4NJGA

Crystal structure of quee from burkholderia multivorans in complex with adomet and 6-carboxypterin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
209
Chain Sequence
TYAVKEIFYTLQGEGANAGRPAVFCRFAGCNLWSGREEDRAQAVCRFCDTDFVGTDGENGGKFKDADALVATIAGLWPAGEAHRFVVCTGGEPMLQLDQPLVDALHAAGFGIAIETNGSLPVLESIDWICVSPKADAPLVVTKGNELKVVIPQDNQRLADYAKLDFEYFLVQPMDGPSRDLNTKLAIDWCKRHPQWRLSMQTHKYLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-carboxy-7-deazaguanine synthase
publication title Radical SAM enzyme QueE defines a new minimal core fold and metal-dependent mechanism.
pubmed doi rcsb
source organism Burkholderia multivorans
molecule tags Lyase
total genus 65
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 4.3.99.3: 7-carboxy-7-deazaguanine synthase.
pdb deposition date 2013-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13394 Fer4_14 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4njgA00
3UNDA 3TQ0A 1HO4A 1T8XA 2NXHA 1KW1A 3HQ1A 4MZ8A 5F1UA 2TRSA 3WJSA 3W07A 1W56A 1OVDA 3NPXA 5LNSA 3L65A 2ISWA 5A8GA 3LCHA 3RLVA 3QSTA 4A21A 4ALDA 1H7WA 2CW6A 2R8WA 2JK2A 3STEA 4JEQA 4BFAA 2TSYA 3W2NA 2EGZA 2TYSA 4KFNA 2VEMA 4MFDA 2VC6A 4EWND 1G69A 2QUUA 1KM0A 1I4NA 3OEXA 2CLHA 4O12A 4MKNA 3PB0A 3Q94A 3BGJA 2DZXA 5HR6A 5AOUA 2X2GA 3UXDA 3L68A 3NZ1A 3JRKA 3MP5A 3PAJA 3NEVA 3ABOA 2RDUA 4KKXA 3TSMA 1DKWA 3THAA 3UY8A 1H7XA 3TV8A 2FDSA 4UTWC 3KFTA 3GDLA 5AHIA 4TMCA 4ZZ9A 3NQ8A 2JKEA 1XUUA 4N4PA 5C55A 4JYEA 3A22A 3TX9A 2W79A 4B5NA 2WOQA 2H3BA 2ZZ4A 1LROA 2GJLA 1LCOA 4HIBA 2C19A 1ZHAA 4XTIA 2ABBA 3DZ1A 1LRQA 1OX4A 2RH9A 1UASA 1VHCA 4JX6A 4JTSA 1SSDA 1QFEA 4EF9A 3W2LA 2VFFA 5SWUA 1U83A 2OCZA 3TUUA 4O19A 3LHVA 1V5XA 3FFSA 1J5TA 2DZUA 1B3OA 2YZRA 1QO2A 1JRCA 3STCA 1EWDA 3MO7A 3NDOA 3WK0A 5DXYA 4NXSA 3G0XA 4MJMA 4EOUA 1YPIA 3M44A 1OFEA 4TR9A 3NA8A 4RZ4A 2XFWA 4I7WA 4BF9A 5LKYA 1R2RA 3EXSA 4ZQRA 3LCIA 3W22A 2A85A 2RDTA 5F4XA 3PBUA 4EVZA 2RFGA 4NNCA 2V8ZA 2WKJA 3TW6A 4OWGA 4JTGA 3R13A 3C8FA 3NL3A 4LU0A 1NAL1 1QPRA 3SIZA 1CX9A 1MEIA 2OZ0A 3NPUA 3W1TA 3UWYA 1TPEA 3L0KA 4PL1A 3CIWA 3VKJA 1N8FA 4FNRA 5AHMA 2DP3A 4MOZA 2AAMA 3G18A 5D03A 3ZWTA 4HNVA 1SW7A 3IIZA 3N73A 5D33A 3S5YA 3IGUA 2IQTA 3C2EA 4NT0A 1OABA 3GNDA 2JGYA 3LHTA 5LNVA 4IGHA 1H62A 3BW3A 2VFEA 1GYLA 1DORA 4JIQA 4AHOA 1NSJA 3PSWA 4IOTA 3W7CA 4OHQA 3U6WA 1HO1A 3NYZA 1ME7A 1OHLA 1VYRA 1VGAA 4UTUA 3LX9A 4I9AA 4WX2A 4N6EA 2V5BA 1FDZA 4NVTA 3C56A 5CSSA 2F84A 3E96A 3PUEA 3ZFHA 3PC0A 5F2IA 4A2SA 1TV8A 3FS2A 3LCFA 3CWNA 5FF7A 1LOQA 3DXIA 4XBKA 2Y7EA 2A1YA 5HINA 3BW2A 2ZRVA 4K7YA 1FWSA 3G1FA 2GVLA 1ALDA 3SZ8A 1W37A 3NXFA 5K2ZA 2TPSA 1K02A 2FFCA 3GXPA 3FJLA 3G1SA 2QJHA 2E68A 4QNEA 4XUGA 2QJIA 4LRSA 1Q6RA 3MW7A 4RJEA 4IQLA 3BLFA 4YCOA 3NQGA 1DOSA 1N55A 3T4CA 3HGOA 3H55A 1WBHA 1F74A 4ZVJA 3W7HA 1R2TA 5A5WA 2VFDA 2E1DA 4Q4KA 2WNQA 4ZQCA 3FYPA 3SECA 3V1PA 3FKKA 2ATMA 4U28A 3YPIA 1WA3A 4OV9A 3STGA 2DJLA 5U4NA 3L0GA 5AC8A 1K03A 3TC6A 4LVAA 4FX6M 3UZ5A 3QM3A 1WQ5A 1H60A 3P61A 4LOCA 4Z1CA 3TXVA 1TPFA 1ZY9A 4ML9A 5E93A 4NJIA 2J24A 3HPXA 2JBMA 4LS0A 2DORA 2V9DA 2ZRYA 3W9ZA 4NUWA 3O15A 4UTTC 4K39A 3W2UA 1X1ZA 3VI2A 2VKZG 2WNZA 4TU1A 1SU5A 1OF6A 3EKZA 1G7VA 2Y7GA 4N9DA 4EF8A 3Q58A 2BTMA 2OX1A 5I3KA 5KITA 1VHNA 2VFIA 5AB3A 4GRSA 1O5KA 5AC6A 1ZALA 2YFNA 3BGGA 3TH6A 2NZLA 1B4KA 4WY0A 4O15A 3W70A 3SI9A 4O1AA 1B9BA 1XFBA 3S42A 1NFBA 4JDBA 3B0VC 1XBZA 2Z1BA 2ZZ5A 2I1OA 4R53A 3W1MA 4UIOA 2ZA1A 1SW0A 3ZS4A 1FCQA 3LHWA 3NQAA 4TX9A 3EX6A 1H7PA 3W75A 1KFJA 4OGZA 2ALDA 4NZFA 4R34A 4HPJA 2Y61A 1OYAA 3P81A 2ZTKA 1RR2A 3NQDA 1LLZA 1VS1A 2DZPA 4HN4A 3W83A 3KXQA 3A5FA 3DI0A 4AMAA 1QWGA 3BARA 3K30A 5D38A 2BXVA 3IV3A 3PG8A 4MIMA 1TV5A 3GDKA 3QPZA 1IIHA 4MFEA 3HJZA 2Z0IA 3PG9A 4IWWA 4CNPA 3JS3A 3NQCA 1GG0A 4QISA 1WDWA 3CHVA 3TQVA 5I3HA 3G1XA 3TNOA 1KTNA 3BLIA 1GVRA 3M43A 2J6XA 5CSRA 1TPVA 3WK2A 5HQEA 3GXNA 1G7UA 1TTJA 4O50A 4XTDA 1SO5A 2KZHA 1RV8A 1JVNA 1TJRA 1N7KA 4IXXA 1U5JA 4MPQA 1EPXA 5AHNA 3LHZA 1DL3A 4OBTA 5C5YA 1KBJA 3O07A 4OQVA 5HULA 1KM3A 2ZA2A 1L9WA 3C2OA 2NLIA 1VLIA 1YXDA 3SW6A 3E0IA 3TROA 4DEFA 4XWUA 4QQ3A 1WYIA 1ZCOA 4FXRA 1PVNA 1DJQA 4O8RA 5HWJA 1NVMA 1H7RA 3V75A 4AAJA 3N34A 2ZZ2A 1WOBA 3T7VA 5EPDA 2AQWA 1W1ZA 3JR2A 1I2OA 1O60A 1VZWA 3O6DA 4Z0SA 4K8HA 5AYXA 4AWTA 5CZ0A 3PBWA 3PVFA 1XXXA 1RZMA 2CLOA 2PE4A 3TIMA 1R2SA 1SSGA 2ZRZA 4AVFA 4JTFA 4HNTA 4UTHA 5D05A 3GZ3A 3W1NA 3VFLA 1SQ7A 4KFPA 2I9EA 3CIXA 2OMAA 3LV5A 1FQ0A 2ZCGA 4QSHA 1F5ZA 2RKXA 1SO4A 2V2CA 2CU0A 5EMUA 5LHFA 2E6FA 1R46A 4O54A 5KZMA 1OYCA 3W6YA 4H6KA 2YFOA 3IVSA 2NX3A 1ZAHA 3IGXA 1DHPA 3G3DA 2Q8LA 1LOSA 3BG9A 3NQEA 4NX0A 5FF2A 3G1VA 5BOOA 4JR5A 4LW7A 4MUZA 3KHJA 2ZA3A 1T0OA 3IVTA 1LBFA 5I3FA 4MY9A 1TTQA 1FCUA 3LCXA 3VCRA 1P1XA 3CC1A 3LHYA 3LOTA 5LNWA 1IF2A 4JTIA 5K9CA 3IVUA 3ATYA 3W7OA 2W6RA 4LV4A 2YYTA 5DCBA 3O8AA 3QPYA 4PH6A 3TU9A 3W7GA 4UTLA 1TPUA 2B7PA 1M7PA 4BR1A 4JIPA 4DXVA 4PODA 5IBXC 4CNNA 5G1TA 4M19A 3HIJA 1KM2A 3N3MA 4FNQA 3TAOA 1HFBA 1WAUA 2FJKA 2JKAA 2B4GA 3OIXA 3G24A 2A2IA 2FPVA 3EB2A 3PWAA 3M6YA 4QITA 3UQNA 3P5ZA 1VR6A 2B7OA 3TK7A 1OFRA 3NAVA 3WJZA 4GUHA 1BKSA 2EPHA 1AL7A 3DFTA 2A7RA 