1LOSA

Crystal structure of orotidine monophosphate decarboxylase mutant deltar203a complexed with 6-azaump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
216
structure length
216
Chain Sequence
SRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGDPGETLRFADAIIVGASIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of inhibitor complexes reveal an alternate binding mode in orotidine-5'-monophosphate decarboxylase.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Lyase
molecule keywords orotidine monophosphate decarboxylase
total genus 80
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1losA00
3U8GA 2H8XA 3LTPA 3LLDA 1Q6QA 5MHBA 1YADA 4UMAA 3L5LA 3EXTA 3ELFA 3VFLA 1GYNA 4MLRA 2A6NA 3B06A 5DLCA 3DGRA 5CPNA 3DFNA 5D2TA 2EPHA 3W7EA 2CW6A 1O5XA 3OA3A 1ONRA 3C2EA 5AHIA 3PG8A 1FCQA 4O16A 7TIMA 3NQFA 4LNYA 1OX6A 3NM3A 6TIMA 3RU6A 1XDLA 4RZ6A 2VEKA 1WBHA 4FNUA 2QCEA 2DP3A 4N4PA 3EKLA 3SSJA 4UIOA 4YXGA 2G95A 1SZFA 2E5DA 3WJWA 4UXDA 3V1PA 2DZXA 4XKYB 3G1FA 4QNWA 3CEUA 3P5ZA 3WK3A 2X1SA 3G8EA 4PEKA 3W1QA 3UWZA 1YXYA 4HT3A 3W2KA 3WJYA 1HO1A 3UY7A 4O52A 4E2DA 3ATZA 5D02A 3W7LA 2RDWA 4TO8A 3MI6A 3W7RA 2VELA 1QNVA 3GK0A 4WOQA 4YCOA 1P1XA 2AAMA 1QOPA 1PHWA 3SGUA 2B4GA 4Y96A 2EGZA 4RR4A 5KMYA 1LP6A 3PC0A 2ZFAA 3O63A 3EX4A 5EPDA 3INPA 2DU2A 5T26A 1BWKA 2I1OA 3TQVA 5D2VA 2WQPA 1G4TA 1OK4A 2G97A 5K4XA 3L0NA 3LCIA 2AQWA 1P0NA 2V9DA 3BLIA 3DXIA 3ZWTA 4GUHA 3W7GA 2R8WA 1T8XA 1GZGA 2E6AA 4IUOA 3MP4A 4JS3A 3LCFA 3F4NA 3NVTA 3S1UA 1YXCA 4IGHA 1KBJA 4TX9A 1IXOA 4IOTA 5CG7A 2A4AA 4O13A 1UUMA 3MUXA 5CZ0A 4WD0A 1QWGA 1TB3A 3W84A 1SFLA 1H5YA 3TJXA 2GOUA 1EIXA 4BFAA 3FJLA 5CGQA 4BK9A 1NAL1 3EX2A 4UTLA 4YCPA 1H60A 2D73A 2A7PA 4ADSA 2Z1BA 1XUUA 3W1XA 1JRBA 2FPTA 4LWWA 3RNDA 2CZFA 1SSDA 2X30A 1SW0A 2C0AA 4JEQA 2ABBA 1EP1A 3M5XA 4DF1A 1N8FA 3NQ8A 3O06A 4U28A 1KM3A 1W5MA 4P61A 1DL3A 2Y70A 1P0KA 5D37A 1WYIA 1VYSX 1TPH1 3NA8A 5DBTA 4JIQA 3LHZA 3NQVA 4XWUA 2YYUA 3G0SA 2ZA3A 2AGKA 1WQ5A 5IBXC 3NEVA 3TMLA 1Q6LA 5EYWA 5EMUA 5E93A 4FX8A 3CQ0A 1S3HA 4BF9A 4KWVA 4NX0A 5FF4A 3MBDA 1TREA 4LW7A 3G24A 4LC6A 3M9YA 2YX0A 3PM6A 1FBAA 3IEBA 1U5JA 1ZAJA 1H50A 2ZA1A 3DU0A 4RXFA 1SSGA 5FI8A 1B4EA 1PE1A 3DFPA 2C1HA 2QEZA 1LBLA 3R2GA 4CCCA 5HWNA 1IXQA 3RK8A 4QM1A 4O1AA 3LI1A 5CPMA 1KFKA 2TMDA 4UTHA 4D2JA 3G1YA 4X3ZA 1CI1A 3W6YA 1D3HA 4JTUA 3G0UA 4WOZA 4MOZA 3NQCA 4NXSA 4OV4A 3KVMA 3P62A 4NT0A 4GUIA 1EP2A 1R30A 1JCNA 1W5QA 3GKFA 3KRSA 4JTJA 3LV6A 2W79A 4Z1CA 1BEUA 4UMCA 4GFSA 2F7FA 1EP3A 1TQXA 4N2YA 1I2NA 5FF2A 5HQEA 1OX4B 1BKSA 2QCMA 5AHNA 3SR7A 1H7PA 5AFDA 4LS0A 4DELA 2Y85A 3UWYA 1W8SA 4WUIA 1LYXA 1TTPA 5I3KA 2HSAA 4YWIA 3UWWA 4H3DA 3MYOA 1XC4A 2DZTA 1TYGA 2DJLA 4PFMA 2QCHA 5D32A 4MPQA 3NO5A 2WOQA 2OCZA 2NUWA 4UFKA 5D33A 2QJHA 2RH9A 2ZA2A 2YDAA 4ALDA 3IGUA 2VKZG 3HIJA 2VFDA 3NPXA 4JTEA 4MY1A 2GQAA 3LHTA 3O8AA 4NZFA 4XZ9A 2Y89A 1I4NA 3KHJA 3KVKA 4JDBA 2Z0IA 3P67A 4JTIA 4LVGA 1KM1A 1GG1A 4FNRA 2QKFA 4NUWA 5GVJA 3TKFA 3W1LA 3A9IA 5D05A 1GQNA 3N3MA 3W7QA 5KSWA 2OMAA 3G0XA 1I2RA 3IIPA 1GYLA 4IPIA 4M19A 3M44A 2ZRWA 3AO0A 3Q58A 3UD6A 2E6YA 1XFBA 3FOKA 3VI2A 1YPFA 4Q33A 2V8ZA 1PHQA 3G3DA 5FF7A 2QCCA 1QPRA 4FNPA 1G4SA 3SY5A 2OJPA 3TR2A 5AC6A 4QAIA 1GT8A 1HL2A 2NXIA 1ZAIA 2YFOA 3L67A 5LZLA 3BW3A 4PODA 3UWUA 2YW3A 2ATMA 4PTNA 3A5FA 3TC6A 1W0MA 3ABSA 2V5BA 1I8JA 4IMFA 4ZQRA 2C19A 1JVNA 5LSMA 1DQWA 3MYPA 1OF8A 4IJBA 2V2CA 4O11A 1GG0A 4S2BA 2CLHA 3M0ZA 3QJAA 2ZBTA 1TRDA 3GB6A 5K9CA 3PBWA 1SO4A 3NAVA 3QPZA 1FXPA 1EEPA 1SUXA 2A2IA 3T7VA 1OFOA 2OZ0A 3UWVA 5KTLA 2ISWA 5H91A 3CU2A 3JR2A 3PUOA 4K7VA 4YL2A 5D09A 3HG3A 4MYXA 2GVGA 3LCLA 3QW4B 4X2RA 5KZDA 1QFEA 3QQ0A 2IQTA 3HPXA 2R14A 3W74A 3H54A 2ABAA 2QCFA 4JYEA 1VCGA 1H7XA 1N7KA 1AMKA 4QISA 2TPSA 4JGDA 4KKXA 2ZRYA 1OHLA 3WK2A 3G8RA 4AHOA 4UC5A 4UCGA 2QDHA 1GPWA 4JDYA 1TJRA 1EX5A 1O94A 3HG5A 4NJKA 4PH6A 4JN6A 1ADOA 1EUNA 2XN1A 3L68A 1ZALA 1OFRA 1IGSA 2RDTA 5F2GA 3N19B 3NYZA 4UUIA 3QYQA 3ABRA 5LNRA 3O15A 1F74A 2J9ZA 4L4MA 3VKJA 1XCFA 1QPOA 4O53A 1E51A 2QCDB 3NZ1A 2XFWA 3HGJA 5AC7A 4AWSA 1Z48A 5D30A 1GTEA 4CQ9A 1A5SA 3NQEA 1YPIA 4GUJA 2V5LA 1X1ZA 2VC6A 2CLMA 2WSRA 1RPXA 2FDSA 1ALDA 4UFMA 3WJXA 5IBXA 3GX9A 1GVOA 1KBIA 3NQAA 4UR7A 1W5OA 5F2LA 2LLEA 3E49A 2WPBA 4BR1A 2JGYA 3H53A 1UBSA 5KZEA 1NVMA 4O1DA 4JD4A 5CZSA 1WAUA 1IXNA 5I3JA 4MYAA 5G1TA 3BW4A 1JCMP 3IRDA 2TYSA 3C3NA 4NJIA 3LCGA 1G7UA 3UNDA 3E0IA 3GZ3A 1F5ZA 2BXVA 2FJKA 4Z0JA 1RZMA 5AHEA 3PY2A 1TQJA 1KM4A 2ZTKA 1FWRA 5HR6A 1XKYA 3M41A 5U7SA 2ATSA 1TPVA 3A5VA 4MFEA 1L2UA 2HMCA 2QAPA 2YFNA 2A6LA 2RFGA 2C6QA 2YW4A 3LB0A 3PSVA 1G7VA 2FQIA 1YTEA 4CNPA 2J88A 5EKYA 5E1QA 3NGJA 5K9XA 5I3FA 3G1HA 1MEIA 3C8FA 1TV7A 4MKNA 3TNOA 1HO4A 4JY9A 5DY2A 2GUUA 1PCKA 5CSSA 5DELA 2E6FA 4ZVJA 3C0JA 4O1BA 1P4CA 4GNJA 2FPYA 4W9TA 3NG3A 3W1MA 2CFFA 1X7FA 5J5RA 3HBLA 1JJKA 4A3UA 4MY9A 4IMDA 4C1LA 4L4LA 3ZR4A 1RQBA 2V2HA 3W72A 1SW3A 3PB0A 1J5TA 5HMSA 3R8RA 3TV8A 1R2RA 4BWLC 2PE4A 4O54A 4AHPA 2BX7A 3CPRA 3EWWA 4NJHA 4PCFA 2PURA 5BMWA 3QH2A 1C29A 4MZ1A 3OVPA 3LXCA 3P60A 4O4WA 3DI1A 5F2MA 4ZQOA 2B0MA 1DVJA 4WQ6A 3HO8A 1X1OA 