4HU4A

Crystal structure of eal domain of the e. coli dosp - dimeric form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
247
Chain Sequence
RLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIPLAEEIGEIENIGRWVIAEACRQLAEWRSQNIHIPALSVNLSALHFRSNQLPNQVSDAMHAWGIDGHQLTVEITESMMMEHDTEIFKRIQILRDMGVGLSVDDFGLPVTEIKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRKIHCRVIQGYFFSRPLPAEEIPGWMSSVLPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein,hydrolase
molecule keywords Oxygen sensor protein DosP
publication title Structures of the catalytic EAL domain of the Escherichia coli direct oxygen sensor.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 247
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4hu4A00
4RNHA 4RNJA 4J40A 4AG0A 4FOKA 4AFYA 3PJUA 2R6OA 3PJXA 3GG0A 4Y9MA 4F3HA 4Q6JA 4KIEA 3TLQA 4HJFA 5MF5A 2W27A 4LJ3A 4FOUA 4F48A 3HV9A 5MKGB 4Y8EA 4Y9OA 5MKGA 4HU3A 3GFXA 4RNFA 2BASA 4HU4A 3GG1A 4ES4A 5M1TA 4LYKA 3GFYA 3PFMA 3U2EA 4RNIA 3N3TA 3PJWA 3HV8A 3GFZA 4FOJA 3SY8A 4Y9PA 3PJTA 3KZPA 3S83A 4Y9NA
chains in the Genus database with same CATH superfamily
2VYOA 3SRDA 2V63A 5FESA 3AMKA 1CLXA 1O5QA 1U1HA 5IRPA 3QLLA 2PLMA 3PZVA 3PHAA 4NG3A 3R58A 4LPCA 4PGLA 5HANA 4ZO9A 3PTQA 4UNLA 1K77A 3RCNA 1VFTA 4PUWA 1E70M 3ITTA 1NIUA 2R14A 4J7RA 4ZODA 3LHZA 2DVTA 4YCOA 3VDCA 1TTPA 1V77A 3KLKA 2WBKA 3TC3A 3STEA 2Y63A 1W5NA 4XZWA 4HSOA 4AG0A 4TXEA 4GUFA 3UWYA 4LVDA 3IARA 1OFPA 5FSDC 1AUSL 3GDTA 2GVYA 4JY8A 1MXDA 3ZT5A 3L0GA 2ZXDA 3H7RA 4WQ6A 1BPLB 3OO2A 2VHLA 5JUVA 2I14A 3ZM8A 4GUJA 1OK6A 1IZCA 1QI2A 4M6VA 3W1PA 2YB4A 3NL3A 6REQB 4LFYA 4L9XA 3B0PA 3UJ2A 1GTEA 3KWXA 4MNJA 2V5CA 1W8GA 1OGGA 4GHRA 1W1TA 3A3WA 2ZQ0A 4RLIA 3MUCA 1FWFC 1E0XA 2V5KA 4B5SA 3PNUA 2VQTA 1BWLA 3UWVA 2BGQA 1DXIA 3MSRA 1HUVA 5EA9A 1E9IA 4PE8A 1FP9A 3GZAA 3W7EA 1HKVA 5I24A 3QHMA 4MKSA 2W5FA 1G4PA 1LOLA 4A22A 3LCIA 4BQ3A 4CN6A 5K2ZA 4O10A 1DTUA 1H51A 3I68A 1LRNA 1WA3A 4MWAA 2HTMA 5XIMA 4U28A 3WLLA 4R7WA 1KFLA 3WLNA 1JAKA 3BCJA 2HE5A 4GLEA 4XO7A 3UPMA 3EDJA 1Z9AA 4DO5A 3KVJA 2VFIA 1NELA 3BUVA 3L4ZA 2CYGA 1DOSA 4A2RA 4AEEA 2W79A 4W84A 2JGQA 4HHLA 2IPWA 2XGZA 1H1YA 3VNJA 3ES8A 4DIAA 2J7HA 2C15A 2WB5A 4Z1CA 4JCLA 4C1NB 4D6FA 3ITCA 1NJJA 2V6AA 2ZUTA 1GVFA 1S3HA 1XRFA 1QNOA 3EMQA 3UFYA 1AJ2A 2WMGA 2IXVA 4QRNA 4V33A 4O57A 2B0MA 1UB3A 2HZGA 3VNZA 3UXKA 1GORA 3BDKA 1GEHA 4F79A 4KEUA 1FA2A 2B7QA 1QOQA 4C6OA 4MNKA 2H9AA 3MKVA 3AC0A 4A8RA 1IEVA 1RVKA 3VD5A 4GIYA 5G5IA 4Z2GA 5FACA 2W62A 3AHYA 2POZA 2Z6JA 2QVNA 4NT0A 3C3UA 4IMAA 3N11A 1EJWC 1R3TA 2NXIA 3TAKA 3U57A 1OB0A 2VR4A 2ZA2A 3ONBA 3WEZA 4JIRA 1TQXA 5HA7A 3QY8A 2OZ3A 3G1XA 1JDEA 5ABGA 3IPWA 4Z1BA 5D04C 4DUWA 1XYAA 1VYPX 2FHBA 1H7WA 4IQJA 3DESA 5CJMA 4G6CA 4UFHA 2I5IA 3R4IA 3WEMA 4JS3A 4TQTA 2C1HA 3M16A 4OV9A 3WQGA 2VT0A 5LGZA 4Y9OA 3A24A 4Q4OA 1Q6FA 1BRLB 1IXQA 5CBIA 2PDYA 2PP0A 3LV5A 2WYSA 1XIDA 1DQXA 3BAKA 3GVQA 5A2AA 4DBEA 4M82A 3CJPA 5A6BD 2D20A 3WMLA 2V82A 5DMMA 3DKJA 2BOFX 3RJYA 1Q6GA 1XLBA 3L23A 2A7PA 3N2BA 4MWAE 1PS9A 2ABAA 1D7FA 3E96A 1E0TA 3KWSA 3FW6A 3R0UA 1KR1A 3H4XA 4UTMA 3PULA 2O92A 3WNKA 1BKSA 4KQNA 1E6NA 1GQJA 3NM3A 1XBZA 1TCMA 4P2VA 3TLLA 4JTJA 4JL2A 2JKEA 3GDKA 2XTKA 3W1RA 1IV8A 3GNOA 1G9HA 1BKHA 2V30A 4DBSA 3CS2A 1P4CA 2CXGA 3L4YA 4GY1A 1GUVA 2R82A 4JZ5A 2XM2A 4L4PA 4GI4A 5H6HA 3NR0A 4IH3A 1EGZA 1POKA 5CQ1A 3SUSA 2VFEA 4F40A 2VFGA 5KETA 1EPVA 3EWWA 1KQZA 1C93A 3FS2A 3W82A 1CLKA 1F5ZA 1Y65A 4NY2A 1HNYA 3QF0A 1JGIA 2PWFA 4FMVA 4G1NA 2BFGA 1Q6EA 3O15A 4UZSA 3E3HA 4L1XA 4KFPA 2GVLA 1ZRQA 3LCLA 2ACRA 4QLKA 1EOKA 2IQDA 2PDKA 3BV4A 3W85A 1VCVA 4K7YA 4REQB 3O1NA 1TV8A 1DHPA 1XH2A 3CHVA 4LC6A 2CESA 2ZTKA 2E40A 1O7AA 1A80A 3OOQA 3NM1A 4YL2A 3EOEA 3VMPA 3RILA 4AISA 5I03A 4JPGA 5CAHA 3UVIA 2DT3A 4OOUA 2NQLA 1R30A 2O7QA 4N2YA 3VYLA 4Y96A 1ENUA 4LNYA 1D3HA 4A3HA 4NYUA 3GR8A 1N2VA 4HPXA 3T0BA 2PTYA 2Z1BA 3B03A 1VP5A 4KRUA 4JTDA 3HMJG 3B9OA 3WSUA 1JAEA 4QJ1A 1D3GA 3HB9A 4CGTA 1THFD 5L6UA 2CHRA 1FCUA 3SY5A 1FP8A 2A2IA 3QV7A 3AS1A 4PCSA 1GQKA 3GHUA 1UASA 3UXLA 2OLAA 3RLUA 1UUMA 4FOJA 3WH8A 4UTUA 1L8PA 3S6TA 3PSWA 2J75A 4AZCB 1ZU8A 4UTIA 2FJKA 1HJWA 4R88A 4QDPA 3OZOA 2YFNA 3OLGA 3NXFA 3T6CA 1EHNA 1W1ZA 1K8CA 2E9MA 3GUGA 1K4GA 1RJRA 2DZTA 2F7FA 3MJYA 4R33A 5A6BA 3GRIA 3WL1A 3LPOA 2J7EA 4X63A 2Q09A 3CBWA 1AZ2A 3SY1A 1X1OA 5CC5A 4BWLA 1TVNA 2NV1A 2NLYA 2PF8A 1I2RA 3R43A 3CU2A 1MMFA 3TYUA 5DEZA 1XIJA 1H7OA 1L8NA 3DHPA 1E9LA 1MRQA 3HG4A 3N2OA 2C1IA 3GDLA 2I5GA 2DZWA 3TJXA 3H7VA 1KGWA 2GWNA 3NQAA 4M51A 4NAFA 1U83A 1XFCA 4ZQMA 2YYTA 5D9MA 4D6IA 1J0YA 5BYWA 4J27A 2GGGA 3G77A 2FH6A 4O0ZA 1B4KA 2WVSA 1BLIA 1XYZA 4DO4A 5H2ZA 1B3ZA 1V02A 4K39A 2BV9A 1YDVA 2ZIDA 3JRKA 1VFLA 3DDMA 2VWSA 3AUJA 2X1IA 3UY7A 4JTQA 1RZMA 3AZTA 3P74A 5I3JA 4UTWA 5H8UA 3CWHA 4NI3A 3R12A 2VL4A 5DANA 3MUXA 3T07A 3GYCA 5CG0A 3SGUA 3G18A 3U4FA 4LYRA 2DSZA 2PCQA 2B31A 3GE7A 5LXEA 4RZ5A 2E77A 4JFWA 4DJFD 3M5XA 1P5BA 1LRQA 3T55A 4FR1A 5A6SA 1XYMA 4O11A 4IG2B 3WLKX 7REQA 3P67A 4JXCA 3CYVA 3VDGA 1AMKA 3ZWSA 3W70A 1XD1A 3RPDA 2Y89A 1FWTA 3PP7A 4DNHA 2YDQA 4AZGA 3BK0A 1E71M 3CTTA 4ZEPA 3BMWA 2XVNA 