4NJGA

Crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxypterin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-carboxy-7-deazaguanine synthase
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Lyase
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njgA00
5HMSA 2DU2A 3W1RA 1GT8A 3CEPA 4HT3A 2A85A 4O54A 1XC4A 3GDMA 2C19A 3W72A 3DFPA 1KFLA 4E0CA 3SI9A 4YL2A 3IGSA 4UTJA 5HJLA 2RDUA 1TJRA 2TSYA 3O07A 3S0CA 3C52A 3DFTA 3BPWA 4RCXA 4XTIA 4DXVA 4JTGA 1NFBA 3LXBA 4O50A 1Z41A 3CEUA 1OJXA 3PAJA 3S1VA 4Z1DA 3O16A 4HPJA 4K39A 4O1DA 5CPOA 3DBPA 4NJGA 3PG8A 4UCGA 3TA6A 3LCHA 1BTMA 4MY1A 2W0UA 3EX2A 5A5WA 1KW1A 1QDSA 4CQ9A 4RR4A 1OHLA 3QMTA 1RR2A 4QNWA 4J9JA 3PG9A 5KMYA 4ALDA 4QAIA 3F1QA 3ATYA 4UIOA 2O7SA 4KKXA 3M16A 3TR2A 3IVUA 3P84A 1YADA 3OVPA 4O4WA 5FEZA 2R14A 3MI2A 3QC3A 1EP3A 3S1UA 5HR7A 1EUNA 3LCGA 1OX5A 2W6RA 3BLIA 4FNSA 2E6AA 3NL3A 5D32A 2WQPA 3UWQA 4IWWA 1KTCA 1ZHAA 3F03K 3PBUA 5HWMA 4HN4A 2BSLA 2OX1A 4A2RA 5K2ZA 2CLIA 2A21A 3N3MA 4BI7A 1H62A 2WJZA 2VFGA 3ZS4A 1XBVA 1OYAA 1LOLA 3LX9A 1F6PA 2YR1A 3G1HA 5G1TA 1QPNA 1TV8A 1JULA 1XFBA 5CPMA 1SSDA 5K7JA 2BXVA 3TDFA 1LORA 3G0XA 4XZ9A 3UXDA 3T55A 4MYAA 4PEKA 1J5TA 4DO5A 3SIZA 2V5LA 3I7QA 2A5HA 3V1PA 3LHTA 3GXPA 1H60A 2X1RA 3LRKA 3DI0A 3IIPA 3QPZA 3NG3A 4HSOA 3CWNA 3P8JA 3EB2A 3TFCA 1A53A 2CFFA 4O15A 1KM4A 3L5AA 1OFBA 4LVAA 2H6RA 1OX6A 4M5PA 2J6XA 5SWUA 3G1FA 2EHHA 1VCFA 1GG1A 4NQ1A 1TPWA 3S42A 3W2KA 4BF9A 4E2DA 1GVOA 1H1ZA 2WSYA 1F6KA 4Q4KA 3W88A 3I6RA 3L21A 2NUYA 3MMTA 3TH6A 4S1FA 2RH9A 4PODA 2Z2UA 4QISA 3W84A 4BI5A 1F7BA 3QEZA 1B4KA 1LLWA 4A3UA 1YYAA 4N9EA 5EKYA 3TK7A 2BZNA 5K9DA 4LV4A 4O1AA 1F05A 2C16A 5FF4A 2ZRZA 4O1BA 5HUPA 2ZBTA 5EPDA 3W73A 4FNRA 3I68A 3O1NA 3UWWA 4ADUA 4Y9AA 3GAYA 2OZ0A 1AK5A 3LV5A 3PSWA 3H54A 2Q3RA 2CZFA 3S1WA 3KVMA 3QSTA 2A7NA 4MJZA 3O63A 3TU9A 4FEZA 3RFAA 1PCWA 3P8IA 3WJXA 4PA8A 3M47A 3RMJA 4AVFA 2DZWA 4AAJA 3G1YA 2Q3OA 4AHQA 1QOPA 3U2OA 4JTHA 3LDVA 4NNBA 1R46A 1G4TA 2JK2A 1G7VA 2VXNA 4AH7A 3P80A 4JTEA 3LRLA 3BK0A 4WOQA 5LNVA 4JY8A 2B7OA 5G4EA 3B8DA 2NWSA 3W2LA 1YXDA 3BV4A 2GJNA 1W5OA 1U5JA 1DL3A 1FX6A 2GJLA 3CQ0A 1I4NA 4CQ8A 3W85A 4EF9A 1W56A 1O5KA 1YXYA 3GXTA 3LTYA 3FOKA 4LRTA 4K7YA 3LTPA 4HSNA 3CB8A 4MUZA 5FEXA 4LVFA 4Z08A 2QCEA 2WPBA 4B5NA 1DBTA 1O95A 2C0AA 3W2UA 3HGJA 4GJ1A 3MP3A 1C9DA 5H91A 4AWUA 1QNVA 4O11A 1JRBA 2YW3A 3G1SA 3NOEA 4JIQA 1HO4A 4DBEA 4LVDA 1D9EA 2PC4A 3W2NA 3PUOA 3A24A 1Q6QA 1KFEA 3S9YA 3TC6A 1Q6LA 1QO5A 3CC1A 3GYEA 1JCLA 2B7QA 2QCDB 4CLMA 3DZ1A 3RLVA 4O52A 1Z48A 2CLOA 1QFEA 3N9RA 8TIMA 4NUWA 2Z1BA 3E49A 1OFEA 1KM2A 3BGJA 4OWGA 4H6KA 3UY7A 3N34A 1W31A 4QQ3A 2AGKA 4JTIA 5DLCA 5C6MA 4MZ1A 4LY8A 1SQ7A 2YDAA 3FLUA 1X8FA 2EGZA 4OGZA 3KXQA 4M7SA 4NJJA 3W83A 4HHPA 4IXHA 1ZCOA 1X7FA 2PRLA 3W6YA 4OQVA 4FX6M 2A6LA 2J9YA 1TPDA 3N14A 3HIJA 2D73A 1TPVA 3OHIA 1H7NA 4IPIA 2NUWA 4JNMA 3QW4B 4R34A 1FWRA 2ZRVA 3W2MA 2ZTKA 4JYEA 1MO0A 1KM1A 5I3FA 3W75A 2GVGA 2ISVA 3QPYA 4JICA 1TPB1 3MYOA 1QCWA 4RLIA 5AHNA 2C6QA 2ZRWA 1KM6A 3C2RA 3ABSA 1DV7A 5ABTA 3S6DA 4R53A 3GAKA 1DHPA 3W74A 2ZZ4A 2BLEA 2NXHA 5K3VA 3U6WA 1IXPA 2E09A 1TQJA 2C3ZA 5BMXA 1LCOA 2HTMA 3PUDA 3G8EA 1S5VA 1Z42A 3UYCA 5HQEA 3FA5A 3HGSA 3ATZA 3W86A 3EX4A 1TTPA 2A2IA 4UTHA 1JUEA 3KVLA 2VFFA 4UR8A 1IGSA 3FYOA 1EP1A 3TMLA 2NLIA 4M6PA 3WJSA 4GNJA 2FFCA 4GUJA 5HWNA 3TAOA 4UMAA 2QEZA 4LS1A 1WQ5A 5D38A 1EB3A 3KOFA 2DORA 1CI1A 3S5OA 1QPQA 1SZGA 2ZZ2A 1L6YA 5CZJA 1HL2A 1YPFA 2C18A 3M7WA 4JXCA 5KSWA 4EF8A 2TRSA 1LYXA 7TIMA 2FLIA 2QR6A 3W7EA 2A4AA 2V0TA 3LCFA 3SSJA 4Z1CA 3B0UX 3C0JA 1DOSA 3KRZA 4POCA 3TJXA 4UR7A 1VPXA 4ZQMA 2RHGA 3QZEA 3TQVA 2R91A 3W7HA 5DXXA 1TSIA 5U7SA 5CSSA 1PCKA 1KLYA 4Z0JA 4Z0SA 3C2OA 1OFPA 1KFJA 4HNTA 3E0IA 1WAUA 2DZPA 5D37A 4JYDA 5LNWA 3QM3A 4KWVA 2CU0A 5KITA 1G7UA 3DFSA 3M6YA 1KTNA 3GK0A 1GG0A 2C13A 2ZA3A 4CNOA 4I7UA 2GPTA 3A5VA 3LBCA 3T4CA 3GB6A 4JN6A 1FUYA 4N9BA 5DXYA 3GX9A 4P61A 1U83A 4NJKA 1ALDA 1Q6OA 4UUIA 1SZEA 1H7OA 4JY9A 1IXNA 4QNEA 5F1UA 4UTKA 3GVGA 3W22A 2E5BA 5DY2A 4N6EA 1VYSX 3C3NA 3OG3A 3B05A 1C8VA 3P74A 4R7JA 3EWBX 1RZMA 1RQHA 1PIIA 1ZAIA 5LKYA 1SO6A 3QMSA 1LROA 1XXXA 4MY8A 2E1DA 4YLWA 4DF1A 3M5VA 4X3ZA 3TC7A 5HNRA 4X2RA 3EWWA 1H61A 4M19A 4RJEA 3Q37A 2VFEA 3W1UA 4IQLA 3S5YA 3T78A 4L4LA 3UPWA 1ADOA 3W70A 1OF8A 4L4MA 3DHFA 1TPUA 2Y70A 3P60A 3PBVA 3W7RA 1S5TA 4RZ5A 1ZAJA 3CPRA 2XN2A 3HG3A 2JKEA 2NWRA 3IIZA 1V7YA 3T44A 2OMAA 3WK2A 3W7LA 1KV8A 4LVBA 1KM0A 2FQIA 1T96A 3HGRA 5IM51 5HR6A 4XBKA 1EX5A 2Y85A 5MHBA 3LI1A 5FI8A 3W1XA 4UFJA 1OX4A 4C1LA 4LNYA 3CLMA 1EWDA 5BW6A 3GDKA 2ZRUA 3NL2A 2HSAA 4RXGA 2XN0A 4FXRA 4KFNA 3THQA 4MFEA 1G67A 3A21A 4K6AA 4X22A 5C5YA 1FBAA 3RF9A 4DQWA 5CPNA 1W5PA 3M5XA 5D05A 1VC4A 4A22A 3MO7A 4N4PA 3BG3A 3DFOA 5F2MA 1FWWA 2WV8A 4DPPA 1IIHA 1KFCA 3HOJA 4RZ6A 4O57A 3MI3A 4I9AA 4AHOA 5CZ0A 3JR2A 3QH2A 1LBMA 3NQEA 4GE8A 5KINA 3LM7A 5CSRA 4IOTA 2B7NA 3NPXA 3STFA 1I2RA 3PS7A 5U4NA 5GVJA 5HINA 1QMLA 1YPIA 1ZENA 3LBMA 1WOBA 1LRTA 3G24A 3NAVA 3M5ZA 3S5NA 3L68A 4XQ6A 3WJYA 3R89A 2H3BA 5I3GA 1AW1A 1Z44A 1A5BA 4FIRA 