1KV5A 1UUMA 5F1VA 3C4UA 2XN1A 1HUVA 3F4WA 3W7NA 5DBTA 1JUBA 3PULA 4WZHA 2NV2A 3P60A 3CPRA 1GVQA 2NWRA 4E2BA 2CWNA 2GQ9A 3ATZA 1KBIA 1EP2A 3W1UA 1KM6A 2ISVA 3CB8A 1OX5A 2G5WA 5F4WA 5C6MA 3NR0A 3GYEA 4RZ6A 3PF3A 4Y6GA 4PEKA 4Z1DA 1YYAA 5DCDA 3TKFA 8TIMA 1MZHA 1QMLA 4QJ1A 2Y6ZA 4MZ1A 4FIRA 1JCMP 5HWNA 4BK9A 4Q33A 4UFKA 3TJLA 4LV9A 3S8HA 4N9EA 1L6WA 4Z1AA 2G97A 3C2VA 1YPFA 3NQMA 4HNNA 5CGQA 3B4UA 1QAPA 4RLIA 1ONRA 4DF0A 3L5LA 3HMJG 4WOQA 4IX0A 2YR1A 5F2LA 4CNOA 2P0OA 4K7VA 4UFLA 3B0UX 3PUDA 4LY8A 2A0NA 4MY8A 4NQ1A 4H3DA 4I7UA 4RXGA 1YXCA 3NL6A 3GVGA 3TSDA 4FNPA 4UFMA 3DI1A 2QUVA 3DGRA 3P67A 1UCWA 3W7RA 3UPWA 2FPYA 4O14A 5L6UA 1I2RA 3BK0A 3R5EA 4LRTA 3NL5A 3MP3A 1F76A 4RR4A 5K7JA 2OT0A 2R14A 4O1DA 1XKYA 3OVRA 3M47A 2XN0A 4M6VA 1TREA 3UWVA 4LUIA 4ZQNA 4DPPA 1TJPA 4RKAA 4UMAA 1X1OA 2C6QA 3KX6A 2NWSA 4GUIA 2CFFA 1KFEA 1Z44A 2QKFA 5D09A 1J4EA 4JN6A 3THQA 1GVOA 4HHPA 3GIYA 3EWWA 3LXAA 4FIQA 2YDAA 1OK6A 2DZTA 1EA0A 2YXGA 3MYPA 1EWEA 3G1AA 1E51A 5J5DA 4XKYA 3DAQA 5G2HA 1LBMA 1R47A 5AHLA 3ABSA 4IMEA 4N6FA 2V81A 4FO4A 4CQ9A 2DU2A 1F6KA 1XL9A 1UBSA 2BZNA 3MWAA 2Y7DA 2ZZ3A 4DPQA 3LRKA 2E6DA 2VEIA 3C0JA 4HKPA 1O95A 3S1XA 3T40A 1KV8A 1D3GA 4GUGA 3CTLA 1ZAIA 1PL9A 3W88A 3NQVA 4K8EA 4UCGA 3GX9A 3NQFA 3A5VA 3HB9A 4XKYB 4LVBA 4ZQOA 4UC5A 2YCEA 3NPVA 1GOXA 3NQ6A 3KRZA 1KM1A 3NGJA 5EY5A 1YDOA 2C15A 3I68A 2FB3A 4JTTA 2BWGA 2J27A 4BI6A 6ALDA 1TQXA 2E5DA 1P5BA 3UWUA 2JGQA 1ME8A 3NO5A 3W7KA 1LP6A 3LCGA 2GQAA 3ABQA 3W7MA 1TB3A 5C54A 1EP3A 4XBSA 1X6UA 4AB4A 1ADOA 2VXNA 1K7XA 4A2RA 1H5YA 1FX6A 4A3UA 2CZ5A 3SJ3A 3W2KA 4GUJA 2G96A 1GEQA 1Z42A 3LCLA 1ME9A 1I2QA 1PHQA 3S5OA 3IIPA 1A50A 1O94A 3FEMA 3I65A 1RQHA 3W1XA 4RV8A 5K3VA 1TTIA 1QPOA 4CQ8A 3W7IA 2ZDRA 5D04C 1LDCA 4AWSA 3TDFA 4UR8A 4W9TA 4FNUA 2V5LA 5CPLA 5I3GA 1F05A 1KFCA 2C3ZA 3LM7A 4N02A 2A4AA 2HS6A 1AL8A 5FEZA 4N2YA 1RPXA 3U2OA 4RX0A 4WD0A 1XM3A 5FEWA 4UNLA 2H3DA 1VC4A 4Y90A 2OJPA 4QAIA 3W1RA 1OK4A 1KM4A 3N9RA 1WOAA 2C1HA 1J2WA 5FEPA 4JY8A 3TQKA 3QZEA 4Z0JA 4MYAA 1TCDA 2C0AA 5CPMA 5D32A 4JDYA 1GT8A 5FESA 3QW3A 4C1KA 4FF7A 1W31A 1XUZA 3QRHA 2E5BA 2Z6IA 4O53A 4XQ6A 4O0ZA 4JX5A 5LSMA 3HBLA 4QM1A 3QFEA 4IJBA 4AH7A 4UR7A 3NNTA 1LOLA 1IIGA 2NX1A 1QPNA 1JULA 1TYGA 3HG4A 2WSRA 3B8DA 5BMXA 2V0TA 4FXSA 3A24A 5D2XA 3CQ0A 4YL2A 4P2VA 2QEZA 1PV8A 5G1YA 1BWLA 2B0MA 4HSNA 1DJNA 3HO8A 2FTPA 1OG0A 2OT1A 5AYYA 3PS7A 5LGZA 2QCEA 3I7QA 3KVKA 4KWVA 3O05A 3PR2A 4O4WA 3LRMA 3SY5A 1DQXA 1C9DA 4AF0A 4O57A 3NM3A 3PUOA 4TMBA 1PCKA 4M6QA 1ICPA 2RDWA 1FDYA 2E09A 5HMSA 5D30A 2R94A 4J9JA 4RCXA 3GAKA 4LVFA 4Z08A 5I3IA 1EUAA 1JQXA 3O6YX 3W7QA 4CLMA 3SGUA 3KVJA 3BPWA 1XBXA 1Z48A 4MY1A 5GVJA 4AF0B 5DELA 4IXHA 5D37A 3IRDA 1XDLA 3GB6A 3O16A 1HG3A 5CKSA 4POCA 2ZYFA 1H61A 4IPIA 2WO5A 1YTKA 5DY2A 3W71A 3C2FA 2Y85A 2YSWA 1UUOA 3F03K 3QW4B 5MHBA 3CEPA 3W7EA 3TR2A 2X16A 3M16A 1TV7A 1GVSA 1QPQA 3AO0A 1KTCA 1W5MA 4LS1A 5EBUA 1SFJA 1KM5A 2QJGA 4LTSA 5K4ZA 4K37A 4JY9A 4MJZA 2F7FA 2HSAA 1JCJA 3W1QA 3RU6A 1JUEA 3HPZA 3QF0A 4RK8A 4YWIA 2P1FA 2Q8ZA 4GUFA 1XCFA 2Y63A 3SR7A 1R30A 3LI1A 4ZQPA 1S3HA 3N19B 3A23A 3DHDA 1I8JA 4BWLA 1MSSA 2GPTA 3N9SA 5FEXA 1VYPX 3CM4A 3QSRA 1W3IA 2YX0A 3LTSA 7TIMA 2VEKA 3BLEA 4IX2A 5E1QA 1TTPA 1XBYA 1FUYA 4M6PA 3L5MA 4NJKA 1K7FA 3DKJA 4MZYA 3USBA 4O11A 4WXZA 5F2MA 1QOQA 3W2JA 1KFBA 2A21A 3LXBA 3TJXA 2VOMA 2Z2UA 2PRMA 3TMLA 1VCGA 3EX1A 1FWTA 2X1UA 1JCLA 5DBUA 2PCQA 2QAFA 3N2XA 1IGSA 4JXCA 4YLWA 5HR7A 3G0SA 4NX5A 4N9CA 2BLEA 3O6CA 4O1BA 4JTLA 1OFPA 4NJHA 4JTEA 2WQPA 3B03A 4LWWA 2H8ZA 3GDTA 1JQVA 1VPXA 3W1LA 3LRLA 3UXAA 3GLCA 1OFBA 4E38A 1GVFA 1LBLA 1G6CA 3NOEA 1I45A 3IEBA 4OT7A 4DELA 4WQ6A 1A5BA 4JX4A 3G8RA 3HOJA 4NJJA 2H90A 3WJXA 5BW6A 1QR7A 1W5NA 2C16A 1SPQA 3KRSA 2X1RA 3UD6A 3QH2A 2ZZ1A 5KTLA 5T26A 4KFOA 4DBDA 1AW1A 1SO3A 1W0MA 1M7OA 5U7SA 2DZVA 1WX0A 2O7QA 3ZWSA 2CLEA 3MJYA 3U8GA 1FCVA 4S2CA 4KWWA 1YDVA 4CCEA 3A21A 4DO6A 2CLIA 1L6SA 3W7JA 2EAWA 4WXYA 4UTWA 3LHUA 4IUOA 1AW5A 1VRDA 5CZJA 3G1DA 3O63A 3EXTA 4BI7A 4Y8FA 3T78A 5KZEA 4UTMA 4AXKA 3ABRA 1EP1A 2AGKA 3H54A 3EWZA 1GTEA 2RHGA 2QDHA 3QC3A 2GUUA 2BX7A 4C1LA 3LCWA 1OFAA 1W8SA 1IXQA 5BNKA 1ZENA 2CLLA 3DFOA 1KFKA 5EYWA 3DH7A 3EX4A 1X7FA 1LRTA 1XC4A 5CZSA 1VLWA 4N4QA 3DBPA 1IXPA 3PBYA 1LORA 1TPH1 1OFQA 3LV6A 3P8JA 2EHHA 3QMRA 1LRNA 1SO6A 3QYQA 4UTIA 3GK0A 2WV8A 1NEYA 1H63A 3QEZA 5FF3A 2Q3RA 5L9FA 1W5PA 1QNVA 2PRLA 3C6CA 2WNNA 3NG3A 4GJ1A 2FB2A 4UUIA 4O28A 3MHGA 3L5AA 3NZRA 1AMKA 1XDMA 2ZBTA 4YCPA 1LTDA 4IPJA 1MO0A 4ZQMA 3O06A 3W23A 5K4XA 1RQEA 1AW2A 3DU0A 3S0CA 1OFDA 4O4VA 4MLRA 4X3ZA 1Q45A 3S6DA 1ZJIA 1AK5A 1D3HA 3UYCA 4M7SA 3MI2A 4NU7A 2QCDB 4GBUA 3UWWA 2LLEA 4NXKA 4FEZA 2DZSA 4M7TA 3W74A 2WJZA 3IGSA 3FLUA 4ZL1A 5K9XA 1ZNNA 5H2ZA 1B4EA 1Z41A 4M5PA 1DQWA 1P0KA 3I7SA 1H7NA 5DY3A 5D2WA 3L2IA 4ONVA 4PC8A 3HG2A 3T55A 3STFA 2FPTA 1FY6A 1UB3A 3HGJA 4OE7A 3N14A 1JCYA 5HJLA 3GNNA 1FXQA 3P7YA 3G1HA 4A29A 3PBVA 4TIMA 3HF3A 1L2UA 2UV8G 3OBKA 2H8XA 4WUIA 3C52A 4HPXA 2C13A 2WSQA 2Y7FA 4JICA 1VH7A 5DXXA 3O1NA 1JRBA 4WOZA 1KFLA 1P4CA 3LTYA 1B57A 3W2MA 3B0PA 4IMGA 4GFSA 1PS9A 4YMZA 3LERA 2A7PA 1G4SA 3W85A 1BTMA 3IIOA 1M6JA 1GPWA 1GTHA 3GDRA 