJA 1FXQA 2CLOA 3G0XA 3LTYA 2JBMA 1WOAA 3DKLA 1OYAA 1TRDA 1TB3A 3HOJA 4ZQOA 5KITA 4OT7A 4UR8A 3TNOA 1XXXA 1KM6A 3GYEA 3I7SA 2J9ZA 3MO7A 3C4UA 4Q33A 3C2EA 3STEA 2TPSA 3BG3A 4O14A 1KM0A 4O11A 3FS2A 4WZHA 3NL6A 3HG5A 1BWKA 3D0CA 3V75A 4NX0A 3UWUA 3HBLA 2QR6A 1LOSA 1T8XA 3ATYA 3V1PA 3TSDA 5LKYA 3GNDA 3W22A 1W5MA 2NXIA 1LORA 4NX5A 1KFCA 4NNCA 3N2MA 3NXFA 3GKFA 1KFBA 3NQAA 1I2QA 1WDWA 3O05A 2ZZ4A 3QJAA 2X1RA 2DJXA 4JDYA 4PL2A 3W1AA 1B57A 3O8AA 2NXGA 2YW3A 4R7JA 1OFEA 1Z48A 1W5QA 1K7XA 1YXCA 3GVGA 1A5SA 3FKRA 3NEVA 3QH2A 4K36A 5F2MA 1TV8A 1VRDA 1I45A 3M5XA 2VFEA 4HHPA 5CKSA 3CTLA 5D32A 2OMAA 1RQBA 3H55A 2PE4A 3NQ7A 3U2OA 1RVGA 5EMUA 4IMCA 3C8FA 4O12A 6TIMA 3LHWA 3UPWA 5AN7A 4GRSA 5EPDA 1LRTA 2ZFAA 3W1NA 3PB2A 5LGXA 4MY9A 3OVQA 3IGXA 5AYZA 4A2RA 1LOQA 4DBDA 3W86A 3TXZA 3PVFA 4UTHA 5K9XA 1ZCOA 1TCDA 2B4GA 4JTGA 3B4UA 3QSTA 3TSBA 5HR7A 4IWWA 3L66A 4QJ1A 3PUDA 5FF3A 1Q6OA 4FHAA 5D2VA 2X2GA 3NVTA 3EKLA 3G1VA 3LCHA 1QPNA 1DOSA 1UUOA 3GDKA 1VCFA 2V0TA 1Q45A 4DF0A 1JCXA 4IQLA 3THAA 5F2IA 3PY2A 1I2PA 3F03K 3QYQA 1LBMA 5KINA 1H7OA 1MO0A 1EWEA 3E49A 3THQA 2FLIA 3SR7A 4UTJA 1AL7A 3M5VA 3I7RA 1EP2A 3QPZA 3DXIA 4FNUA 1ONRA 4MZ1A 4CLMA 3HGSA 4GUGA 3L9CA 2E5CA 3B0PA 2HMCA 3W2LA 2VEPA 4N9DA 4DO5A 1HL2A 3QRHA 4WXZA 1QDSA 4JTTA 3W1TA 3BPWA 3YPIA 4AWUA 1R2RA 2B7PA 2Y62A 3LCFA 3UXAA 2VXNA 1FX6A 4NZFA 1O5KA 1SO6A 3BW2A 2JKEA 2ISVA 1CI1A 4QQ3A 4EVZA 3T4CA 4KWVA 3S1VA 1JQXA 2A5HA 4ZQCA 1RPXA 1ZAHA 2WSQA 3DGRA 3S5ZA 2Z0IA 2ZDRA 2RFGA 1G7UA 4EIVA 1K03A 1G4SA 1TPH1 4MKNA 5K7JA 3W74A 4IJBA 4RZ5A 4GXMA 5D2YA 3JR2A 3KFTA 3ZFHA 3LM7A 2CLMA 1FQ0A 1S3HA 4FEZA 3C2OA 2Q3RA 2XN1A 1X1OA 2PURA 4FNSA 2QCDA 2E5DA 1SZEA 3W70A 2J9YA 4H6KA 1XUUA 3DI1A 1ZALA 2NX9A 1ZY9A 2NUWA 2VELA 3S1UA 4UC5A 4DEFA 2GOUA 2JGYA 4RK8A 4MPQA 3NQMA 5CGQA 4A29A 3FKKA 4FX6M 2HS8A 3W76A 2DZTA 2QCLA 3STCA 2WV8A 1BKSA 5CSRA 3LRLA 2W79A 5I3HA 2EAWA 2OX1A 3LCLA 1F7BA 3EKZA 1F74A 1FWNA 1G69A 2ISSA 1EIXA 3WK1A 2G5WA 1EB3A 1XCFA 1RD5A 3GAKA 3M47A 3UY7A 1OFBA 5G2IA 1ZENA 4K7VA 3OA3A 4D2JA 5TBOA 1OFQA 4DXVA 2X1SA 4ZVJA 2R14A 4ZL1A 3P74A 4PFMA 3PBYA 4CNNA 2V5LA 3TIMA 3WJYA 4UXDA 1ME7A 3QMRA 3IGSA 1VQTA 2A6LA 3NAVA 3HIJA 3L68A 1GJPA 1H1ZA 1PL9A 3NQFA 3R12A 2Y70A 4O50A 5D38A 3BLIA 2CZ5A 3PC0A 3STFA 1XBYA 5LGZA 1Z42A 1UUMA 3R13A 3PWAA 3FJ6A 1SW0A 4UFHA 4AAJA 2RDUA 3LCIA 1FWTA 2QAFA 1FUYA 3EX1A 2DJLA 4RZ4A 3TK7A 4S2BA 1JR1A 3N14A 3W7HA 2VEKA 4NU7A 3RLUA 4MIMA 4QNWA 4YLWA 2FPYA 3MUXA 1WA3A 1G4PA 2WNNA 4Q4KA 3PBUA 4OWGA 1MEHA 4RXGA 4UTTC 2VFFA 4Z0SA 3QSRA 2YFNA 2ZRWA 4UFKA 4FXRA 5EY5A 3LBCA 2Z6JA 3F4NA 4LU0A 1LZOA 4GC4A 4FIRA 1HTIA 4UTWA 3QQ1A 5LZLA 3KHJA 1SFJA 4LUIA 1WX0A 2FTPA 4E38A 1JJKA 3TDFA 3NPVA 1ZNNA 1GG0A 5D04C 2Y61A 1VYPX 3SIZA 3U8GA 1EP1A 2Y7EA 3DFPA 2NWRA 3O06A 5AHEA 3KX6A 1FCVA 2EKCA 1V7YA 3NA8A 5E1QA 3W7GA 1I4NA 1TYGA 2G95A 1VPXA 2VOMA 2O7SA 4O4VA 2J24A 3HPSA 1H7PA 3G1HA 2ZRXA 2I1OA 3P60A 1I8JA 3DI0A 3B0UX 1SO3A 1XL9A 3PG9A 2CFFA 1S5VA 2VFGA 3M43A 3N2XA 3MI6A 3NQEA 3W1UA 2PCQA 2FPTA 3IGUA 5D37A 1LRNA 2QCGA 1LROA 1FBAA 2ZZ2A 4OQVA 5TIMA 3CHVA 3ZWTA 4LTSA 3LB0A 2GVLA 3PUOA 4ADUA 2C18A 4QITA 3W2JA 4TR9A 3NL3A 1D3HA 1H51A 4HT3A 1FWWA 1P4CA 1GTEA 1K8ZA 3GKAA 4WX2A 2Y7DA 3W1QA 2ZRYA 3A9IA 4WUIA 1ZHAA 1SSGA 1OG0A 2KZHA 5DELA 3LXAA 3WK0A 2ZRUA 3H54A 3EX4A 1KA9F 3LTSA 4UTKA 1L6WA 4RXFA 3QQ0A 5IM51 3LI1A 1SFLA 1RV8A 4JIQA 4MJMA 4Y96A 5KTLA 3LHYA 3A21A 1BTMA 1O94A 3PUEA 1XBZA 3P8IA 4M7TA 5CPNA 2OJPA 3SJ3A 3M44A 3DBPA 4DELA 2QCFA 4LC6A 4XTIA 3IVSA 7TIMA 3QPYA 1KM5A 1UB3A 2DP3A 5HQEA 3LHVA 1YPIA 5DXYA 3L5MA 4CCDA 2V82A 4OV9A 4AXKA 1WBJA 3M16A 3VFLA 4BI7A 2GVGA 4K8HA 4PH6A 4EF9A 4X22A 2BXVA 3T78A 4M5PA 1QPQA 3TC7A 1LOLA 2JGQA 3ZWSA 4Y6GA 1JCJA 3T55A 1R2TA 3W2MA 5BMXA 1W3NA 3P67A 4NJIA 2ABBA 1QPOA 3C52A 3LXCA 1RQHA 3R5EA 1MXSA 3DAQA 3IVUA 4YCPA 4N2YA 4JIPA 5EKYA 2DZUA 3GDLA 2CU0A 4L4MA 4S2CA 2I9EA 2QJGA 5AHMA 2Y6ZA 2R91A 1H1YA 1JRCA 3MP3A 5FF0A 1W3IA 1YLVA 4L4LA 4RJEA 3G0UA 3W7EA 1KW1A 3ABOA 2VFIA 1PVNA 4AWSA 4GUHA 1F76A 3W2UA 1G4TA 2V5BA 1KM2A 3TH6A 5KZDA 2C16A 4IX0A 