The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
143
|
sequence length |
379
|
structure length |
379
|
Chain Sequence |
QDTLLTLDTPAAVIDLDRMQRNIARMQQRMDAQGVRLRPHVKTSKSVPVAAAQRAAGASGITVSTLKEAEQFFAAGTTDILYAVSMAPHRLPQALQLRRRGCDLKLIVDSVAAAQAIAAFGREQGEAFEVWIEIDTDGHRSGVGADDTPLLLAIGRTLHDGGMRLGGVLTHAGSSYELDTPEALQALAERERAGCVQAAEALRAAGLPCPVVSVGSTPTALAASRLDGVTEVRAGVYVFFDLVMRNIGVCAAEDVALSVLATVIGHQADKGWAIVDAGWMAMSRDRGTARQKQDFGYGQVCDLQGRVMPGFVLTGANQEHGILARADGAAEADIATRFPLGTRLRILPNAACATGAQFPAYQALAADGSVQTWERLHGW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
D-threo-3-hydroxyaspartate dehydratase
|
publication title |
Structural insights into the substrate stereospecificity of D-threo-3-hydroxyaspartate dehydratase from Delftia sp. HT23: a useful enzyme for the synthesis of optically pure L-threo- and D-erythro-3-hydroxyaspartate.
pubmed doi rcsb |
source organism |
Delftia sp.
|
molecule tags |
Lyase
|
total genus |
143
|
structure length |
379
|
sequence length |
379
|
chains with identical sequence |
B
|
ec nomenclature |
ec
4.3.1.27: Threo-3-hydroxy-D-aspartate ammonia-lyase. |
pdb deposition date | 2014-04-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01168 | Ala_racemase_N | Alanine racemase, N-terminal domain |
A | PF14031 | D-ser_dehydrat | Putative serine dehydratase domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Lyase, Ornithine Decarboxylase; Chain A, domain 1 | Lyase, Ornithine Decarboxylase; Chain A, domain 1 | ||
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Alanine racemase |