4AAJA 4NVTA 1OF6A 1FXQA 4QNEA 3C6CA 4OV9A 1WX0A 1AL8A 2GQ9A 4LY8A 4LRTA 1K02A 1OYBA 2CLLA 3A24A 5C54A 1DKWA 3UYCA 1M7OA 3C4UA 3KRZA 2C3ZA 1G69A 5CSRA 1ZFJA 4R53A 3NXFA 4UTMA 5I3GA 4O28A 3HGOA 3LLFA 2A85A 5G2HA 2E5CA 3LRKA 3UPWA 3WFAA 4OE7A 4AEOA 2QDGA 1G6CA 4NJJA 3P82A 1W56A 1OFDA 2VXNA 4LUJA 1SR9A 1DJQA 1OFPA 4UMBA 1VGAA 3WK0A 5A5WA 3SZ8A 3KXQA 3FJ6A 1MO0A 5G2WA 2E5BA 4E2BA 3HG4A 3W7HA 2V81A 3W86A 2ZCGA 5LGZA 1OFBA 1FWTA 5CKSA 2X1UA 4O10A 4JTTA 2ZZ7A 4JNMA 4UFLA 3NQMA 1YTDA 3EEGA 1RR2A 3FYPA 4Q4KA 3IV3A 2CLIA 3D0CA 4DPPA 5AHLA 3N73A 3BV4A 3OBKA 1LCOA 3O6YX 5CPOA 2WO5A 1SFJA 3GNNA 3FLUA 1SO6A 3UPBA 2ZRVA 4K38A 1TPUA 3TJLA 2BSLA 1WOBA 1ZHAA 1KV8A 1TJPA 2CZDA 5G4EA 1DORA 1A5AA 5HNRA 3LHYA 3RLVA 3NQ2A 4JTKA 3P8JA 3GXPA 3IVUA 3N9SA 1OVDA 1OYCA 1ME8A 3PWAA 4XKYA 5U4NA 3G1VA 3DFTA 2YYTA 1TPDA 4N9BA 2X1TA 2CLOA 4YMZA 2QCNA 2GPTA 3S9YA 3DHDA 4Y9AA 1JCJA 4MZ8A 1OABA 1TPEA 3TQ0A 3W2LA 2ZZ4A 4KFNA 1SPQA 2E77A 2A5HA 3HPSA 4UFHA 2GVJA 3L9CA 4K8EA 5HULA 2QCDA 1LRQA 3T78A 1C9DA 3NZRA 4R33A 3RF9A 4S2CA 3PUEA 5LNWA 1A50A 4FIRA 4DEFA 5AYYA 2UV8G 4O50A 1KW1A 3IVSA 4GUGA 2C14A 3NPVA 3EWBX 1Q6OA 1IXPA 4AMAA 4XTDA 5DCBA 4UTJA 3VCRA 1JUBA 3DH7A 1I2QA 3QFEA 1W3IA 1LROA 1N55A 3LTSA 1J2WA 3STCA 1CX9A 1VJIA 1V7YA 2ZYFA 4E38A 4K8HA 2ZRUA 4UTTA 3ATYA 3GNDA 5FEWA 1GVFA 4WXYA 1VR6A 4EWND 4O12A 3I6RA 3S1WA 3P5YA 1FCUA 3W2MA 1FDZA 3LOTA 2DJXA 3N2XA 3G18A 2X2GA 1EB3A 4LTSA 4N9EA 3C52A 3FYOA 4A22A 3QW3A 4FB7A 3TFXA 2NX3A 2J9XA 1HG3A 3LM7A 4MLJA 3BW2A 4UTWC 3OG3A 1TTIA 2RHGA 3LV5A 1Z41A 2CLEA 4AVFA 1K8YA 1UJPA 3W23A 4LV4A 3AJXA 4JTGA 3LXBA 1VLIA 3YPIA 3NQ6A 1W1ZA 1H63A 4UR8A 3I7QA 3W9ZA 3P81A 2RKXA 5HUPA 4CQAA 3UZJA 3R5EA 1KLZA 3UZ5A 3P84A 3P7YA 4I7UA 3B4UA 4QJ1A 1G67A 4LUIA 2B7PA 1YDNA 1JQVA 4FO4A 3L21A 3W2JA 4LVFA 4LV9A 1GVRA 1F6KA 1TTJA 3TC7A 1IF2A 4Y8FA 4DXVA 5EY5A 4QSHA 1Q45A 1TPFA 3H55A 1I2PA 1H1ZA 4O15A 2Q3RA 5D03A 4LVDA 3NL5A 5AHFA 3DFQA 3O6DA 4YLWA 5K7JA 3T4CA 4K39A 4XBKA 2EKCA 1ZJIA 1MXSA 4O14A 5BOOA 3E02A 1KTNA 1W37A 2YCEA 2ZRXA 5FF0A 4IMGA 4AF0A 2Y7EA 3TH6A 4XQ6A 2HTMA 4RLIA 3W1RA 4AWUA 3LHUA 1K7FA 1OFAA 3L5MA 4IMEA 4MY8A 1ME9A 1BWLA 2JGQA 2Y7GA 2X16A 4DF0A 1RD5A 1NEYA 3NQ7A 3OEXA 5F1VA 4DBEA 3LCXA 2G96A 1TPC1 1Q3NA 1VYRA 3LERA 3HG2A 2E1DA 3O05A 5EBUA 1VZWA 3CIXA 3NL6A 3EWZA 3MJYA 4UTWA 1GVQA 3GDLA 2VFIA 2ALDA 3T55A 2VENA 3BLEA 1RQEA 5AC8A 4O57A 1B3OA 5IM51 4LS1A 1VS1A 3TDFA 2H8ZA 4ZZ9A 4LVBA 1VCFA 4PC8A 4WY0F 3QMTA 1B4KA 3G1AA 1PL9A 4HHPA 2DZUA 4UNLA 2HS8A 1L6WA 1L6SA 4LOCA 4A2RA 4XBSA 2XN2A 5HWJA 3NPWA 1LTDA 4UNKA 1F73A 1ICQA 5DY3A 1FWWA 1YYAA 4H4IA 3SGZA 3ZS4A 2A1YA 5TIMA 3MMTA 5FESA 3UXDA 4R34A 4GRSA 3TAOA 2WSYA 4OHQA 3S5ZA 2X1RA 2V2DA 2A7NA 3W7CA 1MZHA 3DI0A 2WV8A 4UTIA 3C2RA 2Y61A 1FWSA 3FIGA 4HSOA 3VE7A 1V5XA 1DOSA 3TMQA 1KM2A 3CTLA 5BNKA 3N14A 4JX4A 4DBDA 2CWNA 3TXVA 2KZHA 3HPZA 3W7NA 1T96A 5G4WA 3L0KA 3HOJA 3E96A 2QCLA 2Z2UA 4M7TA 1KLYA 2WSQA 1NF0A 1UCWA 1VC4A 5AYXA 4FXRA 3STGA 1FX6A 3OHIA 4JTSA 3CT7A 3L65A 3PUDA 3A21A 4Q32A 3TSMA 3G22A 4FF7A 3MP5A 3OVRA 2P1FA 4PA8A 1XBZA 3E9AA 1L9WA 1ZAHA 3C61A 3GLCA 3TUUA 3Q37A 4LT9A 2HS6A 1KFBA 1UASA 1QO2A 3HGRA 3EXSA 5H2ZA 1ZENA 2Y6ZA 4ORIA 1QCWA 4IXXA 5FEPA 3W2NA 4TR9A 2V0TA 3CWNA 4OQVA 1JCXA 1ICPA 3QZEA 2CZEA 5K2ZA 2FB3A 4ORMA 1FCBA 1B9BA 1S5WA 2PCQA 2Y63A 3PG9A 3QSTA 4GBUA 4ZMGA 2QAFA 5EA9A 4DF2A 2EHHA 3M47A 6ALDA 3FA5A 2R91A 2YZRA 2DZPA 1PVNA 1TV5A 1M7PA 5AOUA 5G2IA 1QMLA 2C18A 1HUVA 4O0KA 1WDWA 4UFJA 4BI5A 1JCLA 5A8GA 1A53A 4KFOA 1H1YA 1VLWA 1SZGA 4HNUA 1QR7A 4O8RA 3W70A 4Z1DA 4N6EA 4NJGA 4RX0A 2PRMA 3W1TA 2H3DA 4FHAA 3QMSA 1MEWA 5BMXA 4FNQA 3RLUA 3G3MA 1GEQA 1G4EA 1X6UA 2F84A 5ABTA 3CHVA 1CW2A 1M6JA 1Z44A 2FIQA 4FNTA 1LOSA 3ANYA 4XUGA 4FX6M 4Z1AA 3GXNA 2CLFA 1WA3A 3M7WA 5DBUA 3GIYA 4FXSA 1A5CA 1OYAA 1TCDA 3B8DA 1I45A 1R2SA 4JTFA 2YPIA 4Z08A 3GYEA 3EX6A 3THAA 1F05A 4AWTA 1EUAA 4O4VA 1EA0A 3EWYA 2QJIA 3TCEA 3BO9A 1T99A 5SWUA 1LOQA 1WOAA 1TO3A 4NU7A 3S42A 1XXXA 1R2TA 2Z6JA 1K8ZA 3IGXA 3NNTA 4RZ5A 1SO3A 1QO5A 2A0NA 3LCHA 3M5VA 1D9EA 3U2OA 3USBA 3FS2A 5KINA 4JTLA 2ZRZA 3C2OA 2R94A 4PL1A 2TSYA 3CEPA 3KVLA 3UY8A 1K03A 4OBTA 3TU9A 2VFHA 3GR7A 3QQ1A 3UQNA 4WX2A 1F76A 4NZJA 1MEHA 3S0CA 4ICNA 3WJSA 3W73A 4BWLA 4JIPA 3R12A 1JCYA 3M1ZA 3GR8A 1G4PA 1W31A 4R7JA 2WJZA 3V75A 1S5VA 4RK8A 4FEZA 4IWWA 3N9RA 4EOUA 2QR6A 4O18A 2I14A 1XL9A 2C15A 3EXRA 2V30A 3TSBA 1W5PA 1VYPX 1XM3A 2Q3OA 3BG3A 5DCEA 3S1VA 4IPJA 3HJZA 3TQKA 3EWXA 4N4QA 2PRHA 5L9FA 3S8HA 1K7EA 1OFEA 3TA6A 1QPNA 1YDVA 5LNSA 3EX3A 4A2SA 1XBXA 4CCDA 1OFQA 3LGEA 1PCWA 2GQ8A 1YTKA 4UTTC 4BI7A 4K36A 1OX4A 2JBMA 2FB2A 1VQTA 2NXHA 5HUOA 3FFSA 3PB2A 4I7WA 1A5BA 2Y7DA 1ZCOA 4WXZA 3W71A 3LHWA 3RMJA 4ADUA 1VPXA 4WY0B 3DKJA 2GVLA 2BLEA 1VHNA 3CC1A 3CLMA 4GXMA 4N02A 1EPXA 2EAWA 1JR1A 3QRHA 3BPWA 2BWGA 4RCXA 5FEZA 5HWMA 5DXXA 2OX1A 2NWRA 4QIUA 3TFCA 3M5ZA 2WNZA 4GUFA 4E0CA 1UUOA 4AHQA 3JRKA 3MO7A 4JYFA 4NXKA 4M6QA 3Q94A 5C55A 4NNCA 2ZDRA 1KTBA 5AYZA 3LI0A 2CU0A 4UTKA 1F2JA 1TPB1 2Q8ZA 4ML9A 5F4SA 3PBUA 1KFCA 3KAOA 2NV1A 3GKAA 1PIIA 5FF3A 3TK7A 3W7KA 3DAQA 2NXGA 1I2OA 3S1XA 1X8FA 