4PB4A

D-threo-3-hydroxyaspartate dehydratase h351a mutant complexed with 2-amino maleic acid
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
379
structure length
379
Chain Sequence
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNAACATGAQFPAYQALAADGSVQTWERLHGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-threo-3-hydroxyaspartate dehydratase
publication title Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate.
pubmed doi rcsb
source organism Delftia sp.
molecule tags Lyase
total genus 143
structure length 379
sequence length 379
chains with identical sequence B
ec nomenclature ec 4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase.
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01168 Ala_racemase_N Alanine racemase, N-terminal domain
A PF14031 D-ser_dehydrat Putative serine dehydratase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.20 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 4pb4A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 4pb4A02
1BD0A 3WQDA 3B8WA 1QU4A 3GWQA 3KW3A 3S46A 4DZAA 4BHYA 3VABA 1F3TA 1VFTA 2YXXA 3N29A 1EPVA 1HKVA 4PB5A 1FTXA 2VD9A 5GJPA 3HURA 2SFPA 1D7KA 4LUSB 2VD8A 3ANVA 4BEQA 4LUTB 4WR3A 4BEUA 4LUYA 3B8TA 4ILSA 3WQCA 1HKWA 2RJGA 3WQFA 3NZPA 1RCQA 1W8GA 3NZQA 5FAGA 3ANUA 1CT5A 4Y2WA 4FS9A 1SZRA 4DYJA 2J66A 1VFHA 2TODA 1SFTA 2QGHA 4QHRA 4BF5A 1VFSA 5GJNA 4XBJA 3WQEA 3N2BA 2P3EA 1XQKA 1B54A 2ODOA 1KO0A 1TUFA 3B8UA 3MT1A 1L6FA 2RJHA 3E5PA 5FAJA 4KBXA 4ECLA 4A3QA 3OO2A 2PLJA 4V15A 1L6GA 3UW6A 1XFCA 5BWAA 3WQGA 3HA1A 3LLXA 5FACA 4AIBA 1KNWA 3BTNA 2O0TA 2PLKA 4ZGYA 2NV9A 3R79A 3CPGA 3SY1A 1TWIA 3C5QA 3B8VA 1NJJA 1XQLA 4XG1A 5IRPA 4PB3A 2NVAA 5GJMA 2ON3A 3E6EA 2DY3A 4LUSA 3N2OA 3CO8A 2OO0A 7ODCA 3AWOA 3AWNA 4LUTA 1NIUA 4PB4A
chains in the Genus database with same CATH superfamily
1M7XA 1BD0A 1E5JA 2QLYA 4GI6A 1JEZA 5RUBA 3PFMA 3AMDA 5DANA 3CB8A 2A3LA 4DJFD 2YCEA 3NZRA 3VTRA 1BG9A 3AJ7A 5EBAA 3EXRA 3ARXA 3HB9A 2VD9A 3QZAA 4Q7BA 1Q6EA 7CGTA 1RBAA 3ANYA 3R8HA 1HXJA 3I7QA 2BY0A 3EA1A 3QXBA 2EAWA 3HMJG 2NW0A 4Q4RA 3DYOA 2X1RA 3UWVA 1MEHA 1YHTA 2XZ7A 4AYGA 4UFLA 1TTQA 4HSHA 1UROA 1K8CA 3I6RA 3ELFA 4NZ4A 4EP8C 1E71M 3UWQA 3WENA 4I5UA 3RX2A 1NEYA 2PD5A 3SAZA 3CGTA 2BXVA 2ZXQA 4AHPA 3O7UA 3PC0A 4UCGA 6XIMA 1ZTVA 5CZJA 4NRRA 5ECVA 2PDBA 2V5JA 4BK9A 2INEA 4CQ9A 1UG6A 4A8IA 2NVCA 4HNLA 1F07A 1JIBA 2Y6ZA 4XZHA 2OYKA 3VNJA 3SRDA 5IDZA 1UBPC 3NQAA 4XKYB 1UYQA 4W7WA 5AN7A 1H7NA 1MXDA 2DY3A 2REQB 1PZ1A 2DSWA 3AWNA 2I56A 1QI0A 1JPDX 1CYGA 4HNTA 2FPTA 1AZ1A 1ZZMA 4FX6M 3T09A 5C2GA 1LOQA 3CLWA 3R1ZA 1FWEC 3G1HA 3AOFA 2ASHA 3MZ2A 4DPPA 3PB2A 3UEQA 3AHZA 1E9YB 3PJWA 2BB0A 1TIMA 1P43A 3UNDA 4BI7A 4C6DA 1OSEA 1EGVA 3UFYA 3BAJA 4S3BA 2HROA 3IRDA 4LYPA 4DBEA 1GNXA 3VZYA 1HJQA 4TQTA 3WLQA 4B5TA 1Q66A 3P0XA 3PPGA 4Z1YA 4D71A 1LL4A 3WUFA 4I9AA 2PDWA 1T8QA 3RMEA 4P8UA 1XC6A 5M3WA 5EKYA 5A8NA 2ISDA 2YB4A 3R43A 4L4LA 2NUWA 3V4BA 4GIRA 1I75A 3BLKA 1ME8A 3TLLA 5DT5A 2OYLA 1WAUA 4AWSA 1S3TC 2BMBA 5TF0A 1SVDA 3TJIA 3STFA 3RG6A 1JULA 3SQLA 1VFMA 4AAJA 2ALRA 2ZUMA 3ES8A 3LB0A 2AAAA 1UZ1A 2R14A 1JUBA 4LS1A 1JL8A 3V75A 3AAMA 2R24A 1F61A 4JD4A 1HJUA 3M0KA 4EWJA 3VIOA 2VGGA 2R94A 4QBXA 2AQOA 4WSJA 4B90A 4YHEA 1OCQA 3CIVA 1VFTA 3P5ZA 1OZQA 3ZLGA 2YZ5A 4RW5A 1QNSA 3TJXA 4Y6GA 4I6KA 4KS0A 4QNEA 1QPRA 3GDMA 4W87A 1XSJA 1ZBCA 5FI8A 4ATWA 2VGFA 2ZZ4A 5A6BD 1DWHM 5AYZA 3B97A 1OCJA 3H2CA 3IGHX 4Z17A 4UTMA 3MCNA 2YA2A 4L1XA 3W7CA 1P1XA 2WSKA 1S5TA 3UY8A 1IIGA 2BY3A 1PDYA 3QRHA 4RDZA 4WJEA 1ZSXA 3Q45A 5CPSA 3TOYA 3K8LA 4JR5A 1O5XA 2PCQA 1J18A 3SY8A 5A8PA 4I9MA 5E9AA 1E1EA 5BOOA 1XRSA 3FAXA 4UWMA 2E25A 3PJUA 4AVFA 3M5YA 3N3MA 1IWAA 4O13A 2ICSA 4GQQA 2R82A 3TW9A 1N8IA 4WIWA 3RK8A 3GR8A 1ZBWA 1OGSA 4QJ4B 2ZVRA 1G4TA 1W91A 3ECQA 1S5NA 4XISA 1G0CA 3H70A 1TV3A 4PULA 1MDLA 4H8VA 1CGUA 4N9BA 1HJXA 3GW0A 3UPBA 2ZIDA 4H41A 3W29A 3W74A 4GIAA 2DJLA 1PV8A 1KBIA 1J5SA 3VKBA 1ZHAA 1Z8AA 3TW7A 1WXJA 3U0HA 3VOJA 1DE5A 3PZIA 5FIPA 2B7NA 5A94A 1X7FA 2J13A 3R8GA 2VEGA 1QNQA 5CAKA 4HU0A 3GIQA 4FNUA 5E6YA 3GNPA 3JW7A 1M68A 1YBQB 4IL2A 2G37A 1M7OA 1QNVA 1A5OC 2PRHA 1YX1A 4ACYA 1E40A 3EWCA 4NAFB 1KFJA 3R2GA 2VT0A 2OQHA 2R1NA 4HCHA 4QGCA 3UXDA 5A95A 4F2UA 4HOXA 4JFUA 2VJXA 1TPB1 4IIBA 4LVDA 1US2A 1XIFA 4NXSA 1ZRQA 4ZCWA 1FWWA 3WJSA 1BGGA 4ZO9A 1TQXA 2H8ZA 1VPYA 4OV9A 1A0CA 4PMYA 2P8CA 3B05A 1PKNA 1V03A 3S2LA 1UPPA 4GZ7A 2DZVA 4KEUA 3QN3A 4HNNA 5IBXA 3ITGA 3N2OA 3CAVA 3LCLA 3W2KA 4JX4A 1XYAA 2QVHA 1K3UA 3E49A 4RV3A 4MJ4A 2ZX8A 4O50A 5CG0A 4GXWA 1Y0EA 3ONCA 4H1ZA 4ROQA 1IWPA 1GQNA 3K5XA 1PKMA 4MJMA 1VKFA 4MAVA 4CCDA 1ADSA 1UA3A 1UR4A 1IE7C 3TTYA 3B8TA 4C90A 4DZHA 3WD4A 1IXNA 2IPWA 4GQBA 1A53A 5ABEA 3RLUA 3AHXA 3PNUA 3RM9A 4H83A 1CGYA 4ATLA 3VM5A 1QWKA 2VUYA 3B0UX 1QVBA 4ZZ9A 4L56A 5KINA 1I8JA 3H4GA 4PUUA 3TYZA 4PCPA 3W75A 2FGBA 4G2DA 2GWGA 3G24A 4MNJA 4IFKA 1DV7A 4P8VA 1WOBA 4IUOA 3JZUA 3EOEA 3DYPA 3S6DA 2VOTA 4UZUA 2FPYA 2G3IA 4HMDA 1UUOA 3ONBA 3BH4A 1MW0A 1FH7A 3BGJA 1W1IE 3U2ZA 4XD6A 4RR4A 2V5DA 5FKYA 2XVPA 1E0XA 4QLKA 4BI5A 3O06A 1FFQA 3NSXA 3G1DA 2QR6A 4AWEA 4XZMX 3LHWA 2JF6A 3GU9A 