2V82A 1JJKA 3W3OA 3NVTA 3TFCA 2ZZ7A 1WXJA 3DENA 1G67A 3I6RA 1EIXA 3TMQA 4ORMA 4AHQA 3C3NA 3EWBX 5AYZA 2X30A 3TCEA 2PRHA 5TIMA 1Q6QA 3P82A 1S5TA 3VE9A 3FA5A 5F4SA 4TO8A 5G4EA 3LB0A 2QCFA 2ZFAA 1PCWA 3L67A 1SZNA 4DQWA 3GAYA 2DZWA 1AG1O 4OV4A 4GXMA 3OA3A 1IXNA 5BMWA 4CCDA 5D02A 1FCBA 1YADA 3KAOA 3WJWA 4JYDA 3QQ1A 5K9DA 5DCEA 1JCNA 3KVMA 1HTIA 2GOUA 3W86A 1OJXA 4O52A 5H91A 2WSYA 4UTTA 1W54A 3M41A 3HG3A 1BEUA 1PIIA 4H4IA 4HT3A 3NM1A 1T99A 5CZTA 1GQNA 1H1ZA 1NF0A 1X8FA 4LVDA 4IMFA 3RF9A 4CCCA 3HGRA 4E0CA 1Q6OA 4PCFA 1W3NA 3OG3A 4O16A 2YPIA 5D2YA 1VQTA 2C18A 3QMTA 1DBTA 5D2TA 2VFHA 4LUJA 4FB7A 1OX4B 2JKPA 4L4MA 2QCGA 2G95A 1UJPA 1VJIA 3R89A 1SZFA 3MBDA 1C29A 2CLKA 2ZQ0A 1ICSA 1YTEA 5LZLA 2V2HA 2GQ8A 5CG7A 3RMJA 1F6PA 3W84A 3NQ7A 2CZDA 4MYXA 1YLVA 4P61A 4UFIA 4DBEA 2GVJA 4DO4A 3HGSA 3M7WA 5J5RA 4Q32A 2GJNA 3CWOX 5EA9A 2J88A 5HUPA 3PM6A 1M5WA 1K3UA 1RQBA 4PA8A 5G5IA 1H51A 2NUXA 2VFGA 4JTUA 2CZEA 3MBFA 3T44A 1A5CA 2E77A 4S1FA 3TE9A 5HNRA 1EEPA 2NUYA 1F73A 1MEHA 3I7RA 2Y89A 1SR9A 1K8YA 1PE1A 4FNSA 1LZOA 3EWXA 3HG5A 2QCLA 3QMSA 1ICQA 5IM51 1TSIA 3BG3A 5D2VA 1K7EA 3RNDA 1Q6LA 3TSBA 5LHEA 4LS2A 1BWKA 3LXCA 3G22A 5TQLA 1Q3NA 1O5XA 2FIQA 2QAPA 4IMDA 3SSJA 3DKLA 3QQ0A 3TC7A 1G4EA 5DLCA 5AC7A 1QO5A 3B04A 3QJAA 4JTJA 1GJPA 2NUWA 5LGXA 2R91A 2YGYA 2VELA 1C8VA 2HS8A 3LDVA 3TA6A 2W0UA 1OYBA 2E5CA 1QCWA 3C61A 3B06A 3NL2A 2P10A 3LTPA 4K38A 1TPB1 2EF9A 3M5XA 2HTMA 1GWJA 3CEUA 3LBCA 1W5QA 4BI5A 4O10A 4ADSA 3FJ6A 1A5SA 1YTDA 4UFJA 1RVGA 5G4WA 2FQIA 3LGEA 2QF7A 5AN7A 4GNJA 2QCMA 3DFPA 2BSLA 5CPNA 4NNAA 2CLMA 2X1TA 3DFQA 3GR8A 3L9CA 4L4LA 1TMHA 3UZJA 2VEPA 4I7VA 2X1SA 2QDGA 3EEGA 3P8IA 3E12A 4WY0F 1VCFA 3EX3A 5FF4A 4JS3A 3Q37A 3EX2A 5I3JA 3W87A 2NX9A 3MI6A 3G0UA 4PL2A 4CQAA 3EWYA 3FOKA 1GZGA 1OFOA 2A6LA 4MLJA 2CLFA 3M9YA 4O0KA 1SZEA 4LNYA 3R8RA 3MMTA 4Z1BA 3VE7A 3CT7A 3SGZA 4FNTA 2HMCA 3G3MA 1K8ZA 1TPC1 3IIVA 1DVJA 1TQJA 1O4UA 2Y88A 1P0NA 3SFKA 3S5ZA 1TO3A 4PFMA 3AJXA 1NF7A 2NV1A 3HPSA 3LLFA 4QNWA 3FKRA 4LVGA 4UMCA 3S1UA 3R12A 1CW2A 3ELFA 3G1YA 4D2JA 2Z6JA 4GE8A 3DHFA 3W1AA 1XBVA 2ZRXA 5KZDA 1PHWA 3H53A 5C2XA 2QR6A 1FBAA 3WJYA 2DJXA 4JNMA 4RXFA 4N9BA 3BV4A 1S5WA 5CPOA 1G4TA 4PTNA 1JR1A 4LC8A 4YXGA 1WV2A 3N2MA 1ZFJA 5DN1A 1KA9F 4WY0B 3G8EA 2XN2A 5IBXA 3PY2A 2J9ZA 4UNKA 2I14A 3M5VA 3W7PA 1CI1A 5ABTA 5HWMA 4X2RA 3WFAA 4AHPA 1A53A 3MI3A 4NJGA 4ADTA 1MEWA 1K8XA 3L21A 1LYXA 1YXYA 3W1PA 2YW3A 2CZFA 4EIVA 1I2PA 3P80A 5AHEA 1TIMA 3BO9A 4AWUA 5BRBA 3TW7A 1MXSA 3W7LA 2A7NA 3CLMA 3M0ZA 5AFDA 3S9YA 3FIGA 4OU1A 1VYSX 3UPBA 3FYOA 2B7NA 2NXGA 1DV7A 1GG1A 5KSWA 3UWZA 2V2DA 4G1KA 3MP4A 2NXIA 3KOFA 3WK1A 2C14A 4DF1A 2E6YA 1KTBA 4E2DA 2EKCA 4ICNA 1G4PA 1RD5A 3TFXA 3ANYA 4JGDA 3ZR4A 3PSVA 4JD4A 3EWUA 2FLIA 4JTKA 4K36A 3P84A 2PURA 3E49A 2Y70A 3MUXA 1ML1A 4O1CA 3S1WA 3INPA 1YDNA 3D0CA 3A9IA 1LLWA 2A6NA 4IMCA 1IXOA 3KVLA 4U4MA 3Q2DA 5E0KA 4UXDA 1QDSA 5TBOA 3VNDA 1T96A 2ZRUA 3IIXA 1KLZA 2ISSA 1HL2A 4ADUA 1TPDA 1WBJA 2YYUA 3NQ2A 1F2JA 4O13A 2QCCA 2YW4A 3W72A 4FX7A 1D9EA 5AHFA 1OF8A 5KINA 3OHIA 5LNRA 4NZJA 5EKYA 4A22A 3DFSA 4DF2A 1F7BA 3EKLA 3L0NA 3LI0A 3WK3A 5HUOA 2QUTA 3F1QA 4JYFA 1TPWA 1SW3A 1ZAJA 3R2GA 1GYNA 3C2RA 3F4NA 2TMDA 3E9AA 1SZGA 4S2BA 3MHFA 5LNUA 4HSOA 4NNBA 2O7SA 3E02A 2ATSA 3DFNA 1XI3A 3OVQA 3W7DA 4GC4A 4MVAA 4XZ9A 4AEOA 2Q3OA 1OX6A 3GDMA 3W76A 3BG5A 4X22A 3MYOA 1FWRA 1H7OA 4QIUA 5EL1A 3GXTA 4FHAA 4UMBA 2D73A 3P5YA 3L66A 4O18A 3M1ZA 6TIMA 3RLUA 2Y62A 1LM1A 1JUKA 3GKAA 5G2IA 1SFLA 5G2WA 1THFD 3UY7A 4UFHA 4R33A 2WPBA 3RK8A 4Y96A 2QCNA 3BVJA 1W5OA 5FF0A 3CU2A 3S1VA 3M5ZA 4WJEA 1TRDA 3S5NA 3GR7A 2QCDA 3P62A 4O17A 4FX8A 3LLDA 4JTHA 4ORIA 1I2NA 4DO5A 2V30A 2B7QA 1S5VA 2ZZ6A 2ABAA 3M5YA 4R7JA 4HNUA 4UTKA 2J9YA 2E6AA 3BW4A 3OVPA 4Y9AA 4BWLC 5KMYA 2PC4A 2QCHA 2ZTJA 1W3TA 1A5AA 2A5HA 3B05A 2GVGA 1Y0EA 1QOPA 3LBMA 2VENA 5FI8A 5F2GA 1L6YA 3UWQA 4LT9A 1FWNA 4UTJA 1TRIA 3RFAA 1EX5A 3TAKA 2ZRWA 1V7YA 1EB3A 1H50A 1FXPA 4LC6A 3W73A 1KLYA 3NPWA 4GWEA 1VCVA 2H6RA 3KRUA 1FDJA 3MHUA 3TXZA 3GKFA 3PB2A 1FWWA 3P74A 3EXRA 4X9SA 4K6AA 4RZ5A 2J9XA 4ZMGA 1H1YA 1SUXA 1EUNA 1JCXA
chains in the Genus database with same CATH superfamily
3GD6A 1VBUA 3CHEA 3DC0A 1KW1A 4MNJA 3OYZA 4MZ8A 2B31A 2TRSA 3CPGA 1H0GA 4E8DA 5FJIA 1OVDA 3PK7A 3UR7A 1K8CA 3AS1A 4ALDA 4B4HA 4KRZA 4JOMA 3STEA 2FZ8A 2TSYA 2V5DA 4RNFA 4HA1A 4MFDA 3U5YA 1I4NA 4ROQA 4MKNA 4JTQA 3C3UA 5HR6A 2X8RA 3AHZA 3QHNA 3UXDA 3L68A 3HPFA 3JRKA 4F48A 3PAJA 4PEEA 3ABOA 3TSMA 4GO8A 2GYIA 3UY8A 1ZBKA 2FDSA 1TV3A 1EH9A 3UCQA 1RJRA 4ZZ9A 2JKEA 1IWBA 4N4PA 4JYEA 2NV9A 3VMPA 1RP8A 2WOQA 2H3BA 3BOLA 3V0SA 3WH8A 1LCOA 3B8WA 3V7PA 4XTIA 1VIWA 2PF8A 5BRQA 3PBMA 1LRQA 4W86A 4GVFA 1H1NA 3AS2A 1BSLA 2V5CA 4JTSA 1QFEA 1Q85A 2VFFA 5SWUA 2OCZA 4O19A 3LHVA 2HROA 2ZOXA 5AY7A 1EWDA 3UZXA 3WBXA 3HV9A 4GX8A 3G0XA 1R87A 1TFVA 2HXTA 4EOUA 4D8ZA 3VAVA 1YPIA 2PDKA 4L4OA 1OFEA 2Z27A 1CT5A 4KIRA 3S46A 5IFPA 2RDTA 2ZUMA 3I4KA 2PDLA 4DXXA 4J3WA 3NGFA 1UP0A 1NAL1 1QPRA 1XQLA 2OZ0A 3UWYA 3HA1A 2DZAA 3CIWA 1OADA 4MSSA 3VKJA 1N8FA 2QZRA 3THCA 5AHMA 5T9CE 2QULA 3QXBA 3G18A 3AIUA 3F4DA 1H4PA 3GG8A 1SW7A 2Y8UA 4ZR8A 4LB4A 2V5JA 