2YCLB 2Y2WA 3W74A 1CCWB 1E1CB 3CUGA 4FNPA 2W66A 2QCMA 3WMSA 3TN4A 2YYUA 3GAKA 1K6WA 3K1GA 3WD1A 5TNVA 2Z1WA 3EXRA 3IJ8A 4CEXC 2CXEA 3ANUA 1WYIA 3GIYA 3VUPA 1EZWA 1W2PA 3T81A 1XLFA 5K9XA 2Y7GA 1EWDA 1AMYA 4I3GA 4PRRA 4JD4A 4WSJA 4DAFA 3QV8A 3ARUA 1H7XA 5CKSA 2XSAA 2Z1XA 4BJHA 2A3LA 2O7SA 3E74A 2QXWA 2Z4GA 4O1EA 3SUVA 4HHPA 1CXFA 5E70A 3SY8A 3E5PA 1ZALA 3JUGA 5E0KA 5EY5A 5CBJA 1WQ5A 2J8GA 4TVDA 5DO8A 1J9YA 4DYJA 3HQPA 5ABTA 4HK6A 4D71A 1GK8A 4DELA 1D2KA 1CGYA 3BJFA 3Q58A 4JQ4A 1V02E 4JYFA 3EB2A 4GG9A 3F5LA 4MY1A 5L9FA 3CL8A 2IPFA 2DSUA 4G2DA 3KOWA 4LEFA 5FEWA 2BY1A 1W1B1 5HQEA 5G2WA 5EGRA 2V3GA 3AHVA 2E25A 2QGYA 3HJZA 4S3JA 1BYBA 1NF7A 1YXCA 4WY0A 3A9BA 1TPUA 1KD0A 2JQXA 2PTWA 4OWGA 1X1ZA 1BVNP 2E5CA 3LHTA 3EPMA 4GOAA 3W23A 4NJHA 3EEZA 2J74A 3EXSA 1QK0A 4NYYA 3NOYA 4IIHA 5BMXA 1DWHM 1T99A 3QW4B 3D0CA 3V1PA 3A3HA 3VE7A 5T26A 2WJZA 4JN8A 1EDTA 1T8QA 4IFKB 4DJFA 3KBNA 1ELSA 3CPGA 3MP4A 5AFDA 3T1GA 3URAA 1PDYA 3TWAA 4F2UA 1DJHA 1J0IA 3VX1A 2BS9A 3AUOA 4L61A 2WQPA 1P0BA 1GOIA 2QJNA 1ESWA 3WNLA 4XZMX 2IXUA 5DMYA 2WM1A 1GWJA 3N2TA 3HM7A 1LWIA 3PFMA 4QBXA 3VDBA 4I6KA 1EJTC 1VHCA 4S3FA 1R2RA 3IGHX 4LRTA 3GQYA 1SO5A 2PDIA 5B80A 4GO8A 4TX6A 3AIWA 4Z0JA 1IZJA 3GR7A 3SCPA 4UIOA 1ZUAX 1CW2A 2XIOA 1XIHA 2WPGA 3DU0A 1NFGA 4KBXA 1YPXA 5DMLA 3OGVA 1Z89A 4PB5A 1E6SM 1KGXA 1AW5A 3E0IA 2CBVA 2C6QA 1W8SA 4ZFCA 4LVGA 2GK1B 4CCDA 4DO6A 4JCMA 4AY1A 3D6NA 4E2BA 4W88A 2PDPA 3NOEA 3DFOA 3CTLA 4DZ5A 1JF5A 1KFKA 3OU8A 4O4WA 1VZWA 2W9MA 3OIHA 4N02A 4GUHA 3M0ZA 2DW6A 3SW6A 3WJSA 3R1ZA 4WDXA 4PFHA 4LV9A 1ITUA 2NXGA 4HYVA 2A3AA 3W2LA 4N9DA 4IGMA 4TV5A 4ZO6A 5EKYA 4Q8QA 1A4MA 5I3DA 1AL8A 2V3FA 1P0DA 4H6QA 1HTIA 2C18A 2E6DA 1XLJA 4KIRA 4C7GA 3P3BA 3VUSA 3Q94A 3NZGA 1HO4A 2AQOA 3WDJA 1K70A 3OA3A 3PBWA 3W7PA 1I4NA 2QQ6A 4YS1A 3ARVA 3TR2A 5JXQA 2B4GA 4PMZA 1UPMB 3INPA 1EFZA 1GG0A 2YR1A 3KS6A 1Z32X 1NFPA 3H24A 3LHYA 3IJQA 6REQA 3C6CA 4XAGA 3CWNA 2NQZA 2E7FA 4AWEA 3QQWA 2RAGA 3B9AA 2MNRA 5DFAA 2CBUA 3G6LA 3TZFA 3AXHA 3BW4A 1DJIA 2B7PA 4OQVA 1EH9A 3NQ7A 2VZTA 3GXTA 1WDWA 4GPNA 3A9IA 5FI8A 3NQMA 3ITOA 4Q32A 3T4WA 3VZZA 3VINA 1F2JA 4TIMA 3AYVA 1W37A 4F0HA 1KWGA 4XD6A 1TMQA 1XXXA 4Z1YA 4O0KA 2OR2A 3DYPA 3N12A 4CU6A 3PG8A 2WNNA 2GDVA 3NWRA 4EPKA 3GC2A 3PZOA 2GJXB 1KRBC 4BS0A 3QSRA 4PEEA 4PUKA 3S5OA 1WBJA 4JTIA 2OCZA 3N3TA 2PDWA 2YGYA 5E0CA 4KEZA 3V16A 3TYZA 1R7OA 1F6YA 1HZYA 4Q4QA 1KFBA 3PUGA 4RCXA 4HHHA 3TQPA 2E6FA 4PSPA 4TV6A 4JNYA 3NEHA 4C1NA 5I3GA 2PC8A 3V4BA 3LDVA 4Y8FA 1H4PA 3CH0A 3EXTA 2ALRA 4GUGA 4O1DA 2ZZ3A 4M6QA 1VC4A 1PV8A 1F4AA 4ONVA 4XQ6A 3QRHA 2X0YA 2BMBA 1MFUA 1WXJA 1E51A 3UNTA 3URBA 1TPVA 2J88A 3NQGA 4EANA 4ZTYA 4G9PA 2F6XA 3WQ4A 1B3VA 2XVKA 3UXIA 1ISXA 1AQMA 1J0ZA 1EC8A 3L5LA 5I79A 1M3UA 3A6OA 3WQ6A 3VXGA 2VEPA 1TRIA 1RLCL 1TWZA 3B9NA 1CXLA 3VDHA 2WWDA 3IIXA 3W1QA 1BG4A 4Q8MA 3KM8A 1C9WA 3TYCA 5DBTA 1TMLA 2WCGA 2QF7A 3GTFA 3N4AA 2H8ZA 3WF2A 2PU0A 4GD0A 3WMCA 5LZLA 2WVUA 4IMGA 4IP4A 5HNNA 2ZE3A 1QMLA 3VD3A 4DHGA 3KX6A 3H12A 3DFPA 5E09A 4CNUA 1J96A 4JFTA 3ZSTA 5FAJA 1XF0A 1A5AA 1Y7VA 2DJXA 4LT9A 1OFAA 5EMLA 4YYCA 2CLOA 1UCWA 3ABSA 3VIIA 2YW3A 4Q4MA 5I3KA 4K68A 4ZXLA 3SFKA 1AA1B 2ZC8A 3AWOA 2PTZA 1PWLA 5FAGA 3S1VA 4DZHA 3U9IA 5KTLA 3W83A 5BCAA 2WMIB 1FWDC 3P80A 1FUYA 3IVSA 4JQAA 3BW3A 4QROA 2YXXA 3K4DA 4XK2A 4HNUA 2H3BA 4H9VA 4FO4A 3S9ZA 3S6DA 4Q8PA 4LH8A 3R8GA 4IJRA 1TG7A 2R9RA 3ABXA 3RX4A 2DORA 3G1HA 3IGUA 1OFRA 3B0XA 3TQ0A 2PZ0A 3U2ZA 1IT0A 3CT2A 2ZUUA 3AYTA 3BAJA 2ATMA 3FX4A 3G1DA 4GBUA 3TE9A 4LBUA 4BZYA 1LP6A 1G1YA 2FGZA 5F4SA 5K9DA 2CLEA 5LA2A 3RFAA 3ATYA 1OT1A 3HPAA 1N8FA 1D9EA 1LL4A 4ICNA 1FOBA 4Q4RA 3MV01 4US5D 1GCYA 5I3IA 3AIQA 3CZLA 3AXKA 3MBFA 1A5KC 1I6NA 2ONEA 1W6TA 2OMAA 3UG4A 5ABHA 1KTNA 2R1PA 1OEPA 1R38A 3HF3A 4UCGA 4A3YA 3WD3A 4C1KA 1OJXA 3U7BA 2PGRA 4NAEB 4R9OA 1AH0A 4N9EA 4S39A 4REQA 1GKRA 3CUJA 2CZDA 1M7PA 3G1YA 4J2PA 1EHAA 1QW9A 3SCWA 3NQDA 3NUKA 1B54A 4RE0A 2FPTA 3K4AA 4FI4A 2YCKX 1ZCOA 3TEVA 4QS6A 1IWPA 1B9BA 4M0XA 3TMLA 1PZ1A 4HSHA 3DUGA 3WH7A 4CD8A 1ML1A 3BICA 1JI2A 4Q8UA 4M1BA 2PDNA 1OG0A 3WJYA 4YMZA 1UD8A 1HKJA 5TAOA 1LM1A 1VFUA 4RUBA 3V5FA 4AAJA 3HFTA 4F66A 3V75A 2VZVA 1TE1A 2WJDA 1T41A 4GFIA 1JR1A 3NCOA 1VF8A 3NXLA 2A3BA 3VOJA 3NJ3A 4AX6A 4JFVA 2HPIA 5I00A 4I7WA 3REQA 3CZ8A 2E6AA 3KOXA 4AZCA 4NXKA 1UIPA 1XIBA 3O05A 1XX1A 4ZQRA 4GABA 4PTXA 4H2HA 2WJFA 1NWUA 5K9CA 3K4WA 1TVLA 2P8BA 3EBVA 2Z2BA 1Y5XA 4CNPA 1UROA 2OJPA 1RK6A 3QR3A 1DKWA 5A2BA 3WQWA 3LTPA 1E1EA 3KBVA 2WVVB 3BSHA 2WSQA 2VZOA 1QI0A 1XYBA 5MF5A 2X1SA 4BQ2A 4CQBA 1XUZA 4DRSA 1AZ1A 2XVPA 2C14A 2QUTA 1GKPA 4M6PA 4WKHA 4JNMA 4MIMA 2ZX9A 4ZBCA 5FF7A 3VCRA 3WO8A 4LWWA 4E4UA 1MQPA 4RW3A 3O63A 4Y9AA 1RXOB 1P1XA 3I6TA 4DYEA 4AC1X 3CK5A 3WDIA 2QNEA 4L6DA 3NQEA 2E9LA 1PWMA 1IYXA 3QY6A 1F07A 3SUUA 4ZCWA 1ODZA 4JTGA 4M7SA 1XGDA 5EYWA 4GYJA 1XRSA 3S1GA 3SN1A 3KTXA 3QTGA 5C9UA 2BY0A 3QW3A 2WC7A 2J7BA 3R25A 4MB3A 5FEPA 1DE5A 1M41A 4IG2A 2X05A 4MLRA 1JCNA 1PX4A 4UTKA 2FZBA 2WOQA 2WO5A 3M0JA 5C0QA 4K2SA 1R3WA 4F0KA 2AL1A 4DBUA 2VTFA 3M0HA 2ZBTA 3ZS4A 5CSRA 4PUDA 1NTHA 3FJNA 4N4QA 1UJQA 4H83A 1XC6A 3KVMA 1SSDA 2GVJA 2YCLA 