5D2XA 1Z42A 4KWWA 3R13A 1Q6RA 1FUYA 3N34A 3E12A 2NV2A 3QPYA 4LVAA 5LGXA 4FNSA 3R89A 1JRCA 3STFA 3TIMA 1B57A 5FEXA 3EKZA 1S5TA 1TV8A 3F4WA 4NNAA 2G5WA 3WJZA 2P10A 2YR1A 2O7SA 2QUVA 1LLWA 4ZQCA 2QCGA 4GE8A 5K4ZA 1AW1A 5CPLA 1TSIA 3G1DA 3L0GA 1VCVA 3KX6A 3O6CA 4ZL1A 1JULA 2H90A 4OWGA 4RJEA 3LBCA 1HTIA 3IGSA 2CZ5A 3MBFA 1J4EA 5HJLA 4CNNA 1R46A 4A21A 2VEMA 3B0PA 3NM1A 4C1KA 1QDSA 3PVFA 2YXGA 3SW6A 3GVGA 2C13A 1F6PA 2J6XA 2RDUA 2NUXA 4HKPA 3LDVA 3LRMA 3CB8A 1TIMA 1K7XA 5LKYA 4MIMA 3A23A 3QEZA 1AW2A 5HR7A 4NX5A 3EB2A 3B04A 5KZMA 2BZNA 3NDOA 3IIXA 1H62A 3EX1A 1ZY9A 3PBVA 1H61A 4NNBA 2E68A 3EWUA 2JKPA 3NQDA 1WBJA 4AB4A 2YGYA 4DO6A 3STEA 4FIQA 4EF8A 4MJMA 5AN7A 2QF7A 1LLZA 2J27A 2B7OA 3DFOA 3DENA 3TE9A 1L6YA 3A22A 2YSWA 3GDKA 3B0VC 3M16A 1NSJA 1RQHA 1H7WA 1LORA 2Q8LA 4P2VA 2FPVA 3W1AA 4PL2A 2VFEA 2NX9A 4HPJA 2O7QA 4IMCA 1SZNA 2OT0A 5D2WA 1H51A 3W22A 1YXDA 2V82A 5C6MA 2A21A 4I7VA 1QPQA 3FEMA 4M7SA 1LBMA 3DFSA 1PV8A 2QJGA 4ONVA 3I7RA 3GDTA 3GXTA 3MI2A 1LZOA 3O07A 2NX1A 1EWEA 3BARA 3DBPA 1C8VA 3P80A 5AB3A 4J9JA 3KRUA 4TMBA 4GWEA 3TW7A 1SW7A 3W75A 1H7OA 1TRIA 3W7JA 3SJ3A 2OT1A 4JX6A 3CWOX 3TX9A 3ZFHA 3HB9A 3TSDA 4HPXA 2JKEA 4JY8A 3N2MA 5J5DA 1IIGA 2TRSA 4LU0A 1O4UA 4M5PA 3BVJA 1WXJA 2WNNA 4EIVA 1R47A 2H6RA 4O1CA 4CLMA 4HNVA 2W6RA 3SI9A 1RV8A 1JUKA 3NQGA 3GAKA 4HN4A 4Z0SA 4GC4A 1LRNA 1PS9A 4IX2A 3FKKA 4RKAA 1H7RA 4MFDA 1AW5A 2ISSA 4AH7A 4RXGA 3M5YA 3LRLA 4QITA 3NR0A 1FCVA 1THFD 5I3HA 1WV2A 3GAYA 4UTUA 3LBMA 4BI6A 2ZTJA 1GJPA 2ZZ3A 4HNTA 3IVTA 3PF3A 1W54A 4JXCA 1LDCA 1KFEA 1SU5A 4TU1A 5BRBA 3CIWA 1OG0A 4RV8A 3W85A 3F03K 3MP3A 3W7PA 4S1FA 2VOMA 1XUZA 5D04C 3L2IA 3W7MA 4Y90A 1Y0EA 3BGGA 1XI3A 3QM3A 4LC8A 1NF7A 1KFJA 3C2VA 1GWJA 3W88A 4ZQPA 1LBFA 3B05A 4JTHA 3W1PA 5F4WA 1K3UA 2E09A 3I68A 3NL3A 3UWQA 1W3NA 1YDOA 3MHFA 1F7BA 1FDYA 1K8XA 5TBOA 1ML1A 4FX7A 3VE9A 4O19A 3IIZA 1VHCA 3T44A 1VRDA 3S6DA 4IXHA 2ZZ6A 1FQ0A 4AXKA 1DV7A 1P5BA 3MI3A 3P74A 3HMJG 3L5AA 2CLKA 4LRSA 4MZYA 4ADTA 4ZQMA 1TTQA 2P0OA 1GTHA 1OJXA 3ZWSA 1UB3A 3C2FA 1T0OA 2W0UA 3W1UA 5DN1A 3I7SA 3PS7A 5C2XA 2QUTA 4DO4A 4RZ4A 1DQXA 1LRTA 3ABQA 4O0ZA 2GJLA 4CQ8A 5I3IA 5LHEA 5E0KA 2J24A 3Q2DA 3QMRA 4H6KA 3T40A 3G1XA 4WY0A 1SO5A 1LOLA 1RVGA 5HINA 3W1NA 1D3GA 2ISVA 3TW6A 3TROA 3G1SA 5CZTA 2BTMA 4U4MA 3MHUA 3WK1A 4XTIA 1JUEA 3IIOA 1MSSA 3BLFA 8TIMA 3S5YA 4WJEA 4OT7A 1U83A 4O17A 3JS3A 4OGZA 4DQWA 1OK6A 2PC4A 1FY6A 3ABOA 3U6WA 1NFBA 5K9DA 1XBVA 1OX5A 4MUZA 5DXYA 3VNDA 3F1QA 3SIZA 3DZ1A 5F1UA 3MHGA 4AF0B 1KA9F 3O16A 3OIXA 1JQXA 3M6YA 5K3VA 3P61A 2FLIA 1GVSA 2VFFA 2WNQA 1XBYA 3PULA 1FWNA 3LCWA 4EVZA 3PBYA 4MJZA 3W7DA 3GDRA 3NOEA 1O95A 5DCDA 1GOXA 4CCEA 4JICA 4B5NA 2ZZ1A 2DZWA 3DKLA 5TQLA 4M6PA 2NWSA 1ICSA 1KM5A 3GDMA 1VH7A 3B03A 3NPUA 1KFLA 1SZEA 2DZSA 5D38A 3K30A 1TMHA 1O60A 4IQLA 3W7IA 3PSWA 3MWAA 3BK0A 4QQ3A 2Y7FA 1KTCA 4HSNA 3BGJA 3LXAA 5C5YA 2VEIA 5LHFA 1W3TA 1AG1O 3P8IA 3QF0A 2QUUA 1YLVA 3TAKA 4A29A 4M6VA 4MVAA 3W87A 3PAJA 5LNUA 2JKAA 3OVQA 2Y88A 3LTYA 2I9EA 1QAPA 1DJNA 3W76A 4NQ1A 3W2UA 5CZJA 4DPQA 1AK5A 3RFAA 3I65A 2Y62A 1EWDA 4KFPA 4N9CA 2WKJA 4JR5A 1ME7A 4Y6GA 1DHPA 2B7QA 4TIMA 5G5IA 4TMCA 1TPWA 4G1KA 2NUYA 2E6DA 2NLIA 4X22A 2FFCA 4N6FA 3CM4A 4OU1A 1M5WA 3THQA 1QOQA 3L66A 1KV5A 2VFGA 4POCA 1IIHA 3O1NA 4HIBA 3M43A 4DO5A 2DORA 2ZZ2A 1KM6A 1LM1A 1W5NA 5AHMA 2EF9A 1ZNNA 3PR2A 1SQ7A 3MW7A 3FKRA 1AL7A 4GJ1A 4WZHA 2FTPA 3S5OA 2JK2A 3W7OA 1H7NA 4K7YA 3W3OA 3KVJA 3W07A 3HQ1A 3QSRA 3DHFA 4Z1BA 5LNVA 1KM0A 4JX5A 4LS2A 4IX0A 4I9AA 3NL2A 5D2YA 3C56A 3LHVA 5BW6A 3BG5A 5G1YA 2NZLA 2DZVA 3KFTA 4EF9A 3W83A 2ZZ5A 1BTMA 4X9SA 5F2IA 2PRLA 2H3BA 3SFKA 2ZQ0A 4HNNA 2B7NA 4K6AA 5L6UA 4ZQNA 2C16A 1FDJA 3UXAA 5F4XA 4N9DA 2J9YA 3HGSA 1O5KA 4K37A 3BG9A 2GJNA 3TXZA 3IIVA 4CNOA 5KITA 3SECA 3HF3A 4JYDA 3QC3A 3LX9A 1DBTA 2A7RA 2XN0A 2VEPA 3KOFA 2Z6IA 5EL1A 3S5NA 4UFIA 1XDMA 1HFBA 3B0UX
chains in the Genus database with same CATH superfamily
3U8GA 1U33A 1NWSA 5CGMA 2VGBA 3WDIA 4I6VA 1I1WA 5H8MA 3CV7A 5CPNA 3HV9A 5A6JA 1QBBA 2EPHA 3W7EA 2E0PA 3NSXA 1X6LA 1KQZA 4O16A 3NQFA 6TIMA 5C9XA 4RDVA 1UPMB 3RU6A 4QCEA 4C6LA 1IWBA 1WBHA 4FNUA 1KWGA 2QV5A 3CT2A 2DSZA 1UQYA 4YXGA 5FJOA 4IF2A 1EYEA 3WJWA 4XKYB 4QTGA 4FK9A 4QNWA 1F6YA 4GNVA 3P5ZA 1RCXB 4PZVA 4KWUA 4GXPA 1WZLA 1J6OA 5ECUA 5EFFA 3WJYA 2NSXA 1HO1A 3ITLA 4Q7IA 4O52A 4PUMA 5FOOA 3O2LA 5D02A 4Q7NA 4TO8A 4DBSA 4Z2JA 1EJTC 5DMLA 1QNVA 4AC1X 3T1GA 2QPSA 3AWOA 1QOPA 3SGUA 2V67A 2EGZA 2EXOA 1DQUA 1R3RA 3AROA 1PTDA 1S2VA 4Y9OA 2G3JA 2ZFAA 5EPDA 4ZB5A 5T26A 2QMJA 1NFGA 2D69A 2IXUA 3A4JA 1TKKA 3JZUA 3FYYA 3LCIA 2R1PA 3BGAA 3VGBA 3F5JA 3DX5A 5TNVA 2IMRA 4YVVA 1GZGA 3RO6A 4IUOA 2PS2A 3VOJA 1E1CA 3S1UA 1RA5A 4IGHA 1FH8A 1IXOA 3E0FA 2A4AA 3RPTA 5CZ0A 1QWGA 4IFOA 3UESA 1SFLA 1QI2A 2GOUA 5I3DA 3R25A 3FJLA 3M7SA 4BK9A 4NILA 1NAL1 3EX2A 4UTLA 1EZ2A 3A3WA 2D73A 4R7WA 2A7PA 1XLHA 4ADSA 2Z1BA 3PBGA 2WVUA 1TIWA 2PLCA 3BURA 1EP1A 3H7RA 2IQDA 3BAKA 3UXKA 2C91A 4C6BA 1E72M 1W5MA 4MUPA 4P61A 4DVOA 3E2RA 2OOFA 1XDJA 2EJ1A 2YYUA 4RL3A 3WLRA 4TXEA 4JN8A 1A5LC 3TVAA 1S3HA 1MUMA 1IR1A 4MAVA 4NX0A 4OIFA 1PTGA 4KIRA 