4NT0A 4NX0A 3W23A 4GWEA 1TV5A 1WBHA 4NVTA 3BG5A 1OK6A 3DU0A 1KFBA 4BI6A 4LS2A 3NQ6A 3TCEA 2NV1A 3P7YA 5HULA 1I45A 3K30A 3MBFA 4RV8A 3A23A 3KAOA 5D03A 1J4EA 1WDWA 1FDYA 2V2HA 2CLKA 3BARA 4Y8FA 3FEMA 1B9BA 3L67A 4XKYB 1I2NA 3S8HA 1TPFA 1JCNA 2F84A 1CX9A 2V81A 4WOZA 4WXYA 3QJAA 4LWWA 2ALDA 3L0NA 1GTEA 1VH7A 3L5LA 2BWGA 4U28A 4OBTA 1UUMA 4UMBA 2ZTJA 4FHAA 3LHZA 5H2ZA 1E51A 2FPVA 4Y96A 3VE9A 5F4SA 3HMJG 3I65A 3MUXA 1GVFA 5C2XA 4PL1A 4FNTA 1HUVA 5D2WA 1JCXA 4A29A 3EKLA 2FPTA 4OV9A 3P5YA 4QJ1A 1VJIA 4ZQPA 5D04C 3B0VC 5F1VA 5G4WA 3MBDA 3SZ8A 1W54A 2BTMA 3BG9A 3DXIA 3GDTA 3EWYA 1XDMA 1TB3A 1W5MA 2GQAA 1SZFA 1HG3A 1F74A 3CU2A 2ZZ3A 1L9WA 1D3GA 2JBMA 3ABOA 4IPJA 1LLZA 5T26A 5D09A 3QFEA 3ZFHA 3TXVA 2OJPA 3W1AA 2V9DA 3EX6A 3KVJA 3NQ7A 3RNDA 3NPVA 1MEWA 3GNNA 1SPQA 1IXQA 4AB4A 1IF2A 3TSMA 4R33A 5AYXA 3WK0A 1SO4A 2CWNA 1NVMA 4Z1AA 3NQVA 5C54A 4CCCA 3O6YX 1DQXA 3QSRA 1FCQA 1TYGA 4UFLA 5AC8A 1W1ZA 1R2SA 4WD0A 3L0KA 4PH6A 3MHUA 3CIWA 3P67A 2QJHA 1XUUA 1M7PA 4JDYA 1EWEA 3G22A 4G1KA 4NZJA 1WXJA 1PE1A 3QQ0A 1GPWA 1K8XA 3DI1A 4QSHA 3HG2A 4RK8A 4IMDA 2X2GA 4JR5A 4NXSA 4ZVJA 3W7NA 2J27A 1MSSA 2ATMA 3O6DA 4K36A 3W7QA 3DFNA 3INPA 1H7XA 4WQ6A 1AL7A 1TMHA 3UY8A 4FF7A 5I3HA 3TUUA 1VR6A 3F4NA 4GRSA 2RFGA 4WX2A 5DCDA 5G2IA 1JQVA 3HG5A 1KV5A 4MZ8A 4O12A 3WK3A 3W87A 5EMUA 4EWND 2G97A 4IUOA 2VFIA 3USBA 4LC8A 4AF0A 1K03A 5FF0A 4YCOA 4O0KA 3W76A 1TTIA 3HJZA 3Q94A 5AHIA 4UTWC 5FESA 2V2DA 4UTMA 2X1TA 1P4CA 5AOUA 3T7VA 1BWLA 2B4GA 3L66A 4HNVA 1FXQA 2XFWA 3PY2A 5LGXA 5D2TA 4AEOA 2YYTA 1W5QA 2QAPA 5F2LA 2DP3A 4MPQA 4TR9A 2EAWA 5E93A 4LOCA 3EXTA 2YFOA 3GXNA 1OFOA 2QCMA 2PE4A 3P5ZA 5F2GA 1ICQA 3N2MA 1PS9A 1QR7A 3OIXA 3JS3A 3A22A 1J2WA 2E5CA 2PCQA 1YXCA 2VEMA 5TIMA 2W79A 1R30A 3UWZA 2ISSA 2YX0A 3DENA 4QITA 3L0GA 2G96A 3NEVA 2JGQA 4K38A 3UWYA 2CZDA 4CNPA 1VGAA 5DCEA 4NX5A 1A5AA 3PM6A 5D33A 2C14A 1M7OA 2WNZA 2DJLA 1PV8A 1UASA 1FCUA 4PTNA 4IMGA 5F4XA 1OX4B 3FKRA 3LHYA 2KZHA 1FCVA 1X1ZA 1DORA 1TIMA 3PSVA 4OE7A 5TBOA 1AL8A 1N8FA 1RQEA 3UPBA 3GLCA 3M9YA 1FDZA 1BWKA 4UTIA 1N7KA 3RLUA 3BLEA 1YTDA 2HS6A 1EIXA 1GYLA 3STEA 2R8WA 4MJMA 2BX7A 2CLMA 1H5YA 3LHVA 3LHWA 3VFLA 1F73A 2X16A 3NQMA 5DBTA 3NPWA 1RPXA 3HO8A 1FWSA 3BGGA 4OHQA 1SR9A 3CIXA 4QIUA 4YXGA 3O05A 2A1YA 3ANYA 4ZQNA 5A8GA 3HPXA 1VHCA 1EEPA 1AMKA 1L2UA 3R8RA 3W9ZA 4ADSA 4ORMA 2Q8ZA 3L65A 3W7GA 3IIOA 3THAA 4DF0A 3LI0A 5LHFA 4CCDA 4DPQA 5TQLA 2AAMA 2DZXA 4JGDA 4NJHA 1OK4A 4TX9A 5I3KA 4K37A 2QCFA 1ZFJA 4YMZA 5G2WA 3MYPA 4Q33A 3UWUA 4JTTA 5K4XA 3PBYA 1M5WA 1XCFA 3FYPA 3H53A 4K7VA 1X1OA 2NX9A 5FF7A 3C8FA 3GKFA 3MHFA 1ZAHA 4S2CA 5L6UA 4PC8A 5D30A 4Z1BA 2YZRA 1JCJA 1KBIA 4JIPA 3T40A 1F5ZA 1OFRA 4M6VA 4HPXA 4KFPA 3CM4A 4BWLC 1ME8A 1DQWA 1MEIA 4IMCA 4O8RA 3BLFA 2DZVA 4FNQA 3O06A 1I8JA 3DKJA 2P0OA 4JTSA 1P5BA 2P10A 3KX6A 3MI6A 4MYXA 3CTLA 5AHFA 2NV2A 3U8GA 4JTKA 2NX1A 3TXZA 2QJGA 4FB7A 4NNAA 3QF0A 4Y90A 4TMCA 1QAPA 1GVRA 4UXDA 4XBSA 4TO8A 3W7KA 3G3DA 4Q32A 4UTTC 2VEIA 4O1CA 1LBLA 1JUBA 3N73A 5FF3A 1RQBA 4PCFA 3W1QA 2QUVA 2A6NA 3W1MA 1FWNA 4AWTA 4UFIA 2E6YA 1LBFA 1L6WA 1JCYA 3WFAA 4WJEA 3SY5A 3Q2DA 3W2JA 1OYBA 3V75A 2A7PA 3A9IA 2G95A 4KFOA 3P81A 3C2VA 4UTUA 1XKYA 4IX0A 2I9EA 1K7FA 1O5XA 2YPIA 3ABRA 1OFQA 3HPZA 2ATSA 4ONVA 1XUZA 1FY6A 3IV3A 4LUIA 4H3DA 4N9DA 2WNQA 1JVNA 2I1OA 5K4ZA 3W7PA 3HGOA 4D2JA 3P82A 3GIYA 1LRQA 1R47A 5F4WA 2CLFA 1I2PA 3RU6A 5LZLA 2NUXA 3LV6A 2VELA 4JYFA 3KHJA 3LRMA 1YDOA 3N19B 3TIMA 1ZY9A 3NQ2A 5G5IA 3E96A 2Y6ZA 3ZR4A 3GR8A 3A5FA 1GOXA 3PUEA 1JJKA 5BRBA 2YSWA 1T99A 1MZHA 6ALDA 2FB3A 1SFJA 2ZA2A 4MKNA 1NF0A 5DELA 1G4PA 1LP6A 3PVFA 5EL1A 2CZEA 2ZDRA 1VYRA 1KM5A 2RKXA 3HG4A 4K8EA 5D2XA 2EF9A 1WV2A 4P2VA 5AHMA 3R13A 4N02A 3SECA 4JTJA 1AW2A 3W7OA 5DY3A 1H50A 3EX1A 5EA9A 5AB3A 3HBLA 3TQ0A 3UNDA 2HS8A 5EYWA 3DKLA 1P1XA 2Q8LA 5KZEA 3QMRA 3NXFA 1Y0EA 2GVLA 3NQCA 3TE9A 3ZWSA 3R5EA 3NZ1A 4GC4A 3SFKA 2GUUA 4XWUA 5AFDA 1TCDA 2ISWA 2QCHA 3IIVA 1K02A 2QDGA 1G6CA 2Y7EA 2E68A 1KLZA 1XBXA 1ML1A 4FNPA 2F7FA 4MOZA 5LNUA 1RV8A 3TJLA 4AF0B 5I3IA 1WA3A 4LV9A 5DBUA 3LERA 1OFDA 4JD4A 3TW6A 5KZDA 4AHPA 4I7WA 5G2HA 3IGXA 5J5DA 1P0KA 3M1ZA 3L2IA 1RD5A 2CLLA 3L9CA 2EKCA 2QCCA 4O19A 3W71A 4JTFA 1DKWA 4NNCA 1IXOA 3G1DA 3EX3A 1H63A 4ZQOA 1TQXA 2PURA 2PRMA 1KFKA 4S2BA 3TNOA 1QPOA 3SJ3A 1VZWA 2JKPA 2WO5A 2RDTA 1Q3NA 1A5SA 1UBSA 1GZGA 2CZ5A 4EVZA 2ZFAA 1H7WA 5FEPA 4N9CA 4NXKA 1W3IA 2DZSA 4DEFA 5L9FA 1PL9A 1UJPA 3B06A 2V2CA 3ELFA 3NO5A 2A7RA 2VFDA 1LOQA 4KWWA 4O10A 3CT7A 2QCGA 4DBDA 2J88A 2UV8G 3LHUA 5K9XA 2FJKA 2NX3A 1OABA 4ZMGA 2FPYA 1G4EA 4K8HA 3IVSA 3HB9A 1OYCA 4O13A 4NZFA 4ZL1A 5D2YA 3B04A 3NL5A 4FO4A 3WK1A 2P1FA 1RVGA 2NXGA 1TPH1 3QYQA 5DCBA 1G4SA 1EUAA 3OA3A 1H1YA 3STCA 3W1TA 4IX2A 3MHGA 3NZRA 2Y62A 3DHDA 3S5ZA 3QQ1A 5EY5A 4A2SA 4HNNA 2VC6A 2TMDA 1TO3A 2B7PA 4GXMA 3S1XA 2OT0A 5BNKA 1ZJIA 2RDWA 3OEXA 4RXFA 3PF3A 5E1QA 4Y6GA 2VENA 3SGUA 4UNKA 2DZTA 4LVGA 2X1UA 4LT9A 4IXXA 4MLJA 3FJLA 3C56A 3W07A 3R12A 3W7IA 3IVTA 1O4UA 2C1HA 2FB2A 4PL2A 3UD6A 3NQDA 4JX5A 1TREA 5AYYA 5LSMA 3TKFA 2V30A 2WOQA 1WYIA 2IQTA 1FWTA 