4BF7A

Emericilla nidulans endo-beta-1,4-galactanase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
335
structure length
335
Chain Sequence
ALTYRGADISSLLIEEDSGVAYKNLNGETQAFELILANNGVNSIRQRIWVNPSDGSYNLEYNLELAKRVQDAGMSVYLDLHLSDTWADPGDQATPSGWSTTDIDTLAWQVYNYTLDVCNTFAENNVAVEIVSIGNEIRNGLLHPLGSTDHYDNIARLLHSGAWGVKDSSLSTTPKILFHLDNGWDWDAQKYFYDTVLATGTLLSTDFDLIGVSYYPFYNADATLSSLKTSLTNLKSNYGKNVLVVETDWPVQCSSPEYAFPSDLSSIPFSADGQETFLGRLADTLEDVGGVGIYYWEPGWVDNAGLGSSCEDNLMVDWRDRTVRESISVFGDLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ARABINOGALACTAN ENDO-1,4-BETA-GALACTOSIDASE A
publication title The Binding of Zinc Ions to Emericella Nidulans Endo-[Beta]-1,4-Galactanase is Essential for Crystal Formation
pubmed doi rcsb
source organism Emericella nidulans
total genus 113
structure length 335
sequence length 335
ec nomenclature ec 3.2.1.89: Arabinogalactan endo-beta-1,4-galactanase.
pdb deposition date 2013-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4bf7A00
4BCEA 4IPLA 2QLYA 2VVSA 2YL6A 2PWFA 1F4HA 1DEDA 4CD5A 4H2CA 4Z2GA 5FL0A 1CWYA 3W6MA 1FHDA 1PZ2A 3B9EA 1MYRA 1KR1A 2ZX6A 3GM8A 3PHAA 2DH3A 1FH9A 3FY1A 2WVVB 4ACYA 1XSJA 4CD8A 1FA2A 2WAGA 3WDRA 3M46A 3L4YA 3FHQA 1E6NA 3TONA 4U3AA 3KL3A 3ZOAA 2X1IA 3VMOA 1C7TA 3OBAA 5TD4A 3RO8A 4U5KA 1OCQA 3NCOA 1G5AA 1TA3A 3KL5A 4TX6A 3ZJKA 1B31A 2RGMA 1MFVA 4HOXA 1BF2A 1H2JA 2OYKA 5BROA 2CHOA 3VTRA 3T09A 2XVKA 4D6HA 4PCSA 1C3FA 2CCRA 4Z2JA 1HKMA 4MB3A 4W8AA 3WN6A 1MQRA 3O2LA 4P7RA 4QCFA 5GNZA 3EDJA 4ATWA 4CU7A 1UH3A 3ZSSA 2D0GA 3BSHA 1UKSA 2D1ZA 2YJQA 3NSXA 3OZOA 3NSMA 3WDQA 4HA1A 2WCAA 4BQ5A 4UOQA 1GCYA 4F8XA 1MQQA 3PZTA 5JBFA 1GHRA 3HJEA 1QI0A 3CUGA 2F2HA 5BRPA 3RJXA 2XWDA 2YL5A 2WKLA 3N9KA 3VIJA 3N11A 4F9JA 1B3XA 4MJ2A 1HJVA 2Y4SA 1UH2A 4QLKA 3M7SA 3SUUA 3RCNA 3PZ9A 3RIKA 5A8QA 3GXMA 1CGTA 1J11A 1NP2A 1PJ9A 1XSKA 2XG9A 4Z2KA 1V6UA 4DWSA 3BAIA 1XV8A 3WUFA 3VIHA 1ODZA 3T0DA 2WC4A 3FW6A 3I3EA 1Q6DA 3WNMA 5GNXA 3WENA 5A6MA 1H09A 2CHNA 2VZTA 1VBUA 2A3AA 1V3LA 4W93A 2B31A 3A4AA 1HVQA 1V3MA 2EEXA 3PZQA 3WNKA 3WQ6A 3BH4A 1JZ4A 3ARPA 1VJZA 4R27A 2VX5A 1Q6EA 1E4LA 2YOCA 2V38A 3W4RA 1EH9A 5A6JA 3G6LA 2VOTA 2WVSA 1XH1A 4MB5A 1HKJA 1W91A 4PCTA 1LF1A 1E71M 2J7CA 3OG2A 2JF7A 2J62A 1ZU8A 3VM7A 5AYBA 4XV0A 4KH2A 5DT7A 1QW9A 4D6JA 1NOUA 2Z1SA 2UY4A 1OINA 2CITA 3IAPA 2WMHA 1E6ZA 3BLKA 2EJ1A 2NSXA 1VAHA 2DT0A 1J01A 4HZ6A 5HBFA 1QW8A 2OYLA 3ZO9A 3WH6A 1VBRA 3GNRA 3VU2A 3CUIA 1IZJA 4GZEA 2ZWYA 5IDIA 2WC7A 2YA0A 2BNJA 3AS1A 3SCWA 5A6BD 1OIMA 3FAWA 4AZCB 2VMFA 1EGZA 3QHNA 2WLYA 9CGTA 5I23A 3D5HA 1E0WA 1BLIA 5DFAA 4NSBA 1HT6A 3PZOA 4UFKA 3QR3A 3VM5A 5I6SA 2BHZA 4MAVA 3WDHA 3AHXA 1WE5A 2W92A 2PB1A 3E1F1 1VF8A 1J0HA 4CKQA 2YKKA 2GDVA 3N13A 3BAKA 1LL4A 2VI0A 1HF6A 2UWFA 5I24A 1OSEA 1R87A 4AZHA 2ZE0A 3ZR5A 1UD3A 3MUY1 2ZUVA 1NM9A 3U7BA 5BWFA 2BY2A 1Q6FA 4MTVA 1BG4A 3VGDA 4OKDA 3WF2A 2D3LA 5JIPA 2DEPA 3CHDA 4P8XA 5D4YA 3K8KA 3VPLA 2F61A 1CGWA 2ZUSA 1ISVA 3WQWA 1UZ4A 1FOBA 3N1AA 3PTMA 1NARA 4D6GA 4PMOA 7TAAA 3G6MA 2HVMA 1BYAA 1EO5A 2WB5A 2D22A 2FHBA 1BAGA 5C8BB 1HJQA 2VX6A 1NWSA 2FGZA 4WJXA 4M81A 1Q6GA 4CU6A 5GQBA 5AC5A 3JUGA 3T0BA 5BXRA 2VUYA 2CBJA 3MMUA 2EPMX 2NW0A 4BQ2A 5BCAA 4IPNB 1UD4A 3ZMRA 4ZEPA 3WMSA 5ABEA 2DSZA 3W26A 4W7VA 2XIIA 5ABFA 4EAMA 1GQJA 3WKZA 2V3EA 1OGBA 4BQ3A 1B90A 2VZUA 4AD0A 1ISXA 1RP8A 1UR4A 1H49A 4QLLA 2E9MA 1NWTA 1DWIM 2Y5EA 4AZ5A 4EANA 3N17A 3WNPA 3N15A 3N04A 4MNKA 1QPKA 1KWKA 5A6SA 1XYFA 3AIQA 1DWJM 4W85A 1KQZA 1XH0A 3OLDA 3FXYA 5EFDA 1GOMA 4UOZA 3TTSA 1CGYA 4WK9A 2J7EA 1GOWA 3OIHA 1W2PA 3IAQA 2YL9A 4JL1A 4HP5A 3GNPA 4LPCA 4W8BA 1PX8A 4MJ4A 5A6BA 4AIOA 4J3TA 1LWJA 1R7AA 3OGRA 3W29A 2G4FA 1C90A 4FLSA 5FL1A 3CMGA 4UFHA 1H1NA 5LA2A 6A3HA 1C93A 1MXDA 4J7RA 2XVGA 1E5NA 1JG9A 5A1AA 1QOXA 3VD7A 1RH9A 1PBGA 4HA3A 1E56A 3AQUA 4LYRA 2NT0A 2GK1B 4CD6A 1ITXA 2Y8VA 2ZWZA 1WZMA 1HN1A 2WZEA 4UQ9A 3ZT6A 3MUIA 4W5ZA 4Q22A 2EO7A 1EIBA 2XSAA 3MKKA 4FF5A 2EPNA 1FHLA 4NRSA 1QI5A 3SCRA 1V0MA 1JDAA 4U2YA 3WNNA 5CZKA 1VEPA 5E9AA 1F4AA 2WMIA 1OT1A 2VR4A 3MSDA 1QNOA 1BYDA 3W28A 1UR1A 3A6OA 2UY3A 1Q4NX 3KE0A 1BPLB 1GOIA 3VILA 2EXOA 1K9FA 3LPOA 3FNDA 1RPKA 3J7HA 1MXGA 1NH6A 2D0HA 3BAXA 1TA3B 3LPFA 2QF8A 2VZSA 1E6PA 1K6AA 4W7WA 4M82A 3RPMA 1OGSA 1EQCA 4BS0A 4OUEA 1XYZA 3AS3A 2WHMA 2BVTA 2WMGA 3WF1A 1D3CA 2TAAA 1ZL1A 1E40A 2GVYA 2GDUA 5LA0A 1ISYA 1KXVA 2QPSA 1VFOA 2HISA 2CETA 1CXFA 4A4AA 4KMQA 4D6CA 5M3WA 3WD3A 4PTWA 1WZKA 3AZSA 3AOFA 5CJ5A 3RM4A 3VX1A 4RE4A 3B8SA 2WZHA 2ZICA 2J79A 1GNXA 3DYOA 1KGXA 3AZRA 1J9YA 1VIWA 5KZ6A 2D0FA 4CN6A 3MU7A 3VOCA 1CXHA 4GXPA 1V0NA 4AZIA 1QNQA 2W61A 1H0IA 1W1YA 2DSVA 4U3CA 3VMPA 5CLWA 1E4NA 2WNWA 3WD2A 2WVUA 3A3HA 2CERA 4Z2HA 3GH5A 1KXTA 1J0YA 1UKOA 1JXKA 2W67A 2O9TA 1KGWA 1US2A 4GO8A 2WMKA 1E73M 3S6TA 4PUDA 3QOMA 4DWSB 5D9PA 1EDGA 2J4GA 4GKLA 4ACZA 3VGGA 1JIBA 1V0LA 5LYRA 3BC9A 4AEFA 4ATDA 1DHKA 1WZLA 3EYPA 3L4ZA 1M04A 3GYCA 1W9DM 2CXGA 2DGAA 1JFXA 4E8DA 3ZM8A 4XB3A 3GH4A 1DWFM 2V5CA 3HU7A 1W9BM 1GUVA 1V08A 3BXWA 1SMAA 3RMEA 3ARWA 1OD0A 1B3VA 1ECEA 1X6NA 3ZJ8A 3L4UA 1JZ8A 3ARRA 2E4TA 4GO9A 1QNRA 4WKAA 1X6LA 4HU0A 1TR1A 3AS2A 3U7VA 4M80A 4CD4A 