1KGWA 4ML4A 4M56A 3N73A 4N02A 4NIRA 3U4FA 3VX1A 3RRXA 3K1DA 3W86A 1Q6GA 1KWGA 3ZVIA 3NO5A 1GOOA 4KGLA 7A3HA 1D7KA 1VBRA 3FKKA 1MMFA 3W1LA 1VJIA 1QT1A 3GB6A 3MHUA 4DBWA 1J6PA 1KD0A 3R5EA 3ZT5A 5LHEA 2QIWA 2ZUWA 3N18A 3TA6A 4O53A 1NTHA 2PRMA 5DBUA 1GOKA 3ENLA 4L64A 2C1IA 4OUIA 3QPZA 1AH3A 3EOOA 4GCAA 4IFKB 1EJ7L 3VCNA 1SO3A 4ENLA 4U28A 2NXIA 3V36A 1PXGA 3H23A 1V6YA 1XLJA 3EKLA 3UQNA 3EWWA 2Y1HA 2YA0A 2J78A 4BCEA 3L9CA 3SM0A 3N2CA 2HMCA 3T7VA 1CGWA 4MFEA 1NFGA 4AU0A 4LVGA 3C8NA 3W6MA 3L66A 3ZM8A 3PZGA 4W89A 5FEPA 4DI8A 1JZ6A 1DJNA 3L12A 5G2IA 4UR9A 1XPGA 3AJXA 4Y96A 4GJJA 5EFFA 2DH3A 5GPRA 4H00A 5J04A 1H49A 5A6LA 3FXGA 4LANA 3OBEA 2WM1A 4YL2A 4YTSA 8A3HA 4PTXA 3W72A 1E1CA 2YGYA 4UOJA 2E5BA 3TN5A 3OW1A 4FXRA 2X1IA 4DLFA 2HK0A 2XGIA 4AZ7A 3GXFA 1Q7ZA 4HOZA 3NL2A 2Y5SA 2VP8A 3VIMA 1XV8A 3KWXA 3ABQA 2PTZA 4HT3A 1W9XA 1W5MA 3R0DA 3BXWA 3UZ5A 3WBYA 2ZZ1A 1TWWA 3EPNA 2POTA 4PMRA 3WY1A 1CI1A 4O28A 2Y0FA 2Y7DA 1UP3A 1VFLA 4GE8A 3WJZA 3CHEA 3BMWA 2V9DA 1JDCA 3UCQA 3V0SA 1ISWA 5D2WA 2DU2A 4KEMA 4D6FA 4GVGA 1F7BA 1UCWA 1T5AA 2PDLA 2A3EA 4F0SA 2F8QA 4PMXA 4AZGA 2O7SA 3RUBL 4IWWA 1GVYA 1WCGA 4RW3A 4PCNA 3TE9A 4BWLA 3D6NA 4Q4SA 2XFRA 2GQ8A 4JHMA 3H4XA 1A0DA 3SN0A 4CVUA 3N25A 1VCVA 2W9MA 3W28A 4DY1A 3M41A 4QAWA 2C8NA 2PDHA 4RXFA 3QHMA 4KF1A 1G6CA 4R9XA 1YXCA 3QMTA 2Z1SA 3BSMA 3GFZA 4H8NA 3A9BA 4NZCA 4IQJA 1E1CB 1R9ZA 2VO5A 1BKHA 1Q6DA 1I1WA 1VP5A 3NZGA 3WLLA 2PTXA 4JIEA 3MUZ1 4JTLA 2VQTA 1ZJAA 1PTGA 3M1ZA 3M6YA 1SZGA 1W8SA 4JYEA 4AWTA 4LUYA 3A3HA 3L2LA 2OEMA 2PP1A 2C0HA 2Z2UA 2PFHA 5KZMA 3K8MA 4QEEA 1UWIA 4N6FA 1O5RA 4AIOA 3CNYA 1Z9AA 3VGHA 2X1UA 1IEXA 1DQWA 1WUEA 2XIOA 3ATYA 4ERIA 2G95A 3QGKC 3M7WA 3ABXA 3VNZA 3B0YA 1VPQA 1VEOA 3KOYA 2VZSA 3THDA 4UMBA 1SGJA 1CXHA 4H2HA 3ITYA 1S1RA 4S1FA 1LCOA 3N19B 3LN3A 4P5UA 2ZZ2A 3HQNA 2QDGA 4QAIA 4R33A 1KBJA 1XD1A 1AQ0A 3R13A 3IK4A 4A21A 3CXOA 3WLTA 1W2VA 3R94A 3PTDA 2HCVA 1TX0A 1RD5A 3NZ1A 4K8GA 3TXVA 3ZJ6A 1H50A 3K4DA 1QO2A 4O16A 5BROA 3OVPA 4UCFA 1QW7A 2ZX6A 3GZAA 1R30A 4GUFA 4PCTA 1NDVA 3AIVA 4CD8A 4IXHA 4P8WA 1WE5A 4OU1A 2VDIA 3B8WA 3VO0A 4KWUA 4DBSA 4QG8A 4XAPA 2EPOA 4H8UA 1LWIA 2HPMA 1E9ZB 3DEQA 4LC6A 1KLYA 5J5DA 1CCWB 3TWBA 4WX2A 1IEWA 3VFCA 1OINA 4E8DA 2QF8A 4MLRA 1GTEA 3TTQA 4GI9A 1MUWA 1OC6A 2GVJA 3WDRA 3AXMA 4HCDA 4EKJA 3WQCA 1BVWA 4JN8A 3GBEA 1TPVA 2JGQA 2ZE0A 7TIMA 3STPA 1R9XA 1YADA 1VCFA 1C9DA 5I2UA 1KQYA 1E73M 1ME9A 3QC0A 1V3KA 1GZ1A 2NQHA 4QS6A 5MF5A 3UJEA 2YCJA 1RH9A 4X22A 1KRAC 2DT2A 2V2CA 1XCFA 4JDYA 3LV6A 1PTAA 4B4HA 1WDRA 2Q3OA 5DBTA 4IIHA 1MZRA 4RV8A 4TOQA 1GJPA 1DHKA 1KKOA 1DJGA 4CN1A 3N9SA 1AUSL 3LXAA 2H8XA 3QPEA 2HTMA 5A3HA 3IUIA 3BV7A 2IUZA 2WSQA 2V6AA 2QJNA 4MNLA 1KB3A 3S5SA 3IV8A 5G1TA 3AMKA 1IEVA 3SCNA 4C6PA 3M44A 2YFOA 4M6UA 4PMZA 3PN8A 5HJXA 3NYZA 1CDGA 3UYCA 1LOSA 3MY9A 4AD5A 1VS1A 3IJ9A 1VD6A 3UCCA 4O1FA 2VZUA 1H7WA 1WO2A 1XLFA 3GO2A 4DX3A 4JCMA 1ENUA 2JGYA 2Z26A 4WSHA 1XH0A 4MDPA 4ZE5A 4AZCA 4JHOA 1LL7A 2P76A 1JZ2A 2EKGA 2Z00A 3W2LA 4ZE4A 4NY2A 4XAFA 2PEVA 2E7FA 4Y8FA 2INFA 4IZGA 3U2CA 1SMDA 1EJRC 1K70A 3C8FA 4FO4A 1DWFM 4JN7A 4GXPA 4W8AA 2L5HA 4KRTA 5LNWA 5AY7A 3WQEA 1VRDA 3R0KA 1XYFA 1LBFA 4I8DA 2NX1A 4ZTXA 3SCQA 2CZ5A 5AKQA 2XIQA 1H7RA 2W63A 3T0CA 1AD4A 2J77A 3BO9A 3C2RA 4L1GA 3SGZA 2BASA 3D0CA 1DJYA 3OA5A 4IOTA 4UQAA 1YPFA 5D4YA 2VC6A 1Q45A 3GC2A 4HTYA 3FXYA 2CHNA 3OYZA 1RP8A 1TWDA 3UT0A 3OIHA 4OBTA 3VDHA 5LA2A 4L9YA 2VWSA 3DFHA 5F1VA 5LYRA 3W1XA 2GJLA 2FGZA 3W7GA 1I45A 3F5JA 3LU2A 3M0YA 2GDQA 4UFIA 4NU7A 4DF0A 3MMUA 1XI3A 4JN6A 4A3HA 3GIYA 1TV2A 1W9UA 3O8AA 3V5FA 5F2IA 3BAKA 2WMGA 5CZKA 2PZ0A 5BOEA 1YTKA 5JMUA 2EPLX 3N15A 3DBPA 2V3GA 4S3EA 4NJHA 3OZYA 2RH9A 3T42A 3FOKA 3HPFA 2PLMA 1J12A 4JTIA 1KBBA 3H2NA 2EQDA 4TTGA 3A4AA 5J8LA 3MCMA 4WK9A 3V5OA 3EDFA 2VCAA 4AD4A 4EOUA 3TFCA 5D04C 2CBJA 5C6MA 3CH9A 1HQTA 1UWAA 4IGMA 3PBYA 3BARA 1W9PA 3GXDA 4DZIA 4KEZA 1VEMA 2R1MA 3PZNA 3RYSA 1IIHA 1NDWA 5KITA 4DO4A 3QVQA 1F5ZA 3RCNA 4KBXA 1OFQA 1IGSA 3W1QA 1YDOA 3B9AA 4NKCA 2WKJA 1Y5WA 1XIDA 1V7YA 3A24A 4RNIA 3VOGA 1YEYA 5I23A 4QQUA 5C55A 4GRSA 4QS5A 2Y5EA 4DAFA 1WDDA 4GX9A 2ISWA 1PX4A 4J3XA 3BMVA 1C8YA 3UGVA 4MPKA 1JG9A 2F61A 3CUZA 4TO8A 1OJXA 4ADSA 3I68A 4Q4KA 1WDWA 4Q8MA 1AJZA 1CB2A 3MP4A 5CGQA 2PU1A 4HOWA 1EWDA 2FVLA 3W27A 1R3QA 2Y85A 3S6OA 9XIMA 5A6TC 4QG9A 2INZA 3WUEA 3PS7A 1TZ7A 3W37A 1IQ8A 1K1DA 3C2VA 1HL2A 4FIRA 4DJDC 2G8ZA 3F4NA 3CV6A 1AMKA 1EGMA 4GH3A 4IJRA 4FR1A 1XHGA 3FFSA 3ABOA 4AZBA 3BQ6A 4FLOA 1UWTA 4EWND 2BOEX 3SUSA 3SCWA 3WJWA 2C13A 3MW7A 2GJRA 1UHVA 4DJEC 1DJWA 1KGXA 3D46A 2PDIA 3M5VA 3DDMA 1J79A 3JU2A 4GKLA 4NJGA 3MUXA 1B2YA 3CUFA 2RHGA 4H9XA 3VE9A 1Z48A 2BVWA 3GM8A 2Z1XA 4IT1A 3S2CA 3N9KA 5HQLA 3MANA 4ZSTA 1XLIA 2C91A 2NQ9A 4E6MA 4DXXA 2OYMA 3TAOA 1RK6A 2WQPA 3VUSA 2QT3A 1JR1A 3SQSA 4KCWA 1YE4A 2EJAA 3P93A 4RE4A 3OZPA 1RCOB 3W7DA 2YXXA 2DQXA 4RDVA 3W7LA 1EZ2A 3KOFA 1P6WA 5HA7A 3G3DA 2GYIA 4WDWA 2D0FA 4LGXA 5FEXA 3IUDA 2OGJA 3SW6A 1NARA 3DG3A 4M7TA 1QOQA 3WH9A 4RL3A 2ZVIA 3MO4A 1O94A 3GG1A 3DG6A 1MFUA 2NT1A 4RZ5A 1JDDA 1ZLPA 3A4JA 3HG2A 5HWJA 4GMEA 4G8TA 4HYRA 5DEZA 6TIMA 5M2FX 1BF6A 4LRTA 4H3DA 4NX5A 4H6KA 5HANA 