4HU4A

Crystal structure of eal domain of the e. coli dosp - dimeric form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
247
Chain Sequence
RLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIPLAEEIGEIENIGRWVIAEACRQLAEWRSQNIHIPALSVNLSALHFRSNQLPNQVSDAMHAWGIDGHQLTVEITESMMMEHDTEIFKRIQILRDMGVGLSVDDFGLPVTEIKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRKIHCRVIQGYFFSRPLPAEEIPGWMSSVLPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oxygen sensor protein DosP
publication title Structures of the catalytic EAL domain of the Escherichia coli direct oxygen sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,hydrolase
total genus 61
structure length 247
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4hu4A00
3PJTA 4FOKA 4Q6JA 3S83A 3GFYA 4Y9OA 5MF5A 4HU3A 2BASA 2W27A 4HU4A 4F3HA 3PJUA 3TLQA 4RNIA 3GG1A 4LJ3A 3HV8A 3U2EA 4Y9MA 3KZPA 4LYKA 3GFZA 4KIEA 3GFXA 4J40A 3SY8A 4ES4A 5M1TA 3PJWA 4HJFA 5MKGB 4Y9PA 3PFMA 4F48A 4AG0A 2R6OA 4FOUA 3PJXA 3N3TA 4RNHA 4Y9NA 4RNJA 4RNFA 4Y8EA 4AFYA 3HV9A 4FOJA 3GG0A 5MKGA
chains in the Genus database with same CATH superfamily
3GIQA 4QDMA 4QSHA 1C29A 3U6WA 1XG3A 4JTAA 3UJFA 2YZ5A 3QFWA 2DZSA 3EA2A 1ZZMA 1OJXA 2WWDA 3PBWA 2W63A 4HA3A 4FOUA 1O1HA 5AHMA 1SFLA 5A2CA 5LXEA 3O6DA 3RPMA 5HK4A 4X63A 1GOOA 3O15A 2QULA 2B0MA 1EQCA 4NUWA 4O4WA 4DJDA 4RW3A 2ICSA 2B7PA 1ZTVA 1PWLA 3N2MA 4BF5A 1ZS2A 2D1ZA 4ACZA 3AMLA 1XBZA 4JBRA 4MUZA 4O17A 3CUIA 3UXIA 1SM9A 1JFXA 4AWTA 3P2VA 4DZAA 4HZMA 3OZOA 1VQTA 2WSPA 3JS3A 3GNDA 4LYRA 1B5TA 3IWPA 2GGHA 3QV6A 4PMQA 1XLDA 3BURA 2I7GA 1TA3A 3OO2A 2OJPA 5I02A 1SJAA 1U33A 1B0IA 2ADAA 1QWKA 1Q13A 3M5ZA 4LNCA 3H2CA 1FXQA 2YW4A 3AIBA 3IJ9A 1KM3A 4S2BA 4FLSA 1EJXC 2GLKA 1XCXA 1A5CA 2W67A 1ZJBA 3AS1A 1PEZA 1FWCC 1P6WA 1TUFA 2A3CA 2VCCA 2IW0A 4JXCA 3UZXA 5CJ5A 1X6UA 1ZUAX 3AHYA 3NG3A 2CNCA 3TQKA 4K6AA 2WZIA 4O4VA 4JDYA 3ITGA 1RQBA 4I7VA 1ONEA 2C14A 2X1UA 3NO3A 2WZMA 2EQDA 2WKLA 1M03A 1DJWA 2VR2A 4GX8A 2F2KA 3GNXA 2PUZA 2Z1KA 3C6CA 1LM1A 4DF2A 3EYPA 3I7RA 3L23A 5A8QA 1SW3A 2W0UA 1G4EA 2UY2A 3B04A 1XDJA 1W6TA 1LQAA 2QNEA 4MAVA 3A3HA 3Q37A 2DUAA 4PYSA 4MGGA 1X1OA 2IKGA 2ZX9A 3ZO9A 1B1YA 2V3GA 1E56A 2VRQA 2V2CA 3LM3A 1OBAA 3KBVA 4UQAA 1ICSA 3DENA 4NJKA 1GZ1A 1EC7A 4IIEA 1DBTA 1GVSA 5BYWA 1GUVA 3T7VA 4EXBA 4FNPA 4JCMA 1K4GA 3H7RA 1TVNA 3GIPA 4DUWA 1SR0A 2J88A 3ABRA 1W0MA 3P61A 3CMFA 2BVWA 1NWUA 4B5TA 2ESCA 3HO8A 3I7QA 3AROA 2FVKA 1W8GA 2WQPA 1P5BA 1Z89A 1LWHA 1PZ0A 4MY1A 3LHTA 2V2HA 3MHUA 1EXBA 2BY2A 4JGDA 4DJFC 3QKZA 3B8WA 3CM4A 3UPBA 4AAJA 1JYXA 4DLFA 3CK5A 3NTYA 6A3HA 5DCEA 3LHUA 4GI8A 4DI8A 2CZDA 3PSVA 4YCPA 2PLMA 3G5EA 1PSCA 1UR0A 3LMZA 1B3VA 2ZKMX 3BAJA 4UOQA 1I1WA 4AU0A 4LS0A 3LGEA 2CFFA 1XYMA 4FNQA 4GACA 2Q8XA 4Y6GA 2TAAA 3QSTA 2ZUVA 2Y61A 3AXMA 1TRIA 4HZ8A 1PX8A 5CZTA 4MAZA 2E25A 5H8PA 1MQPA 1H7RA 1WKYA 2XIIA 5I3DA 3AISA 1D7FA 3S9ZA 4HP5A 3KWSA 5AHNA 1JAKA 1DXIA 2PC8A 1CBGA 2F2HA 4Q4RA 3N73A 5D05A 2INEA 4W7UA 3TWAA 4M6VA 3LTPA 4GXMA 3USBA 4PTDA 4PRTA 3F4CA 1Q6FA 4YU1A 4UTIA 3RU8X 4O54A 2HXTA 4UXDA 4A3QA 4PMZA 3STCA 3PZMA 1S2UA 3LCXA 3WK0A 3FKKA 1TJ1A 1CXHA 3N3TA 2ZA2A 2IPFA 4AZ5A 2OFJA 1MRQA 2EPKX 1HL2A 2G8ZA 3IK2A 5A8PA 3T44A 1E15A 2OEMA 4HKPA 2VWTA 1K6WA 3TSDA 3UXLA 2YL9A 4QROA 3E0LA 3DESA 1JXJA 4HHHA 3ARTA 3PTDA 3G1VA 4FI4A 1ISWA 4J3VA 1UQZA 5BW6A 5DCDA 4R27A 4MB4A 1WDRA 3E02A 1SZGA 5I06A 3EWXA 1QVBA 1DIDA 4MOZA 3NQGA 1OK4A 2PDKA 4R33A 5TQLA 4HMDA 4KWVA 2OODA 4MB3A 3PBUA 1FCQA 2CZEA 2GOKA 1MZRA 3HG4A 1GQJA 4XZNX 1T96A 5GPRA 1M01A 1LT8A 3EA1A 3RCYA 3H7VA 1WZLA 3HMCA 3WLPA 2GWGA 3UJ2A 3WEMA 2GSHA 4XIMA 4I6KA 2CHOA 1WP6A 3WDQA 3BCDA 4HPHA 1FKWA 3BL3A 3HJEA 4LB3A 2J13A 3E1F1 1M04A 4QG9A 3W7NA 3GY1A 4D6JA 3ES7A 1UD3A 4E2OA 1GPFA 3BGAA 3V1HA 1GJPA 1RA0A 4QLKA 3DXIA 1YDNA 2GUBA 4R7JA 1H7PA 1LZOA 3QZEA 3ZR4A 2WJZA 1TV2A 1DXFA 4Q7NA 3SCUA 1GNXA 2DT2A 3N2OA 2QGYA 1AH3A 3B8DA 3FW6A 2ZZ6A 3KHDA 2QCLA 5D2WA 4E6MA 1OF6A 3L0KA 4J9JA 2E6FA 4TX8A 2EGZA 2DQWA 4FF7A 1M5WA 3BLIA 3GLCA 4UTFA 3WQDA 1A5AA 2Z29A 2J24A 3UJRA 3M0IA 4WGXA 1XYFA 3CAWA 3EPMA 2Y2WA 3QMRA 1WDDA 2EJAA 4E2VA 1TVPA 1HXJA 1V0LA 2OLAA 2ZFAA 3V5OA 2YR1A 3EZ4A 4RZ6A 4FALA 3W7PA 2KZHA 3HBLA 3UWYA 3WLRA 4P5UA 1XRTA 3NM1A 2AL2A 5D33A 3MUZ1 1EJVC 2YLAA 3WD1A 4OBRA 4TIMA 3BG9A 2Q71A 1XLAA 2BZNA 1JPKA 3DOPA 1LCOA 2VTFA 1KM2A 4M7TA 1ZCCA 4W8LA 1TO3A 1UPPA 1XS2A 2QVNA 1VPXA 1ADOA 2X40A 1P43A 2GK1A 3UWWA 3Q65A 4G7FA 3PTKA 4Q4MA 4L4LA 3RRXA 1V7AA 2GJXB 2WWCA 3SEPA 3H2MA 4Q8VA 4V27A 1KM0A 2Z1VA 1CCWB 4QSFA 3UWZA 3H12A 1EL3A 4MDPA 5G4HC 5GNXA 2XJ7A 2YL5A 4NXSA 3N13A 4C1LA 4JTTA 2V5BA 2A0NA 2V82A 4HNLA 3RG6A 4IISA 1B57A 3DGRA 3M5VA 1EZWA 1XUZA 4YTQA 1KKOA 3AYTA 4H8NA 3GFZA 3WQ8A 1R2TA 4L4PA 4MMWA 4ZOAA 3DFNA 2QJNA 3B0XA 1TMHA 2Y1HA 3QMTA 3CT2A 1P4CA 4PUEA 2P88A 2WZEA 3EXSA 3HPAA 3UFYA 1K8CA 5CC6A 2WW5A 1OC5A 1IV8A 2HTMA 3VIJA 3AYVA 1NQ6A 2OU4A 3R58A 1TVLA 3TEVA 4GQRA 4ZB5A 1KWKA 1FUYA 4HNOA 3ZJ6A 3W85A 2WHMA 1Y5VA 3ZJ7A 2MANA 3MSRA 1GT8A 2H9AB 3KBMA 3WLOA 1RD6A 2OQLA 4NZJA 4CEXC 4FX8A 2GL5A 3QZ6A 1RA5A 2WNNA 1TWSA 5EBUA 1TCDA 4X0NA 3VABA 3SDOA 3S46A 4N4PA 