4MNMA 1J0KA 3MUAA 3TA9A 4CN4A 3PTQA 2JF6A 3L2LA 1UHVA 1G1YA 2PBGA 1CXIA 4W7UA 4W84A 3UR8A 4JHZA 3CZKA 1FP8A 1M7XA 4CCDA 1KCKA 1SR0A 2BXYA 4WSKA 5E0CA 1DP0A 2X0HA 5A94A 4EE9A 3ALFA 4L4OA 1HJXA 2AAAA 1CXLA 3BCFA 1FH7A 1UD5A 2DSUA 1PZ3A 5E0FA 2BY0A 2ZIDA 7A3HA 4AW7A 3WUBA 2XGIA 4BA0A 2EBNA 5BXPA 1JYXA 4AZ6A 3DC0A 2UY5A 3MANA 1US3A 4GQQA 4ML4A 1ISZA 4HOZA 1XC6A 2CKSA 2G3NA 3IJ9A 6CGTA 4PSPA 4D6EA 2XIBA 3ARYA 1W9VA 2J8GA 4FK9A 3GBDA 2DH2A 4P8UA 3AMDA 4UQDA 2XHYA 3VGFA 1AMYA 2ZUMA 4JFVA 2D23A 1CECA 4NRRA 2YL8A 3AYRA 4UFJA 2J7HA 1NP0A 3WMCA 4CN1A 2VCCA 2WLZA 3CZ8A 1VENA 4LXFA 3AIEA 3VGHA 2ZUWA 1VFMA 3VINA 3UG5A 4PMVA 5GNYA 4WLCA 4U5IA 2GUYA 1C8XA 2XFFA 3ARZA 3AMLA 3AS0A 2XFYA 4YHGA 1UA3A 1E0XA 1Z32X 4WIWA 4HOWA 1GQIA 3EMZA 3W6LA 1E3ZA 1JFHA 2PI6A 4MB1A 5FOOA 1UKQA 2J7GA 3WH9A 3MS8A 1H11A 3B9DA 2J78A 2XYLA 1KXHA 2W63A 3UERA 1E4IA 1QVBA 2V5DA 1GORA 1QI3A 2EPKX 1LG1A 2DSWA 4ZXOA 5DO8A 3N12A 1UR0A 1E3XA 2GJPA 3ZIZA 2J47A 4W86A 4GZJA 4AD1A 4W8LA 4FMVA 3SCTA 4D6DA 1VFUA 4AWEA 1ZBKA 1V6WA 4D72A 3FN9A 4JAWA 3WELA 3VGBA 4AMCA 1SMDA 1EOMA 1J18A 2JE8A 4P7OA 1BYCA 2OSXA 4AISA 4B3KA 5JIWA 2WSKA 4PMQA 4Z2IA 5I3DA 3VIGA 2WXDM 3W25A 2VCAA 5ABFB 2G3JA 4UZUA 3WSUA 5FCZA 6TAAA 2WWCA 3I3DA 4L4PA 4AZGA 4OIFA 5M03A 5HDRA 4H8UA 1WDPA 2O9PA 3SEPA 2DT3A 4CU8A 3WIJA 4H7VA 2X2YA 5JBDA 2GJXA 3KZSA 2PWDA 3GXFA 5HPCA 3QGVA 3VMNA 1VJSA 1EXPA 4LX4A 1DWHM 2DPEA 1CXKA 1PAMA 4JZ5A 3ZJ7A 3BCDA 2XVPA 1ZJBA 4AY1A 3SURA 3CZGA 3VUPA 1E70M 2G3IA 2GFTA 3F5LA 1JF5A 4E8CA 1C7SA 1G94A 2MANA 1TMQA 1JF6A 2CPUA 4J3VA 3ZQ9A 5HNNA 3A47A 2WCGA 1MVYA 3WL1A 1O7AA 4AC1X 1W3JA 4PRWA 1UWQA 2J8FA 2JEPA 4R5EA 1U30A 1WDSA 2ZUUA 1MQPA 2VR5A 2OWWA 4D1IA 5BRQA 4AIUA 4AYSA 5A8OA 1GONA 4X0NA 3HN3A 4E4PA 2ZX5A 2JIWA 1EDTA 3TOPA 3VIMA 1CGVA 3CHEA 2PF0A 3CO4A 3CUFA 1UWUA 2CESA 3AIVA 2VT0A 3AI0A 3FHAA 1UKPA 4AZBA 4RL3A 1UH4A 1HKIA 5HOSA 3SCNA 1W9UA 1FFQA 3PN8A 5IFTA 3AMKA 3GNOA 2A3CA 2WMIB 4MADA 3AMCA 3LPPA 1V02A 2X09A 1L8NA 1BYBA 5AYIA 2ZX9A 4W5UA 1XCWA 1UD2A 1JDDA 5HPOA 1KFWA 4M29A 1R86A 3T2PA 2CNCA 1R85A 4J3XA 1EQPA 1JNEA 4PMRA 3WY1A 2JALA 4F9DA 1BGGA 2ZUTA 1E5JA 1RP9A 4AD2A 4BQ4A 3WDIA 1L0PA 1ODUA 1KCLA 3BMVA 4OBRA 2X8RA 4PEEA 2W62A 2VNCA 3W27A 3B9AA 5A8NA 1ZB5A 4CVUA 4GZIA 4K68A 2PWEA 1IT0A 2WVTA 4UQEA 2XM2A 3ARSA 3CUHA 1VEOA 3NSNA 4QCEA 3WF0A 3W82A 3EMCA 1TG7A 1D7FA 2FHCA 1G0CA 3RM9A 3CTTA 3II1A 2E40A 3SCOA 3OZPA 5A69A 1UG6A 3ZT7A 2VTFA 4V2XA 5A3HA 1EOKA 1HL9A 4UQCA 5E6ZA 1PX3A 4OZOA 1NWRA 2ZXBA 1UWSA 2VO5A 2EQDA 3GZAA 4PTMA 3VIIA 4TX8A 4AD5A 2NT1A 4AIEA 1C91A 3K4DA 1WPCA 1J10A 1LJYA 1UQYA 1V3HA 4MDPA 3NIYA 3MO4A 2WW5A 4AD4A 1N82A 1E9LA 4TVDA 2VRQA 4JCLA 2DSKA 2CKRA 4URIA 2VQUA 1GOQA 4UOJA 5DF0A 4OJYA 1ZJAA 4GQRA 1HP5A 5FD0A 2E8ZA 2V3FA 1QHPA 4QAWA 3CZEA 2ZX7A 4ACZB 2VRKA 3VIOA 2WZIA 4B3LA 4V28A 3AHVA 3WUEA 3WEZA 1CXEA 1ESWA 1UR8A 2QPUA 3AIWA 2PWGA 2J7BA 3AHZA 2ZX8A 4F79A 1KBKA 4X0VA 4KRUA 2XFRA 2IXVA 1V6VA 1W3LA 1CGXA 1ZBCA 1C92A 3UESA 1GW1A 3DYPA 4UFLA 4H04A 4XX6A 4YPJA 5IFPA 1J0ZA 2WMFA 1B30A 5M5DA 4M56A 2CBUA 4PN2A 1U2YA 3TP4A 5I79A 1XH2A 5A95A 5C71A 4B9YA 3GDBA 4QLJA 3UETA 1BSIA 3L4WA 2FGLA 2AMGA 5ABGA 2VL4A 2OYMA 4N42A 3WH8A 3WFLA 4M8UA 4TTUA 4UTFA 1H5VA 1Q6CA 4Q7NA 2V3DA 3AFBA 1LG2A 1OB0A 3WUGA 4H41A 3UG4A 1OM0A 5A6KA 4FLRA 1H41A 2XPKA 4CGTA 5FIPA 4MB4A 3OGVA 1G9HA 3WL0A 8CGTA 4HPGA 5EMYA 1V0KA 3DYMA 2G8ZA 3PZGA 2BHUA 2FHFA 4QP0A 3SCVA 4PYSA 3CBWA 1HIZA 2D24A 4JFWA 3WQ8A 2WHLA 3PBGA 4PBGA 3NDYA 4KRTA 3W81A 3WH5A 1DWAM 1C8QA 2YBUA 4NF7A 5JBEA 3IANA 3AMGA 1CIUA 1VB9A 3POCA 3K8MA 1EHAA 2D2OA 5EBAA 1CDGA 1G01A 2Z1KA 2JFEX 3POHA 4P7NA 1JGIA 4HA4A 3M6DA 1BHGA 3GH7A 1UA7A 2EPLX 4P7QA 1GJWA 4Y7EA 1XGZA 1CBGA 5BYWA 2A3BA 5BXSA 2OSWA 4JFSA 3KL0A 4KGLA 3FAXA 5DT5A 5IHRA 3BSGA 1R8LA 1CZ1A 2ESCA 3BMWA 1DTUA 4UFMA 1CLVA 3MMDA 2WWDA 5CQ1A 1WNOA 1W9XA 4J3SA 4YN5A 1KWGA 2WBKA 3ARTA 4S3JA 4W87A 1B3YA 3W53A 3PZUA 1E55A 1MW0A 4WKHA 3GXDA 4AEEA 4S3KA 1M53A 3OLEA 4MAZA 1WB0A 1QBAA 3NYDA 1W1VA 3EDFA 4LGXA 4GINA 4J3UA 3U57A 4MPKA 1K9EA 1JNDA 5BXTA 1GZJA 4OOZA 1HJSA 4U31A 1CEOA 4EKJA 4TVCA 3RDKA 4JHOA 3L4VA 3WQ4A 5A6AA 3APGA 3THCA 3M07A 1E72M 5JUVA 2BFGA 1NOWA 1B2YA 1W1TA 5D9OA 4WKFA 3VD9A 3NUKA 3KWXA 3EBVA 3ARXA 1W2VA 3MV11 3EDEA 5A2CA 5D9NA 4XUYA 5CPTA 1JAEA 1LQ0A 2WHJA 1UD8A 4D6IA 5CPSA 1JYWA 1PX4A 3ZSTA 1K9DA 1AQ0A 5CPQA 1A3HA 2W5FA 4D1JA 3WDPP 5CG0A 2RGLA 2D20A 3SIMA 1FP9A 3UR7A 1VFFA 1W3KA 3SCSA 3AICA 3T0AA 1UWIA 1WCGA 5CLTA 4U2ZA 1BTCA 3VD5A 1I75A 4PTVA 1FH8A 3AXIA 1KBBA 2GJXB 4TXEA 3VDAA 2VC9A 4C7GA 1S46A 4JKLA 2FH6A 3THDA 3W0KA 3CHFA 4MNJA 1KB3A 3TTYA 3ALGA 3SUWA 2E8YA 1JI2A 2CBIA 2D3NA 2WM0A 3SCQA 1WP6A 1LWHA 1JZ7A 3WF4A 3VVGA 1UOKA 2O9RA 4W89A 5CXPA 3SUVA 5CGMA 2VVNA 3AJ7A 5A2AA 3AXXA 4DM1A 3LPGA 1JZ6A 1E0VA 4HZ8A 1QI2A 2E9BA 4TVUA 4BF7A 5A8PA 4RE3A 1TUXA 3WH7A 3VIKA 3MUZ1 3K4AA 4BZYA 2O9OA 5EFFA 1BGAA 4AXNA 4DUWA 3T2OA 3HMCA 1NWUA 3RILA 1V3JA 2FH8A 1WZAA 2BY1A 4TUFA 2WSPA 1K9TA 1RD6A 3WFZA 1XSIA 2X05A 3L2MA 3TTQA 5D8WA 4CUCA 1QHZA 3EDDA 2DT2A 1HVXA 4GI9A 4C7FA 5A6LA 2BY3A 4U33A 3VIPA 4OBSA 3I3BA 1O6IA 4JL2A 4IISA 2YDRA 2CEQA 3ECQA 3U5YA 4XZBA 2QV4A 1ZS2A 