1OFRA 2GDUA 2BODX 1MRAA 2NWRA 4WUIA 3G22A 1MQQA 3BAIA 1BG4A 2GVYA 3C0QA 2D2GA 4ZQCA 7XIMA 1FVPA 5D8WA 4QP0A 5AC5A 2GFTA 1A3XA 3STEA 1HGWA 2Y4SA 5C54A 2J8TA 2GSEA 3A23A 4GZIA 2NX9A 4J2PA 5GJMA 1KTCA 1XCWA 4GINA 2WLYA 2XU2A 3W1PA 1SQ7A 2TYSA 3WF3A 4W88A 5AHNA 4XV0A 1JZ8A 1GCYA 4HZMA 5HPOA 1H7PA 3LV5A 1RAKA 1ZAJA 2ZRVA 4AEEA 1E4MM 2BSLA 4XWUA 1R3YA 4AWUA 2CBIA 1M6JA 2E8YA 4LAMA 2OKOA 3CTTA 4IP5A 4C6CA 1GYNA 4XSLA 3TC3A 4UTKA 1OCBA 1SR9A 2P0OA 2ZZ5A 4ZMGA 1Q7QA 1X6UA 3R4IA 4GNJA 4HHMA 4LOCA 4IIFA 4NVTA 5C70A 1UKQA 3T4CA 4CQCA 7ENLA 3TDFA 2YDSA 3IGSA 2GOKA 2DW6A 1GZJA 3GBDA 1D7FA 3MBFA 3PSWA 1AW2A 3R7MA 2WB5A 3BW3A 1QPQA 1R9YA 2VX6A 2Q8ZA 2J74A 2OXNA 4UB9A 2XIBA 2OQLA 2Y24A 3CAWA 4OE7A 1RV8A 4RZBA 4HHLA 3E74A 1EP2A 3W6YA 5LA1A 5FF7A 4MLJA 3T9PA 4L1WA 4M0XA 4X9SA 2IKGA 4URIA 7REQA 3WNPA 1PZ2A 1A5AA 1DIEA 4UQDA 1Z89A 1CW2A 2VX7A 3LDVA 4R7WA 1U1HA 5DRCA 3ZJ8A 1XUUA 4XD3A 1XBVA 4WKFA 1VJZA 3N11A 1OYAA 3LX9A 1EO7A 1QU4A 3QH2A 3TMQA 1XWYA 1V0LA 4HZ6A 2WO5A 4K37A 3FYOA 4E8CA 3KDOA 3W53A 3V1PA 1W3HA 2GGIA 4MM1A 1LWJA 3PZVA 1RSCA 3B9OA 3OZOA 3E96A 1K7EA 2EPMX 4C91A 3NYDA 1BF2A 1M53A 3EXTA 2NQLA 1F74A 3UYIA 4Q8UA 1W0MA 3WH5A 4K3ZA 2CZVA 4AZIA 1JAKA 2HVMA 3KWSA 4HU8A 3T2OA 5BRQA 1B30A 5CXPA 3F4CA 1K02A 4JIIX 3V0TA 5CJ5A 3LNPA 3E12A 2X40A 4YJ5A 5A1AA 1R87A 3WNMA 4IX0A 3PBMA 3V35A 1EJVC 4AX6A 1Q4NX 3DHFA 1OF6A 3AYSA 4HNOA 4Z2KA 1FQ0A 2Q3RA 1YW1A 3S5NA 1J0YA 1CXKA 3F5KA 1L0PA 4XB3A 4PMOA 5T26A 1JZ4A 4LX4A 1LZOA 4LS2A 3QFEA 1P5BA 5CKSA 3IAPA 1JCNA 2FZMA 4KGJA 5D03A 3NOYA 1WAWA 3P8JA 2ZWYA 4IG2A 2E5CA 3W1AA 4R3UA 1QNRA 5KZ6A 3S5ZA 4PUEA 5FJPA 2B7OA 1UJQA 1POJA 4HYWA 1XL9A 5A8MA 4TVUA 2CZDA 3PAJA 3GU2A 2WHLA 5E6ZA 4UQEA 3KL5A 4PL1A 3GAYA 2YOCA 3VDBA 3W7OA 1AW1A 1PSCA 3B9EA 5CG7A 4AH7A 2ZX9A 3I10A 4OOUA 3CL6A 2P5NA 4Z1BA 4IPPA 3D3FA 3LCIA 4GO9A 1O5QA 3C6CA 2BGQA 3AMLA 1QTWA 1EEPA 4DUVA 3UWEA 3FS2A 2QUNA 3BLPX 3O3RA 4GYJA 4D72A 4MY8A 1TSIA 2H9AA 2DUXA 3GDKA 1HUVA 3EGJA 1QATA 2A6LA 1XIMA 4I8YA 3RRAA 3LG3A 2QCEA 3VZXA 3CUJA 2QCGA 3MHGA 3ID7A 1M3UA 1ISVA 1A4MA 1VLIA 3WFAA 3ZR5A 4Z2LA 2CYGA 1KR1A 3VFLA 1FWJC 3L67A 1YDYA 4M1BA 3G8EA 1XX1A 4P7QA 4RNFA 2X41A 1E6NA 3GDTA 2ZUVA 4HN4A 1UMYA 3TOPA 3W1RA 3O16A 3P8IA 2X05A 4F48A 4JIPA 2VC9A 4EACA 1MXSA 2ZXDA 3BC9A 2C15A 2Z25A 1GG1A 2YBUA 3TTSA 1XGEA 4MF4A 1ZENA 4LS0A 3ANVA 1E6RA 4MJZA 3L4VA 1OHLA 1UWUA 3MKKA 2V2DA 3H2FA 4A3UA 5K4XA 3CLMA 3AZTA 5CJNA 3VD7A 3LPGA 3TX9A 3HG4A 1POKA 1CGVA 2OTDA 3NQFA 4QFUA 2O4MA 2YR1A 4E3VA 3UP8A 4C1KA 2WCSA 5DX7A 4D6IA 1DBTA 2ZCGA 1R46A 4F0MA 3GG8A 3M16A 4NI3A 3VGFA 4MHBA 3TZNA 2V5BA 3QY8A 2W61A 4N4PA 4V1XA 4LB3A 1JXKA 2H9AB 1GQKA 2G5WA 2B7PA 3DECA 4GYPA 3OGSA 2YCKX 4V2XA 3T0BA 4H6QA 2CKRA 5EGRA 4G7EA 3QLLA 3UZJA 2WCAA 4GFSA 1UD4A 3EKGA 3LRKA 1JCJA 1HZYA 3CEUA 1UZHA 2WZEA 4MYXA 1MUCA 1S2TA 3U5YA 1JQVA 2PS2A 5BXSA 3ZVHA 1ITQA 1XGDA 4QRNA 2NLYA 1QO5A 2XIIA 4RDWA 4FB7A 3E0WA 2F6UA 4J3ZA 4NZ5A 5EY5A 5JIPA 5FEWA 2IKHA 3G1FA 4XAGA 2V67A 2F84A 1X98A 1UPMB 4C6NA 1FTXA 4D8LA 1IWBA 2ZC1A 1VENA 3RM8A 1NWTA 3LTPA 2WNNA 2DW7A 3ORWA 1YYAA 3HN3A 3APTA 3MCOA 2YA1A 5JH1A 3RF9A 3O1NA 4J40A 4KT2A 3DN5A 4ZQOA 4MPQA 9RUBA 1XGZA 2Z28A 3APYA 4UR8A 1UR2A 4TR9A 5HK4A 4MDOA 3G1SA 3KL0A 3GC5A 3U9IA 5I09A 4YHGA 1GQJA 3SUWA 3QBUA 4NJIA 4H9TA 2P53A 4AG0A 1A3HA 2EJ1A 1PIGA 2ABAA 4IPIA 4AVNA 1MZHA 4BQ2A 2V81A 2FHFA 5EMMA 1HP5A 1EDTA 3KHDA 3WNKA 4PMJA 3M4HA 3UJ2A 3CK5A 4I7WA 4H7VA 2PDYA 3II1A 3FGCA 4FOKA 4G7EB 4EPDC 1B3OA 3WL1A 3AIWA 5AHFA 2VFDA 3LSBA 1XQLA 3GXPA 3OLEA 5A69A 5L6UA 2NUYA 1XISA 1MW2A 1VB9A 3ZVHB 2PP0A 3KEHA 2CERA 3WJYA 4IHCA 2GUBA 3Q4DA 4MZ1A 3F2DA 4FALA 1SMAA 3O15A 3VABA 1US0A 2OPJA 1RBLA 1DWIM 1EQCA 3WIJA 4OQVA 5CAHA 4PH6A 4XQ6A 1THFD 3QTGA 4XAYA 1TELA 4J28A 1C91A 3E02A 3NZQA 3TKFA 1FWBC 5LXEA 5FOOA 4MMWA 1CENA 3S47A 4AY8A 1F6PA 3JZEA 4H9UA 2ZA1A 3LBCA 2A7NA 4BF5A 1XLDA 3G1YA 3N13A 3PVFA 4LAUA 4KRUA 1YDNA 1OFPA 3AROA 3JVAA 1TUFA 2XSAA 1RVKA 1KM4A 3SZ8A 4E4UA 4PBGA 4AXNA 4HGXA 1J0HA 1BLIA 3THCA 3FGCB 2XUCA 4MFDA 1KM5A 3OZMA 2H6RA 1WB0A 3EKZA 3WBEA 3KS6A 3W88A 1WOAA 4IICA 1OM0A 1NWRA 1D3GA 4F0RA 1XC4A 1I2OA 3QR1A 2NVAA 3C61A 3W7HA 2C14A 3VNLA 4I5RA 4DJED 1UD6A 5TAOA 3G2GA 4DNHA 3O6YX 4PCFA 2IPGA 2PTDA 1XIHA 3EX1A 3KOZA 4U5KA 3U8GA 1E4IA 2JK2A 3ITCA 1FKXA 4BI6A 3GXMA 1UASA 1V6UA 4PUJA 5BXTA 1G4EA 4MNMA 7TAAA 1SW0A 3W02A 2E9LA 3KLKA 4HIBA 1V08A 1OD0A 8XIAA 1DTUA 3E2SA 3ZR6A 3NDOA 3P3BA 4DEFA 1FH9A 1M41A 2FZDA 3NJ3A 1A49A 2E6FA 5I78A 4DJFC 3L4TA 4M7SA 1Q7MA 2G4FA 1Q6FA 3WLMA 4JKMA 3MSRA 3PWGA 1OIMA 4LUIA 1FWRA 2WW5A 1RY8A 2MANA 1QJWA 1TV8A 4AFYA 2RGLA 3N6QA 3KXQA 4KCUA 2BFGA 2W0UA 1UR8A 4UC5A 2WVUA 2OG9A 1GEHA 3P6LA 4LAOA 4PUNA 3VK5A 3VI2A 2ZRZA 1ICSA 4OFCA 5AVHA 1C3FA 2X7VA 3ZFHA 4J3TA 3QYQA 4ORMA 5CSRA 2VR4A 4Z0JA 2FTYA 1D8WA 1DKWA 4OKDA 5DN1A 1QNOA 3GXIA 2IXUA 5M5DA 3SR7A 2GPTA 1JRBA 1PHWA 2J7DA 4B15A 3LCXA 3VKCA 8RUCA 1GVFA 2VTFA 5H6HA 1MYRA 5I5RA 1V3IA 1B9ZA 5CCZA 3DX5A 3FVMA 2VMFA 3OBAA 4GC4A 3GZ3A 5I3HA 5E1QA 1X39A 4Q6XA 3HFTA 3I3BA 2VFHA 5FF3A 5JVLA 5IFTA 3BV4A 1FDZA 2PF0A 5I3JA 3LGEA 2GUUA 4A3YA 2NWSA 2J66A 1BRLA 4ZOCA 3VZZA 5HXMA 4FXFA 5XIMA 1GPWA 