3H55A 1DJNA 1LZOA 2J9XA 3EXSA 4UTLA 3IRDA 4FX8A 2J24A 1JUKA 3GDRA 5AHLA 1JR1A 1B3OA 1GEQA 3MP5A 4GUGA 4M6QA 3CHVA 1MXSA 3JRKA 2OT1A 1ONRA 5KTLA 1SW0A 1SW7A 4O28A 1A5CA 1P0NA 5LHEA 2GQ8A 3W1LA 3TAKA 2YCEA 3L5MA 3MP4A 3BW4A 4U4MA 1SO3A 1PHWA 2ABBA 2WSRA 3NM3A 4RZ4A 3F4WA 3W7CA 4CQAA 2Y7GA 5HWJA 4UMCA 1JCMP 2WSQA 3I7SA 3RK8A 2VEKA 4N6FA 4MLRA 2QKFA 4DO4A 1QOQA 1W5NA 2QUTA 1I2QA 3NDOA 4MVAA 4BR1A 4UFKA 3TFXA 2YXGA 1ZNNA 3W7JA 2EPHA 4JTUA 3DH7A 1NF7A 3EWXA 5AHEA 3KRSA 2E77A 3W3OA 1O60A 4M7TA 5DN1A 1VQTA 3VE7A 3GKAA 3NQGA 4NU7A 2C15A 1TPC1 1NSJA 5HUOA 3PWAA 3VCRA 3FJ6A 4ICNA 1KTBA 1THFD 3IIXA 4EOUA 3UXAA 1HO1A 2WKJA 5LNSA 2VFHA 4WY0A 3ZWTA 1EP2A 3NQAA 4LC6A 1K7EA 1S3HA 1W0MA 1SUXA 1UUOA 2FIQA 3AJXA 3G8RA 3W1PA 1OVDA 1GVSA 3W1NA 4XTDA 4WUIA 4RKAA 4ML9A 2AQWA 1Q6RA 3MW7A 1VCGA 1XBZA 2ABAA 3ABQA 2QDHA 5IBXC 4UFMA 1OF6A 5E0KA 3LOTA 1WBJA 3BO9A 4ZQCA 3NA8A 1TTQA 1SW3A 1VHNA 1L6SA 1W3NA 3NL6A 2ZZ1A 1ICPA 3B4UA 5AC6A 3OVRA 2ZCGA 1O94A 3M41A 1TJPA 2TPSA 2Y7DA 4MFDA 2Y61A 1XM3A 3HPSA 4GUFA 3CWOX 4NJIA 1QWGA 1D3HA 3DAQA 2YFNA 4PFMA 4O53A 2QF7A 4JDBA 3W7MA 2V8ZA 5CZTA 4OT7A 1NAL1 3EXRA 3UQNA 4IGHA 3C2FA 1BKSA 4N2YA 3C61A 3TSDA 3NNTA 3B03A 1W8SA 1B4EA 4WZHA 4C1KA 3DGRA 2NXIA 1QO2A 5K9CA 1N55A 3NQ8A 1AW5A 3M44A 4IMFA 4TMBA 4MY9A 1B57A 1GVQA 2J9ZA 2LLEA 4AWSA 1ME9A 4EIVA 1I2OA 3LB0A 3SW6A 2JKAA 2PRHA 2Y63A 3STGA 3EKZA 3EEGA 4ORIA 1VLWA 3NR0A 3C6CA 2A0NA 3TX9A 3G1XA 4YWIA 1SFLA 5CKSA 1H7PA 5G1YA 3IGUA 3TQKA 2FTPA 3R2GA 2HMCA 3C2EA 3LGEA 3M43A 3KFTA 4IJBA 3LCXA 2G5WA 1EPXA 1K7XA 3NPUA 2Z0IA 5CGQA 6TIMA 4MIMA 1TPEA 1LTDA 2XN1A 3G0SA 4ADTA 3OBKA 5IBXA 2X30A 3G1AA 4O4VA 3E12A 4FX7A 5BMWA 3LTSA 1GWJA 1A50A 2QCNA 4JS3A 4UTWA 2H8ZA 3PB2A 5AYZA 4DELA 3LLFA 1DJQA 2Y7FA 3Q58A 4LU0A 3B0PA 1WOAA 1T8XA 4WXZA 4AMAA 4AXKA 2CW6A 3EWZA 1PHQA 4GUIA 4LW7A 4FNUA 2I14A 1W3TA 1KBJA 1IIGA 3VNDA 3BW2A 2E6FA 1WX0A 4JEQA 1GJPA 3GDLA 3GZ3A 4XKYA 5D2VA 1LDCA 3KRUA 3QRHA 1QPRA 2VKZG 3PR2A 3N2XA 1FDJA 5AC7A 1DVJA 4UNLA 4LRSA 3AO0A 2CLEA 2OCZA 2WNNA 4OU1A 2DZUA 1W37A 4O14A 5I3JA 1GTHA 2ZZ5A 4WY0F 1VYPX 2V82A 1G69A 1JQXA 3E9AA 3NVTA 1VLIA 1LM1A 3HF3A 4ZZ9A 3FS2A 4LUJA 1OG0A 2R94A 1LOSA 2QCLA 1SSGA 2VEPA 5FEWA 3WJZA 2GOUA 3LXAA 4RX0A 3W7DA 4E2BA 2ZQ0A 1Q45A 3FFSA 3UZ5A 1XI3A 1FXPA 1XBYA 5CG7A 1R2TA 2Y88A 1AG1O 1SZNA 3MWAA 4JX6A 4JTLA 2YW4A 3G18A 1JRCA 2H8XA 1T0OA 2Y89A 2YGYA 3TROA 2GVJA 3MJYA 3GR7A 5J5RA 3KVKA 2ZZ7A 1UCWA 1EA0A 4GUHA 1HFBA 4CCEA 3VKJA 1CW2A 1ICSA 3P62A 3P61A 3PULA 4FXSA 2ZYFA 4UFHA 4LTSA 5CZSA 5KZMA 3G1VA 4I7VA 3TW7A 5BOOA 3O6CA 4OV4A 4TU1A 3M0ZA 3I7RA 4X9SA 1V5XA 1X6UA 2Z6JA 1VCVA 3FIGA 4GFSA 2GQ9A 1TRIA 1TTJA 2JGYA 5C55A 1TRDA 3IEBA 4IMEA 1YTKA 1K8YA 3G0UA 2H3DA 4YCPA 3NQFA 3QW3A 4GBUA 2ZRXA 1VS1A 1LRNA 1FCBA 4QM1A 1HTIA 3PB0A 3TMQA 1GQNA 4E38A 4O16A 3O8AA 1KA9F 4N4QA 1GYNA 2CLHA 4H4IA 2H90A 5LNRA 3PBWA 2E6DA 4BK9A 5EBUA 3LXCA 3SGZA 1SU5A 1PVNA 3UZJA 3PC0A 1YDVA 5FF2A 3NGJA 4FIQA 2ZZ6A 1H7RA 4BWLA 3LCIA 4DO6A 4MZYA 3VI2A 2O7QA 1K8ZA 2X1SA 3BVJA 1YTEA 3M5YA 3D0CA 4O18A 2NZLA 2B0MA 3EWUA 1TV7A 4BFAA 3C4UA 4HIBA 4ZQRA 4TIMA 5LGZA 3LCLA 1F76A 3BW3A 3HQ1A 3YPIA 1VRDA 2E5DA 4O17A 4UTTA 1BEUA 3GNDA 1OFAA 3LLDA 1F2JA 4WY0B 3LCWA 3TSBA 3NM1A 1YDNA 4O0ZA 3E02A 4CNNA 1ME7A 5CPLA 3N9SA 2YYUA 4HNUA 2QCDA 3SR7A 3O15A 3WJWA 1UB3A 3TV8A 3NYZA 1XL9A 2QJIA 2QAFA 2Z6IA 5AN7A 5D02A 4A21A 1M6JA 4W9TA 3UWVA 1XDLA 4UC5A 1FQ0A 2QUUA 1S5WA 1SO5A 2TYSA 3OVQA 2VOMA 1YLVA 1K3UA 1MEHA 4LS0A 3FKKA 2ZA1A 2V5BA 4DF2A 1H51A 4HKPA 1C29A 2ZRYA 4JX4A 3G3MA 3DFQA 1R2RA 1KM3A 2DJXA 2FDSA 1NEYA 4XUGA 1ZALA 5F2IA
chains in the Genus database with same CATH superfamily
1QTWA 1BVZA 1NELA 2EG6A 1EZWA 3B9NA 1QK2A 4P7QA 2QUMA 3W72A 4GO8A 1KFLA 1KBBA 3SI9A 3SCOA 4JQ2A 4P7OA 2YL5A 3C52A 1TWWA 1OJXA 4Z1DA 3RU8X 4HPJA 4K39A 1K77A 1V4YA 1DWGM 2OTDA 1PDYA 2GL5A 3KBWA 4UCGA 3TA6A 4MY1A 3EX2A 1XYAA 1KW1A 1QDSA 4H7VA 3E2SA 4DLFA 2E4TA 4GZEA 4QJ4B 3QMTA 3VX1A 4UIOA 2O7SA 1SM9A 4KKXA 3ZJKA 2FVMA 2R14A 1B3WA 1EP3A 1I6NA 1HJWA 2GSEA 4DYJA 2ON3A 1WUFA 4FNSA 4NIRA 3USZA 3NL3A 4Z42C 1KTCA 2RGLA 3WDIA 4C6PA 2YA0A 3N3MA 1H62A 2VFGA 1OYAA 1FH7A 1F6PA 3CGTA 3QY8A 2YR1A 1TCMA 4Z2GA 5CPMA 5AC5A 2BOEX 5K7JA 4YS1A 1LORA 3HFTA 3UXDA 2I56A 4PEKA 2AL1A 5JIWA 2V5LA 1M41A 5GNZA 3CQKA 3VDBA 3B9AA 2C0HA 1B54A 2POZA 3GXPA 1CEOA 1XH2A 2X1RA 2DT2A 3LRKA 1A5UA 1CGVA 3BZGA 2ZUNA 1R86A 1X6NA 4IIBA 3TR9A 1VP5A 3UZXA 1Y5WA 4A4AA 4D6CA 5BCAA 3OYZA 1VIWA 5AZ0A 4HSOA 3EB2A 2VVSA 2CFFA 1KM4A 3L5AA 1OFBA 4LVAA 1KC7A 3QXBA 3F7JA 1OX6A 4Q4RA 5SWUA 3IJ9A 3S2MA 2A3LA 3VOGA 4W7VA 4IIFA 4NQ1A 1A80A 3ID7A 1TPWA 3O3RA 3RMEA 3WD3A 5EGRA 4HJFA 3S1GA 4H83A 2B31A 3I6RA 4H1ZA 3AHXA 3WQWA 2GK1A 2PD9A 1JYWA 2Y5JA 1H09A 3GUWA 2RH9A 4W8BA 2XWEA 4WJXA 2XU2A 2E1WA 1AQ0A 1QI5A 1VBRA 3LPPA 3A6OA 5FAGA 3SBFA 1G01A 7XIMA 1JI1A 3TK7A 5K9DA 4LV4A 1JEZA 4O1AA 5FJJA 1F05A 2C16A 3SEPA 1XIJA 3MJMA 4A3RA 3H2AA 3PANA 1KWGA 3I68A 3O1NA 3UWWA 4Y9AA 3LV5A 2PDYA 3H54A 2Q3RA 3S1WA 2VZSA 5HA7A 3TNBA 1RXOB 2YL8A 4FEZA 4S3AA 4UQAA 1WUEA 1M04A 3WLRA 1HL8A 