1GJWA 3GH7A 3L9CA 2Y8UA 3W83A 4GXWA 3GDMA 1RQHA 3GNPA 1GYLA 3GXDA 3M0MA 2J9YA 1K9EA 1WZMA 3SQLA 4GUGA 3M46A 1V51A 3LXBA 4IM4A 5CSYA 3GNRA 4CLMA 3IIXA 3W2NA 3DBNA 3PS7A 3MI6A 1A3WA 2ZXAA 1BYBA 2VEFA 1VB9A 2PRHA 3VNZA 3WDRA 1SO6A 5TIMA 5K3VA 2VHLA 3NFUA 3L68A 4GD0A 3W07A 1ZPTA 5LA1A 1CECA 2VDHA 1UHVA 4YS1A 4AVOA 4E0CA 3BANA 4O0QA 4EANA 3Q4DA 3AU6A 4GQQA 3FSTA 1S5NA 1UKTA 2FMNA 4PB3A 3T42A 3SRHA 4QGCA 4PCNA 3MPGA 3A6OA 3T4CA 4ACYA 3DBPA 3UF9A 3A47A 3M44A 4M7SA 4L9ZA 3TR9A 1KWGA 1TG7A 1PL9A 1BD0A 1TQJA 2DY3A 4N9BA 1WKEA 5F2IA 1WAWA 1M3UA 2EPLX 4WGHA 4U5KA 2I14A 1SQ7A 2PP0A 4HCLA 2HQAA 2IXUA 4CNNA 5K2ZA 4IOTA 3OQEA 4XUGA 1WOBA 2PGEA 2FTWA 3MP4A 3IJIA 1VLIA 1H1NA 5LYRA 1SUXA 4ZQCA 2B7QA 4KERA 4M1RA 4YN5A 3VIGA 2A85A 4RXFA 1GOIA 1JYVA 1HP4A 4HNNA 1EXPA 2P76A 3V16A 2PCEA 4JIHA 3ECQA 3ATYA 3O0FA 3TSBA 2DIEA 3OVPA 1KQYA 4NI8A 3USZA 2PD5A 4ZQMA 4QG6A 3G1HA 3ABSA 2AKZA 3VDAA 1V93A 1VEPA 3CUHA 3N25A 4WD0A 2Q3RA 4F0MA 3BAWA 3GYCA 2VX4A 2R6OA 4PUUA 3JZUA 4XAZA 3KBSA 3GC2A 2EG6A 1ESWA 3GVGA 5AKQA 1I2OA 3LTSA 4HOXA 3EB3A 1XLJA 1YTEA 1DWIM 2HVMA 2YLLA 3GHUA 2QAFA 3TOPA 2WJEA 1Q6DA 4XD6A 4IL2A 3SBFA 5K9DA 1R86A 2V0TA 3KRZA 4J28A 2ZQ0A 1NF7A 2XDFA 3V4BA 4G7EB 4H4IA 3VGDA 3N2XA 3ERPA 1CZ1A 3OOQA 5HQEA 3GVRA 5J5RA 4AIEA 1BQGA 5BXSA 1VBJA 4C6CA 4TTUA 3UCCA 1F07A 4O52A 4YHGA 4Z1CA 4C90A 4GIYA 1RK6A 4UMAA 2POTA 1H1YA 1LQ2A 4GVHA 2C16A 1EJRC 3CQKA 1OT1A 3VC6A 3DYPA 3WMCA 5MKGB 3NDYA 4CD4A 4WDXA 4H2HA 1EYEA 1QK2A 1UZDA 3FK4A 1U22A 4KQNA 4Z1AA 1OYBA 1XBXA 4BZYA 2GVJA 3L7RA 2NQZA 4A05A 5BROA 1BLIA 2PDMA 1L6SA 3UCDA 4D1IA 5BWFA 2BTMA 1DIKA 3PNZA 1UA7A 5EU9A 2QUUA 3W1QA 1A53A 4HNTA 3DECA 3VK5A 1IXNA 4BQ2A 4LY8A 1RALA 4W7WA 1TPUA 4XZBA 5H6HA 1XICA 4AXNA 3NPXA 4V33A 2GQ9A 1IXQA 3SJ3A 3AIVA 3W7DA 2PDFA 4HJWA 3LXAA 4B9YA 1YXYA 2GVLA 3VKJA 3R89A 1VYRA 1BXBA 4PE8A 4RXGA 3STPA 2F7FA 5A6AA 2V81A 3VUPA 4NXKA 4XO7A 3T8LA 3KRBA 2J77A 1VKFA 1RJPA 3FGCA 2HE8A 1RY8A 1XYZA 3RMJA 2FDSA 4K68A 2NT0A 3FEMA 5EKYA 2BVDA 3WY1A 4JL2A 3HFYA 4O10A 1EEXA 4JTIA 4H1ZA 3C5QA 4EWJA 1XISA 3MJMA 1DWAM 1RD5A 3E2SA 3EX4A 3IJDA 3C0QA 4NAFA 4UFMA 1TJ0A 4DY1A 1UR1A 3MU7A 1X6NA 3VOHA 3PUEA 3PZTA 4A3HA 1BXNA 1XR2A 4C6FA 2V3EA 4I90A 4Q3MA 4AVFA 3FIGA 5ABFB 4BQ3A 4DBEA 4DJEC 2BDQA 3APYA 5MHBA 3LCWA 1PV8A 2VC7A 4XD5A 2PTDA 3MVIA 3O05A 4WX2A 4ZXLA 3UT0A 5E0KA 2XIMA 4IMDA 4AZ6A 5AYYA 1H3GA 4PMOA 4QP0A 3G1DA 1XGDA 2E28A 4HVXA 3G22A 4UOJA 3THUA 3ZXWA 2BSLA 2FMOA 2HNEA 1ZAJA 3UPWA 3WLLA 1W3NA 5L6UA 3ZM8A 4WJ8A 2B4GA 3OYXA 3VIOA 2FTYA 1XH2A 3KP0A 4OJYA 2V69A 3BLKA 2PGRA 3T2QA 4FEZA 3WF3A 5CGQA 1FH7A 5D9MA 1MXSA 2E67A 1K1DA 1AODA 4NZCA 1JR1A 3O9NA 1Q3NA 4IIBA 1C9DA 3ZWTA 3W27A 2J7GA 1AVAA 2Y5EA 4A8RA 1BGGA 4MG4A 1QPKA 4ZB0A 3FLUA 4D6FA 4IQJA 5DY3A 2FZBA 2YIHA 3DG6A 4NZFA 1WXJA 4YWSA 2BB0A 5IHSA 3UBPC 1QWGA 1UH3A 5F1UA 1DIEA 1JGIA 2GVYA 2DJLA 1JCJA 4DO6A 2QUMA 1CPUA 5HNNA 2E5CA 2C13A 4TXEA 1BWVA 3BLLA 4LW7A 4TOQA 5ECVA 3QVQA 4PMJA 3VOJA 3POHA 3EWZA 4O14A 4G7EA 1E6PA 2PCQA 1ZJHA 3C52A 3FFSA 4H9XA 1NDWA 3VUSA 1R2SA 5FD0A 1RBLA 2XSAA 4MB5A 3G2GA 3PUGA 1NIUA 4XAGA 4LRSA 2LLEA 5D30A 2HWGA 3ARQA 4A2RA 2BFGA 4OV9A 3L4XA 3RDKA 1GOQA 5H91A 4E8CA 3C2OA 1GW9A 1LG2A 4R85A 2Z2AA 2XM1A 4O53A 4ORIA 4PODA 1ZLPA 2X30A 2FFIA 4AY7A 3R13A 2GQAA 5E9AA 3WBWA 3CWOX 3VKKA 1FWTA 3O6YX 3ZS4A 4WOZA 1PHWA 3OBAA 1R46A 4JD4A 4F0SA 5KEZA 4ZO9A 4RL3A 1FRBA 4R9XA 1XIEA 3TR2A 1EIBA 4ZOBA 1EGZA 4D6IA 3CHFA 2BLEA 1C3FA 3QRHA 2QJHA 1A4MA 3T78A 2UBPC 3WMLA 1A4LA 2FZ8A 2QLYA 4P8XA 1HJWA 5G2IA 4BI7A 4TV5A 5D38A 4UTMA 4Z08A 4IH3A 2JF6A 4A3RA 5FKYA 4GABA 2ZE3A 1BVZA 2O9OA 2PDIA 3CZ8A 1O12A 3G1AA 2GVGA 2J8FA 3E2VA 2VR4A 1EQPA 3ZLFA 5EMKA 1ZAIA 1THFD 4LVBA 4Q4SA 3I68A 4WY0B 2OZ0A 1K8XA 1P0NA 2A3LA 2BOEX 5FF7A 2P8CA 3MDUA 4GZEA 1TTJA 1MEIA 2DH2A 1R2RA 1UKSA 3TONA 4PMDA 4E3TA 2PLJA 4Y2WA 1YBQB 4IWWA 2FVMA 1V03A 2HEJA 3DFPA 4N7QA 4TU1A 2BP1A 3NZRA 2QIIA 3QQ1A 2J7EA 2XFRA 3R25A 2GSJA 4PFMA 3UXDA 3W2JA 5C9XA 5BXRA 1JPDX 3UR2A 5G5IA 1TJ2A 5A69A 1X96A 3NDZA 3PPGA 2HE5A 3TCEA 2WLYA 2HZGA 1E4IA 2NWSA 4O15A 5DT5A 3BK0A 2V63A 4PMXA 3S5ZA 1OADA 1XLHA 4H04A 3AYSA 1DE6A 8XIAA 4NIRA 4ZQNA 3WQ5A 2VENA 1IYXA 1NOUA 3BGJA 1H63A 3PC0A 1PX3A 1X98A 1MEHA 3BH4A 3G6MA 3MA8A 3W1LA 1R5YA 3GTFA 3RYSA 3DFOA 2IXVA 2ALRA 3MKKA 1G0CA 2C91A 3UZYA 2REQA 3L2IA 3WFZA 3PJWA 5A6BD 1QW8A 5FEWA 4WK9A 1FBAA 3DG7A 4NYYA 5FSEC 1MQRA 1E4NA 2QUVA 5FJJA 3OLGA 4A22A 3K8LA 1ZRQA 3OP2A 3QLLA 1XBYA 3UY7A 3SY8A 5DQPA 1IGSA 3BV4A 3AICA 4QAIA 2QDEA 3G1FA 4GKLA 3S5YA 4PTXA 1QNQA 3BAIA 2POZA 2CKSA 3AZSA 3KVJA 3O2LA 4EIVA 3GHTA 2I5IA 1WBJA 5AC5A 3ANUA 3QH2A 3ZSSA 3PZVA 5H8MA 3NQEA 4H6KA 3LMYA 4DUXA 3BAXA 3VCNA 4P7LA 3U8GA 4UOZA 3W84A 1MW2A 3IAPA 4ICMA 2FJKA 1YQ2A 4KIRA 3B9EA 3MCNA 1BQCA 4JDBA 3KCJA 4Q8NA 2Y24A 4XZWA 1NOFA 1ZBCA 2XWEA 3AIEA 1D3CA 1WOAA 5A6JA 5SWUA 1DP0A 4JEJA 4DZ5A 1HP5A 4BF7A 1VPQA 1V77A 5FF4A 4DHGA 1OEPA 3B0PA 2CLMA 1E6ZA 3MUAA 5AC6A 3KHJA 3GDBA 1ZP3A 3EMZA 1UUOA 4ICCX 1XCWA 4PUDA 4UCGA 1WBHA 1F73A 3LV6A 3NA8A 1TELA 4IFOA 3S2NA 5A8OA 5CBJA 1CXEA 2ZX6A 3W1XA 2F9RA 1NVMA 3PM6A 4HQVA 3G0XA 1SO5A 1ZSXA 3LV5A 2YKKA 3NQFA 4IPNB 