1E6SM 1KC7A 2GQ3A 4J5NA 5U7SA 3FHAA 2P3EA 1XFBA 1ECEA 4GYKA 1X1ZA 3D3AA 3H8AA 2PDGA 3G8RA 5F2MA 3AYVA 5HMDA 3H4WA 2IPJA 4IIDA 3UA4A 3LXCA 4C65A 4OBSA 4B2DA 3H22A 1TTIA 4G1NA 2NXHA 3BGGA 4Q4QA 1ICPA 5LSMA 1WZLA 3A13A 3VNYA 4EF9A 2NSOA 3B8VA 2ATMA 1CTNA 3AMGA 3CT2A 2X30A 1XXXA 1TRIA 4WOQA 1LYXA 1O5KA 1Q85A 2OO0A 4HKPA 3H24A 4LF1A 1ODZA 3AS0A 5C2CA 4NF7A 4HPJA 2ALDA 5K4ZA 3DESA 3VYLA 2FFCA 3UBPC 2OLHA 2YIHA 2EGZA 3PG8A 4UMAA 4LUSB 1NP2A 3C4UA 4WVXA 1NP0A 4WD0A 2WYSA 4HN8A 5H8PA 5CGMA 1SW3A 4BEUA 2G3NA 1EYEA 3E9AA 3OODA 3BWWA 4Q8WA 2AKMA 1F05A 2ACUA 1TJ2A 4CCCA 3T2PA 2DUZA 2XYLA 2ZRUA 1UKOA 3FA5A 3T55A 3IJ7A 5AOUA 2PGEA 3W0KA 3SADA 2QZRA 1S2WA 1L6SA 3TC7A 5T91A 5EMKA 4S3AA 1IZJA 4C6IA 3PM6A 4H7CA 3AISA 2CNCA 3RN6A 3VMPA 1K8YA 6XIAA 3BL3A 2OZ8A 3SRHA 1HKKA 3NDZA 4O0QA 3WQPA 2VRQA 3GHUA 4MZYA 4ZL1A 1BXCA 3WLSA 3RCMA 4W8LA 2TMDA 1QASA 2QDHA 4TVCA 3W7PA 2JEPA 3CHDA 2QMJA 3NQ8A 4OV4A 1EA9C 3W07A 3EOUA 3HJEA 4NZ3A 1DJZA 2WSRA 1NF7A 5CZTA 4R53A 2Y8VA 2PTYA 4N4QA 1C29A 2CLPA 1E55A 3FX4A 4XKMA 3TSBA 4KFPA 5C9WA 2XWEA 2HS8A 3N29A 2PGRA 3SQMA 4PUMA 1ADOA 1H41A 1GTHA 2PWDA 1J2BA 2XH2A 3T8QA 4GNVA 3P61A 1TRDA 5ABGA 1W9BM 1H4PA 2HK1A 5LIYX 1PX3A 5EL1A 5BCAA 3V0UA 3POCA 1G01A 3LCWA 2OEKA 3FSUA 3GX9A 1FP8A 4KH2A 2XFFA 1GW9A 2J75A 2WKGA 2QCFA 4O19A 3RO6A 4H6RA 3CH0A 1E3XA 4PSRA 3VIKA 3LQGA 3EPOA 5A6MA 1OFAA 3NM1A 3DU0A 4LY8A 4U10A 2Z29A 3WQWA 4M24A 2J8FA 1ZUAX 1HVXA 4I3GA 4YTQA 3UVAA 1BFNA 4GUJA 4JFWA 3MUAA 2ZUTA 3EXSA 3UW6A 2VX4A 4JTGA 3LEPA 3LLXA 2OSXA 3KBWA 2E1WA 3OVQA 3VIGA 1IEQA 1CWYA 2A21A 1V6WA 3IGXA 4BQ4A 3NQMA 4U33A 3GSMA 4E4FA 5KZEA 2I17A 3U6WA 1IYXA 3MMTA 5DMMA 4R7OA 3MDUA 2WJZA 3KRUA 4XUYA 4L9XA 4JQ4A 1SJAA 4B4FA 4J7RA 1F8IA 2J7GA 4B9ZA 3AS2A 1YNPA 2EPHA 3QOKA 3QC3A 5EPDA 3HGRA 4KCVA 1DQXA 2G41A 4F2TA 2V5CA 2D69A 1HO1A 1U5VA 3S1VA 1JZ5A 4HYVA 4RZ4A 5HNNA 1CXIA 4M1RA 2JIEA 5BYWA 3LA4A 4UQCA 5HPCA 1DHPA 5G2HA 5MHBA 4MGGA 3ATZA 1UIOA 2WSYA 4ZR8A 3GLCA 2VXNA 2WJDA 2WLZA 5CPTA 3ITTA 3T6CA 3LY0A 3W1MA 4JPGA 1A5NC 3WSUA 4TTUA 3VUPA 2VENA 3WQ6A 2VDHA 4QR6A 4GUHA 3HQ1A 3TU9A 1IT7A 5HMFA 2VM8A 2DFAA 4ZOBA 4WHBA 3PPCA 1GYMA 3W81A 1H1NA 4GY1A 4I9JA 2PTWA 4PMUA 4E2OA 2E9BA 2Z1WA 2Q6ZA 1XLCA 1R85A 1FFRA 5DO8A 2FB2A 1VAHA 1VQTA 2QCNA 4IMFA 5IRPA 4H7ZA 3R0UA 1EUAA 1GHSA 5CC5A 3DFYA 2WNZA 2BGNE 1E3ZA 4DIAA 4A8LA 2ABBA 3W73A 3VNMA 3A4WA 5H1WA 4MUPA 4UFMA 3PZMA 5LNSA 5G2WA 2CXGA 2G3FA 3RJYA 3ZWTA 4H6EA 5F4SA 1JD7A 3ITXA 6ALDA 1E56A 1K7XA 3NWRA 2E8ZA 4U3AA 2ZTKA 3VOIA 5I3GA 1PAMA 3AIRA 3CASA 5E5CA 3PTQA 3CAQA 3M6DA 2OSYA 3HGOA 3GTHA 4M6PA 3VGDA 2ZRWA 3TQPA 1J5TA 2AL2A 4K6AA 1QBAA 4LH8A 5I3KA 1ZGDA 1V0MA 1GONA 1H51A 3RLVA 4EAMA 1OGGA 2YLLA 1TPH1 5CBBA 1NDZA 1KTNA 2FJKA 2WWCA 1QI4A 5DMYA 2CESA 1H62A 3E2QA 3BJFA 3EX6A 4JFVA 3XIMA 2A4AA 2PLCA 2DUAA 4HZ8A 1LUCA 5A8OA 4GI4A 5K7JA 2QUTA 4I7VA 3GXTA 1LORA 1FH8A 1UQYA 1Q6LA 4HBKA 5C9XA 5AC8A 4LQ1A 1D8CA 3AIBA 1TTJA 2BNJA 2OSWA 2F7FA 4GIEA 1DWAM 4IQEA 1Q5MA 4J2MA 4J4KA 3FEMA 4PB5A 3MV01 5A2CA 3UJFA 3R11A 1TO3A 2J27A 4FIQA 4BEQA 1VFUA 1QR7A 2BXZA 4Q7IA 1PUDA 5E93A 5E0FA 5PTDA 3W23A 4A2SA 5EMYA 3HMCA 1AK5A 1IXQA 1GGOA 2PDPA 3B0PA 4KW2A 2PURA 1EP3A 4JYFA 3R12A 3FYPA 3C0SA 2CLIA 3EMZA 2FPVA 1ITCA 1FCBA 2XISA 2WVSA 4JQAA 4ZB2A 3G1RA 2FZBA 5J5RA 1IR2A 1QWGA 3S5YA 3P0WA 2A3CA 2W79A 1TUXA 4MY1A 3LPPA 1DXEA 1FDJA 2VC5A 1UC5A 3TJ4A 1EGZA 1EXPA 2PU0A 2NT0A 4J3VA 4JICA 3BTNA 2FJUB 4NXKA 2NV9A 2PDXA 1BSLA 5CPOA 1AJ0A 3BDKA 2X2YA 1WDSA 2JIWA 1LUCB 4GGBA 3U7BA 2WMIA 3TONA 1T41A 4JX6A 5IBXC 1W5PA 4ZSUA 5D9OA 3UG8A 5CSUA 1W5QA 1GJUA 1YPXA 2D2JA 3TFXA 2QCMA 3RCYA 4IJBA 4XO7A 3W83A 3B0XA 3QFWA 3JR2A 3MMWA 4M51A 4C6EA 3GDBA 2DORA 1RBOB 1H7XA 1KM1A 5JBEA 1TWZA 2BP1A 1VPXA 2PWGA 3WH6A 1H1YA 3KCLA 5C9UA 1W3KA 3TJLA 3TZFA 2H3DA 4CGTA 1PPIA 1JPKA 1X96A 3S5OA 3P74A 4Z1DA 5FD0A 4L6DA 3UXIA 3DH7A 1A3WA 1QAPA 3M64A 2GDVA 1GJWA 1UUMA 2OWXA 3IPWA 4N0RA 4ZXOA 3QV8A 2A7PA 4YWSA 1FWHC 4XSMA 1FWAC 2BHYA 1XQKA 5D37A 1R7OA 2W3ZA 3EX2A 3GNOA 3A3WA 3G18A 3MTWA 4GKTA 1PWMA 3DFSA 1H11A 1M1BA 3GTXA 5HATA 1OIFA 2XH4A 4P7OA 4EXQA 2AMXA 5DRIA 3A6OA 1OFDA 3HPZA 4XTDA 2REQA 3WK3A 2YL9A 3KRZA 3UETA 4XO6A 3CQIA 1K4GA 2B31A 2PLKA 1SJCA 2W62A 2J8GA 1A5BA 2WXDM 2WMIB 5DCEA 2QJHA 4U3CA 4M5PA 5A6KA 4XX6A 3SUTA 3NOEA 2HBVA 1GOIA 2XM2A 1XIBA 4RXGA 1C7SA 2Z1VA 4E0CA 2CETA 2XHYA 1BYAA 4IFOA 1OVDA 1JGIA 1SJBA 3QQ1A 4Q7NA 1LQ0A 1TCDA 5G1MA 2WHMA 3QHNA 3FN9A 1RCXB 2O55A 2WBKA 3HURA 3GFYA 4IIEA 3EMCA 1BYCA 1KWKA 1GORA 1V6VA 1OK4A 1O6IA 4CNPA 3GNRA 5AC6A 5LNRA 3BCDA 4K7VA 4UR7A 3UG5A 3ARYA 3WELA 3ARWA 3MP3A 2ZDRA 2TAAA 3WO8A 4J9JA 1KCKA 1KM6A 2XZ9A 1EKOA 3ALGA 3P67A 4CU7A 3CQJA 4AUBA 4K38A 3GHRA 3IRSA 4Q4OA 3RIKA 3K30A 3WD1A 3LK6A 3N6JA 4QE5A 3PZOA 1F3EA 3TLQA 1ZL1A 1BKSA 4AF0A 4A8NA 2GZXA 3DXIA 3BMXA 4GZEA 1BTCA 4UQ9A 4B5WA 3GR7A 4JDBA 4IISA 1CBGA 2VRJA 2FTPA 4UTWA 3U7VA 2LLEA 3KP0A 3UR2A 2DZXA 3OGVA 3IV3A 3WJXA 3GH5A 4JXCA 3SCSA 5H2ZA 4GGHA 1EQPA 1PEZA 1U1UA 3GH4A 3GVWA 1B3WA 3EPMA 2YPIA 3H26A 1TIWA 5CC6A 3AMCA 3ARQA 5LNUA 2O0TA 5JBFA 4W86A 4NL1A 3NQ7A 3NUKA 5EA9A 3CUGA 2CHOA 1LDCA 1OABA 5EMUA 4UTLA 3TP4A 2V38A 3W38A 4YTRA 