2ZXBA

Alpha-l-fucosidase complexed with inhibitor, ph-6fnj
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 161
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zxbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zxbA01
2WVUA 3DX3A 3A21A 3WNPA 3VIMA 3F4VA 4DWSB 3GYCA 1WDRA 1R46A 1JXKA 1QI2A 2ZX9A 1FFQA 2DT0A 2XHYA 4TOQA 1CXEA 2PWEA 1E71M 4ZFMA 1XYFA 5E9AA 2YA2A 1C8YA 1UD4A 2E9MA 1VEMA 1BQCA 1W3HA 1B3VA 1E6PA 2QHAA 2ZUSA 2F8QA 4HA3A 3W26A 3GBEA 2X05A 5DMYA 1J0IA 4MDOA 4Z2JA 1GPFA 1EO5A 4P8XA 1F4HA 1FH9A 3BGAA 1W9DM 1V3JA 3WY3A 4JL1A 2Y2WA 4U3AA 1VRXA 5ABGA 2BXYA 3VGGA 1ITCA 4TVUA 1K9FA 2VC9A 2VZTA 3MV01 1H49A 4PMXA 3EYPA 2WM0A 4NSBA 3WUFA 2EACA 2E3ZA 3HU7A 1MWOA 4J3UA 3GNOA 2YFOA 3EDJA 3WY1A 4B9ZA 2Z1SA 5I0DA 1TQTA 3PTMA 1E0VA 1CXIA 2MANA 2Q8XA 1TMQA 4EANA 1WAWA 1GQLA 3BLBA 3ZR5A 3MUIA 1AQMA 4J27A 4CD5A 1E55A 3AZSA 5C70A 2O9PA 3EBVA 2FGZA 1QNSA 1I1WA 3APGA 4KH2A 2EADA 2PWHA 1X6NA 3W29A 3M07A 4GZIA 1B90A 1VFUA 1UHVA 1D7FA 2XUCA 2Y8VA 3T2PA 3VIOA 3K8KA 1GOKA 4UOQA 1L0PA 1A47A 1QVBA 4FNTA 1CGUA 3MUAA 4X0NA 4UOZA 4HMEA 4GO9A 3DHPA 3SIMA 3S2CA 3MUZ1 5FL1A 4PMQA 3U57A 2ZXBA 1XV8A 4NRRA 1HX0A 2HVMA 2PBGA 1WCGA 3BUDA 3L4VA 1XSJA 4E8CA 3AHXA 2VX6A 2ALWA 1UOKA 1JFXA 1RD6A 5I78A 1GHRA 1QOXA 4AEFA 2CNCA 1CPUA 1O7DC 4D71A 5ABHA 4M80A 4CKQA 5JBFA 2XSBA 4HZ6A 2W62A 3VIHA 1PX8A 5D9OA 5ABFB 1TQUA 1MFUA 2WHKA 4A3HA 4QCFA 2CCRA 2F18A 1H5VA 1V03A 4MB5A 2G41A 1JF5A 2DQXA 2QPSA 2ZXDA 3WBEA 4AZ7A 4FNSA 3AMDA 4TVDA 1PX3A 1BPLB 3BXWA 4CN6A 1MQQA 2D22A 3MMDA 4GXPA 4AD3A 4YHGA 4R27A 3SUWA 4BCEA 3HZ3A 5FIPA 3W24A 1MQRA 3ZJKA 4CU8A 2VCAA 1ISZA 3LRMA 4AYGA 1RH9A 5A2BA 1R85A 2YDQA 1H0IA 4PRWA 4WJXA 3W6LA 5BWFA 3KE0A 3VDHA 4JFSA 4X0VA 1VEPA 3BSGA 3OGVA 1WKYA 3LPFA 1XSIA 1UR2A 4MNJA 4AMXA 1NQ6A 3GXDA 2VZSA 