1E1CA 2HJPA 3EYPA 3G8RA 2PI6A 3QGAC 2Z2UA 5AYIA 2VDGA 5A6TC 4DUXA 4IOTA 3LV6A 2I57A 3MB9A 1K9TA 1RY8A 1OCBA 2ZUMA 3BJTA 1E73M 3SRFA 1M68A 4LCSA 1ISVA 3GD6A 3N6QA 3CUFA 2MANA 5BXPA 2XPKA 3GVWA 3UERA 1YNPA 3BQ5A 1LT8A 1X7FA 3DBNA 1NFBA 4XSLA 9CGTA 3A5VA 3G1FA 2VC9A 1Q4WA 1GQIA 1KLZA 3QPYA 4Y9PA 3F4VA 3TTOA 1YEYA 4B5UA 1H50A 3JR2A 3M0LA 3MCOA 4E4FA 4I6VA 4HPNA 3HPSA 4I9JA 1AQFA 1FHVA 3FK4A 3LK6A 3QKEA 2VEFA 2NT1A 2XH4A 2Z1VA 3N3MA 1MW1A 1XGEA 4IT1A 4I9TA 5IFPA 1YTDA 4RE4A 1JPHA 3WUBA 2XHYA 1JNDA 1WNOA 3PZGA 3LXBA 4AX7A 3CAVA 1VCGA 4RPQA 3DG3A 1C91A 4B3ZA 3CM4A 1ICSA 2G50A 3OQ8A 5CGQA 3AZRA 4YLWA 3E38A 3N15A 4QCEA 5CPNA 2Z29A 3W7IA 5I3FA 4H6KA 4Q6XA 4YHEA 1TVPA 1WDQA 3EMCA 5HR7A 3U5YA 4C6MA 2QPSA 4YU1A 1FWAC 5KZMA 2WC4A 1EBHA 2P5NA 3VIMA 3ZR4A 3K8LA 2Y8KA 3ITLA 4GA8A 1I60A 4ZSUA 5DN1A 1JD9A 2OO0A 1J18A 4EX4A 2FGLA 1FKWA 2ISDA 4A3RA 4PH6A 2DFAA 4IFKA 3C61A 4HOWA 3QV9A 2JBMA 3PZIA 3VAVA 2HWGA 4FNRA 4DJEC 3AIBA 5CH9A 5EMMA 4ORIA 3VOCA 4FLRA 4QG8A 3RJXA 3S5NA 1XI3A 4CD4A 4UOZA 2ABBA 3VOFA 4RDVA 4AWSA 3LI1A 3S1UA 3DGRA 1NEYA 2D2JA 3SN0A 3WNPA 3EX6A 4V28A 5CJ5A 2FTWA 3GG8A 3W2JA 1QOXA 1SW7A 2Y24A 1GZJA 1TJ0A 5G1YA 4K3ZA 2XFRA 1NOFA 2DP3A 3EX2A 1PHQA 2I56A 1IR2A 3WLSA 1R2SA 2Z2AA 2QF8A 5CZSA 4MHBA 4UNIA 4PTMA 3RYSA 2EG6A 3L4VA 2YCEA 1MW3A 3L66A 4Z2JA 1CXIA 2WV8A 4MPKA 4WIWA 3WZ0E 5A95A 1L6WA 2FJUB 5C6MA 3ICJA 3MUIA 5AHEA 4Q8WA 1HL8A 1DTNA 4H8UA 5FL1A 1MUWA 2PGWA 4UR9A 1C8YA 1EQCA 3FXGA 3NL2A 2BWGA 2EGZA 2ALDA 4DUVA 3KTCA 5BNKA 3U5UA 4QEEA 2BHUA 5GNXA 1VKFA 1XC4A 1HFBA 2REQB 1W9BM 2XWEA 1AW1A 4JTKA 1UD5A 1JCMP 4D9PA 5D2YA 3RITA 3WKZA 3GNXA 4S3DA 3LU2A 3F03K 2KX9A 3FHQA 4TMCA 3R8HA 3R10A 3TR9A 1LOSA 1FTXA 3ZMRA 3KHDA 4LUSA 4QLLA 2A85A 1RHCA 3KRUA 4H9YA 2YA0A 4WRHA 1JNEA 3WCZA 4OUEA 4KF1A 4JTSA 2OX1A 4AIOA 1V3HA 4GZJA 4W5UA 5DCEA 3IRDA 2IKHA 2NZLA 4HK7A 4H7CA 4PMYA 3FOKA 4RE3A 3SGZA 5D09A 4FPSA 5MKGB 1LRTA 3BMVA 1UQZA 4DBDA 3ITXA 5FF4A 4P7LA 3LM3A 2CBJA 4XTIA 5BMWA 3U48A 2CC0A 1MZRA 1W2VA 4LVBA 1VJSA 4HB7A 2QMJA 3UA3A 1SJBA 4LNCA 1YADA 3GG0A 2DDXA 5D05A 1OIFA 4RW5A 4HCLA 4W86A 1GJUA 3EPOA 2PWVA 4LOCA 1XISA 1V0NA 3E02A 3VGHA 4O52A 1M03A 1TE6A 4XKMA 2PA6A 2AMGA 2WZEA 3VFLA 2AQWA 2PTXA 5M2FX 2XN2A 3VCCA 4JOMA 2XSXA 2XVLA 2YDAA 2PF0A 1IEIA 1QPNA 4H7VA 1KC7A 4M5PA 1H49A 5CG7A 3XISA 2WNZA 1J8VA 1XL9A 3WY1A 3VPLA 4OKDA 3U2OA 1FRBA 2XGIA 4PRTA 1SFJA 2C3ZA 3EKLA 1ZAIA 2GJXA 3R6IA 1TPC1 4PSRA 1KO0A 5EPDA 1W3IA 1BF2A 1RBOB 1BYAA 2ZKMX 4JQ3A 2ADAA 4JKKA 3N04A 1GYMA 4WXYA 4H8VA 4CNOA 4G7FA 5A8OA 1SJCA 1QVBA 1R3SA 3N17A 4AD3A 3OZPA 4J3SA 1L2UA 3MI3A 3DYMA 3TXVA 4D6JA 4QHRA 1DEDA 4XBSA 3BAIA 3L5AA 1XWYA 1KBIA 2Z0IA 2OWWA 2DPEA 5HMDA 4HSNA 1ITCA 3LA4A 3KDOA 5J5RA 3K13A 1TX2A 1VYSX 1KM6A 1XSIA 2OFJA 3M1ZA 1KR0A 3GVRA 4I5UA 4ZVJA 1RVGA 1KTBA 2Q6ZA 3HPXA 3IJ9A 1YDNA 2IKGA 3USBA 4LGXA 1KCKA 1J0KA 2FYMA 3U2CA 1QPKA 1FXPA 3LUTA 1JI1A 4QQUA 3DOPA 5C9XA 1Z3NA 3ARXA 2OWCA 2NQ9A 4IPPA 1RH9A 3LBOA 3SCNA 1O60A 2F38A 3OLEA 3P93A 3LXAA 1Q8JA 2Q71A 3UW6A 4PC8A 3GNDA 2PP1A 4GO9A 3EA1A 3STPA 1MZHA 3IVTA 3UR7A 5CEWA 3APYA 2JKAA 5T8GA 2FMOA 3STFA 4B3KA 2VVSA 3VU2A 4LW7A 5F2GA 3KP1A 4U10A 3P0WA 2PDQA 4ZFMA 4LS0A 2EPLX 2GGHA 3TYDA 1JZ5A 1QPRA 2HPMA 4NU7A 2Z27A 4Y9NA 4DUOA 2V8ZA 2R1NA 1W3HA 2CLLA 4IISA 3NDZA 4OHQA 5FJJA 2VFDA 4WXZA 4FNSA 1MW0A 1K7XA 2WMIA 1T0OA 5A2CA 7XIMA 3S2JA 3E1F1 1EJRC 2PWGA 3XIMA 3W28A 1ZZMA 3D3FA 4QAWA 1B90A 2X30A 2YL6A 1XSJA 1L2QA 1JD7A 1ZS2A 3MT1A 4H3DA 1DWJM 1XLMA 2ACSA 3OBEA 3OVRA 5HXMA 2F84A 4V15A 4OTKA 4QCFA 3LQLA 3W6MA 4BI7A 1OSEA 1NWTA 4Q7NA 1XSKA 2FKPA 2YB1A 1V3IA 1F4HA 2V67A 1TO3A 5CBBA 1ZB5A 2VOMA 3O8AA 3I7SA 1Q5MA 1LL6A 1HG3A 3O7UA 7A3HA 1UR8A 1IEWA 2E9BA 4LQ1A 5D37A 3NPVA 1BTMA 4JBRA 1O5KA 5HK4A 3SB0A 5A5WA 1A5MC 1L6YA 3F4WA 4L65A 3DC8A 3ZT6A 4IMCA 3ZT7A 1C7TA 3GHTA 4AZIA 3NURA 2XH0A 1UP3A 3UZ5A 3H6OA 3W7HA 4L9YA 4RDYA 1KKOA 1SW0A 2QS8A 4PEKA 1VPQA 2YL8A 3L0KA 1OC6A 3WK0A 3B8WA 4GQQA 3PUEA 3L5MA 2G95A 1XS2A 4IP5A 1SZFA 2RHGA 1DJWA 4O1CA 3O16A 4IIBA 3EDFA 1LORA 3Q37A 1DWIM 3H54A 4QAIA 4L64A 1UC5A 1IEXA 4LSBA 4DJDD 4K7VA 3ANVA 3B40A 4UFIA 2PP3A 3KVLA 2CZFA 2V68A 3AHTA 3OTRA 3FKKA 1U2YA 2BB0A 1BXCA 1UKSA 1V7YA 4GX8A 1W3JA 4IUOA 3CNYA 4N4PA 3AROA 4G56A 1I2PA 3AMGA 1R3YA 1NVMA 1MXSA 4XAFA 3ECQA 4QSFA 2FVLA 5XIAA 4EP8C 1XCFA 1IWBA 4EOUA 1JUBA 4G7EB 1PVNA 2I17A 3ZR6A 1U5VA 1T5AA 5AYYA 2D73A 1DJGA 3A4WA 1NQKA 2XDFA 2HEJA 3BLOA 1CGVA 2PRHA 5JMUA 4PULA 2NLIA 3P84A 3PBVA 4DB7A 1W31A 1UWAA 1KB3A 2JEPA 4HZ6A 1H60A 1UYQA 2C71A 2QUNA 2R1MA 4UTLA 3MHUA 4AB4A 3UBPC 3CH9A 3RNDA 1A5OC 1P7TB 1IT7A 5A69A 1GJPA 4M56A 1TV3A 5LHFA 3W38A 1A53A 1Z8AA 3OB8A 1VS1A 1E6RA 3POHA 2FQIA 3OJGA 4BEQA 2HNEA 2WVVA 1JXKA 4NNCA 5T9BG 4GKLA 3QY7A 3TYAA 1B30A 3LNMA 2OYLA 4HT3A 2YBUA 4H8NA 3TA6A 4LCRA 1MQQA 1J2WA 4M6UA 3QFWA 3EWYA 3KZPA 1VIZA 3FFSA 1E4LA 2VEGA 4IUGA 3MYOA 1RQBA 1AJ0A 3BJSA 3RU8X 2OT1A 1VJIA 1CENA 4KKXA 1ADSA 2X2GA 1F76A 3EB3A 4MOZA 1UHVA 4JHMA 3RIKA 4A35A 4EPBC 5ABFB 2XZ7A 3HZ3A 2RUSA 1GEQA 3CAKA 4EVZA 2WZTA 1M7XA 3V0TA 3GXPA 2UY4A 3GH5A 4LYKA 1I2OA 3EAUA 3GH4A 2WMJA 3IVUA 5KSWA 1FWSA 1YPFA 4IJBA 3NQ8A 