1SU5A 2IQTA 4NXSA 4PA8A 1EPXA 5C55A 3EWXA 4E2DA 1B4KA 4IGHA 5FF4A 2H6RA 1NF0A 1ZFJA 2CZEA 5AYYA 3W73A 4I7UA 2GPTA 2VENA 3G8RA 4O57A 5EA9A 1K7FA 3QMSA 3HGOA 3UWYA 2J88A 2E6FA 3ATZA 4AF0B 1Q6LA 3OG3A 4GUJA 3LCGA 5FEPA 3C2VA 1W31A 1DQWA 1QFEA 2DU2A 4BF9A 3LHZA 2A6NA 1OJXA 4TIMA 5LHEA 4LS0A 5AHFA 2V30A 4AHOA 4W9TA 4JX5A 4ML9A 4X9SA 3BK0A 3W72A 1KM4A 1PCWA 3NQCA 4AH7A 5F4SA 5LSMA 3NPUA 2FB2A 4M6QA 2J27A 5HJLA 3PAJA 4OGZA 1TV5A 4NJJA 3F1QA 1W0MA 2G96A 4I9AA 3TFCA 5IBXC 2HSAA 3PR2A 4HPXA 1VLIA 4LV4A 3L0GA 4ADTA 1H5YA 5CPOA 3O15A 3W7PA 4O52A 1M7OA 4B5NA 4JR5A 1Z44A 3O6DA 3WFAA 4WY0B 3MJYA 1J5TA 5G4EA 3EX2A 3CIWA 3LI0A 5E0KA 4ALDA 3QMTA 4MYXA 3S9YA 4O17A 2NXHA 5HUOA 2ZA3A 1EEPA 1F2JA 4CQ9A 5DXXA 5LNUA 2F84A 3HO8A 3LLFA 3NYZA 2V2HA 3G24A 1GVRA 5LNVA 1LP6A 3CC1A 1OX4B 4AEOA 1IGSA 1DJQA 1NEYA 2ZBTA 1ML1A 3DENA 5A8GA 3W9ZA 1TJPA 3W07A 2H3DA 3BLEA 3TUUA 4TO8A 2JK2A 1WQ5A 3NZRA 4QNEA 1ZAIA 2ATSA 1TPDA 1VHNA 5CG7A 1XBVA 3O1NA 3KOFA 4JXCA 2GVJA 3L65A 2C15A 1QOQA 1YDVA 1OF6A 3NPWA 3W7OA 4G1KA 5G1YA 2P0OA 1CW2A 2C6QA 3NR0A 4JTHA 1X1ZA 3WJSA 3LTPA 1OFRA 4M6PA 2ZA1A 4JN6A 3LCWA 5H91A 3BLFA 4JNMA 5KZEA 1GZGA 4UFJA 4XQ6A 1G7VA 5A5WA 5I3JA 4O15A 1I2RA 1TV7A 5K4XA 3VE9A 5FF7A 3KRUA 2ZCGA 1KLYA 2QJIA 3VNDA 1KV5A 4Q32A 1H63A 1W37A 4XUGA 4RKAA 4MUZA 4UTUA 1NF7A 1XDMA 1VC4A 1OFDA 1A50A 3RU6A 1BWLA 2FQIA 1TPVA 4KFNA 3P7YA 2YDAA 3GR8A 1KFLA 2YR1A 2YXGA 3EWWA 4LNYA 4LV9A 1NAL1 5EL1A 3UWQA 1WOBA 3NDOA 3C0JA 3DFSA 3NM3A 2YSWA 4KKXA 5LNWA 1QCWA 3SSJA 1GQNA 3W7CA 1LBFA 4HNUA 4O19A 3W87A 1RZMA 4RR4A 2V8ZA 1IXNA 1TPWA 3M0ZA 3LXBA 1LLWA 4KFOA 1W5NA 3LERA 1YDOA 1XKYA 4MZYA 5HWJA 3L67A 3MHUA 4POCA 4QIUA 2OT1A 4AVFA 1FCBA 2ABAA 3ABRA 3HG3A 2E6YA 3KVMA
chains in the Genus database with same CATH superfamily
3EPOA 1EPVA 1UA7A 1CCWB 1O95A 3ES8A 2RHGA 4NZ3A 5AC6A 4PMNA 1TIMA 3PNUA 1GYMA 3HA1A 4H9XA 1SR0A 3W85A 1J2BA 4J27A 1B3WA 3PUGA 1DVJA 3IIVA 3UT0A 4LB3A 4B2DA 3LGGA 1XSJA 2XDFA 4YVXA 4X60A 1ODZA 3FIGA 1BRLB 4ZB5A 3F4WA 3KXQA 2RDWA 1D3GA 1FDJA 3BAXA 3FDGA 1W3HA 5I77A 5CSUA 2TAAA 3D6NA 3UBPC 3ITCA 4GZEA 4LT9A 3TQKA 1V3JA 5LA0A 1DHPA 2WM0A 3NM1A 1R87A 1JVNA 1TA3B 3ANUA 1V6XA 1J18A 4IP4A 1E4NA 5C0QA 2FDMA 2PDPA 5DBTA 1NM9A 3CWOX 2XYLA 3WH8A 2PCEA 4BEQA 1X6LA 1YW1A 2YDSA 1BD0A 1AZ1A 1G94A 3AS1A 3LHTA 4XIAA 4E5TA 4WJXA 1VIWA 1KRAC 3TJXA 1S2TA 3EPNA 3RGTA 2ACQA 2ANUA 2FZMA 1OT1A 3MMTA 4N9CA 2VR2A 3VMPA 4ZTXA 4ZMGA 3GXPA 6XIMA 3R25A 5TNVA 3DC8A 3D3FA 1C92A 4J3TA 4C7FA 1US2A 5E93A 3T9PA 3HGJA 3S1WA 3QR0A 1WDPA 2CZDA 3ZR6A 1XC6A 4J3UA 3UPMA 2OQLA 1BFNA 3GDTA 1LL6A 4HK6A 4AIOA 2WAGA 1R3WA 3FXGA 4TXEA 3ZJ7A 2XFWA 3WLTA 1OK6A 4P7NA 1PHWA 3W6YA 5F2GA 2F7FA 4RPPA 4NI3A 2BFGA 4ATLA 4GABA 1KGXA 3AYSA 4WHBA 1XYMA 5SWUA 1AUSL 4DLMA 2G3JA 1XLCA 3IUIA 3HF3A 1KCKA 2XPKA 3MT1A 4OOUA 1F73A 2FZNA 3W7LA 3QOKA 3UZYA 3OYZA 1MDRA 1JDFA 3A4XA 3G8EA 4QDPA 2JKAA 4L9YA 3GY1A 3G3DA 1CB7B 4FIQA 3FA4A 2F2HA 3S3GA 4D6EA 3H8AA 2Q3OA 3QLLA 5C7HA 1J5SA 3W24A 4NT0A 3E2RA 1E0TA 4X0VA 1OYBA 3BLLA 2PTYA 1LBLA 3OIHA 5AHIA 1W1YA 1DJNA 3ELFA 3MJMA 4G56A 5B7YA 2QJHA 3IK4A 4XX6A 1HFBA 1ISYA 3M1ZA 4LGXA 4JY9A 1FHUA 4TVDA 1T40A 4XZBA 3NO3A 1TR9A 4JTKA 3G1FA 4HQVA 1TPC1 3SCPA 2AOSA 2X42A 1NVMA 1XLGA 1XG4A 4Y2WA 3HGRA 4ZSTA 2VGIA 2ZZ5A 4ZXLA 3WJZA 3EOSA 5JMUA 1OX5A 1OX4A 4IOTA 3O6YX 4R9XA 1IQ8A 1PHQA 3ZZ1A 1XYCA 4H00A 4AWTA 3ZVHA 4ZQNA 2EKGA 3GTHA 1ADOA 5ABFB 3A4AA 3ZXWA 2PC8A 3W2KA 5CLTA 4M82A 4RDWA 3A4JA 3OBKA 1GVFA 4ENLA 3LY0A 3S1GA 1H7RA 4S1FA 1J9YA 3E5BA 4PULA 3UA3A 4YHGA 4M81A 4LOCA 3W28A 3GUGA 5LNSA 1US0A 1UD6A 4JFTA 3ZT5A 5CPTA 1YEYA 3O6CA 4PMOA 3VKJA 2VC6A 1D7FA 1YQ2A 3M6YA 3UXLA 4O1AA 2GJXB 1H7XA 1T6MA 5CLWA 3LMZA 4Z1CA 4MZ8A 4DUWA 3IEBA 4FSAA 3VNZA 1M01A 3IJDA 1AL8A 3WSUA 4DJFA 3ITOA 1EJSC 2AQVA 1KB3A 3B0VC 3UNTA 4JIEA 3L4UA 3QQWA 1TWZA 3W75A 3B9EA 1JDEA 3EOEA 3RMEA 1P1XA 3S47A 4A3RA 1KM1A 1O5XA 1OG6A 3BSHA 3NO5A 1FH8A 1POKA 3BLKA 4LRTA 3OQ8A 1ICQA 3NQ2A 2PC4A 4U3AA 2E6AA 4UMBA 4JX6A 4NJGA 1J4EA 3ZLFA 3UERA 4YS1A 4O0ZA 3UXDA 1L2QA 7ENLA 1WZKA 4JTSA 3ARPA 3QYSA 