3MYOA 1JXKA 4N9DA 3IV3A 2QZRA 1YXDA 3I3DA 4LVDA 1XYBA 2DU2A 2NLYA 1L6WA 2DT0A 3BW2A 1HGYA 3BVJA 3PWGA 2PLCA 2OQHA 1Z69A 3M1ZA 2P3EA 4J5NA 1PYMA 3EWBX 1V02E 2Y7GA 3B9NA 2PU0A 4F2TA 2JALA 5CG7A 7PTDA 5F4SA 2VEPA 1NY1A 1FH8A 1F8MA 1I8JA 4PEEA 2NQ9A 4F48A 5G2WA 4MFEA 1T8XA 4M24A 3GG7A 4F2BA 5I3KA 2IMRA 3IIVA 2F8QA 4BWLC 4O12A 1BWLA 1JCLA 2UWFA 1OX4B 1VJIA 5REQA 1R47A 2WC3A 1J4EA 1HJVA 4C91A 1Q6EA 1Q45A 1ADDA 3QJAA 4M8UA 3P8IA 2ATMA 4AX7A 5CH9A 1MYRA 3AHVA 3CHVA 4LT9A 2BXVA 2ZZ3A 1F7BA 3ZR5A 3PZOA 6XIAA 5EPDA 4YHEA 3QMSA 3I4EA 3G8EA 1GVRA 5K9CA 3BZGA 1MDLA 1I2QA 4AZBA 4FXSA 3MUIA 2YL6A 2P0IA 3TFXA 1RCQA 4M3PA 1NP0A 3WQGA 3SURA 2ANUA 4UBPC 1ISYA 2NLIA 1HL8A 2ZOXA 3EX3A 5CSSA 4GVIA 3VD3A 1V8EA 1TYGA 3PZGA 3T4WA 4XX6A 3U4AA 3ORWA 5HULA 4GIEA 1V0KA 2XTKA 5I23A 3SCNA 1QTWA 1B3XA 1RSCA 1UPMB 3EWCA 4JPGA 3R4IA 3T0AA 4WKHA 2Y88A 4CU7A 1M7PA 4AD4A 1PIGA 3BE7A 1O5RA 1PTGA 3IGSA 5HMDA 3SCVA 3ALFA 2H3BA 3MJYA 2ZZ5A 3UGVA 1N82A 3TW9A 4W5UA 1IR2A 1MO0A 2O7QA 4A29A 3W4RA 3N04A 4ZTXA 2P0OA 4CCCA 4OZOA 4DJDC 3MBDA 2VP8A 2WNQA 2BV9A 2E68A 1YTDA 1R38A 3TQPA 1UA3A 1OABA 4FK9A 3QY8A 3D46A 1FWEC 3MMTA 5G2HA 4GUFA 3ARZA 1UMLA 5I24A 3ARUA 3DKJA 4C1NB 3Q45A 3SI9A 4JIIX 3MUXA 2VVNA 2ZTJA 1M7OA 5AY7A 2Z24A 3UR7A 4UTWA 1CYGA 4H8UA 2WC4A 4EXAA 3T81A 4GZJA 2J7DA 2AQWA 4H6RA 1A5BA 3SCPA 2HPMA 2XGBA 1DJQA 3S5SA 1M9HA 4AB4A 1E6XM 3L12A 3ZQ9A 3NGJA 4EF9A 5HR6A 2JKPA 3K2GA 3AWNA 4NT0A 3VYLA 1XRVA 3HOJA 2PD9A 5T8GA 4DWDA 3H2OA 4RE0A 4CKQA 1H4PA 3RMEA 2WVSA 3KRSA 2OLHA 4B5NA 1P0KA 2ACSA 4Q4OA 2VR5A 5FJTA 1AZ1A 4IHCA 3CASA 3TZFA 3ZT6A 3H2EA 3S42A 2BODX 1JUEA 4JQ2A 1LOQA 3W6YA 1EOKA 5KETA 3TN3A 2RDXA 1AFSA 1JFHA 1R87A 2ZXQA 3TA6A 4XVDA 2QCEA 4IQLA 1SU5A 5FEXA 1V3IA 3S4TA 1J0KA 1FWBC 3FA5A 2PTYA 4BKNA 1UB3A 1AMYA 1HIZA 3SUTA 2KAUC 2VC9A 5I3GA 4IMGA 1DOSA 2I9UA 4K2SA 4DF1A 3DHPA 6PTDA 4YYFA 2OEJA 5A3HA 4F4RA 2WM1A 2J6XA 1TJPA 1YRRA 5FOOA 2NQLA 3QSRA 3WSUA 1TV5A 1XSJA 1LUCA 2NWRA 4QIUA 5KINA 2RH9A 3U5UA 1KTNA 5D2VA 3RXZA 5C9RA 1EKOA 3TYCA 2X7VA 2NX9A 4IPIA 3QR1A 3WQFA 1BEUA 3OBEA 4NNBA 2FGBA 3CQ0A 1E1CB 1XGEA 2QCDB 3CUZA 3IUIA 2PZNA 3TYDA 4QE1A 2Q8LA 3CZKA 4PBGA 1BYCA 3IK4A 3NVTA 4H7CA 3GG1A 2OWWA 3OEXA 2VZOA 3DC0A 1V02A 5CGMA 3SCRA 3GBEA 4PR4A 1DQWA 1S2AA 1BF6A 4G9PA 1FA2A 3CB3A 2OT1A 4XQ6A 4KEZA 4TVUA 3B97A 4C5ZA 3HTWA 1YNYA 1OVDA 1MW1A 4NL1A 5LNRA 1DWFM 4M5PA 1F9CA 2AMXA 3PPCA 1H7NA 1RH9A 2HMCA 4N4QA 3HJZA 5D9OA 3EOOA 4XBJA 4QX4A 5LHFA 3B0VC 1F6KA 3MI2A 5IXEA 4ORMA 2EXOA 2Y0FA 4BCEA 4GY7A 4UR7A 3VMPA 1P6CA 4HK7A 5I3JA 3IVSA 2EPNA 3GC5A 3FJNA 3W02A 4ILSA 4KF1A 1GGOA 4FXRA 4CVWA 3GR7A 2C0AA 2PDCA 4F8XA 5U7SA 3DI1A 3VKCA 4EK7A 3S2CA 1GTHA 3F1QA 2XH4A 3BV7A 4Q33A 3QOMA 5J5DA 4Y9AA 4JKKA 4UCFA 2QUTA 4P8WA 2PWVA 3BOFA 1X7FA 1CWYA 3IGUA 3JZEA 3DFYA 4XV0A 3DFHA 2D22A 2A7RA 2Q3OA 1XC4A 3DIPA 3VMOA 3GR8A 4WZHA 2PP1A 4H01A 4WXZA 5T9CE 2VO5A 3E38A 3QTPA 3AQUA 2WQDA 1K70A 4PSRA 2DORA 5EY5A 3ZYZA 1OSEA 3HG5A 1DV7A 3T9PA 2WKJA 3VIKA 1D3HA 1V08A 2WMHA 5F2LA 3I6TA 4X60A 3WLIA 3KCLA 4BF9A 4JICA 4C1NA 1B9ZA 2DIJA 4L6OA 5LGZA 3PAOA 7REQA 4YPJA 4NILA 4PN2A 1UD8A 4XZHA 1AQFA 1S2WA 3WLTA 4XAYA 4OECA 2JIWA 2PI6A 4IIDA 4CNUA 2C79A 4GUIA 1E6RA 1BG9A 3AUJA 4GYFA 4K1WA 3U48A 3D6NA 1LL6A 3C3NA 1JNDA 3K4WA 1F74A 1UBPC 5JVLA 3LPOA 1UG6A 1SO3A 2YDSA 2FYMA 3KL0A 2Z28A 1Q4WA 5HATA 4I7UA 1QI0A 3H4XA 2BS9A 5A1AA 4GK8A 2PSNA 3CYJA 2QW5A 3FDGA 1F05A 3OG3A 3GW3A 1TCMA 1JYWA 4RZ5A 3C2VA 3MCOA 3KBWA 4RV3A 3K13A 1NM9A 4GYPA 2WB5A 2BHUA 4REQB 3NJ3A 2WOQA 1OCNA 3IEBA 3W81A 5LIUX 1BSIA 3WO8A 2G3FA 1Q6QA 1MWOA 4C6IA 5A6TC 4LF2A 3UG8A 1IWAA 4ONVA 1KV5A 1VC4A 1W9PA 4M6UA 4IMCA 4HNUA 3K5XA 1ECEA 1WA3A 3WLKX 2XIBA 1KBKA 2V3DA 1CGYA 4KCVA 1HKMA 4CD5A 2E1WA 1AD1A 4PMNA 5ECUA 3A13A 4H9YA 1A5UA 3THAA 1F3EA 2OSXA 3SSJA 2EBNA 3F2DA 3RU6A 3VVGA 4NRRA 1RQEA 3MP5A 1XIIA 4RDWA 1A47A 4H9MA 3EKGA 3WLSA 4GI9A 1IF2A 3P60A 2D2GA 4M82A 3LI0A 1OZQA 1P0DA 1QATA 3CV7A 5AC4A 4UTTA 1PCWA 3GG0A 1WV2A 3NEVA 1AW2A 1XX1A 3ARSA 3V0UA 2XZ7A 3H4WA 4B5XA 1F4AA 5TF0A 3MUY1 3ARWA 3LCLA 4P7NA 1RJRA 4JTGA 1GCYA 3ZMRA 2PDPA 4CNPA 2Y8VA 3QR0A 2XN1A 3KWXA 2OZTA 3BLEA 1F2JA 3MDWA 9RUBA 1J5TA 2G41A 3PY2A 2Z6JA 4QEHA 5G1YA 5F4XA 3DX5A 1XG4A 4JEQA 3SCQA 3MMWA 3I6EA 1U2YA 2RJGA 3H70A 3FCPA 4IMEA 1ME9A 3RILA 3FX4A 2D23A 2NUWA 5DLCA 1XYLA 2NUYA 1XIHA 2YCLA 4O1BA 3PWAA 2Z00A 3VDGA 4WHBA 3P62A 2FIQA 4IFKA 2CBJA 5M1TA 1OG0A 3H22A 1LYXA 2W62A 3ID7A 1KXTA 4I8YA 1RR2A 3G8RA 2TYSA 4G1KA 2ZC8A 4JTCA 3DDMA 1OFOA 2E9MA 4JY9A 1E9ZB 2ZIDA 3MVTA 3ZWSA 3H54A 2CZ5A 1L8NA 4CUCA 3S1XA 3PK7A 4Z2KA 1NU5A 2Z26A 1AL8A 4PC8A 3BLPX 3F5JA 5XINA 2YB4A 1ITQA 4ADUA 2DZAA 3S1WA 3TN6A 3UGRA 1XF0A 4PSPA 1B30A 2YCEA 3LHYA 5HPOA 1C91A 2Z6IA 4HHMA 1LF1A 3IVUA 2BY0A 3HMJG 2YCIX 2E6YA 2XWDA 4ERAA 1H09A 3NQBA 3D3FA 2X16A 3GUWA 4LUSB 1HUVA 1OFQA 3PJXA 3VTRA 2INFA 3VOCA 1UW9A 5F4WA 1IQ8A 5D9PA 2C8NA 4JTKA 1S3HA 3K1DA 3W7EA 3LCGA 2JBMA 3C86A 3GK0A 4HYVA 5GQBA 3ONBA 3CMJA 2V2DA 2HSAA 4HYRA 3W22A 3GHRA 4E4UA 3VNDA 4QE5A 3N3MA 1YW1A 1KR0A 3HURA 1IEWA 3JRKA 1KRBC 1YE4A 4ROQA 3CTTA 3EBVA 1QOQA 4PL1A 4GISA 1A3XA 3W1AA 4QISA 3CUGA 5ENLA 