2DZWA 3T9PA 3G1YA 1OM0A 4UTFA 1QOPA 4HU3A 5DEZA 4JTHA 4YIWA 4NNBA 3CQHA 1O5QA 3VD3A 4IP7A 4CN1A 3V7PA 3QLLA 2W62A 4C6EA 3S2NA 1B3YA 3R10A 2HNEA 1CGWA 2V5DA 3LRLA 2Y8UA 1C7TA 4WDTA 1L6FA 4WOQA 1CXHA 2NWSA 3W2LA 4O0QA 2GJNA 1OG6A 5M5DA 5A2BA 1ZL1A 1U5JA 4YHGA 1YE6A 2GJLA 3U5UA 4CQ8A 1XLDA 1YXYA 3LTPA 4HSNA 3CB8A 3L7RA 4B5NA 2VDHA 3CL7A 4GJ1A 3MP3A 5H91A 4AWUA 1JFHA 3LZ3A 3WF4A 4JIQA 4AZ7A 1HO4A 4DBEA 1D9EA 2J7BA 1E0XA 2J75A 4KESA 4HQVA 2CERA 3QTGA 1TJ0A 1PPIA 3GUGA 4TTGA 3DDMA 4H2HA 2JF6A 2R1MA 3RLVA 4WKFA 3LENA 4O52A 1TZZA 4B92A 4QS6A 1QFEA 3W82A 2HZGA 8TIMA 4EPKA 2W27A 4TQTA 2WSKA 3POHA 2Z1BA 4M1BA 4IF2A 4P8XA 3SCSA 3N34A 4QQ3A 2AGKA 4JTIA 5C6MA 4ZO9A 4D71A 4NF7A 3V1HA 4M7SA 3IACA 3W83A 1PZ3A 1ZCOA 2EG7A 2PRLA 4BQ3A 2I5IA 3L4YA 5IRPA 1O1HA 3CLWA 2J9YA 5BU6A 3N14A 4R9XA 4RW5A 1H7NA 3H2EA 3FA4A 5FOOA 1IT8A 4X9YA 5C9UA 2NUWA 4C1NB 3QW4B 1JYNA 2DT0A 3DC0A 3ZT6A 1FWRA 3UT0A 4DWSD 5JVLA 2ZRVA 1NWUA 3W2MA 4JYEA 1KM1A 3W75A 4PUNA 2GVGA 2ISVA 2EKGA 2E9MA 2ZRWA 1OZMA 1BLIA 1DV7A 3SUWA 1QJWA 4RDZA 1DHPA 1NWTA 1R9XA 2BLEA 2NXHA 3V0TA 3TYCA 1V03A 5BMXA 1CECA 2HTMA 3G8EA 1FFQA 1Z42A 3AU2A 3UYCA 1ISZA 3FA5A 2WVVA 1XLGA 3HGSA 4X0NA 3ATZA 3W86A 4CD8A 2DEPA 3BAXA 1J01A 1XJBA 2XSBA 5CLTA 1DEDA 4Z2LA 1P7TA 2P0IA 3GTNA 5IDZA 1EP1A 4QAWA 4L56A 2WCSA 1V02E 5HWNA 2Z29A 5JBFA 3UZYA 4CKQA 4UMAA 2HPMA 4LS1A 4F0RA 3MQTA 1ISVA 2G41A 4KCWA 4U3AA 4J27A 3S5OA 3DFYA 1TIWA 4EF8A 2P3ZA 2CETA 1XLEA 4PMQA 3UJSA 1GZJA 1S39A 3O6AA 3LCFA 4FXJA 2GSJA 4HYVA 2ZE3A 3C0JA 3L4VA 3QVQA 3KRZA 1DWIM 3SRKA 1EGVA 1EC8A 4ZQMA 4WK9A 2R82A 4TV5A 2BB0A 3VU2A 1WDSA 4PRWA 1KLYA 4Z0JA 1XP3A 4M51A 1XV8A 4HNTA 2E0PA 3E0IA 2DZPA 5D37A 2Y1HA 4JYDA 5LNWA 1JPMA 1TVPA 1LWHA 1G7UA 3BOFA 1VJSA 1GG0A 2ZA3A 4I7UA 3VM7A 2DUZA 2AQVA 5HOSA 3T0BA 5DXYA 4P61A 1U83A 4NJKA 1ALDA 1K9FA 4QCEA 4AUBA 1U2YA 3E3HA 2VVNA 5F1UA 5E9XA 4UTKA 2E5BA 2GK1B 4N6EA 1C8VA 4M81A 1LWJA 1UC4A 1K1DA 5A6MA 1W2VA 4C7GA 4C6FA 1PIIA 1ZAIA 1OC7A 1XSIA 4J28A 3QMSA 2FGBA 4GNVA 2BDQA 4GXWA 2E1DA 7A3HA 3L4ZA 3PZ9A 4L61A 1H61A 1Y5VA 1R3WA 3MDWA 3T78A 5M2FX 3I4EA 1OF8A 5BYWA 4L4MA 2J79A 1GHRA 3W7RA 4O1FA 4AFYA 3HG3A 3RO6A 1ONEA 2DY3A 5FL0A 1BSLA 3IIZA 4DX3A 3V4BA 1G1YA 3U3HA 3T44A 4GI9A 4TVUA 1KV8A 1T96A 1CIUA 1R9ZA 1H4PA 2Y85A 5MHBA 4C1LA 1IEVA 1YDYA 4JIIX 3AZTA 4QEHA 2OELA 1A4LA 4WEVX 1UP0A 1V6TA 4Z17A 2XN0A 4FXRA 3SCTA 1WDQA 4JFWA 4PB4A 2WHKA 3H7UA 2V6AA 4K6AA 1FBAA 4H9VA 3T2QA 4D8LA 5C8BB 3M5XA 1JNDA 3RITA 1DE6A 1VC4A 2HPIA 5HXMA 1OD0A 2C1IA 1EXPA 3UCDA 1W1YA 2FDMA 2ZX5A 2GGGA 2UZ9A 4ZO6A 4KIRA 1QXLA 2OO0A 4NASA 3SRFA 3JR2A 3KBVA 3VNLA 1LBMA 5KINA 4IOTA 1EJ7L 2B7NA 5A1AA 4HNOA 4MB1A 3LD5A 3PS7A 4FPSA 1XIIA 5E70A 3C0LA 2ZDSA 1QMLA 5HINA 1YPIA 3MCNA 2DVTA 1J11A 1TWIA 1WOBA 1LRTA 1DTNA 1VRXA 1HX0A 3PUGA 1UWRA 4BF5A 1EOMA 3CHCA 3I6EA 3S5NA 3TTEA 1C8QA 4CQDA 1EFZA 3GR4A 4XQ6A 4XO7A 2H3BA 3TTYA 4LYQA 3LLXA 3W23A 1SJAA 2YA1A 3VPLA 4Q8UA 4OOUA 4NVTA 2J6VA 1OK6A 3DU0A 4BI6A 4LS2A 1C8YA 1KCXA 4HPNA 3TCEA 2V69A 1UA7A 3P7YA 4PB5A 5HULA 3VD9A 1I45A 2MNRA 3MBFA 4RV8A 1CB7B 2V2HA 1ZUAX 2P5NA 2CLKA 3BARA 3H6OA 1B9BA 4IHCA 4R85A 3L67A 3CQIA 3SUTA 4WXYA 1CX9A 2V81A 3W6LA 1MWOA 3VO0A 1GTEA 1V3LA 3VK5A 3MPGA 1UH3A 1UUMA 4CD4A 1LF1A 2RDXA 4NY2A 2ZTJA 3LHZA 2FPVA 4Y96A 1DWJM 3VE9A 1GVFA 1EF2A 1R3QA 4QE4A 1VJIA 4ZQPA 3B0VC 2WVVB 3HQNA 1DQUA 2VCBA 2BTMA 3A3XA 3BG9A 3GDTA 1P7TB 5E0CA 4MUPA 5I78A 3UG8A 1XDMA 2WBKA 1SZFA 1HG3A 1FH9A 3CU2A 4JQ3A 3IANA 3KZSA 5D09A 2R1NA 5REQA 2XZ7A 4HHMA 4PULA 4W7WA 3ZFHA 3NJ3A 2V9DA 3EX6A 3KVJA 1K6AA 3VILA 3GNNA 1IXQA 4LY4A 2QYGA 1IF2A 1WKFA 1JDFA 4R33A 5AYXA 5A2CA 1QHZA 4DJDD 2I9UA 1FTXA 1EEXA 5E5CA 3PBGA 4QLJA 3QSRA 3EDFA 3BANA 5AC8A 1CXLA 5E6ZA 2VNCA 2VTFA 4GGHA 4NAEA 1M7PA 1EWEA 4HK7A 4IFRA 4M8UA 4H6QA 1NFGA 2BMBA 1K8XA 4S38A 4DJEA 3HG2A 4RK8A 1BSIA 4PSPA 1D2KA 8RUCA 3URQA 4Q4MA 2J27A 1MSSA 2HROA 3T2PA 1XLLA 3DFNA 2W67A 1H7XA 1AL7A 1TMHA 3WLQA 2ZUSA 1I1XA 3N12A 5DCDA 2AKZA 1KRMA 4MZ8A 3USBA 3MMWA 5FF0A 3BLPX 2PP0A 4O0KA 3A13A 4JTRA 4LAOA 3Q94A 1B30A 4OECA 2X1TA 3T7VA 1NOWA 3VINA 1BWLA 4HNVA 3PY2A 4MSSA 3W25A 4I8DA 2PDWA 4AEOA 3MUIA 4DHGA 2QAPA 5F2LA 1J0HA 4M82A 3SY1A 3UVAA 4TR9A 2PC8A 3GIQA 3KP0A 2PBGA 2QCMA 2PE4A 3N2TA 5F2GA 5TF0A 1J2WA 2PCQA 3OODA 4ZEPA 3UWZA 4PBEA 3QGKC 1MFUA 3NEVA 6XIMA 3LQGA 3PZUA 4URIA 4NZ1A 3SY8A 2CZDA 3VDGA 4CNPA 3P93A 1XIHA 4L64A 2Z1XA 1Q8AA 3PM6A 3SCRA 1PV8A 2BS9A 1UASA 5F4XA 4QS5A 3FKRA 1FCVA 5A6TC 5LXXA 1XYCA 2OYLA 4OE7A 1AL8A 3QTPA 4HVXA 3WUFA 1U1UA 2WC7A 3UPBA 3GLCA 3M9YA 4PZVA 3BLEA 1YTDA 2HS6A 1W3KA 5C70A 3OZYA 3SFWA 4MNMA 1JD7A 1GQKA 2R8WA 3NFUA 1W1A1 2CXGA 2OGYA 1HN1A 3LHWA 1J5SA 3NQMA 1RPXA 3CIXA 2ALRA 6CGTA 3HPXA 3S3GA 1VHCA 1AMKA 4ADSA 3R8RA 8A3HA 3W7GA 1O1ZA 1JDEA 3MV11 1X39A 3WENA 2G4FA 4DPQA 1HF6A 3RO8A 2DQXA 4DAIA 1ZFJA 2VURA 2YLLA 3MYPA 6XIAA 5K4XA 3A64A 4QE1A 5M17A 2G8ZA 2IPFA 3FYPA 4E2OA 4K7VA 2V5KA 4ZTXA 1X1OA 6ENLA 2I5GA 4DUVA 4S2CA 3GBEA 1REQB 2NT0A 4GINA 3ITYA 4ROQA 4BWLC 4O8AA 4GH3A 2DZVA 3DBNA 3GNOA 3AQUA 2P0OA 2P10A 4PUKA 4XK2A 3CTLA 