1I9CB 1V7AA 3BQ5A 3W7QA 1VBRA 3E3HA 3G1XA 1XQKA 4XB3A 3W83A 4L9ZA 5DT5A 1QOPA 1G5AA 4IFRA 1QATA 3TROA 2GDVA 1R3QA 2W5FA 3UJSA 3VKAA 5AECA 3MCMA 4CD6A 1JNDA 4LW7A 1M65A 4C6NA 1BXNA 3V5OA 3DEQA 1XFCA 1ZAJA 4O1EA 3M7SA 3VCRA 3GU2A 1I2NA 5HNUA 3HU7A 3GW3A 4J2MA 1CGXA 1RLCL 3HG2A 4GQGA 1QO2A 3ABQA 4WJ8A 1MEWA 4O18A 4OZOA 5TAOA 5BZAA 5FACA 1EUNA 1AMKA 2TRSA 4KBXA 4QCFA 2PRHA 4AMAA 4AD5A 4R7OA 3WLIA 3QZ6A 5KSWA 1DJGA 1R30A 3WX7A 4U31A 3GHUA 3P3BA 2OFJA 4O28A 5BWFA 1TV3A 2G3NA 1E6SM 4WGHA 2LLEA 4C1NB 2HXTA 1YMYA 3C5QA 3G0SA 4MFDA 4LC8A 4JD4A 4R53A 3THCA 4Y8FA 1LT7A 5HJYA 3ZYZA 4AHPA 4H9MA 3CV2A 3ARVA 3RITA 1CGYA 4I3GA 2HS6A 5A8PA 1EDTA 1GQLA 4IJRA 4FX7A 4NUWA 4E6MA 3TYEA 1KCZA 2D2GA 2WSYA 1CGTA 5A3HA 4ZFMA 1UA3A 3O2LA 1GKRA 1XLKA 2W66A 3K5XA 1CGUA 4K2SA 2Z1WA 1GVEA 2ZZ6A 3O9NA 1RH9A 1A5CA 2YYTA 3BW3A 2BY1A 1K4GA 2FH8A 5BRBA 4GZJA 2YA1A 3Q58A 3KUMA 5IBXA 3GFZA 3SJNA 3CM4A 2QHAA 1CX9A 3UWWA 3WY1A 1HKMA 1AVAA 4CNOA 1FVPA 5D33A 3S5OA 2VR4A 4FF7A 4HU8A 2IQDA 4KMQA 3UJFA 4ACZA 3PPHA 4IG2B 1N2VA 1FY6A 2QPUA 4HMEA 1ZL1A 3ENLA 3TN3A 4XKYA 3LG3A 1JXKA 2V6AA 3AIUA 4BFAA 3T7VA 3N04A 1EDQA 4QAWA 2NT1A 2Z24A 3PP7A 1DJXA 3GU9A 2YCEA 1A5UA 3VUPA 2OZ0A 1E4MM 4OECA 4QSHA 1J6OA 3URBA 4UCGA 2DUXA 1OYCA 1UWIA 6A3HA 3OYXA 4PB5A 1H3GA 3I68A 1PZ3A 5G2HA 3BZJA 3WLKX 1GVSA 2TSYA 1A0DA 4B5UA 2R82A 2WOQA 4HB7A 1PIIA 1DJZA 2P10A 4Q7BA 5CJMA 3CO8A 4FZIA 2X05A 2GJLA 4Q4MA 3P8JA 4IXXA 3A47A 4Y8EA 5HDRA 1B90A 2QUTA 4NG3A 1GOXA 3CL6A 1XV8A 3RG6A 3E9AA 1NU5A 3V18A 4WSKA 1JPIA 1DPMA 1SUXA 3GC4A 4QCEA 1A3XA 2WSRA 1A53A 2VD9A 5BOFA 3CEPA 3WF2A 5AYXA 4JTUA 4AY1A 4O16A 4PSPA 1PTAA 4HNLA 2V68A 5M17A 2BOGX 3TMLA 2IMRA 3A13A 3U6WA 1EOKA 1XDLA 1ZS2A 4NVTA 3WQ5A 2ACUA 3B03A 1Z69A 1Q2SA 3B8DA 3N4AA 1A0CA 2ATMA 2VDIA 1AQMA 2GQAA 3WLSA 2CBUA 4IF2A 4D1JA 2CCRA 3SDOA 2IXVA 4NQ1A 3WBYA 4IH3A 3CZ8A 4C6IA 3KW3A 4NKCA 2IPJA 2W0UA 1VFUA 1NFBA 4R33A 3UG4A 1ECQA 4ORMA 3MWCA 2R8WA 3ZLHA 2EF9A 3VNJA 1EIBA 4DO4A 1EJUC 1V02A 1AJZA 3P61A 3LYEA 1WAUA 4NL1A 2Y7GA 1UPPA 1JPMA 3MI3A 1L6YA 2Y88A 4HSOA 4B5SA 5D2XA 2YFOA 4GFIA 4L1GA 3UD6A 2E68A 3OZYA 4BI6A 3OEXA 1L6FA 1YNQA 4B16A 3LDVA 3EWYA 3L4ZA 3TR2A 4Q6JA 3F5JA 2ZUMA 3AIRA 1IZJA 4HZ7A 3TKFA 3ERPA 1ZJIA 4BR1A 2OQYA 1W2PA 1KTBA 1R8LA 4QGCA 4UTFA 3S9IA 4EF8A 2G41A 2AL2A 3ZS4A 2I5IA 3B8SA 4GI8A 2ZE3A 2OLAA 3TAOA 1Q4NX 4DO7A 2FJKA 2OO0A 2V81A 1VS1A 1MW3A 4TMBA 1QAPA 1PWLA 3WF4A 3W88A 5GJPA 2C13A 3BDKA 3SEPA 1WCGA 1XQLA 3N13A 4P7RA 3PF3A 3GVWA 3OU8A 1TV4A 2WWCA 1MUCA 1P7TA 4MF4A 5LA1A 1LTDA 3IJLA 4IQEA 2QUVA 5CBIA 2E1DA 3R89A 4O1BA 2JF7A 4TTGA 4LANA 1S38A 3ANYA 1KV8A 5HK4A 3P93A 1P43A 4UQCA 3UCDA 3ES7A 3AHVA 4Y9PA 2V3GA 1F6KA 3TN4A 4BQ5A 1A47A 1JD9A 4PTNA 3S42A 2IKIA 2NUXA 5JIWA 4AIEA 4FI4A 2ISWA 2E9MA 4IMFA 3TW7A 3HPAA 3F4VA 3GH5A 1X1NA 2O7QA 4DPQA 4GUFA 3DYPA 4AY8A 3UJ2A 2OOFA 3CB8A 4LUTA 3N34A 1GJWA 3G5EA 3C56A 3PZOA 4S38A 1CXKA 1QWGA 4MM1A 1HP5A 4G8TA 2PB1A 3M7WA 3PG8A 1OZMA 3C61A 2QPSA 2HTMA 2WLZA 4DPPA 2GWNA 3NL2A 1PX4A 2QDHA 4ZOBA 1N8FA 1ELSA 4Q8PA 3V4BA 2GDUA 2P53A 3NGFA 3Q45A 1BVNP 1OK4A 3AHYA 4O54A 1JZ6A 5HJXA 1GCYA 3VNKA 1MEIA 3W7IA 5EGRA 2MNRA 4J5NA 1NQKA 1TREA 3M0XA 4CCCA 3UJEA 2JKPA 3MDUA 4H6QA 1J2WA 3M0LA 3O0KA 1Q63A 3MYOA 1FWSA 1F6PA 2VZOA 3C6CA 1TIWA 2P8CA 2WZTA 4OU1A 4EK7A 3VD5A 3S1XA 4AD3A 4JYEA 2QPXA 5HNRA 1FWRA 1M03A 2WJEA 1VEMA 4JOMA 1YNYA 2B7NA 2B7QA 3TQ0A 4DIAA 3BMVA 1LJYA 5DCBA 2G4JA 4YXGA 4M8UA 1R46A 4GNVA 2ZUSA 1WDRA 3W71A 4IT1A 2TYSA 4PMZA 3ARQA 1PS9A 1UIOA 4DYEA 2C3ZA 2INFA 2DZPA 4M19A 4DX3A 1W2VA 3LS9A 1SZNA 3BVJA 1NWUA 2PODA 5G4WA 3LV6A 1LWHA 3VVGA 2GGGA 5AHNA 3OLEA 4IHCA 1GVQA 4QISA 3PTKA 1CDGA 3W1LA 4XTDA 3CO4A 1JDCA 1DHKA 1N7KA 2BMBA 4GO8A 3VKDA 3PBMA 4DBSA 5C71A 2YW4A 2CLOA 3CV7A 3EMZA 4KT2A 1XIEA 1DIEA 1OYAA 2BY0A 4WF7A 1XXXA 2QV4A 1EDGA 3I7SA 3B40A 4EXBA 2J9ZA 3MO7A 3C4UA 3H22A 3HQNA 4Q33A 2C0HA 2IKHA 8CGTA 2PBGA 3GBDA 4CVWA 2VNCA 1LL4A 3CT2A 4B5XA 1T8XA 3ATYA 4QE5A 3VC6A 1J0JA 1B2YA 5LKYA 3VAVA 5LIXX 4QSFA 3W22A 2OODA 3F7JA 3EGJA 4NX5A 5CC7A 5HPCA 3T0BA 4YYFA 3GKFA 