1LROA 1OG0A 1WDQA 4D1IA 4IF2A 4PB4A 2VKZG 2J7FA 3GFXA 5BRPA 4K68A 1XDJA 1QDSA 4Q8NA 4YPJA 1NWSA 4E4PA 3LHYA 3O2LA 4D8ZA 1V4YA 2DSZA 2CLOA 4TMBA 3L4UA 2A1YA 3NVTA 3QR0A 1WKYA 3RILA 3O05A 1XYLA 4QDPA 3ARRA 3C2FA 2WZMA 4O4WA 5I77A 3A9IA 5TIMA 3N9RA 4LEFA 1JYXA 4GUGA 1J4EA 1VYRA 1W17A 4ZXLA 1RCQA 3ZLHA 5FAGA 4RX0A 4JQ3A 3GH7A 1OX6A 4PYSA 3BPWA 1W3TA 1NY1A 4WQ6A 3DC0A 2QMKA 4JIQA 2FQIA 1CGTA 3VIIA 4RUBA 2PP3A 5GJNA 1Q6OA 3LCHA 5TD4A 4AF0B 1PB0A 4AEOA 5C9ZA 1UIPA 2HXUA 2Q71A 3BOLA 3BZJA 3THUA 4U2ZA 3VKDA 1KO0A 1AW5A 3CTLA 1EOMA 4DHGA 1BXNA 4AYSA 2VDGA 4NUWA 2F38A 2NLIA 5BXPA 4BWLC 4INFA 1PKYA 1X6LA 2VZVA 1MEIA 3RPTA 1JCTA 3RFAA 3WLNA 3G1VA 2WC7A 1BVNP 3E5BA 1SFSA 5CZ0A 2DZTA 4TUFA 1Z41A 1LG2A 2P88A 1XR2A 4Y9PA 4CUCA 3NPVA 3VILA 3RLHA 1W56A 4WDUA 3O0FA 4NZFA 5AZ1A 1LJYA 3RNDA 3WQDA 2PD9A 1P0DA 2WMFA 3S46A 2XIMA 1SFLA 3OQ8A 3RJXA 3EB2A 4DBUA 2FDMA 4L6OA 3UPMA 1P0KA 1YBQA 1AQFA 3AZSA 3NL5A 1JRCA 1K6WA 4YYFA 1VIWA 3LLFA 5G1YA 4O1EA 5F2LA 4NAFA 1TPFA 2RAGA 2I16A 4REQA 3NGFA 1DWJM 3KTXA 5ENLA 5H8MA 3WUGA 4MKSA 1DP0A 4LYKA 4N9DA 4DYJA 2I9EA 4G5DA 4NSBA 2KAUC 3JS3A 4DB7A 3T4WA 1X1NA 4PTNA 3EMQA 1D2KA 2O9TA 1UZDA 1VFSA 3T2QA 1PX8A 3LMZA 2I5QA 5GNZA 3CPUA 1B9BA 2A6NA 3DBNA 5C8BB 1JCXA 3UXKA 5E0KA 4CD4A 2ZRXA 3H7UA 5DY2A 2CITA 2JBMA 4YN5A 5HWMA 3A5FA 3WNLA 4KRZA 4JZ5A 2E4TA 3M07A 3CZEA 4HB7A 4MB3A 2HSAA 2E77A 1KLZA 3OP2A 1QOXA 3AUOA 2FLIA 4DUWA 3WLHA 3MA8A 4JAWA 3MZNA 4ZGYA 1SO5A 4BS0A 3AS1A 4F79A 3DFPA 2YYUA 2PDNA 3ES7A 1QW9A 4QTGA 2O92A 4HPXA 4JTDA 3INPA 4JTUA 3FHQA 3NEVA 3WLJA 2OU4A 5REQB 3PTKA 4FOJA 4XBSA 5FF4A 2ATSA 3QR3A 1G7VA 1DL3A 2WWDA 2EG7A 1BVZA 5IOBA 2ZKMX 4M6QA 2Z1BA 2Q8LA 4GHRA 2DT0A 3AO0A 2SFPA 4MKVA 4OUEA 4EAYA 4ADUA 1W1B1 2D73A 5HJLA 3Q2DA 4F0KA 4REQB 4YMZA 5BWFA 3MYOA 3BG9A 1ZU8A 2QDDA 2ZE3A 3CM4A 3B40A 4C60A 3L4ZA 2NVDA 1FCVA 3UVIA 1F76A 3SEPA 4K1GA 1Q13A 1R6WA 3FVDA 1DJQA 4GQGA 2EPNA 3QYSA 4KWSA 2V3DA 3G0SA 1DJIA 1NFBA 3S2JA 3P84A 1ZAHA 3L23A 3K8KA 4G7FA 1GQIA 2XVGA 2WSPA 5FF2A 1GOQA 1GVRA 5FAJA 2R1KA 3W01A 1I2NA 3W85A 3QEZA 3K13A 3TN3A 3CB3A 1TE6A 2KZHA 1H0IA 4GJIA 4TV5A 1OX4A 5HBFA 4O0ZA 1B90A 3AFBA 3FNDA 4NI8A 5AYXA 1S5VA 3U57A 4FNPA 3QQWA 2OR2A 4Y9OA 4P8XA 3T1GA 4G9PA 1XUZA 1O66A 4Y90A 3NL6A 4EANA 4M29A 4R88A 4I7UA 5AC7A 3AC0A 4R27A 4H01A 3A47A 4BHYA 1QI3A 2NQ5A 1MXGA 3EYPA 4FHAA 1H1ZA 4HMNA 3CYJA 1UWSA 4FAMA 1BGAA 3PZUA 1WKEA 2CHRA 4GI8A 4O17A 1GZGA 4Y9NA 4GA8A 1TVPA 1YXDA 4XVDA 1O60A 3DKLA 1GOWA 4C6JA 1Q3NA 4HD5A 2QDEA 4IMEA 3JUGA 3CIWA 4WY0F 4MWAA 3BAWA 2HBXA 1I2RA 1XPYA 3NPWA 4Z2IA 2UY5A 1YMYA 4YU1A 3MC5A 3VKAA 4IGSA 4IPJA 2XFYA 3I7RA 1EC9A 1N8FA 2E09A 3W6LA 1QBBA 5FJIA 3RMJA 2DQWA 3POHA 1DORA 1FX6A 3RO8A 4PRRA 4UTIA 4LWWA 3BLEA 4W9TA 2UWFA 3MI2A 3CAKA 4AZ5A 1ZCOA 2OOFA 3E3HA 2A79A 2X2GA 3IUHA 3PK7A 1OX4B 5A2AA 1QK2A 2EHHA 4MJ2A 4PRTA 1JXJA 2HZGA 1TG7A 1E9IA 1GPFA 3NNTA 4UFJA 3NURA 4BQ5A 4IXXA 4DI9A 3IIZA 2DDXA 3ERPA 4AB4A 1BWLA 2QAPA 3KVMA 3B06A 3B8SA 4XZNX 3VCRA 1PIFA 3GKAA 4LJ3A 4GYFA 2E6YA 2ZYFA 3LS9A 5IHRA 4GABA 1S2CA 1JFHA 3A21A 3IVUA 4ILSA 1HW6A 1YKWA 1K9TA 2Y2WA 5DELA 2B7QA 2VWTA 3DOPA 4MWAB 1V02A 2CLKA 1B4KA 1HNYA 4CD6A 3PFRA 2XSBA 3ABSA 1FY6A 1BYDA 1FUYA 3N2BA 1E1FA 3GS6A 1PCWA 2BDQA 4Z0SA 5K2ZA 1B4EA 2J6XA 2FKPA 3MT1A 2V82A 1E0TA 3CUHA 4CQDA 3H2MA 4IP7A 4CKQA 2VZTA 3EB4A 5A8GA 1AG1O 5AZ0A 4GY0A 1KFCA 4YS1A 2WOQA 2CWXA 2ZUNA 3I6EA 3MHFA 1E5NA 4XD4A 2DZPA 3F4VA 1AH4A 3W2MA 1VYPX 3HF3A 1R3VA 3TNOA 1XM3A 1ISZA 1FRBA 3NFUA 3CL7A 4PUKA 3N12A 2DVXA 3WK1A 3V16A 4Z2GA 1BQCA 2V30A 1RXOB 4HA4A 4D2JA 3G1AA 3L5AA 3BW2A 1ALDA 2E1DA 1FWNA 3CYVA 1XDMA 4TX9A 5F2GA 3REQA 4DLMA 5C0QA 4M6VA 3EBVA 3AXHA 3QZEA 3M0JA 3RU6A 1ITUA 3DFTA 4X0VA 4C6BA 3SN4A 4O15A 1VBGA 2PDQA 3SIZA 1OYBA 2ESCA 3G1XA 3QGAC 1ADDA 2OT0A 3VKJA 4U5IA 4NX0A 3DYMA 2Z2AA 3N2MA 1Z69A 4PODA 3NSMA 1MI3A 1EHAA 3GR4A 1XRVA 9CGTA 4ERAA 2PLJA 3GVGA 1WBHA 1JVNA 3KHJA 4QG6A 4H9VA 4D8AA 2F2HA 1KFKA 1UR1A 4WXZA 3ZQ9A 1R38A 1SU5A 2G97A 5AVNA 2EG6A 4NNBA 4HZ7A 4ICNA 3EDJA 4IMDA 5CSSA 2QUVA 3PG9A 3EDEA 5AYIA 5FJOA 3GVVA 3BJSA 5K9CA 4U31A 1RALA 3LCFA 3VAVA 3FAWA 1KFWA 1RQEA 1C93A 4NAEA 2E68A 2PUZA 4XIMA 3IVTA 2Y61A 3SIMA 3KBVA 1HVQA 2P50A 1KGUA 3W84A 2X8RA 4CNTA 2VCBA 3WD3A 3REQB 4D6CA 3A64A 4ZO8A 2HVNA 3S2NA 4GVIA 5XINA 2EG8A 1SJDA 3AQUA 1OFBA 4L7ZA 3CS2A 2QGYA 2P3ZA 1JYVA 5FL1A 2QXWA 3B8DA 2A3AA 2AKZA 1IR1A 4LVFA 1KM3A 3W22A 4QEHA 4RPPA 4HPHA 3SY5A 4FNQA 4ZTYA 1BWKA 5LNVA 4PA8A 1M04A 5A2BA 4O4VA 1OC7A 3XISA 1RA5A 3HM7A 3VNDA 2CFFA 5C2XA 4V15A 5EMJA 2Y7GA 3PPHA 2DT3A 3KVKA 1UH3A 1UOZA 1TZZA 1WDPA 4D6GA 3LTSA 4H9YA 2PWVA 2CWNA 2JE8A 2QCDA 1H7OA 7ODCA 1PHQA 2OJPA 4QIUA 1W2PA 1W1A1 2Q8XA 2HS6A 3C2EA 2G3JA 3Q65A 1PDZA 5DMNA 5JUVA 4LEQA 4NAEB 4IH3A 3EOLA 4ZB5A 4BQ3A 5EB8A 3GTFA 4EE9A 2XINA 3GU1A 2Y7FA 3NPXA 5D09A 4DWSA 3LRMA 3KBMA 1UH2A 2D2OA 3ITLA 1O7AA 2FFIA 3AIUA 3IVSA 3W1UA 2BG5A 4JFTA 1C8VA 5KETA 2OOGA 3K4AA 1Q4WA 3WLPA 5I6SA 1MQRA 2PMQA 4YTUA 3DUGA 4FF5A 4A05A 3OIXA 1YNQA 3T0DA 4UZSA 5IHSA 5CQ1A 1Q8AA 3VIJA 3H21A 3N2TA 3LXBA 1AZ2A 2WNQA 3GDRA 4EXAA 4IGNA 3WK0A 2GGGA 4E5TA 1FDYA 1K77A 3TA9A 4JTAA 3CV2A 1Z3NA 2D3LA 4F8XA 3GD6A 