1BFNA 4PSRA 3CZJA 5I2UA 4CCEA 3ARUA 1D2KA 1KR0A 1YHTA 3ARVA 4JFUA 3SUSA 1TFVA 3AIRA 3VGEA 2WK2A 3WQ5A 1UKTA 3OB8A 1JYNA 5EB8A 1H4PA 3GBEA 1OIFA 2XWEA 3BGAA 5CGTA 4PTXA 2XTKA 3RM8A 3CUJA 1W32A 2YDQA 4J28A 2XVLA 2A3HA 3OLGA 2YDSA 3WD0A 1LL6A 3SCUA 1M01A 1GOKA 1B9ZA 2W4XA 4LYPA 2DIJA 1JD9A 3BAWA 3CLWA 4D6FA 4WSJA 5E70A 4N0RA 5AY7A 4HMCA 2VX4A 1HXJA 3EDKA 4C7DA 3PTKA 1X1NA 4B16A 4DUVA 3K8LA 5DEZA 5KEZA 1UD6A 1V6XA 4PMYA 1CENA 1OT2A 4ZE5A 3T08A 4ZENA 1V03A 4P8VA 1B1YA 2PBOA 3WD4A 4PUEA 1WAWA 3VNYA 2C8NA 2WVVA 2BS9A 1HL8A 1TVNA 1NOFA 4Z2LA 2ZXDA 2G41A 3NJ3A 3MV01 3VDHA 1HJUA 3ARQA 3KEHA 3S2CA 4YHEA 1QI4A 1AQMA 3VDBA 3QHMA 4PMXA 4CCCA 2C7FA 4ZXLA 4QFUA 1E43A 1B3WA 4B9ZA 1UQZA 5IXEA 1JI1A 3ZJ6A 1VRXA 1E1FA 1E4MM 3L4XA 1CTNA 1GQKA 4J27A 3ZT5A 2VURA 4UCFA 1ISWA 2A3EA 3WEMA 4TTGA 4CVWA 5GPRA 2CBVA 3WNOA 3AISA 2XVNA 1ZBWA 4OOUA 1ZBVA 4JFTA 3CMJA 1IZKA 2VRJA 4J3WA 3ZR6A 1CPUA 3OLIA 1LLOA 1WDRA 2Y24A 4PMNA 1B0IA 2X0YA 3SCPA 2QMKA 1J0JA 3TTOA 3DHPA 5C70A 3NDZA 1WDQA 2F8QA 4JKKA 4MDOA 1NQ6A 3N18A 4PMDA 3GXIA 5D8ZA 1E6QM 2ZUNA 2BV9A 5CSYA 2VZOA 1UZ1A 3AXHA 1GVYA 1GOOA 1PEZA 1UYQA 1MW3A 2J74A 5CSUA 2WHKA 4UQAA 1YQ2A 4GI8A 1JDCA 1GQLA 1EHNA 2EPOA 1V3IA 3O6AA 3MMWA 1JYVA 3O9NA 1BQCA 2CIPA 3F4VA 4H8VA 1MWOA 1B3ZA 2QMJA 3OGSA 4JCMA 2XGBA 1U33A 2BVDA 2XSBA 2OSYA 3AROA 4M24A 3BLPX 4QDMA 1J0IA 1BVZA 2VZVA 4WF7A 2AOSA 2VQTA 3CPUA 1P6WA 2FDMA 5I5RA 2YLAA 5D9MA 1HX0A 3PZIA 1V3KA 3AZTA 1BVNP 1ITCA 4MNLA 4V27A 2VJXA 1EA9C 3UEQA 3K46A 3CIVA 4KWUA 2E3ZA 4GIAA 4NI3A 2JIEA 5M17A 2WMJA 2G3MA 4LYQA 1PIFA 5E09A 2E0PA 1KQYA 3OA5A 2VX7A 1SYTA 4P7LA 4H8HA 3AIBA 5I0DA 1CLXA 2IUZA 4AD3A 3VNZA 2XM1A 2DT1A 4M1RA 5DMYA 4LQ1A 2Y8KA 3CH9A 1HP4A 1IV8A 1I1WA 3WQVA 4FLQA 3T2QA 3DECA 3AIUA 1E1EA 2ZOXA 2PWHA 1TE1A 3K1DA 3VD4A 4UNIA 2OWCA 3RJYA 1H0GA 2CYGA 1PPIA 2WANA 2J77A 3VKKA 2O92A 1JZ5A 3UG3A 1Y7VA 1KXQA 1CGUA 2E9LA 4AZCA 2BXZA 3VX0A 4D71A 2YLLA 1UR2A 2DIEA 4HMDA 2J75A 3AYSA 4JKMA 3WMBA 5ECUA 7CGTA 1UWRA 1GJUA 1XD1A 1E6XM 3W24A 3F5KA 2ZXAA 1AVAA 3UCQA 2JEQA 3F5JA 1V02E 3CGTA 1TVPA 4EK7A 1WKYA 4HPHA 1JZ3A 3BAJA 2OWXA 4NZCA 5LA1A 3VDCA 1SFSA 1LL7A 3SUTA 1OWQA 3IJ7A 3QOKA 2DQXA 2WYSA 1CYGA 3CZLA 1BG9A 2Y2WA 4RE2A 1H3GA 3WEOA 4HU8A 5ABHA 1XRVA 3WD1A 1FFRA 4HTYA 3A4WA 3WNLA 2W91A 4GPNA 1W1PA 1EO7A 4DUXA 4UR9A 4ATLA 3VO0A 1TCMA 5FKYA 2YIHA 1QNSA 1V6YA 1OD8A 3IJ8A 1GHSA 4IM4A 2WPGA 2BHYA 1W9PA 3PZMA 1JXJA 2QHAA 3PZNA 1XHGA 3VD3A 1XD0A 2YA1A 2OLHA 4UQBA 4DWSC 1A47A 5AC4A 2J7FA 1GPFA 1JZ2A 1TZ7A 3DHUA 2BVYA 1QNPA 3W38A 3GTNA 1CNVA 1MFUA 5F7UA 3IK2A 3A4XA 1UR9A 4KGJA 3LMYA 1AQHA 5I77A 4W88A 2YBTA 1E15A 1HNYA 3EMQA 3WDJA 4CD7A 3U5UA 1DWGM 4FLOA 5A8MA 2WC3A 1JL8A 3AHTA 1MW1A 3WBAA 2WCSA 2YA2A 1UUQA 2XJ7A 1PIGA 4HMEA 4ZFMA 4HZ7A 2WKGA 1JD7A 4DM2A 4AZ7A 4B15A 4XZWA 3L4TA 2J25A 5I78A 3PZVA 3VIFA 4IUGA 8A3HA 1GVIA 5E6YA 1UWTA 4E2OA 2W66A 2C0HA 1HJWA 4A3YA 1J12A 3WBEA 2XUCA 1I1XA 4TOQA 2J7DA 3AHYA 4F66A 4ZE4A 1KGUA 1MW2A 2WBGA 2GSJA 1EDQA 3WF3A 1E6RA 1QHOA 4P8WA 5IHSA 2IXUA 2UY2A 1M03A 4UZSA 3W37A 1VEMA 1E6SM 1OBAA 2PC8A 1QBBA 2ZXQA 2V3GA 2VCBA 4X9YA 1HKKA 5A2BA 4A3HA 1R7OA 3D3AA 5HXMA 4DWSD 2Q8XA 3MSGA 3BAYA 1XCXA 3QHOA 4JIEA 4UFIA 3CHCA 1JAKA 1OGGA 2DDXA 1C8YA 4PMUA 1W3HA 2GJRA 4PMZA 2GK1A 1WO2A 4GI6A
chains in the Genus database with same CATH superfamily
5T26A 4OBTA 4BCEA 3EAUA 4IPLA 2VVSA 2YDAA 4UTTC 4E4UA 1F4HA 2VFDA 4G2DA 4C6JA 1VPQA 1PZ2A 3MVTA 2O4MA 3NQCA 4F2UA 3GM8A 5DBUA 1RQEA 3FY1A 1WX0A 5MF5A 4PRTA 4HIBA 2WAGA 1MUMA 3M46A 3V36A 4TV6A 3IJLA 3W1LA 1L2QA 4U3AA 1C7TA 4U5KA 3UXIA 4PB5A 3ABXA 4H9YA 4R7WA 1ZHAA 3GUGA 3KL5A 1B31A 4HOXA 4DBDA 2BZNA 2V5LA 5FJJA 4LAOA 1XLHA 5XIMA 5H8PA 4N4PA 2CCRA 4O1BA 3REQB 3KOYA 4Z2JA 3PFRA 3GC4A 4C6MA 1Z69A 1MQRA 1NDYA 2SFPA 5GNZA 5TQLA 2C1GA 2GLKA 2FVLA 2J6VA 3BSHA 3PPCA 2J9XA 4PODA 2WNNA 4GABA 4HA1A 2WCAA 1X7FA 1X7IA 3N4AA 3LGEA 4RV3A 2AQWA 1UIPA 3PZTA 1RJRA 2WOQA 5JBFA 3PTDA 4JR5A 3M0VA 3CUGA 3U8GA 4AY7A 5BRPA 1I8JA 2PDHA 4I5RA 1BRLA 1CLKA 3N9KA 3PUEA 3VIJA 1NU5A 3TQKA 1PTGA 4OTKA 3TQ0A 3W7NA 2V63A 3C5QA 3GXMA 1J6PA 3OW1A 4HNTA 2WNZA 1XSKA 2XG9A 4Z2KA 4A8LA 1GEQA 3TKFA 1GKPA 3BAIA 1Q66A 4YYCA 5CC5A 1IYXA 3DFPA 4Q8WA 1H09A 2CHNA 2QJNA 1TWIA 4W93A 2B31A 3HFTA 3CQJA 3SW6A 3WQ6A 3BH4A 3N2OA 3ARPA 4G7FA 3W4RA 3G6LA 5B7YA 2WVSA 5T9CE 3U4FA 4K8HA 1LF1A 1UCWA 2J62A 1QO2A 1ZU8A 3BWWA 3AXMA 5AYBA 5A6TC 5DT7A 3QMTA 4QAIA 2OO0A 1JCNA 4ZMGA 4Z1BA 2CZEA 1J2WA 4GK8A 1E6ZA 1VAHA 3DBNA 4DF0A 3CASA 2DT0A 3E2VA 3W02A 5HBFA 1IEVA 2OYLA 1JR1A 3SAZA 3R12A 3S47A 2ZWYA 3O6DA 1ALDA 1N8WA 2KZHA 5LXEA 2YA0A 4O52A 4C90A 1SVDA 1ECQA 3WJZA 1EGZA 3PUGA 3QHNA 4ADSA 1BLIA 1Q45A 3N34A 5D30A 3A23A 3VM5A 3CV1A 1L6GA 3OOQA 1XP3A 1P4CA 4XTIA 1GVSA 5EKYA 1YTEA 3NR0A 4IHCA 2PB1A 2ZBTA 1M3UA 2GDVA 3N13A 4UTTA 3THQA 5AVHA 3H6OA 3LLXA 4DO5A 3TLLA 4GXMA 5J5DA 1R87A 4AZHA 2PLCA 3BANA 4Z1YA 3CIWA 3M5YA 3B03A 2BY2A 3U7BA 5BWFA 5HQMA 5HATA 3LCLA 4S3BA 1ZP3A 2D3LA 5JIPA 2DEPA 4XWUA 1EJTC 1VP5A 2ZDRA 1CGWA 2ZUSA 3M0MA 1JQVA 4GA8A 3N1AA 4D6GA 7TAAA 2DY3A 5CJNA 1RY0A 2HVMA 4ENLA 1P0EA 2FHBA 4IXHA 5C8BB 1HJQA 1NWSA 1M65A 4C6EA 4WJXA 4IGMA 4GFIA 5GQBA 