3TFCA 3P3BA 3K30A 2A7NA 2EKCA 4MKVA 1GHSA 1UD2A 3KX6A 5CZ0A 3B9OA 3S3GA 1XIFA 2J8TA 3UZJA 1DWHM 3SO7A 3RJYA 2WMKA 1IWPA 1B4KA 2UV8G 1TKKA 3R8HA 1YYAA 4UR8A 4QQ3A 1WQ5A 1LT7A 4RZ4A 5HBFA 5AHIA 1G94A 1RHCA 3CGTA 2CXEA 3IGXA 2YDQA 3QC0A 3G18A 4LAOA 3N12A 4JTHA 1UKOA 2BGNE 4JYDA 1J2BA 2WMFA 2CC0A 1ZBKA 2ODOA 4IT1A 1J0YA 3E5BA 2DZVA 3KW3A 4QR6A 1YIXA 1KXVA 2A3BA 3ATZA 5B7YA 4C6BA 2A3AA 1SFTA 3SADA 4URIA 4XTDA 3S0CA 3PR2A 1TWDA 4CD8A 3CL6A 4J1OA 2VZVA 2HCVA 3GD6A 3IIZA 3F4VA 3KP1A 3O6AA 4Y9OA 1H0GA 3VO0A 1RBAA 2J74A 3JUGA 1YE6A 1TPEA 3GU2A 3WH7A 4PBEA 2VCBA 1A0DA 3WNMA 4TMCA 2J25A 2O9TA 6REQB 1OGSA 1QASA 3AMGA 3TUUA 2ZZ4A 4R53A 2TPSA 1RLCL 4A8IA 3G0SA 2VGBA 4A8LA 3BSGA 3SN4A 3RR4A 1KFKA 2OKOA 1G69A 1JYNA 4ZSUA 1M65A 4FPSA 1H7WA 4UTJA 5BMWA 3O1NA 4IJCA 2FVLA 2VD8A 4OIFA 3ARPA 4TX6A 3APTA 4RLIA 3PFRA 2ALDA 5EMYA 1R9YA 3GFYA 4XKMA 3KOWA 4ZOCA 4K38A 2PP3A 2TODA 3MKVA 5D9NA 5K4ZA 1W1VA 4K8GA 2WVVB 2JK2A 1UWUA 2PWHA 3ABOA 3GXIA 4S3JA 2B31A 3WQWA 1OCBA 4DNHA 1ZP4A 4I9MA 3IJ7A 2Y5SA 4UB9A 1KBLA 2NT1A 1XGZA 3V5FA 4U3CA 3REQB 1GQIA 5CPTA 1K6AA 2O4QA 4QNEA 3RGTA 4LC8A 4DJFD 1JPIA 3N4AA 1SGJA 1QT1A 4Q8QA 3SCSA 2YW3A 4I5XA 3VIFA 1D2KA 5I09A 1PKNA 1JG9A 3RO8A 1E43A 1G5AA 3IACA 4AWUA 4ZQPA 1GVFA 4GI4A 1YXCA 4ZCWA 3T40A 1VLWA 1YHTA 5I03A 2NQJA 1XL9A 4B5WA 4LH8A 4H6EA 4JIPA 4ES4A 5GVJA 1QRQA 4C6OA 2OPJA 3FXYA 3LCFA 3NM3A 1V6TA 3WQEA 1T5AA 4PCTA 3V7PA 5FL0A 4BEQA 4E8GA 3RUBL 3WD2A 3HFTA 1C90A 4Z1BA 4CD7A 3M0VA 4PTNA 1X38A 5FEZA 2WNWA 3CYVA 4BEUA 4M56A 3QY6A 4ZL1A 2BXYA 1ITUA 2V5CA 3GDTA 2PODA 3AOFA 1EDTA 3WMSA 1S5WA 3AHTA 5KMYA 3L0NA 3ZVHA 4I9AA 3RX2A 4J35A 3PNUA 1SPQA 4CNOA 2QS8A 3VCCA 3FJ6A 1LBFA 1VIWA 1E0VA 4LCSA 1FWWA 2VGIA 1T6MA 1H41A 4C6LA 1QK0A 1BFNA 2PS2A 2WKGA 4X3ZA 1UP3A 4DQWA 1JD7A 5A8NA 1K03A 1VCFA 3BCJA 2PRLA 4LVAA 1K77A 2QPUA 3A9IA 1MMFA 2J78A 4EX4A 1OF8A 2A7PA 3PWIA 2J7FA 4YCOA 1W3HA 3IAQA 1C93A 3BDKA 3TJXA 3PF3A 2XIOA 1R0MA 2D69A 4UFIA 1SO4A 3SGZA 4Y9PA 1A5LC 4J3ZA 3E5PA 3M0KA 4FP1A 2GDQA 1EJUC 1XRSA 3HGRA 1K3UA 3QW4B 1YNPA 1PIFA 4MYAA 2YCJA 2YBVA 4GNJA 3F03K 2QVHA 4GI6A 1YDYA 1SYTA 1A3HA 1YNQA 1IZKA 1GOKA 1JGMA 3RHGA 3NSXA 3WF2A 1HN1A 1WO2A 4MZYA 3C0JA 1SFSA 1WZKA 4IGNA 4S3GA 1SSDA 2X0YA 2XVLA 4HU3A 1Z32X 3B9AA 3HU7A 4PUKA 4KEVA 2D3NA 1FWGC 3EGJA 3TN5A 4IFRA 3NR0A 3UETA 5EMMA 1M68A 4UQ9A 1O94A 1W1ZA 3P0XA 5G4WA 1F3XA 5EFFA 4O16A 1U83A 4P8VA 2ZBTA 2GGIA 5E9XA 4LCRA 1XFBA 1G01A 4G5DA 4NJGA 1Q66A 1ZBVA 3WH9A 4RPPA 3N2TA 3R11A 3GE7A 1QPOA 2PFHA 4IIFA 3WJXA 1EFZA 1TZ7A 4JYFA 3L4WA 1PO9A 3W7JA 4NZ5A 4ZXOA 3HGOA 1EO7A 3IRDA 3WLNA 1X1ZA 2XIJA 4Z2IA 4C6MA 2GUUA 1D7KA 1J93A 2HBXA 3SFKA 1EC8A 4N2YA 3UZWA 1PKLA 2QJJA 1HL9A 3W2KA 4LAZA 2QDHA 1IEQA 3GDLA 3PG8A 3D0CA 4JOMA 4EE9A 2P1FA 2W92A 4EPDC 1XLCA 1G7VA 1GK8A 2DVXA 1D9EA 1OY0A 2VC6A 4IXHA 1GQLA 2ZA3A 3ARRA 1XXXA 4DF0A 5E70A 1QPNA 2ACQA 5CLTA 4L4MA 4Q6XA 4HHLA 1J18A 3KEHA 4HTBA 1TSIA 3W76A 4IJRA 4AMAA 1HZYA 3EX6A 3QGKC 2CLPA 1TPFA 3LSBA 3CAKA 2FZMA 4CD6A 2R1MA 1CGUA 1VYSX 3AALA 1DL3A 5L9FA 2PC4A 3T0TA 1UYQA 4MPQA 1KXHA 3VOIA 4E3VA 5LA2A 4Y8EA 3QGVA 3NZQA 5D37A 1DWGM 1GOXA 4EF8A 5JUVA 4JQAA 4FF5A 2ZX7A 1UC4A 1QFEA 3K4AA 2FFCA 4AZGA 3Q58A 4F0KA 5C70A 2XVGA 3AIRA 1JCXA 4M80A 3PBVA 3EWUA 2E77A 2CLHA 4RE4A 2BASA 1JCTA 1Z44A 4XTIA 3PUOA 5JIWA 3SGUA 4XSMA 1J5SA 1JI2A 3ARXA 3RR1A 2O7SA 3OZMA 1ITXA 1OCJA 1AG1O 1ICPA 3ONCA 4JNMA 2R91A 3VOGA 3DHFA 3VGHA 2OQYA 3UYCA 3FY1A 3IPWA 1A5NC 1IT7A 1R8LA 3KOZA 2W61A 1QW7A 4C6EA 3TOYA 1EP3A 3O8AA 3A4XA 1V0NA 2FKPA 2PDGA 2L5HA 1OFEA 3BJSA 2QJGA 3N9KA 2R1KA 3AUOA 3AHXA 3UESA 1EBGA 4LUTA 3TC7A 4JTSA 5M3WA 3VIMA 2DFAA 2E4TA 1ICQA 1ISXA 4B2DD 4H6QA 4JFSA 3H21A 3HPXA 3FEQA 4MPKA 3LK6A 3H2AA 3CZGA 3ZT7A 4CVUA 4YYCA 1G1YA 1VENA 4GO9A 4DWSA 1GKPA 2B81A 4UFKA 3W1UA 5TD4A 2OR2A 3LX9A 4YVXA 3TLLA 3DG3A 3UXKA 5XIAA 5EFDA 3AS0A 3CHDA 4MY8A 5C9UA 3EWDA 4FR1A 1NTHA 1WYIA 3KTCA 1EJWC 5GJPA 3ARYA 5LNWA 3NYDA 3P8JA 2DT3A 3LS9A 2V68A 2XFFA 4JTUA 3LPFA 1F3WA 3VX1A 4FZIA 4JHZA 4RNJA 3BG5A 4PA8A 1E0UA 2ZUSA 2G50A 4D6GA 5I3FA 4BJHA 4D6HA 5HMEA 2V5DA 1XJBA 2CWXA 2X0SA 4JIEA 4JTQA 3CC1A 4UTHA 5EA9A 5EYWA 2YCKX 2NZLA 4C6QA 3IRSA 2W6RA 2RHGA 5FESA 2WAGA 1FOBA 4IPLA 4MNJA 2NV9A 2NVCA 4MZ8A 3U2EA 2NV2A 3MY9A 4PEKA 3PBMA 1H7XA 3FN9A 1A0EA 1PVNA 4LBRA 1UWAA 5HMFA 5C2GA 2VUNA 2FH6A 1NELA 1E4MM 3NAVA 2VWSA 3W82A 5BXPA 1I75A 3DYMA 2PWFA 2WBKA 4CNSA 2HPIA 4K8EA 4JX6A 1V3JA 4F9DA 1H7OA 3QPYA 2VD9A 1BTCA 4S3EA 5CC7A 2CHNA 2ZE0A 2VEIA 4KGJA 3URQA 5K4XA 2RKXA 1XLEA 1W3IA 4XK2A 3SJNA 5A2AA 1RLDA 1EWEA 2ZTKA 4I9JA 3VA8A 3ITVA 1Q5MA 2RDWA 4LVFA 1D3GA 1EX5A 3D47A 3P14A 3UNTA 2QKFA 1JZ7A 1XI3A 3BMXA 1MXDA 2GUYA 4O1EA 4XWUA 2R1PA 4PGLA 3LDVA 3DU0A 2WHJA 2HV5A 4IX0A 2VEMA 1KKRA 4ATDA 4CGTA 3W7RA 3L21A 1V6WA 4NRSA 2ZCGA 3EDEA 2WC7A 2BMBA 3N18A 2ON3A 3LD5A 4YJ5A 4LGXA 2YX0A 4EPEC 4BA0A 4C65A 1MSSA 3N11A 4IP4A 1IGWA 1W17A 3LPPA 3TCSA 2XVKA 4ZGYA 4B9ZA 3EB2A 1KFJA 4Y96A 5E0CA 5I7GA 4HT3A 2I1OA 5J8LA 1QW9A 4UZUA 5AHFA 3EKZA 3HIJA 4G56A 4IP5A 1G9HA 1S2TA 3WDHA 4Q8TA 4UQDA 4B91A 3TAKA 3T09A 3CMGA 3BW3A 2HBVA 3CAVA 1ZY9A 3OLDA 3S2JA 1P7TB 2DW7A 2YXGA 