3ABRA 4JTEA 3BLFA 1XDLA 1UR0A 1C8QA 5I24A 3VGGA 2BXYA 3BANA 4HA0A 1IXOA 4JTRA 3OPSA 4DAIA 1VHCA 4WXYA 1ONEA 2QCDB 4HP5A 4YVXA 1M7PA 3S0CA 1A5CA 4M81A 5BXRA 3VXGA 1QFEA 2HISA 4IMGA 2WNWA 1W3LA 3QOMA 3NQEA 2FTWA 4AISA 4D6EA 3CWOX 1NOUA 3W87A 4L4OA 4LFYA 2QJGA 3CZLA 1GYLA 5DFAA 2YLAA 2PSNA 4Q3MA 3SCPA 5JIWA 3UNTA 5D38A 4DWSB 1UOKA 1TMHA 1Z7AA 4JIRA 3NQBA 3B9DA 3TAKA 1EJSC 1U5HA 1CXLA 1TYGA 3P60A 3UXAA 3N3TA 3SCRA 4GUIA 4L80A 4GY7A 3TCEA 4JGDA 4HNVA 2D0HA 4NASA 2PBOA 3XINA 1X8CA 4O1DA 3TK7A 4H2CA 4K39A 2FB3A 1W1ZA 1JPHA 4D1JA 1I2QA 3BE7A 3HFYA 4U2YA 4JKLA 4CD7A 4JEQA 1BHGA 3N4EA 3VPLA 3I6TA 3E5PA 5H8UA 1A0EA 1KXTA 2AAMA 3GNNA 1R3TA 3MKVA 5I79A 4LTSA 2XM1A 3DHPA 3G5EA 2F6XA 5LGZA 2R6OA 1OT1A 1K8ZA 4QISA 1J0KA 1WZMA 3QY7A 2WMKA 3N2XA 4ZEPA 1GW1A 4A3RA 3W7IA 4B5UA 2QPXA 5A6BA 4FZIA 3M0VA 1CLVA 3N34A 4WJXA 5H91A 1JYNA 4GLEA 3B04A 4J1OA 4FMVA 4WY0A 2GUYA 3CMJA 4RNHA 3W7RA 2BGSA 5FJRA 4LBUA 2VYOA 3IWPA 4MUZA 4FOUA 2DIKA 1P7TA 4JIHA 5C7VA 1UR9A 3Q58A 3UJRA 2A7RA 3MUY1 5ABTA 4IPNB 3GQYA 3RR4A 3TTEA 3PSVA 3RX4A 5TBOA 3HPXA 1S2VA 3NVDA 3NXLA 1ZAIA 2AGKA 5LA0A 1E43A 1W1PA 4PMVA 2GGEA 4ES4A 2FYMA 1US3A 3UR5A 3ICJA 4ICCX 2QPSA 1E70M 3HPSA 4QCFA 3P14A 2Z27A 4EIVA 3WQ5A 1MVYA 6REQA 3W7NA 5K9XA 2QUUA 2AGTA 5DF0A 1A50A 4PC8A 3T44A 1S1PA 2FMOA 5AHEA 4WEVX 4EPKA 4DXVA 3SCTA 1WA3A 3SRKA 2OWWA 3K4WA 2I57A 3LHZA 2ZICA 3AUJA 3VNIA 1W37A 1FXPA 3AALA 4E2DA 1JD9A 1T99A 3NAVA 4UTUA 2XN0A 2IS7A 4PTVA 4DWSD 2GQ9A 3EOSA 4RZ6A 4WY0B 1P6BA 4A29A 4DUXA 5F1UA 2KX9A 1JUKA 3M47A 3VVGA 1MSSA 3K46A 3PWIA 4J3WA 1P7TB 1EFZA 2VRKA 1OYCA 2WVTA 4P7LA 4OZOA 1BPLB 1FWFC 4A2RA 1HKVA 1TA3A 1EH9A 3W3OA 1GVIA 4S3GA 1DWGM 4QXIA 1NF0A 4LUTB 4WR3A 1EO5A 3OLDA 3PR2A 4CCZA 5HAOA 1XLMA 3IJIA 2ACSA 1EIXA 3GHSA 2Z7GA 3PZQA 4NYYA 3LQLA 1OB0A 4HSOA 2CLLA 2UY2A 5HQEA 2OX4A 4BA0A 3WDPP 2WVVA 2VI0A 1N55A 3QQ0A 4M3PA 1RPKA 3FW6A 1XSIA 6REQB 3PTMA 5KZDA 5HWNA 1K9FA 3T08A 3GHTA 2QULA 2UZ9A 5BRBA 3QKEA 4XK2A 3GVRA 4DQWA 4CQBA 4GYPC 1AJ2A 2QUMA 1JAEA 3WF0A 1U2YA 1A80A 5BNKA 3DGRA 3B0VC 1KBLA 2YDAA 4BF7A 3VD4A 4H8HA 2I14A 2DZUA 2IQ0A 3LPFA 4FSAA 1OF8A 1V7AA 3V5CA 3CO8A 2Q02A 1H60A 3FSTA 4LW7A 3K1GA 2C71A 5D05A 3PULA 3UGRA 1GVEA 4UTTA 3GYCA 3BW4A 2Y8UA 4LNYA 1TKKA 3GKFA 3AI0A 1F3TA 1TA3B 2ANUA 2CXEA 2FIQA 2QAFA 2EPKX 3MU7A 3B4YA 3NO1A 1J11A 1E6QM 4AEFA 4F9JA 4JTHA 3W00A 4C6LA 3EEZA 2WHJA 3UZZA 1YDVA 4FXJA 4B16A 2ISVA 1JFXA 4HNCA 4F3HA 2YDRA 3LBOA 3OU8A 1KM0A 4C5ZA 1S39A 3SGUA 3GXNA 3BUVA 1OD8A 4MAZA 2VR2A 5BU6A 1FHUA 1V0KA 4DN1A 3W7MA 1KFLA 5CSYA 1L8PA 1TV7A 2DPEA 2WVVB 4PEEA 3W7EA 4BR1A 3LTYA 3OLGA 5I3FA 4PFHA 4ZO6A 3MB9A 4UNKA 3ARSA 3TN4A 4E3TA 1P0EA 1XKYA 2ODOA 2BTMA 4PUDA 2O7QA 5FA5A 3FLUA 3BSGA 4H04A 1FWTA 1TJ0A 2BWGA 3SBFA 2CLMA 3IAQA 4CU8A 5KTLA 1A5LC 3ZT6A 2R8WA 1HJSA 1SM9A 4LCRA 4UQBA 1FHVA 4PN2A 3ALFA 3MKCA 1TV4A 3MSDA 1JZ7A 2CBVA 4KERA 1R2RA 1XLHA 2RFGA 1ZNNA 1DIKA 3S8HA 4V27A 4FK9A 1K7FA 1JJKA 1QCWA 3DAQA 2CW6A 1B5TA 5HOSA 4N7QA 4PFMA 1M9HA 3EDDA 1R2TA 1T96A 4PBEA 4I5XA 1LWHA 1XINA 3UG3A 5HR7A 1ISXA 2R91A 5BU9A 3CUXA 3WL0A 2ZOXA 3N14A 3WBXA 5IM51 1BQGA 4TXEA 5IXEA 3KBJA 1J96A 2ZDSA 1QHOA 4KKXA 4B9YA 1H3GA 3H54A 2GJNA 4GCXA 1HTIA 2YXGA 2Z2BA 4HJFA 3TTOA 4IGHA 5A8QA 2EXOA 4NP7A 5AC4A 3W7QA 2J79A 4CLMA 1WUFA 2BV9A 2C0AA 1ITXA 4GBDA 1UH4A 3U3HA 2ZBTA 2PB1A 4C6OA 1FCUA 3FJLA 1RJQA 3HPAA 1YTEA 2FZNA 3RITA 2DT1A 3PY2A 1DE6A 3C2OA 3KVJA 4YLWA 3PHAA 2UY3A 1ZJBA 2CLFA 2JKEA 3UJSA 3AIEA 5CLTA 3A22A 1P48A 3RHGA 1W5OA 1UD8A 3GWQA 1FCQA 3IANA 2DVUA 3VD9A 1A47A 3SUVA 5E9XA 1KXHA 1MFVA 3L7RA 4CQ8A 1XCXA 3SSZA 3KX6A 1TREA 3UPWA 1Q2RA 1WX0A 3GG0A 3WMLA 3UU0A 3NM3A 3L5LA 4LBRA 4NT0A 1FHDA 2OELA 4L5ZA 3KS5A 4AD1A 1FWDC 1A5KC 1S2UA 1V3MA 1PE1A 5KEZA 4N6EA 3G6MA 2QCHA 3H53A 5E09A 2OZTA 4HK6A 5D30A 3IEBA 4DF1A 1B3ZA 4DYEA 4JEJA 2QIIA 2J9ZA 4F40A 4LT9A 4O10A 4Z08A 4DF2A 4C1LA 5D2XA 3MSGA 4HSNA 4ZFMA 1E6XM 4UOZA 3BOXA 3MVIA 2DZBA 4F0HA 5LIXX 1XRTA 1UKPA 1KW1A 4RLIA 4ICMA 3S1XA 1EUNA 4W5ZA 1UWQA 4HPGA 2C16A 3NGJA 2O56A 4JTKA 1LP6A 4Q32A 3OGRA 3S83A 1JPIA 3GNDA 1TZ9A 3EA3A 1W1TA 2C79A 3QM3A 5D9MA 2IQTA 2WQDA 3FYYA 5FL0A 4O11A 1G9HA 3TXZA 1GHRA 5CEWA 3DFQA 5F4XA 2X09A 4P7NA 2Z7KA 3CIXA 4X2RA 4X0NA 1DJXA 1ME7A 4MIMA 4R34A 1Y7VA 2PBGA 3W2UA 5DT7A 3UF9A 4H9ZA 3FY1A 1JGMA 4Y8EA 4KETA 4M8UA 3BSHA 4K36A 5AECA 3E0IA 4XAZA 1SZNA 3LLDA 3EWUA 5D2YA 3ZZ1A 1J2WA 4IL0A 3MYPA 3EAUA 4R9OA 6A3HA 2PDKA 3NQ2A 4IQLA 1QHPA 3T05A 2W66A 4Q8OA 2EF9A 3NQVA 3W76A 2DIEA 1T8XA 4O57A 2FZ9A 1J0JA 4C6FA 3YPIA 4GK8A 3FJ6A 3TQVA 3IIPA 2V3EA 3QW3A 4UUIA 1P6CA 5LIUX 2I1OA 4AIEA 3S1UA 4LV4A 4MSSA 1H63A 5CGTA 4OT7A 2J24A 4A8RA 2D23A 2WMJA 4EPBC 3TVAA 4PL2A 4FPSA 3A12A 1UQZA 3I4EA 4FA3A 5JH2A 3TR9A 4UNLA 5FJTA 1SR0A 2GJXA 1VZWA 4G56A 5FF0A 3HTWA 4MKNA 3AXKA 5HR6A 2NQJA 2RUSA 2QS8A 1SO4A 1M7JA 2BS9A 3O07A 2E28A 2R1PA 2Y8KA 3W24A 4Z1AA 5I3IA 3UR7A 1W9DM 3AXIA 3LI1A 2H3BA 4XVEA 2QJJA 3UCDA 4XZIA 3U4AA 1RY0A 3R6IA 4AHOA 1ZY9A 4ZQRA 1OADA 4V1YA 1JDAA 4JX5A 1HKJA 3L4WA 1Y65A 2RDXA 2QV5A 3T40A 1PCKA 4IQDA 2XDFA 3WEMA 2Z24A 4MTVA 3OEXA 4NJKA 1CEOA 3F2BA 2IW0A 2R1LA 4OWGA 4UOQA 1WV2A 3KZSA 5XIAA 3EX3A 2QGHA 