4HNUA 3WJXA 4LVGA 1QRQA 3QTGA 3T0BA 5BXRA 5C2CA 3MMUA 3TSBA 4US5D 4IPNB 4NZ4A 1GZ1A 1EJXC 1AH3A 4O53A 3E38A 3OZYA 2ZRXA 4KCUA 3IPWA 4CQDA 1TO3A 3ISIX 1RLCL 1GQJA 3KM8A 1WAUA 1XDJA 2PTYA 4XUGA 4ZQCA 2Q01A 1GVOA 1Q63A 4M6QA 4NT0A 1NWTA 2Q02A 3WNPA 4OV9A 3TW9A 3RHGA 4MNKA 3G22A 1KWKA 4BF5A 1OHLA 1DWJM 1KQZA 1DQUA 1XH0A 2YXGA 1KRCC 1GOMA 2GJNA 3WMLA 1AG1O 4LCRA 1GOWA 2ZC8A 3INPA 4K38A 1A5AA 4ASTA 4J3TA 1LWJA 1R7AA 1TX0A 3OGRA 4KIRA 3WQFA 1C90A 4MYAA 1MO0A 1D7KA 3GHUA 3PF3A 5DCEA 2ASHA 2CFFA 2YB4A 2P50A 4UFHA 1H1NA 5LA2A 6A3HA 2VELA 3WFAA 2FTPA 4J7RA 3G1RA 2Y85A 2YXXA 2PRHA 1E5NA 3FVMA 3SECA 4WCJA 4LB3A 4WJ8A 4Y9MA 4PL1A 3BJFA 4R88A 2G96A 1N2VA 1BXNA 1R2RA 3PULA 4KEMA 1ITXA 4ONVA 3VOHA 1IXPA 2Z6JA 4MKVA 3M16A 1YIXA 4N2YA 4ZTXA 1KM6A 4LEQA 2EO7A 1R46A 3C3UA 1FBAA 1W8SA 4O8RA 3OPSA 3GHSA 3P7YA 4NRSA 3KBMA 1V0MA 3UBPC 3WNNA 2Y5SA 3BCJA 3TAOA 1OT1A 1YEYA 1MZRA 2F38A 1RLDA 1BYDA 4NZ3A 3W28A 1UR1A 1X6UA 3M0JA 3FNDA 4ZQPA 3UPBA 3OQEA 4GQGA 2EJAA 3G1DA 2D0HA 3BLIA 2NX1A 2JBMA 3GAKA 1V93A 2QF8A 3P0XA 3RR1A 1PTDA 3KX6A 3T0CA 4US5A 3RPMA 1OGSA 2P0IA 4OUEA 1YYAA 3AS3A 5E1QA 1M5WA 1TELA 4Q8OA 5G5IA 1TV3A 2GDUA 5LA0A 1KXVA 4HHPA 2QPSA 3BG3A 4GCAA 1MNSA 4F3HA 5M3WA 4XK2A 4RPQA 3LCWA 3R10A 5I03A 3W23A 3IUIA 4RE4A 3GDLA 3WX7A 2ZICA 1LWIA 1OCNA 1DJZA 3I4EA 5H8UA 5KZ6A 3E9AA 3VOCA 1REQA 4AZIA 3QLDA 1QNQA 1Q5MA 5CLWA 1E4NA 1FWIC 2WNWA 3LOTA 2OJPA 3EOOA 3A3HA 2CERA 4Z2HA 3GH5A 1SQ7A 4DBUA 4UTWC 5D2TA 1MDRA 1JXKA 3B40A 2WMKA 1OZQA 1K7XA 1R47A 4MJZA 2Q09A 1Q2RA 2PLJA 4GKLA 1JIBA 4XSLA 4ATDA 1DBTA 3EKLA 3N2XA 1DHKA 1WZLA 1EEPA 1W9DM 3LRKA 1JFXA 4XB3A 4H00A 1GUVA 4GC3A 2J24A 1ECEA 1EL3A 4C1NB 2REQA 3ARRA 4GO9A 1F74A 1X6LA 4HU0A 3VNIA 4HK7A 3U7VA 4QX4A 3PAOA 4CD4A 4JQ3A 5GVJA 3UR8A 2ZRWA 1M7XA 3T4CA 2Y7GA 2G97A 4XIMA 1QDSA 3VFCA 5A94A 2HNEA 4ERIA 1A50A 2AAAA 1CXLA 4ZQRA 1P0BA 2Y89A 3WLLA 3JS3A 2VFIA 5LGZA 1FH7A 3NWRA 2BY0A 3ZXWA 7A3HA 3D6NA 1T7LA 4EX4A 3WUBA 4S3CA 2XGIA 1UPPA 3LUTA 3K30A 5BXPA 2PTDA 4QBXA 1DXEA 1EX5A 2UY5A 3MANA 1US3A 4ML4A 4UNKA 4HOZA 1XC6A 4H7ZA 3UR5A 3QTPA 2GSEA 4F0LA 5A5WA 3ARYA 4K8GA 4ADUA 3V1PA 1CECA 4NRRA 5C9XA 3F2BA 4UFJA 2J7HA 2EF9A 1NP0A 4PCPA 3W6YA 1RV8A 4ZGYA 3Q37A 1WV2A 3CZ8A 3UGVA 3RUBL 2ZUWA 5HR6A 2NX9A 4KBXA 4X2RA 3UG5A 2GUUA 2QUUA 1MUWA 4LH8A 1XIHA 5GNYA 4HPJA 3OEXA 2GUYA 1C8XA 4J2PA 1AODA 3C2FA 1Q6OA 3AMLA 1UUOA 4GFSA 2OZ0A 4AX6A 4WIWA 4HOWA 3EMZA 3W6LA 1JFHA 5CG7A 1FHUA 1UKQA 2J7GA 3H23A 4A22A 1XLKA 1E4IA 1GORA 3GDKA 3LHUA 3KHDA 4UMBA 2VGGA 3N12A 2GJPA 5KITA 1PV8A 1AA1B 4AD1A 4FMVA 1PO9A 3SM0A 2BASA 2VEMA 3DAQA 4NXKA 3FN9A 1XQKA 3FK4A 7REQB 2QEZA 3CV6A 1EOMA 3PBVA 4DBEA 1OCJA 2JE8A 4P7OA 4IICA 5JIWA 4IMGA 2OG9A 2RKXA 3N9SA 2WSKA 4PMQA 4Z2IA 3WLOA 1B4EA 4M5PA 1A80A 4PB3A 5ABFB 3WSUA 3C86A 1TPDA 4HKPA 1Z8AA 4AZGA 4OIFA 5M03A 3SEPA 1S2VA 1SO4A 5HPCA 3C0QA 3VMNA 2XIJA 4Z42C 4LX4A 2QDHA 2Z26A 4NNCA 3UCDA 4UTWA 1BTMA 2NV9A 4PULA 4XO7A 5C2GA 2FPTA 1ZJBA 3G5EA 3N2TA 1E70M 4BEQA 5J04A 1G94A 2BDQA 2O7QA 4J3VA 1YPFA 2J13A 1SW7A 4PRWA 4RDWA 1KCXA 5G4WA 4A8NA 1RSCA 4FEZA 1MQPA 2VR5A 3I7RA 5XIAA 4DXVA 3SY5A 5B7ZA 5LNUA 3KLKA 1TIWA 3N6QA 4W4QA 4JTTA 4YTQA 3H21A 3LB0A 4N9BA 3KBWA 4RKAA 2JIWA 2ZA1A 3VIMA 5I00A 3CHEA 3TFXA 3CO4A 4R9OA 1KFEA 4PEKA 3AJXA 1DJNA 1LORA 3CUFA 2VT0A 2P8CA 3SGGA 3AI0A 1IHIA 4H9TA 1P6BA 5I3KA 3SIZA 1G4EA 3G3DA 3SCNA 1ITQA 3LDVA 1HFBA 3WO8A 3AMCA 2X09A 1L8NA 4E2VA 1VCVA 1CCWB 3GQYA 3AU6A 4DBWA 3FJ6A 1JDDA 3APYA 3CHVA 3F4NA 2DV0A 4JTJA 2WSRA 2CNCA 4J3XA 4NZ5A 1A3WA 1RK5A 1RP9A 4AD2A 2EAWA 4TV5A 4LTSA 2L5HA 3KOFA 1ODUA 2C6QA 2W62A 1Z6KA 3RN6A 4PB4A 1WOBA 3B9AA 4E3TA 2PZ0A 3P14A 2Z1VA 3BZGA 5DELA 1NSJA 3K5XA 1I60A 4Q4OA 2PC4A 3BLLA 3UT0A 3CUHA 1ME9A 1MNZA 5LZLA 3SCOA 3AUOA 3DZ1A 1XLJA 5LNWA 2VTFA 4L7ZA 1OFAA 3O6YX 2R1LA 2IPWA 1EOKA 5D02A 4UQCA 2R8WA 1NWRA 1UWSA 2VO5A 2EQDA 3VIIA 1I2OA 1SJAA 2V0TA 2NUXA 2XN2A 5BWAA 4E6MA 3PNUA 1NDZA 3MO4A 4AD4A 1A5SA 1N82A 2NVDA 2CKRA 3KOZA 1J79A 3BTNA 5FJOA 1ELSA 1ZJHA 4GQRA 1HP5A 1P7TB 4QAWA 2ZX7A 2EHHA 2VRKA 3CEPA 3F03K 4V28A 1SUXA 2PWGA 1DOSA 3AHZA 1KBKA 1HKWA 3PC0A 4LRSA 2NXIA 3Q45A 1ZBCA 3UESA 1GW1A 3DYPA 1KD0A 4YPJA 2BB0A 1DJYA 3ZR4A 1UC5A 1B30A 5M5DA 5DMLA 5CZ0A 2EGZA 2CBUA 4PN2A 1U2YA 3TP4A 1R2TA 1FTXA 5A95A 2IPFA 3SQLA 3P60A 3L4WA 2AMGA 4X9SA 3WFLA 2QAFA 3VKDA 4M8UA 1Q13A 1H5VA 2CLLA 4PRRA 3R0DA 3I10A 1P43A 4HN8A 2AAMA 2QUMA 3KS5A 3UFYA 5CPLA 4CGTA 3SN1A 4MB4A 4WEVX 1G9HA 3LM7A 4WDTA 1DYSA 4RZBA 4AF0B 2TMDA 5FSEC 2BHUA 2FHFA 4PYSA 3W71A 3W73A 1OX6A 4UR8A 1HIZA 4JFWA 3NQ8A 3UA3A 3PBGA 3NDYA 3AYTA 4KRTA 3W81A 3ES8A 4LU0A 1D3HA 1G7UA 3AMGA 1CIUA 5EBAA 3LN3A 5HJXA 3T1GA 4P7NA 1UA7A 2EPLX 4Y7EA 4DJDA 1XGZA 1CBGA 3FDGA 4A05A 1LROA 2YCLA 1TZZA 3FAXA 3QYQA 3MWCA 3O07A 5IHRA 1DORA 3W7KA 3OVQA 2ESCA 1K8XA 4NQ1A 3E5BA 3EOSA 4J2MA 1CLVA 3OG3A 4QG6A 3CEUA 2X30A 4HYWA 1UPMB 2YSWA 4AYGA 1S5TA 4YN5A 2WBKA 3GYEA 4PFMA 2BBFA 3W53A 4A2RA 1UMLA 1E55A 1MW0A 5D2VA 4ZB2A 4C60A 1QBAA 3EXRA 2HS6A 3HJZA 4PC8A 4WGXA 1WXJA 2V6AA 4OOZA 1CEOA 1EJ7L 2C19A 3RG6A 4JYFA 3S42A 3TNBA 1JCJA 3M07A 1V7YA 1DIKA 1E72M 2BFGA 4H9UA 1B2YA 3IARA 4MJMA 5D9OA 3KWXA 4IJCA 2NZLA 