1RAKA 1TPWA 3WUFA 4FX6M 3A4WA 3CB8A 5I2UA 3GDKA 4HMNA 3OIHA 1EDQA 4QAWA 2E5DA 1ZAHA 3AIQA 3GWQA 5FL1A 2GWNA 2OOGA 7CGTA 1E9LA 5HWJA 3W2MA 1GPWA 5HQMA 4F0HA 2OG9A 3BMVA 3GNNA 3QEZA 1KD0A 1H11A 1P0EA 3GYEA 1UH2A 4B5SA 1SJBA 3QF0A 1IEXA 2VKZG 3MKCA 4LF1A 1JQVA 2AAAA 3L5MA 4TTGA 1PZ3A 2ATSA 2JGYA 1TWWA 3UA4A 3GH4A 4DAFA 4IGSA 5H8UA 4FR6A 9XIAA 1CGXA 4ZMGA 4ZO7A 4XD3A 1G4PA 2PDLA 4GWEA 4ECLA 4OUIA 4WDWA 3C61A 2GGJA 4X61A 2OWXA 1W3TA 3NOEA 5C7VA 5CC5A 2YDRA 3NZPA 5GNZA 3W7OA 4HGXA 4MF4A 2QV4A 1EX1A 2AMGA 4ZQOA 1O66A 3TVAA 4DVOA 3MMUA 4GVFA 4S3BA 4JN8A 1UR3M 4C6NA 3KXQA 3PB0A 1PAMA 1UWTA 3DI0A 5H2ZA 1LOLA 2OZ3A 2YBUA 4AHOA 2VGGA 4F2UA 3W72A 2F84A 1XP3A 1AL7A 6ENLA 1I6NA 4DYEA 3WBEA 2I56A 3EOUA 3ANVA 3OW1A 5D2XA 1Q2SA 4QEEA 1MDRA 1NQKA 1RUSA 4D1JA 4RNFA 5T9BG 1VFMA 3VNYA 3BAKA 4MVAA 3WK2A 1XQLA 3TTEA 5BOFA 3SN0A 3R79A 5TBOA 3UY8A 3ME3A 4NAEB 4EPKA 4TX9A 5HMSA 4FNSA 5AYIA 1X97A 4XD4A 3M0JA 2IQTA 3RX3A 3JR2A 3GQYA 7XIMA 3TX9A 4FXFA 3W29A 3VGFA 3KVKA 1AW1A 4P8UA 2WXDM 4EKJA 4D2JA 3EPOA 4OU1A 3PZQA 5CEWA 1E72M 4RJEA 1HF6A 2Y63A 3ITTA 1CLXA 1UZ1A 1EYWA 3OVRA 2DUXA 1TRDA 3OVQA 2CLKA 3E2QA 2EHHA 2AKMA 3EDJA 2V5KA 5CZKA 3N15A 3MI3A 4I5UA 4QQUA 4DJED 4UTWC 1EJ7L 1Y5XA 1WZAA 2G3IA 1W1A1 3H2NA 4O18A 1C8QA 4L64A 2DSKA 4MNMA 4FNTA 4LC6A 3M6DA 4JTEA 2AL1A 4KIEA 4H83A 3SIMA 1IIHA 4O1CA 4U3AA 3NZGA 1EOMA 2RDTA 3CO8A 4QLLA 4C7FA 3R1ZA 1RY0A 3VKAA 4IIGA 5KZ6A 2QYGA 2QEZA 5HWMA 3L2MA 3THDA 4PUNA 3W7LA 4IX2A 2Q6ZA 1A5SA 5LGXA 5D02A 1SJCA 1PXGA 2IS7A 4U4MA 2FPYA 2W3ZA 3UVAA 3RAOA 3V75A 1TQXA 4AWSA 4MWAB 3F5LA 5KTLA 2E8YA 1TE1A 3QQ0A 3HGSA 3WUBA 1JCMP 1U1HA 2D0FA 5DMNA 3R5EA 3F4NA 1NFBA 1B3WA 1VHNA 3NQ8A 3STGA 3MZNA 3WFLA 4BS0A 1HX0A 1BF2A 1W54A 1ZGDA 4LNYA 3M64A 3F2BA 4F66A 3P5ZA 2E0PA 4LANA 4DM2A 4IICA 1KM1A 1NWRA 3CZEA 3KTSA 1QO2A 3MWCA 3TTOA 4H8HA 3HZ3A 3COTA 1VZWA 1BKSA 4MNLA 3GHSA 2W9MA 5FF2A 5LHEA 3H23A 2RFGA 1V6XA 5IBXA 3VDHA 4NSBA 5AC7A 1QHPA 1NFGA 1BYAA 4Z42C 3NCOA 1O60A 1UASA 2CBVA 3MSYA 4H19A 5D2TA 3W73A 2QF8A 3L2LA 2IPGA 2BWGA 4DI9A 3NL6A 2R14A 2PDXA 1P7TA 4LTSA 4QDWA 4KH2A 3WENA 4GGBA 3WQOA 3VXGA 3MP3A 1LLZA 3LEPA 4ATLA 3H2FA 2QDGA 3BXWA 3QKEA 4HMEA 5E93A 1LORA 1OYCA 1U30A 3QGAC 1CTNA 3O63A 4DBUA 1TX0A 5IFPA 1PS9A 1LL4A 4CN6A 3FS2A 4P2VA 3DAQA 3UNDA 1VBHA 4MDOA 2E9LA 2FZDA 3C4UA 2VEKA 4E5TA 3QTGA 5FF0A 2AQOA 1TR1A 4CQDA 2EF9A 2GDVA 4CN4A 4DM1A 8A3HA 1XM3A 1M1BA 1KRCC 4YIWA 2VZUA 1WAUA 2H3DA 3MUCA 4IGHA 2CYGA 3UD6A 3NIYA 4R7OA 4LUJA 2JEQA 4LUYA 3VNKA 4X2RA 4W89A 4A21A 3KL3A 2DH3A 3C56A 2G3MA 2VOMA 1ZQ5A 3LENA 1XLKA 5DRIA 2G97A 1NDVA 1P0BA 2FPTA 3EXTA 4LB4A 3N6JA 3T2OA 3N1AA 1DJHA 1YLVA 3UG5A 3RPDA 3QW3A 1US2A 4GY1A 2XVPA 1V6YA 1Q7QA 1XLFA 2H8ZA 2VX5A 2WMIB 4HMCA 4A4AA 1IEVA 2DIKA 1VFFA 2W27A 4HK6A 1A0CA 1FTXA 3CPRA 3IVTA 4GCXA 4WEVX 3E2RA 4Y90A 2D0HA 4MADA 2QPXA 3E3HA 3V5CA 1I0BA 2V8ZA 3MB9A 2WZHA 4C6KA 4MWAD 3DUGA 3W74A 4PMVA 3NXLA 4GUJA 2WSRA 4US5D 3KDNA 2X2GA 1MFVA 4KMQA 2NSOA 1KQZA 3O07A 1XBVA 3WK3A 3GBDA 4GFSA 1JAEA 1PPIA 2BHZA 1J0IA 3DHUA 4L7ZA 1TR9A 2EPMX 4OQVA 4Z0SA 2BOGX 2GYIA 1CB2A 4J27A 4Z2LA 1DHKA 3LPGA 4XKYB 2DSZA 2X0HA 3CL7A 2HROA 1OB0A 1W1IE 2MNRA 4V2XA 1ONRA 3WF4A 4K39A 1REQB 3V3WA 3B9DA 4DO7A 3CJPA 4JZ5A 4L80A 4LFYA 4DELA 2JKAA 1N2VA 3DZ1A 3U2OA 5FJUA 2QCCA 4INFA 3IJLA 3BTNA 3FV9A 1QUMA 1E3ZA 3TZNA 3CHEA 4J3WA 4OTKA 4C6JA 4UTKA 1LLOA 3BWWA 4DXXA 2P8BA 2V67A 3MCMA 1VBRA 4M1BA 3IJ6A 1E9IA 1T8QA 1TV3A 1DHPA 3VDCA 2DZUA 1WXYA 4M0XA 1E1FA 3AS2A 3TYAA 4HJFA 2ZUUA 3VGEA 3DYOA 1EF3A 3SCWA 3WLJA 3RPTA 1OIFA 2YYUA 3SR7A 3AC0A 2I57A 1K8ZA 3WK1A 3GVQA 1Q63A 3M0HA 3GKAA 4AIOA 3I6RA 1IE7C 5BNKA 3C2EA 3M9YA 4EPBC 4EXQA 4HCDA 1ZFJA 3W7IA 4GYPC 2QUNA 3KS6A 1J6PA 5F7UA 4IGMA 1WDWA 1SW0A 1NWSA 3SCTA 4HU0A 1XIMA 1H50A 1XW8A 4U28A 2TRSA 4G1NA 4X2PA 1FCVA 2YSWA 4NKCA 3NPVA 4JCLA 1V5XA 4DZHA 1PZ1A 4IZGA 1ME8A 3ITXA 4XB3A 3DN5A 1KFWA 3OA5A 1HT6A 4EAYA 2ZRVA 4AMCA 2DSUA 3KLLA 4S39A 4CCDA 4CEUC 1ML1A 2FJUB 4DAIA 4QTGA 1Q7ZA 1TPVA 5ABHA 1BYDA 4OV4A 2ZICA 1ZL1A 3N29A 4S38A 4AZCB 1KLZA 1AJZA 4ACZB 2GJXA 2Z1BA 4ZVJA 4AD3A 1KLYA 3M6YA 1WDPA 4IPJA 2OSYA 1AQMA 3KFTA 3GSMA 1H5YA 3CEPA 4AD1A 1TPH1 2JGQA 7A3HA 2CZFA 3E9AA 3K8MA 1GZJA 1HKKA 2IKHA 3OHIA 3WELA 1TA3B 2ZRYA 4UTTC 1R6WA 2Y62A 3SRKA 3TW7A 5HWNA 3R8RA 1KGWA 3PFMA 1AJ0A 3QHMA 5CAHA 1KV8A 3ITCA 3HN3A 2OYKA 3W01A 1QU4A 4TUFA 3GRIA 1JZ5A 2CLOA 1QI2A 3EOLA 1ALDA 3G3MA 3U2ZA 2PA6A 2C71A 3OA3A 2J8GA 2FGLA 1DTNA 1OFBA 4P7RA 1K9FA 1ZJAA 1QI3A 2Z0IA 5IM51 3NSNA 3IARA 5FA5A 1W2VA 4CQAA 1FWSA 2ABBA 1XLBA 3AIUA 4L1GA 2ABAA 3BSMA 4NASA 4JX4A 5D03A 3A22A 2YYTA 3UWEA 2OCZA 3RLVA 2VDGA 4N9CA 1VH7A 5EGRA 2EO7A 4NG3A 5CPLA 2XFYA 3VIHA 3PN8A 2H9AA 3LLDA 4S3FA 3U3HA 3MO4A 4GQ0A 3LERA 5AC8A 1ITCA 3CQHA 3UZ5A 3VAVA 1CIUA 3EDDA 3QXBA 4BFAA 3CLWA 2QQ6A 4AZIA 4LAUA 2WMIA 5IOBA 3F2CA 5JBEA 1LL7A 3B4UA 2OXNA 2QT3A 1VD6A 4D8LA 2QCFA 4QDPA 1MZHA 1GONA 3C3UA 1XV8A 4N6EA 1V3LA 3TWBA 2AQVA 3CQJA 3FA3A 4NP7A 1W9VA 3QM3A 3V0TA 2HRWA 3AMKA 6TIMA 3URNA 2ASHA 4GO8A 1NARA 4L6DA 2CETA 4ZO8A 4JIRA 1KM6A 1W5MA 1CB7B 2ZX8A 5FIPA 5I07A 3SY1A 2I16A 1LRTA 3PZ9A 3GTXA 4W85A 2DDXA 3L4TA 