3WIJA 2YX0A 3PM6A 2D0GA 4AIEA 4L6OA 1KCZA 3QPEA 3DU0A 2WKLA 2HK0A 4XIMA 1DEDA 1TX0A 2C71A 1B4EA 2FGLA 1LBLA 2PDJA 1IXQA 2ZADA 4GZIA 3LYEA 3A47A 1HJWA 3AUJA 1S3TC 4A3RA 4TX6A 4YHEA 3BQ5A 4UTHA 3GH5A 3WLMA 3W6YA 4JTUA 3G0UA 1LUCA 3MUZ1 4YTTA 2QF8A 1W5QA 4A35A 3KRSA 3QV6A 2V38A 4Z1CA 3VDGA 2DSVA 2F7FA 4N2YA 2GUYA 1I2NA 5HQEA 2YL6A 1OX4B 2Z1SA 1TG7A 4XG1A 2ZX5A 4MWAE 5AFDA 1UWRA 3UF9A 4H1ZA 4D8ZA 4HZMA 1YHTA 5HAOA 2HSAA 4YWIA 1KC7A 3DHUA 4TVUA 3WH5A 3EDFA 7REQB 2DZTA 2Q8XA 3PZQA 4NRSA 5D32A 5C7VA 1EDQA 2NUWA 3E5BA 4UFKA 4BKNA 2QJHA 2RH9A 1BF2A 2ZX9A 1XYMA 3WLKX 4Q8WA 3JZEA 3HIJA 4JTEA 1C3FA 3LHTA 3S6TA 5EU9A 1UR2A 3GTFA 2D2JA 3EGJA 2W91A 2Y5EA 2J47A 1XLKA 3GFYA 5IXEA 2OO6A 4B3KA 3ZSSA 3W7QA 3G0XA 3IIPA 1GYLA 4IPIA 3M44A 4I8YA 3Q58A 1UR8A 2FMOA 8CGTA 4GBDA 5FF7A 2QCCA 2QVNA 3MSYA 1G4SA 4MF4A 4HSHA 5AC6A 4ILSA 3WL0A 1GT8A 2NXIA 4QAIA 3FA3A 4REQA 3BMWA 2YFOA 3L67A 5M17A 5LZLA 2INEA 4C6QA 4HTBA 4ERAA 1JVNA 2W67A 1OF8A 3H4WA 2ACRA 4BCEA 2IUZA 4O11A 1GG0A 2CLHA 3M0ZA 1JZ6A 1TRDA 4GISA 3GB6A 3WQVA 3DYOA 4ICMA 1FXPA 3T7VA 4GO8A 2RGMA 3UWVA 5BZAA 1QK0A 5KTLA 1DE6A 2Z1XA 3AJ7A 2ISWA 5H91A 3JR2A 3DHPA 3AIWA 3PUOA 4J4KA 4K8GA 3KRBA 3PZUA 2D23A 1FWBC 1QTWA 1W8GA 2R14A 3WLOA 1IR2A 4R9OA 1VFUA 5H8UA 1H7XA 4QISA 2TPSA 2J8TA 2YOCA 1SJDA 1OHLA 1R8LA 2WWCA 1JZ3A 4UCGA 1GPWA 3OBAA 2XH2A 2GJPA 5CLTA 1UROA 3HG5A 3K2GA 1PB0A 1JZ2A 3NYZA 4X9YA 4UOZA 3EMZA 1MQQA 3O15A 4L4MA 5I23A 2ON3A 2XG9A 4O53A 3RUBL 4E6MA 4J1OA 1XS2A 3W27A 3V0UA 2VUNA 1OQFA 3NQEA 1KXHA 2PDPA 2V5LA 1V3JA 3TN5A 3FCPA 1RPXA 2FDSA 1KWKA 2D0FA 1UR0A 3NQAA 4UR7A 5F2LA 4MB3A 3OZMA 1IEQA 3LU2A 2WPBA 3OOQA 1UBSA 5TD4A 1NVMA 4O1DA 4F9DA 4FF5A 1POKA 5I3JA 5G1TA 1XLBA 5LIWX 3QZ6A 3MDUA 1G7UA 4Q8NA 1F5ZA 1XLLA 3W29A 1TQJA 3VDCA 1FWRA 3TTQA 4K1WA 4WRHA 1ITCA 1SJBA 1QNQA 1EEXA 4Z1YA 5U7SA 2ATSA 4S3FA 1TPVA 5A8OA 3H6OA 2A6LA 3MUIA 3N11A 2VC5A 1ONEA 2NT1A 5A69A 1YTEA 3WELA 2J88A 3GC4A 5EKYA 5E1QA 2YCKX 3NGJA 5K9XA 5I3FA 3G1HA 5GNXA 4H04A 3PZNA 1TV7A 3SRHA 4MKNA 5DY2A 4JY9A 4ACZA 3ZT7A 1FA2A 3OIHA 5CSSA 2E1WA 1YE4A 3QGVA 2DGAA 4M51A 4HGXA 1KD0A 2REQA 3B0XA 3NG3A 4LGXA 4AIUA 1EJWC 2XGBA 4MNJA 4BHYA 2ZXDA 3WEOA 4JQAA 1IYXA 2AL1A 3R79A 4NI8A 3W72A 1SW3A 3B9OA 3PB0A 3ZJ8A 5HMSA 1R2RA 5HMFA 1RA0A 1WXYA 2BX7A 3CPRA 3EWWA 1EC9A 1VPYA 1L2QA 1ZBWA 4ZGYA 1C29A 1YBQB 2J7DA 3P60A 2WHKA 4GJIA 4XISA 3OG2A 4WQ6A 1W6TA 4RDWA 1WX0A 3R58A 3N2CA 4D6CA 1MWOA 3RMEA 3SFWA 5FIPA 5C54A 1DKWA 3UYCA 1M7OA 3C4UA 3KRZA 2C3ZA 1YX1A 4J3TA 3CPGA 4KGJA 5CSRA 2ACUA 1X96A 3GIPA 1ZFJA 4UTMA 1OC6A 3IACA 2VR5A 3LLFA 4NAEB 2NQZA 3VILA 4Y9NA 2I56A 1HKVA 2PDYA 4NJJA 1W56A 3GHRA 4LUJA 3IRSA 4TQTA 2OFJA 4UMBA 3WK0A 3QHNA 4DJED 3SZ8A 2P50A 3QGAC 4H9TA 3L23A 1WAWA 1JIBA 3HG4A 3W7HA 4ATDA 3CLWA 1FRBA 2ZCGA 1OFBA 5J8LA 2X1UA 4E3VA 2HVMA 5E09A 1V08A 4JNMA 1RR2A 1WDDA 4YS1A 2GL5A 1Q7ZA 1RCQA 3BJFA 4LYKA 2GDUA 3H2OA 2CLIA 1CT5A 3N73A 3BV4A 1PIGA 3LUTA 2WO5A 3FLUA 1DXFA 1PKYA 4IL2A 3TJLA 2YA1A 3ONCA 4XAPA 1BYCA 1W1IE 2F6XA 1KV8A 4QE4A 1A5AA 3LHYA 3R10A 1W1YA 3PZTA 1B90A 3GXPA 3N9SA 4LUSA 1QI5A 2CXGA 4CU6A 4GK8A 1ME8A 4XKYA 3W02A 3GBEA 1YKWA 3B9AA 5I5RA 2X1TA 1Z89A 2WJFA 2QCNA 2WZIA 3S9YA 1NJJA 5BXTA 4MZ8A 3V0TA 3OGVA 2VOTA 1WKEA 1XIIA 1AJ0A 3TLLA 4UFHA 4I8DA 2GVJA 2QCDA 1LRQA 4MWAC 4Q6JA 3RF9A 4S2CA 5AYYA 4IPNB 2H9AA 1W3KA 1OEPA 5BXSA 3TWBA 1I2QA 3N17A 3WQGA 2HBXA 3N6JA 3TN3A 3UZYA 3R4IA 1Z69A 5HNNA 1CX9A 3AYVA 1BSIA 3BMVA 3TTOA 4WXYA 1B31A 2IKHA 4HOZA 4H9VA 2UBPC 3P5YA 1TWSA 4HCHA 3BOFA 3SM0A 3W2MA 3G18A 3A3HA 2X2GA 5DF0A 3EDEA 4LTSA 1GKQA 2NX3A 2J9XA 1HKJA 4MLJA 3BW2A 4G5DA 1OCQA 3W6MA 3CV1A 1XSJA 2GVEA 2CLEA 5EB8A 4QEHA 2QXWA 2BVWA 7CGTA 3AJXA 1RUSA 4JTGA 4ZA0A 3LXBA 2F6UA 4HP5A 1VLIA 5A1AA 4GI9A 1BVZA 3A4XA 3TYEA 1BVWA 3I7QA 3W9ZA 2X05A 1O5RA 2RKXA 4CQAA 4WDWA 4Z2KA 1BWVA 4HNCA 3AIQA 5AYIA 4BEUA 4L1WA 1JQVA 4FO4A 1ONWA 1ENUA 3ZOAA 1IF2A 4Y8FA 3P0XA 4DXVA 4U5IA 3KBMA 1ITUA 1TMQA 4PMDA 1G9HA 1H11A 1TPFA 4ROPA 1TZ7A 4O15A 5XIMA 1S2CA 3DFQA 3VNJA 4HA1A 3URAA 2FHCA 3PPCA 2PLKA 2Z2AA 3EB3A 4AD4A 2INFA 1ZJIA 4O14A 1KTNA 1Q4WA 4PBGA 4H9XA 5FF0A 4IMGA 4L6HA 4J27A 4AD1A 4RLIA 4JQ2A 1R3VA 4MY8A 7TAAA 5FSEC 2I17A 2X16A 4DF0A 1RD5A 3HJEA 3OEXA 3TLQA 1JAEA 2G96A 5EBUA 1VEOA 1VZWA 4HK7A 3N13A 1W91A 3AI0A 3EWZA 3MJYA 1A0CA 1CCWB 3O7UA 4DY1A 2ZX6A 3GDLA 3C3UA 4LBUA 2VFIA 1I0DA 2A79A 4AC7C 4C6PA 2VENA 1B3OA 4LS1A 3CTTA 1IHIA 4ZZ9A 1VCFA 3TW9A 1PKMA 3QMTA 3G1AA 1L6WA 3MKKA 3L4XA 1M04A 3UETA 1OINA 4UNKA 1F73A 1ZP4A 1ICQA 1YYAA 3SGZA 4P7OA 1V8EA 5JH2A 1QATA 3ZS4A 5FESA 2DIJA 4R34A 4GRSA 4EXBA 2TODA 2WSYA 3S5ZA 3WUGA 2A7NA 3WQPA 1MZHA 4DHGA 2V6AA 2CBUA 2VURA 3FIGA 2CBJA 1OADA 4AZCA 1P7TA 1KM2A 2GLKA 5BNKA 1EGMA 2VHLA 5HMDA 3TXVA 3W7NA 4JEJA 1E73M 4OVXA 3E96A 4W8LA 1ZBCA 3PJTA 2RUSA 1IT7A 2QCLA 1SJCA 2VD9A 2BY3A 2D2OA 4M7TA 2F38A 4FXRA 4DLFA 1M01A 4JTSA 3L65A 3RM9A 4Q32A 5AECA 2E8ZA 1OC7A 2EPNA 1O12A 1TJ1A 4ZODA 2VM8A 3F4CA 5B7ZA 1DJWA 1ZAHA 3C61A 2HVNA 4PYSA 5DT7A 4DXXA 2HS6A 1XGDA 3HTWA 5FSDC 1QNOA 3EXSA 2OEMA 1ZENA 5H2ZA 1BQGA 5A6TC 1K70A 4LB3A 3WNPA 3QHOA 4QG8A 5FEPA 4IICA 