4HU4A

Crystal structure of eal domain of the e. coli dosp - dimeric form
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
247
Chain Sequence
RLVLGAALKEAISNNQLKLVYQPQIFAETGELYGIEALARWHDPLHGHVPPSRFIPLAEEIGEIENIGRWVIAEACRQLAEWRSQNIHIPALSVNLSALHFRSNQLPNQVSDAMHAWGIDGHQLTVEITESMMMEHDTEIFKRIQILRDMGVGLSVDDFGLPVTEIKIDKSFVDRCLTEKRILALLEAITSIGQSLNLTVVAEGVETKEQFEMLRKIHCRVIQGYFFSRPLPAEEIPGWMSSVLPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oxygen sensor protein DosP
publication title Structures of the catalytic EAL domain of the Escherichia coli direct oxygen sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,hydrolase
total genus 61
structure length 247
sequence length 258
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00563 EAL EAL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.450 Alpha Beta Alpha-Beta Barrel TIM Barrel EAL domain 4hu4A00
5MF5A 3GG1A 3U2EA 4F3HA 3SY8A 3KZPA 3PJXA 2R6OA 3N3TA 4KIEA 4F48A 4RNHA 2BASA 4RNJA 3PFMA 3TLQA 3GG0A 4Q6JA 4FOKA 4LJ3A 4FOUA 4Y9NA 4RNFA 5MKGB 3GFZA 4AFYA 4HU3A 3PJTA 4Y8EA 4Y9OA 3HV8A 4AG0A 4FOJA 4Y9MA 3PJWA 4HU4A 5MKGA 3HV9A 4J40A 3GFXA 3GFYA 4HJFA 5M1TA 2W27A 4ES4A 4RNIA 4Y9PA 3PJUA 3S83A 4LYKA
chains in the Genus database with same CATH superfamily
1A50A 2VFFA 3CUHA 2DIJA 5FJIA 1EXBA 1QPOA 3PY2A 3KCLA 2GSJA 2WHKA 1RAKA 1VLWA 3N73A 3PTKA 1VD6A 4U3CA 1QPKA 2OO6A 1PHQA 4WGXA 4WJXA 4H9TA 3WK2A 4DWSB 3OGSA 1ZAJA 2IUZA 3P84A 4O1AA 4AY7A 3FNDA 2Y89A 1DWFM 4HMCA 1W5NA 3QSTA 4TUFA 4S3GA 4O8AA 4CU8A 2WWCA 2J7EA 1E6ZA 1Q45A 1AUSL 1E0TA 4QQ3A 5EY5A 5A69A 2A3CA 2PTDA 5HNTA 1NOWA 3WF2A 1QNVA 1EO5A 3KWSA 3BANA 5C71A 1WUFA 2OR2A 1PCKA 1SFJA 1I75A 2OT1A 3N11A 4FR6A 2ICSA 3K1DA 1JYXA 1H11A 4F0KA 3C61A 4Z2IA 3KVKA 3P8IA 4FIRA 3T4CA 3VM7A 1QPQA 4AD1A 5TD4A 1KFKA 2PDXA 1NFGA 4FZIA 3DDMA 4IMDA 3VKAA 4ZSUA 3VINA 4FIQA 1H7OA 1X97A 2OWWA 4Q4KA 1XL9A 3LB0A 3AI0A 4XV0A 1LWIA 2DU2A 1SFSA 1SQ7A 3O3RA 4UTFA 2WK2A 3BV7A 2Q6ZA 1JVNA 4S3AA 1QI4A 2NWSA 2VT0A 3RO8A 4Y9MA 3K8MA 2DSVA 3U3HA 5KZDA 4TVCA 2PPGA 4NAEB 3E2VA 1MW2A 4CEUC 1S2WA 4QDMA 5EMYA 1RBAA 1S46A 1NM9A 2PDGA 2FGZA 2Q8ZA 2G5WA 4O10A 2DIEA 4KRUA 3W1AA 2Q8LA 4AHQA 4GYPC 3EX3A 4ATDA 3WNPA 1AFSA 4QNEA 4PFHA 4F66A 5DY3A 1BVZA 3KRZA 1RCOB 5AVHA 2CESA 4RZ4A 3EWBX 4GUGA 4WY0F 2Z29A 4L4LA 2GUBA 3PTQA 1SMAA 3QZEA 2C14A 4CN4A 2VR5A 3ZZ1A 3AC0A 1UYQA 3MMTA 4OUIA 4MKVA 3W88A 1ZTVA 1NDYA 2WMKA 2OELA 4JHOA 4NZCA 4CQ9A 4R7WA 2BHYA 2J9ZA 4IICA 4J3WA 1EKOA 2YLLA 3OZPA 4JNZA 1JYNA 1FHDA 2DPEA 1W8SA 4S2BA 3A4JA 1H7NA 1XCFA 3T55A 2INFA 1OK6A 3M41A 3HG2A 4N42A 2OWCA 3M47A 1JPIA 3F03K 2V67A 3ZFHA 4MKNA 2HSAA 3T4WA 1UUMA 1V6UA 3GTIA 1G0CA 1W56A 3CYJA 4OIFA 1GYNA 3ZR6A 3EXTA 7PTDA 3KOFA 4GC4A 4N6EA 2EG8A 2EBNA 1AH3A 4JGDA 1C8XA 3JR2A 5I7GA 1US3A 1KGXA 2Q3RA 3P5YA 5CG7A 5D32A 1I8JA 2XIMA 4XTDA 1TE1A 4HSOA 1TREA 4PTVA 4O17A 1HGWA 2BVYA 5FACA 1H1YA 3CV1A 1TKKA 8XIAA 3NUKA 4FNPA 1K9TA 4IISA 3DAQA 5FF2A 3IUDA 4M81A 2ALDA 4GH3A 4ZQCA 1V5XA 2XUCA 4DJDD 1NDVA 5EA9A 1UUOA 4UNKA 3UGVA 3PB2A 1JGMA 4UXDA 1QPRA 4I8YA 5GNYA 1EIXA 3WQDA 3CZEA 1SZNA 4LF1A 5FOOA 3W2KA 4IIGA 3STPA 1SU5A 3GG0A 1AODA 4B5UA 1H3GA 2FVLA 4L1XA 4XIAA 1TPUA 2OZ0A 1LOLA 2E0PA 3PP7A 1WDDA 1EA9C 3RAOA 1JEZA 3HG5A 3AS3A 3S83A 3GYCA 2V3FA 4TOQA 3MHGA 2ZADA 1B4KA 4MGGA 5A6MA 2BFGA 5B7ZA 3R0KA 4Y9NA 3KXQA 1WDRA 1UR1A 2VRQA 3N9RA 4LX4A 4TV5A 2Z7GA 4L4OA 1FCUA 2QDEA 1REQA 5AHLA 4KF1A 1P0EA 4RJEA 4GQRA 5DQPA 3WLLA 2IQ0A 3XISA 1FWEC 3NR0A 1GHRA 5HQEA 3ATYA 4AXNA 1XDLA 3OG2A 1P0KA 3ARTA 1FTXA 2NQLA 4AUBA 2CKRA 2I1OA 3OLIA 3GU2A 4CNUA 4HBKA 2NLIA 2DW7A 2JK2A 4ZQPA 2CLLA 2GGHA 1TRDA 1WXZA 3PBWA 1QHZA 4MZ1A 2BY0A 1PZ0A 4HZ8A 2PC4A 4N4QA 1WBJA 3AJ7A 1ONWA 3H24A 3FOKA 3LRKA 2VFGA 1W3JA 2Y8VA 3ARUA 3C8FA 2G96A 1OABA 2GJPA 1KKOA 4UWMA 2DZXA 3RLGA 4G8TA 3PJXA 1ZP4A 1QK2A 4WDTA 1D2KA 3R4IA 4UFKA 3S2MA 4XK2A 1GORA 3I4EA 4KCWA 4X60A 1YPXA 4MB4A 4OTKA 3EB3A 1M01A 2E6YA 3WNLA 2P3ZA 3GG1A 2BXYA 3LUTA 3PR2A 1UIPA 2FQIA 1WDWA 4IIEA 4LYRA 2TPSA 4PB4A 1KBJA 4US6A 3LI1A 1W1IE 4B90A 5G4HC 4MDPA 3M16A 2EKGA 1R2TA 4CVUA 1Q85A 4ATLA 1X6NA 5M3WA 2QUTA 1G1YA 4K7VA 3STEA 2F2HA 5I03A 4OE7A 1L2QA 3H53A 2XH0A 4R53A 2ZE0A 2CZDA 2Y8UA 1OCBA 1RBLA 2EGZA 2YA2A 1FDJA 3QM3A 3QKEA 3A4WA 3GG7A 3C2YA 4C7FA 2ZVIA 3B8SA 4B4FA 1AQFA 1WNOA 2IPJA 4I6KA 1UQYA 1TCDA 2CLFA 2VQUA 3W07A 3SQMA 4D1IA 5FSDC 4MAZA 3R8HA 2R6OA 3W7LA 4KCUA 1T5AA 4ADSA 3ZVIA 3WQ4A 4ZSTA 3W87A 1WKEA 2QJGA 2VZVA 4FNSA 4IPIA 3GVGA 2WNNA 1VZWA 3BAKA 2GGEA 1EL3A 3W3OA 2OFJA 4RNJA 3MC5A 4GVIA 2ATMA 5J5DA 4MDOA 3UWWA 3P62A 3UBPC 3C56A 2PDIA 3SAZA 2FZNA 1G67A 1VEPA 3M64A 1EHNA 1JZ4A 3DZ1A 1BG9A 4QJ5B 4D6GA 2PLMA 4Z1DA 3EOOA 1TPWA 2IXVA 1HKMA 2CPUA 3QPZA 3KLLA 2PTWA 4L56A 1U1UA 4KEZA 1HVQA 3CH9A 1TMQA 2CFFA 4PB5A 4WSKA 4CD7A 1EB3A 1VJIA 4FX7A 3LCIA 2WW5A 4Q4PA 4V1XA 5HNNA 3WLOA 5A8PA 1ISYA 1PXGA 2I7GA 4HPJA 2PDFA 1L6YA 4K37A 2GZXA 4GA8A 5KINA 2HVNA 1CI1A 3QOMA 1S1PA 2QUUA 2QLYA 3UZZA 5HQLA 3R10A 5JH2A 1EEXA 4I9AA 3BG5A 1FXPA 3LV5A 5D09A 2GQ8A 1GG1A 2HVOA 4E2VA 1PUDA 4NYYA 4A21A 1RD6A 4B2DA 1HJVA 4KW2A 1DKWA 4YU1A 1FH7A 4JEQA 3LOTA 3NZPA 2OCZA 1J2BA 