3IGUA 2IQTA 1AMYA 3GNDA 4JHMA 3J7HA 5BOFA 4IGHA 1RH9A 1DORA 4JIQA 3K4WA 2FVKA 3R0DA 3PSWA 4IOTA 3URNA 3DERA 4WGXA 5D8WA 4F9DA 2PDQA 3CHCA 4UTUA 1VGAA 4KCUA 3WF0A 2WKGA 3L4YA 3UCCA 4N6EA 2V5BA 2ADAA 1NY1A 2F84A 1M41A 1GQJA 3AS0A 1XRFA 3FS2A 1TV4A 5FF7A 3DXIA 1YEYA 4MG4A 1QI2A 1Q7QA 2A1YA 2V6AA 3CMJA 1JDFA 3L23A 3POHA 4UWMA 1W37A 5JIWA 3GXPA 3G1SA 1M53A 2QJHA 1I0BA 3MW7A 3C2YA 1RCQA 4JQ3A 1XS2A 2E0PA 3NQGA 3MC5A 3PTMA 5IHSA 4LAKA 4PUUA 3SRDA 2F61A 3BLLA 3W7HA 1R2TA 1SFTA 2VFDA 1EHNA 2Z7KA 1Z7AA 5DANA 3CT2A 5FJTA 1O12A 2ATMA 2WJEA 1WA3A 4OV9A 2C1GA 1W3HA 1J10A 2I9UA 4FX6M 3UZ5A 4C6JA 2WBGA 3LPGA 2DUAA 1P0DA 3TXVA 1ZY9A 5E93A 4NJIA 2ZRYA 4QHRA 4AD4A 4RE2A 2YA0A 3VI2A 3NZGA 1E6ZA 3SDOA 3PTDA 3Q58A 1VFHA 5I3KA 3MUZ1 3U57A 3JUGA 4Z1YA 3S9IA 1EQCA 3HFTA 4FOUA 5AB3A 1IYXA 3WQ4A 1ZALA 2G3FA 2YCIX 3U2CA 4O15A 3F5KA 2QGYA 3W70A 2OSYA 2ZUVA 3GM8A 3ARXA 2ZZ5A 4R53A 1K77A 3WLRA 4UIOA 2ZA1A 3ZS4A 4UQEA 4DLMA 1KFJA 2OGYA 5B80A 1CXKA 3T9PA 2Z1XA 4R34A 1Q6FA 4K8GA 4E2OA 1VS1A 3KXQA 3A5FA 5KETA 2NVDA 3VD9A 5E9XA 1QWGA 3K30A 3AQUA 3DESA 2XGZA 4MIMA 3WG6A 1GPFA 5CZKA 3EA3A 3QPZA 3HJZA 1TJ2A 4IWWA 1J18A 1GJUA 4L9XA 5TF0A 5HQMA 4DZIA 3UZWA 2IXVA 3GC5A 1DWJM 1EDTA 4IH3A 3PPFA 1GVRA 3GHSA 4LAMA 2W63A 2D23A 4WEVX 2WANA 5HQEA 3CV6A 4QROA 2EEXA 1KB3A 2CBVA 2XJ7A 2VDHA 3GNPA 1ODZA 4GJJA 4IXXA 1U5JA 4MB3A 3GDBA 1L2QA 4OBTA 3UJSA 3WQFA 1QVBA 1KBJA 5CJNA 1L9WA 2WMGA 3HN3A 1YXDA 1F8MA 3SW6A 2XIJA 3UEQA 1E9YB 4GQ0A 1WYIA 1PVNA 4GY7A 1B9ZA 1DE6A 1CGVA 3ERPA 2PMQA 3AMGA 4BHYA 1X98A 4XBJA 3T7VA 1S38A 1HL8A 2E40A 3CUGA 1PZ3A 4NHVA 4ACZA 5AYXA 1FWEC 4Q4SA 1EDGA 3N3TA 2X09A 3VABA 1XXXA 3TYAA 1R2SA 1SSGA 4P7LA 4J4KA 4HNTA 1TUXA 5XIMA 5D05A 1GJWA 4LXFA 3GZ3A 2EPNA 3N15A 3CIXA 3FJ4A 4WKFA 2OSWA 5A6LA 2ZCGA 4MM1A 1XSKA 1QNPA 4F8XA 2E67A 1SO4A 2CU0A 2OWCA 4PMNA 3UXIA 4S3FA 2E6FA 3MCOA 5H8UA 1XIFA 3IVSA 1ZAHA 2FH8A 3KDOA 2UWFA 4IG2B 1LOSA 4AY1A 1Z8AA 4AD0A 1C91A 3FEQA 4NX0A 5FF2A 3VO0A 3UWEA 3CAQA 2WJFA 5HANA 1X7IA 3EB4A 3WLMA 3M0IA 4W5UA 4HA0A 4LW7A 3ZQ9A 2Q6ZA 4JKKA 1Q5MA 2ZA3A 3WMCA 3IJLA 4PBFA 1TTQA 3W0KA 1P1XA 3CC1A 4NKCA 1J79A 1IF2A 4JTIA 3IVUA 5CEWA 2W6RA 3O8AA 5HNNA 1XGZA 1GHSA 2VR5A 4CQDA 3CZGA 1TPUA 2B7PA 1M7PA 3SFWA 4A3HA 4PODA 2GK1A 3RIKA 4M19A 3HIJA 2GDUA 4G7EA 3OIXA 3PANA 2FPVA 3EB2A 4QITA 3UQNA 3P5ZA 4DIAA 2O9OA 1HQTA 4GH3A 1GOWA 3BLDA 3RX3A 1PXGA 3BCFA 3WJZA 1BKSA 3H7RA 1XCWA 2JFEX 3IRSA 2A7RA 1UUMA 4AZHA 4XVEA 4Z2KA 4NY2A 3FW6A 3GFZA 2CBJA 1FHLA 4UZSA 2GQ9A 3BCJA 4ZBCA 2FTWA 2KAUC 3U9IA 1GOKA 2G5WA 1HVXA 3NSNA 2CNCA 3NR0A 2BXYA 5H1WA 4Y6GA 4PEKA 3TKFA 5DCDA 1MZHA 4Z17A 1QMLA 4XIMA 4MZ1A 4FIRA 4D6EA 1ONXA 2C1IA 3M4HA 4LV9A 4CD5A 1FH9A 3H70A 3SUUA 3C2VA 2OTDA 1YPFA 3NQMA 4PMXA 4ZENA 3B4UA 4RLIA 3RM9A 2INEA 3HMJG 4YVPA 2YR1A 1H49A 1PAMA 1ZJHA 3DN5A 3TWBA 4R88A 4RW3A 4K7VA 3PUDA 2VMFA 2A0NA 4B5TA 2GJPA 1O5RA 1RLCL 3TSDA 5A2AA 3BTNA 3V0UA 1E5JA 4GH1A 2X40A 4WDTA 3TN3A 2J13A 1QK2A 3DI1A 3S3GA 3LPFA 1CGXA 1EJWC 5I3DA 3UPWA 3CQKA 4AZCB 4O14A 3N04A 4LAUA 2GGIA 4MDPA 3NL5A 1JIBA 1F76A 1PKYA 4RR4A 2R14A 4O1DA 1CWYA 4M6VA 1BGGA 3UWVA 1E15A 2I57A 5MKGB 4DPPA 4RKAA 4UMAA 3IV8A 4UQAA 1AZ1A 1C8XA 4W84A 4JN6A 2YIHA 2UY5A 1R3RA 3R8GA 4FIQA 2YDAA 3DHPA 1DWHM 4I3GA 3WH7A 1G1YA 3G1AA 4NSBA 1E51A 3CZ8A 5J5DA 1UUQA 2OEMA 4QJ3B 2V81A 2FYMA 4FR6A 2VRJA 5AECA 4UCFA 4J3UA 1UBSA 4HKPA 4M3PA 1ZSXA 1KV8A 1D3GA 4GUGA 1JPHA 3W88A 3NQVA 3HURA 1RCXB 3N2BA 3NQFA 4U2ZA 2J7BA 3HB9A 4XKYB 2ICSA 3UETA 1LT7A 5BZAA 3NGJA 2FGZA 2CHOA 2VCAA 2FB3A 4P8UA 3KM8A 4M80A 5BROA 4U31A 3AWNA 4KCTA 1I6NA 1TQXA 4PUDA 5BOEA 1UWQA 4AD2A 1C3FA 5CJ5A 3KUMA 2Y4SA 6XIAA 4FLOA 2E4TA 5C54A 2BODX 4B90A 1ADOA 2VXNA 1K7XA 4A2RA 1FX6A 2XVPA 5C8BB 2YB1A 4GX9A 1QNQA 3E2QA 1F4HA 3IIPA 1JPIA 1O94A 1QHZA 3I65A 2EG8A 4CQ8A 1RCOB 1RBAA 2A79A 5D04C 4AWSA 4LFYA 3TDFA 4B91A 2V5LA 5I3GA 4GQGA 4C6IA 3QOKA 2C3ZA 4PMZA 3KL5A 3SADA 3CYJA 4U10A 4UNLA 2H3DA 5LIYX 4Y90A 2ON3A 2Z1SA 2OJPA 1IZJA 1OINA 2VGIA 3MT1A 4AIBA 3N2TA 5CG0A 1WOAA 2C1HA 4EXBA 5FEPA 1QASA 1J01A 2QJJA 5CC5A 4Z0JA 1TCDA 2C0AA 5D32A 4NASA 2J8TA 1QJWA 4FF7A 3WUEA 4C1KA 3QRHA 4M0XA 2BY2A 2E5BA 2E28A 3SCNA 1GKPA 5E6YA 4O53A 4HTYA 3HBLA 4XIAA 4HSHA 4B5UA 1OGGA 3NNTA 3EWCA 4QG6A 4LYRA 3PZVA 2JIEA 3UERA 2BXZA 3V16A 2V0TA 1MUWA 3CL8A 1AJ2A 2NVCA 2QEZA 5G1YA 4HSNA 3HO8A 4CU8A 2J7EA 1OG0A 4AW7A 1GKRA 2YJQA 1KQYA 3I7QA 4H9TA 1K6WA 1CCWB 3OVGA 3PR2A 2VQUA 4A3QA 2XFFA 5ABHA 3V0TA 4W7VA 4AF0A 3NM3A 2RDWA 1FDYA 5I02A 3AYTA 1EUAA 3MKKA 2J6VA 4UQCA 2GSJA 2YXXA 2CCRA 4LB3A 4CLMA 3SGUA 2YKKA 1Z48A 4ZOAA 3I3BA 3EOUA 2ZUUA 1XDLA 1XD1A 3GB6A 1HG3A 2VZSA 5I6SA 5CKSA 2CESA 5JBDA 6A3HA 1H61A 5LIUX 1YTKA 3IJ8A 5EGRA 4JTDA 1VEPA 3QW4B 1Q6GA 1AD1A 4GI4A 1NDYA 1BQGA 1QPQA 3AO0A 3N13A 1B5TA 1KTCA 4JPGA 1KM5A 2QJGA 4LTSA 3T4WA 5K4ZA 5G1MA 3FSUA 3VNMA 3MANA 4MJZA 3K1GA 1JCJA 3W1QA 1KCZA 1JUEA 3QF0A 4RK8A 2ZVRA 3DFHA 3KP0A 1IE7C 4P7QA 1XCFA 2QT3A 3MMWA 1S2UA 4Q4QA 3RJYA 1S3HA 3N19B 3DHDA 4BWLA 1OBAA 3I6TA 5BCAA 3WQVA 1GW1A 1XGEA 9XIAA 3SY1A 2MNRA 4XX6A 3LTSA 4HHHA 2VEKA 1EZWA 3ZIZA 4F2UA 2BOEX 4AXNA 1XBYA 5GNZA 3R8HA 4M6PA 3VK5A 3VNYA 1QOQA 2A21A 3ARTA 