1K03A 3THAA 1UZ4A 5GVJA 1TWSA 3SSZA 2ATSA 3NL6A 1CIUA 1AL7A 3SJNA 3MWAA 2UWFA 1TR1A 3G0SA 3V5OA 1FDYA 4DJDA 2H3DA 3THCA 3GXDA 3E0WA 1EXPA 2PE4A 1EX5A 3DFYA 4EACA 3IIOA 3IV8A 3L7RA 2ISVA 4N0RA 3MTWA 1EC7A 1W9PA 1N7KA 4UQBA 3MA8A 5DX7A 4DO7A 4XBJA 1NDYA 5CPMA 3RR1A 3CHEA 2ZXBA 3VNMA 3OYZA 4D6CA 5C55A 3OW1A 4U31A 1FCQA 4GYFA 3FV9A 2V3EA 3CEPA 3DKLA 4CN4A 4Q7BA 3ALGA 3GW0A 4WLCA 1W9UA 3A12A 3IJDA 4IWWA 4O28A 2PBOA 1H1NA 3NYZA 3H8AA 4C6FA 3TTYA 3FCPA 1V51A 2AQVA 4GYKA 2DY3A 4QG9A 1RCOB 1SU5A 4Z1AA 3W0KA 5RUBA 3P8JA 1QPQA 4A8LA 1DIEA 2WMKA 1PKYA 5AC8A 4E6MA 3TIMA 5K7JA 1PCWA 3DX5A 3DZ1A 2QUUA 3LD5A 4ACYA 1TZ7A 2R91A 3C2VA 2JE8A 5HPOA 1FWCC 3MSYA 3HGOA 4HN4A 1XG3A 2IUZA 1PPIA 3STGA 4KIEA 4K1GA 2VRKA 2NV9A 3G0UA 3MSDA 1NDVA 1ONRA 1XPGA 3GFXA 3KFTA 1WZLA 3VILA 3HTWA 3LHUA 1QW7A 3A21A 3N29A 4V27A 3ITVA 4I90A 4TOQA 4QE1A 1UZ1A 3TSBA 2HRWA 2AL2A 4XUGA 3NNTA 3AMCA 4OOZA 4YN5A 4UBPC 1L6SA 9XIMA 4H7ZA 1FWJC 4HPHA 4AD5A 2QYGA 3VNYA 1NAL1 2GVGA 5KZEA 2EG7A 4QS5A 3O07A 2GGIA 2WNWA 1OHLA 1BSIA 2OB3A 2PDBA 3HPFA 1ZENA 1JPKA 4ILSA 3BLFA 2J9XA 2O4QA 2BXVA 2A4AA 1R9ZA 2HVNA 3L68A 3QLDA 3S5YA 1FX6A 3E9AA 4R5EA 1LYXA 3RXZA 1PX3A 2ZZ1A 5HDRA 4YTTA 4ACZB 3HQ1A 1GONA 3L67A 3FXYA 2CBIA 2Z7KA 3B3DA 4IPJA 4LYPA 2E1DA 3ONCA 1HKKA 1VD6A 2DIJA 5AECA 4C6LA 4X60A 2PZNA 1Q85A 3MMDA 5A8PA 1VLIA 2JFEX 3B4YA 3WLJA 2F61A 4JX4A 1E6PA 3POCA 1Z69A 3QZAA 3GDBA 1EUAA 1DXEA 4WHBA 3A5FA 3BC9A 1GKQA 3P14A 2J7CA 1A50A 3R13A 1K9EA 5TD4A 3FVDA 2HCVA 3NO1A 1V6TA 1VCFA 3DI1A 2WLYA 4JYDA 4DLFA 1KM3A 3C4UA 2NVAA 3QHOA 2BY3A 2HMCA 4O15A 3KL5A 4GVGA 2NSXA 3S2LA 2DUZA 4FOKA 3FNDA 5JIWA 4DI9A 4AMAA 1Q6DA 2HK0A 4QX4A 3MP5A 3G22A 2WSKA 1OABA 4HCHA 5E93A 3W53A 3SQLA 5I06A 1CZ1A 3THDA 4YIWA 1QAPA 3CHCA 1KNWA 4W8BA 5IM51 1UKOA 4HPJA 3D47A 1KV5A 3KTSA 4ATWA 3W7LA 1QNRA 4PMOA 3B8SA 4FNTA 3W2MA 3PBMA 3VA8A 4MWAC 1XRTA 2REQA 3TNBA 3OHMB 3S2NA 3F5KA 4NRSA 1EDQA 1VIWA 1GVIA 3CZEA 5GJMA 3G5EA 1OX5A 4BK9A 1C90A 3MHFA 4U2YA 2FTYA 5CSUA 3SI9A 4B5XA 1WV2A 3MHGA 3H70A 3C52A 4QLJA 1KXVA 4MY9A 3C2RA 3WBYA 4CU8A 3O9NA 3LPPA 4ZGYA 1VH7A 1I0BA 4L9ZA 4UWMA 4WOZA 3SQSA 4X0NA 4NNAA 4J3XA 4L4LA 2YW4A 2P53A 5LYRA 2G37A 5F2IA 3WLQA 2QCHA 3QPEA 2NUYA 1FWEC 2BNJA 3GXNA 3SIZA 4C6IA 3ARQA 3M6YA 1B3XA 4KRZA 1FXQA 2ANUA 4F3HA 1PIFA 3MC5A 2OOFA 3W7GA 2G3FA 4CU7A 3OHIA 3W7MA 1B2YA 3MMWA 3SZ8A 3K46A 3UZXA 5D9PA 3DENA 4KCTA 3NGFA 1JCYA 2CKRA 1JDCA 2GJLA 1BWVA 1M5WA 4KESA 4PCFA 4O1BA 4BF7A 4O14A 4CLMA 1KLYA 1U33A 4G1KA 3UZZA 3CGTA 1GTHA 2ZXAA 3PFRA 1F9CA 4C6DA 3H2EA 4KRTA 1A5LC 3B4UA 3TQKA 2HS6A 1E15A 1W1IE 4Q33A 2R94A 1QPOA 4BI6A 4QTGA 3Q67A 2VWTA 1R9XA 3KW3A 4PBGA 1GJWA 3PUDA 1A5CA 5A6KA 2GOKA 4IMDA 1QRQA 4Z17A 3G1VA 1GHRA 3VIHA 2HDJA 1TJPA 3WJZA 2ZRZA 2DQXA 3MMUA 4YTRA 1CB7B 3U8GA 4ZENA 2UY5A 1FFRA 4N9CA 3U2EA 1OADA 3VOGA 2Z24A 4LB3A 4TVCA 1SM9A 4AZ7A 4C65A 3PS7A 1LLOA 4GINA 3L0NA 4ZQNA 1KWKA 3TW7A 1HVXA 1PKNA 1UH4A 3W01A 4JNZA 2QIWA 1MQRA 5C71A 3UCQA 1IXPA 1W5OA 4QJ5B 1DIOA 4E2VA 4B16A 3CMGA 2OQYA 4JKLA 3N4EA 1B1YA 1YTEA 4LXFA 1CEOA 1AH3A 4FLQA 3QZ6A 3T8QA 2CWXA 3BV7A 2JEQA 3EOSA 4J3WA 1UR1A 2YDRA 2X1TA 3F4NA 5HJXA 1QUMA 1O1ZA 1IWAA 2GL5A 5T91A 4Z2IA 2Q8ZA 1RJQA 3W71A 1PDZA 1W3LA 4ES4A 4W85A 3E5BA 3GO2A 1A3XA 1Z6KA 4H9UA 2FVKA 2J8FA 3AMLA 1YHTA 1GYLA 2JF6A 3T9PA 4RZBA 1U1UA 2QGHA 4JGDA 4LS1A 4EPDC 2E1WA 1LBFA 2Y5SA 1XLDA 3CXOA 3KRBA 1AJZA 2INFA 2E28A 3FA4A 5EMUA 3PWGA 5H91A 4ENLA 1A3HA 3KVKA 5FJRA 1QU4A 1KCZA 5KMYA 3ABQA 1C92A 4FXJA 6XIAA 3IIZA 1K9DA 1R3VA 2ZX7A 1R9YA 4RZ6A 3NAVA 3T2PA 4NZCA 4JTRA 6TAAA 2GOUA 3I10A 2YXOA 4AMCA 1Y5VA 1LLWA 1UOKA 4RNHA 3I3DA 4HNOA 3AIEA 5ENLA 4Z2HA 1MWOA 1TX0A 4E3VA 1I45A 1S5WA 3OQEA 1TSIA 2J9YA 4HN8A 3L2MA 1GOQA 1RA0A 4HA1A 2AKMA 5G1TA 1CGTA 5JVLA 4IXHA 3AJXA 4GXWA 3HURA 1KM1A 2ZVRA 3WNNA 4WOQA 1RBAA 1WCGA 1TWDA 4B5WA 4J3UA 4WEVX 4M19A 1YBQB 5B7ZA 4DXXA 3VZXA 3WFAA 2OGJA 4GQRA 1GZ1A 4J1OA 2I7GA 3TKFA 4BQ5A 2ZWZA 3MJMA 4LEQA 2QCCA 4ML9A 2NX3A 3WBAA 4HTBA 3P61A 2DV0A 2VUNA 4H2CA 1MEWA 1J10A 5CGTA 2Q3OA 4QSHA 5C8BB 2Z1SA 4XAYA 8XIMA 1WO2A 3T42A 1WBHA 3I3BA 4GNKB 4GYPA 4NQ1A 5AKQA 4QNEA 5A6MA 2W92A 4ZQOA 3TNOA 4WSKA 1O94A 4UTWC 3TX9A 1UD3A 2J6XA 4D6EA 5I07A 2YBTA 3R94A 4TTUA 2J24A 2QAPA 1UWSA 3B9EA 5J04A 4UQAA 4GJ1A 5CC7A 1K7FA 4LUTA 3AICA 3BW2A 3TTEA 3LG3A 4X0VA 3FEQA 3QEZA 2MUCA 3S1XA 2ASHA 4MVAA 3TXZA 4GJJA 2ZYFA 1F74A 4LAZA 2IKIA 4G7EA 5DY2A 3F4DA 1TTQA 2DUAA 3CT7A 3WG6A 3RN6A 1ADDA 4PRWA 3GKAA 3N2MA 1YLVA 3FSUA 1CGXA 2BXYA 4QFUA 1ISZA 3VKCA 3RMEA 2A7RA 2VELA 1HQTA 1P7TA 1TV5A 2J77A 2XFWA 5I02A 1NP2A 4I7VA 8TIMA 3AMDA 3DG7A 5I23A 3NQVA 4FEZA 3KBJA 5BROA 2WZHA 2ZRVA 3T7VA 3AOFA 1IGWA 2HE8A 3RLGA 2EBNA 3HA1A 4YTSA 1KV8A 3N2CA 5I7GA 1XIFA 2CLFA 1U30A 2CKSA 1ZNNA 4DWSD 3KOFA 4FX8A 2DT2A 2A0NA 4PMXA 2VZSA 3MZNA 3BLDA 3BGAA 4LANA 3K30A 4LX4A 5C5YA 4MZ1A 2OZ0A 4Q8TA 3CPUA 5G2IA 4E38A 4NNBA 4ROPA 1MDRA 3CB3A 3MYPA 1SUXA 2OQHA 5FJUA 4ZB0A 1EZ2A 1K8XA 1A3WA 1FWWA 4JAWA 3GU9A 1WOAA 1A5BA 3AS0A 1S2VA 1ZGDA 1B0IA 5BRPA 1OD0A 3PBGA 3HG3A 3SSJA 4PMVA 1ZP3A 4H6EA 1ECEA 5ABFA 1O12A 1US3A 3MDUA 3C2YA 3CQIA 1T8XA 2BG5A 4U4MA 4M7TA 2C19A 