3AYRA 3G1RA 4KRTA 4HZ6A 4B5UA 3W7MA 4UIOA 5PTDA 3NVDA 5FEPA 1CT5A 1UR2A 3C8NA 3QPZA 3R12A 3W26A 4DJDD 1A80A 2QMJA 2WVUA 1FHUA 1RV8A 1BGAA 2J27A 3NZ1A 1UIPA 1N8IA 1GORA 2PTXA 5BRBA 1OZMA 2G0WA 1AA1B 1IHIA 4GINA 2NVAA 4GIAA 4GIRA 3LLFA 3WNNA 2WVTA 4NJJA 1CX9A 1H5VA 1XUUA 2ISWA 4QJ3B 2WSYA 2J7CA 4Z1YA 2WHLA 4HOWA 2NXGA 1TV8A 3RFAA 2ZZ2A 3M5XA 1YPXA 1OM0A 5E6ZA 2OTDA 3OVGA 5ABTA 1LROA 3IJ8A 4IP7A 5EMLA 3T07A 4MJ2A 5BMXA 3WQ4A 2HXUA 1R7AA 3U57A 3LI1A 3NWRA 4RDYA 1LDCA 3GVVA 3PPHA 1XSIA 1A49A 1JRBA 3WLHA 2XYLA 2PURA 4LV4A 2CITA 4I3GA 2D2HA 3KBNA 3VNMA 4BY3A 3L5LA 3TJIA 3QLDA 1Q6GA 4KRUA 3WUGA 1QXLA 4PMUA 3TTSA 3VCRA 1G7UA 1UOKA 3EXRA 1O4UA 1Z3NA 2GJRA 2A1YA 2INZA 2CPUA 1TMLA 4ALDA 1W2PA 4C60A 3AO0A 1F6YA 2NVDA 1H0IA 3N4EA 3LGGA 5HAOA 1A5OC 3SUSA 4D9PA 2HJPA 3SAZA 4Q8MA 2AGKA 4GCAA 3EMCA 3PTMA 4L4OA 4L9YA 5LZLA 3DFQA 4AUBA 1OGBA 4AZCA 1FP8A 3QV8A 4UMCA 5BOOA 4GE8A 4RZBA 1ZHAA 1RXOB 3Q94A 1Q7MA 4LQ1A 1EP2A 4MNKA 1NEYA 2O0TA 2OO0A 3TLQA 2VT0A 3VGBA 3CV6A 2PEVA 4X22A 4LUIA 2J9XA 4YVVA 3XINA 4ZSTA 2GSEA 4O28A 3HPFA 1TPC1 2PU1A 3KTXA 1OFDA 4ZA0A 1H51A 1VFUA 1KCXA 2YZRA 4LS2A 1PB0A 3VNJA 5C7HA 3HV8A 3S8HA 1H62A 3P74A 3ZLGA 1ISVA 3M47A 1I0DA 1LOSA 4IG2B 1JCNA 5AZ0A 1L0PA 4W7VA 1S38A 1MQQA 5MKGA 2XN0A 3GO2A 3RJXA 3GTHA 3TSMA 2Z1SA 1UP2A 4ATWA 4EACA 4GX9A 3G1XA 3W1MA 2X7WA 2BGSA 2WHKA 1E6QM 3FYOA 4LX4A 3NSMA 2EAWA 2XH7A 1HVXA 3L4VA 1DKWA 4U31A 3GB6A 5G1MA 3UVIA 2ZX5A 5HXMA 2Y85A 4O0ZA 3CEUA 1EIXA 2HK1A 4XG1A 1FWJC 5CAKA 3RLGA 4DUVA 3NL3A 1CDGA 2I9EA 3LRLA 4TO8A 2IKIA 4U5IA 3BSHA 2RGLA 1F8IA 3FOKA 1R3SA 5A8MA 1MW0A 1R3VA 3O3RA 2FB3A 5DMYA 4JQ4A 4K8HA 4LBUA 4H8VA 2PDYA 2MUCA 2WSKA 3QBUA 1N7KA 4FO4A 3N2CA 5TNVA 1HO4A 1NDZA 4NU7A 1J2WA 3NPUA 2I5QA 3W28A 5FAJA 1WUEA 1E71M 3ABQA 4GZ7A 5HNUA 5I0DA 3TNBA 4LXFA 4NX0A 4HU4A 4ASTA 4MSSA 3SB0A 4QJ5B 2AL2B 3H55A 3N19B 4IUOA 4YTSA 2GQ8A 3RNDA 2PLKA 1C8YA 3SQMA 4RX0A 3S5OA 1WCGA 2DUZA 4ROPA 3Q2DA 2OMAA 2W79A 2ZRUA 1JL8A 1XIBA 3WDIA 2NXHA 4GJIA 2GK1B 4FAMA 5ABFA 1W9XA 3WCZA 2PDBA 3C2RA 5LNUA 3G77A 3R8GA 1OFPA 2OSWA 4C5YA 4BR1A 3CZLA 4KWWA 1GG0A 2CCRA 1JRCA 1EJTC 3MYPA 3LNPA 3TP4A 4CQ9A 3B3DA 4KWOA 1ZJIA 5KITA 1WNOA 1PIIA 3WD3A 1LTDA 5DBTA 1VIZA 2TMDA 2DZWA 4ZB2A 4F0LA 3CAQA 1FDYA 2NW0A 4HIBA 3NO1A 3O16A 2VQUA 2P53A 2RGMA 1FWDC 2OEKA 1NSJA 1IXPA 2WK2A 3O7UA 2ZVRA 1XD0A 2C6QA 3BLOA 2QMKA 4AIBA 2GJNA 4L61A 3SZ8A 3PPFA 5KZDA 3KE0A 1NJJA 3T55A 4FIRA 3B8SA 1HJSA 2DSVA 1YPFA 1L6FA 4HPNA 1Q6LA 1VPYA 2DSWA 4PTVA 2WLZA 4E4FA 5CSUA 1Q65A 1XLGA 1J01A 3AXKA 2HISA 3SY5A 1SW7A 2UY5A 4JNYA 1G4SA 3I3EA 1EA9C 1Z9AA 2OX1A 3BARA 2PWUA 3GG8A 2R1NA 2YJQA 2VFEA 2V9DA 2C7FA 3HGJA 4EVZA 3QQWA 1TWIA 2F6KA 2CLFA 4R7WA 4U2YA 4Q4KA 5M17A 4L9XA 3UYIA 4DLMA 1SZNA 4PMYA 1QNOA 1EWDA 8TIMA 1SMAA 1KGUA 1EHAA 3LBOA 4NZ4A 3QC3A 1W3JA 4WKAA 1KCLA 1EB3A 1H61A 3VD5A 5A6BA 2ZUMA 3L4YA 1F6PA 5CGTA 4QCEA 3I10A 3GFXA 1DJZA 3W7QA 3BPWA 2ZRZA 2RAGA 5HA7A 4HSNA 4B5VA 4IG2A 4B3KA 3CV1A 2WPGA 2FDMA 4I6VA 4K36A 2A3EA 1IWBA 3R6IA 2CU0A 4V15A 4U33A 2HS6A 3VC5A 4V28A 1DIOA 4FLOA 4MZ1A 3TU9A 5LKYA 3KL5A 3ABXA 3OG2A 3N9RA 4TQTA 5DELA 4OOUA 1J8VA 4OFCA 4FA3A 3EDKA 3SSZA 2OO6A 3ZLHA 3STFA 1CGWA 1DPMA 3FYPA 2QPSA 1RP9A 4L5ZA 2DZXA 1UH4A 2EJ1A 3WLMA 5CCZA 5BXTA 1B2YA 4HSOA 5AFDA 4HYWA 4JFWA 1BRLB 1TFVA 1QNVA 4DO4A 3W1RA 5CJNA 3W2UA 3L66A 4ZBCA 3LRKA 4OE7A 1PYFA 2WYSA 2YBTA 3R0KA 4W93A 3WH8A 3CUFA 1R30A 3URBA 2FHBA 2VFFA 1X8CA 4YTRA 1CXKA 1XD1A 1Q6OA 3HG2A 4WY0A 3W71A 3R10A 1UR4A 3LQLA 1FP9A 3O06A 5IFTA 4GRSA 1O5QA 2PF0A 1HJXA 2ZRXA 4AHPA 4DBDA 2J62A 1U5JA 1YBQA 2NV1A 2YFOA 4AYSA 3NEHA 1SFJA 1ZU8A 4GBUA 2Y7FA 3M0LA 1S5MA 2X8RA 4R5EA 2D73A 3EB4A 1K02A 1JPMA 4QS5A 3DFSA 4AXKA 3RRAA 4HB7A 2E40A 5C55A 1AZ2A 4PRRA 2IQDA 1UD5A 1TTPA 1YTKA 4DWSC 5DMMA 1EH9A 3MWAA 3CBWA 3CUJA 2D20A 3CNYA 1I2RA 1D8WA 4LV9A 3AS3A 2O56A 3OB8A 1GYNA 4AZ7A 3WYZA 3F4DA 7TAAA 4AVNA 4CCEA 1MNZA 4UQCA 1WE5A 5HJLA 4N42A 2PBOA 1K8YA 4DEFA 1B90A 1QPQA 2ISDA 3ALGA 4HCHA 4WJXA 2VCAA 3WLQA 3HQPA 3EEGA 3RCNA 1UBSA 1M7JA 2PPGA 2FZ9A 1VYPX 3AI0A 3WQCA 4EWND 2VFDA 1W91A 2WJDA 3LCIA 2GGEA 4QNWA 4JIQA 4Z17A 1UD6A 4YLWA 1MUMA 2Y5JA 4AEOA 3G3DA 1EZ2A 3A4JA 1EHNA 1C7TA 2CHRA 2PWGA 3B4YA 3BJTA 3L0GA 2ONEA 1J0HA 3CS2A 4F3HA 2EG7A 3TYBA 2QHAA 3IGHX 3LQGA 3LBMA 5EBAA 1GWJA 1OK6A 5LSMA 2E6AA 4GVGA 1UWRA 2JF7A 3WNLA 3KDOA 1Q85A 4AD2A 1W1TA 4J7RA 1W3KA 2CLEA 1KGXA 3OODA 3M7SA 3NL2A 5LIYX 1H2JA 2XH2A 5FJOA 3UXAA 4A2SA 2Y8KA 2R82A 1C8VA 1J10A 4JS3A 2ZC1A 4B15A 1RCOB 4UQBA 1XLLA 1JF5A 4DB7A 3ITOA 3PJTA 3VM5A 4ERIA 4O1DA 4BQ4A 3VM7A 3SIZA 3WQPA 2XPKA 1TTIA 1WPCA 4X9SA 1DVJA 4GC4A 2ZXBA 3W37A 3BQ6A 3HM7A 4R9OA 3GU9A 1QO5A 3FGCB 1ZNNA 2NXIA 3UG4A 5RUBA 3PHAA 4ZOEA 4RE2A 1VJZA 3GU1A 4RDZA 4N0RA 1VHCA 3IIOA 3THCA 1WKFA 1E4LA 3W23A 1R7OA 3N17A 1UZ4A 1W5OA 3WN6A 3EA3A 3TC6A 1C8XA 3SM0A 5JBDA 2PBGA 3PG9A 3UJSA 3OGRA 1FWAC 3I7SA 3IANA 4J3XA 1XH1A 2CERA 4NAFB 2HK0A 3WFAA 3MMDA 5C54A 3EOSA 3W1NA 4Q32A 1OX4A 1QNPA 4L1WA 1HJQA 2C0HA 3G6LA 5HINA 1LG1A 5C0QA 2P10A 1O7AA 1I2PA 1V3MA 3WJSA 3VDBA 1KR1A 4MIMA 4TV6A 5BCAA 4UR9A 4YTTA 4AEFA 3GIYA 1BRLA 1EUNA 4F9JA 1V4YA 5BU6A 