1JCLA 5DBUA 1F61A 4H6QA 4W8BA 4B5XA 2XM2A 4KEUA 3PZGA 4H8HA 4XSMA 3O6CA 4IG2A 3T8LA 4JTLA 4NJHA 3LG3A 1GVEA 2WQPA 3LNMA 3GDTA 3N25A 4Q6JA 1QRQA 3QV7A 3UXAA 1OFBA 4E38A 4B16A 1NM9A 1GVFA 1LQ2A 2FZBA 3LZ5A 4Q4OA 2TAAA 4RE4A 4YHGA 3IEBA 3G8RA 3HOJA 3RR4A 4XZIA 3WJXA 1W5NA 2GJXA 2Q8XA 5BRPA 2Z25A 1BSIA 3OBAA 3QH2A 3UD6A 2ZZ1A 1V6VA 3NYDA 3RLHA 3QYSA 1XKJA 2X7VA 5T26A 4DBDA 4F0SA 4LAZA 1N2VA 2Q01A 4PMDA 1CXFA 2CLEA 1KFWA 1WZKA 2WHLA 1FCVA 1YNQA 3PJUA 1RP9A 4KWWA 4MJ2A 4HU4A 1RK6A 2BHUA 2CKSA 1L6SA 1EXBA 4WXYA 4RE0A 1T41A 1MXDA 4IUOA 3G1DA 2E3ZA 2RGLA 4L1XA 3T78A 4QAWA 3ABRA 1EP1A 2AGKA 1QHOA 3SN4A 1WZMA 3QC3A 1WKEA 4C1LA 3GFXA 5BNKA 1JDAA 1XFCA 3HQPA 4O1FA 4TVCA 1A4MA 1LRTA 1VLWA 3PBYA 4GIYA 3DBPA 2PLKA 3LV6A 1PBGA 2EHHA 3ITYA 3QMRA 1QW7A 4M81A 4IIEA 1SO6A 2D2HA 1YX1A 1Z32X 3S2LA 2ALRA 3LQGA 5DEZA 3C6CA 4V15A 4PCTA 5A8PA 1AUSL 4O28A 3MHGA 3L5AA 1AMKA 1MI3A 1XIIA 2JF7A 1E6NA 1FVPA 4IPJA 4MAVA 1JXKA 4ZQMA 4Z2GA 1RQEA 2WLZA 1PYMA 2YA1A 4R3UA 1V8EA 1E6PA 1ZJIA 1AK5A 4ZO7A 1MZRA 3MI2A 3VFCA 1BWVA 3DCPA 3BSHA 1GYMA 4FEZA 3UVAA 3QY6A 3RCYA 1G0CA 5K9XA 4M5PA 4MUPA 3TYEA 4XK2A 1P0KA 3LMYA 1P6BA 3LN3A 1PIGA 4AZCA 2VI0A 5DY3A 3BJTA 3STFA 4P5UA 1HGYA 4R9XA 1ZS2A 1U22A 3C5QA 2F38A 1FXQA 4Q8WA 2FFIA 4A29A 2J62A 2PF0A 2Z29A 3OBKA 2WZMA 5MKGA 1QI0A 4QG8A 3C52A 1QU4A 2WSQA 1EZ2A 1UWIA 2YXOA 1DJIA 2WHJA 1JRBA 3BLKA 4IUGA 4RNJA 1V3LA 1KFLA 4AG0A 3W2MA 5T8GA 1SMDA 1AODA 4IMGA 4D1JA 3DGBA 4GFSA 1PS9A 1KQZA 2GFTA 3AYSA 1J96A 1JJKA 3TNBA 3W3OA 3DHUA 3NVTA 5A2BA 1FWDC 3TFCA 1F4AA 1JAEA 1TIWA 4AQLA 3DENA 2WVVB 1EIXA 5HQLA 3CL7A 1UD3A 4UZUA 1UA7A 3EWBX 2X30A 1Z6KA 3VD3A 2VD9A 1Q6QA 2FZMA 3WELA 5A1AA 2J8GA 5F4SA 1PCWA 4DQWA 1UBPC 2CIPA 1IEXA 1TJ0A 4GXMA 5BMWA 1YADA 3OHMB 4GI9A 1KGUA 5CC7A 5MF5A 2QJNA 2CHRA 3B9DA 3HG3A 1BEUA 1PIIA 4Q8OA 1KRAC 1JFHA 1NF0A 3PBGA 3Q4DA 3HGRA 3IK4A 2P3ZA 5EMLA 3ZM8A 4YU1A 1WCGA 2YPIA 5D2YA 2C18A 2PU1A 5D2TA 5ABEA 2V3FA 3FNDA 2VRQA 1WDQA 1UJPA 2G95A 3EKGA 1E72M 1CLKA 3R0KA 2Z26A 4GJIA 4XAYA 4CNUA 4JL2A 1F6PA 3W84A 1KGWA 4W93A 3AZTA 3M7WA 3G6LA 1UR1A 3WL0A 1BXNA 1M5WA 1QXLA 2VFGA 2VDGA 4CVUA 1H2JA 1A5CA 4S1FA 1B3XA 3QGKC 3HQOA 3ZR6A 4Y8EA 2FDMA 1W1IE 1F73A 5BWFA 4F0MA 1EGVA 4QCFA 4J3VA 4ZE5A 3EWXA 7REQB 1C8YA 1P0EA 1Y5XA 2V3DA 3CS2A 1DIOA 4NRRA 3G22A 1KWGA 3KTXA 4GCXA 4DB7A 1NP2A 4CN1A 2YL5A 5DLCA 1RXOB 5AC7A 3QJAA 1LL4A 4MWAA 1R3QA 2R91A 2XH0A 4F2TA 1TWSA 2EBNA 4L61A 2W67A 4B92A 3MO4A 4WKHA 1KRCC 2P10A 2VCBA 1MDLA 3LTPA 4K38A 4GY1A 2IKGA 4Q8NA 1E0XA 1W5QA 3AU6A 4L4PA 3FJ6A 4U3CA 4UFJA 3UW6A 2PFHA 4S3JA 4DJDC 4JTRA 2BSLA 3RCMA 4NNAA 4XVDA 4W7UA 3T8QA 5JMUA 3DFQA 1TMHA 4X63A 2VEPA 3VDGA 4RNIA 4BEQA 4WY0F 3O3RA 3Q37A 3QY8A 1W9VA 1CXEA 1E3XA 4PL2A 3EA2A 3FOKA 1PIFA 3EWDA 1HIZA 2CLFA 1UROA 4CEUC 4LNYA 1NH6A 2F2KA 4Z1BA 4MB5A 3CT7A 3SGZA 3PP7A 1DIEA 1E70M 1O4UA 2EPKX 3SFKA 2OX4A 3QVQA 1TE6A 2XH7A 3HPSA 4DLFA 4UMCA 4R7WA 4D2JA 2Z6JA 4REQA 2Z1KA 2BOFX 3DHFA 4HP5A 3W1AA 4PCPA 1W9BM 1B31A 3H53A 5C2XA 4I90A 1FBAA 3WJYA 1XDJA 2DJXA 1A5NC 1ONEA 4GIEA 3FA3A 2QS8A 4H7CA 4ZA0A 5D4YA 1CXHA 4HN8A 1WV2A 3N2MA 3WNKA 1KA9F 5DN1A 1F9CA 3LYEA 2AAAA 4UNKA 3LGDA 2TODA 2F9RA 4E4FA 4AHPA 2J77A 4QQUA 1BF2A 2CITA 1K8XA 3L21A 2V68A 2CZFA 4AWUA 4GIAA 2DT2A 3AALA 4QLJA 3FK4A 2INZA 3TW7A 1MXSA 3M0ZA 4AIOA 3S9YA 4OU1A 2B7NA 2W4XA 1E0WA 1GG1A 4X0NA 4EANA 4G1KA 2E25A 1OC5A 2NXIA 2YB4A 2E6YA 4BQ5A 1WB0A 3T07A 1DJXA 2QXWA 4QRNA 2J7DA 4F0LA 3ZR4A 3SCQA 3KCJA 4IJCA 1PWLA 3ONCA 3AHVA 1OQFA 1OT1A 4CD8A 2NQZA 4O1CA 3EPOA 5XINA 3INPA 1W8GA 2IPJA 3D0CA 3VIGA 3COTA 1VFFA 1CB7B 3TN6A 5TBOA 1KLZA 2R6OA 2ISSA 3TP4A 3B9OA 1EA9C 1V02E 5H6HA 4HOXA 1F2JA 3VOIA 2PTZA 4FX7A 3VNKA 1NQKA 1VFTA 1D7KA 4AC1X 2RDXA 2XIIA 2QMKA 4MAZA 5D9NA 1EOKA 1ZAJA 3SGGA 2VEGA 3ME3A 3MHFA 3T0BA 4JQ4A 5LNUA 1B3VA 4Y9NA 1HP4A 4E2VA 3DFNA 3OVQA 3W7DA 2P50A 2I5GA 4MVAA 1V6TA 3GSMA 2VT0A 4AEOA 3B9NA 3BG5A 4GA8A 4X22A 1FWRA 2NQLA 4ZOEA 5EL1A 1UMLA 4FHAA 4IGMA 4MB4A 2Y8KA 1E43A 3L66A 3PZTA 1RHCA 2PGWA 3HZ3A 3RLUA 1LM1A 3IJDA 3B9AA 5G2IA 3GY1A 3N11A 4UFHA 4Y96A 2QCNA 3VZZA 3BMXA 3TYZA 1TRDA 3WLQA 4AFYA 1OCJA 1W1VA 1H11A 1XYAA 1IT0A 4GNVA 4ORIA 4NP7A 4GCAA 5AVHA 3XISA 3ZT6A 1S5VA 3UGRA 1TWDA 1JNEA 1GZ1A 4I6VA 4JTAA 3AMDA 4BQ2A 4IQDA 2UY3A 4Y9AA 3N1AA 2PC4A 2PZ0A 4YTUA 2GVGA 2WAGA 1VPYA 3RUBL 2PDJA 4US5A 3UWQA 3AUJA 1I60A 1TRIA 1EX5A 1IR2A 1FKWA 1V7YA 3ARUA 1UD4A 2I5IA 1KLYA 2VVNA 1VCVA 1KXQA 3TXZA 1FWWA 3EXRA 5I77A 2W5FA 3S6TA 3SBFA 1R3SA 1HO4A 1EGMA 2WVVA 3QY7A 3WJSA 1W56A 4JNYA 3QR0A 1QWKA 2ISWA 5A8GA 3LCHA 3RLVA 4A21A 1QNOA 2BVYA 1H7WA 2H9AA 2CW6A 2R8WA 3HJEA 3GNXA 1W3LA 2YBUA 3W2NA 2EGZA 2TYSA 4KFNA 3WLHA 2QUUA 4B2DA 1I75A 1UZDA 3BGJA 2XTKA 3DYOA 4KIEA 2O92A 2WLYA 5AC5A 4JFWA 1TWWA 3BAJA 5FIPA 1ONWA 2X2GA 1HW6A 3NZPA 3WQEA 2J47A 1W1TA 3NEVA 5JH2A 3RAOA 2RDUA 3ITLA 4C6CA 1FWGC 1ZL1A 3IARA 3GW0A 4QJ4B 4BF7A 1VD6A 2A3CA 5I5RA 2X1IA 1BD0A 5C55A 3A22A 1DWIM 3VZXA 3F2DA 2ZZ4A 2GJLA 2C19A 2ABBA 4PN2A 1XLJA 2D3LA 2GDQA 1M7JA 4N42A 3N6HA 1U83A 3TUUA 3L4XA 3CQIA 3FFSA 2DZUA 2QNEA 1B3OA 1JRCA 3STCA 2E8YA 3UCDA 1JGMA 3S4TA 4WIWA 2X0HA 2PSNA 3NDOA 4L1GA 2FH6A 4MJMA 