3H2MA 1HF6A 1ICQA 2H9AB 2YYUA 3G6MA 1S5NA 2X2GA 1PX8A 4YLWA 4HKPA 2OKTA 3BMWA 5FAJA 1V7AA 5BXRA 3AZTA 2D2OA 2VX5A 1GTHA 4XBJA 1V93A 2FZBA 3Q4DA 2FVMA 3TN3A 3ITOA 2YBTA 1XLFA 4R9XA 3ZIZA 3W1LA 3CXOA 2DSKA 1XLKA 3D3FA 1TJ2A 1UROA 4KBXA 1J79A 4LEFA 1L8PA 3SCRA 1M04A 1MZHA 3AO0A 5CSRA 5IXEA 3VXGA 1ZAIA 4DF0A 1UKSA 3TTYA 1VYRA 3RX2A 1UPPA 3I4KA 4KRZA 1TWDA 1KRBC 2V5DA 3SZ8A 2VFEA 1KM0A 4H8UA 1P7TA 1XRVA 4IMCA 4A8IA 5LIXX 3EPMA 1TVPA 2ZZ5A 5EMLA 4ZXOA 4RPPA 3G1FA 1ICSA 2QCNA 5A95A 1DTUA 3N2XA 1W1YA 4PUKA 3WLRA 3XINA 2QYGA 1DJQA 4UQBA 5FD0A 2ZUUA 3UWZA 2A3HA 3ZLGA 2YDSA 3KOYA 4MOZA 5AHMA 3AMLA 2C15A 3RR1A 3HQOA 3W7EA 1JFHA 1P6BA 3CU2A 5IDIA 3VFLA 3FA3A 4HNCA 2WSYA 3PZVA 5C0QA 4L1WA 5HPCA 1J5SA 2BGQA 3I7QA 1W54A 3THCA 4FEZA 5I77A 3ZJKA 2W79A 2P50A 3B4YA 3MMWA 3IAQA 2G3MA 3H54A 4WSJA 4DELA 2BS9A 2DVTA 2POTA 3TYZA 1THFD 2J7BA 5DXYA 5GJPA 3KVMA 1H51A 2BXVA 5HUPA 4QG6A 5LNWA 2D2JA 2ZRXA 3AXMA 3POHA 1R2RA 4O4WA 4Q6JA 1Q8AA 3F2CA 3D6NA 3C2FA 2Y24A 3JVAA 4IPJA 4J7RA 4GX8A 4MY8A 3OYZA 4JIIX 2OLAA 3NQBA 3BGGA 1E1EA 2X0YA 1TPEA 4ATWA 2C91A 4WQ6A 4UTMA 2HMCA 3SADA 3G1AA 2Z1VA 4IXXA 3QFWA 1ZFJA 5JH1A 4N0RA 5A6AA 1XLAA 3WMSA 2VCAA 3KCOA 4R7OA 3HB9A 4W88A 2Z4GA 4C6PA 4IFKA 3UFYA 6A3HA 4TMBA 4XAGA 4N2YA 2I57A 3DC0A 3AS0A 4M6UA 3BW3A 4KCVA 3B0PA 1R3WA 1CXIA 1FHVA 3M7SA 3ITTA 4TX9A 4JHMA 2WVVA 3VNMA 3QMRA 5G5IA 4E38A 4TX8A 4ZR8A 1DPMA 2G0WA 2DQXA 1W0MA 2F38A 4WZHA 1QXLA 1XIGA 1E5JA 4E2BA 4HQVA 3LGDA 1GVQA 1CLKA 2X09A 1MMFA 4Y96A 2C16A 3COTA 3TE9A 2UV8G 3NZQA 2CNCA 3P2VA 3G1VA 2WHMA 3PFRA 1Q6DA 2QPUA 1X8FA 1SO5A 1MEHA 1Q6QA 2PTZA 4W8AA 1P6WA 1VFMA 3NQ7A 3O07A 5ECUA 4C6KA 4ZB5A 4KEMA 5CKSA 4AVOA 4QIUA 4NI3A 1ICPA 4K36A 6TIMA 3MUCA 1P7TB 4ROQA 3RO6A 4PUUA 7TAAA 4CCCA 2ZRZA 3LHUA 4U10A 1PPIA 2OTDA 1YDOA 4B2DD 4GIAA 3MO7A 3AIVA 4KFPA 2CKSA 1UA3A 1IWAA 1F76A 1Z48A 1CWYA 5U7SA 1SW0A 3ENLA 3IIZA 3HOJA 4MZYA 1F6YA 3IUIA 3O6YX 2XFYA 4CCZA 3ITLA 1KC7A 5GNXA 4HOWA 4CNTA 3SSJA 4PMVA 1V3MA 3TQ0A 1QHOA 1OC5A 4C6MA 1XLLA 3O15A 4MHBA 3DG3A 4H00A 1S2CA 3PN8A 2P5NA 3CWOX 3RX4A 5JIWA 1OF8A 5HJLA 4C91A 1UCWA 4PODA 3QY7A 1SVDA 3L0KA 4JQAA 3N6JA 3EPNA 4IIFA 2VFDA 3LHWA 2PUZA 5LA0A 3O6CA 2VEIA 3M44A 6XIAA 2E6DA 1IV8A 2OGYA 3DHFA 4LQ1A 3SCSA 4MWAA 4C6EA 1D8CA 3PSVA 2WCSA 1J10A 1XUZA 3TP4A 1F2JA 1R47A 1AZ2A 4PTNA 3K5XA 5K9XA 3H2CA 4XZ9A 3TUUA 2HBVA 2WWDA 1E71M 4B9YA 2E28A 2YPIA 5DANA 3IIXA 3GFXA 2C1GA 3B8VA 1EF2A 1VBGA 3LRMA 4XO7A 1ZGDA 3NSNA 4JOMA 8A3HA 4H9MA 4WKFA 3BLKA 4XG1A 1GVEA 2GSHA 5D2VA 3FJNA 3AYTA 4PCTA 3DFNA 3UZXA 1JZ7A 3T09A 5K4ZA 1SJDA 3WNMA 2QS8A 2R1KA 1DIDA 4IFKB 4JQ4A 3PJUA 2CLKA 1XC4A 1HL9A 3UJ2A 1KWKA 4LVDA 5M03A 5D9OA 3SM0A 1QNOA 1WDPA 5BRPA 1BLIA 4C6NA 1JZ6A 2FHCA 2WVVB 1KFWA 3N3MA 4Z17A 1K3UA 4UQEA 4ALDA 5EKYA 2Z1KA 2VFHA 1G9HA 4M56A 5E1QA 2CIPA 3HF3A 1O5RA 5CZJA 3ZS4A 3WQGA 4DN1A 3AIBA 4H8HA 3L68A 3WUGA 4H2HA 1XPGA 3W00A 4DX3A 2X30A 4UOQA 3UF9A 2DZTA 4PUNA 2XGBA 1KXTA 2W27A 1W3TA 4A22A 1FVPA 3ANVA 4NILA 2QV4A 3BLIA 3OZYA 3FA5A 4P8UA 1LRNA 1UR3M 4P8VA 1AMYA 2PU1A 1WDSA 2CWXA 2VZUA 1HFBA 2QCLA 3W71A 1JJKA 4UR8A 2CETA 2Z6IA 1E6NA 1W1B1 4AWSA 1MRQA 3U5YA 4B91A 3GFYA 1UKTA 2WJFA 3CM4A 4CEXC 2VGFA 3ZYZA 1XI3A 2PGFA 2J77A 3R7MA 3PANA 1IIGA 5FEZA 4I5UA 5IBXC 1XYBA 1JZ8A 2WMJA 4IHCA 4LEQA 1YE6A 3ZMRA 1MQPA 3QOKA 3GC4A 4G6CA 2IKIA 2PWHA 3TC3A 3T8LA 1YW1A 3V4BA 1OVDA 4PCPA 1E3XA 3AUOA 4HA1A 4REQA 3CL6A 2AQVA 3OJGA 1UH2A 1SR9A 2BLEA 3RMJA 2Y88A 1UZHA 3MVTA 1PTAA 3GHTA 3OGRA 1XLJA 3MZ2A 3V3WA 4J3TA 3O9NA 3S5SA 3O8AA 4J2MA 4IMAA 4EXAA 3VK5A 4HT3A 1KD0A 4P5UA 1RA0A 4HYVA 3GXIA 5BOOA 4M82A 3BLOA 1GYLA 4Q8OA 3LGEA 3SGGA 3PF3A 2E09A 2D3NA 1XV8A 1PBGA 2Y1HA 1E9IA 1CENA 5E0KA 1UD8A 1KV8A 2ISVA 1JL8A 2UZ9A 5I79A 3A47A 1E6SM 3CQJA 4U2YA 3LQLA 3GS6A 1JPDX 1S3TC 3W38A 3EWWA 2OZ8A 5K7JA 4NJJA 1J0ZA 2PFHA 3EYPA 3HV9A 1EYEA 4GJ1A 4O15A 5CZ0A 3NQDA 4Q32A 3UU0A 4XAZA 2OPJA 4DY1A 3AHTA 2YB1A 3PC0A 4W5UA 1RH9A 4P7QA 2YCJA 1W5PA 4TTUA 3T8QA 5JBEA 3GSMA 3MDUA 3VI2A 4PEEA 2F6KA 5I2UA 4JQ2A 1WV2A 5RUBA 3W7CA 4LYQA 3S0CA 1A5AA 1NWRA 1HL2A 1H7WA 1RP8A 4EOUA 4WR3A 2G8ZA 3G1XA 5FJPA 3IV8A 1KR1A 2ZTJA 1XLHA 3L0NA 1ME9A 2CBJA 1N8FA 3UYIA 1Y8BA 3TYDA 1R2SA 2A6LA 3H4XA 2O56A 2QJJA 3G6LA 1C93A 4MAVA 1NDWA 3HV8A 2LLEA 1A5OC 1X39A 1JCJA 4JTGA 4U31A 3STGA 4AVFA 4GIRA 2NQHA 3CK5A 2PDYA 3C5QA 1KTNA 1TV3A 3VIFA 4ICCX 3AAMA 2FIQA 3VX1A 4QRNA 1BXBA 2QJIA 1HZYA 3AHXA 4RNFA 5LNVA 1A0DA 2XG9A 1ECEA 4FB7A 2PDHA 1J8VA 4J3ZA 1RBOB 1O5XA 3MUY1 2Z1BA 1LBMA 3KW3A 2YGYA 4KGJA 2R24A 3L2MA 4E2DA 2GVJA 1OFOA 4W84A 2YA0A 3ABQA 2ZUNA 3HGRA 3LHVA 4A29A 2A7PA 4RX0A 3G0UA 3S46A 3EWUA 1F7BA 1LG1A 3H8AA 3ARYA 4QE1A 1BAGA 3QTPA 2NW0A 3H2OA 1CB7B 1Z8AA 1B4EA 3PJWA 2GK1A 4E8CA 4BY3A 3BH4A 4REQB 1R7AA 2WQPA 3F4NA 4GUIA 3N14A 1OFDA 1DJHA 3I65A 4Q7IA 1P0NA 2AL1A 2TMDA 7REQA 3TWAA 1O1ZA 3WD1A 3GNXA 3LLFA 3EDFA 3N6QA 3WEOA 1EX1A 1KQZA 4ADTA 5GNZA 2NUWA 1UD2A 3NPWA 1Q3NA 4F48A 2V82A 1YNQA 2RH9A 3FN9A 2QW5A 4S3EA 4YXGA 1TTQA 4DO4A 1K9FA 1A5MC 1U22A 5FJTA 2QNEA 4JTTA 4D6HA 6TAAA 1FWRA 3OU8A 3KRSA 4YTUA 4Y2WA 5DMYA 3KM8A 2WHJA 4UTLA 1JDDA 3S6DA 2Z1XA 3WDPP 4O52A 3B9DA 1PB0A 3II1A 3GTNA 