5GNZA 2P3ZA 1WDWA 2ZZ4A 2X1RA 2XISA 2OYLA 1HJSA 3USZA 1OY0A 1B57A 1RJPA 1A4MA 3SCRA 4RNHA 3L4WA 5EFDA 1Z48A 1IZCA 3CMJA 1K7XA 1YXCA 3NEVA 3QH2A 7XIMA 3T8LA 4K36A 1E3ZA 4QJ3B 1HGWA 4HHPA 4IISA 4PBGA 1J11A 2QT3A 3H55A 5EMUA 1RVGA 4Q8MA 4IMCA 4PMUA 4O12A 3UPWA 4F2BA 1KBKA 5EPDA 1LRTA 2ISDA 3CQJA 3APGA 3PB2A 4MY9A 4ZO7A 1VB9A 3AZRA 1IWBA 4A2RA 1TE6A 2XVKA 3W4RA 3WNMA 2PDJA 1E4IA 4ZTYA 1RPKA 4W86A 5HR7A 4IMAA 1SGJA 4DWSC 3L66A 4QJ1A 3PUDA 2QW5A 3E0FA 3QV8A 2PGRA 4FHAA 3KL5A 5D2VA 4NZ1A 3JZEA 3V7PA 3U57A 3EKLA 2QDEA 3G1VA 3IS4A 4DWSD 4J7RA 4V27A 1JCXA 4IQLA 3VNIA 3THAA 2HRWA 4LX4A 4GKLA 2HCVA 3F03K 3CHEA 4GJJA 1V3MA 4ZO6A 1KCLA 4EPDC 2HPMA 3SR7A 3KZPA 2ZOXA 3M5VA 2OZ8A 1WDDA 2FVMA 4FNUA 1XIHA 2CHRA 1GHSA 3AXXA 4GUGA 1J0KA 2E5CA 3L9CA 1FRBA 2VEPA 1BG9A 1HL2A 4WXZA 3GVRA 4QX4A 1EZ2A 4B9YA 4JNYA 4AC1X 2EEXA 2ZVRA 1AH0A 2IW0A 5E9AA 3W1TA 3YPIA 1R2RA 3GFXA 1V0MA 2VXNA 4NZFA 1SO6A 4GPNA 2PWEA 3W38A 4QQ3A 4EVZA 3AIEA 4WGXA 1W17A 4PTMA 2I7GA 1NJJA 2A3CA 4LUSB 1YE4A 1RPXA 2XG9A 1FWIC 2FFIA 2QNEA 2ZDRA 4UQAA 2RFGA 5E6YA 2G8ZA 5D9PA 4W8LA 2PDFA 3VYLA 3H21A 1RJRA 3FAXA 3JR2A 3LM7A 4PUJA 4J3SA 4OOZA 4P8UA 1X1OA 2G3FA 2P5NA 2JALA 1VBJA 3TW9A 2AAAA 4W5UA 3WBXA 4IFKB 4MWAE 3ZT7A 3SQLA 4CVUA 2GOUA 3TN5A 4RK8A 2HE5A 3NQMA 1JDDA 1B9ZA 3BAIA 1UUQA 3W76A 4HVXA 2QCLA 2Z29A 5CSRA 3LRLA 2J8TA 5XINA 3JU2A 2OX1A 3EKZA 5IHSA 1EIXA 3RX3A 1XF0A 4K1GA 1ZJBA 3WK1A 1MZRA 2G5WA 3DBNA 4ZODA 3U0HA 1R9ZA 5G2IA 2J7EA 2YBVA 3SCVA 4D2JA 2ACSA 3WBWA 3MCNA 1UP3A 2X1SA 2YDRA 2AMXA 1VBHA 2OYMA 3PBYA 3TIMA 1FFRA 4KIEA 2PTWA 4A3HA 2W63A 2XIOA 2I5GA 1GJPA 1EKOA 1H1ZA 3NQFA 2D2OA 3MZNA 4C6BA 4PTWA 1XBYA 5CG0A 3RN6A 3R13A 3UGVA 3SCNA 3BURA 4LYQA 3TOPA 1RD6A 1H09A 3Q4DA 2QAFA 3WFLA 1FUYA 3EX1A 2DJLA 4RZ4A 2WMIA 3SUUA 4S2BA 1UWUA 3W7HA 1R0MA 2PGFA 4QNWA 3PANA 2FPYA 1CIUA 3MUXA 1WA3A 2VMFA 2WNNA 1UH4A 3PBUA 4OWGA 4UTTC 3TTOA 3RCNA 4DNHA 3SRFA 2XIJA 4LU0A 1MWOA 1YHTA 2GQ3A 1V3LA 1A49A 3WNPA 3RJYA 2ZIDA 3E5PA 2YJQA 4E38A 1JJKA 3M0MA 3TDFA 3NCOA 3SIZA 3VGGA 1LQAA 2Y7EA 2CERA 5FL0A 5AHEA 4E8GA 1XWYA 4HA3A 1FCVA 3NA8A 3OG2A 4PYSA 5EMKA 2G95A 1WNOA 3H6OA 4GD0A 2HWGA 3UR2A 4F4RA 3WLHA 2WMHA 3F2BA 1B31A 4G7FA 4IUGA 1QBBA 2XVGA 4JHOA 4C6DA 3QC0A 1LRNA 2QCGA 1XPGA 4HCDA 4BEUA 4GQRA 3VINA 1F9CA 4AU0A 3LB0A 4DBUA 3GZAA 1J12A 4GACA 5LXXA 4ROPA 3W25A 4QRNA 3TONA 2DVXA 3NL3A 1H51A 2Y5SA 3OZOA 3GH7A 4WX2A 3QR1A 1EGZA 1PB0A 3W1QA 2ZRYA 3WMLA 1W9PA 1IHIA 3A9IA 4GJIA 1SSGA 1NY1A 1TELA 1RJQA 3LXAA 2WM1A 1ISZA 3BE7A 4UTKA 1ZPTA 1DIDA 4XV0A 4RXFA 4R27A 3TTYA 4XZNX 1XIMA 1ZP4A 1SFLA 3O7UA 4MJMA 1RA5A 4Y96A 3NZGA 3JVAA 3L12A 4DJDC 3PUEA 4PCNA 1WPCA 4PUEA 4XAPA 3CQHA 3M44A 3DBPA 3CIVA 4DELA 1A5MC 2QCFA 3NEHA 1T8QA 1KM5A 1Q85A 4DJDD 1IEQA 2IPWA 4CCDA 2Z2AA 4Q7NA 4DM1A 3R58A 3BOXA 3VFLA 2G3MA 3KS6A 1XIDA 4FPSA 2BXVA 3T78A 1RP8A 5C2CA 3P67A 4NJIA 3TCSA 3V5CA 1K8CA 3C52A 1RQHA 3ITTA 5XIAA 1EYWA 1XIIA 1T41A 4N2YA 4JIPA 4L4MA 3N12A 2I9EA 1XW8A 1H1YA 1JAKA 4Q22A 1DWIM 2DT2A 2FHFA 3EOOA 4MJ2A 2G0WA 4A3YA 2ZICA 4BZYA 2VFIA 1PVNA 3ZOAA 1CXHA 1KBBA 2D0FA 2WMJA 1LUCB 5EBAA 3SCOA 4MUPA 4NAEA 1EPXA 4GXPA 4E2DA 1DXIA 2XU2A 1ZFJA 5REQA 4J3VA 4ZOCA 3NTYA 3TYBA 3VZXA 2UY5A 1Z32X 4QS6A 4JTDA 3AQUA 2QULA 4AF0B 3LCGA 4JFVA 3C2VA 1QHZA 1QFEA 2BOEX 1OJXA 1O6IA 2WSPA 4TIMA 4LS0A 1CPUA 2W62A 3BK0A 1UKSA 2X40A 3W72A 4HA0A 4XZIA 4M6QA 3C0SA 4TQTA 2Z4GA 4NJJA 3F1QA 3TFCA 3PR2A 1CLVA 3QTGA 2FYMA 1G9HA 3L0GA 2DW7A 1H5YA 4JQ4A 4DXXA 2WZEA 2R1PA 1M7OA 3VPLA 1SZRA 4B5NA 4XUYA 1OD0A 3FVDA 1KKOA 2PZ0A 4CQBA 5E0KA 4HJWA 3S9YA 1FH7A 1E1CA 2NXHA 3ZJ8A 3WQ4A 4Q4SA 1AQHA 5DEZA 2ZA3A 3QVQA 4B4FA 2VRJA 4GZIA 5DANA 2J74A 4CQ9A 5DXXA 2WZMA 5LNUA 2F84A 2DVUA 3G24A 4FOJA 1WP6A 5LNVA 1LP6A 3R8GA 3CC1A 2HVOA 5A8GA 3W07A 2H3DA 3TUUA 2JK2A 4QNEA 3NZRA 1ZAIA 1SM9A 4I9MA 4JQ3A 1FWAC 2PS2A 4XO6A 2GVJA 4D9PA 3A12A 3QV7A 1YDVA 1GVYA 1OF6A 3WQCA 5FL1A 3NXLA 5G1YA 3KBWA 3CYJA 2YLAA 1X1ZA 3LA4A 4PCTA 3BLFA 1GZGA 4HZ6A 4CQCA 3S2JA 3CL7A 2O9PA 2J8GA 5I3JA 1TV7A 2QV5A 4L6HA 3VE9A 4D6IA 2ZCGA 3HFTA 1KLYA 4Q32A 3VIGA 