4BQ4A 1FA2A 1HVQA 3BOLA 4Y90A 1ZP3A 4TMCA 4XBSA 2V5CA 1M7XA 3A4WA 4AEEA 3ARYA 4UTTC 2VEIA 3GH4A 5FF3A 4NI3A 2XG9A 1ESWA 4E8DA 1ECQA 4CGTA 1WDPA 2E6YA 5HDRA 5DQPA 2L5HA 2VUNA 3EPMA 4FLRA 1XKYA 2YPIA 1CXFA 3NQBA 2ATSA 3CZJA 4ONVA 9XIMA 1EO5A 5ABEA 1HKVA 5K4ZA 2QVNA 1ENUA 4L65A 1VBGA 5F4WA 3LMZA 1GVIA 2R24A 5LZLA 2NUXA 3LV6A 1T8QA 3S9IA 3TIMA 4HU8A 3GO2A 1IV8A 1EJVC 2QDDA 3E96A 1XLHA 2BGSA 4D6HA 3PUEA 1GVEA 1JZ4A 2HEJA 1UP3A 6ALDA 2FB3A 2ZA2A 1NF0A 4IPPA 2ZDRA 2YA2A 3SECA 4NAEB 4I5RA 4HCDA 3SUSA 1NJJA 2NQLA 5DY3A 2VC5A 5EA9A 4AX6A 5DMMA 3UNDA 2HS8A 2BODX 5EYWA 2QUNA 1P1XA 4DAFA 4XZLX 4XSLA 4X63A 3QMRA 2VEFA 1I1WA 1Y0EA 3ZWSA 1GJUA 3R5EA 1DJYA 2WJDA 2D2GA 4XWUA 5A6BD 1HW6A 4KF1A 1E73M 4A6GA 1BPLB 4D8ZA 2ZX9A 1XBXA 1ML1A 4MOZA 2F7FA 5LNUA 1XYFA 3FVMA 4WGHA 4EKJA 3VNYA 3MUCA 4AHPA 4I7WA 5G2HA 4DUXA 1SYTA 2R6OA 3AI0A 5J5DA 2SFPA 3L9CA 3AUJA 2QCCA 4JTFA 1DKWA 2DZBA 1IXOA 3EX3A 1TQXA 3TNOA 3OBAA 4YTTA 1EJSC 2RDTA 1Q3NA 4EVZA 1GZGA 3L4WA 4NXKA 4CNTA 4DEFA 4GVGA 4HK5A 4V33A 2VC9A 4GVHA 1EC7A 3SJNA 3MZ2A 4KWWA 2QCGA 3E74A 2UV8G 2GYIA 3LHUA 2PTXA 1V3MA 2FJKA 1KRAC 2NX3A 3SAZA 4JHZA 5T9CE 4DO7A 1OABA 2YXOA 1OYCA 4NZFA 1VFMA 4FO4A 4P7RA 1N82A 2P1FA 4AEFA 2NXGA 1G4SA 3BSHA 3VKAA 2PWFA 3KOXA 3STCA 2X0SA 4CQCA 3S5ZA 1UYQA 1ZCCA 1TA3A 1XLIA 1XIMA 4GXMA 4IQEA 4XD3A 1GUVA 4JNYA 3T1GA 4GZIA 2RDWA 2BXZA 3PF3A 4MAVA 3G6LA 3KOYA 1ZB5A 4ACYA 4UNKA 2DZTA 1UIOA 4I8YA 4LVGA 3RPDA 4IXXA 2VRQA 3C56A 7ENLA 2DVXA 3W07A 3R12A 3W7IA 2QHAA 2WM1A 1O4UA 5HANA 3KBSA 3WUBA 5CBJA 1TREA 3UXIA 1OB0A 2HE8A 2IQTA 1FWTA 1LZOA 4UTLA 1ZS2A 4DB7A 3ITTA 2D23A 3IRSA 2J24A 5FAJA 1U22A 3QQWA 4GVIA 5E6YA 4GUGA 4I3GA 4NZ4A 2PWGA 1MXSA 1VAHA 1SW0A 3FAWA 1A5CA 5LHEA 1TX2A 1VFUA 2AMGA 4C5ZA 1MRAA 3BW4A 5CSYA 1ECEA 3W01A 1GKQA 1HKMA 4AWEA 1ZTVA 4IT1A 2ABBA 2WSRA 3AJ7A 3NM3A 5HWJA 5RUBA 2H9AA 4UMCA 4GY7A 4DBSA 3I7SA 4N6FA 4LCQA 3BZJA 2GWGA 3GRIA 1OGBA 2QKFA 5FJTA 4ECLA 1UZHA 2VDGA 1QOQA 1W5NA 2FZ8A 2YIHA 4LYRA 3AIUA 1ZNNA 4X2PA 1OCBA 2EPHA 1NDZA 2YXXA 1NF7A 2QJMA 3EWXA 3G2GA 1VQTA 3GKAA 1P0BA 5HUOA 4LB3A 3FJ6A 1TR9A 1P6CA 1HO1A 2VFHA 4IFKA 5DX7A 1K7EA 1W0MA 3V18A 3NVDA 2FIQA 2Q71A 1GVSA 4WUIA 2V68A 4ML9A 4YVVA 2AQWA 2WMFA 2X0YA 4XO6A 2ABAA 3QR3A 5IBXC 4UFMA 1OF6A 5E0KA 3TYBA 2HXUA 4Y2WA 3OOQA 2FH8A 1YNQA 1J0YA 1SW3A 2ONEA 3RG6A 3B40A 3OVRA 5GJNA 3H2NA 3W38A 1AJ2A 4C91A 4S23A 2ODOA 5FA5A 4H00A 3WY1A 4NRRA 4PFMA 3CQJA 1M7JA 4O53A 4JDBA 4YYFA 4OT7A 2XFFA 3ISIX 4IIDA 4IGHA 4YPJA 1R38A 3C61A 4WZHA 1SFTA 5GNXA 4A35A 3H2CA 2BOFX 4LQ1A 2Q02A 1AW5A 3JUGA 4Q7BA 2GZXA 4L9XA 3SRHA 1F4HA 1GVQA 2PGWA 4EIVA 2OLSA 4QR6A 1W3LA 4P7LA 1EC9A 2PRHA 3STGA 2ZADA 1VLWA 3NR0A 3MZNA 2XZ9A 2PUZA 3ZJ6A 4GY0A 4YWIA 4AIUA 3W27A 4B5VA 4A3YA 2FTPA 4GPNA 2HMCA 3WBEA 4FSAA 1US3A 3FXGA 3BCJA 3KFTA 1DJIA 2V38A 1EPXA 3ZYZA 5A2AA 4S3CA 4I5XA 1DJGA 4MIMA 1W9VA 3B8WA 3OBKA 2X30A 2Z00A 1W6TA 1S2UA 5LIYX 3EPNA 1A50A 1VFLA 3II1A 2QCNA 4UTWA 1IZJA 1PKYA 3CPGA 3VIPA 1WOAA 4B3LA 4XVDA 2CW6A 3GU1A 1N8IA 1PHQA 5BXTA 3MSDA 1UD6A 2CESA 3SQLA 1WX0A 3K1GA 4JEQA 1GJPA 3GDLA 2A3BA 1Z9AA 2BBFA 4GNKB 1E15A 4PMNA 3DC8A 5D2VA 2PDCA 3VIHA 1LDCA 5JH1A 3AS3A 3QRHA 1XWYA 3UR8A 2BV9A 5AC7A 1BAGA 1CWYA 4UNLA 1KGUA 2WNNA 2VGIA 4GYKA 2DZUA 2X09A 1A3WA 3WYZA 4LBUA 1PB0A 1XG3A 2V82A 1ZSXA 3NVTA 1VLIA 1LM1A 3FS2A 4LUJA 1YKWA 4L7ZA 4PB3A 2VEPA 2CPUA 5FEWA 3WJZA 1GOQA 1UC5A 3FFSA 3GZAA 1FXPA 3HV8A 2Y88A 1JRCA 1T0OA 1T5AA 2YGYA 4XAFA 4WIWA 1RJQA 3VM5A 2BVYA 1SJBA 2ZZ7A 2PS2A 3GG7A 3RJXA 4DRSA 2FTWA 1ICSA 5HMFA 1UKQA 4LTSA 5KZMA 2PLMA 2Y5SA 4I7VA 3UESA 4K3ZA 3E0VA 4OV4A 3I7RA 2EEXA 2BGQA 1LQ0A 3VC5A 5M03A 3JZUA 4AZIA 4IMEA 2PFHA 4CN4A 2ZXQA 3K8KA 3TYAA 1KCKA 3PZGA 4YCPA 3WH8A 1JXKA 3VNMA 4Q8QA 1VS1A 1LRNA 3GSMA 1HTIA 3GHUA 3VX0A 3O8AA 2HBVA 2X0HA 3R94A 5CJNA 1GYNA 2CLHA 4H2CA 5EBUA 2H9AB 3RGTA 2G3NA 2VR4A 3EYPA 4LUYA 2J66A 4MZYA 3VI2A 4C65A 2X1SA 2CBVA 1TWSA 1YTEA 3RM9A 3COTA 1RLDA 2GGJA 3W6MA 5H8UA 3UVIA 4GJIA 1FFRA 4BFAA 5EMKA 4HIBA 1O68A 1VEOA 4F8XA 1VRDA 2E5DA 4O17A 3BCFA 1OFAA 1PAMA 4YHEA 2OLHA 4H04A 4AD1A 1XH1A 2OOGA 1NFPA 4IFKB 1Q2SA 3WLPA 3GDBA 4K68A 3DYOA 1S38A 5BXSA 1JAEA 4ML4A 3GU9A 3SR7A 3THCA 1KWKA 5AN7A 3AICA 4BF7A 1M6JA 4MWAD 4QG8A 1FQ0A 1W1VA 4QG9A 2OKTA 3DG7A 2VC7A 3EWCA 3TN3A 3UA3A 1HL9A 3K4AA 3WNPA 3N6HA 4U2ZA 1IWBA 4LS0A 3FKKA 2ZA1A 5I23A 3T8QA 4HKPA 3N04A 2PSNA 4JX4A 4PUMA 4NILA 3WQDA 1NEYA 2OGJA 2GWNA 2WKGA 3W1RA 3PHAA 3MU7A 3CEPA 3DX5A 4HT3A 2A85A 4O54A 4C6BA 3EA2A 1LT7A 2W91A 4OKDA 2ZC1A 1K6WA 2XH4A 4YL2A 1OIMA 5ENLA 3ZOAA 1TJRA 2TSYA 3DFTA 2PTWA 3BPWA 2P3EA 1LT8A 4MB3A 4DXVA 1ITUA 4O50A 3CEUA 4KRZA 3O16A 3VZZA 1F3XA 4NJGA 1FKXA 3IUDA 3PG8A 3R8HA 4JFUA 2W0UA 3W4RA 3POCA 2J8TA 5HPOA 3FX4A 3D5HA 4NYUA 5BXPA 4ALDA 4AZCA 4QAIA 2PU0A 4DZAA 3C2YA 3ATYA 2Z1WA 4JL2A 5TNVA 3VIOA 4NYYA 3M16A 3TR2A 1H0IA 3FW6A 3SQSA 3DHPA 3N3TA 4XV0A 3UZZA 1EUNA 1A5MC 4XD5A 4C6KA 3UWQA 1J10A 3GTXA 1ZHAA 3F03K 5HWMA 5K2ZA 2A21A 4RV3A 2Z1VA 3LX9A 3EPOA 1TV8A 1GK8A 1JULA 1E4MM 1XFBA 1DP0A 3L4XA 1JZ8A 2OYMA 3G0XA 4XZ9A 2OB3A 1XYMA 