2VGFA 1QWKA 4W7UA 2VQUA 5CC3A 1GVYA 2PTDA 1ONEA 2Y61A 1KTCA 5GJPA 1XFBA 1G69A 4CNSA 2G97A 1OYCA 2QCEA 1EA9C 3DBPA 3IK2A 2B81A 3H55A 1XBVA 1F3TA 4KEMA 4Q7IA 4KW2A 1QDSA 3KXQA 4V1YA 1SR9A 4B5TA 1RCXB 3ZLGA 1U5HA 1S1RA 2V81A 4DJFC 3O3RA 4K36A 4J3TA 1XV8A 1UMLA 3L4WA 3NYDA 1UKPA 4HZ8A 3D5HA 4PMRA 4FIQA 4IXXA 4DNMA 2IMRA 1FWNA 4YJ5A 3UJFA 1BD0A 4AY8A 3UEQA 5LXXA 2DT0A 3T2QA 3SADA 1DL3A 1DIKA 4JTTA 4X3ZA 1J0HA 4FS9A 3LTYA 3WF0A 1CBGA 4UR8A 1SQ7A 2ZE0A 1MVYA 1QO5A 4C91A 3GK0A 4MGGA 4WDWA 1E40A 3F1QA 4OJYA 1GW1A 1ECQA 4X61A 3T0DA 1RSCA 4W7VA 3CV2A 1S1PA 4ZOAA 1JJKA 1LQAA 2XGBA 5HINA 1W9VA 2GGJA 2OYKA 3CASA 4L1GA 1LOQA 4DWSA 1VFHA 3BMXA 3W07A 3CMJA 3U4AA 3V5CA 1EP1A 1L0PA 5AYXA 1V6WA 5BWFA 5KINA 4K38A 3THUA 1FBAA 2I9EA 3O06A 5HWMA 3NZ1A 2Y7DA 3M0XA 3WNMA 2G0WA 2HSAA 1E6XM 4ZL1A 3WF1A 3CC1A 2C0AA 3A4XA 3SN4A 3VM7A 2FIQA 4GE8A 1IXOA 1XLGA 5A8MA 3QBUA 5D9NA 3OVGA 3W81A 5CZJA 4R85A 5I77A 1XBXA 4U3CA 2DZXA 3NGJA 4LTSA 2WQDA 3COTA 4PMUA 3QMRA 5AHNA 5D9OA 4LUYA 1NDWA 4TUFA 4IF2A 1V03A 2WK2A 1OFEA 3VNIA 2DU2A 4C1LA 3LCWA 1MFVA 5DLCA 3CO8A 1OK4A 3TROA 3B0UX 4DXVA 2IPGA 3HJEA 1J6PA 4E2OA 1OVDA 1E3XA 3OGRA 3TJLA 4UFKA 4PODA 2VEIA 3G24A 1UBSA 1WZKA 8XIAA 3WDQA 1TJRA 1ZJBA 2HV5A 4AWTA 4DF0A 1VFOA 3S83A 3B8DA 3HU7A 2RDXA 1H09A 2NVCA 1YXDA 2BVTA 2V2HA 2D69A 2PC4A 1GW9A 3TC6A 3Q65A 5CLWA 1WKDA 3LRLA 4ML4A 2HVOA 3N6HA 2FZMA 2WBGA 1IT8A 1VJZA 2R1LA 4ZA0A 5F7UA 1JFXA 4JIIX 3I6EA 4UTTA 4OU1A 3WEOA 4MWAB 1IZKA 2F2HA 1W0MA 1Q2SA 3BCDA 3C2OA 3KL3A 4H01A 3BLKA 1Q45A 4WKFA 3W84A 4Q8VA 1B57A 3W37A 3UWZA 3LY0A 1NH6A 1UC4A 2BDQA 3LGGA 2G4FA 3BURA 2X2YA 1I75A 3OGSA 3WLPA 4H8HA 1SZNA 4KWSA 2BHYA 4E0CA 5D8WA 1K6AA 4MNMA 4LJ3A 4LC8A 4ALDA 4H00A 3LNPA 1EJXC 3EX1A 2QPXA 3I7RA 2XFYA 2P3ZA 4NJGA 3GBEA 5I78A 4P7OA 3SUWA 2FDMA 1TUFA 1OBAA 2H9AB 2PDJA 4HMCA 3OPSA 1LLZA 3VMNA 5D38A 2XH2A 1JUKA 2NV2A 4Q4SA 2W61A 5FL0A 2VO5A 3CQHA 2ZWYA 4K8GA 4HNNA 3V0UA 3M0IA 1XG4A 3KDNA 1GVSA 4B4HA 2VRJA 2OKOA 5TQLA 2ZTJA 2QJJA 3H21A 2E4TA 3FDGA 2WWCA 3W87A 1XLAA 4IQEA 3BARA 5EL1A 4RZ4A 3O6DA 3S0CA 4KWUA 3M07A 1JYWA 1X7IA 3MUZ1 2OZTA 1PTGA 5FJPA 1OFQA 3T0TA 4U5IA 1ADOA 3APGA 4UNKA 2P0IA 4MKNA 3WD4A 3QPZA 3TYBA 3PTDA 1RR2A 2DIEA 3QR0A 3MCNA 3N19B 4I9MA 2AKZA 3GY1A 2ZA3A 5D2XA 1NF0A 5A1AA 1QTWA 3R2GA 1P48A 4JTAA 4IPIA 3S9IA 3LCGA 2CU0A 1JGMA 1PEZA 3UWUA 3VOIA 2XG9A 3PZ9A 2VR2A 1KM2A 1Y8BA 3E12A 1YPIA 4W9TA 1J12A 4ERIA 1XW8A 3UR5A 2CHNA 1V8EA 3MKCA 4AQLA 3JW7A 3DG6A 1AW2A 2CIPA 2D2GA 3BG5A 4WDUA 1Z41A 2W3ZA 4J3VA 2BY2A 1YDYA 3GHRA 5XINA 4C6QA 2PPGA 3PWAA 3LRMA 4UMCA 2FPVA 2TRSA 3ARPA 2RH9A 1Q3NA 1PYFA 2VP8A 2OEJA 2QHAA 3W1UA 1M04A 4GI9A 4Q22A 3N9KA 1F3EA 3UJEA 1UBPC 2Y8VA 4GIEA 1QHPA 1I9CB 3LCFA 3USZA 4L7ZA 1TPWA 5M3WA 3KLLA 1A5UA 1C8QA 1XLHA 4HGXA 3FJLA 3WD2A 4UB9A 1JEZA 2QMKA 1YRRA 3RX2A 3U6WA 2VFFA 4BF5A 5D33A 1WDSA 4HP5A 1XLKA 3RX3A 5FF3A 1TJ2A 4UC5A 2WHLA 4I9AA 4M1RA 2WHKA 4D6HA 2CNCA 1TWWA 5A6JA 4PBEA 3NZPA 1CLVA 3TUUA 1DYSA 2RDWA 3BVJA 3S8HA 4RNJA 3P5ZA 1EB3A 1QNVA 2GUBA 2J7GA 2VGIA 5U7SA 1G4TA 1WXYA 2QDEA 5IBXA 1F6PA 1MO0A 3TFXA 1VFSA 1ZJHA 5C2XA 5M1TA 2Y85A 3NO3A 4BQ4A 1JZ7A 1VPYA 1P6WA 2B7NA 5C7HA 3WUGA 1EX1A 4JR5A 3NSMA 3DHFA 3AALA 1BF6A 1OF6A 2ZRUA 3RM9A 1V08A 4IFRA 3PAJA 4QGCA 3W26A 3W25A 1A5NC 4S3AA 3M5VA 3VX0A 2OSWA 3W75A 4L56A 2CLIA 1FFQA 3SJ3A 3NEVA 3WH9A 4CQ8A 2QR6A 3GDRA 1E4NA 4ZMGA 2PDXA 1ISYA 1HF6A 1R7AA 3S5SA 5EFDA 4MLJA 4DBWA 2Q8XA 3SIMA 2VGGA 1I2QA 4YYFA 5SWUA 2GLKA 4JTLA 4AD1A 4FXRA 2BOGX 5AZ0A 2VNCA 2F9RA 4ECLA 3J7HA 4YCPA 4W8AA 4GZ7A 2ACQA 3E2VA 2VC5A 3FJ4A 4O1AA 4GZIA 1F8IA 2O9PA 4O12A 2QDGA 4LCQA 6PTDA 4CQAA 2NWSA 5IHSA 2PLKA 4A29A 4QITA 3ATZA 4CEUC 4Q3MA 4IHCA 4YPJA 2ZXQA 4YTUA 5AVHA 3ZJKA 3H2CA 4MF4A 4O54A 2XVGA 5FF0A 4F0MA 1F73A 2JK2A 3LGDA 1YBQA 2X7WA 3PZQA 3CZGA 4FF7A 3NPUA 2CWNA 1KCLA 3UY8A 2OSXA 1I1XA 3LSCA 4GQGA 4R7JA 5BXRA 1JYXA 3BZJA 4J2MA 4XO6A 3C3NA 4P8UA 3P8IA 3W2KA 2EPKX 2KAUC 3BQ6A 3PPCA 3UXAA 2D23A 5LA0A 2J7FA 5BXTA 1T96A 3RCMA 5E9AA 3R89A 3TQVA 2ZUSA 1VGAA 1I1WA 1Q6QA 1W5MA 1PZ0A 1UIOA 3ANYA 3ES7A 3SURA 4AHQA 4IX2A 1E6ZA 2E5DA 3M0YA 3N6JA 3M5ZA 1H7RA 3VIPA 2QVHA 3CUIA 1MRAA 1H5YA 1FCBA 3HQOA 1E56A 3RAOA 1DQWA 4FIRA 4A6GA 3DERA 1JUEA 3QVQA 4WY0F 4JIHA 5LNUA 1FHDA 1WAWA 2QJIA 3GZ3A 2OXNA 2Y7EA 3TAOA 1N82A 3T09A 3BGGA 4JIPA 1YMYA 4QXIA 2FMNA 4Y2WA 4LF1A 1C8VA 1QASA 3F5JA 3BWWA 3ARYA 3CV6A 3AIVA 3W7KA 4D72A 3MSGA 2E5BA 4HA0A 4KMQA 3LLXA 1QBAA 2FDSA 2X41A 3FGCB 2NSOA 2ZX5A 3G1AA 3WF3A 4Z2LA 2P10A 3EWCA 1DVJA 3VC5A 3AIUA 5M03A 4XAZA 2W63A 3WLOA 1V3JA 3CUXA 2VRQA 3JZEA 5A6LA 1UR4A 5AHLA 3P6LA 2WNQA 3WFZA 3HBLA 1XYLA 3WX7A 7ODCA 4J35A 1XYCA 3BOFA 3BAYA 3H2FA 2DH3A 5A8GA 3NQ2A 1FWRA 3QHNA 1R47A 3ARZA 5JU6A 4P8WA 4OZOA 2NUXA 4WGXA 2PAJA 3BXWA 1VR6A 2ZX8A 3LMZA 2SFPA 3B8UA 3FDKA 3BTNA 3I6RA 3WELA 3WLHA 4OFCA 5CXPA 3WUEA 3VKAA 3URQA 3VGEA 4JDBA 3DFTA 4XD3A 1UR3M 2UV8G 5HOSA 4JICA 1VFFA 1UG6A 1VRXA 1US0A 2VC6A 3P0XA 3NL5A 4C90A 2EJAA 1AH4A 2CERA 1ITQA 3ARRA 4WD0A 3C8NA 4KFNA 2BVDA 1UOZA 2GDUA 2DUXA 5HJLA 4PCPA 1NU5A 4PUNA 3LHVA 4NL1A 1S2UA 2XIJA 4KERA 5AZ1A 4F2BA 3JS3A 3MV11 3ZLHA 1OC7A 2HXTA 