1KFLA 4LAOA 1LROA 4M6QA 3MI2A 2ZX8A 1PIIA 2IXUA 4RZ5A 2GPTA 4LNCA 3BTNA 4JBRA 1DXEA 1Y65A 4HCHA 3NL5A 1GKQA 2Y85A 1M5WA 1SO3A 3E2QA 1RY8A 4WRHA 1DYSA 2F2KA 1ALDA 4C1KA 2PRMA 3FHQA 5F2IA 3WBAA 1XLDA 4QS6A 1LJYA 5CXPA 3R1ZA 2J8FA 2ISDA 1EJWC 2VL4A 3B8DA 4I7UA 4DJED 4QCFA 3OBAA 1CGWA 2B31A 2X0SA 4P61A 2PWFA 1A5LC 3OGVA 3KRUA 1MZRA 3PNZA 3LHYA 2YW3A 3A5FA 4AZ5A 6REQA 1QAPA 3O1NA 4JHZA 2OG9A 2C71A 1IF2A 4R5EA 4RDYA 2I5IA 4MZ8A 3VGFA 3UWQA 3GH4A 4LXFA 2DY3A 5AYXA 2NQJA 1E6RA 2P8CA 1CDGA 5AHEA 2RDTA 3OG3A 1P5BA 1VGAA 3L9CA 3BOFA 4IMFA 1UZ1A 4XBSA 4Q6XA 2Z1SA 1VBHA 2XH2A 2Z0IA 2IKHA 1YBQA 3DGBA 5HNUA 2DUAA 1YRRA 1RP9A 4HJWA 2B7NA 3WH6A 3QC0A 4GK8A 1DWAM 3QN3A 4ZENA 4CNOA 2CC0A 5A8QA 3AHVA 7CGTA 3GDTA 1DVJA 3KBJA 2GK1B 1XG3A 3E49A 1BGAA 1YXCA 3H22A 1RSCA 5T9BG 7REQB 1G4EA 3V5CA 1QOXA 4F3HA 1OZMA 4AIOA 5I02A 1W91A 2E5BA 1U83A 4C6IA 2GOUA 1L9WA 1Q6FA 2YKKA 1E3ZA 5XINA 4X0VA 4XBKA 1TVNA 3C0LA 4RKAA 5IHSA 4NT0A 3RG6A 2UY2A 3W7QA 1JNDA 1XCWA 4NG3A 4AIBA 4MUZA 3D3AA 3KVJA 2W66A 4HOZA 5AC5A 4PH6A 2KZHA 3PPFA 3GM8A 3BLPX 1M3UA 2PLCA 1PHWA 2F61A 5A6KA 4B15A 1VH7A 3QKZA 2PC8A 2DJLA 3DFPA 1RZMA 3KOZA 1UC4A 2D0GA 3CZGA 1SM9A 1IT8A 4DJFD 3GNPA 5SWUA 3MUAA 5JBFA 1JCXA 4MYAA 1ZL1A 1TJ0A 1B3XA 4GUJA 3S1WA 4MYXA 3VIHA 3QR3A 4L4MA 5FL1A 4AWTA 4I5RA 3HMJG 1J01A 3GR4A 1T41A 4GJJA 1BWVA 4LBSA 4S3DA 1B3ZA 1DP0A 1B0IA 4F79A 2XDFA 2Z27A 2WHLA 4HK5A 2ZXQA 1HJQA 4DXXA 4PL2A 2VCBA 3CHCA 5F1UA 3B05A 3CZLA 5CG0A 4PTXA 3C0JA 1P4CA 4NZ4A 1ONXA 3G8RA 2VZSA 1G69A 1JDAA 1UMYA 1GVSA 5AYZA 4XZWA 3KUMA 1WO2A 5DLCA 3NL6A 1K03A 2GQ3A 3E38A 1Q66A 2IKGA 1Z9AA 2NQ9A 3VDAA 4J3UA 3TN4A 3W26A 1TJ1A 4HPHA 4TTGA 4NZFA 3PUGA 2CXGA 3DEQA 3WELA 4NIRA 3TYAA 1RPKA 3CAWA 3WD4A 3LNPA 4MVAA 2VCCA 4QR6A 1QHPA 4E4FA 1CYGA 2QPSA 5LIYX 1WXJA 5CPSA 4IIHA 3B04A 4P7LA 5LXEA 2DT1A 3W24A 1Y5VA 1KLZA 4ZQRA 2Z1WA 2F6XA 1FDYA 4FX8A 1PX3A 5H91A 4H2CA 2X0HA 2W3ZA 2CBIA 1Q6GA 4LANA 1ZALA 5A8GA 4GFIA 1VPYA 3C6CA 3LX9A 4XB3A 5T26A 1VJSA 2E1DA 4V33A 1RQHA 3MWAA 3UA4A 1U33A 2FTWA 3MJYA 2DH3A 2CHOA 4YTQA 2J24A 3HM7A 2ZWYA 3W9ZA 1R3RA 3N29A 2TRSA 1FKXA 3PAOA 3BL3A 3W84A 4UFMA 3VZYA 1BFNA 3NQ8A 4PTDA 4OBSA 2YCEA 1V3HA 1ZLPA 3UETA 4XZLX 3QH2A 1DWJM 1FWAC 1C8YA 4HNNA 4ZQNA 4ASTA 1UBSA 1AD1A 4GKTA 2ZWZA 1OK4A 3XIMA 3UR7A 1RLDA 1QTWA 2OX4A 3U48A 4J1OA 1EYWA 1OINA 4WF7A 5AFDA 4IPPA 3FS2A 5I6SA 4DVOA 2YDQA 4UB9A 1E6PA 3PB0A 3TNOA 1EOKA 4H4IA 1TA3A 1XXXA 3RFAA 1JDFA 1E0WA 4C6JA 1R3YA 3ARWA 3HPXA 5IRPA 3HG4A 4UTWC 3HPFA 3YPIA 3UZYA 2C1IA 3EA1A 3RM8A 5D02A 2XIQA 1QBBA 3RU6A 1IQ8A 1JDCA 2J25A 1HJUA 2NT0A 4PYSA 5AC6A 3WQ5A 4WKAA 3N3TA 1OY0A 4B5NA 5FIPA 5EGRA 1TQXA 3EOEA 2ZZ1A 3V1HA 1RVKA 1LCOA 3RJYA 5BU6A 3JU2A 2R82A 3MP3A 2J78A 4JTCA 2EKCA 3NO5A 3HJZA 2INEA 3VO0A 2DH2A 4R88A 2D73A 1J4EA 2PF8A 2OSXA 4DZAA 3IJ9A 3BVJA 3ZT5A 3APYA 2XVGA 3MCNA 4DBSA 1PDZA 2W92A 4HMNA 3P8JA 3E2SA 4QE4A 1PV8A 1X96A 3OA5A 3RPMA 1U5HA 1UBPC 5DCDA 3N13A 4D8ZA 4L6HA 5FJRA 1NWTA 3DYMA 1WKFA 3E5BA 2OQLA 1XWYA 5CZKA 3QV7A 2VEKA 3BOLA 5HNRA 5A8NA 5B7YA 4BF9A 1V3KA 1WCGA 4FLQA 5A94A 1W3NA 4JTHA 4P8WA 1Q4WA 2E7FA 2FYMA 5CJ5A 2PDLA 3TTSA 3GDMA 2WVSA 3CMGA 1SMDA 3LCLA 1WOAA 1JR1A 4GGHA 1DIOA 1Z42A 2ZZ6A 3TXZA 1LOSA 3G1SA 4WD0A 4P7OA 1V8EA 2OOFA 4A3QA 2WZEA 1UG6A 5FL0A 1B57A 1ITCA 3TKFA 2YIHA 3KWXA 3UEQA 2OZTA 4AFYA 5K9DA 1QOPA 4GQQA 4Y8EA 4FXSA 4GKLA 5TIMA 2WV8A 4OJYA 3STFA 4UTTA 4QG9A 3NSXA 1XDJA 3RITA 2YBVA 4UFJA 1FY6A 3S5OA 1QCWA 3BAXA 3A5VA 1RK5A 2VX7A 5DCBA 2JGQA 1EP2A 3DFHA 3WK0A 3WN6A 3DCPA 2G3JA 1EH9A 3IK4A 3GBDA 1L6GA 2XJ7A 3QMTA 3NXLA 1YHTA 3GTHA 1G4TA 4Q7NA 4HVXA 1ONEA 4JTJA 3HZ3A 1XHGA 4PCFA 3MI6A 3LHZA 3WLJA 5CC6A 4M51A 5I06A 4LJ3A 3F2BA 2BXZA 3GFZA 1XGZA 2QJHA 3RCMA 3T0CA 1YXYA 2OLSA 3WNKA 5ABHA 5FCZA 3M0XA 3RJXA 3S6TA 3H6OA 2V5LA 3M0VA 3N17A 3MO4A 5A5WA 3HU7A 1HVXA 3E0VA 2VUNA 1E4MM 3NO1A 3IWPA 4WDXA 3WX7A 3CBWA 4LFYA 1BTMA 2NT1A 5KZ6A 2V38A 4DBWA 4M7TA 1A3HA 4LOCA 4F9JA 2X1RA 1KB3A 1W5OA 4K8EA 3GXMA 1ZZMA 4ZL1A 1FDZA 1QMLA 2QUMA 2ONEA 2E8YA 4JTSA 3UXLA 2V6AA 2W91A 1J9YA 1MNSA 5LHFA 1A3WA 4HZ7A 1XFCA 3MYOA 1HGYA 4L9XA 3OIXA 2ZTKA 5IM51 3PNUA 1HN1A 3PWIA 3VD7A 2YCIX 2Y7FA 2ESCA 3ZSTA 1U5JA 1PTDA 1SZFA 1VEOA 3DXIA 1TV4A 1XLEA 2OSYA 4MPQA 3TW7A 1R9YA 1QNPA 1WZAA 2YLAA 3HGSA 5AOUA 3ICJA 3SN0A 1PYMA 1CB2A 2GQ9A 3WLSA 5FSEC 1MXGA 4FOUA 1A47A 2X7WA 4DRSA 1XIJA 2GGJA 3CQKA 3G1RA 2AQWA 4D6JA 5A2BA 3TMLA 1NFBA 1K7XA 2R9RA 3OO2A 3SEPA 3CUZA 3IUHA 4C1NB 1IEVA 5L6UA 1E5NA 4O18A 4OV9A 2UWFA 2DT3A 4XAPA 3M6YA 3KBMA 3LTPA 3H2FA 2J8GA 1E55A 1V02A 2QPXA 3TTEA 2ZUWA 4FF5A 4DXVA 1HKJA 1GNXA 3SCUA 5FESA 1RQEA 1BEUA 1ESWA 4LALA 2XFFA 3UY8A 4QISA 4US5A 2TODA 1P48A 1I60A 1FWIC 4LSBA 4GXPA 4LVBA 2EPHA 3E2RA 4IX0A 1M7JA 2WPBA 2OO0A 1HP5A 4LV4A 1KCLA 1NDZA 2VR2A 3K2GA 1QI3A 4B5SA 2P10A 1OFAA 3C3UA 4HPGA 4LCSA 3BICA 1QI0A 3W7HA 3T1GA 2A3AA 3VNDA 3U2ZA 3GUGA 4MKSA 3THQA 5XIMA 1I1WA 1YADA 1EDQA 2ANUA 1M7OA 2YZRA 3DG7A 3WDHA 5LXXA 3UQNA 1F3EA 4A8NA 4MWAC 3TNBA 5DF0A 4YIWA 2JEQA 1HO4A 3QHNA 3FX4A 4E8DA 2REQA 4W4QA 1F8IA 2GJNA 1R6WA 3M9YA 5KETA 4AEEA 3S6OA 1MQRA 4ZQOA 4KS0A 1HTIA 1WE5A 1JRBA 2A5HA 4MNLA 4E8GA 3VM5A 5C54A 