4XUGA 4RKAA 1E5NA 3GH4A 4Q4OA 4Y9MA 2OZ3A 2YR1A 3EWWA 3APYA 3ID7A 3L23A 3NM3A 1XLDA 4MWAC 3W7CA 4GISA 1SFTA 4HNUA 1J0IA 4RR4A 1M3UA 1F6YA 4H83A 3EBVA 2BB0A 4MWAD 4PTDA 3PJWA 1W5NA 3VNMA 2HV5A 5HWJA 4LEQA 1FOBA 1UR8A 4JZ5A 2DSWA 2NQJA 3TNBA 4JNZA 4L65A 3KVMA 1GOOA 2CNCA 2QUUA 2XVLA 2DV0A 4Z0JA 4FOKA 4PUUA 1K8XA 3WELA 5I02A 2ONEA 4G9PA 2XH2A 4WQ6A 5A2AA 1RBLA 2VCBA 2WMFA 3KRZA 3CZGA 4ZQPA 1HG3A 1NFPA 4LNCA 1V03A 2PDBA 3DG3A 3GHSA 2FZBA 2ZC8A 2HDJA 4J1OA 1DIKA 1E73M 4NAFB 4L80A 4BF7A 4GNKB 2FHCA 2Z2UA 3MSGA 1IE7C 4C6CA 1CB2A 3VM5A 3B8IA 4BWLC 3V0SA 4F2TA 1HKJA 4K38A 4E2BA 3VIJA 1L0PA 3Q65A 1Y5XA 3HPFA 4EANA 4MVAA 2WCGA 4HOZA 1UASA 1LYXA 2OR2A 4CCEA 4K37A 1PX3A 3WEMA 1MZHA 4P61A 1REQA 1VP5A 2IQ0A 1PO9A 1HT6A 1GGOA 3GFYA 4HNVA 4GJ1A 2VEFA 3RPDA 3MBFA 4B90A 2YZRA 3ZJKA 2P8BA 3UF9A 1UR3M 3GDBA 2WB5A 2GVYA 2ZE0A 4HN4A 2VRKA 2YCLB 4ZBCA 3TC6A 1BWVA 1M1BA 4ZR8A 2ZXAA 3MWAA 3CWNA 3CTTA 3IJIA 4LAKA 3BJFA 2GGIA 1GZJA 2R94A 3TTSA 2VVSA 1FFQA 1ITXA 4X2RA 3IJ8A 2A1YA 3RU8X 4DJEC 3NJ3A 1VFFA 2VKZG 2CYGA 1WXJA 3L21A 1CZ1A 3V0TA 2R1LA 4NYUA 1XIGA 3OVRA 5AZ0A 1J79A 3NQBA 1NWRA 5C5YA 3IGHX 5A8MA 2DSZA 1DJWA 4HNOA 4C65A 1PBGA 2GFTA 2KAUC 2DIJA 1LWJA 2W9MA 4FB7A 3R94A 3A3XA 4PEKA 5H6HA 1W5OA 4DUXA 1W9UA 2ZXBA 4S3EA 3RILA 5F7UA 3M4HA 1BLIA 5D9OA 4IPIA 4NJKA 2WZHA 1KLZA 2XWDA 3SRHA 1W3LA 2PZNA 3OODA 2XFRA 5CZKA 1GYNA 2VI0A 3N2OA 1NDVA 3RAOA 3GR7A 1E6RA 4D6CA 2E28A 4AZCB 2OWXA 4EPKA 4PUKA 2INEA 3WQ8A 4FNTA 3EDDA 5FESA 3AHTA 2NQZA 5A6LA 3TU9A 5U7SA 2OLSA 2POTA 2G37A 4WK9A 3TYDA 1W5PA 4HOXA 2AGTA 3VC5A 2VEMA 4QDMA 3UGRA 4XBKA 5E09A 1J93A 3TA6A 1E6QM 1AW5A 2GK1A 3QEZA 3WJXA 3IIOA 2DUZA 2YCJA 1FWDC 2D0GA 3B0XA 4JTEA 1FWFC 4DJEA 2CLLA 7A3HA 1QPRA 5D03A 1W6TA 3CHDA 3KVKA 1V3IA 3ZM8A 4XZHA 1MMFA 1S2VA 2BVDA 3A9BA 2QAPA 4LB4A 4Z2KA 4GO9A 4QFUA 2FIQA 3S5NA 4X9YA 3C2RA 4A4AA 3GIYA 2QXWA 2QGYA 4DVOA 1DBTA 4HNCA 3SUTA 4U10A 2EPHA 1PWMA 4E8CA 3BAYA 1K3UA 2XN2A 4WLCA 1A5BA 1JF6A 3UXKA 2BS9A 1WDSA 4C7DA 3QFEA 2UBPC 2XVNA 4F0MA 3RMJA 2DH2A 2BY3A 1OFOA 4PBEA 3N29A 4FXJA 2IKJA 3K46A 4GLEA 4Q7IA 1ME8A 1J0HA 5G1MA 1XLEA 3WQEA 4UMCA 1VFSA 3CQKA 1OZQA 1SMDA 1KQYA 3T4WA 4ILSA 2ESCA 3PPGA 1ZTVA 1JGMA 1FCQA 1IIGA 3F5LA 1OM0A 4O1FA 3QHNA 4DQWA 4UR7A 3TQPA 1RUSA 5EMMA 2Y4SA 3FA3A 4MB4A 4AX6A 4QAIA 4U28A 1XRTA 2X0YA 1WO2A 3N9SA 2H3BA 4LVFA 1G67A 4PTVA 4GI9A 1R85A 5BWAA 2A85A 1C3FA 3ZSSA 2WHKA 1OIFA 2ZUVA 3VX0A 3GS6A 4O0KA 5TQLA 4OFCA 1E40A 4JHMA 2GJNA 3HURA 4B3LA 1P5BA 4WRHA 5K4ZA 5KMYA 4DUVA 1FHDA 3DKJA 2IKGA 2OTDA 5I3GA 3K4AA 3NG3A 4YWSA 1PCKA 1BEUA 1TSIA 4LAZA 1F5ZA 3WLRA 4AUBA 4ZQRA 2XVPA 2DZXA 1M9HA 4AEEA 3AUJA 4KESA 5C6MA 3PJTA 4JEQA 2VUNA 4Z2IA 1FHVA 1M5WA 5C9WA 3GXDA 5C2GA 4L9XA 9RUBA 3HPXA 3ANVA 4LY4A 1UZ1A 4OKDA 4CQ8A 3RR1A 3E12A 4Q4PA 4X63A 1VGAA 2BTMA 3E0LA 3WEZA 2WHMA 4G7EB 3MP5A 1QI4A 4LXFA 3GLCA 1M7XA 3VIMA 4OBSA 5D09A 1SO4A 1S5WA 4GH1A 2EG6A 1UZ4A 1TTPA 1J8VA 3S2CA 3FN9A 5MHBA 1A80A 1WZMA 2CLPA 3LUTA 3GVQA 1QNVA 5AHLA 2B7OA 4IIGA 4AZGA 1BRLA 8TIMA 3TR9A 3GW0A 3V36A 1SMAA 3D46A 4J3XA 3KVLA 1U33A 3WUFA 3DFNA 3LV5A 2WPGA 3PPFA 2NQHA 4S3DA 1TTQA 3MW7A 3CGTA 4L4PA 4US5A 1SW3A 3N17A 2R1MA 3GVVA 5A94A 1RXOB 2EO7A 1K7EA 4NZ5A 4AB4A 1XYLA 4UWMA 1TA3A 1CBGA 1UR4A 3DZ1A 1JUKA 4S3BA 6REQB 4XG1A 4TMCA 1LQ0A 3EWZA 4N02A 3HQ1A 3LOTA 1TUFA 4PCFA 3QXBA 1XIJA 1G0CA 1Q6CA 1TPEA 3LNPA 1GVOA 4UFIA 2AGKA 3H7VA 1QR7A 1F3EA 4Y9AA 3QFWA 3LGEA 1TPB1 2WNZA 3B04A 1JYWA 2ZTKA 1XDJA 4CN6A 3LMYA 4A22A 5U4NA 3E96A 4ZXOA 1X39A 5D2WA 5ECVA 4DF1A 4GVFA 1TUXA 1UJQA 4Y9OA 1P0NA 1EJXC 3SQSA 4MGGA 1O68A 1X98A 3S4TA 3EX3A 3KCOA 2Q8LA 1V6VA 2BZNA 1X7IA 3LN3A 1VJIA 3T0CA 2CZFA 4L61A 1JZ8A 1JCLA 3LGDA 3WD2A 3E2QA 2WJFA 4D6HA 3G1DA 1H1NA 2HNHA 4GX8A 3W7JA 2W27A 3N1AA 3N6HA 1UD3A 1WYIA 3EX6A 2IPFA 4LH8A 3INPA 1AG1O 3C3UA 1UPMB 5C2XA 3HFYA 4N6EA 2Y7FA 5F4XA 5G2WA 1UZHA 4K3ZA 3SSZA 3VKKA 4YL2A 1TVPA 5KZMA 2Y89A 2C0AA 1EEXA 5DY3A 4KCWA 3B9OA 2WC4A 1AQFA 1MUMA 3AWNA 3GXTA 4IIDA 2O9TA 1GOKA 1YPFA 3UYCA 2DORA 5E0FA 5FAGA 1B5TA 2HQAA 4WOZA 1HP4A 1AA1B 4NIRA 4LBUA 