4JY8A 3MCMA 1RAKA 1YXCA 3MV11 4C6IA 3P81A 5A2CA 5D9NA 1SFLA 1HG3A 2IS7A 1UD8A 5CPSA 4HBKA 1G67A 4NASA 3KCJA 2GGHA 3SIMA 4FSAA 1VFFA 3T6CA 3AXKA 4OVXA 2CZ5A 3B9OA 4H9VA 3T0AA 5FAJA 1EEXA 1WCGA 2XIOA 4U2ZA 1Q6LA 4UBPC 9XIAA 1I75A 1NF0A 3MJMA 4TXEA 2GJXB 1VZWA 2PDWA 4PBEA 4JKLA 1KFLA 1HO1A 3UJFA 4O0ZA 1LWHA 4IMEA 3WLNA 1LM1A 1EJWC 2HK0A 3S2NA 3GTXA 1F6YA 4DM1A 1UOZA 4R9XA 4DO4A 1E0VA 5LIYX 3JVAA 3TK7A 3DESA 5CPNA 3DX5A 2PDYA 3NURA 4REQA 3DHFA 5EFFA 4X2PA 4DUWA 2P0OA 4JXCA 3RILA 2QAPA 5TBOA 4TUFA 2BY1A 4NYYA 4FXRA 3DFOA 1D8CA 2VWSA 3QQ1A 1YX1A 3LS9A 2ZYFA 1T99A 1XPYA 4GH3A 4C7FA 2BY3A 1OYAA 1XCFA 2QF7A 4U33A 4O11A 1P0NA 3FSUA 4GYPC 4Z1CA 3R2GA 2CEQA 3ECQA 4XZBA 1ZS2A 3LERA 4PSRA 2ODOA 5I2UA 1KFKA 3ARVA 3SUSA 1XYLA 7ENLA 3AIRA 1TQJA 3OB8A 3SBFA 3P5ZA 2P1FA 3HPXA 1TREA 4V1YA 3HM7A 5AVNA 3LRLA 4XD3A 4LVAA 3JU2A 1JEZA 1UJQA 2YDSA 1A5BA 5DCDA 1B9ZA 4JEJA 2NWRA 3LEPA 2YW3A 1DVJA 2DIJA 1JD9A 2Z0IA 4DUOA 2OB3A 5E70A 3UY7A 3NFUA 4XAFA 4E8GA 4I5XA 5DLCA 4YTUA 1XFCA 1JDEA 4S1FA 3K8LA 5DEZA 1UD6A 2C91A 3M47A 4N02A 4PMYA 1OT2A 4HSHA 4ZE5A 1AL8A 3CJPA 3SB0A 4DZAA 4DPPA 1EKOA 5I3JA 2AGKA 3RAOA 4GLEA 3GR8A 1NOFA 2ZXDA 2CWXA 3ZVHB 5LIKX 1RPXA 1HJUA 3KEHA 4YHEA 1QI4A 3STPA 4PMXA 4CCCA 2HZGA 2C7FA 1PL9A 4B9ZA 3CV7A 1UQZA 3VUSA 3VCNA 3GIQA 1VRXA 4OGZA 4IMDA 1E1FA 4HJFA 3CT2A 4IQLA 2E28A 1JCMP 1EBGA 2OFJA 4TTGA 3HPAA 4CVWA 4RXGA 4DEFA 5GPRA 2CBVA 2ATMA 2Z28A 3REQA 2ABBA 4IPPA 1ZBWA 3CMJA 4KT2A 4J3WA 1CPUA 1Q7MA 5HA7A 1B0IA 2X0YA 2PUZA 2VFEA 4LT9A 3W1PA 2A6LA 2O0TA 4MDOA 1K02A 3B04A 1KM5A 3O0FA 3WLHA 4JOMA 1GEHA 5FEPA 5FJTA 1LRTA 4E4FA 2J74A 2ON3A 5CSUA 4LOCA 1ZENA 1JPIA 3OHMB 4IMFA 2JKAA 1VYPX 2XH7A 1O5RA 1VD6A 2CIPA 4AVNA 2Z27A 1U33A 1U1JA 2FMOA 3W72A 3KS6A 3MI2A 4RXFA 4U10A 4H9XA 3KLLA 4J1OA 3NGJA 4WF7A 2AOSA 1F5ZA 4WY0B 4O14A 5I5RA 2FIQA 5F2MA 3PZIA 3A4JA 2GWGA 3LTSA 3OYXA 4GUIA 4H6RA 4MNLA 2OGYA 2PTZA 2VJXA 3UEQA 3BG5A 2RDXA 5BOOA 4KWUA 5BOEA 1QATA 1SZRA 1EXBA 3GZ3A 5E09A 3VE9A 2PDBA 2XH0A 4JHMA 4G7EB 2R91A 4B91A 1FWSA 1JJKA 1CLXA 2R1PA 3CWOX 4GYPA 4LQ1A 3PSWA 3CH9A 2AGTA 5AOUA 2INEA 1I1WA 1ZSXA 2QJGA 3R11A 3THUA 3WQVA 3SR7A 4Q4RA 1YE4A 2YZ5A 1QNVA 3BW3A 2PWHA 3PUDA 1TPUA 2F84A 4UNIA 2OWCA 3G8EA 1PPIA 2B7NA 1JZ5A 4EOUA 3BMXA 4DHGA 1Y7VA 1H50A 1KXQA 1CGUA 2BXZA 1HL2A 5FJIA 2YLLA 4LUJA 4WHBA 3ERPA 3V0UA 4YJ5A 2FZNA 4JKMA 4FOKA 1K4GA 5HWMA 3EWDA 4GACA 3RR4A 4F2BA 1UWRA 1GJUA 1XD1A 3W24A 3F5KA 1AVAA 1JCXA 4LW7A 3UCQA 1WKYA 2D2GA 3O06A 4LS2A 3W7RA 3W7LA 1LL7A 5TNVA 1OWQA 1LP6A 4LY8A 1V4YA 1F6KA 2OLSA 2Y2WA 3H7VA 3KBVA 3RNDA 3QV6A 1XRVA 1W5NA 3V35A 4EP8C 5KETA 3EA1A 4GCXA 1ADSA 4ICMA 2W91A 1F9CA 4DUXA 4ATLA 3NL3A 3VO0A 1TCMA 1H7WA 5DX7A 2QCMA 2A5HA 2WPGA 3CMFA 3GX9A 4IZGA 4BHYA 1XHGA 2YA1A 2RJHA 4ICCX 2OR2A 3TJLA 3TC6A 1EB3A 3R43A 3H4GA 1TZ7A 1Z9AA 1JZ2A 3DHUA 2BVYA 4OE7A 4WX2A 3LD5A 2NQ5A 5D33A 5F7UA 3A4XA 3R58A 2WQPA 4XBJA 1DJQA 4W88A 2YBTA 3GVVA 1E15A 1I4NA 3EMQA 3KWSA 2I14A 4AVFA 2WC3A 4QE4A 3WBAA 1UUQA 2ZTKA 4EXQA 1KLZA 2V9DA 4HZ7A 4AZ7A 4JS3A 2I56A 3N73A 1ADDA 3W86A 4B15A 4XZWA 3L4TA 1VS1A 2J25A 4JTFA 1T96A 2W66A 3B3DA 1EGVA 4JTUA 2XUCA 3NOEA 4E0CA 3LMZA 1I1XA 4NKCA 3G1XA 4F66A 2WBGA 2E6DA 3TN3A 4GUFA 1E6RA 4L65A 3NZ1A 3PPGA 4JPGA 1M03A 3T05A 1VEMA 4AVOA 3SGZA 4ZVJA 5CPOA 3P93A 4DZIA 2HK1A 4MZ1A 2OCZA 5HXMA 3SSJA 2F6KA 2Q8XA 4NXSA 1ZAJA 4I6VA 4JIEA 5CH9A 1X97A 3UZZA 3KDOA 3W1TA 1OGGA 2DDXA 1C8YA 2V2HA 1W3HA 2GJRA 3PNZA 3CU2A 4LVBA 5HWJA 1T41A 3NNTA 3L9CA 6PTDA 3IRSA 3VOGA 1F8IA 1LBFA 3W1UA 1FCUA 7XIMA 4H8NA 1KLYA 3L0KA 1DEDA 4CD5A 3KBSA 3G0XA 2HTMA 3I68A 3U3HA 3B9EA 3TU9A 1KR1A 2V5JA 2DH3A 1FH9A 3W7IA 2WVVB 4JIIX 4ACYA 2E6AA 1XSJA 4CD8A 1FA2A 4KRZA 3WDRA 3ABRA 4IFOA 1UROA 3T7VA 3TONA 2X1IA 4IP4A 3VMOA 3SRKA 1OCQA 1B9BA 3NCOA 3RK8A 2G3FA 2RUSA 4UTJA 1MFVA 1TRDA 5BROA 2CHOA 1SSGA 3T09A 2DUAA 3CPGA 1CB2A 1UBSA 4CQAA 1OF8A 1NF7A 1HKMA 4MB3A 3WN6A 3TNOA 3LQGA 1SO3A 4KETA 1TWSA 4DYJA 3U2EA 1UH3A 1B5TA 2D0GA 2C1IA 4GG9A 2D1ZA 2YJQA 3OZOA 3NSMA 4BQ5A 3E74A 5HNUA 4YTSA 1VYRA 3LM3A 4KPLA 1IIHA 1ITUA 2PDXA 2F2HA 3RJXA 4ZL1A 1XM3A 2Z1XA 4BR1A 3S0CA 2YL5A 3LQLA 4F9JA 4IWWA 4R7JA 3JZUA 4MJ2A 4LALA 2DUXA 2Y4SA 3SUUA 3RIKA 1TV2A 2DIKA 5A8QA 3IGXA 3CAKA 1OEPA 3LCGA 5DANA 1PJ9A 1NP2A 2EG8A 5SWUA 1V6UA 1LUCB 4QRNA 3MZ2A 2QZRA 1XV8A 1ODZA 1Q6DA 1M6JA 4RDYA 4B3ZA 1JPHA 4L4LA 3WNMA 2E77A 5A6MA 1NVMA 4LAZA 1VBUA 1G4PA 1V3LA 2UZ9A 4G6CA 1GWJA 3IIOA 3PBUA 5AECA 3WNKA 5G1YA 1TX2A 1E9ZB 4PGLA 4C1NA 4RNFA 4ZODA 3TAKA 4IUOA 2V2CA 2VC5A 4YMZA 1QMLA 1SW3A 4AX7A 1XH1A 3NQ7A 1HKJA 2QKFA 3I7QA 1I45A 1IQ8A 4PCTA 4CEXC 3T78A 3G18A 2JF7A 4IMCA 1OVDA 2BODX 3BJSA 3DN5A 4B5XA 1OC7A 1XPGA 3O05A 1B4KA 4D6JA 1NOUA 1OFEA 4L1GA 2P10A 3IAPA 3U0HA 1ZAIA 3FYPA 4O10A 1IR1A 4HNNA 5EA9A 4EIVA 3V16A 1Z3NA 1QW8A 1X8CA 3GG7A 2V30A 3GNRA 3VU2A 4PUWA 1IZJA 3U6WA 3BICA 3T07A 3SCWA 3N6HA 1UJPA 4C5YA 3D3FA 2PDJA 1LBMA 1QU4A 1R5YA 9XIMA 2WLYA 2HVNA 1QPOA 1AFSA 3LA4A 3V5OA 3S6OA 3W2JA 1HT6A 3PZOA 2ICSA 1MEHA 3B8TA 3KP1A 1FXPA 4OV4A 2BHZA 1H51A 3WDHA 3FSTA 5J5RA 1KTBA 2DU2A 1AW2A 2IKGA 1J0HA 4CKQA 1TSIA 1Y5XA 3EB4A 3ME3A 3A13A 1LL4A 1WXZA 4CNOA 3DI1A 3G3MA 1P5BA 