4Q8QA 3TN6A 1N8WA 4Z1CA 5AB3A 1JNEA 5CC3A 1ZQ5A 2OGYA 4QROA 1SZEA 5DXYA 3H2AA 3H7VA 3FDKA 1E9LA 5LIWX 2J7CA 1VBHA 1LG1A 4PBFA 1ICQA 4HHHA 4LXFA 2X42A 2W92A 3BG5A 1VHNA 1XFCA 1NM9A 4B5VA 1TB3A 4ZENA 1H2JA 2V5KA 5DY3A 1XIGA 4DO5A 4LAZA 3CV7A 3W4RA 1FHLA 5I00A 3TC6A 2NQZA 1YTDA 2UY4A 2QVNA 2ISSA 3KBSA 1RD6A 2C6QA 2ZTJA 2DSVA 3C0LA 2JALA 5GNXA 3W26A 2ZUSA 2FHBA 3R58A 4NQ1A 1J10A 2GJXB 4AD3A 4WOZA 5LZLA 3VD5A 4YVVA 2QNEA 3AHVA 4LNCA 3QF0A 4EPEC 3E2VA 3SCVA 1DEDA 4K7YA 3I7SA 4YNGA 1X7IA 1VCGA 2G96A 3VDGA 4ZBCA 1EZWA 4LBSA 4S3JA 2YFNA 3AICA 4G1KA 4Y9AA 3UR8A 1HKWA 1QPNA 2Q01A 2Y63A 2A2IA 3CMFA 4FI4A 4DO7A 2A5HA 1KM2A 4QLJA 3CBWA 2G0WA 4CVWA 3PZ9A 4B3KA 3ZSSA 4CN4A 1SSDA 1NVMA 2B81A 5HINA 1HN1A 2J88A 1Q63A 1D9EA 3NR0A 3VC5A 4JFSA 2OCZA 5I0DA 2XWDA 4GX8A 3APGA 2FDSA 1S2AA 1L6FA 2CLHA 3VIFA 1V3JA 4OGZA 1BSIA 3AU6A 1TPC1 3PUEA 3TROA 1I1XA 1TWSA 1I0BA 3N4AA 3DI0A 4AC7C 1PTDA 3M5XA 3IARA 1PJ9A 3MP5A 5D8ZA 3QMSA 3SY1A 3H2OA 9XIAA 2YBVA 4JQ2A 4ONVA 4UTJA 5F7UA 2BY1A 4LF2A 1OEPA 2PWEA 5CPQA 1BTMA 3ISIX 4D6HA 4CN6A 2YXOA 1UP2A 4OIFA 4OOZA 3V18A 1AVAA 2J4GA 2C19A 1Z44A 3B03A 3V7PA 1MDRA 4DZAA 2WPBA 1UP0A 4QJ3B 4R85A 1GOXA 1OFOA 4B3LA 1OK6A 1KQZA 5I3DA 3NDYA 2ZA2A 3VNKA 2V2HA 2GVGA 4GC3A 5FESA 3CWNA 1T7LA 3PJTA 2OX1A 1W8GA 2V8ZA 2BHUA 2NV2A 1LRQA 2PAJA 4PEKA 4W7VA 4OHQA 4C7DA 1C92A 4HPNA 3TNBA 2WPGA 2IKJA 3G0UA 3EWZA 1J93A 2OODA 1G1YA 4FP1A 3MUIA 1U5JA 1EF3A 4HJWA 3PAOA 4A22A 4FNRA 3S1GA 2BZNA 3LCGA 2TSYA 1OT2A 5LIKX 4HU4A 4V33A 1XIEA 2V5LA 3WDJA 4HMEA 4WLCA 1K9EA 1MEWA 1XW8A 1GT8A 1X6NA 3T0TA 2D2HA 1E0WA 1W3IA 1NJJA 1ONXA 4CNSA 5KMYA 2YYTA 1OBAA 4Z2JA 1IXPA 3L21A 2PC4A 1AL7A 4W85A 1WZAA 2QHAA 3KLLA 3WNOA 1W3NA 3A4XA 3FK4A 4FX7A 2FGLA 4WDTA 4Y2WA 4FR6A 2DGAA 4J3SA 1UMLA 3W1NA 4C6KA 1K03A 1GKQA 4OJYA 5FJUA 4H19A 4DELA 4Q33A 1GKRA 2OT1A 1EOKA 1OY0A 2XGBA 1B3YA 2Y62A 3F1QA 2WANA 1X8FA 4RK8A 3T07A 1AL8A 3PBGA 2QJMA 3A3XA 3VDCA 1SUXA 5DQPA 1TCMA 3JRKA 1JDFA 2Y89A 4PTWA 4NJJA 4YWIA 1PL9A 4PUWA 5JXQA 3I4KA 4L61A 5LKYA 3WDIA 3IJLA 3DFNA 4A4AA 2DZAA 5TQLA 4MB4A 1KV5A 4GH1A 5C7HA 3BG3A 3URAA 4JTCA 1MQPA 1XKJA 8TIMA 1REQA 3TIMA 1A5MC 1MUMA 2GSHA 2BX7A 3THAA 1UWRA 4Z42C 1J0ZA 4DZ5A 4GWEA 2E67A 1WBJA 1D3CA 3IIOA 2QW5A 5I07A 3WQGA 1XH1A 1WP6A 2GK1A 4AIBA 4UBPC 4RJEA 3OG2A 4QDMA 4PSPA 1OCNA 2PDJA 3CT7A 1RP9A 2WZIA 3ZMRA 1PIIA 1S3HA 1VEPA 2ZX7A 2FMNA 4LAKA 1K8XA 4LUSA 3EWYA 4M19A 4XZ9A 1PYFA 3WDHA 4NYUA 3E38A 3M0IA 4LUJA 3RPDA 2J7HA 4L4PA 1V93A 2C18A 3I3EA 3SURA 1XBXA 4QCEA 3S9YA 1HO4A 3LYEA 1XG4A 2DP3A 3NCOA 1XRFA 3RGTA 2AL1A 1UB3A 1L6YA 2JKPA 2DJXA 3M0LA 2VFFA 3SSJA 2QQ6A 1EC7A 1GUVA 4RKAA 1J8VA 1Q6QA 4A6GA 4ZQPA 4YCOA 3MVTA 4O14A 4MY9A 2RDUA 4YIWA 2P1FA 3T0AA 1M65A 2BOFX 2ZX5A 5FSEC 4KWWA 1NDYA 3CZKA 1W3JA 3N04A 1QPOA 3URNA 1F3WA 1V77A 7PTDA 3AHTA 4I6VA 4AZCB 3DI1A 1REQB 1CIUA 1VFFA 1EX5A 4KESA 2HNEA 2HQAA 2OLSA 1DQUA 3L4YA 2DIJA 4H4IA 5A5WA 3LM3A 2H90A 5I03A 4QNWA 2WHKA 4UFKA 3GRIA 2D1ZA 3S3GA 1VGAA 2GK1B 1V3HA 4HQVA 1UR3M 4PTMA 1ODUA 3TYEA 2YBTA 3CPGA 1EJTC 2PZNA 1W54A 2HRWA 3HOJA 1KFBA 4ZOAA 4W5UA 4AD2A 1MW1A 4NHVA 4XG1A 4NILA 3DG7A 4ACZA 1ELSA 2ZUUA 1OQFA 2XN2A 2XVKA 3F7JA 1KRBC 1J0IA 4G6CA 2GVEA 4DYKA 2VFIA 1T40A 1VR6A 2C7FA 3ARZA 4TVDA 3P7YA 1SZFA 1AD1A 3F4DA 5A6AA 2P10A 4D6JA 2WZTA 4B5SA 4KMQA 5A6SA 3PP7A 2QCCA 3SI9A 3QY6A 5K9DA 2JFEX 4AQLA 5HJYA 3KTSA 4XZLX 3WQFA 4M82A 3WFLA 4CCEA 1RUSA 4PGLA 4F4RA 1K6AA 3OG3A 1H5YA 3ANUA 4PMDA 1CZ1A 1NU5A 1SZRA 1NOWA 4S39A 1TVLA 4IIGA 3MSYA 5F4WA 2TODA 1PBGA 4JTJA 3KP1A 4GNKB 3TR2A 3NQCA 3DFOA 4JY9A 3KZPA 5HUOA 3VIPA 4QSHA 3GUWA 2P0IA 3HZ3A 1EBGA 3PNZA 1XF0A 2RDTA 3QSRA 4GACA 3IJDA 3AYRA 4C5YA 1H61A 1RQHA 3URBA 4EVZA 1YXYA 3DERA 1AODA 1ZP3A 2CKSA 1ZJHA 3CHCA 2OEJA 2ONEA 1UZ4A 4TMCA 2ACQA 1GEQA 1Q6CA 2IXVA 2Y70A 4ACZB 1I60A 2ACRA 1XD0A 4KWOA 4UMCA 3E6EA 2EKCA 1GK8A 3UA3A 4E2VA 1XYMA 4MWAE 2X0HA 3W71A 3ZLFA 3BLOA 3N1AA 3RM4A 1QUMA 2A0NA 1EX1A 2PDCA 3UWWA 1Q6RA 2W6RA 5TNVA 3TYBA 3P82A 4JQ1A 5EBUA 1WKDA 2PDFA 4ZQMA 3WQOA 3QGVA 6ENLA 1ZCCA 5HULA 2X0YA 1YIXA 2HVOA 2ZADA 5HNUA 5BW6A 1XBZA 3LBMA 3B3DA 3HGJA 1KCXA 4FEZA 1UD3A 1ISYA 2PF8A 3V3WA 2UBPC 3CUIA 3O6CA 3NSNA 2QCLA 4ZO7A 3WLRA 1PKLA 2QYGA 8XIMA 2O9PA 3KM8A 3MQTA 4UTWC 4ALDA 1JYWA 1PWLA 3LOTA 5FJJA 1QW8A 3TEVA 1TV5A 2BHZA 4A3QA 1ZBVA 3L68A 1W31A 3MBDA 4B92A 1L6GA 1R86A 1XP3A 4F66A 4IM4A 1TJRA 3BOFA 3WD2A 2NUXA 1P0NA 5BZAA 1WNOA 3CZJA 5L9FA 3DGBA 3AU2A 3NQGA 1K4HA 4GISA 3SFWA 4KIRA 5MKGA 3G77A 3HQOA 3AIQA 1EHNA 2VEMA 1V02E 2CZEA 4HCLA 3HBLA 1ZB5A 1LT7A 1M5WA 3PF3A 2I5IA 1QI2A 1R3RA 3UERA 1V6TA 1VC4A 2O9RA 3WN6A 4B2DD 4QITA 1S5MA 2JF7A 3PBUA 4EXBA 1H0GA 2OVLA 4NZ1A 4EF8A 2X7WA 3UXLA 5AYYA 4TX6A 1L2QA 3GW3A 3OHIA 4NRSA 2XSXA 1VLWA 1LQAA 2G4JA 2YL6A 3HV9A 1VFOA 3F5LA 1S38A 4WJ8A 2WCGA 4DM1A 2QV4A 1TPEA 2CU0A 3O6DA 1I2PA 3DIPA 3A5VA 4CNNA 2J7EA 1SPQA 4DXKA 3W1TA 1EXBA 3OVGA 2B0MA 5HDRA 3U2EA 2BLEA 2VVNA 4Q6JA 3H7RA 4DUOA 3MDWA 3I3DA 4XUGA 4W8BA 3BLDA 5ECUA 3RR1A 4RPQA 1CX9A 1XBYA 5AHIA 5E70A 3SRFA 3STCA 1GVSA 1R2SA 3LMYA 3IS4A 1TE1A 1EDQA 1HJVA 2OZ3A 3C86A 1JUEA 1HP4A 3T81A 5G4EA 4CQAA 1E51A 1W9VA 4D9PA 2XVNA 3AZRA 3WH7A 