2XFRA 2XM1A 3I7QA 3EDDA 3EOSA 1KKRA 1FH8A 4DJEC 5I03A 3B0YA 2INEA 4W84A 1EH9A 1BG9A 4RPPA 4DNMA 3DI0A 3QPZA 1HP4A 3GVRA 2VQUA 4KWSA 3N4EA 2J7DA 5GQBA 3EDJA 3VGEA 2PDLA 3G1FA 4NAFB 1VCFA 1MMFA 2R1KA 3BJTA 1RBAA 3S42A 1YHTA 1PKLA 1S3TC 4E2DA 2E25A 1GVOA 4H7CA 1OBAA 4RL3A 1UPPA 3EWDA 1F7BA 2OWXA 3GU2A 4PMVA 1B4KA 4ZB0A 1LLWA 4RDVA 4N9EA 5EKYA 4DWSB 1RPKA 2ZRZA 4O1BA 5EPDA 3W73A 2F61A 4FNRA 3I6TA 1W32A 2O92A 3WL1A 4ADUA 3PSWA 2XVLA 3JW7A 1N8WA 2INFA 2REQA 3RFAA 3GWQA 3MUY1 4TV6A 1PCWA 3EEZA 3FGCB 3RMJA 4CD7A 4AAJA 2EPLX 1UHVA 1R46A 4WSHA 1CB2A 3UERA 2D24A 4F4RA 4MF4A 1G7VA 3R0DA 3QHNA 2XGIA 3GG8A 1L8NA 3BK0A 1M65A 3VUSA 4GKTA 3EA1A 2ISFA 4G1NA 1DL3A 1FX6A 3W85A 2F38A 1KCLA 3LTYA 5HJXA 3FOKA 4LRTA 4K7YA 2UWFA 4LVFA 2QCEA 1K9TA 1O95A 3HGJA 2EXOA 3VIMA 3TN6A 4O11A 2I5QA 4LVDA 5JH2A 1PYFA 1Q6QA 3GY1A 3HJEA 5C2CA 3S9YA 3AAMA 3TC6A 3CC1A 1JCLA 1POJA 3EZ4A 3N17A 4IPNB 1AZ2A 3VDHA 4CLMA 1SJCA 4H9MA 2VCCA 3N9RA 3FDKA 3OGVA 1S2CA 4NUWA 1ZQ5A 3BL3A 3IAPA 2RGMA 1KM2A 3BGJA 3DHUA 2AGTA 2ZE0A 1W31A 3ARQA 4MZ1A 2DZAA 1AQHA 2YDAA 4GX8A 1NQ6A 1ISXA 3FLUA 4QDPA 4OGZA 3KXQA 5EB8A 2PTDA 3WH5A 5ABFA 2X8RA 2WM0A 1XQKA 4IXHA 3W6YA 3HN3A 2A6LA 3NZQA 3RCYA 1TPVA 3OHIA 4A05A 4TXEA 1ZBWA 3IAQA 1I60A 4J3WA 3FSTA 5AY7A 2BOGX 3LNPA 2WMIA 3ARRA 1M01A 2ZTKA 1MO0A 2VZOA 1BD0A 4JICA 1TPB1 3R4IA 4LUSA 4RLIA 3W37A 2C6QA 3N11A 1DJHA 3BQ5A 5FSEC 3L2LA 5DT5A 2EPOA 5ABTA 2FMOA 3AS1A 3QY6A 1O5RA 4GA8A 5D9NA 4YNGA 4R53A 3GAKA 4CEUC 1AUSL 3W74A 4E3TA 4P7NA 4E8CA 2NVDA 1LCOA 3W00A 3PUDA 3OZMA 4AZCB 1TTPA 2A2IA 2IUZA 3AS2A 4UTHA 1JUEA 1AVAA 4RDYA 4UR8A 1DIEA 4US6A 1EZ2A 2YB1A 2VP8A 3RAOA 1Y5XA 4US5D 4J5NA 4M6PA 2XGZA 2D0HA 2FFCA 1U33A 1XYBA 4D6EA 3SN1A 4LNCA 1Q65A 1Q6EA 1X6LA 4H9XA 1EB3A 3RR1A 4M29A 1CI1A 3W02A 3GNPA 4V28A 4LEQA 1YPFA 3M7WA 4JXCA 1XH0A 3PN8A 4LPCA 2ESCA 7TIMA 4HNLA 2G3JA 1JAKA 4AZ6A 2V0TA 4MAZA 3SSJA 4MHBA 1UKTA 1HJUA 4Z1CA 3B0UX 2D1ZA 3SB0A 4UR7A 3JZEA 1VPXA 3AIWA 4EAYA 5I00A 3GYCA 1OSEA 2Z2BA 4EXBA 3QZEA 3SO7A 5DXXA 4KCUA 4Z0SA 3ONBA 1OFPA 3T07A 1CPUA 3F2DA 3UG4A 1YNPA 4KWVA 2CU0A 1E5NA 2DH2A 2O9PA 4GCXA 5KITA 2X7WA 3CT2A 3CL8A 1X38A 2C13A 4CNOA 3GB6A 4HTBA 1AQMA 4JN6A 2BP1A 3D3FA 3RDKA 2WWDA 3F2BA 4UUIA 2VZVA 4HCHA 4JY9A 4L1WA 2WBGA 4QNEA 3EA3A 1K4GA 3C3NA 3P74A 2E28A 1JI2A 1A0CA 3EB4A 1BHGA 1E9IA 2GSHA 3B8TA 5LKYA 1SO6A 1LROA 3PZMA 1XXXA 4I5UA 4MY8A 4FXFA 3WNKA 5HNRA 4LB4A 3EWWA 3Q37A 3KS6A 4FOUA 3W1UA 1KXQA 1UKPA 3S2CA 4L4LA 2WZEA 1BYBA 1EYEA 3I3BA 2FVLA 2VHLA 3P60A 1OGSA 2Y70A 2REQB 3PBVA 1KBLA 5LIWX 1E0VA 3PPGA 3S46A 3CPRA 2XN2A 1KQZA 2OMAA 3W7LA 2XM2A 3T42A 5I09A 1KM0A 4HPGA 5IM51 4XBKA 3ITVA 2VCAA 5KZ6A 1MW3A 3CLMA 3WEZA 1RUSA 3C0QA 3THDA 3WF1A 3HZ3A 3NYDA 1F8MA 2CYGA 4ICCX 3CMFA 3THQA 1C9WA 1G67A 3SQMA 3A21A 2XIBA 1HKIA 4DQWA 5CEWA 1W5PA 3QGAC 5D05A 1MQQA 4N4PA 1Q7ZA 1RJPA 3DFOA 5F2MA 4C6DA 2J7CA 1FWWA 3KLLA 1IIHA 1KFCA 2OFJA 1U1JA 3KCOA 3NTYA 2JEPA 4JKLA 4I9AA 4D9PA 4ASTA 5CZ0A 1ZU8A 3S6OA 2V3FA 3NQEA 2CHNA 4GE8A 3AWNA 4GYJA 3LG3A 3TN5A 5CAKA 1RCOB 3AUOA 2Y2WA 1MDRA 3CTTA 1QNOA 4RPQA 1VEMA 5DT7A 4XD4A 3I3EA 3LBMA 1B3VA 1PEZA 4DBWA 1Q2RA 4RNFA 4PFHA 3R43A 3NAVA 1QU4A 3KEHA 3M5ZA 2IKHA 3PBMA 1AQFA 3VOFA 3WJYA 3WLNA 5ABFB 3QPEA 1Z44A 4GY1A 4NT0A 1NWSA 4GWEA 1Z7AA 3SN4A 1R0MA 2WLYA 1NWRA 1KFBA 2XSAA 1GQLA 3NQ6A 3O7UA 2NV1A 4KCTA 3K30A 3CV7A 4YJ5A 1WKDA 4NRSA 1RVKA 2XGBA 3UJ2A 3B8UA 1FWHC 2WMIB 1BQGA 1FDYA 1PZ2A 2ISDA 5HNNA 3FEMA 3PPHA 3RPTA 1H0GA 2F84A 1Q6GA 1VH7A 3H12A 4UMBA 4JQ1A 4FHAA 3WQCA 4U5IA 5F4SA 4A8LA 5C2XA 1E5JA 4HMNA 3EKLA 4OV9A 3P5YA 3GXMA 3DFHA 2GGIA 1BYAA 1M3UA 5F1VA 3W0KA 3MBDA 4JTCA 1W54A 4GG9A 4HD5A 3DXIA 3UYIA 1FWIC 2Z1KA 3ANUA 4Y9PA 4LYKA 4L1GA 1QW9A 3M0YA 3ZQ9A 2P50A 1TB3A 2VWSA 4WDUA 2GQAA 3WMLA 5HK4A 1IEIA 5ECVA 1F74A 2J47A 3M64A 2ZZ3A 2QQ6A 1D3GA 3CZ8A 4UOZA 1S5NA 4IPJA 5T26A 1PDZA 3V5OA 2VWTA 3LSCA 3N6JA 5ABHA 3WK0A 5I79A 3WF0A 4F9JA 1SO4A 1NVMA 3AIBA 3NQVA 2FZMA 2DQWA 3O6YX 1DQXA 2XDFA 4QHRA 4UFLA 1X96A 5JQ9A 1NDWA 4WD0A 3L0KA 4PEEA 1FOBA 2XVPA 3CIWA 3VZYA 3BAWA 4U3CA 2XYLA 3P67A 4HU4A 4ATDA 3CZEA 1G0CA 3G22A 4NZJA 4A8IA 1E4LA 4UQ9A 5GNYA 1BWVA 1GPWA 3KHDA 4E6MA 4ZR8A 1CZ1A 4GVFA 4YYCA 2OOFA 3ITLA 1B2YA 5HQMA 2IXUA 5CSUA 1V77A 3IS4A 3Q45A 2JE8A 1KKOA 3F4NA 2RFGA 4WX2A 5I6SA 1JQVA 3ORWA 4O12A 4YWSA 5FIPA 4LC8A 5LXEA 2OSYA 3HJZA 4UTWC 5FESA 2OKOA 2YKKA 2PU1A 1P4CA 4TUFA 5AOUA 1LL4A 2B4GA 4RE3A 5H6HA 8XIAA 5AC4A 1W5QA 2WC4A 4MPQA 1E6NA 2EAWA 1RAKA 1AJ0A 3FDGA 3EXTA 2YFOA 3K4DA 3GG0A 2J7EA 3VA8A 2VX4A 1YMYA 1ICQA 1PS9A 3CIVA 1QR7A 4I6KA 3OIXA 5BRPA 2E5CA 1R30A 2YX0A 3DENA 3TTSA 5A6KA 3T6CA 4U33A 5HNTA 4JTQA 3UWYA 3ZMRA 1S5MA 4GOAA 1HGYA 1VGAA 4B91A 3VNZA 2QPUA 5D33A 2C14A 8CGTA 2Z7KA 4KETA 1FCUA 4IMGA 3NDYA 2KZHA 4FLQA 3F5KA 5J04A 1E0WA 4IUGA 1UQYA 2ADAA 3VVGA 1RQEA 1J0ZA 1BWKA 1MUWA 1N7KA 3PZNA 4W85A 4F2UA 1EIXA 1WPCA 3WBXA 3FHQA 2HVNA 5I07A 1MYRA 2XVKA 3GBDA 4GO9A 4MG4A 1EDQA 1KRCC 5CPSA 3VFLA 1F73A 3ZVHA 3GXIA 4IJRA 4BKNA 3T4WA 3BGGA 4OHQA 1SR9A 2GQ3A 4YXGA 4DM2A 5A8PA 3ANYA 1KBKA 3KTSA 1X1NA 4ORMA 