3QGKC 2BY1A 4IP5A 3CHCA 2VJXA 4WDTA 2CZEA 5K2ZA 2FB3A 3N6QA 1F8MA 1FTXA 2W66A 2J62A 4H2CA 1S5WA 3SQSA 2ZOXA 4PCNA 2OLHA 4ZMGA 5EA9A 1X98A 2R91A 1PVNA 4QXIA 4H6EA 2QULA 4WK9A 1PZ2A 1I6NA 2INZA 2Z1WA 3LQLA 3ERPA 2C18A 1LL7A 4O0KA 1XYAA 1WDWA 2XSXA 4BI5A 1H09A 1BLIA 1H1YA 1VLWA 1SZGA 4O1EA 3LNPA 4O8RA 3H70A 2EQDA 1CECA 1JL8A 3BUVA 3S3GA 4KWOA 1CXFA 1MEWA 1S5NA 3RLUA 2OSYA 1MW1A 4LYRA 5ABTA 3SEPA 1CW2A 1Z44A 3ANYA 2WZTA 3Q45A 2J7EA 1XC6A 2I57A 2CLFA 4C90A 1WA3A 1Q4NX 1TCDA 1XYZA 2HROA 5G1MA 1R2SA 3GHTA 4Z08A 3EX6A 3THAA 4AWTA 1REQB 2J74A 1EO5A 3MZ2A 3KEHA 4HCLA 3HN3A 4DX3A 3TCEA 4EANA 2OYKA 1T99A 5SWUA 1WOAA 3PNUA 1E43A 3E3HA 3S42A 1XXXA 3QOMA 3IGXA 3BLPX 1S2AA 4WR3A 4I3GA 4WHBA 4GJJA 4WJ8A 4J3ZA 4PL1A 1HP4A 2ZUVA 4W4QA 4OBTA 3BV7A 2VFHA 2WMIB 3QQ1A 3UQNA 3APGA 4WX2A 3S0CA 1QI4A 5I77A 4BWLA 2WB5A 1P6WA 3M1ZA 3GR8A 2VRKA 1G4PA 3SRKA 2WJZA 3V75A 2BASA 4O18A 1K77A 2YKKA 1GORA 1XL9A 2C15A 6XIAA 1VYPX 2Q3OA 3BG3A 1KBBA 2DT3A 3QKZA 4IPJA 3VD9A 3S8HA 1YDVA 5LNSA 1OSEA 3EX3A 1FVPA 4A2SA 3CMJA 1FWAC 1YTKA 4K36A 1OX4A 4L9XA 2HWGA 4PSPA 1VQTA 4GZ7A 2DUXA 3QKEA 2DFAA 1KXQA 3FDGA 3VK5A 5HUOA 1A5BA 1J0KA 4XX6A 1ZCOA 3WBEA 1J2BA 4RE3A 1IZCA 3W71A 1JPIA 3ECQA 3O0KA 3RMJA 4GVHA 2VCAA 2PDIA 2WXDM 1E4MM 4DJDA 4OBSA 4B4HA 2GVLA 2BLEA 3GNOA 3CC1A 3SUSA 1EPXA 4CNUA 2AQOA 1PJ9A 1BXBA 3QRHA 1BSLA 4RCXA 3VOCA 4QIUA 4PBFA 4U10A 1KRBC 4E0CA 3T9PA 1UUOA 4HYRA 2VZUA 4JYFA 1FP9A 5C55A 4NNCA 1H5VA 3KP1A 3GM8A 1UR9A 3LI0A 2CU0A 2MNRA 1GHSA 3ZSTA 4UTKA 1V02E 5F4SA 1ADDA 2VZSA 3PBUA 3S2CA 5FF3A 4GPNA 4Z42C 4ZTXA 3BSMA 3H7UA 4H19A 4L4OA 1A5NC 1I2OA 1QI0A 5LXEA 5D2XA 1VFFA 4HK6A 1Q6RA 1FUYA 4E8GA 5LGXA 4PUJA 4EXQA 4WSJA 5FEXA 1EA9C 3A3XA 3F4WA 2P10A 2O7SA 3EEZA 1LLWA 5K4ZA 3WBXA 4H8UA 4ZFMA 2PF0A 2QVHA 4RJEA 3UR2A 1AQMA 3HM7A 3MBFA 1P0BA 1J4EA 1AH4A 3CV6A 4EPDC 4C1KA 2ZUWA 5GNZA 1K4HA 2YXGA 2BY0A 2ODOA 3GVGA 4MDPA 4FLQA 2RDUA 2BGSA 3VMOA 3LDVA 1A5MC 1Q63A 3VTRA 4NX5A 2I7GA 3AICA 3QN3A 1BVNP 4XO6A 3TOYA 3PFRA 3U4AA 1LQAA 4EK7A 1K6WA 4IIGA 2X7VA 2E68A 2YA0A 4RDYA 2YGYA 4DO6A 1EBGA 3STEA 5AN7A 1JCTA 2J8FA 4EACA 3URNA 1Q13A 2B7OA 3DFOA 5D9OA 5DRIA 4DZ5A 6PTDA 2CERA 2XWDA 4UCFA 2BV9A 1MUCA 3W1AA 4JQ1A 2NX9A 4ICCX 3VNMA 3GVQA 1MDRA 5D2WA 2O9TA 1KKOA 2AGTA 2A21A 3VM7A 4M7SA 1TX2A 4ONVA 2QJGA 4Q8MA 3HFTA 2NX1A 1EWEA 8A3HA 1C8VA 2XISA 3WQ8A 3VD7A 3KRUA 3WLJA 5EMMA 1TRIA 2GGHA 3TX9A 2WWDA 4KRUA 4DWSB 4HPXA 2XPKA 1L0PA 3MVTA 4YWSA 4M5PA 1WXJA 2W6RA 1W3HA 1FOBA 1NWRA 1OCNA 1JUKA 1XW8A 3GAKA 3S6OA 4UB9A 4GC4A 4YNGA 5EMYA 1AVAA 1UR1A 3UU0A 1O1ZA 3QC0A 1AW5A 4S3EA 5BRPA 5C2CA 2ISSA 1TE6A 3LRLA 1FCVA 1THFD 1FWGC 5I3HA 3GAYA 4UTUA 2XSAA 5JQ9A 4BI6A 5JIPA 1QK2A 3C86A 5HJXA 4HNTA 3IVTA 1W54A 5EFDA 4JXCA 3VDHA 4DIAA 5XIAA 2P8CA 2PD9A 4J3WA 4F0RA 1KBKA 1EF3A 5MF5A 5CAHA 3W85A 1XUZA 4ZSTA 4MGGA 4L1GA 3NCOA 4CD7A 4JHOA 4DZIA 4D6GA 3NOYA 3FVDA 3C2VA 4ZQPA 1R7AA 3VIIA 1K3UA 2E09A 4Z17A 2VX6A 3WZ0E 2DW7A 3IIZA 3T44A 1RBAA 4IXHA 4IZGA 4PTVA 3VC6A 2CLKA 3NYDA 3LM3A 3FHQA 3N2OA 3VOGA 3BE7A 3MUAA 1GVYA 1EQPA 3ZIZA 1OJXA 1E6ZA 4OECA 3ZWSA 1TELA 1L8PA 4GFIA 2XDFA 4C6KA 1UB3A 1CYGA 5DN1A 4LAZA 3A13A 2QZRA 2QUTA 3TQPA 1DQXA 1Q85A 3ABQA 4O0ZA 1A80A 2B31A 4CQ8A 3DN5A 2XIJA 3QMRA 4H6KA 3T40A 3G1XA 1SVDA 3SCWA 1EQCA 2REQB 1BAGA 4U4MA 3WK1A 4DBUA 1NOUA 2XM1A 3MMUA 3IIOA 1MSSA 4WJEA 4TUFA 1JZ4A 3TOPA 1LT7A 4UNIA 3CPUA 5BCAA 2XU2A 3F2DA 1V3LA 4GIYA 1OK6A 2PC4A 3ZT5A 3U6WA 4QROA 4EX4A 4KBXA 3DZ1A 2VP8A 3MHGA 1PZ3A 1JQXA 3P61A 2G4JA 1GVSA 3OYXA 3OZYA 1VJZA 4YYCA 1GCYA 2WNQA 1OD0A 2E8YA 2GGEA 1SZRA 1FWNA 4EVZA 2PLJA 4ZENA 4D6DA 3PBYA 1OBAA 3E2SA 1E0WA 3PTQA 5DCDA 1XCXA 5CCZA 4CCEA 3ZXWA 4JICA 2ZZ1A 4AQLA 4XZWA 1KM5A 1VH7A 1SZEA 3WO8A 1TV2A 4FOUA 1UD4A 1JPMA 4IQLA 3GWQA 1AJZA 3PSWA 4IL0A 3ABXA 4INFA 4IGSA 4X61A 3MWAA 3NJ3A 3RGTA 2Y7FA 1TUFA 1KTCA 3IK2A 3MU7A 2EPKX 2VEIA 3EZ4A 2UY2A 1W3TA 3S9IA 1J12A 3P8IA 1PDYA 2P88A 3QF0A 3THUA 2QUUA 2PTDA 2NVDA 4MVAA 2JKAA 4JIHA 3OVQA 1HZYA 5I0DA 2QIIA 4NQ1A 1MNZA 3RFAA 3I65A 4EAYA 3LD5A 1HXJA 1ME7A 1DWJM 1G5AA 1NFPA 5JBEA 1SFTA 1XIBA 2E6DA 4X22A 4Y9MA 1M5WA 2PMQA 1JFXA 3THQA 2OSWA 1CLKA 4GHRA 1KV5A 4R7OA 4DO5A 2DORA 3VIKA 1RBOB 2EF9A 3IJ8A 4V28A 4Q4MA 3KBWA 3S5OA 3W24A 3W7OA 4K7YA 3HQ1A 4MB4A 3QSRA 3S4TA 2BFGA 1QNPA 4H7ZA 3CBWA 3B9EA 3PZGA 4JX5A 3TR9A 1R85A 1ISWA 4AD3A 5A6KA 5BW6A 3C0QA 1V6VA 4EF9A 1BFNA 3W83A 2PDUA 5ABEA 5F2IA 3CXOA 1MRQA 2PRLA 2H3BA 2B7NA 4O8AA 4ZQNA 5LIUX 5F4XA 4N9DA 2J9YA 4BF7A 2QIWA 2V5KA 4PUDA 2QNEA 3TXZA 4CNOA 3KOXA 1HKMA 3OVGA 3HF3A 5ENLA 4EWJA 1U5HA 3R43A 3SUTA 4JFUA 4MKSA 1UA7A 1XX1A 4OTKA 4DJEC 4S23A 1YADA 4QX4A 3DG7A 2GUBA 3RRXA 3VFLA 1GYNA 4MLRA 2A6NA 3B06A 1RLCL 4MB5A 5F7UA 5DLCA 1HL9A 4J40A 3QY7A 1YEYA 3RX2A 3KS6A 1FCQA 2HK1A 3P14A 7TIMA 2WC4A 3QZAA 1XIDA 4LNYA 1OX6A 4HYWA 4GVIA 4RZ6A 4JCLA 2R9RA 2DP3A 4N4PA 4PMYA 5M1TA 4TV6A 3HQNA 4LY4A 1W9XA 1TCMA 2D1ZA 3R7MA 2E5DA 4UXDA 2J7CA 3F5KA 3G1FA 2F2KA 3WK3A 4B90A 4DJFC 4HOWA 4PEKA 3W1QA 3UWZA 3LK6A 2J7HA 5B7YA 4HT3A 5GJPA 3AQUA 3UY7A 3K46A 1FH9A 2RDWA 3FVMA 2W61A 3W7RA 4XAFA 2VELA 3ZJKA 4EPBC 1WP6A 2ANUA 