3WBEA 4XO7A 4LH8A 3T1GA 3M44A 1Q66A 3NA8A 4FXJA 1HKVA 4QP0A 5E09A 2IKJA 3XIMA 4S3BA 3RX4A 3C8FA 3LQLA 2EPMX 3E5PA 1JYVA 3SCUA 3L0KA 3CGTA 4FNRA 3VX1A 1A5LC 2VTFA 3SURA 2AAMA 1PJ9A 1W2VA 3ZWTA 4HNVA 4GISA 2YBTA 2ACSA 3VINA 3FXYA 4Q8MA 3U3HA 1OABA 4FLSA 3ITTA 3W24A 4AHOA 3W7CA 4OHQA 1HO1A 1Q13A 4LANA 4WX2A 4AX6A 4DWSB 4KCVA 4MNKA 3GNOA 4NVTA 3C56A 5CSSA 1DIDA 3OQEA 5A69A 3E96A 3PC0A 2YCLB 1E9ZB 3CWNA 2FHBA 1DQUA 1LOQA 3S47A 1YHTA 3VD4A 4LAOA 1FWSA 1AVAA 3O0FA 5I2UA 3SZ8A 3V36A 3K8LA 3S1GA 2YA2A 4F9JA 3MV01 4ZOBA 5IFTA 3TN5A 3QTPA 2E68A 4QNEA 2DDXA 1AFSA 1ESWA 2PWEA 3H8AA 4YCOA 2XVLA 1NOWA 1DOSA 1N55A 2DSZA 4F40A 3H55A 5D9MA 1WBHA 4ZVJA 4Q4KA 2WNQA 3FYPA 4BY3A 1BLIA 3FKKA 2MUCA 4U28A 3STGA 2DJLA 2GGEA 3L0GA 5U4NA 1K03A 2AKMA 2W9MA 1TPFA 5HA7A 1QT1A 7ENLA 4KGJA 2J24A 4LS0A 4DBUA 5BXSA 1LL7A 4UTTC 4K39A 1XHGA 2VGGA 2VO5A 3KBJA 1SU5A 1OF6A 2CLPA 3EKZA 4EF8A 3CV2A 1RA0A 4H19A 5HMDA 2BTMA 4GYPA 5DMMA 4GRSA 1O5KA 1TJ1A 1EIBA 3B8TA 3H4XA 3TH6A 5AC6A 5EB8A 2BFGA 2IS7A 4QE1A 3SI9A 4O1AA 1B9BA 3UR2A 1XFBA 1NFBA 3VOJA 4FPSA 3B0VC 1XBZA 6PTDA 4DZAA 4V1XA 1H5VA 3W1MA 4B3LA 3URBA 1S3TC 4TX9A 3EX6A 3R58A 3WQ8A 1UZ4A 4OGZA 4NZFA 4LEFA 1OYAA 1LLZA 2DZPA 3W83A 3W81A 4AVNA 2BXVA 2O0TA 1EJ7L 5ENLA 3IV3A 3PG8A 5E5CA 1TV5A 1HXJA 3GDKA 1IIHA 5CC6A 1K9FA 4CU7A 3PG9A 4CNPA 4C6KA 1OZQA 3JU2A 1M1BA 3NQCA 1R85A 3LPPA 1NFGA 1WDWA 2DUZA 3CHVA 4KPLA 4XAFA 5I3HA 4R85A 3G1XA 2HXUA 4W88A 3OODA 1TPVA 1CTNA 4Y9MA 3OBEA 4C6NA 4IPNB 3GXNA 5BWAA 4XTDA 2KZHA 4L80A 1L0PA 1TJRA 2HE5A 2W91A 1EPXA 5AHNA 3O07A 4OQVA 1HJSA 5HULA 3VX0A 1RBLA 2OR2A 4H6RA 2XIMA 1EF2A 3C2OA 1U1JA 3E0IA 4WGHA 1V3JA 1ZCOA 4FXRA 4FK9A 1SVDA 3T2PA 2EXOA 3SN1A 4C60A 1PZ2A 4F66A 1H3GA 3V75A 3G1RA 3N34A 3CUIA 1N8WA 4ICCX 1V93A 1JZ4A 3JR2A 1I2OA 3E2RA 1VZWA 5LIXX 1JD9A 4EK7A 3EBVA 3MWCA 4Q8PA 3UA3A 2HVNA 4KT2A 1A4LA 1Q6CA 2ZRZA 3WENA 1EQPA 2WCSA 3PWIA 3VFLA 4GHRA 1SQ7A 3MY9A 4PUNA 3WLIA 3LV5A 3N4FA 5BXRA 3VIMA 5M17A 4A8NA 3UJRA 4AD5A 2RKXA 2V2CA 4GKTA 1IZKA 3ABXA 3GXFA 1V02A 4O54A 5KZMA 5REQA 3W6YA 3K1DA 3PFRA 4V27A 3BMVA 1VBHA 1AA1B 1DHPA 3G3DA 2Q8LA 3QV8A 3GHTA 4UOJA 2Z1VA 3ENLA 3UESA 4MKVA 4A3RA 1LJYA 4AVOA 2XPKA 1Q7MA 4AZIA 3IVTA 1D8WA 4X2PA 3VCRA 4XZLX 3VM7A 5A8QA 1S2TA 3LHYA 1QBAA 3RPDA 2Y0FA 1UR3M 4GG9A 5K9CA 5PTDA 2YYTA 5DCBA 3QPYA 4PH6A 5KZ6A 3W7GA 2XIOA 4LGXA 4UTLA 3K13A 1W6TA 3HTWA 3L4WA 3FDKA 5I23A 4CNNA 1DTUA 2Y8VA 1WNOA 4H83A 3UG4A 5G1TA 1WPCA 1QW9A 2DSWA 4WDUA 4FNQA 3TAOA 1HFBA 1XYMA 3M0VA 2B4GA 4X0VA 3PWAA 1SM9A 3IJ7A 2D22A 3M6YA 2B7OA 1OFRA 4KF1A 4F2BA 3DFTA 1Q2RA 2YLLA 1TX2A 4LY4A 1PZ0A 2EG7A 4NZ3A 2YBVA 3RILA 3HFYA 1TG7A 1RY8A 5DBTA 1HP5A 1B30A 3PULA 4WZHA 2NV2A 2HJPA 1QNRA 2J75A 4GZIA 1EP2A 4CUCA 5E6ZA 4WR3A 4V2XA 3ITVA 2HK1A 1KM6A 1K1DA 1OX5A 3W01A 3PF3A 3APYA 1HN1A 1YYAA 8TIMA 3CUZA 2ZC8A 2P5NA 4QJ1A 3UXLA 3B0YA 1TWZA 3BANA 1UR4A 3I10A 4Q33A 4L7ZA 4UFKA 3ARPA 3MDWA 4XB3A 3TJLA 2PTDA 4N9EA 2JEPA 2G97A 3GHRA 5GNXA 1K9DA 4HNNA 3W26A 2VR4A 1ONRA 1QK0A 3L5LA 1CLVA 3KEHA 2OU4A 2ONEA 3SCWA 3N9KA 1P48A 4CU6A 4OKDA 2P0OA 4OOZA 3B0UX 4LY8A 3KZSA 2PB1A 2BV9A 4MY8A 3VXGA 2VWSA 4H3DA 4RXGA 2G3JA 1YXCA 3GVGA 3VNJA 4HCHA 2UY4A 4YJ5A 4FALA 4ACYA 4UFMA 3CWHA 1OD0A 1UCWA 2FPYA 2GDVA 2ISDA 2CZVA 3CO4A 3PPHA 5K7JA 1XH1A 2OT0A 3TLQA 2OXNA 4LNCA 4GIRA 1L6GA 2VZOA 4GPNA 3UNTA 4AD3A 2NWSA 5AKQA 4QTGA 1K70A 1KFEA 1Z44A 5D09A 5C2CA 3XINA 3ORWA 1R9XA 4XZBA 1GQIA 3AICA 3UG3A 2QDEA 4IQEA 3EWWA 1JZ3A 4XAGA 1JPKA 1OK6A 3ZO9A 2XUCA 1EA0A 1CLXA 3ZLGA 2YXGA 1C9WA 3DAQA 1R47A 2ZWYA 3UG5A 3AI0A 4DJFC 4N6FA 1R7OA 1S5MA 3ZR5A 3NJ3A 1XL9A 2BZNA 2AQOA 2Y7DA 3GXDA 1ADDA 1ZBCA 2E6DA 2VEIA 3JZUA 2DQXA 4C5YA 4MB1A 5JBFA 2BY1A 3GX9A 4DJEC 1LQ0A 4U5IA 4LVBA 1BYCA 4UC5A 4NF7A 2PBGA 3NPVA 3B8UA 2R24A 3NDYA 2HEJA 1E6RA 3FHAA 1XH2A 4Q8TA 1V77A 2CBIA 4CQCA 4E8CA 2J74A 3KDNA 6ALDA 3EYPA 4U33A 3WBYA 1WO2A 4DWSA 3LMZA 1J0ZA 1P5BA 5HJXA 3UWUA 4NZ5A 4EPBC 1ME8A 3NO5A 3LCGA 1BHGA 3QOMA 2GQAA 7ODCA 3ABQA 1HJQA 4XBSA 1Y5WA 5CBBA 3SQSA 2CZ5A 2YL9A 4CN6A 4PRRA 1LL6A 2ZC1A 1ME9A 3S5OA 2G0WA 2FHCA 1FOBA 1EEXA 1RQHA 1UMYA 5K3VA 1TTIA 3QR1A 2HE8A 2IXUA 1LDCA 4W9TA 4P8XA 5A6TC 5C2GA 5E9AA 3I3EA 3H4WA 4X60A 4UQ9A 2QJMA 3CH9A 3NSMA 4N02A 2HS6A 3PFMA 4RX0A 4WD0A 1XM3A 3N18A 1FP9A 4H41A 4YVVA 5FEWA 1AJ0A 2HVMA 4PB3A 4Q22A 1S1PA 1M65A 4QAIA 1NQ6A 1XSIA 3GU1A 5GJMA 3W1RA 3VZYA 1KM4A 1X8CA 1NIUA 3R79A 2VM8A 2P0IA 1EX1A 4GD0A 4GINA 4JIEA 4MYAA 3ES8A 3QW3A 1W9UA 1W31A 1JDDA 1IHIA 5LA1A 2D0HA 5LSMA 1JGIA 4QM1A 2RGMA 3GTXA 4IJBA 3APGA 1XWYA 2NX1A 3KTCA 3QHOA 1MYRA 1TYGA 3AXHA 1IWPA 3B8DA 5BMXA 2Z28A 3BOFA 3IACA 1PTAA 2XZ7A 3AFBA 4HPGA 4MPKA 1XGDA 3L4ZA 3PS7A 5LGZA 2INFA 1LF1A 3A47A 4KH2A 2EJ1A 3KVKA 5C71A 3RGTA 1M01A 3SY5A 1ISWA 4O57A 3DG3A 2Z7GA 2WMIB 3PUOA 1PCKA 3TR9A 4J9JA 1F07A 4JIHA 4RCXA 4FLRA 2Y5EA 3S83A 3GAKA 4S3AA 2YL8A 1OZMA 2PLMA 1WZLA 1JQXA 1D3CA 3W7QA 3KVJA 2J79A 1XBXA 3M64A 2HNEA 1VIZA 5DELA 4IXHA 3SCRA 3WX7A 3IRDA 5I00A 3IK2A 1GZJA 1RY0A 2F6XA 3RO8A 4HMCA 4I6KA 2DQWA 3U2ZA 4RW5A 2WO5A 3CAKA 4GY0A 3W71A 3PZNA 3PHAA 3QKZA 1XLLA 3SY8A 3W25A 1NDZA 1TV7A 4QLKA 1PSCA 5GJPA 1W5MA 4LS1A 3EZ4A 3FYYA 