3STGA 3ABSA 4HSNA 4F9JA 2F2KA 4NNAA 1AFSA 2EJ1A 3SUWA 4F8XA 1H0IA 1EYEA 5HPOA 4KWWA 1IXQA 3WJWA 1A5OC 1BG4A 1ICPA 1RCXB 1MRAA 1GEQA 1EP3A 3BANA 1L2UA 3C2FA 5CSYA 5A6SA 2E8ZA 4LQ1A 5HQMA 3IV3A 3A23A 2XN0A 4WKAA 4EP8C 3BJSA 3IPWA 3WF1A 4CNUA 1ISXA 1PTDA 2C1HA 5JBFA 3IV8A 3ZR4A 1IEIA 4UTWC 2H8ZA 3C8NA 2NX3A 3WMCA 5E9XA 1VLWA 3GTXA 3WIJA 1O66A 5I24A 3FGCB 1S3TC 3E2SA 3Q37A 4U4MA 1EX5A 4PGLA 1UBPC 3M0YA 1AW2A 5I3KA 3H2FA 3H4XA 4H19A 3TW6A 5ABFA 2FGBA 1PAMA 1L6GA 1GW9A 2I16A 2UV8G 1JZ4A 3EA1A 4MHBA 4LALA 4DXKA 3G1YA 4CD7A 3J7HA 4WY0F 5T91A 1D7KA 2CC0A 3DFOA 2YA0A 2J75A 2QCNA 3PZ9A 2XJ7A 3DYOA 3EB3A 3CPRA 3NOEA 1ZCCA 7CGTA 2XM1A 2W3ZA 3OVPA 3SCWA 3NSNA 5ABEA 3B4YA 2GJXA 2C19A 3H26A 3M5YA 4AD1A 3CU2A 2VCCA 3DHDA 4LVAA 5EFFA 5LA2A 1FWCC 4HK5A 4NRSA 1BF2A 3W7KA 1JD7A 3TWAA 2QS8A 4UFLA 2NZLA 5BRQA 1GONA 4RNIA 1M6JA 3IWPA 3U5UA 4EXQA 2Y85A 1RALA 4UUIA 2I5QA 1H11A 1AW1A 3GTFA 5GNYA 1CGWA 4QJ5B 1OCQA 2D20A 1CXIA 2FVKA 3G3MA 4K6AA 4XZWA 3DOPA 4UNKA 4ZZ9A 1C9WA 2WK2A 1D3CA 4NZ4A 4BK9A 2DH3A 4Q8UA 4LBSA 4JFUA 2B0MA 4PRRA 5HNTA 3H2AA 4H2CA 1Q6FA 4UCFA 4UTMA 1HN1A 2ZYFA 3NQGA 4CD8A 4RNFA 1B30A 4CQAA 3N18A 2XSAA 4UFMA 5J5RA 1FWGC 1QRQA 1I2OA 2D23A 3G18A 4JN7A 4ZEPA 2OPJA 3W6LA 2XIIA 1LDCA 1K8YA 1OX6A 3GDRA 3HQOA 3WBEA 1PKYA 4PMRA 3EB4A 3NQ8A 2Y8VA 3WD0A 3W2NA 3E02A 2GGEA 1Y7VA 3WN6A 2O9OA 3QV6A 4HNNA 4WIWA 1A5LC 2V2CA 5F1UA 4FXSA 1PV8A 4ZQMA 2WQPA 4FLQA 2QCDB 1IV8A 1TPFA 3BGGA 4FNRA 1OVDA 1WUFA 1OC7A 2OYKA 3BV4A 4FLOA 4PTXA 1YE6A 2VFDA 3MC5A 1MRQA 1EWDA 4BI5A 1X8CA 1HIZA 3JRKA 3UA4A 1RQEA 2ALDA 2J77A 4LYKA 4JBRA 4YNGA 1JZ7A 1YTDA 2FZ8A 1UG6A 4GINA 4C1NA 3P62A 3DFHA 1J0ZA 3P14A 3MY9A 3L0KA 4ATDA 2Y5EA 1GOWA 2Q8ZA 4L5ZA 3PNZA 1EHNA 3T40A 3ARRA 1KBIA 1UD8A 2BXZA 3P82A 5BXSA 1B4EA 4U2ZA 2UZ9A 4C5ZA 2QF7A 3LHUA 3BMWA 5L6UA 4LYRA 1DE5A 2P76A 2YL6A 2VWSA 4MFEA 4JTRA 2PBOA 2FHBA 1YXDA 1GUVA 2GSJA 7ODCA 1R3VA 1XYZA 2YGYA 4JX4A 2V5JA 2ZRVA 3WD1A 5DMMA 3M64A 1LT8A 2YIHA 4HZMA 2C79A 3GG1A 4I7VA 3S6TA 5A6BD 2GQ8A 5CGTA 1KNWA 3TYZA 3SAZA 4P8WA 1UCWA 3ARZA 5BROA 4GE8A 1JF5A 1W9BM 3DU0A 2GGHA 1KXTA 3MP4A 4Z1DA 3T8QA 3WQWA 1OFPA 4DLFA 4IG2A 4W85A 1K70A 3S0CA 2PDMA 2BGSA 4W5ZA 5CZ0A 1Z89A 4C1LA 3WNKA 1KGWA 3TQVA 3F2DA 4ES4A 4TVUA 2X7WA 4LUYA 4FR1A 4A8NA 1QNQA 2PP0A 2X1UA 5L9FA 3BLDA 2PTDA 1PYFA 1K02A 3BAKA 2GQ9A 3RLGA 1KXHA 1TR1A 5ABGA 4Y7EA 1JCTA 1FXQA 1VFLA 3LTYA 1P7TB 1WOAA 3DKLA 4HHMA 1TB3A 3OZMA 5AYBA 1FP8A 1A5KC 5KITA 4UR8A 2YB1A 5JH1A 5A6MA 3U3HA 1X97A 3GNXA 2H9AB 2BHZA 3B9NA 3FS2A 1GOIA 3HG5A 3V75A 3UWUA 1RK5A 2QR6A 1LOSA 4JFWA 2X09A 2VVNA 3TLQA 3GNDA 2O4MA 1W5MA 2GSEA 1KFCA 3N2MA 4DYKA 2VEGA 3NQAA 1I2QA 3O05A 1UOZA 1BXCA 4QXIA 5I7GA 2BBFA 3K8LA 3N4EA 4WSHA 3LPFA 3CZLA 4Q8OA 4L6OA 1HF6A 3TWBA 3O8AA 2NXGA 2GJRA 2NVCA 3UZXA 3GVGA 3FKRA 3LK6A 3ZMRA 1BQCA 1FKWA 1VRDA 4LFYA 3W01A 5CKSA 3WQ6A 1K4HA 5D32A 4AG0A 1MQRA 1RQBA 1GKPA 4OVXA 4GGHA 3AMGA 4GRSA 3IGXA 4CN1A 3VIIA 4DBDA 1CGVA 2GJPA 3PZQA 3R43A 4GHRA 4UTHA 3GXMA 3HV8A 1OD8A 3LSCA 1TCDA 2B4GA 3TSBA 1W32A 4IWWA 1POJA 2B31A 2NQLA 3AMCA 3FK4A 2PD9A 1V4YA 4IQJA 3M46A 2X2GA 1O5RA 1OIMA 1QPNA 2CBJA 1JDAA 1VCFA 1Q45A 2Z27A 4N0RA 3LZ5A 4H8NA 1NH6A 1LBMA 1NDWA 1TMQA 1ITUA 3TYAA 1EWEA 3THQA 3FYYA 1ZBCA 4UTJA 1PSCA 2PD5A 4B2DD 4K8GA 1EP2A 3QPZA 2D1ZA 5MF5A 5FSDC 1ONRA 1BTCA 4CLMA 4H9UA 3WDPP 2HMCA 4N9DA 4DO5A 3KM8A 3Q67A 3NOYA 4HMCA 1QDSA 4DM2A 1QI3A 4AWUA 3UXAA 3VNLA 5IFPA 1DJHA 2JKEA 4YTQA 4GH3A 3T4CA 3WQDA 4XK2A 2HEJA 1YX1A 2REQB 2A5HA 4NYYA 1ZAHA 1OGGA 7REQB 3V16A 1EC9A 2OG9A 3VD7A 4TX8A 1K03A 4MKNA 3ZQ9A 3VDGA 4IJBA 5D2YA 1W1B1 4HPGA 3ZFHA 2CLMA 4M3PA 2YBUA 2QJNA 2Q3RA 4GY0A 4PMJA 3VD9A 1F3WA 1ZALA 2NUWA 4W7UA 4ZA0A 4F79A 3II1A 9CGTA 1C8YA 1YKWA 4CCZA 4A29A 3H2MA 5JQ9A 1JL8A 4FX6M 1UR1A 2DZTA 2Z26A 4JHZA 3VIFA 1S39A 1W3KA 1K6AA 4GYPA 1EO5A 1WKEA 1F7BA 1TVNA 5FJJA 4NILA 4WDXA 1F74A 2ISSA 1G69A 3WG6A 4GGBA 4MDPA 4ASTA 3T09A 5BYWA 4GVHA 3WFZA 4AQLA 1ZENA 4K7VA 4KGJA 2Z28A 1OFQA 1EJTC 4FOUA 4ZVJA 4ZL1A 1ZP3A 4UQBA 1YRRA 1ZZMA 3H4WA 2VX7A 1U1JA 1VQTA 4CKQA 3NAVA 3L68A 