4EXBA 4MM1A 4XZNX 2Q8LA 4EF9A 1PKLA 1XIGA 3FYOA 4OVXA 1BQCA 2UY2A 3N9SA 1UWQA 3H2AA 3V0SA 2AGTA 2QCGA 4NKCA 8RUCA 2EPHA 2G3JA 1ZTVA 3PTMA 4KCUA 5E9XA 2QDHA 4PMDA 1LCOA 3ZLFA 2PWUA 1LT7A 1BVWA 3MMTA 5EFFA 4X2PA 2R1KA 3ME3A 1SO3A 1CT5A 1LBMA 3AJ7A 2G8ZA 3UXDA 2C91A 4RL3A 2WSRA 1W3NA 4FZIA 4M29A 1BRLA 2CLPA 2FHCA 3V35A 1FWBC 1VLWA 3WFLA 2BP1A 4XD4A 2ZDSA 4NP7A 1OYAA 3EMZA 3FAXA 4V1XA 4K1WA 1V6UA 3R0DA 4LALA 1BYDA 3KRSA 4TTGA 1Z44A 5EU9A 2WVTA 3BLPX 1CWYA 1US2A 3PWIA 1UR9A 4H1ZA 1GOWA 1ZLPA 4D8AA 1A4LA 3GTIA 4ADSA 5FA5A 4IIEA 3DYOA 5IXEA 4RXGA 3WQDA 1XINA 3H53A 1V6XA 2NX1A 3R8RA 4R9XA 4WJXA 4DZAA 4OGZA 1HGWA 2J79A 1FWHC 3MUY1 5DXYA 1HGYA 3CHFA 2AAAA 1YE4A 5D2TA 5U4NA 4GNJA 2EPOA 1O1HA 3ZWTA 3PVFA 2DZSA 3K2GA 4ZXOA 1TPEA 1TA3B 5KITA 4P8VA 3LYEA 1Q65A 3N9RA 3SCSA 3GYEA 1TWIA 1X6UA 3OYXA 5TIMA 5KEZA 3L2LA 4B92A 3AHXA 4D8LA 4MJ4A 5IDIA 2OELA 3TC7A 1Q6LA 2OGYA 3SCVA 4OECA 4ZOEA 1LBLA 1A47A 3P81A 3BE7A 1FHLA 2BASA 1OFDA 2WM0A 3OIXA 1EP3A 5BW6A 4NF7A 4BEUA 1O6IA 4IPLA 5G4EA 4C6CA 4FNQA 1XCWA 1P0EA 1GVEA 2Y70A 4L6OA 1SFLA 1R3RA 1ZPTA 2LLEA 2ODOA 2GWGA 3VE9A 1BXNA 4YVVA 3ZR5A 4D8ZA 1DJZA 2C79A 3IJLA 1DHKA 3C56A 4MZ8A 1QR7A 3LEPA 3RMJA 1M6JA 4IICA 1EPXA 4UR7A 2JALA 1KXHA 4EPEC 1NOWA 1ICQA 2OVLA 3WK2A 4UFMA 4O8AA 1BVZA 2YL9A 1J6OA 3UU0A 5CPOA 4XTDA 3CV1A 3P82A 4OE7A 2GPTA 1FDZA 2CHOA 3R0KA 4AF0B 4AIEA 1EC9A 2X42A 2Q01A 3F2CA 3B05A 5DRIA 1X97A 2HS8A 3L12A 1DP0A 3HG2A 2OLHA 4IL0A 1TR9A 3DGBA 3N73A 8CGTA 3QXBA 2OX4A 1XRVA 1PUDA 2GQAA 2F2KA 5FCZA 3SAZA 1QI3A 5E1QA 4W5ZA 2QZRA 4AD2A 3V3WA 4HU8A 3LLDA 3NPWA 1ZP4A 1E5JA 3H23A 4H9ZA 3CQJA 4UFJA 5REQB 4ICMA 5EMKA 4GX9A 1Q13A 1X39A 2WJEA 1TELA 3DFQA 3UR2A 5JBFA 2RGMA 4D6GA 2L5HA 2V2DA 5JH2A 4XB3A 5LGXA 3F7JA 2C13A 4ROQA 7PTDA 3HGJA 2PMQA 4IGNA 6ENLA 3W73A 3FHAA 4US5A 7ENLA 2GFTA 1RJPA 1TPDA 4F2TA 1G67A 2JKPA 3QC0A 1LWHA 3BAWA 3NVTA 3L65A 1DJQA 1RCQA 1FCVA 2QCDB 3O2LA 4LBRA 4M3PA 2C16A 1TREA 1VPXA 1WDRA 6ALDA 2PRLA 5HNRA 3L2IA 2EJ1A 3HO8A 1XIIA 2DVXA 4Q8OA 2WANA 1J11A 1KFWA 2WMHA 1KBLA 3C0JA 4LY4A 4JX5A 4RJEA 1UP2A 2ZVIA 5GPRA 3KOZA 1K4HA 3ZZ1A 2F6KA 4I5RA 3KS5A 3GNRA 2Y5JA 4S2CA 4EK7A 4YHGA 4XWUA 4L80A 5C54A 3PZTA 5D03A 1LWJA 2WCAA 1W3TA 4AUBA 2R6OA 2PWEA 1UZDA 2Y0FA 3GX9A 4D1JA 4HNLA 1WPCA 2PRMA 3CZKA 4FB7A 2GSJA 5EBUA 3W02A 1TMHA 4XZLX 5HJYA 1TV4A 2TSYA 3E0VA 3RM8A 3QOMA 3HFYA 1BG9A 1IIHA 4LRSA 1PTDA 1HXJA 1D3CA 3W1AA 2GUYA 1LG1A 5BRQA 2VXNA 4HYRA 1EQPA 1DIDA 3AISA 4S3BA 5BOEA 1PJ9A 3TW6A 3S4TA 4EXAA 3GHSA 2ZZ7A 3M7SA 2I16A 4F9JA 2WKLA 5AY7A 3W1NA 3Q4DA 4DI8A 5F2MA 2XFFA 1HIZA 1XKYA 1CXKA 2DZAA 2YA2A 2A79A 5I3HA 1SJDA 2OG9A 5FEZA 3M4HA 1OY0A 2FZ9A 5DXXA 2H90A 2Y7FA 4AEOA 2PCEA 4ZE4A 3DXIA 1CDGA 1UWUA 1JXJA 5HQLA 4KCVA 5PTDA 2OT0A 3ORWA 1W1VA 3SGGA 1UR0A 2GQ8A 3IJ6A 2BLEA 4HNTA 4RR4A 2HVMA 3NA8A 5CZKA 5HBFA 3CB8A 3GAYA 1K8YA 4KWWA 5AC6A 2E67A 3RGTA 2PB1A 1L6GA 3Q2DA 3V36A 4EWND 4IIFA 2VI0A 6CGTA 4GVFA 4O4VA 1V6YA 2D2OA 3PPFA 5GQBA 2E6YA 4LV4A 2WHMA 4JN7A 1CXHA 1T40A 4UQDA 1J2BA 1K02A 3ZJ6A 4NHVA 1XJBA 2YDSA 3VMOA 4N6FA 5M5DA 3W7CA 4RXFA 6XIMA 1KRAC 1MI3A 2ZICA 3FAWA 3UQNA 1E0WA 4GH1A 4CQ9A 4MB5A 2J8TA 4B90A 4YVPA 2UY3A 3WDRA 4C6NA 5EMJA 3REQB 2DT1A 4MSSA 5HAOA 3UWEA 1HW6A 2E68A 3M0VA 4BFAA 4QJ3B 1CNVA 1O66A 4AU0A 3L4UA 3B8TA 2DW7A 3WH6A 2WKGA 4C6KA 4IMFA 3PZUA 2W67A 4GNVA 1SO6A 4CCCA 4IQLA 4Z1DA 4AHOA 4FP1A 1C8XA 2XIBA 4KETA 4UXDA 5F4XA 3UCCA 3AS3A 1H61A 3NO5A 1OZQA 2NVDA 3DEQA 3TN3A 2EG8A 3HMCA 5AC7A 4JTUA 5G2HA 1Q4NX 4K37A 2AGKA 5DBUA 2JF7A 3CIXA 3IEBA 1NY1A 4S23A 5LIUX 1I2NA 1MUCA 2VKZG 3WENA 3EKZA 4UTHA 3KOYA 3B9DA 4XG1A 1H7NA 5MHBA 2X40A 1UPPA 1W9XA 6TIMA 1IEQA 4NXSA 3ITYA 5AN7A 1GQNA 5F1VA 4MJMA 2CETA 4UFLA 1C7SA 1BEUA 1CGWA 3TONA 5CLTA 2QV5A 4YVXA 2GK1A 4F0SA 1NQ6A 3GB6A 3TDFA 3TWBA 4XD5A 1PAMA 4NSBA 4GMEA 3EDKA 2EO7A 5C9WA 3RR4A 1XDLA 3U7VA 3WBXA 4MYAA 2HROA 3C86A 2W6RA 3MI2A 4PMJA 4JDYA 3S2CA 1OM0A 1Q6OA 4GVIA 3WLMA 4PFMA 4GY0A 1E5NA 3QM3A 3G1RA 2V5DA 4JTEA 3OZMA 4HMNA 4NJJA 1G4EA 5FJOA 4ZSTA 4LAKA 5G4WA 1VBRA 1RAKA 1FY6A 3VNKA 2IPJA 1SZEA 1T7LA 1VEOA 3VIGA 3MCMA 1UD6A 1Q66A 3GFYA 5AOUA 3DIPA 3P60A 1VEMA 1PHWA 1AD4A 4DPPA 4WUIA 2PODA 2TAAA 3E2RA 4X22A 3SBFA 2YSWA 1O68A 3F2DA 1NARA 3PANA 4GIAA 5CPLA 5LNWA 3H2NA 4E5TA 1E9ZB 4P5UA 4DJDC 1X1NA 2ESCA 3TP4A 5LNVA 1RPXA 2XSBA 1S5VA 3WIJA 4ZTXA 9RUBA 3KZSA 1S38A 4N9BA 1F7BA 4UOQA 2OYMA 3FA5A 4AXKA 4I5XA 2ZZ2A 4EAMA 1TKKA 4HA3A 4AEFA 1HP5A 3C2FA 3CUZA 2A3HA 3FGCA 3MW7A 4NZ3A 1WX0A 2HQAA 1JFHA 4C5ZA 1P0KA 4IL2A 5BZAA 2FB3A 4RPPA 1BYCA 3KBWA 4XUYA 3MI6A 4H9MA 1ZHAA 3GXMA 3TOYA 3G6MA 2ZUNA 5LKYA 3NFUA 2GJPA 1J5SA 4DX3A 5A6AA 4US6A 2QULA 3ZVHB 2PS2A 4QDMA 1RQEA 4AYGA 1CTNA 1YYAA 2DEPA 3WQPA 5K4XA 4DF1A 1W54A 4S2BA 2YPIA 1FDJA 5H8MA 4MZYA 2CLKA 1OC5A 3UGVA 3AU2A 4F9DA 1WOBA 1W56A 3SUTA 1XIMA 5DY3A 3HGRA 1DJXA 2WMFA 1XKJA 1JF6A 2ZRXA 3B0YA 1QI4A 3FSTA 3IUHA 3QQ0A 3QV6A 1AFSA 3T05A 3WQVA 1AQHA 5FF2A 4A3QA 4DLMA 1H41A 2PWDA 1KRMA 4U33A 3N18A 1UUOA 2BSLA 3IGSA 1UD4A 3S5ZA 1ISWA 2QLYA 2YFOA 1EGMA 2FFCA 4Y90A 1XQKA 4KWVA 2D1ZA 3BZGA 4QM1A 1E0VA 2D0HA 4R34A 1R5YA 4PUJA 3DHDA 1U5JA 3ALFA 1ZQ5A 