3H6OA 2YZRA 1XH2A 3E0FA 4GBUA 4LYRA 5MKGB 4W4QA 1WKFA 3S1WA 4AX7A 1VBJA 1DVJA 4LSBA 2POZA 4KFOA 4KCTA 1G5AA 1U83A 3KOXA 2F9RA 1AFSA 4S3DA 4AZHA 1XICA 1L6WA 1XIJA 5C71A 3WEOA 2RKXA 3WQVA 1DYSA 3EA2A 4LVBA 2V68A 1RJRA 3FCPA 2WC4A 4FF7A 4W84A 3ARVA 3IGUA 2F2KA 5LHFA 3EEGA 1EJWC 3EWXA 3TUUA 3NZPA 1BAGA 3TV8A 1VBUA 4PMNA 3SJ3A 3UD6A 1M01A 4JL1A 1HL8A 5CJMA 1VJSA 4LY4A 1DTNA 3VINA 1VFHA 4E8GA 3USZA 1E4NA 2VEPA 3H2EA 4JTTA 3VKKA 3TSDA 1N2VA 2YJQA 1Q65A 1I9CB 6CGTA 5G5IA 2YKKA 3CV1A 4FLQA 3QMRA 3ARUA 3FA4A 2D20A 1X97A 4XBKA 2XJ7A 1OWQA 3M43A 1CGXA 1K9DA 1TPDA 3ARPA 1JNDA 2BOGX 2VEFA 4QDWA 5CPLA 1F73A 3LGDA 4US5A 1SYTA 1G4PA 1TR9A 4R5EA 1QOPA 5U4NA 4AC1X 5CLWA 3C5QA 4GPNA 1L8NA 3CZGA 3OA3A 3KVLA 3UESA 3NXFA 5JBDA 1NQKA 5I7GA 1I0DA 2JKAA 3LHTA 4AHQA 1KBKA 3F4WA 4FLRA 3VOFA 7REQB 2UV8G 3OJGA 4OBRA 3UZXA 1RLCL 5EFDA 5JU6A 3WBWA 1I4NA 3WEZA 1C7TA 4PCSA 4JY8A 1NOFA 1B31A 3CO4A 1E6PA 1MO0A 4J3UA 1R47A 3B4UA 1D3HA 1MWOA 4Y7EA 1RHCA 5AHMA 2OWCA 1C90A 1Y5XA 3CQKA 2ZZ3A 2HDJA 1QPKA 3LD5A 4PMQA 2D3NA 1YLVA 2NV1A 4DVOA 3MWCA 2J6VA 4ORIA 1U30A 4GJ1A 3TW6A 5K3VA 3W7JA 3GYEA 2BBFA 1WQ5A 1JI1A 3OO2A 1ZBKA 3STGA 3VD3A 2J25A 2HNHA 2GQAA 3TQ0A 4QJ5B 4ASTA 4LCQA 4E2BA 5I06A 3NTYA 4GG9A 3WYZA 3W70A 3UZYA 3ZS4A 2ZXBA 1IHIA 1CECA 2Y7EA 1FBAA 5G4WA 3P81A 3IJQA 4PRWA 2J47A 2OO6A 1XLAA 3TCSA 1QNPA 3BLLA 4ZQNA 3OBKA 3P80A 1JCLA 3SUUA 1R0MA 3C0JA 1LTDA 3URQA 2TRSA 3RAOA 1LRTA 3U48A 2EBNA 4DWDA 2VX5A 1KTBA 2XH7A 3E0LA 2E6DA 1C8XA 4DRSA 1FWGC 2XIJA 2RJGA 3SGGA 4IG2B 4ZVJA 2XPKA 4FS9A 4HA1A 3VM7A 1JZ3A 4DJDA 1JCYA 4MWAC 1XLGA 4CEUC 1PYMA 2G3MA 1KKRA 4W7UA 1ZFJA 2VELA 3FEQA 3TYDA 1PZ0A 3L2MA 2FVKA 3RU8X 2PE4A 2PRLA 1HL9A 4Q4PA 1NQ6A 2DEPA 2YB1A 4DJEA 3ZJ7A 2X1SA 5BOFA 2V3FA 1LT8A 1TMLA 1FOBA 4CNOA 2C1HA 3O0KA 4MG4A 1IZCA 1V6XA 4L4MA 5GQBA 3IK2A 1QHZA 1HG3A 4LU0A 2Z6JA 1LBMA 1RZMA 3OHMB 2Z6IA 5ABHA 1DPMA 2J7BA 3GK0A 3L5MA 5CH9A 2AMGA 2ON3A 3GAKA 1WPCA 1BYBA 1SFJA 2J9YA 4WGXA 2E5DA 4DNMA 1ECQA 3DHUA 1LBLA 4L65A 5M17A 3RPMA 3CEPA 4UNIA 1HGYA 5B7ZA 2DSUA 4BF9A 1OC5A 2VGIA 2GOUA 2X1TA 2NX3A 4JTSA 1GVOA 2YW3A 1Q2SA 2E0PA 5DXXA 1TPWA 3IACA 4Q8VA 3WQ4A 5C5YA 3PUDA 1S46A 1ZP4A 3OB8A 3VGBA 3KCJA 1CT5A 1UC4A 1V79A 3VE7A 4US5D 4B91A 2DSKA 4WCJA 2WK2A 4LRSA 2D0GA 1LRNA 3UWZA 2GJPA 3WMBA 4K1WA 3SCUA 1HF6A 2YL5A 2WAGA 2BVDA 1A5SA 4MADA 2X16A 1QMLA 1O1HA 4BY3A 3B8UA 2VEIA 4N9EA 2EEXA 2VEKA 3BQ5A 4O8AA 5CPMA 2GGJA 4C7GA 5HMSA 4M80A 4C6MA 3DZ1A 3QLDA 4K8HA 1LM1A 4LB4A 1Y5VA 4AMCA 2VHLA 4KWVA 1IF2A 4WF7A 2W91A 1O95A 2IPFA 3PJXA 1CXEA 3ZXWA 3CWHA 4FX8A 3HJZA 3FKRA 2XGZA 1DXIA 1GG0A 2P8BA 3SN1A 3MPGA 3PUGA 3LENA 2WJFA 1XLLA 3PWAA 1AQMA 3QV7A 2I5GA 4L6HA 3CMGA 1XLEA 1ZPTA 1J6OA 1QRQA 1RVGA 3R89A 3O9NA 2V0TA 1PZ3A 1AMYA 4K2SA 3S2MA 4XD5A 3LSCA 4W93A 1J01A 3VMOA 3GDLA 1IZKA 1VF8A 3O6AA 4ZFCA 3U2OA 4S3CA 1RA0A 4HMCA 1R8LA 3AS3A 2ZA3A 3WK2A 4AIUA 2IQDA 3THQA 1TQJA 4KEVA 3SO7A 4DBDA 1JPMA 3KOWA 2HV5A 1X1OA 5T9BG 1PS9A 1IEIA 3PUOA 3GUGA 1TFVA 1IGWA 3WMSA 3J7HA 4R7JA 4BJHA 1KCZA 1DXFA 1NSJA 4O1BA 1XYBA 5REQA 1F2JA 3DENA 3IJ8A 3WBAA 1TVNA 3LZ5A 4O12A 3WDQA 4TX8A 1XIIA 1SSGA 2PGFA 3HU7A 4IJCA 2ZZ6A 1TMQA 5HMEA 1ML1A 4S2BA 4KPLA 4UTHA 2YSWA 3HGSA 3BJTA 1UJPA 3OLIA 3NQ6A 4RE2A 3K2GA 4Q4MA 3VU2A 5GNYA 4DJDD 2IMRA 3GTNA 4OVXA 2E40A 1UKTA 3LHUA 3F2CA 1GKPA 5FCZA 2PDUA 3OVRA 2CLEA 3AXXA 1RJPA 3EX4A 4NNAA 4JOMA 4GQ0A 3OOQA 1JQXA 1BEUA 3WX7A 4UXDA 4WGHA 1YPIA 1I6NA 3WMCA 3LM7A 3QZ6A 3H55A 2FH6A 4J35A 4YXGA 3N17A 2CC0A 2PDMA 2OB3A 5CBJA 1T0OA 5HNTA 4CNUA 3MI3A 1BWVA 3Q37A 1NELA 3N6HA 3NIYA 4YYCA 2V63A 1V3LA 3BLIA 5D33A 1AA1B 1O1ZA 4Q22A 1J9YA 2ZXAA 4AXKA 5CBIA 4QX4A 4D6DA 3TQKA 3OQEA 3H12A 4XBJA 5CC7A 3M0ZA 3HG5A 3CC1A 2J9XA 2B4GA 4JTFA 2VNCA 3C52A 2ZRYA 1HX0A 4JKKA 1F6KA 4ECLA 2PWUA 3ARTA 4QE1A 4MB1A 4TU1A 1UKSA 1E6ZA 4CEXC 4N2YA 3CQ0A 3MV11 5AYBA 3LRLA 3FDGA 1EWEA 4LV9A 3RXZA 3G3MA 3MO7A 2PA6A 1BXBA 4LPCA 3UWYA 3WLOA 2PCEA 2YW4A 3L0GA 4C1NA 3R10A 2HE5A 3QV9A 3S6TA 1DJHA 4O0KA 4X60A 3BZGA 4XZWA 1L2UA 3AWOA 3SECA 3TYAA 1TJ1A 2E6AA 1ZALA 4EK7A 2X0SA 3CHVA 3P5YA 1PVNA 2D22A 2HWGA 3FV9A 3W25A 3M9YA 3ZR4A 3C3UA 2VCCA 1QXLA 1IT8A 2G50A 4FNSA 3F03K 3GG7A 4DWSC 3Q94A 1VH7A 1FXQA 4ERGA 3M7SA 2RGMA 1G94A 3E2RA 1SW7A 5CPNA 3W2JA 1Y8BA 3ZT7A 1FWCC 1NAL1 1LQ2A 3NA8A 3TYUA 3SCOA 3BVJA 4J27A 1XYCA 2GSJA 4XIAA 2PODA 1FP9A 4Q8PA 2AOSA 1C9WA 5DCBA 2XVLA 4MZ8A 2NXGA 1B54A 1VYSX 3D5HA 2VFGA 6PTDA 3BCJA 3GE7A 4S3FA 3T8LA 5KSWA 3CPRA 4MVAA 3GIPA 3VCCA 5ABFA 1HKIA 1KNWA 2WZHA 1PO9A 2VUNA 4K8EA 3ABZA 3C3NA 4MYAA 4HTBA 5IDIA 3TWAA 4YCPA 2JEQA 1N82A 1YE6A 2PWFA 2Q09A 2QF7A 1AQHA 5AFDA 4C1NB 4GOAA 3IJ6A 5HQMA 1S5WA 1SO6A 1FWIC 2TPSA 1NH6A 1E72M 3SB0A 2Y5JA 3P2VA 4S2CA 4GVHA 2F6KA 2NSXA 4US6A 4B5NA 3E1F1 3W9ZA 1EPVA 2E9MA 3ZJKA 5BMXA 1OFEA 4Y9MA 1R3WA 2BVYA 2VD8A 1U22A 3I65A 1CNVA 2O9OA 4Z2HA 1CXFA 2CIPA 5G4HC 3KRSA 1U1JA 4FXSA 5T9CE 1UD5A 3HV8A 1Z6KA 5SWUA 1F4AA 5DLCA 2GLKA 1KA9F 1N7KA 4IMAA 3HO8A 3WF2A 3TMLA 4GIYA 1HKMA 1SFTA 4PTDA 3L0NA 1F6YA 2XTKA 4OTKA 3G6LA 1E15A 2C3ZA 4X63A 3RDKA 3BGAA 1VRXA 1MRQA 1G69A 1YRRA 4KQNA 1W6TA 3KAOA 2MNRA 3R25A 5D9PA 1OG6A 4F0LA 4IMCA 1BRLB 2FH8A 4ROPA