3H24A 4PMYA 4Q4RA 5LIUX 5LGZA 1QNRA 1Z42A 1Q7ZA 2EPOA 4RPQA 1VAHA 2RDUA 1BHGA 2YXOA 3N6QA 2BVWA 4RDYA 1RP9A 1HKIA 2J7DA 2VEKA 3RLUA 5IFTA 4DY1A 3KTCA 2PTZA 4H7CA 2EQDA 1H0GA 1MEHA 2WNWA 2VFFA 1UW9A 1ADDA 4YTSA 4PZVA 4GG9A 2PLMA 4Z42C 4QTGA 2ZRWA 4UFKA 3VIPA 3P0XA 3LBCA 3CUFA 1LZOA 4NI8A 4GC4A 5A6AA 4FIRA 1T5AA 4GC3A 1TKKA 5GQBA 5A2BA 3AU6A 1WX0A 3B8VA 2NVDA 3AIWA 1GG0A 3V35A 1TJ2A 1MQQA 4XD6A 5CEWA 1M68A 2NWRA 4US6A 1UQYA 1DEDA 3LPOA 3KX6A 1V7YA 1FWHC 3FEQA 1SJAA 1HJVA 2C8NA 2VOMA 4UQDA 2O7SA 2J24A 3JW7A 3LQLA 2P88A 3MO4A 3CB3A 1I1XA 3G1HA 1W1A1 4WCJA 2ZRXA 4B15A 2J78A 3P60A 1I8JA 3DI0A 3B0UX 2OSWA 3PG9A 2VO5A 2CKSA 2Q09A 3M43A 3OBEA 4TTUA 4DWSB 3KL0A 1HZYA 3NQEA 3W1UA 2FPTA 3IGUA 1HNYA 4R5EA 1UR9A 4DBWA 3DECA 3CHVA 4LTSA 3AMDA 3W2JA 5DMLA 4CD5A 4CU8A 3U4FA 2BV9A 3WZ0E 4IGSA 1QVBA 1K8ZA 3A3HA 4GMEA 1NOUA 4DJFC 4WUIA 4CEXC 1XLHA 3AMKA 3BOFA 2KZHA 3QLDA 4KWOA 2X0HA 3GYCA 2VWTA 5DELA 3MSRA 2ZRUA 4H9YA 1KA9F 4DZIA 4DJFD 5FJPA 3T0TA 3VKCA 3M0VA 3STPA 1L6WA 3QQ0A 3QY7A 1RV8A 1V93A 3WQFA 3SIMA 4EAYA 4LSBA 4J35A 5C9RA 1CEOA 5E70A 3WLPA 2E4TA 2PGWA 2NSOA 2CEQA 1UD2A 4M7TA 1DTNA 2OJPA 3S5SA 3UCCA 1GEHA 2JF6A 3R7MA 4LC6A 5I3DA 7TIMA 4C5YA 1JFXA 4OUIA 4D71A 2DP3A 5DXYA 1YPIA 1S2UA 3CLWA 4DYJA 1TZ7A 3L5MA 3BH4A 2V82A 2Z1XA 1XGEA 3PTDA 1ESWA 1YBQB 4X22A 4GIEA 3TC7A 1LOLA 4MNLA 2E8YA 3ZWSA 3IAQA 1R2TA 3W2MA 2ABBA 1QPOA 3LXCA 5JBDA 3R5EA 4YIWA 1UIPA 3DAQA 5DRIA 1Z7AA 5EKYA 2DZUA 4BQ3A 3G6MA 1MXGA 2Y6ZA 4I9JA 2R91A 2C91A 3MP3A 3M0IA 1YLVA 4RJEA 4RE0A 1XISA 1C90A 4F2UA 1XIFA 1N82A 4AWSA 1F76A 1G4TA 1CXEA 1P0BA 2V5BA 1UKTA 4OJYA 1Y65A 1KM2A 3TH6A 2C16A 3PZNA 4IX0A 1SU5A 1TVLA 3ABXA 4PA8A 2DUAA 4IGHA 4XAFA 2EJAA 3GU1A 2R24A 5FF4A 5I5RA 1EQPA 4BA0A 2CZEA 5AYYA 3W73A 2GPTA 1F8IA 1ECEA 2VENA 3G8RA 3SADA 3HGOA 4MDOA 3ABZA 3ATZA 3W00A 1Q6LA 3THDA 5G4HC 1W31A 1DQWA 4AISA 4BF9A 1BYDA 2A6NA 2WKLA 2V30A 4AVNA 4W9TA 4JX5A 3AROA 2I9UA 4F0RA 2PDXA 3PAOA 2Z1KA 4IFKA 3BQ6A 4EPBC 3NQCA 5F4SA 2FTYA 5LSMA 3PZVA 5HJLA 4OGZA 1TV5A 1W0MA 5IBXC 1OC5A 4HPXA 4BF5A 1UC5A 1NDZA 4LV4A 4ADTA 1RBAA 3H70A 5CPOA 3W7PA 3AU2A 3RIKA 3T2QA 1BPLB 3O6DA 2E40A 4WY0B 1EXBA 2YL9A 1TFVA 4BHYA 1JXJA 4QBXA 3LI0A 1QI2A 3CUXA 3QMTA 5I00A 2PDYA 3RXZA 4O17A 3LENA 4EAMA 3CQIA 5M3WA 3IACA 5C70A 3CZJA 1W1TA 3NDZA 3N25A 3OB8A 3HO8A 1RCOB 1M7JA 2FJUB 2D3LA 2VC7A 4P7OA 1IGSA 1W1VA 4RE2A 3I3EA 2ATSA 3G6LA 4WDTA 4F9DA 5CG7A 3MUIA 3HJEA 1XBVA 1ZBKA 3O1NA 1VD6A 3KOFA 4JXCA 2BY2A 5LIKX 3GRIA 5C8BB 3NPWA 1RK6A 4JKMA 4G1KA 1MW0A 5TF0A 2ZUWA 1C8XA 2F38A 1EL3A 1OFRA 4JN6A 3HV9A 4CNTA 3TOYA 3LEPA 2RJHA 4WDWA 1E6XM 5AY7A 1FTXA 4UFJA 3IANA 5A5WA 2VGBA 1I2RA 3KRUA 2R1NA 3VNDA 1UQZA 1KV5A 4JEJA 4KEMA 4R88A 4IPLA 2PLCA 1XDMA 2ASHA 5DMYA 4RW3A 1FP9A 1OFDA 5AZ1A 2VOTA 1QNPA 4ZE5A 1XJBA 4KFNA 1S5MA 2YXGA 5EL1A 1NAL1 4JTQA 3UWQA 1ODUA 1GHRA 3NDOA 5JVLA 4MKSA 3C0JA 3SSJA 1LBFA 1IXNA 4V15A 1TPWA 3AIQA 1IR2A 2J66A 1TWSA 4KFOA 2Y1HA 4LBRA 2MUCA 1XKYA 5REQB 3SURA 1PDZA 1PKMA 4POCA 4ZB0A 4XAYA 3UETA 3FAWA 1HKVA 1FCBA 3OQEA 3LU2A 3FYOA 1L8PA 3B0YA 4J2PA 3W1MA 3KBSA 4LPCA 3EDEA 1CXFA 1GOQA 4HPHA 4O10A 3PZUA 3ZLGA 3GXIA 2XHYA 2WLYA 2E25A 1OHLA 4L1WA 4AC7C 1AH4A 3KBVA 3T1GA 5HATA 2WSKA 1NWSA 3OP2A 2E6DA 4KERA 1NARA 3ARWA 4IMEA 3T08A 1KFJA 3HG4A 5CAKA 2RUSA 1LCOA 1UHVA 3SW6A 1S5TA 4NZCA 2OQHA 1UWSA 3OLIA 4JGDA 3AIBA 3I7QA 4K7YA 2AL1A 4MJZA 5LNRA 3VKBA 1E6PA 1R5YA 4UTIA 3K4WA 5I0DA 3BGAA 2D22A 3BG9A 4M6UA 4IGMA 3MHGA 3BXWA 4ZSUA 4TX6A 4QHRA 3DUGA 4XZ9A 1B3ZA 1G4EA 1KR1A 4HYWA 3OGSA 4N4PA 4F0HA 5EMJA 3WH5A 3BTNA 2WVUA 4DZ5A 4LS2A 5BXTA 3JS3A 1I75A 4AYSA 4IX2A 5LIYX 1V0LA 1KWKA 3H2CA 1EC8A 4V1XA 1XUZA 4YU1A 3MB9A 2ZUUA 3BJTA 2RGMA 1VKFA 2CESA 3KVJA 5K3VA 5I3IA 1PDYA 4ERIA 3P81A 2XFFA 5DBUA 4E8DA 1TJRA 4KCTA 4M7SA 5HWNA 1XLLA 2DZAA 2DFAA 3S6OA 7TAAA 2FVLA 2PDIA 2Q71A 3W7MA 1TQJA 4IMGA 1GW1A 2FKPA 2V3DA 3ZVIA 1H2JA 2V63A 1LUCA 2J6VA 3L4YA 2OELA 1UD5A 3U9IA 3WK2A 3CAKA 4YWIA 1UWQA 4PC8A 1FKXA 3TV8A 4DAIA 4JIRA 5DY2A 1DQXA 1YADA 8A3HA 1JRBA 3PM6A 2DT3A 4N9EA 3P80A 3WH7A 1VEPA 1LQ2A 1ZB5A 