1SPQA 3TOYA 4GZIA 5BWFA 3U2OA 4PUWA 1TZ7A 3IGXA 3MSGA 4LY4A 4ADUA 1O95A 3HQNA 2FH6A 1LUCA 4PMYA 1EP1A 2OYLA 3SDOA 5CZTA 3NA8A 2YB4A 4ZVJA 4A05A 5FEXA 4YYCA 4BI7A 1OD0A 1PJ9A 1XYAA 4LB4A 3TEVA 1UIOA 3I10A 5K4XA 1PL9A 4RW5A 1CGTA 4GY7A 2WB5A 3WQPA 3GC2A 2CW6A 5T91A 4B92A 1CXFA 1XFBA 4HTBA 3ANYA 1AK5A 1AD4A 2PD5A 3RN6A 5D30A 1XINA 1IEWA 2C3ZA 3B8WA 1GQJA 3UG8A 2GYIA 3PZTA 4PMQA 1XCXA 2KX9A 4CVWA 3TJXA 3BLDA 3FW6A 4PC8A 4ZOCA 2TAAA 3N19B 4YS1A 3VNKA 5CH9A 3JW7A 1H2JA 5HATA 4AZIA 2WKJA 2ZA1A 3CAVA 2WC3A 2ALRA 2PP0A 4NHVA 2QAPA 3QYQA 2PRLA 5GJMA 3OBEA 4DJDC 5G4EA 3A4XA 5FKYA 2VC7A 5HXMA 3BLLA 5C2XA 3KTXA 4GQBA 3T0AA 1LBLA 3VMPA 1IIHA 4Y90A 1G01A 1SJCA 2X1SA 3BAWA 2HTMA 3NZRA 5BMXA 1EGZA 2DFAA 4PMZA 2NV2A 5E09A 1HIZA 3L0GA 4IMEA 4XKMA 1US2A 2R1NA 1M41A 1BF2A 3VCRA 1RXOB 4IF2A 1TWZA 5A2AA 1LL7A 1YLVA 2NVCA 4W87A 3BARA 1A4LA 3QPYA 3WH7A 4FF7A 3DYOA 4DPQA 1XIIA 2JQXA 3S9IA 1GEQA 4O11A 5LA1A 4NUWA 2J62A 1MXDA 3QC3A 4QS5A 5HWNA 4OOZA 4GQGA 4XQ6A 4IL2A 1QBAA 3MHUA 3L2IA 4Y9OA 1A4MA 5LNSA 3NPVA 4AC7C 1A49A 3IJDA 3WQVA 4BR1A 2WZTA 2ATSA 3NXFA 3FYOA 2EJAA 2O0TA 4W8LA 3SCVA 1S1RA 3NFUA 1KW1A 5A6BA 5G4WA 2PDUA 2G4FA 4HU3A 1EPXA 3DBNA 2WCGA 4XUYA 1FH8A 3PPGA 4NJGA 5IDZA 3VUSA 6ALDA 4CQDA 1NWUA 1JDEA 1XLMA 3CC1A 5KSWA 2G41A 5EBAA 1MW0A 5IFTA 2IQTA 3GZAA 3LPFA 4FXFA 5AKQA 3MBDA 1LUCB 1R86A 4AD5A 3BQ6A 2CHNA 4CUCA 3CH0A 1O12A 3FYPA 1LF1A 4FS9A 3AU2A 3THDA 3N2CA 4HNLA 3KTCA 1KKRA 4R85A 3VGHA 3ISIX 4PUMA 1IEQA 4L9ZA 1OG0A 2IW0A 3UCDA 4A8RA 4M0XA 3NTYA 4AIEA 5CSUA 1WKDA 2ISWA 2ADAA 2ZOXA 4BF7A 3OA3A 4JYFA 1QK0A 1BKSA 3MSDA 2B81A 4AYSA 4HU0A 1HT6A 4Z2KA 4LUJA 1WQ5A 2OKOA 3G5EA 2Y5EA 4X9SA 3BOXA 2DGAA 1GQNA 4GPNA 4AZCA 4EVZA 2WMIA 3AMGA 1AQHA 1EUAA 1YMYA 2PI6A 1E1CB 3MP4A 3C8NA 2EHHA 2I5QA 5D8ZA 1JD9A 3WMCA 1XIDA 1T40A 1WPCA 3L21A 4QEEA 2A85A 3M5XA 4RE4A 4Q8UA 1W17A 4J3XA 1C7TA 3AFBA 4JTUA 5D9NA 5C7HA 4JYEA 2XYLA 1GKRA 4AWUA 4F40A 4PULA 3P0XA 1KRAC 4GMEA 5CGQA 1UD5A 4Z1YA 3CNYA 1H0IA 3CMJA 1PYFA 4Z1AA 2OZ3A 1NAL1 3VMOA 1GKPA 3TJLA 3MJMA 3TH6A 2O7SA 3PTMA 2YYTA 2R14A 2FH8A 1GOIA 3W53A 1HJXA 2QDDA 3BSHA 3A9IA 2GUUA 2AL2A 3ITCA 2J7FA 3KS6A 1A5UA 4JTIA 3HN3A 1BVWA 3FJ4A 2ODOA 1EO7A 3W7GA 4OGZA 1V6YA 4L6OA 3N4AA 3TYBA 3EOLA 4BQ5A 4H01A 2JIWA 2W5FA 4JTEA 1I2PA 1X1ZA 2IS7A 2OEKA 3GO2A 1BD0A 1W37A 5D2XA 1LT7A 1V7YA 1CX9A 2DQWA 1ZB5A 3PBYA 1TPFA 1Z6KA 1N55A 1PS9A 1BRLB 2VHLA 2CU0A 3W02A 1ZAHA 5C9ZA 4TIMA 2XSBA 3U9IA 4MJ4A 3R5EA 5CJMA 1B3WA 3GY1A 3KTSA 5AHFA 1BWLA 4GWEA 4S3FA 2V5KA 3GBEA 3HO8A 2YZ5A 1EJTC 1MI3A 4OBTA 3NM3A 4NAFA 3WLTA 4AQLA 3NPXA 2X41A 3MHFA 2OEJA 2WJEA 3TROA 9RUBA 4GXMA 1TMHA 4K38A 1X98A 3QGAC 1M9HA 1ISVA 3ITGA 4V27A 1GOQA 4XZBA 1V51A 5DFAA 3NOYA 5E93A 3MCMA 4E5TA 2BVTA 4F0SA 2XZ7A 3S9ZA 3AHZA 3LLXA 1KM5A 4S2CA 3QHOA 3LGGA 2E25A 1PO9A 1JF5A 5CPLA 3VKDA 4J28A 1TB3A 5TF0A 4AD2A 2ZZ4A 5BXPA 3GWQA 2WMGA 3PBUA 3V18A 1IWPA 3D47A 5BZAA 3WF0A 3AZRA 4CN1A 4BZYA 4H83A 5FJOA 4H9XA 5B80A 3ZWTA 2C6QA 1KM3A 4YCPA 4AZCB 1MXSA 2WMIB 3OIHA 3TN5A 3IIPA 1M03A 1UD3A 5BMWA 1G7UA 1VIZA 4WKHA 2Z25A 2J47A 1Q6OA 4UQ9A 1IYXA 3W1MA 2PDQA 1UOZA 1LT8A 3V36A 4DBUA 4H8NA 3ITYA 1JRCA 2B7OA 3V16A 1OBAA 3VD3A 2QGYA 4JCMA 3T44A 2VQTA 1IXQA 2DJXA 1GVFA 4W89A 1HX0A 5MKGA 3I6TA 5CBJA 3IEBA 4XKYA 5D9MA 1SJBA 1WX0A 1KXHA 1XYFA 3W2NA 3IJ7A 3S3GA 3T6CA 1EJ7L 2GVYA 1D7FA 4X3ZA 3CGTA 5F4XA 2BG5A 4YNGA 3W6MA 2BTMA 2WMFA 4TQTA 1FWCC 2HK1A 1YQ2A 4GI4A 1M6JA 4DEFA 3B9NA 4WVXA 2GLKA 3TQKA 4D8LA 1UD6A 1BXCA 4PMUA 2Y5JA 3KFTA 4ZA0A 4JFTA 1EQPA 2VWSA 1FFRA 3DGRA 1VBJA 4MMWA 3TSDA 3LSBA 3WCZA 4S3CA 1EX5A 2WNZA 3WNOA 3NPUA 2WZHA 3LZ3A 5HR6A 4QEHA 2CXEA 3A3WA 4JX6A 5CPTA 1F74A 1EJUC 1JPKA 2GOKA 4DB7A 3EMCA 1AL8A 3VGBA 4C65A 3GQYA 1AW1A 1PEZA 3GRIA 1XKYA 2Y70A 1VFFA 3QRHA 4DIAA 3B06A 3ECQA 3NM1A 5HWJA 2WC4A 1DQWA 4NAFB 3ZT6A 1E0XA 1GONA 1W9VA 1KLYA 7ENLA 3R0UA 2CBVA 3HBLA 4DPPA 2BP1A 5FF4A 3SCPA 3UJRA 1UPMB 2E3ZA 1WXYA 4IFOA 1CXEA 2WSQA 1GVRA 2EAWA 3RM9A 1EUNA 3LBMA 1UR0A 1TZZA 1Y5WA 3R8RA 5DRIA 4PMRA 1JGIA 3BW2A 1QW7A 1JYVA 4PRTA 1YXDA 3TCSA 4ML9A 4ORIA 4RZBA 3WD0A 2PEVA 3VOCA 1W1A1 2ZFAA 3FSTA 4HYWA 4ZTXA 4R27A 4F4RA 3R0DA 1JPMA 5JQ9A 1W9UA 1J18A 5TAOA 4DM2A 2X1IA 3GG8A 3R25A 1CXKA 3UA3A 3WBEA 2ZDSA 1XUUA 2DT2A 2HVMA 4EPEC 4NZJA 3WLPA 4A2SA 2BWGA 2VZOA 2DZUA 4ERIA 2QXWA 2HS8A 2PDBA 1OYCA 1EPVA 2ZUTA 4PA8A 5K3VA 5L9FA 4BJHA 1TIMA 2PZNA 4M24A 4DWSD 3GNDA 3DFSA 4K7YA 1R3VA 2Q71A 3NDZA 3LV6A 3B0UX 1OFRA 1QUMA 3VDHA 4GH1A 3CUIA 3WL1A 4IIBA 1FWDC 4N9EA 3M5ZA 4X9YA 2BASA 3ABOA 3FGCA 4HNUA 2C1HA 3RRXA 5MKGB 3ANUA 4MY9A 3M46A 2O55A 1MDLA 5C9XA 4XKYB 2NV9A 4PB3A 2FMOA 3GU1A 1F4HA 1TTPA 2ZRYA 2VOTA 3GW0A 2WZMA 5ABFA 2ZXAA 1ZBKA 3WJYA 4UMAA 1X7FA 4KIEA 3WQ6A 2V5JA 3LSCA 2XM1A 3B0YA 3MCOA 1TRIA 4Q4OA 4LS1A 1BSIA 3SN4A 1F6PA 1J0IA 4DI9A 1ZSXA 5H2ZA 2W63A 2VGIA 5D2WA 3E12A 4YVVA 1O5KA 4QLLA 3W2JA 4NZ3A 4F0RA 5TQLA 1I45A 4HPNA 1V0LA 2PDWA 4QSFA 3NEHA 5H8MA 3S5NA 5CLWA 3O16A 3RDKA 4DYJA 3L4UA 4AZ6A 1EXPA 1MEIA 3VOFA 3S8HA 1SO6A 5E70A 2A3LA 3FAWA 3GKAA 4QDWA 4RR4A 3ELFA 4J3SA 3GXTA 3NYZA 1YDYA 2PWGA 1BSLA 3NWRA 4YN5A 5CEWA 3GXDA 4RE3A 1YNPA 2FJUB 2QHAA 1UASA 2J6VA 