1OADA 3S8HA 1OSEA 5CPMA 1VIZA 1XIGA 2ZCGA 4GYJA 1BWLA 2QYGA 3MUY1 1C9DA 2OOGA 2GSHA 3STFA 3VGDA 4OKDA 2VKZG 3K8KA 3GW3A 3VPLA 1XGDA 1KM4A 2PPGA 4QJ4B 3OVGA 3LHTA 2QNEA 1HO4A 3M0IA 1VHCA 8TIMA 4O13A 3FLUA 1JULA 1EO5A 4YL2A 3RF9A 1BAGA 2CLKA 4JBRA 2VP8A 2F9RA 1Q6GA 3U2ZA 5LNSA 3QF0A 4TX9A 2NW0A 3P0WA 4XZ9A 2RH9A 2FZ8A 3WLSA 1FHVA 3W2LA 3E02A 2E25A 3L2IA 4O50A 2DSZA 4XVDA 5ABFA 2V2DA 3MW7A 3PBWA 3WKZA 3DENA 1I2PA 2V3EA 4BQ3A 1B90A 2VZUA 1NY1A 1F6PA 1RP8A 4YTRA 2QXWA 2E9MA 1DWIM 2Y5EA 4AZ5A 3R6IA 1T8QA 2QULA 1QPKA 4GHRA 3OLDA 2IPJA 1CGYA 3GE7A 4WK9A 2J7EA 2YL9A 2FDSA 3ID7A 3OYZA 4MJ4A 1TWWA 4Q4SA 3HGRA 4AIOA 4IGHA 3CAQA 3W29A 2G4FA 3BV7A 4FLSA 2JGQA 1YBQB 4JIQA 1SZEA 3MKVA 1C93A 1MXDA 3I4KA 1U22A 3VD7A 1RH9A 4NJJA 1KM0A 1E56A 4FS9A 3P6LA 5F2GA 2ONEA 1LYXA 4NAFB 1R38A 4JDYA 3GU1A 3IS4A 1H7OA 2GYIA 2Y8VA 1MUCA 1AJZA 1HN1A 5K9CA 3EEGA 4UQ9A 4W5ZA 1TIMA 2B7QA 3EGJA 4NILA 1XIEA 4CCZA 6ENLA 1A5KC 4FF5A 4B5NA 1QI5A 3PR2A 1JDAA 4QDWA 1VPYA 4ZA0A 2XFWA 4MY1A 5CZKA 1O1HA 1XWYA 2VR4A 3MQTA 5KZEA 3B0PA 1RQBA 1XIFA 3A6OA 4O0KA 3KE0A 3NGFA 3RXZA 1BPLB 1F76A 1EP2A 4JD4A 1K9FA 4O18A 2OX4A 4FHAA 3BAXA 1TA3B 1M7OA 2HS8A 2Y5JA 1E6PA 3NPXA 1V79A 1U5HA 4W7WA 4M82A 3VI2A 1EQCA 3WF1A 1D3CA 1KNWA 5RUBA 3UF9A 3M5ZA 1E40A 2R1MA 4IJRA 3O6CA 1CI1A 1XRFA 4KMQA 4NX5A 4WZHA 5LHFA 2QCDB 4NAEB 3WD3A 4AH7A 4TO8A 1O5KA 3AOFA 4K36A 5CJ5A 1HZYA 3VX1A 4Q4PA 2H90A 3B8SA 1TWDA 2C3ZA 1GNXA 3DYOA 2A0NA 4K7VA 3AZRA 4CN6A 4XBSA 2UBPC 1CXHA 1XG4A 4ROQA 3SJ3A 5C2XA 5CZJA 2DSVA 1W1YA 4U3CA 1FWTA 3WD2A 2WVUA 4HHMA 4CQ9A 1KXTA 2W67A 2O9TA 1DJGA 1KGWA 3MA8A 5DQPA 4DLFA 2V5KA 4I3GA 1P7TA 5DBTA 1QTWA 5D9PA 3CPRA 3VGGA 4QISA 4TMCA 3TOYA 3EYPA 3W00A 3W2NA 4E8DA 2WPBA 4XBKA 4XZLX 4O16A 3GH4A 5BMXA 5H1WA 2V5CA 4PMJA 3BXWA 1SMAA 1X6NA 3N6JA 3ZJ8A 5CEWA 1JZ8A 3CH0A 2CLOA 4WKAA 5JH1A 3PJXA 4NUWA 5FAGA 1TR1A 4M80A 2PA6A 4CN4A 3PTQA 2JF6A 3L2LA 1UHVA 4A3UA 1G1YA 4W7UA 4Y90A 4JHZA 1OQFA 4ZOCA 1UUMA 4MG4A 5E0CA 3W7MA 3L66A 4G9PA 2Y6ZA 1DP0A 2X0HA 3ALFA 3S9IA 4L4OA 5FF0A 3CYJA 3IIVA 3M0HA 3NO5A 2GVJA 1VPXA 1ICSA 6XIAA 4UMAA 4AF0A 1PZ3A 1UIOA 3T0TA 2OLAA 4AW7A 4ZSUA 2EBNA 3KRZA 2QUNA 4XTDA 3WQEA 1WXYA 4E2DA 4GQQA 4C1LA 1SM9A 2G3NA 3S5ZA 3C56A 3IJ9A 3FEMA 6CGTA 3VOIA 1W9VA 3QEZA 2JKPA 2DH2A 4YU1A 4P8UA 3KVMA 3TCSA 2XHYA 3VGFA 3E2RA 4CLMA 1PYMA 4JFVA 4YLWA 3LI1A 2VD8A 3GC5A 5M2FX 3UXAA 3USBA 2C14A 3O63A 4CN1A 5CBBA 1RVGA 3VINA 2VUNA 1TJ2A 4K1WA 1TZ9A 4PMVA 3MTWA 4WLCA 4U5IA 2D2JA 4FF7A 4N6EA 3TR2A 3CB3A 3AS0A 2XFYA 4GX8A 4CQCA 1UA3A 5U4NA 1ONEA 1FCQA 1E3ZA 4MB1A 5FOOA 4LV4A 4F0SA 3QJAA 4S38A 4GVIA 1P0KA 1W37A 3UERA 4XO6A 1QVBA 3EOEA 4ALDA 2CW6A 1ZY9A 2DSWA 3LLFA 3URQA 1SZGA 4FI4A 1MEIA 3FJNA 3TSDA 3RPDA 5HANA 5C6MA 1XINA 1I0BA 4D6DA 2I17A 1VFUA 3VC5A 4PUNA 4DXXA 4D8LA 1DE5A 4AMCA 3TYBA 2OSXA 3CQKA 4LV9A 4RUBA 4RV8A 3H2NA 3LZ3A 2E09A 1OABA 5I3DA 4GNVA 4QITA 1W1IE 1AW5A 3STCA 3B4UA 4FR6A 2VGIA 3TROA 2WWCA 1Z44A 5KSWA 5HDRA 1WDPA 2DJXA 3SRFA 2FFCA 3WIJA 1GW9A 5JBDA 2GJXA 3MDUA 3GXFA 4I9AA 3UWWA 2I5IA 3OO2A 4XIAA 1EXPA 4MFDA 3S5YA 4FOJA 2YCEA 4FR1A 3OODA 5U7SA 1DWHM 1Y65A 2DPEA 1W5OA 4JZ5A 4U28A 5CSRA 3LCHA 4AY1A 4Y9PA 2GFTA 1WUFA 4WUIA 5D2YA 1JF5A 2TRSA 5LXXA 1JF6A 5HNNA 3A47A 2WCGA 1MI3A 1LOQA 1MVYA 3HPSA 4PZVA 3A64A 3WL1A 3KVKA 1DJXA 4J35A 3PS7A 3GTHA 1W3JA 2PF8A 4NX0A 3LTPA 2JEPA 4AEOA 4R5EA 4LVDA 2P5NA 4IP5A 2J6XA 2E1WA 2OKTA 2YGYA 5BRQA 3ONCA 3AAMA 4E3VA 3XINA 4AYSA 5A8OA 1GONA 4S2BA 1N7KA 2ZZ5A 3T40A 5K2ZA 3G1FA 1EDTA 4UXDA 4Q3MA 1A4LA 3OIXA 2CESA 3AIVA 2X1TA 3ABSA 2XU2A 3EKZA 3FHAA 3KBJA 3VA8A 1UKPA 1ZJIA 2P3ZA 4KCVA 4JICA 3QN3A 1GVQA 1W9UA 1FFQA 3SRHA 1Q85A 2H3BA 4HSOA 2HDJA 1UR3M 3LPPA 5AYIA 3GY1A 2QW5A 1M7JA 2QCNA 4GZ7A 1W5QA 2WSQA 2X1RA 5C54A 1I2NA 1KFWA 3UNTA 1E9YB 3MC5A 1R86A 4M29A 5CGQA 1R85A 4IQEA 3TJIA 1JNEA 2ZUTA 3TN6A 1E5JA 2NQJA 3VNLA 4BQ4A 1FWWA 3WDIA 1LDCA 1TTQA 1EGMA 2IPGA 5DCBA 1ZB5A 5A8NA 4CVUA 7ODCA 4GZIA 2PWEA 3NEHA 1IT0A 2WVTA 2XM2A 3ARSA 4XD4A 4QCEA 2PS2A 3EMCA 4KKXA 1TG7A 1D7FA 3CL7A 3XISA 3CTTA 3II1A 3OZPA 4MVAA 3ZT7A 9RUBA 4XKYB 4Q6XA 3TIMA 3TW7A 2FZBA 5E6ZA 3Q4DA 1PX3A 1N55A 2DVTA 1XQLA 4GJIA 4AIEA 3ZVHA 1PDZA 2QCHA 1J10A 3OU8A 2NLIA 4S3EA 2PDMA 3LTYA 1YPXA 1JPMA 3NIYA 4MDPA 3KAOA 3TR9A 3DKLA 3OA3A 3PJUA 2VRQA 3VE7A 3M5XA 3QSTA 4JCLA 2DSKA 3TC7A 2VQUA 4OJYA 3KTSA 3MHUA 5EMKA 3O16A 5F2LA 3CZEA 4Q8PA 1JCTA 4ACZB 3WLTA 3KVLA 4DIAA 3LX9A 5GJPA 4M51A 3AHVA 3WEZA 1CXEA 1UR8A 2QPUA 1TB3A 2J7BA 2YR1A 2ZX8A 4KRUA 2XFRA 2IXVA 2YPIA 3QRHA 4FOUA 1CGXA 4GE8A 3SQSA 4UFLA 1A5UA 1J0ZA 3RMJA 5BMWA 3M0XA 5I79A 3L5LA 1XH2A 4FZIA 5C71A 1FWCC 1LOLA 3UETA 3UPMA 3T9PA 2VL4A 4N42A 3E0LA 4YS1A 4B90A 2V3DA 1OX5A 3AO0A 4IFKB 1F61A 4JNYA 1ZGDA 1VJIA 1KV8A 5A6KA 1XIBA 2E7FA 5TAOA 2ALRA 4HPGA 1FWEC 1R3TA 3ZWTA 4WD0A 1GYNA 5L9FA 1O5XA 3SCVA 3HG4A 3PJTA 3R94A 4PBGA 1DJIA 4WY0A 2QDDA 1M68A 3WH5A 1IGWA 1C8QA 3GG0A 3ITVA 2D2OA 2R82A 2Z1KA 4AUBA 4LF1A 4HA4A 3G1HA 4GY7A 3GH7A 5G1MA 2A1YA 3C61A 4P7QA 1KFCA 5LHEA 1DIOA 4H3DA 5BXSA 3MJYA 3C2RA 3GVGA 4G7EA 3QV9A 2W9MA 1XRSA 2WJEA 3BSGA 3BMWA 3EXSA 1DTUA 2QCEA 1K70A 3E3HA 4MUZA 3QZAA 3FIGA 5DN1A 2NUYA 2DFAA 3FA5A 