3GK0A 3HPFA 4JPGA 4WOQA 1O66A 4C6DA 4PSRA 4RR4A 4LF2A 2E40A 1RJRA 2NVAA 5CJMA 1VIZA 5G4HC 1BWKA 1IEXA 3TQVA 2DY3A 4J3VA 3CS2A 2VGIA 1OK4A 2G97A 4PMZA 3L0NA 4WKAA 1GJWA 4QDPA 3ES7A 3ZWTA 3W7GA 3EMQA 2RJGA 2VD8A 3LCFA 3F4NA 1NDWA 5I79A 1A0EA 3T08A 3K4AA 3MUXA 5BOFA 5CPQA 4WD0A 4BFAA 5A6BD 2YL8A 5CGQA 4DJDD 3D5HA 2ZC1A 1F9CA 4FP1A 4PUEA 1I75A 4MTVA 2FPTA 2JFEX 2CZFA 1SSDA 2PF8A 3AC0A 1SW0A 3CO8A 4LFYA 4JEQA 4FZIA 2QJJA 4DF1A 1UKPA 3V1HA 3NQ8A 5EBAA 4U28A 1KM3A 4RNHA 2Y70A 5D37A 3NA8A 3AS3A 2D2HA 3NQVA 4XWUA 3G0SA 4D6IA 2ADAA 4QQUA 3UYIA 4AMCA 3NZPA 2HZGA 5EYWA 3CQ0A 1AMYA 2A3EA 3GTNA 5JBFA 2VCCA 5FF4A 2EO7A 4MJ2A 3W37A 2FZBA 2J77A 3M9YA 1WKYA 5M5DA 5A2AA 1D8WA 3SN1A 3H12A 3DFPA 2VR2A 2QEZA 2DPEA 5HWNA 4CCCA 1FWDC 2WQDA 3NIYA 4ZO6A 1O5QA 3LI1A 5CPMA 5LA1A 1KFKA 3WD3A 3GG0A 4A4AA 4HHLA 4XD4A 4D2JA 3G1YA 4K2SA 1CI1A 3PBMA 2ZDSA 4NZ1A 4MOZA 3AHTA 3P62A 4NT0A 4GUIA 1EP2A 1R30A 1ISVA 1ZBVA 1JCNA 1W2PA 3RO8A 1HIZA 2W79A 1BEUA 4UMCA 4AUBA 1V0LA 1JZ8A 1NQKA 1BKSA 3BH4A 5AHNA 4UQAA 1RXOB 2J13A 2POTA 2OU4A 4FXFA 2OOGA 1XICA 5TAOA 1HT6A 4H3DA 2W3ZA 2CYGA 3FSTA 3MYOA 1XC4A 1FWFC 1EBHA 5FCZA 3FK4A 2QCHA 4S3JA 5HXMA 3NO5A 3DESA 4NYYA 2C1GA 5D33A 3QLDA 4IISA 3F7JA 2WPGA 9XIAA 4IJCA 3SUVA 2ZA2A 2YDAA 1GNXA 4ALDA 3IGUA 2VKZG 3NPXA 5CC6A 3GQYA 1XLCA 2Y89A 2UY4A 3EB4A 3KHJA 1ZPTA 3KVKA 4JDBA 3WD4A 3P67A 4JTIA 4XZLX 1DE5A 3AIEA 2QKFA 4DM2A 4KGLA 4WSKA 1WXZA 1KRMA 3TKFA 5D05A 4HZ6A 4FA3A 2WKGA 2PFHA 2OMAA 4M24A 1I2RA 1G0CA 4JFSA 3ICJA 3UD6A 1UKSA 1XFBA 3L4WA 1YPFA 4Q33A 3UA3A 2V8ZA 1PHQA 4NRRA 3G3DA 1QPRA 4K1GA 3CZLA 1XD0A 1HL2A 3W25A 3C2YA 5JH1A 5FJTA 2XZ7A 3UWUA 2YW3A 1XLFA 1E0VA 1TVPA 4DJFD 1E56A 1W0MA 3ABSA 4US6A 4ZQRA 2C19A 3MYPA 4IJBA 2XGZA 3ARPA 2V2CA 2W62A 1NARA 1UOKA 4ZOCA 2ZIDA 2ZBTA 3CZ8A 5LIKX 5A6LA 3QPZA 1EEPA 1SUXA 2ZE0A 3I6TA 1TR9A 4NAEA 5ABGA 5FAGA 1BYBA 4X63A 1QT1A 4YN5A 1F07A 3HG3A 5D09A 4PMNA 3S1GA 4ZSUA 4MNMA 1XYFA 2IQTA 4W84A 3ARTA 3WF3A 3U57A 3BLKA 4ZO7A 1SR0A 1AUSL 4DNMA 1E9LA 2ZRYA 2CBVA 3WK2A 3G8RA 1AFSA 1E3ZA 3DECA 1E55A 1VFOA 2XVKA 4PH6A 1PKLA 1ADOA 1EUNA 5HQLA 3SY8A 1ZALA 1OFRA 1IGSA 2GWNA 5F2GA 3AXXA 4QP0A 1F74A 2WBGA 4AX7A 3VKJA 1XCFA 2JF6A 2VI0A 1UC4A 4AYSA 2OZ3A 3NZ1A 3SURA 1E4LA 3HGJA 1VF8A 5D30A 4GUJA 1YPIA 5REQA 4EKJA 1MW0A 2WSRA 3S47A 4JFTA 2WM0A 1ALDA 4UFMA 3IPWA 3JU2A 3PWIA 5IBXA 3WJXA 1XRVA 1GVOA 1KBIA 1A4LA 3GBDA 4KS0A 3E49A 3M46A 3CUZA 1W1TA 3H53A 3FV9A 1KCKA 1ZS2A 3BW4A 1JCMP 3IRDA 4RW5A 2ZE3A 3GZ3A 5GNYA 2FJKA 4Z0JA 4NHVA 1O6IA 5FJIA 3AWNA 3KS5A 5HR6A 3E1F1 3M41A 4RW3A 3MB9A 5A6SA 1L2UA 2HMCA 2YFNA 1XV8A 5BXRA 3DDMA 1XR2A 4OUIA 1CPUA 1A3XA 3LB0A 3F4DA 1I60A 1XGEA 2PBGA 2FQIA 3W0KA 3RITA 1U1UA 3C8FA 3KE0A 3V35A 2FMNA 4ML4A 1HO4A 1MI3A 3EPNA 1CGTA 3VCCA 1PCKA 5DELA 1T5AA 2F61A 5C9RA 1P4CA 4GNJA 3RPDA 4W9TA 3W1MA 2CFFA 3OHMB 5J5RA 1M7JA 2E3ZA 4MY9A 4KQNA 4L4LA 3ZR4A 1VBRA 4W7UA 1VIWA 2W92A 3VPLA 3CH9A 5KEZA 4AWEA 4QR6A 4O54A 4AHPA 3C8NA 4PCFA 2PWDA 2FZMA 1E70M 3OVPA 4XKMA 3LXCA 2WSKA 4O4WA 4B15A 4XZHA 3DI1A 4ZQOA 2CETA 2B0MA 3W38A 3OZPA 3COTA 1UQZA 5LIYX 1OF6A 1FXQA 4QNEA 3KL0A 5I6SA 3KBSA 4LRTA 4A3YA 2Q09A 1B3ZA 1SM9A 3VO0A 5E6YA 1P48A 4NAFB 1G69A 4JL2A 2PDLA 3N4EA 4XSMA 4R53A 5I3GA 4O28A 1UWSA 2R1LA 2A85A 2VDGA 4OE7A 2QDGA 1WKDA 2YB4A 3P82A 1D8CA 2PDWA 4F4RA 2C7FA 3V16A 3WFLA 2VRJA 2WVSA 1W9UA 1VGAA 3G2GA 3TCSA 4AEFA 3VZYA 3KXQA 4QG6A 1RAKA 4S38A 3CASA 3PANA 3IANA 2OXNA 3VNYA 1E5JA 2YDQA 5LGZA 1C93A 1W1VA 3WBAA 1IT8A 3NQMA 4ENLA 3FYPA 1M65A 1J8VA 3WDHA 3AZSA 4EE9A 1R5YA 3IUIA 2XVNA 3O6YX 1E9IA 3LN3A 4H9ZA 1XLMA 3ME3A 1SO6A 4ASTA 3UPBA 2ZRVA 5CXPA 4K38A 1TPUA 2WZMA 1IEWA 4H8VA 3REQB 5HNRA 2O56A 1EHAA 2PDNA 1YW1A 4JTKA 3H2FA 1OYCA 1POJA 3PWAA 4JQ4A 3O0FA 2OVLA 3DFTA 2OWXA 4LBRA 4N9BA 2CLOA 5D9MA 5A3HA 2GPTA 4Y7EA 4Y9AA 3TQ0A 2AMGA 4KFNA 2E77A 1NDVA 1DIKA 3B0YA 1QWKA 5CGTA 3TC3A 1KR0A 3BDKA 3PUEA 4FIRA 4DEFA 2UV8G 3G1RA 4DUOA 1Y7VA 3D47A 3IVSA 4GUGA 4D1JA 1UH3A 3NPVA 3EWBX 1Q6OA 1W9DM 4CD6A 3LZ5A 2Z25A 3VCRA 3DH7A 4KCUA 3QFEA 1W3IA 3LTSA 4RNJA 4U33A 2PGRA 3MKCA 3CGTA 5J04A 4ZTYA 4RNIA 5FEWA 1UZ1A 3CMGA 4EWND 4O12A 3S1WA 1FCUA 2W63A 1ELSA 1FDZA 2DJXA 1TWWA 3OA5A 2PP0A 3C52A 3FYOA 4FB7A 1ZCCA 1HG3A 1ZSXA 3OG3A 2RAGA 1TTIA 1TZZA 1Z41A 5A8MA 1IQ8A 2YL9A 2I9UA 3W23A 4ZE5A 3UBPC 4HJWA 1JPKA 1H63A 4JOMA 2Q02A 3P81A 4E4FA 1E6XM 4I7UA 1DPMA 4J7RA 3B4UA 4CEUC 5C7HA 4QJ1A 1H4PA 1G67A 4LUIA 4LAUA 3AYRA 4KT2A 4PTXA 1KKRA 1FHUA 4LVFA 1S2WA 4JNYA 5A94A 4BEQA 5EMLA 2WMJA 1Q45A 2D22A 2EEXA 1H1ZA 3OJGA 3ZVHA 5D03A 4BQ4A 1ZB5A 3NL5A 5AHFA 3O6DA 1ONXA 2Q01A 3S5SA 2OQYA 4Q8QA 2X41A 4XBKA 2EKCA 2EKGA 1HN1A 2Y5SA 1MXSA 3V5CA 1CWYA 3AXIA 3SRFA 2YCEA 2WHMA 2ZRXA 4LNCA 5CBIA 2OEJA 4AZIA 1RSCA 3S46A 1B3XA 4XQ6A 2WC3A 1W17A 3W1RA 3VIFA 1TA3B 4L56A 1U2YA 3LHUA 4QDMA 1GQKA 1BWLA 2Y7GA 1NEYA 3EAUA 3NQ7A 4HMNA 3WUEA 4F2TA 5F1VA 2E1DA 2OEKA 4KCVA 3O05A 2PWEA 2Y2WA 1ECEA 4D8AA 3H2CA 4DZHA 1CLXA 1GVQA 3BCFA 1E6QM 4AZ6A 1CGVA 1GHRA 2WK2A 4M56A 3LS9A 4J5NA 4AZ7A 1AA1B 1M68A 2D3LA 1UWAA 2GVYA 2QJNA 1V02A 4QG9A 4JAWA 1ZGDA 4WY0F 3UPMA 1B4KA 4UNLA 2HS8A 1XRFA 