4UUIA 1R8LA 4D2JA 1OYBA 2C19A 3TZNA 3WUFA 2FKPA 5JU6A 4FXJA 2E77A 1OFQA 4ZFMA 1LRTA 3VGDA 1WB0A 1EOMA 2QV5A 5FI8A 4ACZA 3IVTA 1A3XA 2JGYA 4DQWA 3KVLA 2MNRA 4C5YA 3MI3A 3GDBA 2FFIA 4C1LA 4IGMA 3HA1A 3WKZA 1B1YA 4KFOA 1BF6A 1DE5A 5FJJA 1MNZA 4LUYA 5EB8A 1CTNA 2QUVA 4U5IA 3VKKA 4D6CA 1A5KC 3W28A 1KXVA 5C70A 1KM4A 3VD9A 1NOFA 3UWEA 1H7XA 3E3HA 3Q94A 3FJLA 1ZPTA 4FHAA 3APTA 2R1LA 3QTGA 2ZUMA 1UHVA 3LK6A 5AC7A 2W61A 4M3PA 1GPFA 3CPGA 3N15A 1IXOA 4AZBA 3A3HA 2DZVA 2YDAA 1W3LA 2QCDA 3L4XA 1TYGA 3WSUA 1D3GA 3P82A 3VIOA 3DHDA 3NNTA 2CLPA 1OADA 4IJCA 3IARA 4PUJA 4GNJA 4ES4A 2BHZA 2F8QA 3G0XA 4HCLA 4XSMA 4EF9A 1RK6A 4QAWA 2R8WA 1B9ZA 3LBCA 1H5VA 2CLIA 2V63A 4YJ5A 3GKFA 3CLMA 3PVFA 2X42A 1GHSA 1AW2A 2H90A 3UPMA 1EBGA 2ZRWA 2OXNA 1UR8A 5ABFB 4WY0A 3V0TA 4IZGA 1V4YA 2SFPA 5DXXA 4G2DA 4IJRA 3RYSA 2VGBA 3TX9A 4AEFA 4B3LA 1TPC1 4LUSA 1W9XA 1NEYA 4PRRA 3RR4A 4UTTC 3RLVA 4QGCA 2G50A 4LC8A 2PODA 5T8GA 2CWNA 4AF0A 1VYPX 2DZAA 2X8RA 3FFSA 5C9WA 4WEVX 3TLLA 2MANA 3SGZA 4RE2A 1XGEA 3N9KA 4WLCA 1NP0A 5AZ0A 3P81A 4WK9A 2WSPA 5DT7A 4ZZ9A 1AVAA 1W1PA 4JTQA 3M0ZA 3W1QA 2EPMX 5CSYA 4G56A 3BC9A 3H7UA 5FF7A 3AIUA 3WLIA 4QNWA 5G1TA 3W1UA 3IIVA 3NQVA 1N82A 3HQ1A 3N2MA 4HNVA 1UKQA 1VCGA 4K8HA 1JQXA 1AH4A 4LS2A 3VDCA 2Q09A 2NXGA 3FKKA 3EBVA 4PMNA 4GYFA 4FLRA 2ZDRA 1QRQA 1L8NA 3VNYA 1XSJA 1XLCA 4N02A 4NXKA 1X6UA 1OFPA 1F4AA 4NXSA 2YR1A 5CQ1A 4XZHA 5ABTA 1YX1A 4LRSA 1BQCA 2NX3A 1OFBA 1P1MA 3WEZA 2EPLX 3VOJA 2V8ZA 3PPCA 1NQ6A 1U2YA 4ACYA 4RE0A 4NQ1A 3WEMA 1XRFA 3LXCA 2EPOA 2WLZA 4RV3A 3UWYA 3AXXA 3WDIA 5I3FA 4TXEA 3W7KA 3DYPA 1KBLA 3FDKA 5TNVA 3MKCA 2XISA 3NZGA 3DU0A 4IOTA 3TW9A 2A2IA 2GDQA 1TZ9A 2Y5SA 1YDVA 3RGTA 3S2CA 3L5MA 2G4JA 4DXKA 1F3WA 3TDFA 3BCFA 1TX0A 3A24A 1EGVA 3N12A 4MSSA 1Z69A 1FP8A 5I3JA 2QCDB 2VMFA 3VIIA 3IGSA 3EXRA 3W72A 4E3VA 3W75A 4GG9A 1R0MA 3W0KA 3NURA 2YJQA 3W1NA 3K8LA 2F6UA 2QCHA 2QULA 4GBUA 4XVEA 3S2JA 1E15A 1REQB 4LV9A 3KHJA 2VOMA 1C90A 4XAFA 1HQTA 2XFWA 2D20A 1KFCA 4HIBA 4DAFA 3BURA 1H7RA 1VAHA 1VHNA 3IGUA 4HMDA 1ADOA 1QNSA 3E9AA 1R87A 4Q8TA 4QJ3B 3CHDA 3UYCA 4WY0B 1S5VA 3Q2DA 4K39A 3TN6A 4M1RA 3VMNA 3GH7A 4ONVA 3WMLA 2OJPA 4W86A 3ABXA 9XIMA 2BHUA 3NQ6A 1XSKA 2HNHA 3W7RA 1IWBA 1XR2A 3W22A 1TV2A 3C2RA 2BOEX 1EJXC 4LGXA 1XJBA 5CAHA 2XH7A 3W81A 1UW9A 1TQJA 4S1FA 1E9YB 5CPQA 4M80A 3W6LA 4WDWA 1ODZA 1H1NA 2FGLA 4Y8FA 5HMDA 1EHAA 2I56A 4O8RA 3IJ6A 3QXBA 2E67A 3O2LA 4UTWA 1TV8A 3D0CA 1UZDA 1Z41A 1EIBA 1W3IA 2E9LA 3P0WA 4Q4QA 1R7OA 2PCQA 3FVMA 1XGDA 3BZJA 3OTRA 2QUNA 2QCFA 5JUVA 1LG2A 5C9RA 3HGJA 2RHGA 2OSWA 3A4AA 3KDOA 4ENLA 4JY8A 5EFFA 4S39A 1UR4A 3E96A 1T7LA 2GJXA 3U5UA 4IUOA 2GWGA 3DENA 3LS9A 4FA3A 1KBKA 1UWRA 1HUVA 2VENA 4HCDA 4K2SA 4W9TA 4XD5A 3MS8A 4IP4A 4JFWA 5GJNA 2ZYFA 3WF4A 1LLZA 1IR2A 4JICA 1WBHA 1VFTA 4PSPA 4UQAA 4LYKA 4O12A 4NP7A 4DJEC 4F0LA 4LUTA 5I23A 2YXOA 1FCQA 4DWDA 4C60A 1K4HA 2PA6A 2YL5A 5AYYA 1CPUA 3QHMA 3QGVA 3LYEA 4LRTA 1ITXA 1PSCA 4FP1A 3N04A 2JALA 2PD9A 2GGGA 4IQDA 2FZ9A 4A8LA 1UJPA 1DQUA 2RGMA 1PKNA 3CIWA 1T8QA 4LAUA 3BCDA 3ZWSA 3BGJA 2A3BA 2PF0A 1T96A 3FEMA 3CV2A 2O4QA 3L12A 3G1YA 3OQEA 1E56A 1XPYA 4PR4A 1DWIM 4GCXA 1R3QA 3VKJA 5A2CA 3NQFA 4ZB2A 1V6XA 2QDGA 1Y5XA 3A3XA 2BV9A 3GXNA 4EWJA 1AJ0A 3L4VA 5AZ1A 4X61A 1GOWA 4DZHA 3PSWA 1JUEA 1VFSA 3GR7A 3K13A 4AMCA 1AG1O 4GRSA 3CB3A 5E6ZA 5KITA 5E6YA 3JS3A 1A53A 1P0BA 5AN7A 1ZQ5A 3CUFA 1RCXB 3SY5A 3QFEA 3OODA 3Q45A 3OLDA 5I3DA 3MYPA 4K1WA 3RF9A 3SUWA 3NJ3A 2WVUA 4XTIA 4Q8VA 3QMSA 1M7XA 5KEZA 3TXVA 2JIEA 2ZQ0A 3DKLA 1UD4A 3LG3A 1P0DA 3VOIA 3M4HA 4I8DA 3VCNA 1DHKA 4ZE4A 4XISA 1YNYA 2PLKA 3A64A 4JS3A 2HBXA 4OECA 3TSMA 2BY2A 4QLJA 3T08A 2Y63A 3AUJA 3ES7A 2Z7KA 3PBGA 4U3AA 3GXPA 5M17A 2XVNA 2ZA2A 3B8IA 3SY8A 2J79A 3IVUA 1NARA 2NSOA 4A3RA 1Z44A 1BKHA 4JKLA 4QCEA 3K8KA 5EBUA 4QHRA 2Y2WA 1KXQA 1K7EA 1VEMA 1OEPA 1FWBC 3O7UA 3GB6A 3TFXA 1W32A 2H6RA 2UBPC 4QITA 1EZ2A 1OCQA 4ZODA 1PKLA 3UXDA 3LPPA 5E9XA 2WM1A 2C79A 2DSZA 4H6QA 4QM1A 2CEQA 4NU7A 2E40A 3T78A 4GD0A 2ISFA 2Y4SA 2YW4A 2QT3A 4UCGA 3U4FA 4YCOA 4CD6A 3M1ZA 2V30A 1S5WA 1XKJA 2FZMA 1H5YA 3NOEA 2P3EA 3E0FA 2PDCA 3TC6A 3PBVA 5HANA 4HHHA 4RLIA 2V5CA 2BGNE 4QSHA 1QPNA 4LUTB 3S1GA 2Z6JA 2DUXA 3BK0A 1QWKA 1X1NA 3PWGA 3VPLA 1O68A 2GUYA 5IFPA 1W9DM 3LXBA 4EAYA 1PKMA 1TR1A 1CXHA 1JXJA 3HPAA 1QI2A 1DIEA 3M0YA 3TWBA 3B40A 3ARRA 2EJ1A 1IGSA 4RDVA 1SFTA 1F8MA 4XX6A 2VC6A 1YIXA 3BLEA 3WDJA 1M7PA 1GT8A 4TVDA 1WYIA 1EQCA 3LNMA 3WFLA 1KM2A 1VPXA 2NX9A 4ECLA 1DXFA 3U0HA 2NSXA 1UH3A 4U33A 3BPWA 4YVXA 4N6FA 2FDMA 4LCQA 4GZJA 1E0UA 4Q8QA 3IACA 1K9EA 3DHPA 1RUSA 1NF0A 1UH4A 2HE5A 1K6WA 2BNJA 1GVIA 3DFOA 4OT7A 3T0DA 2P0IA 2QVNA 1B5TA 2P0OA 1SW3A 2QCEA 4C6BA 3IJIA 3BAYA 2WPGA 1KCKA 5EMMA 3UGRA 3VD5A 1OGGA 1VB9A 2GVGA 1K77A 3PS7A 4W85A 1OT2A 5LYRA 3W4RA 4LW7A 4ZGYA 1L0PA 3DHUA 2ZX9A 4N9DA 2XGIA 2NLYA 4PTWA 4CQAA 4I9JA 1LQ0A 2ISSA 1DJNA 1IE7C 1Q6LA 4AVNA 4UTIA 3TJIA 4M29A 3IJ8A 1CW2A 2DUZA 2Y6ZA 1U5VA 3WLNA 2E9MA 3UXAA 3INPA 4HSHA 2ZZ2A 3F1QA 5I3KA 8RUCA 3T0BA 2A79A 2EG6A 4PBGA 5AC4A 5JIPA 4ZCWA 1FFQA 4L5ZA 5GQBA 1Q7ZA 3UXKA 5DMMA 1DOSA 3H55A 3L4WA 3ITVA 1KFBA 4Z2HA 3VDBA 1S38A 4R34A 4GFSA 3WLKX 5D38A 2QJNA 