1OC7A 1QMLA 3T05A 4ENLA 5DX7A 5CXPA 4RKAA 3HV9A 1S5TA 1NP2A 3QZAA 5CBBA 1AQHA 1UWSA 1POJA 3M7WA 1JQXA 3CU2A 1O68A 3D3AA 3P93A 1I9CB 3VGGA 1KW1A 3P81A 4U10A 3WJYA 3M0ZA 3CZJA 1A5MC 5B7ZA 1TREA 4DYJA 4LAKA 1L8PA 3M07A 3MS8A 4KWUA 3P84A 3W1PA 4N6FA 2J7HA 1HG3A 4GQBA 1HKWA 3TXZA 4ERGA 5I77A 4H9VA 2XG9A 1XLMA 2WPBA 4BHYA 2J6VA 4PL2A 2BX7A 3UPMA 1GW1A 3VZZA 3KZSA 4D71A 3A5VA 4IMFA 3EOEA 4EOUA 1QR7A 1R9XA 1HW6A 1S1PA 1XYCA 3BICA 1GJUA 2QGHA 1SJDA 3FA4A 1CGVA 1DJYA 3W7KA 1GVEA 2GQ3A 3CH0A 3CPGA 2EG8A 1U1JA 4O50A 3B03A 4MB1A 3PBYA 2O55A 3KAOA 4JTLA 3PZIA 2ZYFA 4R88A 2V30A 2JFEX 1W8SA 3VINA 5T26A 3MO7A 4TVCA 4QJ1A 1GTEA 2JEPA 4FS9A 3MANA 4JNZA 4ZENA 5ABGA 2PDHA 3FVMA 5HNTA 1AMKA 3N14A 3STEA 2V38A 4PH6A 1PE1A 1FQ0A 1FWNA 3A4AA 2PDUA 3O0KA 3RLUA 2DW6A 3SGGA 3CO4A 2XHYA 2BHYA 3J7HA 3WBXA 4HNVA 4FIQA 5CPOA 1JUBA 4PCPA 5DCBA 2X42A 4OUEA 3CT7A 2PGWA 3OBKA 3W6LA 4MUPA 1JCYA 2J9ZA 4F40A 1Y5WA 5CQ1A 4D6CA 1UJPA 3LOTA 3A21A 3OJGA 4MTVA 1W37A 3M16A 4MY9A 3TW6A 3T0DA 3FKRA 3T6CA 5G4EA 3PJUA 5A94A 3TNOA 1L6YA 2GGGA 4GHRA 1J9YA 5D8WA 3UQNA 1VRXA 2OOFA 2G3NA 3K4DA 3WJZA 4GLEA 1ZB5A 1S2VA 1PTAA 4CQ8A 4HD5A 3F4WA 4O11A 4W4QA 4RNIA 5D2YA 1W1PA 4E2DA 3WH6A 1QI4A 3GKFA 5AECA 1TJRA 2E09A 3CWHA 4HZ7A 2XU2A 1KCZA 1FHLA 1T41A 2WSQA 5E09A 5IDZA 3U7BA 5CBIA 3RX4A 3BLDA 2YXOA 3IJQA 2ZUNA 3A23A 1ISZA 1S39A 3ISIX 1IT0A 1YPIA 4HPJA 3N34A 4WRHA 2QXWA 2QJIA 1UCWA 3KOYA 3RM4A 1FDJA 4FLQA 1W5PA 3UCQA 2YGYA 1UQYA 1H1ZA 1E5NA 1Y7VA 3WD0A 2ZZ7A 5DFAA 3IIPA 3NDOA 2IKJA 1E9YB 5I6SA 3VMNA 1W5QA 1XRFA 3GW0A 2PWEA 1YADA 1ONXA 1FCBA 2D0GA 2XVNA 1LBMA 4AC7C 1FWIC 2VRKA 3NOYA 4O8RA 3E0VA 2DZPA 2A6LA 1E1CA 2QCDA 4Q4PA 1FWHC 4YVPA 4IIHA 4DRSA 2J4GA 4GKTA 4UQEA 3FNDA 3AXIA 5I00A 2X1SA 4IJBA 4WDUA 2FH8A 3VE7A 3DCPA 1UKQA 3FHAA 4UWMA 5CJMA 1VFLA 1F4HA 5DMLA 3PB2A 4UNKA 4DXVA 1N8FA 5M03A 1SMDA 3MSDA 1TV4A 2VL4A 5CG0A 3BAYA 5IBXC 1XQKA 4JL1A 1X8FA 1UIOA 1PHQA 3BUVA 1XYAA 1XCFA 4CQCA 4JN6A 5HR7A 3TDFA 4KT2A 1TV7A 3NGFA 1B3YA 5A95A 2PRMA 1W32A 3E49A 2REQB 4Q8WA 1VBUA 4RPQA 3RLHA 2VFGA 1PCKA 2GJPA 1X7IA 4QCFA 4JKMA 1E40A 3H4GA 2GPTA 1FHDA 2CIPA 5AVHA 3Q67A 1GVIA 4YXGA 2CLIA 2GZXA 4A6GA 2J75A 4YTUA 3LM7A 1LRNA 5M2FX 1UWQA 5JU6A 3VIPA 5I3HA 4QBXA 1GEQA 3GH5A 1PZ2A 1SVDA 4UUIA 3SQSA 4GG9A 3ABZA 4S3KA 1UD4A 4BI6A 2EPOA 4AG0A 2NSXA 3W24A 4GJJA 1P1XA 4CU8A 4XISA 1SR9A 1GQKA 1OCQA 1FY6A 4FOKA 3S1GA 1KB3A 1CNVA 3UW6A 4H3DA 3TYEA 4B3ZA 4GYJA 1HTIA 1Q8JA 3V35A 3ICJA 5BRQA 3QR3A 2YDAA 2X05A 3UWQA 2Z7KA 4M6PA 1CGTA 3TTQA 1WDQA 4CNTA 3L67A 3VD7A 2ACUA 4WQ6A 3P82A 1FWRA 3EX1A 1TX2A 3PTQA 4YNGA 4O13A 3AJXA 3B0YA 3H6OA 1NH6A 4L65A 2F6UA 4CU6A 4G2DA 1UOZA 5DN1A 4L1XA 1PKMA 1GZGA 3UU0A 5JQ9A 3INPA 1AJ2A 1QOPA 1S5VA 3ZZ1A 3W0KA 2I17A 1JNEA 2VXNA 4Y9NA 4RR4A 1LQ0A 3K46A 3BG3A 1FFQA 4RE3A 2A6NA 3GXFA 5MF5A 4FLRA 4AY8A 2GOUA 3A3XA 4PCSA 1X6LA 3VX0A 3CIWA 1TTQA 4HPXA 3M41A 4B90A 1GQNA 1Z42A 2NQHA 5E0FA 3ARVA 1DJXA 4C6DA 5CC3A 3EPNA 3PZUA 1XKYA 3IUHA 4ZE4A 3KVLA 3NL5A 2VZTA 1CXLA 1KFLA 4REQA 1GVYA 4PZVA 1E70M 4AZHA 1BPLB 3ZOAA 4UC5A 1OX5A 3R94A 5REQB 3IV8A 2VELA 4M81A 1YMYA 4J2PA 3GZ3A 4EAMA 2WCAA 4ADTA 2OGJA 2YA1A 4XBKA 4GQGA 5HANA 4N9EA 1BG4A 4UFLA 1ADSA 2TSYA 2WBGA 2CZVA 1DXEA 3QYQA 4IMAA 5FAGA 1KCKA 4GZIA 4NYUA 1TPB1 1J0JA 1QOXA 1UWIA 4Z2JA 4FHAA 1GOMA 3HPZA 3W70A 3K1GA 1BVNP 1I2NA 2CLLA 3TJ4A 4GXPA 4MWAC 1MRAA 3OZYA 3RITA 3L4UA 4E38A 5G1TA 2WV8A 3BZJA 3TYUA 2A5HA 1VF8A 4ICNA 3LTYA 2Q09A 4Y9MA 1J6OA 3QOKA 3QYSA 2IUZA 1KM5A 4O19A 4QS6A 3TV8A 1OGGA 5JMUA 5GJNA 1ZENA 4KWSA 3SUVA 3LGDA 2QCNA 1BTMA 4HHPA 3T1GA 6XIMA 3O6CA 5AB3A 1KA9F 1TIWA 3DERA 4QITA 5IRPA 2WJFA 1Q4NX 4IPPA 2X09A 2Y7EA 2ZVIA 5E1QA 1ODUA 3TH6A 4LSBA 3V18A 4V1YA 4B92A 3HA1A 4ZTYA 5K9XA 3OGSA 5GJMA 3VD9A 4MKSA 4KFNA 2R24A 1IZCA 4D6EA 3VI2A 3I65A 1BWKA 5HQLA 3W88A 5EB8A 2AOSA 3CHCA 2VOTA 3K8KA 5KZMA 2AGTA 1TMQA 1TZZA 4XAPA 3E6EA 1IEIA 4L56A 1POKA 3W25A 4XZIA 4BQ5A 3WUEA 3EX2A 5I5RA 1AW5A 4WJEA 5BU9A 1HVQA 3KBJA 1WUFA 4Z2GA 4GY0A 3APGA 4WLCA 2OZ8A 3ANYA 4UTLA 4ZFMA 2WNZA 3KRUA 2QDDA 1RJQA 3EEZA 2DEPA 3OZPA 5HOSA 3LZ3A 2FPVA 4AQLA 4NY2A 1JZ6A 4W88A 1KRMA 4Z2HA 3WJWA 1RVGA 2VEGA 3GUGA 2A3HA 4B4FA 3S83A 4LY4A 1HKIA 3QV7A 1TPDA 2G4FA 1XKJA 2G4JA 4J40A 4W84A 3B8TA 3VFLA 3W1TA 3T08A 1DORA 3BW4A 5AVNA 6TAAA 4N02A 4MJZA 5DY2A 2CESA 4LUSA 1P6BA 8XIMA 2B7NA 3ENLA 3PZNA 4Q8UA 1WXZA 5BOEA 4TR9A 4Y8FA 4AISA 3OLEA 1E55A 3SFWA 3B8UA 4CN1A 2X41A 3TN4A 4GFIA 1J96A 4RNHA 5AOUA 3WQVA 5BRPA 4QE4A 5AHLA 4DJFA 2DZTA 4F79A 1H49A 5E5CA 4FB7A 4DPPA 3LA4A 4CCZA 1KRAC 4P61A 5C2XA 4QLJA 4X0VA 5AZ1A 3GXTA 4G6CA 1QBAA 2RDUA 4S3AA 3SUWA 4GNKB 4FSAA 3CPUA 1TE6A 1LUCB 3LHWA 4XZMX 1K7EA 2YL8A 2PTZA 3MC5A 1JDFA 1X1NA 3AXXA 5C8BB 1S3TC 2DVUA 3BC9A 4DBWA 2CBUA 5EL1A 1LJYA 3VD4A 2EEXA 4I9TA 1O1ZA 2Q01A 1PUDA 5BWAA 1DTUA 1BHGA 3WQ6A 4NI3A 5KZEA 1L9WA 4AY1A 4PMRA 1DYSA 1VFOA 1QAPA 3BLFA 4M19A 1GKQA 1Q8AA 5AYBA 3WX7A 4BI5A 4B16A 3RM8A 1VEMA 4H2CA 3DC8A 1HNYA 3I4KA 2WO5A 2GVEA 4PRWA 3P7YA 1Q6CA 2VDIA 3VE9A 1OG6A 2FQIA 2R94A 3OLIA 5FSDC 1S2CA 4AHQA 3OPSA 1JDDA 3RM9A 1KFBA 4JR5A 3I3BA 1RVKA 8RUCA 4RCXA 3T8QA 4DBSA 2QV5A 3GNOA 