1DJXA 2DUZA 2E4TA 3MWCA 5HWJA 1QW8A 2J7BA 3NPWA 4C6JA 2ZX7A 1LTDA 3APTA 4ACYA 2QLYA 3W28A 1ZL1A 1RCOB 2Y8UA 1JNDA 3RX4A 3URQA 4AY8A 2PD5A 3W7CA 1EH9A 4GZEA 4GA8A 4E8DA 1CIUA 4WCJA 4UTIA 3C2RA 4PUUA 4HSOA 3VE7A 1GYMA 1B3VA 4C60A 3TMQA 1V0NA 1EHNA 4R27A 1M03A 1TE1A 2DZBA 4D1IA 5JMUA 4CVUA 3N14A 1J6PA 3U7VA 2PZ0A 1J18A 4WEVX 1E6NA 2BVYA 2OELA 4U3CA 1KLYA 2AOSA 2CBIA 1K1DA 5AYXA 2Z24A 5D9NA 3ZMRA 3A21A 3TSMA 2MANA 5CSUA 4L1XA 3GG1A 1OY0A 2XINA 3T09A 4C7DA 3GLCA 4B3LA 1KFBA 1QO2A 3SCTA 3HGRA 1V6XA 4H41A 4I90A 5I07A 4V2XA 4P5UA 4IXXA 4JTRA 4TR9A 5BWAA 1JCXA 1UKQA 3DC8A 5T9BG 1LT8A 4ORMA 1C8QA 2JIWA 4JIRA 2X0YA 2PDBA 3PG9A 4FMVA 3TYDA 5JXQA 2QAFA 3EYPA 2YZRA 2E9MA 1M7PA 2R1MA 2NQJA 1C92A 1HUVA 3VD4A 3GY1A 1R3QA 4UFJA 5A8GA 4CN1A 4UTFA 3W70A 3U2ZA 4N6EA 4NJGA 1NDZA 4K3ZA 1CLVA 4J3UA 2IPWA 4KW2A 4M29A 3UG8A 3QMSA 5A6AA 4RPQA 4FNQA 3G3MA 2F84A 2WHJA 1YIXA 3ARWA 1M6JA 4D72A 3VUSA 1OT2A 3FAXA 3KTCA 1B5TA 3GIYA 3WF2A 4FXSA 3KM8A 1A5CA 1BYDA 1OYAA 1I45A 4V33A 1QVBA 3GYEA 2FTWA 1XKJA 3BLDA 1K8CA 2ZUMA 2E7FA 1EUAA 4PEEA 4O4VA 3EWYA 5A2CA 2QJIA 1Q6CA 4F2BA 3CHFA 2Z6JA 3NNTA 4NZ5A 4YU1A 3M5VA 3QR1A 5HBFA 1C8YA 1YE6A 3U2OA 2ZRZA 2R94A 3KVLA 3UY8A 1F76A 2EJAA 3R12A 2DQWA 4IIFA 5HQMA 2C8NA 4R7JA 3RYSA 5D9PA 5T91A 4IWWA 4QRNA 3N9RA 3VXGA 5A8NA 4EOUA 4R9XA 2E28A 2PB1A 3LGDA 1XM3A 5DCEA 1OM0A 3HJZA 3EWXA 4B9ZA 5L9FA 3BAJA 2O4QA 1XBXA 3H26A 5GPRA 1OFQA 4MSSA 1PCWA 2GQ8A 2JBMA 2FB2A 3QY6A 1V3MA 4TX8A 4R88A 1IE7C 3FFSA 3BLLA 3CIVA 3PB2A 4I7WA 4IGNA 2Y7DA 1XLIA 1XINA 4NF7A 3GXIA 4JTQA 4IHCA 1NIUA 3LPPA 4G7EB 4H83A 4RZBA 4CCZA 4WY0B 1U5VA 3DKJA 4PMRA 2V5CA 1VHNA 2R24A 4IFKB 4GXMA 2GK1A 4XVDA 1JR1A 4GZJA 3BPWA 1Q8JA 5HWMA 5FA5A 1BRLA 5DXXA 2OX1A 2NWRA 1H1NA 2CNCA 2WNZA 1OD8A 1JDAA 2XM2A 4AHQA 2PWFA 4M6QA 3Q94A 2VWTA 1ISXA 3U2CA 1TPB1 2Q8ZA 4DUVA 3L2MA 3KAOA 5FJUA 3GKAA 1UHVA 1ITXA 3TK7A 3DAQA 3UCQA 2GSJA 3E12A 3QPYA 4X60A 1JRCA 1P1MA 3CV2A 3KCOA 3C0SA 2OYMA 1NH6A 3EKZA 1S5TA 3CO4A 1E71M 2TAAA 3UJ2A 4IPPA 4ZQCA 1E40A 4GE8A 1AW1A 1U22A 1VCVA 2X2YA 3WMSA 3GNPA 1JULA 2H90A 4Q8UA 3OO2A 3LBCA 4LX4A 1Y5XA 2W27A 2VZOA 2CZ5A 1TZ9A 4IQDA 2BODX 4A21A 2VEMA 2PDFA 3B0PA 3NM1A 2PDCA 4PTDA 2C13A 5FACA 1RK5A 2NUXA 3UZZA 3LRMA 3CB8A 4B91A 3SADA 4ZO8A 1TIMA 3SN4A 3GNRA 1K7XA 4N0RA 5LKYA 4MIMA 2SFPA 1AW2A 4UR9A 5HR7A 1PBGA 3N04A 1UKOA 1DWFM 2HNEA 2VZTA 1L6FA 2Z1VA 1XRSA 3NDOA 4XD6A 1H62A 1ZZMA 3RM8A 1JGIA 1ZY9A 3PBVA 3AHYA 1JEZA 3EWUA 2JKPA 1WBJA 4AB4A 4EF8A 4MJMA 4OFCA 2QF7A 1LLZA 4ZCWA 3QTPA 1SFSA 3FAWA 3A22A 2R1KA 2YSWA 3GDKA 3CAQA 4AXNA 1E15A 1LORA 3F2BA 4YHGA 2FPVA 6ENLA 4PL2A 1RJPA 2WYSA 1NWUA 4IMCA 3WQEA 1VENA 1SZNA 2OT0A 3VZZA 1H51A 3BCDA 1S39A 7PTDA 1JXJA 5C6MA 1IV8A 3FEMA 1LBMA 3N18A 3AU6A 1LZOA 4PCSA 1RLDA 1JD7A 5AB3A 7XIMA 4P7QA 4GWEA 1SW7A 2AL2A 2KX9A 2OSXA 2EG6A 3HB9A 3TSDA 3VGFA 4JY8A 3N2MA 1IIGA 2XIMA 3T4WA 2A3LA 2BHUA 4EIVA 1UR4A 3HZ3A 4O1CA 4CLMA 1RV8A 4REQB 3OLGA 4HN4A 3UG5A 2GSEA 1LRNA 1PS9A 3K4DA 3KL5A 2V69A 4NASA 3KDNA 1F3WA 2Z26A 1MXGA 1PWMA 3VU2A 4QITA 4H7CA 4K68A 3OPSA 1ZJHA 3GFZA 1UD6A 2ZTJA 5HNTA 3NO1A 1GJPA 2ZZ3A 1Q6DA 3C0LA 4H6QA 3H4XA 4QS6A 4JNZA 3B8IA 1LDCA 1KFEA 2XZ9A 4TU1A 1EF2A 2HNHA 2BXZA 4RV8A 4S3AA 3XIMA 3MP3A 3W7PA 5D04C 3L2IA 2AMXA 3W7MA 4IT1A 3QLLA 3MKVA 1UOZA 2DT2A 1CENA 1YNQA 3QM3A 3TN6A 1KFJA 1UIOA 1LBFA 4JTHA 3RRAA 1E0TA 3I68A 4LH8A 3UWQA 3WY1A 1YDOA 3MHFA 3GXMA 4LAKA 3OGSA 2WMGA 3UJFA 3VE9A 1HJQA 3SAZA 3VINA 1VHCA 1QUMA 1M53A 1VRDA 3II1A 3EDJA 1YPXA 1XSIA 2OPJA 1BPLB 2ZZ6A 3M0MA 1DWHM 1DP0A 1FQ0A 5BOEA 3SGGA 3N3TA 3RLHA 3IV8A 3M0JA 4Q4QA 1KQYA 1E6PA 1KCLA 3NGFA 4LRSA 2CWXA 4MZYA 3AMGA 1UG6A 4A3QA 4ZQMA 3IJLA 1JG9A 1J10A 3R8HA 1XLDA 2HXTA 3CB3A 1FH7A 4OBRA 4GQBA 2C79A 4DO4A 2HXUA 3M64A 5I02A 1XQLA 2GJLA 1KRCC 4C6EA 3UG3A 2F8QA 1Q2RA 3Q2DA 2AL2B 3CQKA 4GCAA 3V18A 5I09A 1AH0A 1KXTA 1D3GA 2ISVA 3E38A 3WMCA 2HPMA 3TROA 2VX7A 2BTMA 4GQGA 4AG0A 4XTIA 1KRAC 4V1XA 1JUEA 3S5YA 5ABFB 2WLZA 1U83A 1TMLA 3DFHA 4GYKA 4WKHA 2ASHA 1UD5A 1NFBA 1XBVA 1OX5A 5DXYA 4AU0A 3SIZA 3ITOA 3MCNA 4AF0B 4CD4A 2OLAA 3O16A 1CXLA 2G41A 2DVTA 1EYWA 3ZO9A 1M41A 3GNXA 5FD0A 1PIFA 4FXJA 2P8BA 3I3EA 4TTUA 3W7DA 4L4PA 1FHDA 2IPFA 2DH2A 3GDRA 3NOEA 2J25A 1VFSA 3SUUA 2HISA 2BMBA 2DZWA 4LUYA 3DKLA 3PTDA 4M6PA 1KFLA 1DJYA 5KETA 1ZTVA 2BOFX 1Z32X 1B54A 2IKIA 2VC7A 4QQ3A 1KFWA 3BGJA 1V0MA 2FDMA 1JI2A 3E0WA 1AG1O 3MMWA 4GY0A 2Z1KA 5C9ZA 3WLPA 3QTGA 4GC3A 4LAOA 4NL1A 3TAKA 5CPTA 5LNUA 1XWYA 1ISYA 4NKCA 4N42A 3AHVA 4CD5A 1CZ1A 1QAPA 3FNDA 3GXDA 3NFUA 3W76A 4B16A 4PRRA 2JF7A 6REQA 1WO2A 1EOKA 4DPQA 3VIMA 4AD2A 2Y62A 4J35A 4N9CA 1OCBA 5BYWA 2WKJA 3VNIA 1HNYA 4RUBA 1GQLA 1DHPA 2J6VA 3XINA 4WJXA 4TMCA 3UCDA 4G1KA 3FGCA 2J7FA 2NUYA 2R82A 4AD5A 2FFCA 1J96A 4N6FA 1XLEA 4OU1A 4X0VA 1Q2SA 3SRDA 3L66A 1M3UA 4YTRA 1BXNA 3CUXA 4AEEA 3IK4A 3O1NA 1CGXA 3M43A 1KM6A 1CXHA 5AHMA 3IAPA 3MW7A 4NZCA 1AL7A 1AODA 4GJ1A 3OLIA 3XISA 5CC5A 3GR4A 4PBEA 2JK2A 2VL4A 1PAMA 3KVJA 1Z3NA 1R87A 3AXHA 3RM4A 4FLOA 3W26A 3K4WA 4F79A 2O9RA 4P8WA 4I9AA 3NL2A 3C56A 3BG5A 5G1YA 2NZLA 4JHZA 3ZVHB 1CB7B 5E9XA 4P7RA 3NVDA 4ATLA 2QW5A 