4HZ6A 1KO0A 3S47A 3RHGA 2E9BA 4DF0A 3LI0A 4CCDA 5TQLA 1PTDA 2DZXA 3H4GA 1NOUA 4TX9A 4XAGA 2HE5A 4A8RA 4K37A 4Q33A 1BYCA 4JTTA 3F5LA 3PBYA 5B7ZA 1ADSA 2QJNA 1XCFA 3H53A 1HKWA 3ZVIA 2PWVA 4ZO7A 2HWGA 3MHFA 5AYIA 3BH4A 1J9YA 3AXMA 2PCEA 1VJZA 5H1WA 4PC8A 4Z1BA 3AIRA 1JPKA 2YZRA 1JCJA 2JQXA 4KWOA 1OFRA 3CM4A 3N2BA 4I9JA 1ME8A 1MEIA 2D20A 3TWBA 3O06A 3DKJA 1HGWA 1K8CA 3O2LA 1AH4A 3PJWA 1V79A 3MI6A 4MYXA 5AHFA 2FJUB 3WBWA 4ZBCA 4UQBA 3TEVA 1EPVA 1TFVA 1W1IE 4NNAA 4J3TA 4TO8A 2FVKA 1C7SA 3G3DA 4Q32A 1EGZA 1LBLA 4PCFA 3W1MA 4B5WA 1L6WA 4WJEA 1Z8AA 3SY5A 3ZR5A 1XIDA 3TYZA 3V75A 2A7PA 2QS8A 1S2WA 2G95A 2GGEA 3P81A 4K2SA 3C2VA 4Q6JA 1KRBC 2I9EA 4UOJA 3N6QA 4Z2KA 4R7WA 3WFZA 4ERIA 5BWFA 4QRNA 1XUZA 1FY6A 3IV3A 4H3DA 2VM8A 4D2JA 2FHCA 1LRQA 2OEMA 2J7GA 3RU6A 4JYFA 2INZA 3NQ2A 1VBUA 4IL0A 1O7AA 3V5FA 5FACA 3WDHA 5BRBA 4LEFA 2YSWA 2OWCA 3DESA 1M9HA 5DO8A 5HAOA 3QR0A 5DELA 2OSXA 1AD4A 1G4PA 5EL1A 1QW7A 1VYRA 1KM5A 2F8QA 3M0VA 1WV2A 1BXBA 3R6IA 2PDBA 2QDEA 3M6DA 3V16A 5BRQA 2EPMX 3TQ0A 1F61A 4QBXA 3DKLA 2Q8LA 4IQJA 4U5KA 3TZNA 4S3JA 4Z2HA 3LUTA 5AFDA 2PD5A 1TCDA 2ISWA 2P76A 3K13A 4W89A 2PI6A 4AX7A 3VKCA 2Y7EA 1CGXA 3LERA 1QBBA 3N18A 3DERA 3LGGA 2PEVA 4KIEA 4IICA 2W4XA 3VIJA 5KZDA 6TAAA 3R0UA 3LM3A 2PP3A 3E0FA 4DZIA 1MQRA 2WSPA 1UWIA 4X60A 3IGXA 3RIKA 1P0KA 3DYPA 3L2IA 2GGHA 1EBHA 2CLLA 3IUIA 4X0VA 2EKCA 3R0KA 4O19A 2PA6A 4NNCA 1Q6DA 3QLDA 2PURA 5T9BG 3WNLA 2PRMA 1JNEA 3WDJA 3AXHA 4C1NA 3PJUA 3PJXA 2DDXA 1QPOA 4IG2B 1A4MA 1P6BA 1VZWA 2JKPA 2PF0A 2P88A 4DYKA 2ZFAA 5EMJA 2DZSA 4IIGA 3B06A 2VEGA 3WQ8A 3LPOA 2OXNA 3NO5A 1GYMA 2PWEA 4KEMA 4H7ZA 4DXKA 3CT7A 2J88A 3M0KA 3M4HA 3V5CA 2NQHA 3QKEA 3T2OA 3W24A 4MWAA 4AMCA 3BAYA 1C90A 2JEQA 1GKPA 3CHDA 3IVSA 3ABXA 3HB9A 4QEEA 5CGMA 3NL5A 4IH3A 1RVGA 1TPH1 1FHVA 2GJXA 2AL2A 1WKYA 5JU6A 3NZRA 5BOFA 5EY5A 4A2SA 4AZBA 3LPFA 1TO3A 2B7PA 3S1XA 5T8GA 2OT0A 3ZVHB 4RXFA 2I17A 4Y6GA 1PWLA 2HV5A 4AD5A 5DMLA 4MLJA 4J7RA 1ITCA 2YDSA 4JFVA 5BU9A 1DXFA 4PL2A 4JX5A 3CUJA 4EAMA 3TKFA 2V30A 1P48A 3PZTA 3HMCA 1DJNA 3EXSA 2J9XA 1ZP4A 4GX9A 1PX3A 4E5TA 1F07A 1JR1A 5AHLA 5IXEA 1GEQA 2ZC8A 3CAWA 3EDEA 3K46A 4M6QA 3CHVA 5KTLA 1J6OA 1JGIA 3V36A 1P0NA 2Y0FA 3W1LA 3U57A 4DXXA 3MP4A 2CITA 3HPAA 1PHWA 4GIEA 3O0FA 3CPUA 4M0XA 4CQAA 2Y7GA 1KR0A 2QW5A 3KW3A 2JIEA 1XC6A 1NDVA 3RK8A 1AH0A 1QASA 2VX5A 4OBSA 4DO4A 3IJQA 2QUTA 4B4HA 4UCFA 3W7JA 1V3IA 1C91A 3FEQA 2IKIA 4W8AA 3W3OA 5A6SA 4HYRA 3NQGA 1NSJA 5A95A 4ZODA 3VCRA 4V2XA 2FH6A 4ICNA 1THFD 4R5EA 4EOUA 4DJFD 3WBYA 2IPGA 3NQAA 1S3HA 1SUXA 3G8RA 3W1PA 4IP4A 4XTDA 3VCCA 4REQA 2ACQA 2J7FA 8XIMA 3FXYA 4PUEA 4HMCA 1SR0A 3MW7A 1VCGA 3WMSA 1XBZA 1XD1A 4IFOA 3WH6A 1XYZA 1ZBCA 3LOTA 3SCNA 4CD6A 1OQFA 5JIPA 1MUCA 3BO9A 1RALA 3NA8A 2ZXBA 1W3NA 3NL6A 2YL9A 3B4UA 1ITQA 1XGEA 2TPSA 3KOZA 4GIYA 3AIVA 3NO1A 3CWOX 1QWGA 2X7VA 1UWSA 1WDRA 1CXEA 2VUYA 5C0QA 3IPWA 5CZTA 1NAL1 1E9ZB 1W8SA 4C1KA 3WKZA 1QO2A 2HVMA 3L12A 2Q01A 1L8PA 1JGMA 3CUGA 3APTA 1MZRA 3C5QA 2XH7A 3LB0A 2Y63A 3EKZA 3EEGA 4ORIA 3GVWA 4GD0A 1JPIA 3TX9A 3G1XA 3MVTA 4J40A 5CC6A 4MNJA 3K5XA 3TTOA 2WMJA 5CKSA 5G1YA 3TQKA 3ZT7A 1W91A 1OCNA 1QWKA 3R2GA 3SCWA 3C2EA 1R6WA 3URNA 2O9RA 1F3WA 2FFIA 4ZOCA 3QV8A 5CGQA 4IGNA 1GOOA 3WLMA 2Y8VA 2XN1A 4XSMA 3G0SA 1XISA 2BFGA 5IBXA 3WF2A 3B3DA 4O4VA 1A5NC 4FX7A 4L5ZA 3F4DA 4PMRA 4JS3A 1Q8JA 3TYEA 2H8ZA 2PP1A 1DJQA 2Y7FA 4EANA 4LU0A 5CC7A 3A4XA 1XIGA 4KPLA 4AMAA 1XRVA 4AXKA 4U2YA 4GUIA 2Z1SA 1M1BA 1W3TA 1E6ZA 3CAQA 3UBPC 2ACRA 2E6FA 2ZWZA 2DIJA 4PN2A 1X97A 2GDQA 2WZIA 1X7IA 4LALA 1QK0A 3OQ8A 3PR2A 4E4FA 1AA1B 3GS6A 2FGLA 1YE4A 3CYJA 1V0LA 4LRSA 2CLEA 4BQ5A 3GNXA 1RSCA 5I3JA 4R27A 1GTHA 2ZZ5A 3VFCA 4AC7C 3E2VA 1VYPX 1G69A 1D8CA 1HNYA 4MWAB 3BWWA 4IJCA 3R7MA 1FP8A 4GKLA 4GI4A 2R94A 4YTSA 2QCLA 3SCQA 2GOUA 2J74A 3W7DA 2ZQ0A 1HJVA 2GJXB 1Q45A 2VX6A 2AL2B 1XCWA 1XBYA 1A0EA 1AG1O 3GW3A 3TYDA 1VFSA 4JTLA 3JVAA 1ZJAA 2C7FA 3TROA 1OC6A 2GVJA 3AHZA 3MJYA 3GR7A 4FOKA 4HZ7A 1V0KA 4B5XA 4GZ7A 1QI0A 2WZHA 4CCEA 2CXEA 1IWPA 3MS8A 4F0SA 3P62A 3RCNA 1EQCA 2ZUTA 1BTCA 4KT2A 5I24A 4Z2IA 3CHFA 3P3BA 3G1VA 4RE4A 1V3KA 2G50A 3HTWA 2EO7A 3GC2A 1VCVA 3FIGA 1CLVA 4GFSA 2GQ9A 4UB9A 4FF5A 2JGYA 3GHTA 1B31A 5C55A 3F4VA 3I10A 4ZENA 2O0TA 5E9AA 2H3DA 1IHIA 4M80A 4GBUA 2DIEA 2J8GA 2VDIA 4PCNA 2HK1A 5IFTA 4IGSA 3PB0A 3TMQA 4C6NA 1QNSA 1KA9F 4N4QA 3L4TA 3VC6A 3ZJ7A 2NVAA 3SGZA 1SU5A 1PJ9A 4US5A 3UZJA 5FF2A 4XD6A 1B3ZA 1H7RA 1R7OA 2VYOA 3ARTA 2I7GA 4PMJA 3VDAA 5MF5A 3BVJA 3CWHA 1TZ7A 4O18A 2NZLA 1Z6KA 4J1OA 4PUWA 3C4UA 1RBLA 3KE0A 3EMCA 5FJUA 2VR2A 1F76A 4GBDA 3HQ1A 3YPIA 1F3EA 1V6XA 3ENLA 5C7HA 1E43A 4LCRA 1DWFM 3GNDA 4C6LA 1UUQA 5CC5A 2WW5A 3KDOA 4UQDA 2CBJA 4O0ZA 4QE5A 3E02A 1TV4A 2QMKA 1ME7A 5CPLA 2IS7A 4PTDA 1UD2A 2CKSA 3O15A 1ZJHA 3TV8A 4CU7A 2QJIA 2Z6IA 4REQB 1GOKA 3TLLA 3HV9A 4PCSA 3UWVA 4UC5A 4DUWA 3STPA 1ZLPA 4Q8VA 1XS2A 1S5WA 1SO5A 1LL6A 5IDIA 4Y7EA 5B80A 1K3UA 3W26A 2PDFA 2V5BA 2J77A 4DF2A 3K1DA 4FK9A 3NDZA 4HCLA 3ARPA 1C29A 2WVTA 3DFQA 1R2RA 1KM3A 2DJXA 2X1IA 3PWIA 4XUGA 1T7LA 4NHVA 4G6CA 3SUVA 5HMSA 