3WQDA 4X61A 3K5XA 2IW0A 1Z3NA 2E9BA 2F7FA 2HSAA 1U33A 3KBSA 3UR8A 1HKIA 2CEQA 4XSLA 2P1FA 4XKMA 1W32A 2Y63A 1JPMA 1R30A 2AMXA 5FL1A 2CC0A 4MWAC 1I8JA 4DXKA 1VYPX 1OY0A 2HV5A 1W3IA 4FMVA 4HHMA 3P0XA 2YX0A 3KL3A 1TTPA 5ABFB 4DO7A 3WNOA 2DUXA 4CD7A 1DXFA 3OIHA 4MZYA 2DVUA 3USBA 1MDRA 4WXZA 1N8IA 2BMBA 3TJXA 1VBGA 3CTTA 4D6CA 5I78A 1VCGA 4J27A 2AL2A 4PMRA 5CGMA 2X1UA 4ILSA 3WEOA 4AC7C 4IIBA 3JW7A 1IGSA 1J6PA 3WLTA 5HR7A 3TTEA 4NX5A 2BLEA 3PPCA 3P6LA 3W02A 4LCSA 4O1BA 1OFPA 4S3GA 4JTEA 1OC6A 1VPXA 3URQA 7XIMA 1PTDA 5DF0A 3M0KA 5TNVA 4DELA 1A5BA 4GI8A 3CQJA 1PX3A 4NJJA 1NOFA 5BW6A 4GI6A 1UJQA 3BLPX 2WVSA 1UC5A 1E6XM 2X1RA 5FA5A 4MWAD 5KTLA 4KFOA 1M03A 3V18A 4QR6A 2ANUA 4J40A 2DZVA 1WUEA 5A8OA 4PE8A 3ZWSA 3OZPA 3U8GA 4DNHA 1MRQA 4J28A 1YDVA 2PTXA 4CCEA 1J0YA 2PUZA 3GO2A 2BS9A 3OG2A 1YE6A 1VRDA 4AYSA 2CPUA 4D6GA 2ZX5A 5DRIA 2BX7A 2GVYA 5CPQA 2Z2AA 3U4AA 3TCSA 3WQCA 1ZENA 1UW9A 2CLLA 1Y7VA 3DFOA 5EYWA 3R6IA 5JIPA 1JG9A 1X7FA 2X42A 1XC4A 3ANUA 4HMDA 4N4QA 2W62A 1GOQA 1TPH1 3GK0A 2WV8A 2XFYA 3EOLA 3R1ZA 2Q3RA 5L9FA 3VIOA 3RLGA 2WNNA 4GJ1A 1J0KA 4UUIA 4U5KA 3NZRA 1B3WA 2ZBTA 1LTDA 4NZCA 3RPTA 4EXQA 5K4XA 1W17A 5A8NA 4XZMX 3DYMA 1OFDA 2GZXA 1TWIA 2HK0A 4MLRA 1QI5A 1YDYA 1Q45A 3S6DA 3TC3A 3FAWA 1XF0A 3UWWA 2DT1A 3GC4A 2DZSA 1C93A 3FLUA 3GS6A 4C7DA 1US2A 3VKBA 4TVDA 1Z41A 1A3HA 2JEQA 1UKQA 2CWXA 1H7NA 5D2WA 3OQ8A 3NXLA 2FPTA 4EP8C 3HGJA 4J35A 4OE7A 3M0MA 1JCYA 3GNNA 3P7YA 2WWDA 4AZ6A 1KCLA 1IEWA 3VGBA 1UD2A 2H8XA 1E4NA 3II1A 3TJIA 4HPXA 2C13A 3IJ9A 4QDPA 5DXXA 1YW1A 5TAOA 4WOZA 2W61A 1P4CA 3VM5A 3LTYA 1B57A 3B0PA 5JH1A 1VPQA 1RUSA 4WRHA 2XH4A 1Q6EA 4H01A 4YMZA 1NWUA 3AJ7A 3W85A 4L65A 1FWAC 1GPWA 1M6JA 5A8MA 2B81A 5HMEA 1DPMA 5HMFA 1WXJA 1W2PA 3VUPA 3L12A 1F6YA 1G67A 3CUHA 3VC5A 1J0JA 4P8VA 4XAZA 1OCBA 2PRHA 4ATDA 4WDWA 4NI8A 2WSKA 1E4MM 2ZFAA 4EWJA 3L67A 1EBGA 2IPFA 3GAYA 1HVQA 4ENLA 3OA3A 1EJRC 1VKFA 1TVLA 4JQAA 3VNZA 1HJVA 2R1PA 1A3XA 1XC6A 5D02A 1FCBA 5FJOA 3KAOA 3WJWA 2Z2BA 1JCNA 3WD0A 9RUBA 2DW6A 3W86A 1OJXA 5IRPA 4O52A 4ZTXA 1W54A 5GQBA 4H4IA 1QBBA 3MUAA 1LG1A 2X0SA 1GGOA 3RF9A 4E0CA 4GZ7A 3WYZA 4LUTB 5FSEC 3UT0A 4O16A 3AC0A 1B54A 1O1HA 3GXMA 3QMTA 1MUCA 4TTGA 4P7NA 1DBTA 2PWDA 8XIAA 1OG6A 2P8BA 3N6JA 4LUJA 1B3YA 1XINA 1OX4B 1J5SA 1MMFA 1VJIA 1C29A 1MQPA 1HKJA 2GQ8A 5CG7A 2WMJA 3NQ7A 4MYXA 1UIPA 3GBEA 2GVJA 4TXEA 5M1TA 3HGSA 4DO4A 1VP5A 5J5RA 2GJNA 5EA9A 4R9OA 3BE7A 1FTXA 3PM6A 2QPXA 4B3ZA 4GVHA 1VEMA 1JI1A 4JIIX 3V5OA 1R5YA 3AXMA 4NAEB 1SFSA 1EEPA 1M68A 2QLYA 1PUDA 1MEHA 2ESCA 3I7RA 1SR9A 1FHDA 2ISFA 3U7BA 2QCLA 4YVXA 1J93A 1TSIA 5HPCA 3BG3A 1K7EA 1YRRA 3RNDA 3TSBA 5LHEA 1I1WA 2P88A 1BWKA 2DVTA 4NI3A 1TMQA 4J3TA 2FIQA 4H6EA 2Y5SA 1K9TA 4GACA 4QS5A 3QQ0A 4I5RA 4ZB0A 2QPUA 3V5CA 1MQQA 4FLQA 1QO5A 3W6MA 3FA4A 3B04A 3F5LA 4JTJA 3LDVA 3WLLA 3TA6A 4Y9PA 2E5CA 4US5D 3L4VA 5JXQA 3AYVA 5FAJA 4ZFCA 4PUMA 3TZNA 2E9MA 3CAWA 3LBCA 1JF5A 4BI5A 1ISVA 3B8SA 3L2MA 1A5SA 2YDSA 1RALA 4MDOA 2QF7A 3MMDA 1ZZMA 4GNJA 3VMOA 3DFPA 4JCLA 2X1TA 4I7VA 2QDGA 2GWGA 4HZMA 1ZLPA 1VCFA 3GFYA 5FF4A 4ASTA 7A3HA 1GCYA 3K8KA 3W4RA 3SJNA 3ABZA 5I3JA 2NX9A 3PZIA 4CQAA 3M9YA 1SZEA 3CBWA 4GQRA 5E0CA 3MMTA 3ZOAA 1ELSA 2HMCA 2DIEA 1K8ZA 3OLDA 3EA1A 4GBDA 1TKKA 4B2DD 3S5ZA 1TO3A 4PFMA 1POJA 3UZYA 2SFPA 2NV1A 3GQYA 3LLFA 4QNWA 3BSMA 3HM7A 5T9BG 1WDRA 3B40A 4GE8A 3U7VA 3WLOA 4IM4A 5HJYA 2XSXA 5DFAA 1ECEA 1UC4A 5KZDA 1BRLB 3FAXA 2QR6A 1UP2A 4JNMA 1XLIA 4N9BA 3BV4A 4LBUA 4TX8A 1E4LA 1S5WA 4PTNA 5D9OA 4LC8A 1ZFJA 4DUXA 4WY0B 4ZSUA 1NARA 3GU2A 3FV9A 2J9ZA 3LBOA 3AROA 3N4AA 4IFRA 4EPKA 4KWUA 1JCTA 2ZWZA 1CI1A 5ABTA 3QZAA 4D6IA 4X2RA 3MI3A 4NJGA 4IMAA 3T6CA 3S2MA 4ZSTA 3WQWA 1MEWA 5ABFA 4B15A 2C7FA 1E9LA 2OEJA 3BO9A 4LALA 2GUYA 1OT2A 2A7NA 2PPGA 2VUNA 3E38A 3UPBA 2IMRA 5KSWA 2V2DA 2YDQA 3MP4A 3WK1A 3CV1A 2Z4GA 2E7FA 1KTBA 4E2DA 2EKCA 3P0WA 3AUOA 1G4PA 1RD5A 1W1B1 2QVNA 4DYEA 3ANYA 3PSVA 4JD4A 1O68A 3EWUA 3PNUA 2QDDA 2Y70A 3SEPA 1ML1A 1UKOA 3VIFA 2NVAA 1YDNA 3A9IA 1LLWA 3G2GA 3TJ4A 3TYUA 3VNDA 3IIXA 1CIUA 2PS2A 4AY8A 1PYFA 5M5DA 3NQ2A 2J66A 3CQHA 3OJGA 1X6NA 2WWCA 4O13A 1JI2A 1QTWA 4AX7A 4KQNA 2OQHA 1VBJA 1D9EA 5KINA 3CZKA 3SCVA 4NZJA 2XVNA 3DFSA 1J12A 1F7BA 2PDYA 3LI0A 5HUOA 2QUTA 4JYFA 1TPWA 1SW3A 3DBNA 3EDFA 3R2GA 1GYNA 3C2RA 3WH6A 3ARVA 6REQA 3WFZA 1V6UA 2OQLA 1A5KC 2O7SA 5I09A 2ATSA 3D3FA 3ZLFA 4K1GA 4L64A 4GC4A 1XRVA 1LWIA 3GDMA 1OX6A 1UR9A 4MJ4A 3WLJA 5AYIA 3C8NA 4FZIA 2D73A 1XYFA 3FXGA 4H8VA 4O18A 1DJYA 3B9EA 5B7YA 8XIMA 3WDHA 2Y62A 2ODOA 2V63A 1SFLA 3UY7A 2RJHA 4R33A 4WJXA 2WPBA 1A5OC 3UU0A 1WKDA 3S1VA 2FVMA 2Y24A 4WJEA 2VC7A 1BG9A 2VCCA 4DUVA 3DIPA 3DC8A 3WH5A 4QFUA 3THUA 2WJDA 3P62A 4GXWA 4E4UA 4O17A 2PD9A 3LLDA 5A6BD 2EQDA 1DJGA 4L9YA 1XLGA 2ABAA 1WP6A 1TVPA 4HNUA 1KBLA 1E0UA 3VIHA 4LPCA 2PGRA 4JN8A 1PZ1A 3FGCA 2OKOA 3BW4A 3OVPA 2CKRA 6TAAA 2ZTJA 3JVAA 1W3TA 2Y1HA 3B05A 4INFA 5EBAA 1QOPA 1BG4A 3DOPA 1RAKA 2VENA 4C5ZA 1NWSA 3UGVA 4K3ZA 1VFLA 1LWJA 2NSOA 3TONA 1FWNA 3FVDA 1PKNA 1EB3A 1VJZA 4B5WA 4LC6A 2EG6A 3WF2A 4I5UA 2H6RA 3MHUA 4G56A 3R11A 1K6AA 5XIAA 2VX4A 3VOCA 1YQ2A 4K6AA 1TE1A 4RZ5A 2J9XA 1H1YA 1JCXA 4PTXA 3TQ0A 