3G2GA 1R30A 2C13A 4GNVA 1RY0A 5K9CA 5H6HA 1NJJA 4FNQA 3RCNA 3WQEA 2WNQA 1V3LA 3L67A 1OFEA 3TR2A 1NP2A 1SSGA 1KRMA 2W4XA 1FWSA 4H7VA 1A5SA 4IGNA 5G1YA 2J66A 2FVKA 3SN1A 4D72A 3PZMA 3U8GA 1C9DA 4O1EA 3KP1A 3RMEA 4PN2A 5DN1A 5HAOA 3B4UA 3GH5A 3R2GA 1H1ZA 3VIGA 4DJDA 4HOXA 5A8OA 3W7IA 2WJZA 1ZBWA 2VNCA 3QV8A 1B54A 1Z7AA 3VTRA 3CZKA 3ZJ8A 2DDXA 5DY2A 1N2VA 3ZO9A 2PBGA 2PURA 1M68A 1CZ1A 3WNNA 4QAIA 3QGKC 5I07A 4BQ2A 4MLJA 2AAMA 4CD5A 4FSAA 5I09A 1XDMA 3IRSA 3PBMA 1V3IA 3UZWA 5JBDA 2VD9A 3DKJA 4D6EA 5REQA 2Y7DA 3I6EA 4OOUA 4HNOA 3T42A 3P67A 3GK0A 1W2PA 3DBPA 3ZJ7A 3SIMA 4DF1A 1MRAA 4A3UA 4HMEA 5LA2A 3U4AA 1HKKA 1NELA 2A0NA 1AMKA 4PL1A 4C6OA 1I2RA 4AMAA 4YHEA 3GIPA 2R1MA 3UJEA 3DECA 1GCYA 3EB2A 2J74A 4O0KA 1LLWA 1CLVA 2J7CA 1XLBA 5KTLA 2PZ0A 4MWAB 1LORA 4XD4A 3THUA 2WLYA 3SRFA 1DJZA 2Y0FA 3TJ4A 4XO6A 4XIMA 3GAYA 4GYKA 2H8XA 2VZTA 3IGHX 1KWGA 5CJNA 3W25A 1GPWA 2ACUA 2ASHA 3CL7A 4GVHA 5D05A 2W67A 3WBWA 4GI6A 5HPOA 3U2CA 1UWTA 3R43A 4QFUA 2VJXA 4DUOA 4KWVA 1E6QM 1TPH1 1TPB1 4W7UA 1UC5A 3L4YA 4EKJA 1YKWA 4NVTA 5F4SA 3G3MA 1KNWA 1QJWA 2EF9A 4P7NA 2QIWA 2WKLA 1H61A 3L5LA 1VQTA 1ADDA 5J04A 3PULA 1MW3A 2GGIA 2V2HA 3SUSA 2XWDA 2FB3A 2X16A 3MWCA 1XF0A 1OT1A 4F9DA 1BTCA 5BOEA 4KEUA 3QQWA 4NKCA 3HTWA 4HHPA 3GHSA 2XIBA 1XRSA 2PWEA 3NIYA 5G2HA 2CBUA 1GJPA 2VVNA 3MUIA 3DI0A 1QOQA 2RJGA 3OZOA 5I0DA 4X2RA 3R13A 3G0SA 3MTWA 3UNTA 5DO8A 4AXKA 2WSRA 4MWAD 1I2NA 2E9BA 2IQDA 1IXPA 4OQVA 1HW6A 1OCNA 3QF0A 4Y9AA 1JAKA 3IRDA 4XUGA 5BXTA 4PMXA 1LL4A 1G5AA 4NNBA 2XFRA 3O6AA 5C9UA 4LTSA 4BHYA 3EX2A 2HZGA 2XVKA 4AB4A 1FWNA 2NQZA 4YVPA 1JCLA 1C9WA 3W7DA 1YYAA 2VVSA 3N6HA 3AU6A 2R1PA 3G1HA 3BMVA 3C4UA 3AJXA 3P61A 4D8AA 3OLEA 2GJLA 1T8XA 2YA1A 2WO5A 1RJPA 1S3HA 4B9ZA 2J7DA 4HNTA 4UR9A 1PZ2A 3N2OA 4O53A 2QGHA 2AGTA 3BG9A 2BX7A 2YCKX 1VFHA 4JIRA 1OJXA 3U57A 5AC8A 1LRQA 2BVWA 2QCMA 3LLDA 4Z42C 1DJGA 4I7VA 4UCFA 3S5ZA 2XSAA 4O4VA 1RJRA 3RM4A 2E5DA 3MBFA 4YHGA 5REQB 3L4ZA 3PWAA 1EEPA 4JYDA 1TUXA 1OWQA 2E6AA 3HFYA 1K9DA 3R6IA 4U4MA 3OVGA 5C8BB 1VKFA 3AS2A 4DNHA 3LN3A 4UMBA 1J12A 4GIEA 2V9DA 1GVOA 3WUBA 4PGLA 3TC7A 3VGEA 2E4TA 4JQ3A 1BXNA 1TIWA 5FF3A 3SO7A 1W1TA 1F3TA 3W7MA 2XHYA 2DZSA 2WM0A 4B5TA 1DJYA 4A4AA 1HXJA 3UPWA 2W6RA 4BWLC 2PDMA 3T07A 2XIJA 2I17A 2X40A 2Z28A 3EWDA 3ME3A 1SFLA 1UP2A 3FHAA 1XYMA 1V6TA 1ZCCA 4LS0A 4XZMX 1XP3A 4UTHA 1MUMA 4ZEPA 4PE8A 5CGMA 3VOHA 2JEPA 1YPIA 1ZENA 3GYEA 1ITUA 3V5FA 3NQEA 4L61A 2FPTA 3LD5A 1PWLA 2CLOA 3URBA 1XRTA 1VRDA 2YL6A 3E0IA 2FZDA 2QQ6A 1VFUA 3SCNA 3KS5A 1XQKA 3MMUA 4N4PA 1YPFA 3O05A 5AYBA 1TJPA 2VTFA 4G7FA 2FDSA 1DBTA 3DUGA 5I00A 1C3FA 2HXUA 5HINA 3QQ1A 4GQ0A 4UC5A 4FLOA 3KZSA 1ZJIA 3RX3A 5CPOA 2DT0A 4O0QA 3ARSA 5HUOA 2XPKA 3QR0A 1NSJA 3V0SA 1CGUA 4DYEA 1B3VA 2D2HA 4P7RA 3ONCA 1EGMA 2OEMA 3NO3A 3VKCA 1XC6A 1J93A 3KL0A 4ICNA 4N9BA 3BAIA 3S2NA 5A1AA 2VEGA 1CLXA 4XVDA 4Z1BA 4QTGA 3W37A 3CHEA 4ERAA 4O13A 4OFCA 4WUIA 3MUXA 1D3HA 3GHUA 4ZOBA 3NQ2A 3LCGA 1KM6A 2WKGA 1DV7A 3TYUA 4NYUA 3U7BA 3A22A 4PRWA 2X1UA 2JFEX 3W86A 3AIEA 1WZKA 3EDJA 1QATA 3DN5A 3G77A 3TOPA 1C7SA 4E2OA 3FDGA 1KR0A 4NL1A 1K8XA 1AW5A 4HU8A 4LC6A 1XQLA 3SGUA 3UJSA 2PWVA 2H9AA 3GNNA 3TAKA 4NY2A 1PWMA 1MO0A 4JQ1A 1HKIA 3C0SA 2RKXA 1D3CA 1D8WA 4MB3A 3E0WA 5D9PA 1E40A 2VYOA 4H1ZA 3B9OA 3OLGA 4FPSA 1CEOA 2G37A 2FZ8A 5BNKA 4O1DA 1Q65A 1T6MA 4KEVA 2X2YA 4Y7EA 2WQDA 3OVQA 3SQLA 3QLDA 4IG2A 1MEWA 1Z32X 3OYXA 5LNRA 1LP6A 3M0HA 1OC6A 4WX2A 3M0IA 1XIMA 2NQ5A 3USZA 1FWTA 1ZBVA 8XIMA 1UUQA 2AKMA 3VE7A 3PAJA 1V6WA 4HA0A 2A3EA 1BQGA 3CLWA 2G95A 4EWND 3F4DA 2FLIA 1E43A 1NF7A 3FIGA 2A4AA 1X8CA 4EXQA 3DFQA 1G4SA 3CEPA 1S2AA 4JXCA 4JTRA 1R38A 3PM6A 4F2BA 3RXZA 5U4NA 4S3BA 1ADSA 4IUGA 2VUYA 1UB3A 4A35A 4JY9A 1BGGA 4HK7A 3IIOA 1E70M 4GC3A 2XH4A 3B9EA 1GUVA 1GOMA 5HULA 4MLRA 1ZUAX 1DJWA 4UFLA 1RPXA 1KTCA 3FV9A 4XZIA 4AX6A 2NVDA 3A23A 1I6NA 3W2MA 2DIKA 3RRAA 1RALA 4JKMA 3WLHA 1Q13A 1RCQA 4PUEA 1IZJA 1C29A 1JPHA 3WH5A 2OLHA 4NX5A 4QE5A 4WJ8A 3ZLHA 2B7PA 3T2OA 1FA2A 4AD4A 1O94A 3ARQA 6REQB 1WZLA 5HDRA 3B3DA 3TW6A 2YL8A 3GVRA 3SJNA 1GQLA 4KERA 1RVGA 3CASA 5FF0A 1KBIA 4O14A 3W23A 3EX1A 4AY8A 1JCMP 2PLJA 1GOKA 2O92A 4JDBA 3R79A 3EDKA 1CNVA 4MNMA 3VNJA 3LDVA 3PZIA 4JX5A 1DWHM 2JKEA 1N7KA 1SYTA 3A12A 1BPLB 3RPDA 3SCQA 5LZLA 4MM1A 2Q3OA 3M5VA 3VIKA 4ILSA 1B3OA 2HWGA 2PGRA 1C91A 1TV5A 1YBQB 4I5XA 3V75A 1J0HA 1M1BA 3CB8A 1QASA 3MB9A 3W6YA 3W27A 3ERPA 1Q5MA 1L6FA 4GE8A 2ZICA 3GZ3A 1Q63A 4JFVA 3EX4A 1CIUA 1PIFA 3NSMA 3NYDA 4B4HA 3VNLA 2Y61A 3LCXA 2EPNA 4Q7BA 3HIJA 1Q7MA 4JTLA 2I16A 3F4VA 4GZ7A 4HGXA 4JIEA 5EFDA 2F7FA 3KOWA 5F2LA 3HPSA 2PDNA 3B9AA 1DQXA 2FTPA 3ZLFA 3SY1A 3AWOA 4O54A 1PVNA 3NZ1A 1JZ3A 4IG2B 2OODA 3Q67A 1MUWA 3WF3A 4CQ8A 1B3YA 1BYBA 3URAA 4O0ZA 1K4GA 3T05A 4CGTA 3EWYA 4JZ5A 4X22A 3BDKA 4G5DA 3TR9A 1SZRA 4L80A 3W1TA 2PP1A 3QSRA 4W7WA 4M5PA 4BQ4A 1WA3A 2OX1A 1FHLA 2XN2A 1F05A 1ZY9A 1YTEA 2VRJA 3DERA 4DO7A 2BGSA 2CZEA 3GVVA 4H7CA 2VKZG 3PHAA 2G97A 1CGXA 3OW1A 2QCCA 2XGZA 5AECA 4LY8A 3Q58A 4O16A 5EPDA 2EXOA 4AZGA 3RILA 2VX6A 2V69A 4AZHA 2VXNA 7XIMA 3VCCA 2WANA 4KFNA 1E6XM 3F2DA 3OVRA 1RD5A 4IP5A 3AMKA 4MWAE 4C6DA 4PBFA 2QJMA 3IS4A 4AD0A 1HKWA 