2J7DA 3H7UA 3R5EA 3JZUA 4PL2A 2YZRA 3VK5A 2VDHA 2RJHA 2D3NA 3AZSA 5C9ZA 4B9ZA 1ME7A 5HWNA 5EBAA 5I6SA 3G2GA 1MNSA 1GZGA 4IPNB 1YE6A 4Q8NA 1L9WA 4XV0A 3IGXA 4R27A 3H26A 1IIGA 3LZ3A 4O16A 3TFCA 1RV8A 2HXUA 3CYJA 3GTXA 4W89A 2CZEA 4ZE5A 5IOBA 5I0DA 4NILA 3E6EA 2VGBA 3N1AA 4IIDA 4AZ6A 4L5ZA 4A8NA 2F8QA 5DELA 4MUZA 3VFCA 3GDMA 5CZ0A 3W3OA 4GGBA 2E8YA 5LA1A 3UWWA 1KFCA 3A64A 2ZUWA 2YX0A 5D32A 4ZQCA 4UOJA 5T9CE 3GS6A 1GG1A 3SCQA 3WLTA 4EE9A 1OCQA 2BX7A 4XZBA 1MSSA 3TCSA 2ZRWA 4D6DA 3YPIA 1BQGA 1ME8A 2OPJA 1FQ0A 3VKDA 3C8FA 1N8IA 4DVOA 3WK1A 1PSCA 3MP3A 5KZ6A 4MAVA 1BHGA 2FPYA 1TPB1 1UMYA 3DN5A 3QFEA 1Q6CA 2UBPC 2J66A 3C0LA 3ELFA 3KHJA 2PUZA 4HVXA 3GSMA 4A4AA 3TMQA 1RALA 3WH5A 1NWSA 2O0TA 1T6MA 1YX1A 4QE5A 2G3MA 4LVFA 3V7PA 3LZ5A 3LBCA 2FHFA 4NZJA 4Z08A 3GIPA 4J3ZA 4XAPA 3W29A 3QJAA 3NZQA 3PC0A 3W6LA 2Z00A 3T44A 2EQDA 4ZB2A 2DZVA 4UQCA 2GVEA 1S3TC 3LBMA 4E3TA 4LUSB 3CL6A 3TH6A 1B3OA 3LCHA 4L6HA 2YBVA 1A0DA 4HU4A 1E9YB 1TA3A 1VAHA 3IAQA 3MZ2A 3IJ7A 2AOSA 2VVNA 2W4XA 4EKJA 2C0HA 3AYSA 2CZVA 1KBBA 1S5NA 3CIVA 1A0EA 4HOXA 3GH7A 4QE4A 1OT2A 3I7QA 4LAUA 1F8MA 4NAEA 3TN6A 1IF2A 1RUSA 2C8NA 4TO8A 3TJ4A 2PSNA 3H2OA 4BCEA 4W87A 4R3UA 4F48A 1EUNA 1G01A 2QCFA 5BWAA 4J40A 3TW9A 2XYLA 3PB0A 5LSMA 4EAYA 3V18A 4CKQA 5HUOA 3I4KA 2PGEA 4L4OA 3MDWA 3TZNA 5CCZA 1TIMA 3EB4A 4L4MA 1J0JA 4HQVA 2FVMA 1OG6A 1PTAA 4IFOA 1KGUA 2PEVA 1JCLA 2CPUA 4DM1A 3WK3A 1RY0A 1V0MA 1R87A 3RPTA 3BLLA 1VQTA 1GVQA 5BU9A 4FK9A 3M0MA 4MG4A 3UESA 4AF0A 3HGSA 4XZ9A 4AH7A 3PJUA 5JBDA 3G3DA 4PB3A 1BFNA 1M1BA 1O4UA 4GI6A 4IP7A 3W00A 2WW5A 4PTVA 3E49A 4QEHA 1S2TA 2WXDM 3OG3A 3IWPA 2J9ZA 3MS8A 3WMBA 4PCTA 3BG9A 3VGBA 4JFSA 2ISFA 1HJQA 3GR4A 3WD0A 3RF9A 2OQLA 2O55A 4LUJA 1X8CA 3SCTA 2DZBA 1QHOA 2QEZA 1OINA 2YL5A 4DN1A 3W7NA 3C2EA 4HD5A 1OF8A 2G41A 1WZMA 3BPWA 5REQA 4A3UA 1ONXA 4DAIA 1EF3A 4FX6M 5DT5A 1GNXA 3WQCA 2Z7GA 1DE6A 2XM1A 4JTCA 3CMFA 1D8WA 4J28A 1EL3A 3ERPA 5K4ZA 4DEFA 3LN3A 1J93A 4RNFA 2V5BA 1UP0A 3EOLA 2YOCA 2D24A 4H4IA 5DCBA 3SECA 5K3VA 3CWOX 2CFFA 2DH2A 4WKAA 1DQUA 7TAAA 4GI8A 4E2DA 3EWXA 4IZGA 5BOFA 3LGEA 1EKOA 4GCAA 3WLRA 4HCDA 1G7UA 3GC5A 3KBSA 3UG5A 2QCDA 3KCJA 1S39A 3W7OA 2WPBA 3AXIA 1V3LA 5CSYA 4KGLA 1JYNA 1UH3A 4P8XA 2ISWA 3FA3A 2PGFA 2DGAA 4KGJA 4WF7A 1AQ0A 3RO8A 3VIJA 3WBEA 3G0XA 3G3MA 5HULA 3C5QA 3T8LA 1PZ3A 4DPQA 4HHMA 3EKGA 3ZIZA 4HNVA 1YTKA 3S9YA 2FFIA 1R2TA 4FALA 1NDZA 3BSGA 1ZFJA 2EHHA 2PDHA 4U2ZA 2VCCA 4JEJA 4D2JA 3GFZA 2OTDA 4MDOA 1XDMA 2A6NA 1E3ZA 2ON3A 4LU0A 1Y5WA 4HJWA 2ZRYA 1XH0A 4RKAA 1S2AA 5CC6A 2PU1A 2BZNA 2RDTA 4MNLA 3ABRA 1XYFA 1QJWA 2D2HA 5B7YA 2Z26A 4RE2A 1EO7A 4WX2A 4YNGA 4HNCA 4Y9MA 4H6RA 1G94A 3UR8A 4H9TA 2DSWA 2Y4SA 2VR5A 2YIHA 3WQOA 1U22A 1XLIA 5AHFA 2YCJA 1XUUA 2EEXA 3II1A 5GJNA 1FKXA 1AD1A 1M01A 5A3HA 4PB4A 1DXFA 2Y6ZA 4H9XA 3GWQA 3WBWA 1LDCA 4IMEA 3STCA 4LY8A 2G3IA 3VD4A 1HKMA 1XLLA 4LS2A 2W27A 2FB2A 3RRAA 1M7OA 4PBFA 4C60A 4Z2KA 3MKKA 3H4WA 1H5VA 3CZJA 2V5JA 2I1OA 3R79A 3WDPP 3OA5A 3SM0A 2GDQA 2XIMA 3K8KA 1IE7C 5EMYA 4AW7A 3W7QA 1LROA 2IKJA 1WAUA 3SRKA 4CNNA 4ATLA 4Q4KA 1QFEA 1OZMA 2V69A 4UQEA 3GU1A 4PTDA 3M46A 2WSPA 4GKTA 4KEVA 5BXSA 1CB2A 2PDFA 4C5YA 3SO7A 1W1A1 3M47A 3NQFA 3T4CA 1JIBA 2P1FA 1POJA 3W2UA 1PCKA 1MDLA 5LIWX 1BGAA 3UZWA 5FOOA 3FEMA 5LIXX 4EF8A 4GYPC 4CNTA 2ZFAA 3QYQA 4S3KA 3M7WA 5C7VA 2VD8A 1X96A 4QG6A 2X1RA 1REQB 2P8CA 3WF4A 1ZAHA 1JZ4A 1QI5A 4WVXA 3UVAA 3MWCA 2GGEA 4DM2A 4IQDA 2VDIA 2H8XA 4NUWA 2WCSA 3IUDA 2HBVA 4N42A 1UR2A 1KBJA 4AWUA 4K8EA 4POCA 5C2GA 1UH2A 4MPQA 3AXMA 1G0CA 1GHSA 3BLIA 4KPLA 1TCDA 1DORA 4HYWA 5ABEA 5TBOA 1M7JA 3SCUA 9XIAA 2H6RA 1HJXA 4KFOA 2CZ5A 1EEXA 4BY3A 1ZAJA 2PWHA 5CJNA 5LIKX 2NUWA 2X8RA 4M81A 3N2XA 4YXGA 2KZHA 3BSMA 3CAWA 3VTRA 4NI8A 3L9CA 4B4FA 2VD9A 1R46A 1C29A 2DJLA 3K8MA 5DCDA 5LNSA 3KL0A 3U3HA 1XIEA 2J78A 4FX7A 2A21A 4A05A 4RX0A 2QW5A 2WC3A 1MW2A 1SSGA 3GLCA 4S3GA 2OEKA 1HVQA 2FGBA 4HIBA 1M9HA 4S38A 3W6YA 5CPQA 3LB0A 4HK5A 4H19A 1J4EA 1KQYA 3SQMA 1S2WA 2Y5EA 2HNHA 5AHIA 2D0FA 2WSYA 2POTA 4Q4PA 2V5LA 3G1SA 1W1YA 1W1PA 1A49A 2RGLA 3BAXA 3GNPA 3CUHA 4TX9A 2BTMA 2QIIA 1ZBKA 1TRDA 4AIUA 2WKJA 3LCXA 2W91A 1OWQA 1ZCCA 2HK1A 1OGSA 2TMDA 3W24A 4FAMA 4B3LA 3T40A 3KCLA 3VOHA 5FD0A 2XH7A 2Z25A 3KUMA 3DC0A 3W1MA 4X2RA 3O6YX 3WQ5A 3VC6A 4MDPA 3KBMA 5A8NA 2IQTA 3RK8A 2G5WA 1X98A 4I8YA 3GIQA 3M43A 2EKGA 4DF2A 1TTIA 4EXQA 1EWEA 2INEA 3IIPA 5HWJA 3UPWA 5CAKA 4NZ4A 3V1HA 2BVYA 2QJGA 1SR0A 5MKGA 3H2MA 5FEXA 4GISA 3OEXA 3OG2A 4KCWA 4GCXA 1NOUA 3RHGA 2PDUA 2CEQA 3RCYA 4NZ5A 1RK5A 4KH2A 2ISSA 2OOGA 2W0UA 2VX4A 1OFOA 3NDYA 2J4GA 3OBAA 5HUPA 4IX0A 2X0HA 2GUUA 4UMAA 1SFSA 3RRXA 1E72M 1B3YA 4NJIA 3UD6A 3KAOA 1G6CA 3TTSA 4UMBA 2GSEA 5LIYX 5HPCA 5LNRA 4CN1A 3DFHA 1E4MM 2ZDRA 2EKCA 1LQ2A 1JQVA 1F3WA 3UJRA 8A3HA 3EDDA 2Y62A 1V4YA 1YXYA 1V3MA 4K6AA 5KZDA 3CAQA 4PL1A 3A4JA 4GC4A 4AIBA 4RK8A 4MYXA 3KCOA 3LQGA 4QISA 2A3EA 1WKYA 3KP0A 4J5NA 1V0KA 1W5QA 2OZ8A 4E8DA 4P7RA 5CPTA 4GQ0A 3ZVHA 1QATA 4ERGA 2GJRA 4MFDA 1RD6A 4N6EA 1O5RA 4JTHA 3QQ1A 1WKEA 4O18A 3IUIA 4AY7A 4CD6A 4PUUA 5ECVA 1WUEA 2J27A 1WE5A 2AL2B 4Y6GA 3DECA 1N55A 4R53A 4XBKA 2J25A 3T78A 4WK9A 3M41A 1MEHA 