3TCEA 1PTAA 2ACUA 3TMLA 2WWDA 1SJCA 4IMAA 2ZRYA 1EF2A 4S3JA 2ADAA 3QZ6A 4BF9A 1MMFA 1SW0A 1B3YA 2PURA 2RDWA 3FKKA 4E2BA 1WDDA 2HQAA 4WKHA 1XBYA 3OLEA 1WB0A 5HWNA 4GISA 2YB1A 4IIFA 4DVOA 1VBHA 2HXTA 1KM3A 4GINA 4J3UA 4LBUA 4MPKA 2QVHA 3NQVA 1JNDA 1GTHA 4ZOAA 3Q2DA 3DCPA 3NQEA 5BXTA 1GZJA 4EKJA 3HOJA 4KWOA 1GYMA 1PE1A 2B4GA 4JHOA 3L4VA 4C65A 3APGA 1TWZA 1JUBA 3THCA 5AB3A 1EF3A 3EWYA 4W9TA 3GS6A 1NOWA 3BO9A 3LNMA 3WLMA 4LNYA 3SADA 4IGSA 3TXVA 1IWPA 1YTDA 5C5YA 1RXOB 4ZOBA 1JAEA 1LQ0A 2XGZA 3CL8A 1G4SA 1PX4A 1V8EA 1WQ5A 1K9DA 1IWBA 1AQ0A 4Q8MA 5CG0A 3L7RA 5AC6A 1KKRA 3G1YA 3EWCA 5I3IA 1IT7A 3GD6A 3ITOA 4NP7A 4ZSTA 1YE6A 4PTVA 1KBBA 3VDAA 1S46A 3BLDA 1QPRA 2I5QA 3CHFA 3WLQA 3W22A 1XXXA 3TTYA 3ALGA 1JI2A 2D3NA 2WM0A 1WP6A 4FX7A 4J4KA 4HN4A 2O9RA 4KWVA 1QW7A 5A2AA 3L23A 1ZTVA 1QR7A 3AXXA 1JZ6A 1XW8A 1US0A 4CNSA 3VABA 3V1HA 3RRXA 1QI2A 1EJVC 4BF7A 5KTLA 1PIIA 3VIKA 5FI8A 3K4AA 2VEGA 4AXNA 3S9YA 3HMCA 1V3JA 1X8FA 2FH8A 1WZAA 4ERGA 1GYLA 1TV4A 3O8AA 3WFZA 3QY7A 3WLPA 3TTQA 3DIPA 5D8WA 1QHZA 1GG0A 3SQMA 1R9YA 4DAFA 1H7XA 5ENLA 3S3GA 3VIPA 1S1PA 4JL2A 3U5YA 4HK6A 3W7PA 3CZJA 4R53A 1KR0A 3NQGA 3U2CA 1QFEA 4ZQNA 1TFVA 3H26A 4L9ZA 4TU1A 4ES4A 1AZ1A 1BXCA 5EB8A 4F48A 3GBEA 3CT7A 2XWEA 3BGAA 4D9PA 3MI6A 3CUJA 1W32A 2YDQA 4J28A 4GIRA 4NJGA 1XYMA 5MKGB 2A3HA 1V6TA 3ES7A 4GH1A 3ZLFA 2XIQA 2B0MA 1E1CB 2W4XA 4QXIA 4F0KA 4LYPA 1EPXA 1TPC1 2W0UA 2O4QA 3CLWA 5JU6A 4CNUA 4WSJA 3IK4A 3HIJA 1GK8A 4HU4A 1HXJA 3EDKA 3UJSA 3DUGA 1PHWA 4C7DA 3FXGA 4C6OA 4QS5A 1XKYA 1CENA 5HJLA 1O94A 4JN6A 4HTBA 3RLHA 4IPJA 3T08A 5G2IA 1V03A 2PBOA 4PUEA 3CC1A 2VD9A 1KBIA 4WR3A 4A35A 2C8NA 2WVVA 3FYYA 5AFDA 2BS9A 1V7AA 1TVNA 3H70A 2ALDA 3NJ3A 3MV01 3VDHA 4GVGA 3PWGA 2G95A 4MLJA 1B3WA 3ITTA 3K1GA 3PWIA 4M19A 3ITXA 2A6NA 4J27A 1ONWA 2QIIA 1TPH1 5I3FA 2I9UA 5D04C 1ISWA 5G4HC 3W1AA 2WJFA 3A24A 3M0KA 2NVCA 5HR7A 2A85A 4JFTA 1SFJA 3ZR6A 1K8CA 1WDRA 1IEWA 1IXNA 2D2HA 1E51A 3ZS4A 3UYCA 2QMKA 2AQVA 1J0JA 3DHPA 1WDQA 2F8QA 2CZDA 3N18A 5D8ZA 1VLWA 2ZUNA 3BQ6A 1UZ1A 2C79A 4GVHA 2BWGA 1GVYA 1UYQA 4L6DA 4EPDC 3ONBA 1LT7A 3MBFA 4GI8A 3QV8A 3U4AA 1JDCA 1TJRA 2EPOA 3O6AA 1JYVA 3F2DA 1XLBA 4R7OA 4JQ4A 3F4VA 4H8VA 1MWOA 3TVAA 2QMJA 1QOQA 2XGBA 4UTKA 4Z08A 1LUCA 4NY2A 1K7FA 2QJJA 4DRSA 3AROA 4M24A 2I7GA 1J0IA 3KP0A 4JN7A 1QPQA 4A21A 2R1NA 2I1OA 4O4WA 3CPUA 5FA5A 4S39A 1VR6A 1R3QA 2FTWA 3UNDA 1ITCA 2HSAA 3CIVA 2E3ZA 3KCOA 3I7SA 5M17A 2WJZA 2G3MA 1OFQA 1XLFA 4L6HA 3B8IA 4L61A 2WM1A 1WA3A 2IQDA 4DB7A 4H8HA 3AIBA 3H4XA 3H2FA 1S38A 2PRMA 2DT1A 4M1RA 3G24A 2Z2AA 4KFNA 5LIUX 3TV8A 1I0DA 4GXWA 3ZWSA 2Y8KA 4DQWA 3EKGA 1XL9A 1IV8A 2CLPA 3DECA 4L6OA 4G56A 1GKRA 2HV5A 1F3WA 1M41A 2FZDA 1TE1A 3P3BA 3RJYA 2WANA 1Q2SA 3TLQA 2E9LA 2GGEA 1QO5A 1E0UA 1UR2A 4DO6A 3LY0A 4HMDA 4DJFC 3P61A 3AYSA 4QNEA 4H4IA 4O8AA 3TQPA 1PCKA 1XISA 4IGNA 3GK0A 1E6XM 4HYRA 5JXQA 4F4RA 2ZXAA 1VFLA 1V02E 1P6CA 1TVPA 3CGTA 4EK7A 4KFPA 2PLKA 3NG3A 3MMTA 1F05A 1JZ3A 4NYUA 4UMCA 5LA1A 3L5AA 2GJLA 1W6TA 2PRLA 4A29A 4UTIA 2DQXA 4ML9A 1CYGA 5HMSA 4BEUA 3ORWA 1BG9A 5LIWX 4RE2A 5CC6A 5FF4A 1L9WA 3A4WA 4Q33A 1W1PA 3NZGA 4QSHA 2GVGA 2FPVA 2A3LA 1FWBC 2QJIA 2BSLA 1QNSA 1V6YA 3IJ8A 1GHSA 3WK0A 3R79A 1W9PA 1JXJA 2QHAA 4IQJA 5FEWA 4AIBA 2OTDA 4GQBA 2HRWA 4UQBA 4L56A 1EC8A 2J7FA 3GVRA 3L5MA 3W38A 1W3NA 4QG9A 1JUEA 3GTNA 2Z2BA 1P48A 4PTDA 3IK2A 2Q6ZA 4IX0A 2DVXA 4DJFD 3LMYA 1AQHA 4POCA 3LXCA 2C16A 4Y6GA 3UY8A 1HNYA 4MWAB 2QCCA 3OZMA 3WDJA 4MOZA 4CD7A 1DWGM 2ZA3A 4I8YA 1JL8A 3AHTA 2OXNA 3N2BA 3W7QA 1MW1A 4MM1A 4NZ1A 3BGGA 1PIGA 4GYFA 4HMEA 5EMJA 3W2UA 5MHBA 2ZZ4A 3C2YA 1JD7A 4DM2A 3UA4A 3DBPA 4IUGA 2CC0A 3BQ5A 5DMMA 1K8YA 2XSXA 3M44A 3WJSA 2AKMA 2V8ZA 3W1QA 4YVVA 5ABTA 1OF6A 5LKYA 4IIGA 1Q7QA 1W3TA 1MW2A 1O66A 2GSJA 1QHOA 4P8WA 4I7WA 3AWNA 5CBIA 2IXUA 3O15A 3VKCA 3W9ZA 3LG3A 2PLMA 3KOWA 1I2QA 2DZUA 1YBQA 4O1DA 1QWKA 1UP2A 1DJWA 2ZXQA 1YRRA 3EA3A 1V5XA 3QR1A 3NXFA 7PTDA 4LY4A 2CLEA 5BRBA 2YX0A 3D3AA 3MSGA 2HNHA 3GG8A 4GBDA 3TE9A 2NXGA 4PMUA 3OP2A 2CLIA 3S83A 4NAFA 4A6GA 3ANUA 3C0SA 2TYSA 3CQIA 3OBKA 1XDMA 3AWOA 2YL6A 3V5CA 4UB9A 4ZO9A 4K8EA 4LF2A 4H2CA 4Z2GA 3LNPA 4AY8A 4RK8A 3DG7A 3W6MA 1FHDA 1VYSX 3S4TA 3ZYZA 4H01A 2D69A 3PHAA 4HA0A 5EY5A 7TIMA 5FEZA 4OQVA 5CJMA 3NL2A 3GR4A 3RX4A 3L4YA 3FHQA 1E6NA 2Z6IA 1WKDA 3FV9A 4JTLA 1KRMA 3OBAA 2PD5A 3GXPA 1ENUA 3S1VA 4XVEA 4DY1A 1G5AA 1TA3A 1OZMA 3ZJKA 1VRDA 3HPFA 1LZOA 3EX2A 3R8GA 1BF2A 4RNIA 5EBUA 3VTRA 3AC0A 3BL3A 4KERA 4DJFA 4WDXA 4D6HA 4PCSA 2I5GA 4H6QA 2AL2B 4JTSA 4AAJA 3ITCA 3QGKC 3NVTA 3S6DA 1S5NA 1R30A 1K03A 3TTEA 2QCDA 4NAEA 3EDJA 3LCIA 1IEXA 2WNQA 2PDKA 1Z7AA 4MZYA 2ZVIA 1ZLPA 3ZSSA 1UKSA 8XIAA 4JX6A 3N14A 4UOQA 4F8XA 2PDCA 2QUTA 2D73A 3EX4A 3HJEA 4WQ6A 1LRQA 4WVXA 3TYEA 1K8ZA 4BY3A 2DUZA 2HXUA 3BOFA 3S1GA 4TQTA 2BXVA 5AHNA 3UP8A 2W27A 2AMXA 4QQ3A 3N11A 3CIXA 3UCCA 3PFMA 1B3XA 3CAVA 1HJVA 3RCYA 3GC2A 3UVAA 1UH2A 3Q94A 2VEFA 1LT8A 2V81A 3RCNA 1XUZA 3PZ9A 2YYTA 3WK1A 1TMLA 4O15A 4MY9A 3ELFA 1XX1A 1OJXA 3WUFA 3VIHA 3S5SA 3I3EA 4A2SA 3LV5A 3S46A 4UTUA 2A3AA 4B2DD 1XLGA 3A4AA 1G4TA 3ABQA 3PZQA 2J88A 4TR9A 4F0RA 3SRDA 4R27A 2V5BA 2VX5A 1Q6EA 1E4LA 2F7FA 2YOCA 2V38A 