1IZJA 4HSHA 3HF3A 1B3OA 2OX4A 1UJQA 3OYZA 2E9BA 4MFDA 3S1UA 1B31A 4K3ZA 3SRDA 3U7VA 2X1IA 1J0ZA 2VZSA 3LUTA 4HN8A 2DPEA 4W9TA 1RZMA 1TB3A 4EP8C 4WY0F 1A50A 6REQA 2XINA 4HA4A 4KETA 3WD4A 3XISA 7ODCA 1JEZA 4WSJA 1ZCOA 4GMEA 1LWIA 2D2JA 4KESA 1JVNA 2QAPA 5JH1A 3MTWA 3DHDA 3TK7A 4JTJA 1OC6A 5CKSA 2XH0A 1J12A 2YOCA 4LALA 1V3KA 3DGBA 3TYZA 3W38A 1UUMA 4E8DA 2XGZA 2C15A 1TWZA 4W86A 3JVAA 4YL2A 1KO0A 1PDYA 1R9ZA 5EMUA 3P0WA 1ONWA 1US0A 2GJLA 2WVVA 3XIMA 3VOFA 3GTIA 3L65A 1IR1A 3IUDA 4IUGA 1JJKA 3AMCA 4GA8A 5I79A 4FX7A 3LNMA 2YPIA 4LVGA 2PAJA 1GKRA 3REQA 3AU2A 3L5AA 4DZIA 4GGHA 5C9WA 4ADSA 5LIWX 2Z27A 7TIMA 2E5BA 4JKLA 1CXIA 3LY0A 3BCFA 3PULA 3E74A 4ZODA 5DRCA 1ZBWA 1WX0A 3VZXA 1H60A 3N6QA 3WZ0E 4OBTA 3W7GA 4HTYA 1BXCA 3FAWA 4NHVA 5HJYA 1XIJA 3AZTA 3QHOA 3T2PA 7REQB 5CPQA 4PUMA 1HO1A 5DT7A 1DQUA 2J7BA 2WCSA 1EF2A 2VQTA 3A9BA 2D24A 3C2YA 2WM0A 1ZALA 4AD0A 4HA1A 2YFNA 4RK8A 3NQDA 3WF0A 2VX7A 3A64A 2G3JA 3NQ6A 4RDVA 5C2CA 2EKGA 3ZFHA 4DIAA 3UZZA 2GFTA 2OLSA 4KEUA 1LP6A 1M7XA 4J3UA 2HVNA 1O95A 2PDNA 3MV11 1NWTA 2P5NA 1OFRA 4J2MA 3A5FA 1DJNA 1W5NA 2ZZ1A 2XZ9A 2A79A 3W87A 1HFBA 2A21A 4ML4A 4AX6A 2YXXA 3WMBA 4LPCA 4LOCA 2J47A 4KFPA 4JTFA 1QHZA 1XLIA 1B54A 3E0WA 3MV01 4HU8A 4XIAA 1W1B1 3VNIA 2PZ0A 3GXNA 2P3ZA 3B8IA 3E96A 1AH0A 4AH7A 1AH4A 1UUQA 2G95A 1FKXA 4U2ZA 1VEOA 2BXZA 4WSHA 1XWYA 3MQTA 4J3TA 3NNTA 5A5WA 4QG8A 5DO8A 1XDLA 2BBFA 2YA0A 3M0XA 4H9UA 5XIMA 3CH9A 1JZ8A 2W91A 4A3YA 4F0RA 2UZ9A 3AIWA 3CTLA 5M5DA 2ZADA 3E0FA 4S23A 4HA0A 4JHOA 4LYPA 2PE4A 4KEMA 1FWFC 2VRJA 1VP5A 4PULA 3IS4A 3TROA 4D8AA 3AFBA 1Z48A 5A6LA 2VC5A 1BAGA 5CPNA 2PMQA 1PBGA 3TJLA 4LEQA 1IT8A 4IQEA 4DN1A 4XZLX 1JDAA 3E0IA 3SN1A 1W1YA 2DV0A 3M0YA 4O1AA 5D8ZA 5EMJA 2JIEA 3DFTA 4KGLA 2HS8A 2Q8ZA 4R3UA 3NXFA 3UR8A 4B4HA 2Y70A 5AYZA 4RUBA 4KFOA 2QIWA 3SUUA 3D5HA 5TAOA 1AUSL 2UY4A 1J79A 5HUOA 4A3UA 1E6NA 3GZAA 4W5ZA 1R3TA 4PCFA 3KVMA 4PUJA 4XVEA 1K7FA 1XIGA 3PUDA 4E2BA 5CZJA 3GX9A 4WIWA 3RK8A 3EAUA 4O8AA 3EMQA 1VCGA 1FFRA 4D72A 1EEPA 1KFEA 1RP8A 5LNVA 3WKZA 4O0KA 4M6QA 4H9ZA 2JKEA 4ZQRA 2WZTA 3S2LA 4LU0A 3WF1A 1KTBA 3B8VA 3NO5A 3CUXA 3L4ZA 2XUCA 1Z7AA 4ZFCA 1QHOA 4B2DA 1RPKA 3QV9A 3CLMA 3NURA 3FYYA 2E7FA 2I5GA 1DJIA 2ACRA 4NNAA 4K7YA 4GH3A 5LIKX 4OKDA 3CIXA 4RW5A 4UMBA 1MI3A 1OINA 2WCGA 1OD8A 1VAHA 2YCLB 4QHRA 3URAA 4NNCA 3LG3A 2X2YA 2FHCA 1DJGA 4FNRA 4IFKB 4OVXA 3RN6A 2OYMA 4XZ9A 2O9PA 2DQXA 1V3HA 3YPIA 3EWYA 4KCUA 4C7DA 5D04C 5FI8A 4X9YA 3BMWA 1LLWA 1GVOA 3PAJA 3NUKA 1LWJA 5BZAA 3FHQA 2D3LA 3PSWA 4AD5A 4H7ZA 4MJ4A 5FCZA 1YDVA 1Q2RA 1VFHA 4JFUA 1EA0A 4OHQA 1U5VA 4Q8PA 4TMBA 2DT1A 5DANA 2ZUTA 3HG3A 2C18A 4OWGA 2FLIA 5F2GA 1L2UA 3LRMA 1MFUA 1FCUA 1BSLA 1W9UA 3MSGA 3LB0A 3GM8A 4WKFA 3II1A 3VKBA 4UZSA 3T0CA 1CI1A 4W87A 2C1HA 4AFYA 4JHMA 1E0TA 3CIVA 4NF7A 5T91A 5FJPA 4H7VA 2A2IA 1P1MA 3KOFA 2DP3A 9CGTA 4QFUA 4Q7IA 3A12A 4WDTA 1NFPA 1LRQA 2OT0A 3PVFA 3WEZA 2ZA1A 4DPQA 1JUKA 3CXOA 3AJ7A 4JY8A 4UTUA 3G24A 4Z0JA 1MNSA 4JQ1A 3R7MA 5F1VA 1Y65A 1IIGA 4M51A 2XFWA 1PWMA 2CEQA 2Y89A 4RV8A 5DXYA 3GXMA 1G4TA 1XPYA 4NJHA 3PBGA 2DZBA 6CGTA 2W5FA 3ITLA 2G37A 3S6OA 4I5RA 4AF0B 1CEOA 3S6DA 5CLWA 3JU2A 1LBLA 1OYAA 1W9BM 4QXIA 1DWJM 1EJSC 3BOLA 4POCA 3N2BA 1V79A 4HN4A 4JTRA 3KLKA 5CZSA 3ZR6A 4D8ZA 3W6MA 1N55A 2R9RA 4FMVA 2R1LA 1UMYA 4E4PA 1SZRA 5DXXA 3T0BA 4I7WA 1V0MA 1WDSA 3POCA 3WNKA 4US6A 1EP1A 4IL0A 2XISA 4WR3A 3H26A 3FXGA 3U9IA 3EKLA 2ZXDA 1EBHA 1NDYA 1JZ3A 2FTPA 5HUPA 2OVLA 1QDSA 3BGGA 2BY3A 1E5JA 2NQ5A 3P6LA 3PP7A 2Z2UA 3W75A 4D6DA 5KSWA 1XC6A 4ZE5A 2RUSA 1EGMA 4ZR8A 5AYXA 3PANA 4H00A 4FXJA 1UR8A 2NX1A 1OHLA 3VIIA 3WL0A 4S2CA 3DEQA 2P50A 4GJ1A 3QY7A 1XSKA 2VJXA 1E6SM 2KX9A 1R3WA 5H1WA 1HKVA 1KBBA 3TMQA 4GNVA 1PJ9A 5C9ZA 1QNSA 2FB2A 4S3CA 3U5YA 3P5YA 3GAYA 2ISVA 3FVDA 4HPGA 4P7QA 4Q7BA 3QPEA 3OGVA 2C1GA 2PGFA 2BG5A 4WXYA 4WCJA 3SRFA 5J04A 1E0WA 3TE9A 3S9IA 3GXPA 5LXXA 2VFHA 1HGWA 4AIUA 1MUWA 3NQ2A 1US3A 1OT2A 4MLJA 4MHBA 4AWEA 2V6AA 1UKPA 1C7SA 3G1SA 5HDRA 1KC7A 2X1TA 5K7JA 4WUIA 1EGVA 1VGAA 4MWAE 2W66A 4LBSA 5JBFA 3W7CA 1P48A 4HK5A 2E6DA 3GVWA 2VGFA 1SZFA 1VBGA 4KCWA 4LJ3A 3TMLA 2XN2A 3C0LA 1VRDA 4H9TA 2O4MA 1O6IA 3NQVA 4OOZA 3G0UA 4XAFA 1JIBA 3WNOA 2V5JA 3E12A 3ZVHB 3HQNA 2QCGA 3BO9A 1JZ2A 3TAOA 2FHFA 4GC3A 3JW7A 4H41A 2WMGA 3HQ1A 3FSUA 3KOXA 3NQMA 2H8XA 4DNMA 4Q8OA 4K1GA 2XSBA 5IHRA 2C1IA 4JYEA 1FH9A 1PTDA 1EO5A 1J11A 3OQ8A 4R34A 3THQA 1E3XA 2C19A 4B3LA 5ABEA 2OKTA 1I45A 2QF7A 4JN7A 1VJSA 1W3LA 5DF0A 1CLKA 2Q02A 4Q6JA 4Z1DA 2G5WA 3NYZA 1L2QA 3SCOA 1R85A 3H8AA 1C92A 4K7VA 5I3IA 4MYXA 3DH7A 4LCQA 1T99A 5HPCA 3WBAA 2VX6A 2QCHA 1DQXA 1ELSA 3TTYA 4AEEA 2VNCA 1CLVA 2PDWA 5DEZA 2Z1WA 4ZEPA 4NZ3A 2E1DA 4KRZA 1VFSA 1CXFA 3ZSTA 3EDFA 1JDCA 1B9BA 4DJEA 1B4EA 3LLXA 3TKFA 4JFTA 4OBSA 1T7LA 2PF8A 2VI0A 1ENUA 3M4HA 4JTDA 1BVWA 2DJXA 1EC9A 2DVTA 5LA0A 2C3ZA 4IQDA 4FNUA 3V1PA 1EPXA 4XBSA 3C2FA 1RCXB 4NQ1A 1KM4A 3LN3A 3S2MA 3ZVIA 1GVQA 4LWWA 1MEWA 3FJ4A 1Y8BA 2HVOA 3FDKA 4KS0A 1E51A 3V0SA 1FVPA 6ALDA 1TZ9A 3WNPA 1AK5A 2E3ZA 4QJ4B 4PTMA 5D09A 4AF0A 2H6RA 2QR6A 3UJEA 3A24A 3RIKA 4PB5A 3CQIA 3KUMA 1VR6A 1UP0A 2ISFA 3TXVA 4MKNA 4GYKA 7ENLA 3UP8A 2VFIA