5JH1A 1XM3A 4DWSC 4F4RA 3ARSA 4O53A 2WAGA 5F1UA 3GXIA 1EO5A 3VO0A 3WJWA 4QR6A 5JQ9A 3CO4A 2VENA 3NIYA 4MAZA 4DQWA 5DT7A 3LPFA 2O9TA 4A2SA 4HA4A 1UA3A 1ZJAA 3PJTA 3CL7A 4AXNA 2UZ9A 5DQPA 2XIQA 3QC3A 2OO6A 2NT0A 3L4XA 1F61A 4S3CA 3UG8A 1Q2RA 1V5XA 3UF9A 4I7UA 3TOPA 1OCJA 1PIGA 4ZO7A 3P62A 2X16A 1P0NA 2Y1HA 4ERAA 2QUMA 3I4EA 4WJ8A 3VKKA 1LUCB 1TZZA 2I5QA 2E3ZA 1LTDA 3ID7A 3EA2A 2J6VA 1ODUA 1KA9F 4CVUA 4C7FA 1K8ZA 3ZO9A 3UZJA 3NSXA 1U1JA 3TN5A 3IJIA 3QR1A 1NM9A 1CI1A 4K8HA 1XHGA 4G8TA 3W7RA 1BGGA 1HJUA 1WDPA 4FSAA 1GYNA 1KRCC 1ME9A 1XICA 2PLJA 4FR6A 3I3EA 4FF5A 4FXFA 3AXXA 4Y7EA 4JQ2A 3LM7A 3OZYA 4PR4A 1OYBA 3URNA 3B8IA 4JTFA 1FH9A 3EX3A 3BL3A 1W91A 2VFHA 2F6UA 4EWJA 3VIFA 4AHPA 3JVAA 4PCNA 2AAMA 4INFA 3M0KA 3BGJA 3IAPA 2VZUA 4ZO8A 4S1FA 3CQKA 1JCXA 3O0KA 2VEMA 2DZUA 4GK8A 3BH4A 3NQCA 4UTTC 3LOTA 3E0FA 2J47A 1Q7ZA 1TV2A 3WYZA 1S5MA 1L6FA 1M65A 3EWZA 4J4KA 3VCNA 2G3NA 3UWQA 1ZBCA 3HQNA 4JEQA 3NPXA 3OVQA 3GKFA 3IK4A 4CVWA 4YWSA 1UKTA 7CGTA 2OODA 1Q63A 3P2VA 2ZZ6A 3QMTA 4BWLC 1FHUA 2EAWA 5H8PA 1KXTA 4PTNA 1OGBA 2VCBA 2EPMX 2QCNA 4UQ9A 5D30A 4GXMA 3M6DA 3VKBA 3DCPA 4IM4A 3TK7A 2PFHA 3W76A 1SPQA 4XIAA 1ICPA 3AFBA 2A3CA 2D0GA 1H11A 4IGSA 1EXBA 2HBXA 2X0SA 4FNUA 5E0FA 1QK2A 3ZVIA 1UD2A 2RKXA 4DZIA 3S2MA 5AHMA 1DJYA 2PD9A 1LG2A 3E2SA 2HISA 3NQ6A 3VIKA 1UWTA 4H04A 3AS2A 3GTHA 3IV3A 3EWBX 4C6EA 2OU4A 3W86A 3ABZA 2XUCA 4GACA 2QT3A 1WXZA 1O95A 3TV8A 4F0RA 2VJXA 1PE1A 3T0AA 3QSTA 3NDOA 3TU9A 1UWRA 2G4JA 4NX0A 1J01A 3BLEA 2Q3RA 1JCTA 1B9ZA 1KKRA 3GG1A 4BKNA 3LXCA 2YLAA 3M64A 1YKWA 2V9DA 2FZDA 4MY8A 4P7NA 2QCLA 1DJNA 3LRKA 1GPWA 5I2UA 1HL2A 4WGHA 3UYIA 4A8IA 2VX6A 1QWGA 4Y8EA 1PBGA 1EYWA 4AD4A 3GW3A 4TMBA 2XN1A 1WP6A 4JYEA 4NVTA 2YKKA 1TJ1A 5E6ZA 1GGOA 4GFSA 3VM5A 5D2VA 3PJXA 1P6BA 1V79A 3LI0A 3SR7A 4GUIA 1C9DA 1VFMA 1TPFA 2DSKA 4CCEA 1VBUA 3Q45A 1QW8A 3WL0A 3T0CA 1DWAM 2AMXA 1SZRA 2XU2A 1MNZA 1CX9A 2B7OA 1OIMA 1WZAA 4XSMA 1DWGM 1R8LA 1NSJA 3VGGA 1JDDA 2GQ9A 2NWRA 3ABOA 4NIRA 4O0QA 1RLDA 1TUXA 2TYSA 1OX4B 1HN1A 1V3KA 3CV7A 1E6QM 1OD8A 4GQBA 5BOOA 4CD5A 1B4EA 3OLIA 3L21A 4LUIA 3TVAA 4CQDA 3FY1A 4PTWA 4HJFA 1R3QA 3GG7A 4MB1A 2IW0A 4HBKA 3HN3A 2PDCA 3DFSA 1JRBA 4XISA 4KWOA 1E43A 4PMNA 2DQWA 3A23A 4DJED 2ZA1A 4O1FA 3B04A 1GOXA 3AU6A 4XKYB 4GRSA 3PB2A 6A3HA 1WB0A 1DV7A 2I9UA 3GVVA 3F2BA 3K5XA 4GH3A 4BF9A 2J13A 3MANA 1AVAA 1E55A 1CPUA 3MY9A 1KFEA 2VMFA 2BVWA 2PURA 4C6JA 4LYQA 4ORMA 1H2JA 4AD0A 1I0DA 4PUEA 3AI0A 3QGVA 1JPIA 3EDEA 4MMWA 4XIMA 1LZOA 3FN9A 3O6AA 4GVHA 5IBXC 4M8UA 2EXOA 4ATDA 3APTA 5HNTA 4L1WA 1X38A 3ZJ8A 1HL9A 1GOKA 1Q7QA 1R6WA 1MUMA 3WQFA 2INZA 3CQ0A 1P43A 4LB4A 1EOMA 3PTKA 1PKMA 1YDOA 3VZYA 3QOKA 1OX6A 4EIVA 2QJHA 1KW1A 3GXFA 4JFUA 3GNNA 1K7EA 3BANA 3B06A 3P7YA 2XJ7A 4OBTA 3NTYA 4RV3A 1IXNA 2IS7A 3AIRA 1QBBA 1K1DA 2G96A 2V2CA 3O0FA 4JN6A 5FIPA 2OKTA 1HJVA 4B5NA 4IIGA 4CCZA 1YQ2A 1D7KA 2V38A 3CLMA 3GTNA 5HR6A 5CSSA 3AQUA 1JPMA 1E0UA 1RP9A 1HO1A 1I8JA 3A47A 3LS9A 1HKWA 3GVGA 3IRSA 2ZX6A 4HMDA 3PZNA 4UCFA 1FWIC 2QV4A 5FJTA 4FLOA 2Z6IA 1QT1A 1PL9A 4TVUA 2R24A 4UTJA 4ZOCA 1R0MA 1LL7A 1FVPA 3HG5A 1HX0A 4X9SA 5A8QA 4B5VA 1GT8A 3FKRA 3FVMA 1CXEA 1XCXA 4PA8A 1Z48A 4QP0A 3QTPA 2QUVA 4UZUA 2RFGA 2CCRA 3UGRA 2NW0A 1O5XA 1P1MA 3EX4A 5AC5A 3VGDA 5F4WA 3MUAA 1PZ2A 4JIEA 2RDUA 1MEIA 3BCFA 3SDOA 1F3XA 3D46A 3H4GA 4HU3A 2FTPA 2VUYA 1AK5A 1TIWA 4DJEA 1HKIA 4O8RA 4JY9A 1JYVA 4XX6A 3U0HA 4LUTB 4GZEA 3A3XA 1D8CA 1P6CA 2ZOXA 3EWDA 3VIOA 1KBKA 1IGSA 1R85A 3THQA 1KM5A 3WN6A 3MVTA 4OBSA 1QNPA 3W88A 1REQA 2JIWA 1EP2A 3C0QA 3VABA 1JULA 2ZADA 4ZOBA 2X1UA 4ACZA 2DSVA 2PD5A 3UYCA 3FJ6A 1ZBVA 3PAOA 2VOTA 3AHZA 4Q6JA 2NQHA 1PYMA 3WDHA 1SMDA 4MKVA 1EJVC 1SVDA 3W9ZA 4GJIA 1H7PA 3R11A 1JZ3A 5E5CA 1W17A 1N8WA 3KEHA 3ZQ9A 5I09A 2Q02A 5G1MA 2A1YA 1TQJA 5D4YA 1IHIA 1EEPA 2YLLA 1JZ6A 4OUIA 2O56A 3O6CA 1JDAA 2GYIA 4YTQA 1VENA 4FOUA 1B5TA 3UPBA 4OIFA 1QXLA 1SGJA 5J8LA 2EF9A 1XLCA 1BWKA 1RPKA 4QDWA 4TU1A 1YNQA 1TV7A 1FWGC 4GBDA 5C2CA 1JL8A 4HU0A 3IIVA 3G8EA 5CPSA 2FH8A 5D8ZA 3EA3A 1AG1O 2GQ3A 3CLWA 1XGZA 1H1ZA 3FYPA 2VM8A 4N7QA 2QAFA 2E09A 5E6YA 5BU6A 1ZL1A 3ITGA 4P7QA 3BOXA 3E2QA 4O50A 1S2CA 3UT0A 4NZ1A 4D1IA 4DWDA 3BOLA 2D3LA 2PBGA 1NWRA 3GM8A 4FHAA 3S6OA 4U3AA 1YNYA 4GWEA 3WNOA 3PBYA 4WCJA 4G5DA 1GOOA 4E4PA 1KCXA 3M5YA 3QMSA 3AYRA 1B3WA 1UKQA 3VDAA 1H63A 1V6VA 1XPYA 1TZ9A 4XVDA 1GOMA 3KE0A 1X8FA 3GBDA 3AAMA 2TPSA 3CHDA 3QH2A 4O13A 4R7OA 2Z28A 3EOUA 4X9YA 3VNDA 3SFWA 4JX6A 3K1DA 4AVNA 1ONWA 1XLEA 2YA1A 1GQLA 2DIKA 1ZSXA 2QKFA 1J79A 1G7VA 1UWIA 2YXGA 3N4FA 2CLMA 4P61A 1Q7MA 3TYEA 4JQ1A 3W4RA 3EPNA 5D2WA 3ZJ7A 1YIXA 3UG3A 1JCJA 4I8DA 4S3EA 4C7DA 1X6LA 5I5RA 4MJ2A 3WJXA 2NQ5A 4ADUA 4C6BA 3MVIA 2P0OA 2XWDA 2C1GA 5AVNA 1QNQA 3S42A 5M17A 2GSHA 3BO9A 1PIIA 3PNZA 2WLZA 3PF3A 1TPH1 4WZHA 4Z0SA 3RO6A 2VX5A 2Y88A 3RDKA 4PMQA 3LHWA 3W22A 3PJWA 3TA9A 3WQEA 2ZZ5A 3RUBL 1UUQA 1JG9A 4PZVA 1BTCA 1EF2A 5J5DA 3NZRA 4XZHA 3LMYA 3QZEA 1A0CA 4MJZA 3W2NA 5HMFA 4B2DD 2E0PA 3A22A 2WZIA 4AC7C 3PZMA 4HZ7A 2Z1KA 4W7WA 3WUFA 1WDDA 2BGNE 4DWSB 3OP2A 3S47A 4LF2A 2BHZA 3TLQA 1CGUA 1WKFA 3T2OA 1TB3A 3P5YA 4HTYA 4W8LA 3SCRA 2EPNA 3CPRA 3RLHA