3IRDA 3P84A 4AHQA 2ZXQA 2WVSA 4IUOA 3USBA 4R3UA 1MNSA 3MYPA 5G5IA 1JQVA 4GOAA 3GHTA 4AF0A 1IF2A 1D9EA 3AXIA 3UVAA 3FY1A 4GCAA 2Y8KA 1J01A 2NV2A 4E3TA 1EGVA 2Y63A 3BLPX 1E0VA 2H90A 2XH0A 3IJ9A 1GPFA 1SPQA 3G22A 2HK1A 3SRDA 4P7QA 4ERGA 4I5UA 2BG5A 2EPMX 4CU7A 1PE1A 1Q13A 3UQNA 1CT5A 4LVBA 1FWEC 3KDOA 4KQNA 3H53A 5DF0A 1OABA 8XIMA 2J4GA 4KRZA 3M6DA 2FPVA 4REQB 3CAWA 4LCSA 3CNYA 3KRBA 1NTHA 1R9YA 3SUSA 2CKRA 4R34A 4RX0A 3SY5A 3T05A 1Q5MA 3NDYA 3EWDA 1F3XA 5I03A 2Y5JA 4PUMA 1PX8A 4YTUA 3CASA 1PZ1A 5DRCA 2CXGA 4O0QA 3R2GA 3KL3A 3QW4B 1LLZA 1TV2A 4OUEA 2F6UA 2PRMA 4H9ZA 1HL8A 2Q6ZA 4ZO8A 1Z6KA 1JZ2A 2HXUA 4MWAB 4CGTA 3IVTA 3M0HA 4HNTA 3BGJA 3F4DA 1MSSA 1CWYA 4F0LA 4M1RA 1JPDX 2CLIA 1B3YA 2C1GA 3QZAA 1V3HA 3A4WA 4H1ZA 3BARA 1ZBVA 3V5FA 4K68A 3BG5A 2X30A 5BXPA 2PDLA 3UPBA 3PFRA 3VIOA 3BO9A 1XCWA 3FV9A 3H7RA 1S1PA 2XZ7A 3H23A 3KOZA 1WE5A 5D2TA 1C9DA 4PE8A 3W37A 4WJEA 3OHIA 3TZFA 2QQ6A 2FFCA 2OKOA 3MBDA 2HJPA 2FGLA 3VIKA 5T8GA 1R3TA 3T6CA 4BY3A 4YTTA 1MI3A 2PU0A 3UZ5A 3RCMA 3RLVA 1KTCA 4N9BA 4MB3A 4NP7A 3S8HA 3GXNA 3MTWA 3WNOA 3LLXA 1S5NA 1RR2A 3I6RA 2ZVIA 2P50A 3BSMA 3CUZA 4JTJA 4Y9NA 3BWWA 2V5DA 4QS5A 3TAKA 4XAGA 3R8RA 4INFA 4EWND 1AH3A 4HU3A 3OTRA 2VEIA 2ZQ0A 2Q01A 3R6IA 4XD3A 2VC5A 4A3UA 3HZ3A 3CLMA 1XBXA 4UOJA 2G3IA 1Q3NA 4B3ZA 1NDYA 1AJ0A 1VYSX 3REQB 3T2OA 1U1UA 3M41A 5FEWA 3U48A 5D9MA 2AQOA 2OEKA 3F5KA 1EOMA 1XLJA 4LVDA 5AC8A 4LCRA 4MG4A 1R3YA 4UZUA 3DX5A 2W67A 1BQGA 1FHLA 3VILA 1M41A 4GUIA 3XIMA 1IZKA 1F8MA 3M0JA 1HO1A 4JTCA 2QVHA 1IWPA 4RLIA 1QASA 4U2YA 4MNKA 1UR2A 1ZJHA 4NAFA 1KFKA 1P48A 3UY8A 1L6SA 3SFKA 1IXOA 3UZJA 3NL5A 3V3WA 3ITGA 2XTKA 3GHRA 4Y90A 1C93A 1W1IE 4OHQA 3TSMA 1LG1A 2VL4A 2VZUA 2OSXA 1KD0A 3SY8A 1P0KA 5K9CA 3TTQA 2WMGA 3SI9A 2V3FA 4KEVA 1IT8A 3BAJA 2WO5A 5K2ZA 3CQ0A 1JGIA 3BSGA 3BOLA 3IIXA 1BYAA 5IDZA 3N73A 3AXKA 4NXKA 3KLLA 3EMCA 4FNPA 3CUIA 1XP3A 4EOUA 4KETA 2WCAA 3SCQA 4MB5A 2PAJA 1R7OA 2YCLA 1WXZA 3CUJA 3VOIA 1FH9A 1VENA 1WZAA 4OE7A 3P0WA 1IIHA 3AICA 3ARXA 3FJNA 4JY8A 1MVYA 3QZEA 5HINA 3N3MA 4QP0A 1JG9A 2I56A 2FGZA 3BW4A 3QGAC 3BAWA 4HKPA 3SFWA 1O4UA 1TPUA 2GUBA 1G6CA 1I6NA 1QTWA 1V5XA 3RO6A 4A8RA 2EBNA 2JEQA 3O07A 5I6SA 5FKYA 1KQZA 3FFSA 4M6VA 2VC9A 3FVMA 2TMDA 4S3JA 5AVHA 5EBUA 5DO8A 3EDJA 3B97A 2E67A 1VCVA 3U4AA 5C9XA 3UWZA 4QG6A 4ICCX 1LM1A 2Z1BA 1JYVA 4EX4A 5CPSA 4WD0A 1Q7MA 5T26A 3TX9A 2PMQA 2J7FA 4Z2HA 4YMZA 2C1IA 4MMWA 3EEGA 3ONCA 3W27A 4GIYA 1QUMA 1TMHA 4YVVA 4HU0A 3ZR5A 4AZCA 3WUGA 1DL3A 2E09A 2VQTA 3CHFA 3DDMA 5C7VA 4ORIA 5AB3A 5CPMA 1V08A 1IT7A 1W1ZA 4FR6A 1QBAA 4JKLA 3KZSA 1VPQA 3ISIX 4GI6A 3W1XA 5DQPA 3VX1A 4GXWA 3VABA 3VGDA 1EH9A 1W91A 1FWBC 2WQDA 1NOWA 1MQPA 1VF8A 1HW6A 2NV1A 2YLLA 2DY3A 4I6KA 1IXPA 5HMFA 1JNEA 2NWSA 4MB1A 3RDKA 1QWKA 4IJCA 1JCNA 2WVVB 1Y0EA 2YZ5A 5AC4A 3PB0A 5DN1A 1KGUA 2VM8A 3PBVA 1W3JA 2WHJA 2CETA 5ABTA 2PEVA 1GWJA 3AC0A 4B9ZA 4J9JA 5FCZA 1OADA 2W92A 2QF8A 2A3BA 3I4KA 1W3TA 3L5AA 3A5FA 3W53A 4M29A 2E3ZA 2OEMA 2A3LA 4LCQA 4NNBA 4OBTA 1F05A 1XM3A 3H7UA 1RHCA 5IDIA 4HHLA 3NUKA 1LWIA 4PR4A 4DI8A 3VGBA 3MUAA 4PRTA 3NWRA 1O5QA 1CECA 1WV2A 2W61A 2WVTA 3DYMA 3PJXA 1X7FA 4ROQA 3DIPA 1CENA 1J6PA 1X6UA 3PSWA 5F4WA 3EB2A 1OGSA 1DKWA 2DSVA 1PXGA 3COTA 2XM2A 3SGZA 1CTNA 3PN8A 5HUPA 3TE9A 4AX7A 3WBAA 2X1TA 4DHGA 4E4UA 3RYSA 3QW3A 2NX1A 4F0SA 4O8AA 5I78A 1VH7A 1F4AA 3SCSA 3UXIA 3B06A 4S39A 4CNSA 2DSUA 4O1CA 3FA5A 5AFDA 1DIOA 5IXEA 5EU9A 1Q7QA 3AFBA 1NWTA 1NFGA 1ITQA 1GJUA 2A3EA 5D05A 1U5HA 3UG8A 4HA4A 2D73A 1DP0A 2IXUA 4G7EA 3TJIA 3AJ7A 3CV1A 1FDZA 2FTWA 1V0KA 1E43A 2J79A 1GQJA 4ZGYA 1VHCA 3NQ6A 1GTHA 3EXTA 4HYRA 4UOZA 1UP0A 3FYPA 3FOKA 2CBVA 1H7WA 3TMQA 1SSDA 5I09A 4O4WA 4B5WA 4W93A 1KO0A 3KE0A 4HTYA 3AI0A 2YX0A 1GKQA 1XI3A 2CLKA 2YDQA 3O16A 5CZTA 1Q66A 3VNYA 4YN5A 2EHHA 5CPLA 1OFAA 3CPGA 1V6YA 3NURA 2Z6IA 4Z2JA 4ZE4A 4H3DA 4LJ3A 4C6LA 3QF0A 4JS3A 5AOUA 1WBHA 3MKVA 4KRTA 1UC4A 1YTEA 3N6JA 4G6CA 4I7WA 4HIBA 2ZZ1A 3AZSA 3IIZA 1GNXA 4E3VA 1WKFA 4DZAA 3KBNA 2W6RA 6REQA 4UNIA 4QM1A 1TTIA 3N9RA 4I9TA 1XLIA 2GSHA 5TD4A 4IPPA 2EGZA 3QM3A 4J40A