1N2VA 3GG8A 3SFKA 1PYFA 2ZQ0A 4HNNA 4K6AA 1R7OA 2C16A 4PMXA 2A3CA 4G8TA 3S2JA 1JGMA 3HGSA 4GX8A 4K37A 3SECA 4JYDA 3VGHA 2VEPA 4IIHA 4GIAA 3S5NA 1HFBA 2OX4A 4KMQA 3LLDA 1Q6QA 5MHBA 3MZNA 3T42A 3ELFA 3ONBA 4R3UA 4XD5A 4AZCB 3USZA 4QLKA 4JKMA 2CW6A 1O5XA 1ONRA 3OBEA 3PG8A 3NM3A 4OOUA 4DYKA 1XDLA 4HBKA 1BGAA 1LJYA 1PDZA 4GXWA 3S2NA 3VDAA 4RPPA 1J0IA 3EKLA 2I16A 4XD3A 1UMLA 1XYCA 2G95A 1SZFA 3V1PA 1DJIA 2DZXA 5A2BA 1GJUA 3MC5A 2IS7A 3VKKA 2VGFA 3U2EA 4Z2LA 1AZ1A 2YL5A 3W2KA 4E2DA 3B8VA 1PX4A 3W7LA 4L5ZA 1E9YB 1NDYA 2X42A 1E1EA 1F3XA 2W5FA 5LA2A 5AC4A 2AAMA 2XTKA 4BY3A 2D2GA 3WLTA 3MVIA 2X8RA 1LP6A 3TYUA 4JZ5A 3O63A 3EX4A 4FS9A 4KEVA 3VUPA 3R0UA 1VFMA 3UEQA 1HJSA 5D2VA 2WQPA 4C6CA 1G4TA 3KBVA 1J93A 4ACZB 2AQWA 1P0NA 2V9DA 3BLIA 2AQVA 3PP7A 3DXIA 1LWIA 2R8WA 1T8XA 4G56A 2WJDA 1ZUAX 3NVTA 4GI8A 3UZWA 5E5CA 3K13A 1A3WA 3WD0A 1TB3A 3TJXA 3NUKA 3EDDA 4CKQA 1IEVA 3MSGA 4XZMX 2FHBA 5M2FX 1XUUA 3W1XA 2POZA 3WQ6A 4LWWA 5HA7A 1DYSA 2C0AA 3REQA 3WKZA 3M5XA 1L8NA 1NWTA 2JEPA 3O06A 4OJYA 3UWEA 4DUXA 1DL3A 1P0KA 3BTNA 5DBTA 4JIQA 3LHZA 4YVPA 1LWJA 1GOWA 3EOLA 3M0XA 2ZXQA 5IBXC 3NEVA 1Q6LA 4LCQA 4L9ZA 5E93A 4FX8A 4BF9A 3LSCA 3QYSA 4KWVA 3MBDA 1TREA 4D6FA 4LC6A 1QBAA 2V3DA 3WEZA 1FBAA 3IEBA 1U5JA 4Q8TA 3EWDA 1SSGA 5FI8A 4WLCA 1PE1A 1XISA 3MSDA 4JTDA 5DT5A 4O1AA 5DANA 2TMDA 2DDXA 1KNWA 4X3ZA 4IMAA 3ZVIA 1WNOA 1P43A 3NQCA 4OV4A 3B0UX 3KVMA 1IT0A 2ACQA 1W3JA 3LV6A 1CTNA 4GFSA 5JBDA 3PZMA 3HURA 2D24A 1EP3A 1WZMA 4D71A 4LUSB 7A3HA 4MMWA 3CYVA 3KLKA 3CUGA 1H7PA 3DYPA 4M1RA 4LS0A 5CC7A 2Y85A 3UWYA 2NQ9A 1E1FA 3CZGA 4Q8PA 4HOXA 3BAYA 1TTPA 5I3KA 4FPSA 3BJTA 3UWWA 2PP3A 3TNBA 1CBGA 3A12A 1TYGA 2DJLA 7ODCA 2IW0A 3UJRA 2WOQA 2PI6A 3ISIX 4CD8A 2HE5A 2BXYA 3BL3A 1W2VA 1X39A 3KBNA 3CUIA 4UBPC 3SBFA 4MDOA 4GMEA 3O8AA 4NZFA 1W1B1 1PTAA 1D7FA 4TTGA 1KGXA 4NUWA 5GVJA 3T2QA 3WD2A 2EPMX 3A9IA 1JYVA 1QASA 1EFZA 5KSWA 3VAVA 1GK8A 5DX7A 4M19A 2ZRWA 3AO0A 2E6YA 3PFMA 3IJ7A 4Q8OA 5FAJA 4FNPA 3WSUA 4GKTA 4JBRA 3QOKA 3IARA 2I5GA 2HRWA 3BW3A 4HMCA 2ATMA 4PTNA 3TC6A 2YDRA 1I8JA 4IMFA 4HCDA 4KEZA 4GIRA 2IKJA 4XSLA 1FWCC 3QJAA 2BGNE 2PCEA 4UQDA 4UOJA 1XPGA 3PBWA 2OKTA 1SO4A 3MO4A 3R94A 5I03A 4FALA 3WL1A 2QV4A 4W86A 3BAWA 2Q71A 3N9KA 1MVYA 1AD1A 2WCSA 4HVXA 1CGWA 3ES8A 3LCLA 3QW4B 4X2RA 1QFEA 3SB0A 3BJSA 3PAOA 3W74A 3H54A 3PPGA 4JYEA 1VCGA 3M0LA 4FR1A 3D3FA 1AMKA 1Q65A 5FL0A 1J0HA 4KKXA 2DEPA 3I3DA 4AHOA 1A0DA 3RDKA 2NV9A 3EA1A 3FSUA 1FFRA 1IZJA 4JDYA 3MANA 1EX5A 1O94A 3GTHA 4NJKA 2PTXA 4JN6A 4IH3A 2XN1A 1CXEA 1MNSA 3L68A 4PE8A 2EPOA 4HMDA 4UUIA 3UJSA 4HZ8A 5LNRA 1FHLA 2J9ZA 3KCJA 2VVSA 3DUGA 3EOEA 1QPOA 1BKHA 1S1PA 1E51A 5C9UA 1CGYA 3FHAA 3SSZA 4PFHA 3GVVA 3RR1A 4IP4A 5AC7A 1I1XA 4AWSA 1Z48A 2GZXA 1RP9A 1A5SA 4CQ9A 3KTSA 1YNYA 3KWXA 5CBJA 4JTAA 3GX9A 2DVXA 3VCNA 2LLEA 3BANA 4TVDA 2JGYA 3DEQA 4UQEA 3RPMA 5KZEA 4QEEA 1KR1A 1WAUA 4HJFA 4MYAA 2B81A 4GOAA 1K9EA 2ZICA 1MDLA 2WVTA 1V6YA 2TYSA 2JE8A 3C3NA 3UNDA 4MWAD 4CN4A 2MUCA 1XP3A 2JALA 5AHEA 3PY2A 1R3SA 1KM4A 2YBVA 3DERA 1XKYA 2DSKA 4WSHA 4ZOAA 3M0YA 4Y2WA 4YTUA 2QAPA 5FKYA 1BG4A 2RFGA 4OOZA 2C6QA 2YW4A 1R9ZA 3PSVA 5RUBA 1UD8A 1X6NA 3MV11 3AS1A 5EMKA 1AH3A 3WUFA 2W9MA 1V6WA 1MEIA 2DZAA 4TOQA 1J0ZA 2GUUA 5HATA 1CGUA 4ZVJA 1CXIA 3WNNA 4DLMA 1O1HA 2FPYA 2YA2A 3LMYA 4E5TA 2PODA 1QJWA 4HK5A 4L61A 3HBLA 1EXBA 1JJKA 3ZZ1A 3UGVA 4IMDA 4C1LA 3TJIA 9RUBA 3POCA 3PTMA 3WEMA 1UH2A 4JTCA 1HJXA 4F0HA 4TV5A 3TV8A 2VEGA 3WLQA 4BWLC 1IZKA 2WLYA 2PDGA 4NJHA 4W88A 5CZKA 3U5YA 3WMBA 2PURA 4KPLA 3QH2A 3LSBA 4MZ1A 1RVKA 3SDOA 3NTYA 5F2MA 1DVJA 1T41A 2DT0A 4AAJA 1EL3A 3GVRA 4P8VA 2VUYA 5IHRA 3A4AA 4BQ5A 4PUWA 2VNCA 5AYBA 5IRPA 1PSCA 1AL8A 2GQ9A 4LY8A 1AD4A 3A24A 2VTFA 3WF4A 4DJFA 3TZFA 4H9UA 1LG1A 5XINA 1GKPA 4W7VA 1WE5A 2AAAA 4AY7A 4LF1A 2E25A 2HVOA 3VABA 1DWIM 3GHUA 5G2HA 2PGFA 3BZGA 3FJNA 2E5CA 3UPWA 3WFAA 4AEOA 1YMYA 3O3RA 4GYFA 2BOEX 5M03A 1G6CA 1DXIA 4WF7A 2J66A 3LMZA 1OFDA 3CH0A 3Q65A 4H9MA 1OFPA 1PZ0A 5A5WA 1EC8A 3GUGA 2CKSA 4DRSA 2CHOA 3U9IA 4J2MA 4H6RA 6CGTA 2E5BA 2V81A 2XGIA 3WUBA 3F4VA 3W86A 1FWTA 2JEQA 3W6LA 2GFTA 2X09A 3T0CA 2ZZ7A 4UFLA 1YTDA 4CU7A 3AYTA 4AFYA 4Q4KA 4B9YA 2JQXA 1GOIA 3IV3A 3D0CA 1DWAM 1Y8BA 3L4TA 1HL8A 1SFJA 2XFYA 1H49A 4J2PA 3AHZA 3BCJA 5HK4A 2VX4A 3T0TA 4D6EA 1L6GA 3PTKA 1YBQA 3GTIA 1ZHAA 3SCPA 1CB2A 1DORA 1MQPA 3RLVA 4XB3A 3WFZA 4MB1A 3P8JA 2ZUUA 4A8RA 3M0HA 3ITGA 1OVDA 3AZTA 3G1VA 1TPDA 1Q8AA 4YMZA 2E9BA 4HHHA 2XSBA 3DHDA 3GVWA 1OABA 3W2LA 2ZZ4A 3IS4A 4FOJA 3TP4A 1SPQA 2A5HA 3TTYA 1JDEA 4F48A 3HPSA 7REQA 3L9CA 1GPFA 5HULA 2G4FA 5FL1A 1K9DA 1C9DA 3NZRA 4R33A 3ZQ9A 2OGYA 4LBSA 1LG2A 4O50A 1KW1A 4JKKA 2HV5A 4AMAA 4XTDA 3Q4DA 5DCBA 2BBFA 4UTJA 1A4MA 1JUBA 1VEPA 3N2TA 1Y5WA 1VJIA 1ADSA 1VFHA 4M80A 2FHFA 2ZYFA 4WDUA 4E38A 4K8HA 3BWWA 3GNDA 1VR6A 5IDZA 3I6RA 3FY1A 3N2XA 3SCNA 1WKFA 1EB3A 1V6UA 3QW3A 3TFXA 1KB3A 4ZBCA 4JQ3A 3LM7A 2OGJA 2OKOA 3APYA 4EP8C 5CAKA 4AVFA 1F61A 1UP3A 3GS6A 3KLLA 4LV4A 5HOSA 3YPIA 3I3BA 3VM5A 1MQRA 3NQ6A 3ZT6A 4ERGA 1JF6A 3GW3A 3UG4A 4UR8A 5DMMA 1W32A 2J78A 1KLZA 3I4KA 3DC0A 3UZ5A 4CVWA 3P7YA 1H41A 2G8ZA 4RE2A