3MSRA 4AIBA 4DVOA 4Q8PA 1VIZA 3GDMA 4DUOA 1TUXA 2RAGA 4DIAA 2RDUA 2NW0A 3O07A 4XKMA 1VFHA 1XKJA 1NFBA 2XFYA 1Z41A 3MUZ1 2W63A 2QZRA 2WB5A 1EJUC 2E7FA 4O1DA 5CPOA 5DRIA 3U2ZA 4JQAA 3LK6A 1BTMA 1XF0A 4C6QA 1KD0A 1RR2A 4QNWA 1ZBKA 1F9CA 3GFYA 2DSVA 3PG9A 5KMYA 3J7HA 3F1QA 2YDRA 3ME3A 4DWDA 1PUDA 3P84A 3OVPA 3ZR6A 5FEZA 3MI2A 3QC3A 2BHZA 3ITXA 4ZA0A 3PZIA 4JTDA 3T09A 1OX5A 2F9RA 2HCVA 2E6AA 3NO3A 4B2DD 1OC5A 1WZKA 4IWWA 3T0DA 1REQA 4AD3A 4GI6A 2BSLA 2OX1A 3U2EA 4LJ3A 3DCPA 2WJZA 3VOIA 1MUMA 4JEJA 3MC5A 5G1TA 4U10A 3OYXA 3LN3A 1SSDA 1E3XA 5E09A 3S83A 4HSHA 4H01A 1EJXC 4DJED 1EOKA 1J5TA 4R7OA 3SIZA 4ENLA 1XQLA 2A5HA 1VFTA 1DIOA 2UY5A 3UJRA 1XRFA 1H60A 4BEUA 1XPGA 3CUZA 5XIAA 4Z1YA 3IIPA 1Q63A 3OG2A 5FL1A 1W9PA 1A53A 3TFCA 1DTUA 1CT5A 2VD9A 4O15A 2PF8A 5FCZA 2PB1A 4XAYA 4QJ5B 3DIPA 2VMFA 2DT3A 1B5TA 1GG1A 4EP8C 2QV4A 2IKGA 2Y24A 1WXYA 4BF9A 1DWAM 2WSYA 1F6KA 4Q4KA 1UOKA 2NUYA 3MMTA 3T0TA 4F0MA 1JZ2A 1M68A 1E40A 4PODA 3GC5A 1MDLA 4M56A 3R11A 3W84A 3QEZA 2YCIX 1NP2A 4JOMA 4LBSA 4A3UA 1YYAA 2W9MA 4F40A 1H11A 4KGJA 3CNYA 3BCDA 5GJPA 2CIPA 3GAYA 2OZ0A 3ES8A 2CZFA 3PJTA 4XISA 2A7NA 3MTWA 3TU9A 1OCJA 3P8IA 4PA8A 3M47A 1B9ZA 2NT1A 2Q3OA 4AHQA 4F48A 2XHYA 3LDVA 2WMKA 3KCLA 3MVIA 1G4TA 1UJQA 2JF7A 4AH7A 2G3FA 3DN5A 3P80A 4JTEA 5D8ZA 3NUKA 3VD7A 2DV0A 2IQ0A 4CEXC 4RZBA 4Q6XA 2O9OA 4F3HA 1WZLA 3BV4A 4Q7IA 1I4NA 4EF9A 1W56A 1O5KA 3OVGA 3BJFA 1PYMA 4HHLA 1HT6A 5EMMA 3PPFA 4MUZA 5FEXA 5HMDA 9XIAA 4Z08A 3VZXA 3W2UA 3H2MA 4FZIA 1JRBA 2YW3A 3G1SA 3WNMA 1IWAA 3S2JA 3W2NA 4L4OA 3PUOA 4OOZA 3UR5A 1KFEA 5DFAA 1QO5A 2DSUA 1A3HA 2B7QA 2Z7GA 3DZ1A 2QPXA 9RUBA 1Z48A 3GHSA 3OZPA 4AXNA 3E49A 7TAAA 1XGZA 3B9OA 3O9NA 3H2FA 3SADA 4JN8A 5DLCA 2ZX8A 3BLLA 3SN0A 3AXXA 3AOFA 4QGCA 3CK5A 1Q66A 2EGZA 4IL2A 4HTYA 1EA9C 2BASA 3N13A 1RK5A 1X7FA 4FX6M 1J79A 4EK7A 3WNOA 1PTAA 2EQDA 1JDAA 1TPDA 4MM1A 1XLBA 2D73A 2DUAA 3RLGA 1V02A 1O66A 4IPIA 3WLTA 1J8VA 1P0EA 4WRHA 4JNMA 4R34A 3CAVA 1NP0A 3REQB 4G7EA 1OINA 3VNJA 1UOZA 3BE7A 3W28A 3CH9A 5I3FA 1S2TA 1E1FA 3MYOA 1QCWA 5AHNA 2A79A 3RM4A 4M1RA 3C2RA 3H4WA 3ABSA 4BY3A 1OADA 4UZSA 3I4KA 1UBPC 3VAVA 5K3VA 1V7AA 1IXPA 2E09A 1TQJA 1RCXB 3WD4A 2BXYA 4E8GA 1S5VA 4L1XA 5HQEA 2PWUA 3EX4A 4GMEA 3K4WA 4I9MA 1FP9A 5CPTA 4H41A 3CMGA 3EBVA 4XAPA 3WJSA 3WDQA 4GUJA 5CQ1A 1E4IA 1UR3M 3N15A 3H22A 2QEZA 4MGGA 3CL6A 4AY7A 3IWPA 1HJXA 2DORA 3TA9A 3KCJA 1E1EA 1SZGA 1QPQA 2FZ9A 3VDCA 2CC0A 1HL2A 4S39A 5KSWA 3OTRA 2W92A 1LYXA 2FLIA 1DJWA 1QRQA 2BHUA 4DN1A 1J0KA 3VGBA 1A47A 1SZRA 5D9OA 1DOSA 4WKHA 4XB3A 3E5BA 3UNTA 3TQVA 4CUCA 4LF1A 5CSSA 1LQAA 5U7SA 3PZVA 1PCKA 1FWCC 5M3WA 5CAHA 4IGMA 3C2OA 2TAAA 3UZWA 1WAUA 3QM3A 3WMBA 4FAMA 3DFSA 3M6YA 1KTNA 2GPTA 4XZNX 4G7FA 3MA8A 3QOMA 2D3LA 3GX9A 3ITOA 1Q6OA 5I0DA 1H7OA 1UA3A 3EMZA 3HU7A 1CYGA 3BXWA 3GVGA 3ZJ8A 1CGYA 4PYSA 1EF3A 1CNVA 2Y8KA 1KQYA 3P0XA 3WLIA 3GXFA 3EWBX 1Y65A 1RQHA 1UG6A 3AHVA 3VMNA 3CZLA 2ZUVA 3ITGA 3TW9A 4YLWA 3D6NA 3UF9A 5TAOA 4DF1A 4I90A 3TC7A 4X2RA 2OWWA 4M19A 4RJEA 1GNXA 4W4QA 2NQ5A 2D0GA 4IQLA 3S5YA 1OT2A 3UPWA 1UIPA 3QYSA 1FWJC 3GTFA 4H9ZA 3DHFA 3E2RA 5T91A 1R3VA 4RZ5A 1ZAJA 1ITXA 4CNSA 3ICJA 3BOXA 1AD1A 4L9YA 4MWAC 2JKEA 4H8VA 2NWRA 4ZSTA 1V7YA 1JDCA 1RLCL 5A94A 3AFBA 4LVBA 5HR6A 3HGRA 4NL1A 3LI1A 2O9TA 3EDKA 3W1XA 4UFJA 3Q65A 1OX4A 5EFDA 3VIKA 1ADDA 4AZGA 4HMEA 1EWDA 1ZGDA 3GDKA 2ZRUA 4XUYA 4P5UA 1EBGA 1PIGA 3BLDA 1CCWB 3WG6A 3WQ4A 5LA0A 3CUHA 1RP8A 2FYMA 3M0JA 2F6KA 4G8TA 4A22A 3MCMA 3R58A 4EWJA 4FR6A 2E8ZA 3AZRA 6A3HA 3WD0A 4ZOAA 3QZ6A 3B0XA 2WHLA 3A3WA 4C90A 5DMYA 2WC3A 1QHPA 2PLKA 4O57A 3MI3A 3QH2A 1S46A 5HATA 5EBAA 1Z89A 1XLCA 2BVTA 3STFA 1TVLA 3ZXWA 5U4NA 3VIFA 1H3GA 4X61A 2XIIA 5GVJA 2CWXA 5D9MA 4KS0A 1I0BA 4F0HA 1ZENA 3ARVA 4FS9A 3WDRA 3G24A 4JL1A 1WB0A 1E9YB 3VGFA 4ICMA 3L68A 4ZXLA 2XIOA 4XZHA 4NX0A 1TV5A 1WBHA 3BG5A 4R88A 3WELA 4F9DA 2BGNE 1K9DA 4GIAA 3WUGA 3KAOA 1J4EA 4G7EB 1AH3A 4Y8FA 3NCOA 4V1YA 1TG7A 4S3GA 4AYGA 4W5ZA 1LLOA 3KL0A 5XIMA 1UWQA 4XKYB 1I2NA 2OG9A 3S8HA 4KCVA 1GQJA 3QJAA 4XX6A 2OQHA 4LWWA 2ALDA 3L0NA 4PTWA 3L5LA 1NH6A 4U28A 4OBTA 4IMAA 1UP2A 3NOYA 3CV1A 4WSJA 3W53A 3W81A 3HMJG 4ZFMA 1IYXA 2ZUWA 1HUVA 4A29A 4WVXA 2FPTA 4QJ1A 3QBUA 5D04C 5G4WA 2VQTA 3SZ8A 4Q8OA 1A5OC 3MV01 2PDIA 3PWGA 4V1XA 4LF2A 4XIAA 3EWYA 4C7FA 5CCZA 1QPKA 2XVGA 4GZJA 3GD6A 3R25A 4KEVA 2JBMA 4RE2A 1LLZA 3BC9A 1US2A 3UGRA 3TXVA 3PPCA 1RY0A 3W1AA 2BHYA 1RJRA 4JAWA 3NQ7A 3RNDA 1C92A 2WMGA 3BAIA 2FGZA 4AB4A 3UETA 3H4XA 3TSMA 4R9OA 5CJ5A 2CWNA 5A3HA 4YVPA 3WMCA 4Z1AA 5C54A 5CPQA 4CCCA 2EBNA 1E1CA 2QIWA 1FCQA 5C7VA 1TYGA 1W1ZA 4PH6A 3MHUA 4OFCA 4A3QA 5GPRA 2QJHA 3OLDA 5CBIA 4G1KA 1XG4A 1PE1A 3VOCA 4RNHA 1IR1A 3CMJA 4B9YA 4JR5A 2PZ0A 2E8YA 5AVNA 3W7NA 4RDWA 1HP5A 2ATMA 4K36A 2MANA 4WQ6A 4TOQA 3WQEA 1V3HA 3UY8A 1E0UA 4FF7A 5I3HA 3TUUA 3BMVA 4GRSA 3HG5A 5FD0A 4EWND 2G97A 2VFIA 2GDVA 1VPYA 4AF0A 4GQRA 5A8OA 4YCOA 3W76A 1TTIA 5AHIA 1CLKA 2V2DA 4UTMA 4LAUA 4EPEC 4PMDA 4PCTA 1QUMA 2J7HA 1QOXA 1FXQA 4A8NA 2IPWA 1VKFA 4KRUA 3UXKA 4B90A 2FMNA 5E93A 4LOCA 1OFOA 4JCMA 3P5ZA 2VRJA