3DGRA 4QM1A 1EH9A 3M5VA 5A6JA 2VOTA 4WJEA 2ZZ6A 1DJHA 1W91A 5HMDA 1E71M 3HZ3A 4NVTA 4O19A 3EWXA 4OFCA 4RNHA 3VM7A 1EPVA 4XV0A 3GDRA 1ZCCA 4KH2A 4I8DA 1QW9A 2Z1SA 1OINA 2CITA 4MIMA 1A0CA 4MWAE 2FB3A 2WMHA 3KRSA 5TF0A 4GKTA 2EJ1A 3H7RA 2G4JA 3LK6A 1J01A 1LLWA 3WH6A 4KEVA 1VBRA 4M1BA 3TYCA 3CUIA 3DFNA 1TTJA 2YBVA 4RE0A 5IDIA 1S5MA 3AS1A 5A6BD 1S3HA 4B5UA 3FAWA 2OEJA 4AZCB 1TJ1A 1X96A 2FZMA 3QQWA 9CGTA 5I23A 1RCOB 3D5HA 2EG6A 4HK5A 1EX1A 5I6SA 1M9HA 3W1NA 2YKKA 4DJDC 3VZYA 2VI0A 1HF6A 1MZHA 2ZRUA 1S5WA 1TR9A 4UC5A 2OZ8A 2ZE0A 1EYWA 1UD3A 1YKWA 1FWNA 2FZ9A 2GUBA 2X40A 5IM51 3QMSA 1BKSA 1BG4A 3C4UA 3CHDA 4P8XA 2G50A 3EXTA 4C91A 1ISVA 3MHGA 5GJMA 3PTMA 2GWNA 2HPMA 3M64A 3BSMA 2E5CA 1XLAA 3G6MA 2W79A 3TC3A 5T91A 2PTWA 4ILSA 1YDOA 4HPNA 3GLCA 1FDYA 3WLIA 4B2DA 2FGZA 2QDGA 2VDIA 3GRIA 3E2SA 4XZNX 1OX4B 1TTPA 3LYEA 5AC5A 5PTDA 3JUGA 3BOXA 2DW6A 5BCAA 3VAVA 1UD4A 4FO4A 3ZMRA 4ZEPA 3WMSA 1JRCA 4QSFA 3C8FA 4W7VA 3U9IA 3LHZA 3WK2A 5CCZA 4EAMA 1H1ZA 3IUHA 2FGBA 3TN4A 3LZ5A 4AD0A 4P61A 1B57A 4DJDD 2Y1HA 1ISXA 2FYMA 5C9RA 4QLLA 3W7CA 3P82A 5KZDA 3N17A 3MWAA 3CL6A 3N04A 2GQAA 3HF3A 5A6SA 1XYFA 1W17A 4W85A 1K77A 3BV4A 3PM6A 2X1UA 1XI3A 4UOZA 3GB6A 4ZO7A 3OIHA 3IAQA 4V1XA 4JL1A 4LPCA 4W8BA 3H24A 2Y8UA 3C0JA 4EPEC 2HCVA 2V68A 3MI3A 4GBUA 1PX8A 1OFBA 1IEIA 5A6BA 4I7UA 4HNOA 1B3OA 3UXLA 3JR2A 1JRBA 2PGWA 4NJKA 5BU6A 3PVFA 4K39A 4HA3A 5EL1A 5D38A 3UG8A 1RBAA 3K2GA 1PWMA 2QGHA 1FDZA 5EPDA 2DZAA 4JTRA 4R34A 3RLUA 2FB2A 1WZMA 4ZO6A 1G7VA 3RPTA 4C6CA 3C6CA 2PGRA 4XZMX 1EIBA 4ZB5A 4GY1A 3UPWA 2XSAA 1FHLA 3FYOA 3SSZA 3FJLA 3SCRA 3GNXA 4U2YA 3AYVA 3DOPA 4GC4A 1YMYA 1R3RA 2OPJA 3MSDA 1KTNA 4B5TA 1Q4NX 5CAKA 5FACA 3VILA 2PDLA 3M1ZA 1QPNA 2EXOA 3JW7A 3LPOA 1EZ2A 1RPKA 3NM3A 3J7HA 1MXGA 1NH6A 5F4XA 1DKWA 1PKLA 2VZSA 1K6AA 5AYZA 3ITLA 5E9XA 2ZZ3A 1TPB1 4YVPA 4BS0A 3GG1A 1XYZA 3MCNA 4OU1A 2WMGA 1GTEA 4Q8QA 2GQ8A 3S2MA 3VKJA 4BI6A 1ZL1A 4MKSA 2GVYA 1ZPTA 2BOFX 4KW2A 2CETA 1CXFA 2OT1A 4D6CA 4PTWA 1WZKA 3EZ4A 2ISSA 3AZSA 2WJDA 3L65A 4XKYA 1A5OC 3A9BA 2J79A 3GKFA 1KGXA 2X16A 1VIWA 4GXPA 4YVXA 3E12A 1BQGA 2W61A 1H0IA 5CSSA 3D0CA 1CT5A 3T8QA 4WRHA 1H63A 3IUDA 5LIXX 1J0YA 5JQ9A 1UKOA 3UXDA 3GAYA 2RHGA 1SZNA 2I16A 3G0SA 3GU9A 1D3GA 3KRBA 5BZAA 1H7RA 2PP1A 1VKFA 1BSLA 1E73M 3S6TA 3BOLA 1OFOA 1NDWA 3QOMA 3KRUA 4DWSB 2BP1A 2YFOA 4ACZA 1A0DA 2DJLA 3MVIA 3T81A 1V0LA 2DQWA 5LYRA 4AEFA 3WBYA 3GYCA 2CXGA 2YXOA 3EPMA 2DGAA 2BGNE 3EWWA 3IIXA 1H60A 1DWFM 2Y70A 1V08A 1JQXA 3RMEA 3ARWA 3CB8A 1OD0A 4V15A 5C7HA 3L4UA 4Q8VA 2E4TA 4DJEC 3VNDA 3W7DA 3VNMA 2FLIA 2HEJA 1O1ZA 2QVNA 3AS2A 3W1XA 1J0KA 4XAGA 1YADA 2BX7A 4DI8A 1FCVA 3H12A 3CZKA 4CCDA 1KCKA 1SR0A 4WSKA 5EU9A 3LV6A 2XDFA 2CXEA 3H2MA 4IFKA 5A8GA 2FJUB 5K9DA 2B81A 2G0WA 2DZSA 1HJXA 1W56A 3BCFA 1RZMA 4GJ1A 3PB2A 4IQDA 4M3PA 3TJ4A 5AHFA 3W7EA 1F3TA 5E0FA 4LJ3A 1XDLA 2QGYA 3QVQA 4BA0A 3NL6A 4MMWA 4KESA 1EC7A 2PODA 5FSDC 1AL7A 4GGHA 4PSPA 4PUJA 2J8GA 4FK9A 1TYGA 2WKJA 3AMDA 3HURA 2ZUMA 4IG2B 3AYRA 2PDFA 3QXBA 4JQAA 3B06A 4RDVA 4JNMA 2VCCA 2WLZA 3CK5A 1VENA 4LXFA 4DJED 3AIEA 3VGHA 1BWKA 1FKWA 3ABZA 1EP3A 5C55A 1PXGA 1OC5A 4G1KA 2E67A 3IIPA 1FWHC 1TJPA 2XFFA 2ANUA 5FESA 4LUYA 5JH2A 2PI6A 2WQDA 3WH9A 1AQFA 3STGA 3B9DA 5IRPA 2XYLA 1KXHA 2W63A 4M6VA 1QI3A 2EPKX 4QNWA 4ZXOA 3MT1A 1RA0A 1E3XA 1W1B1 2YYUA 2J47A 4M6PA 4GZJA 3FJ4A 4W8LA 3DFTA 1ZBKA 1V6WA 3UXKA 4JAWA 3LCFA 3VGBA 2IKHA 4N9CA 4AISA 4B3KA 2LLEA 2NQZA 3VIGA 3GXNA 4LWWA 2RDUA 3W25A 3S9ZA 1ZP4A 3SY8A 2P88A 4GUHA 2VCAA 1LTDA 3BDKA 4FX6M 5FCZA 6TAAA 3NA8A 4UCGA 4L4PA 4XZHA 2GQ3A 2Q3RA 3KTCA 4PR4A 5IBXC 2DT3A 4CU8A 5DY3A 3CQ0A 1RBLA 3R5EA 3KZSA 3UWQA 3B9NA 4ZZ9A 3IJIA 1H7PA 3NVDA 1VJSA 3E0FA 3MDWA 4KS0A 1CXKA 2ZTJA 3ZJ7A 3PB0A 2DVUA 1YW1A 2XVPA 1VLIA 1RY8A 3SURA 4R3UA 2G3IA 3F5LA 4E8CA 1C7SA 1TMQA 2CHRA 4LCSA 4X22A 2XN1A 5DRIA 5HK4A 2ZZ2A 4HYVA 4AC1X 3GNNA 3M9YA 1UWQA 3TFCA 3R13A 3MP3A 1O68A 2OWWA 4D1IA 2E6FA 3GVQA 1N8IA 4MF4A 1KW1A 3B05A 4DJEA 5KMYA 1PKMA 3WQGA 5HINA 3PG8A 3DFSA 1RJQA 1MEWA 3KXQA 4H7CA 4E4PA 4HU3A 3W88A 3TOPA 1JGMA 3GIYA 3NZRA 3R8RA 2HJPA 4MFEA 1UWUA 3C2VA 3DG6A 2ZZ7A 4AZBA 4RL3A 5KINA 3KCLA 1UH4A 5C0QA 1HKIA 4RCXA 3PN8A 4LUSB 3NEVA 3GNOA 2WMIB 1R3VA 4MADA 4JQ2A 2OOFA 1V02A 3CTLA 3NQBA 3UD6A 1UD2A 5E5CA 1CX9A 2NQLA 4K1GA 3DFHA 3T2PA 5MKGA 5B80A 1E1CA 1QASA 3CAWA 4RZ6A 2OEMA 5LGXA 1NEYA 1L0PA 2IKJA 1GGOA 1KCLA 3BMVA 2X8RA 1UWAA 4PEEA 4QE1A 1OFPA 3LSCA 1O95A 2PWUA 2XIMA 2MUCA 3W7JA 4AFYA 4DLMA 4UQEA 3QGAC 3K4WA 4PA8A 3WF0A 3B0VC 2FHCA 2QV5A 1G0CA 2VC6A 1QCWA 1P1MA 4MKNA 4GD0A 4ZFCA 1YXYA 2ATSA 3N4EA 3DHDA 3W83A 4PTMA 3BGJA 4AD5A 1WBJA 2NT1A 1C91A 4HNVA 3F7JA 1WPCA 4B5VA 5EMUA 4CEUC 1V3HA 1EWEA 1VCGA 1DQWA 2WW5A 3DFYA 3FDKA 4TVDA 4Y9AA 2J9ZA 3T42A 3B8DA 4GWEA 3H54A 5DF0A 3CLMA 4JIPA 3F4WA 1S2AA 2E8ZA 1RA5A 2V3FA 1QHPA 1ONRA 4H83A 3EX6A 3VIOA 4H6KA 3VCCA 3IEBA 4B3LA 1SPQA 4ZQMA 3M0YA 1XYCA 3WUEA 2NSOA 4MWAC 4L1XA 4F79A 4A8IA 4WGHA 4FP1A 1UW9A 5IFPA 2WMFA 5DRCA 3QFEA 5LSMA 3VZXA 3SY1A 1G6CA 2C71A 3GDBA 6REQB 2VFHA 4QLJA 5IBXA 3N2CA 2Y61A 1BSIA 2IKIA 1EC9A 4F40A 2FGLA 2XZ7A 2OYMA 3WH8A 1XG3A 3TX9A 3S1XA 4UTFA 4US6A 4AQLA 1Q6CA 2FVKA