5DMNA 2BOGX 4D71A 5D37A 3TONA 1NH6A 3AXHA 3P60A 4BEUA 3FLUA 3SIZA 5EMKA 3BAJA 4GY1A 2ZX6A 3BLFA 3P3BA 1ZBCA 2ZBTA 3KBNA 1PZ1A 2HNEA 4GOAA 1ZP3A 3VOGA 4KESA 3EX6A 4TX6A 2PDPA 1A5NC 4HK6A 1NTHA 2P76A 1W6TA 3ZXWA 3TMQA 3GHRA 3PZQA 4ORMA 3O6DA 4LVGA 3F5KA 4POCA 4FO4A 4HJFA 3FK4A 4R3UA 4KKXA 5CGTA 1KCZA 1WDQA 4C90A 2J8TA 3R89A 5ABGA 1X38A 5A6JA 2GJRA 1JCNA 1L2UA 1O6IA 4H3DA 1VP5A 2PGEA 1LLOA 4N7QA 2C7FA 5M2FX 4PCNA 3S9YA 1IT0A 2VRKA 1U1JA 2ZIDA 2HK0A 1VR6A 1OM0A 3AHYA 4DI8A 2PE4A 1A80A 3H21A 1R3TA 3ABRA 2QEZA 2WC7A 1GQIA 3W2UA 4ZXLA 5ABEA 3AXIA 3T40A 4RDZA 2WMHA 3LU2A 4LH8A 3TZFA 1ME8A 2L5HA 4C6FA 1I2QA 1I2OA 4JEJA 1EP3A 4IH3A 2CZ5A 5AVNA 1IZCA 3M7WA 1UKPA 1S5TA 2Z2BA 3GNOA 4HA3A 2XTKA 1TE6A 1XICA 4M19A 5AHIA 1X7IA 3W73A 1GWJA 5LIWX 3AMDA 3P7YA 3JUGA 4KETA 3AYRA 4F2TA 4GACA 4I90A 3OZMA 3A13A 3ATZA 1TA3B 2XIOA 4EP8C 5HJXA 3LERA 2RAGA 3CL8A 2OT0A 2HCVA 2RDXA 1XYZA 2O9OA 4ML4A 2J7HA 2HPMA 3MSYA 3WJWA 1E72M 4NJHA 4L1GA 1J96A 4CNSA 4Q8WA 4GZEA 4HZ6A 3MP5A 2BY3A 4OKDA 1DE6A 3LMZA 2D23A 3REQA 3SCOA 3G1DA 4V28A 4KQNA 3WL0A 1EZWA 3N9SA 4PMOA 2VX4A 2XWEA 3TK7A 3M43A 3CQ0A 4TMCA 3B03A 4GI9A 3CHFA 1UWIA 1POKA 1JIBA 4AEOA 1T0OA 2HE8A 3SFWA 2F9RA 4LF2A 4YWIA 3NQCA 2J9YA 5BOFA 4F8XA 3CQIA 1S2UA 2NXHA 3DI1A 3THAA 1EF3A 4KWOA 4Z1CA 4DYKA 2I5GA 5MHBA 4V2XA 5DCEA 1TX2A 2V5BA 2R91A 2VWTA 5DBTA 3W7OA 3QR1A 4H04A 3VD4A 3FEQA 5I3HA 2J4GA 3D46A 4MTVA 1UWSA 3G18A 5I24A 3HPZA 2PBOA 1JUBA 3EKLA 3OOQA 3G22A 4UOJA 3FY1A 1KO0A 4NI8A 2GDVA 4UR7A 1EWEA 4B5XA 5E9AA 4FOJA 4YYFA 3TQVA 4DHGA 1TTJA 3QJAA 3TAOA 2F84A 4LBRA 3QYSA 3UJFA 2VC5A 3UESA 4INFA 3GIYA 3QV9A 3ZJ6A 2O4MA 1R5YA 3OEXA 4F0MA 1VCFA 2C18A 1EFZA 1XIHA 5F1VA 5CLTA 3M0LA 3LM7A 5J8LA 3V5OA 1G94A 3WIJA 4HZMA 4KGLA 8TIMA 4O28A 1XX1A 3UR2A 3N4EA 1OYAA 5FJUA 3VIJA 1WOBA 3HQPA 3VDGA 2MUCA 4HU4A 4UFIA 3CIVA 4DWSC 1W31A 2VO5A 4ZO9A 2OU4A 3FXYA 3EEZA 2AOSA 2QMJA 4H7ZA 3GTFA 4R33A 2AQOA 5FEWA 3OHMB 1JNEA 2BY1A 1VENA 3DFYA 1DJXA 1E9ZB 4IGHA 1AJZA 2EQDA 1M65A 2WSKA 1GTEA 2DEPA 4J9JA 3S1XA 4Q8PA 4BS0A 1WP6A 4LYPA 4CLMA 1PDYA 4DBEA 2FHBA 4NASA 3L2LA 4Z0SA 2D0FA 4AG0A 2DORA 4LAMA 1E4IA 4GNKB 3F5JA 3LTYA 4ICMA 3PZUA 4AIUA 1UWQA 2B7QA 2OQHA 3K4AA 1P6CA 2AMXA 3ZOAA 3ARPA 3WG6A 1OX6A 4ZO6A 5I3GA 1W5MA 1LDCA 2VEFA 5LHEA 3B8UA 5D2YA 5LGXA 5G1MA 5ECVA 2CZVA 3FSUA 2QF8A 1D7KA 4W5ZA 2DZPA 1MYRA 2Q01A 3REQB 1VLIA 3GU9A 1BWKA 1C8QA 4AU0A 4FAMA 1MQQA 3EKZA 3NGJA 2VM8A 4HHLA 3UR8A 1NOUA 4HSNA 1XBVA 4QX4A 1SZEA 4DAIA 2WBGA 3BJTA 1KA9F 4WOZA 4JIHA 3SB0A 3CTLA 4GCAA 2ZE3A 2J6XA 1H09A 3PG8A 1OSEA 4K3ZA 3H7RA 4OUEA 1OX5A 2A21A 4OV4A 2WYSA 4L9YA 1VPQA 1J2WA 4D6IA 2D22A 3DESA 2EEXA 4JAWA 1CGYA 4DJEA 3V7PA 2E8ZA 3CPRA 4EPKA 3EEGA 4JN6A 3MA8A 2UY3A 3B0XA 4H6KA 1XYLA 2XM2A 3AROA 1VHCA 2WAGA 2RJHA 4UQDA 1AJ2A 1H60A 1A0EA 3UW6A 2O7QA 2PRHA 3IV3A 3FXGA 3UERA 4M6PA 3POCA 4B3KA 4RXGA 4JN8A 3W70A 3BJFA 4HD5A 3UP8A 3H7VA 4DZ5A 1K70A 2TSYA 3WD2A 3WK1A 1XSIA 4GLEA 3EMZA 2HV5A 2XVPA 1JF6A 1YE4A 4Q22A 3FCPA 3EOUA 1XG4A 1GVYA 4UIOA 3GVWA 3UNDA 1G4PA 1W8GA 5EMUA 1SGJA 4O57A 3NG3A 4MADA 5BXSA 3USBA 3SUVA 2PB1A 3CWNA 1V6VA 3K4DA 2ZX5A 3CPUA 1V0NA 2CITA 5TBOA 1NY1A 3LCHA 1PIGA 4DM1A 2TYSA 2FPVA 1OX4A 5BU9A 4GINA 3WLMA 4GUHA 3AIRA 2I14A 3P80A 4ZTYA 1UMLA 3LPGA 4J35A 5CC3A 2HXTA 3F5LA 1V03A 4K68A 1JFXA 2Z2AA 3ARVA 3CO4A 2REQB 2JBMA 3BGAA 1C92A 1LM1A 4HP5A 1NIUA 2INZA 5A3HA 2PGWA 4OBRA 2ZUVA 3HURA 4KCTA 2J9XA 4IFRA 1C8VA 2VEMA 3MU7A 4KWWA 1AA1B 3MSRA 2X05A 3S4TA 2NUXA 3W01A 5EL1A 2WVTA 2PDKA 4DJFA 4RNHA 3QY8A 2HISA 2BOFX 2GFTA 4US5D 4EPDC 4MB5A 4N9CA 3P5ZA 1B2YA 3WQ8A 1M53A 3EXSA 4WJEA 3P93A 4RXFA 4Q4MA 1Q6CA 3NAVA 1ENUA 1MFVA 3CTTA 3C52A 4CD4A 3OVPA 4FOKA 3L66A 3SR7A 4CQCA 1F5ZA 3WDQA 2Z2UA 2VP8A 1UKOA 1OC7A 2NX1A 3VYLA 1RA5A 3ZR4A 3GDKA 4EANA 5M5DA 1KV5A 2E6FA 4P8XA 5H8PA 3VA8A 2IMRA 1KGUA 4H41A 2CLHA 3VNZA 4G1NA 1KRCC 4K6AA 3BJSA 4XSLA 5DX7A 4DUXA 1EC9A 1JUKA 4DF2A 5C55A 4Q8NA 4QP0A 3GXFA 3LPOA 2I9UA 5FAGA 2DVXA 4TV6A 1V08A 3GC5A 4OWGA 3GW3A 2PTYA 4UZUA 3IJQA 1AQMA 4RL3A 3TV8A 3VVGA 4EK7A 2YCLA 4OZOA 2DZWA 4HA4A 1WAWA 3GX9A 4V1YA 3ZVHA 1QNQA 4JDYA 3CHVA 1FX6A 1XH2A 3KBWA 3GIQA 2XU2A 4L6DA 3PPHA 4RK8A 1XD1A 3CUGA 2VFIA 3OB8A 4U2ZA 1H50A 3STCA 5D8WA 3WQCA 2PMQA 3S2LA 1HNYA 3SRKA 3QBUA 2Q02A 2P53A 3CZ8A 5C2GA 1OIMA 4E6MA 4MNKA 3CIXA 3HG3A 2V3EA 1JI1A 4CCDA 3RNDA 3WFAA 3N2BA 4JPGA 4ZMGA 5KZEA 3K4WA 4JTDA 3CJPA 4BFAA 4DNMA 1TJRA 1UQZA 1OX4B 3AISA 1K1DA 1F61A 4GYJA 4X0NA 4GABA 4BK9A 3NQGA 1ZJBA 5E0CA 1PE1A 4XD6A 3PJTA 2PP3A 1GEHA 2DSUA 2RUSA 3UG5A 4RW3A 5IOBA 1W5QA 2RDUA 1FXQA 3L65A 3CT2A 3W7NA 4FR1A 2G3IA 3LCWA 4KPLA 1V0MA 1FCBA 4EX4A 1H4PA 4IX2A 1NU5A 2B0MA 3B8TA 2RGLA 1TV7A 2NVAA 3RK8A 1WUEA 4HYRA 2J7GA 5GVJA 4BEQA 1DL3A 3BSMA 4WCJA 1GJUA 4O1FA 4W7VA 4CU6A 1J6OA 3H12A 4L64A 1ZNNA 1ME7A 2ACRA 4U28A 2H3BA 4NRRA 1TPDA 1YTDA 2EPKX 4KWUA 1SZGA 2V0TA 3WJSA 2JKPA 4UQCA 1W3KA 4DUWA 1S2TA 2FB2A 1X1OA 1XIBA 3M07A 5CAKA 3LENA 2QF7A 1N8WA 1RV8A 3TFCA 3CZJA 2ZC8A 4AISA 4BKNA 4ZB0A 9CGTA 5E5CA 1ZS2A 3SJ3A 3LHTA 2ZZ7A 1OZQA 1ZCOA 3MDWA 3N4FA 4U5KA 4IQJA 4UZSA 3NL3A 4RCXA 1R9ZA 4K8GA 5F2MA 1KCXA 1F6KA 3NVTA 4YPJA 3ARXA 2GWNA 3WQOA 