3QGAC 3AAMA 3AU2A 1CB2A 2NXHA 3HQ1A 3EPNA 5F1UA 3VD5A 1KCKA 1DYSA 1NTHA 3IANA 3QSTA 1JXJA 3ARQA 4JEQA 3H26A 3ZLHA 2VEMA 2VC6A 3AHXA 1G69A 1XIMA 3QFWA 1UH2A 2NT1A 4GNKB 2CLHA 2PTWA 2FTYA 4O12A 1V6YA 3PB0A 3Q94A 1PX8A 3IUDA 2WNWA 5AOUA 3SRKA 3NZ1A 1ZJBA 5LXEA 4R27A 1ZB5A 1DKWA 3QLLA 3THAA 3Q67A 2HPMA 1ISZA 1BYDA 9CGTA 3T81A 1H7XA 4XUYA 3TV8A 1VFUA 4UTWC 3KFTA 3WNLA 5DX7A 1BFNA 4LUTA 4AEFA 4IFKB 3TX9A 2W79A 1Q4WA 4B5NA 4JFTA 2F6UA 4IIGA 4HIBA 5LXXA 1RJQA 1ZHAA 4MNMA 1F3WA 4IP5A 2GSHA 1DEDA 1OX4A 1AQFA 1A5UA 4JX6A 4KETA 1SSDA 4WSHA 5IOBA 3E6EA 1UPMB 1KKRA 1V5XA 1JZ8A 1ISYA 1DE5A 3SQMA 4TUFA 2YZRA 2ZUSA 4PTVA 3MO7A 3VA8A 5DXYA 3OPSA 3I6EA 1T6MA 4TR9A 4W89A 5I79A 4RZ4A 2XFWA 4BF9A 4WDXA 2WHMA 2A85A 5I03A 5JVLA 3PBUA 3LNPA 4EVZA 4NAEA 2RFGA 4JTGA 2ZIDA 3TOYA 4LU0A 1WUFA 1CX9A 1MEIA 3EB3A 2FGLA 4A35A 4XZHA 2DP3A 4MOZA 3BZGA 1ZPTA 3KLLA 5D33A 3C2EA 4NT0A 3QGVA 1GOMA 5LNVA 1H62A 3MKVA 1UQYA 4GYFA 2OOFA 1MQRA 1NSJA 3U6WA 2BOGX 1CECA 2MANA 1XQKA 1VYRA 4B3KA 3LX9A 4I9AA 3VKCA 1QPKA 1CGUA 1UQZA 3BCDA 3PUEA 4PUEA 2UZ9A 3ZFHA 5F2IA 4A2SA 4LCRA 3LCFA 1HNYA 1ITCA 4XBKA 3WQPA 4RDWA 4DVOA 2Y7EA 5HINA 3BW2A 4K7YA 3G1FA 4DUWA 3OGRA 4OTKA 5K2ZA 2J7CA 2V67A 2TPSA 2FFCA 1EO5A 3FJLA 3ZT5A 4XUGA 3LK6A 4LRSA 2J4GA 4RJEA 5CBIA 4IQLA 3BLFA 4HU8A 3CYVA 4GQQA 1MXGA 3T4CA 3T2QA 3HGOA 1ENUA 2GWNA 2E8ZA 3WO8A 3KOXA 1GOOA 2G3NA 5A5WA 5IDZA 2E1DA 1AD4A 3WLNA 3GTHA 1CZ1A 3NWRA 3TC6A 1EC7A 3CUXA 2ZUWA 5EMMA 3UF9A 2VNCA 4AZBA 3V5FA 4R5EA 4DM1A 3QM3A 1H60A 3P61A 3FHQA 4LOCA 4ML9A 3A4AA 4XD5A 3HPXA 2JBMA 4RE3A 2DORA 2V9DA 1EJVC 1XIGA 3W9ZA 4EKJA 4IICA 4FAMA 2G37A 2VKZG 2WNZA 1XLHA 3B0XA 4TU1A 2DGAA 1BRLA 2JE8A 4QJ5B 1G7VA 1QI4A 5CAHA 2OX1A 5KITA 3WNNA 3LLXA 5I7GA 3QHMA 3IGHX 4B9YA 1B4KA 4WY0A 4M1BA 3V35A 2BGSA 5FJUA 4DN1A 3S42A 4JDBA 4TQTA 3EMCA 3GUGA 3C0QA 2ZE0A 2V5KA 1K4GA 4YYFA 4AU0A 1F3TA 4F79A 2WPGA 4FOKA 2HISA 3JZEA 3NQAA 4I8DA 4HGXA 1H7PA 3W75A 3W37A 1Q2SA 3W82A 4HPJA 4LQ1A 3P81A 3G6MA 3NQDA 2W92A 3MUIA 2PD5A 5D38A 1GOIA 4MTVA 4D6JA 2BBFA 4MFEA 1TR1A 1O6IA 3VIJA 5CJMA 3G77A 4PYSA 1GG0A 3N2CA 4QISA 3TQVA 3AHTA 5BU6A 3TNOA 2PA6A 3M43A 3CMGA 3ZVIA 3WK2A 2CXGA 4DBWA 3H21A 1TR9A 4S23A 4O50A 1H41A 1SO5A 2DV0A 3MUCA 1RV8A 3CAVA 2WZTA 1U5VA 4MPQA 4QCEA 4B5VA 3DYPA 3LHZA 8CGTA 1DL3A 4WSJA 1SJBA 3BWWA 2DZBA 1KM3A 2R1KA 2ZA2A 1VLIA 4C6PA 3EGJA 3HU7A 3TROA 4DEFA 2GLKA 3MA8A 4DWSD 4QQ3A 3GIQA 4HK6A 1DJQA 4O8RA 5HWJA 1NVMA 4Q4MA 2ZZ2A 1WOBA 4D72A 1O60A 3T0AA 4Z0SA 1Q6DA 4K8HA 4KWOA 1IZCA 5CLTA 5I07A 1NOUA 4KW2A 3PBWA 3PVFA 2CLOA 2PE4A 3IAPA 3TIMA 3TEVA 4JTCA 4AVFA 2PDUA 1V3IA 2Z00A 4IT1A 1NELA 2WC3A 2I9EA 1V79A 2OMAA 3WFLA 4UOQA 2G41A 4QSHA 1WDPA 1XLAA 3WQ6A 3KP1A 4WVXA 5G4HC 5LHFA 1GEHA 3AMLA 4H6KA 2YFOA 3IGXA 1VEOA 4FF5A 1EC8A 4PBEA 3PJXA 3VIKA 3G1VA 5BOOA 3WN6A 5M2FX 3NCOA 3KHJA 1T0OA 3VNIA 2PDGA 3IJIA 1K9EA 3WH9A 1FCUA 4PCSA 3LCXA 3SN0A 4C1NB 4S38A 4AZ5A 2XVGA 1RJPA 3F2BA 4PRTA 5FAGA 1CXIA 4LV4A 2PODA 3TYBA 3BURA 3CZJA 4LYKA 4JIPA 4DXVA 1JDCA 5IBXC 2XWDA 1S2CA 3F5JA 1A0CA 1KM2A 3N3MA 3CHDA 1WAUA 2FJKA 4HA3A 2JKAA 1XH0A 3WIJA 1W1PA 3G24A 2IKHA 1XIJA 4AD1A 2VZTA 4AZ7A 1CGYA 1QUMA 3BH4A 2EPHA 1AL7A 4IIFA 1KV5A 5DMLA 5HOSA 3CMFA 1JFXA 1KR0A 1UH4A 2IUZA 2XN1A 4Y2WA 3KBNA 3WNPA 3D6NA 3P60A 1UH3A 1GVQA 2NWRA 3VCCA 5DQPA 4E2BA 3VKAA 4CGTA 2CWNA 4NYUA 1KRBC 2WSPA 3BXWA 4JFVA 1MW2A 3VD7A 1ITQA 4BQ4A 2PU0A 3KW3A 1LUCB 4WK9A 1R86A 1V3MA 3WDQA 1WDSA 5C6MA 2PDXA 1H09A 3GYEA 4RZ6A 3IWPA 3S5SA 2Q02A 3EMQA 3VMNA 2OZ8A 1ITXA 2E1WA 4C6FA 5HWNA 2XGIA 1XRSA 1UWAA 3WDJA 1OGBA 2C71A 4Z1AA 2RJGA 3MVTA 4LX4A 5CGQA 3E1F1 4DF0A 4LSBA 4WOQA 2PAJA 1YMYA 3CHFA 2L5HA 4PUKA 4CNOA 4UFLA 4X9YA 3LD5A 1X6LA 4NQ1A 4I7UA 2WC7A 3N17A 3KBMA 2EJAA 4FNPA 3M6DA 2QUVA 3DGRA 3P67A 5E0FA 3W7RA 2FVLA 3WKZA 1I2RA 3GVVA 3R5EA 4IFKA 1Z69A 2XN0A 3O2LA 1TREA 4BS0A 4LUIA 3ID7A 1TJPA 3ITGA 4C7GA 1X1OA 2C6QA 3KX6A 3RPMA 5IDIA 1JAKA 2O56A 2CFFA 2PWGA 2OODA 1C7TA 3VDHA 3H4GA 1GVOA 3EOSA 2OYKA 2IKIA 3GIYA 3GTIA 4PMYA 4DJDA 3LXAA 3A9BA 3MYPA 3TN4A 1R3WA 4K1WA 3BAWA 4XKYA 1XIBA 1LBMA 1O1ZA 5AHLA 3CK5A 3QKEA 2FJUB 3ABSA 4FO4A 3LGGA 1UKTA 4CQ9A 2DU2A 1IEVA 2VZUA 3AISA 4LUYA 2ZZ3A 1SJDA 4DPQA 1JZ7A 3AZRA 1O95A 1QI3A 1GHRA 4JFUA 3T40A 1W91A 3E3HA 2FZ9A 1XG3A 1DHKA 5A6SA 4K8EA 3GTNA 3USZA 3ITXA 1UD6A 1N82A 3A5VA 3PAOA 2WC4A 4ZQOA 1TUFA 5FD0A 4W8LA 1EJXC 1IWAA 2GGHA 3KRZA 1KM1A 2OQYA 3RR1A 1BXBA 2DW7A 4BI6A 2J7GA 3ECQA 4LBSA 4ZB5A 1XPYA 4QG9A 3WD1A 3W6LA 5EU9A 3NURA 3OLGA 4PFHA 2QV5A 2QV4A 4LF1A 1LP6A 2NLYA 4QBXA 4MADA 2A3AA 1XV8A 1TB3A 1EP3A 1X6UA 2IQ0A 4AB4A 3MSRA 1U5HA 4A3UA 3B8VA 3SJ3A 3W2KA 2OOGA 2G96A 4JQ1A 1GEQA 3U5UA 4S3CA 3GR4A 3LCLA 1I2QA 3E0VA 4QGCA 4IJRA 1A50A 1Z9AA 4GGHA 4JZ5A 1D2KA 3STPA 2X0YA 3W7IA 4N0RA 1V3HA 3FSTA 1OGSA 4IF2A 3H2NA 1F05A 3MSGA 5DO8A 5HDRA 3TWAA 2A4AA 1AL8A 4N2YA 1RPXA 3U2OA 4AUBA 1Q4NX 1CGWA 4G8TA 1W9PA 1OK4A 4HVXA 4C6LA 1EBHA 3N9RA 1J2WA 1YNYA 1XLEA 3MU7A 4XAPA 4G5DA 1KR1A 2CBUA 1YKWA 2Y2WA 3TQKA 3QZEA 5CPMA 4JDYA 4KGLA 1GT8A 5FESA 5A3HA 2Z6IA 3KCLA 2V69A 2P8CA 4XQ6A 3QFEA 4AH7A 1FKXA 7TAAA 1LOLA 1IIGA 2DH2A 4DRSA 3QQWA 4IPPA 4FXSA 3A24A 1FFRA 3CQ0A