3GD6A 5BWAA 3VAVA 3SUUA 2NUYA 1B90A 4QG8A 2ABAA 3W29A 3C2VA 2VDIA 1RR2A 4AH7A 5A6BD 4ZOEA 2DVUA 3SURA 4KH2A 2VGGA 4ZE5A 4O50A 1TWWA 2V2DA 4M8UA 3PUDA 1XD0A 4J2PA 4CKQA 3AOFA 4LNYA 2BMBA 1ZJAA 4XZNX 2YCLB 3ZQ9A 3EB4A 2UY5A 3ZVHB 3GDRA 2PAJA 3KOXA 3KCJA 1DJIA 4GVGA 3UR5A 1MVYA 1HJSA 1LOQA 2V3GA 3RLUA 2PTXA 2NV1A 1BYCA 2VURA 4IJBA 5HBFA 2WJDA 3EWZA 1LYXA 2FHFA 1XBZA 4Z2JA 5A6TC 1HO1A 1ECQA 4HPXA 4DBDA 2W62A 2EO7A 5HA7A 3NDOA 1QNRA 2E5CA 4FNTA 4GXWA 3PZ9A 1I0DA 1DXIA 4BI5A 4IM4A 5EYWA 1FWJC 4WIWA 2H8ZA 3WY1A 1O1HA 1ELSA 2YX0A 3ES8A 5EMJA 3T7VA 4LAKA 1Q6EA 2C0AA 3WDRA 4GJIA 3FAXA 1UR2A 3GNRA 3H2NA 1US0A 3M0JA 2AL2B 3SSZA 4IIDA 1EJSC 2JE8A 2Z24A 1W3HA 4C5ZA 4JX4A 2FFCA 4S3JA 3TTQA 3MV11 3VNIA 4Q8MA 2CCRA 4BF5A 5D03A 3S1UA 1TG7A 3MKKA 2KAUC 1J5TA 1LL6A 4NF7A 1R3SA 2PDJA 4I3GA 1UR9A 1SR0A 5CCZA 2YSWA 1X6LA 4GO8A 3VZXA 5HR7A 2W9MA 3IAPA 4ROPA 3MPGA 3GLCA 3E1F1 1O60A 4LUIA 5AHNA 4S38A 5T9CE 1QR7A 1QVBA 5HMEA 1EDTA 3QEZA 2ZRUA 5HJYA 5KZMA 3EAUA 3U2EA 3NVDA 5LKYA 1H49A 3H70A 4IT1A 1S2VA 4IP7A 1E4NA 2VEPA 3W1XA 3UWUA 3E0LA 1FUYA 1TELA 1EC8A 1GK8A 4GYPA 4QJ4B 1MUCA 3EA2A 4P2VA 1TTIA 4UMCA 5CSSA 4WSHA 1JG9A 3TU9A 3G8EA 2V3DA 1V0KA 1P1XA 5A8MA 1FKWA 1Q7QA 3MQTA 3UCCA 2ZUSA 2QAFA 3H4GA 3KL5A 5F4WA 1KBBA 4I7WA 4UNIA 3QPEA 4RPQA 1FWGC 3ABSA 4I6VA 2FMNA 1UOKA 1JI2A 4LCRA 3KLKA 4G7EA 2J75A 3FA4A 3KAOA 2POZA 2OYKA 4IWWA 4AWEA 3CQHA 1TUFA 1FWHC 1FHUA 3K1GA 3O0KA 3VZZA 1PZ3A 3T2QA 1CXLA 5K2ZA 2QVHA 1HKVA 4YMZA 4PTMA 3OHIA 3W82A 2YXGA 3BSGA 3IVSA 4RZ6A 3CAKA 4EF8A 1KFEA 4WOQA 3DOPA 2Q8XA 2D24A 5HWMA 2FGBA 4CD8A 4UTKA 3PZOA 2XN1A 1E0VA 3O63A 3H2EA 4C7DA 4C6QA 1XLGA 3DX5A 4X63A 1U30A 3DC8A 4Z0JA 1VCVA 3GDLA 4HTYA 4CN6A 2ABBA 4ZO7A 4OHQA 2ZA3A 1FCVA 3AYVA 3NDYA 4UTUA 4L7ZA 1OGBA 3EWXA 1S39A 2VC9A 2CLMA 1W1VA 3QLLA 3VKBA 4LT9A 1UWAA 2QIIA 2P8BA 3LZ5A 4BWLA 3CWHA 3MANA 3IJLA 1TVLA 2GL5A 3ARZA 1QT1A 2JF7A 3K46A 3C86A 3CYVA 1XYCA 1QDSA 4TR9A 5D2TA 1ODUA 4LBUA 3RIKA 5E0FA 1W1ZA 3AIQA 4JCLA 1DWGM 2NZLA 1TWSA 1V77A 2HRWA 1WZMA 1QU4A 1V02E 4PMJA 4Q4RA 2GDUA 3SI9A 1W9BM 1G6CA 4HN8A 1I4NA 2VDHA 4JR5A 5PTDA 2R94A 4FI4A 1F73A 1KGWA 2AMGA 1LQ2A 4C1NA 4NJIA 3H4WA 3F4WA 4DO5A 1GOXA 3S47A 2D1ZA 4RDWA 2W0UA 1K8CA 1L6WA 2NXIA 2A1YA 3KDNA 1R46A 1JAEA 1K02A 3FKRA 3SW6A 1SUXA 3A21A 4Y9PA 2BB0A 1GJWA 4YL2A 2FTYA 4UOZA 4G9PA 2OQYA 3V0UA 4EE9A 2O9RA 1Q8JA 1E51A 1JZ5A 4JKKA 3RU8X 1BYAA 4JTKA 4X2PA 3AALA 1EWDA 4NZ1A 1I9CB 5CZSA 4H8VA 3WMBA 3KZPA 4A2RA 3T9PA 1AQ0A 4I9MA 4C6LA 3G3DA 3SECA 1EA0A 1F07A 4LVFA 2OMAA 1XS2A 4FLSA 4FNRA 1HL8A 1I1XA 4IQEA 1VF8A 3TIMA 3OQ8A 1QW8A 4NNAA 1LQAA 3M0KA 2WNWA 3EA3A 3M5YA 4LU0A 4GHRA 3GVQA 3MVIA 4RUBA 4LPCA 4UNLA 1XBXA 4G7EB 1IZKA 3KHDA 3DG6A 1J0YA 2XN0A 4AW7A 4PMDA 2J13A 3CO8A 2WXDM 1IR1A 3NQMA 1WAUA 4GX9A 4BA0A 3RHGA 4PZVA 2BDQA 2Y7EA 2A7RA 1ZU8A 4DLFA 2YXXA 3OP2A 4F2UA 3VU2A 3WBYA 1EBHA 2CERA 3SRHA 3CEUA 2DSWA 4D1JA 1XIFA 3TA6A 3ITXA 3N25A 2OGJA 3T0TA 2RFGA 1MWOA 1K7FA 4XWUA 1ZHAA 2I9EA 4PSRA 3T81A 3HFTA 1PCWA 5CC7A 3LY0A 4LB3A 5BYWA 1FQ0A 2HJPA 4NJKA 3V35A 4D6DA 1A5BA 3MKVA 4GBDA 1W2VA 3NL2A 1A0CA 2OB3A 2VDGA 4MF4A 5D4YA 1YEYA 3FGCB 3N1AA 2XSXA 4AYGA 1OQFA 3WH8A 2ZKMX 4K1GA 1JD7A 3WQWA 2GQAA 4QJ1A 3UVAA 3MMDA 5LSMA 1QO2A 4UFHA 4YWSA 3BW4A 1A5CA 5XIAA 1E1FA 3WUEA 1H41A 3MZNA 2ON3A 3URQA 3CV6A 2E68A 4GO9A 2XINA 3HGOA 1B9BA 3AS1A 2EG7A 3WF1A 2ZXBA 4I9TA 3AQUA 3P74A 2GVEA 1OF6A 1VBUA 3W1PA 1XIEA 4MJMA 1XW8A 1H0GA 2XVLA 4MG4A 5G2IA 5LIUX 5AYIA 3JZEA 4ZBCA 2QMKA 3GAKA 4NZ5A 3PZNA 3C2OA 3P6LA 3K30A 1CECA 2X7VA 4PUDA 1RHCA 1BG4A 2QCGA 3B97A 3L5AA 5FEPA 3Q37A 1BVNP 1TFVA 4EAMA 5I3IA 4J40A 3UCQA 7TIMA 1B31A 4M7SA 1UJQA 4GIYA 3DFTA 1UA7A 4B5WA 3I3BA 2X1TA 5HOSA 3CMFA 3RPTA 2XIIA 5CPNA 1LZOA 5I78A 1UP0A 5BROA 3W74A 5HQMA 3WFZA 5DT5A 4AZ7A 5CPMA 2D2GA 1VRXA 1CBGA 2IPWA 4OU1A 3TQPA 3PUEA 3GR8A 1L6SA 1QI5A 4EIVA 2B4GA 7ODCA 4R9OA 4QBXA 3AICA 1HP4A 2YDRA 4ACZB 4DLMA 3M0MA 4FXRA 3GE7A 3VX0A 2P88A 4IPLA 4URIA 4KIRA 4WGHA 2BZNA 2WZIA 5HMSA 4QLKA 3SFKA 1LWHA 3PUOA 3FYYA 1TO3A 3UWVA 3URNA 4A3YA 2V81A 3F7JA 3IANA 4Z08A 3R58A 5DRCA 1V3JA 3C3NA 1UP3A 2FPYA 3H23A 4H9YA 1LTDA 4CQBA 3V1PA 4AC1X 1DHPA 4B16A 3VILA 1E4LA 2XZ9A 4BCEA 1MW1A 3W85A 3APGA 3I6RA 6CGTA 1OG6A 3N34A 4IPNB 4PFMA 2RDWA 2VI0A 3UVIA 3TTOA 1JCYA 1Q2RA 3M6DA 4MJ2A 4EPBC 1E73M 1JQVA 3EKGA 3QV6A 4JNMA 2PCEA 5H1WA 4WDUA 2GSEA 1XLIA 4JD4A 3LCFA 3LXAA 2CYGA 4FNUA 1GQKA 4AY1A 4OVXA 2AKZA 3D5HA 3UG3A 3N18A 1PTGA 3JZUA 3ZSSA 1E9LA 5C6MA 1QO5A 2PWDA 1OD8A 1RQBA 3BXWA 4TU1A 1DEDA 4HB7A 2IPFA 3KRBA 4GISA 3WK3A 5JXQA 4EXBA 4FK9A 3W7PA 1OB0A 1TR9A 4LUSB 3QY6A 4QROA 1T99A 4E0CA 4O1CA 4S3KA 5CBBA 1AH0A 1FWFC 1F3XA 1XBYA 3E6EA 3O06A 1J0JA 1FWWA 4GY0A 5MF5A 3QVQA 2CZFA 4AF0B 3S5YA 4S23A 6PTDA 1NQKA 5CBIA 3BCJA 3TLQA 2ZZ3A 2O9TA 1FH9A 1KTBA 2WOQA 5HK4A 3WLQA 1Q6RA 3MW7A 1ZJHA 2P1FA 1XISA 3BG3A 5A6SA 1OGSA 4J27A 5C7VA 1E1CA 1YDNA 4H9VA 4Q4SA 3NGFA 2NWRA 4ZOAA 4Q33A 3WZ0E 1ISZA 2GVLA 4W93A 2DP3A 1JULA 5A6LA 1JXKA 3G24A 4PBEA 3AZSA 5D04C 1MFUA 3SCWA 1MSSA 2BVDA 2PSNA 3WBXA 4CNNA 4YTRA 1VIWA 3TCEA 1H63A 4GUFA 2Z26A 3L4TA 3ZR5A 3SUTA 1J6PA 3WJZA 4CU7A 4MUPA 4H6RA 3MUZ1 2HDJA