3ZIZA 2YIHA 1QHPA 1B3ZA 3BCDA 4U5KA 5D9PA 2NT0A 2WLYA 5KZ6A 1SMDA 1CNVA 1TUXA 1WE5A 4ZXOA 2BNJA 3CZEA 3CC1A 1UKPA 3GDBA 3AMCA 4PMNA 2FH6A 2BY2A 1XCWA 3VM5A 3ZQ9A 3GZAA 3AFBA 4W5ZA 3WNLA 3SCVA 3WH6A 3FHQA 3PZVA 1HNYA 1HVQA 2VOTA 4OKDA 2WWCA 3KL0A 4U33A 1EXPA 1E4LA 1W1PA 4W86A 3WD2A 4Q22A 5E09A 3KL5A 3U7BA 3VM7A 1W9VA 3JUGA 2EABA 1VF8A 1K9EA 1QBAA 1R34A 5IHSA 2V5DA 1JZ5A 3AHTA 3IK2A 1GQJA 2XVLA 4U3CA 3BVWA 4PCTA 1EIBA 4MNMA 1E6XM 3GXFA 3K46A 1V08A 4PMYA 4U5IA 1W3KA 3NDYA 2DDXA 3WY4A 2WC3A 4AZBA 4IPLA 4JFWA 2E9LA 1NOUA 2UY3A 5D8WA 4EKJA 2V38A 4PMUA 3NJ3A 3WDRA 5A6MA 1E6NA 2VT0A 2F1BA 5CQ1A 1JDCA 1TQSA 2ZWZA 3PBGA 1JI1A 4W88A 2OWWA 2A3HA 3VD9A 3RPMA 4AMCA 1UKQA 3W6MA 2NW0A 4HA1A 4K68A 3MU7A 3TTSA 4FK9A 3UERA 4W84A 3VILA 1UYQA 2CBVA 1TVNA 3BAYA 3N04A 1JI2A 1UD5A 2X2HA 1EDTA 1PZ3A 3ARVA 2J25A 5I77A 3AQUA 2BFGA 2DEPA 3BAJA 3GXMA 1SYTA 4NX0A 3IJ7A 3AZRA 5EB8A 5CG0A 2AMGA 2RGMA 4M56A 3D51A 4UQDA 5A8OA 3WL0A 4F9JA 4PMVA 1MXGA 1L8NA 1OWQA 3WSUA 1BTCA 4CUCA 3W27A 1B3XA 4AIEA 1SR0A 2EPNA 5A8NA 1NP0A 2GK1B 4P7NA 1NH6A 1ZBCA 2WAGA 4JCLA 3CUGA 4D1JA 4OJYA 1UH2A 2D3LA 1JF6A 1E6SM 3EMCA 4JKKA 4DUWA 3EMQA 6TAAA 1XH1A 3LRLA 3PZUA 3WEZA 2WHMA 3WUEA 1K6AA 1O6IA 4KGJA 2XIIA 2ZUUA 3QHOA 1JG9A 3FXYA 5A8QA 3OA5A 1B1YA 2YLLA 3T0BA 1UWTA 1V0LA 2XYLA 1OCQA 1UKSA 2VX5A 3VDCA 2F7OA 5IXEA 5E0FA 3DHUA 4LGXA 5BRQA 1TE1A 4DUXA 2GJXB 3BUQA 1Q4NX 4Q7NA 4EK7A 3N9KA 5HOSA 3KL3A 3ECQA 2IXUA 2EXOA 1QI5A 1Q6FA 4HPGA 4HU8A 1MW2A 4ML4A 3BLPX 3TV8A 4D6DA 2FHBA 1J01A 3M7SA 2YDRA 3W53A 5A6BD 5D8ZA 1AVAA 1E3XA 3RM4A 3VVGA 4HPHA 3WMSA 1E9LA 5AC4A 3WQ5A 2WHLA 3VIIA 2DIJA 4IPNB 1M03A 2J74A 3A47A 2XVGA 3TTQA 1JXJA 3BCFA 2GJPA 1OIFA 4CD4A 1IT0A 1MXDA 1SMAA 3FNDA 1H4PA 4J7RA 1E70M 3CO4A 3GNRA 3MSGA 4D6IA 3WD0A 1EHAA 3FHAA 1V6WA 4PMDA 3VOCA 2CYGA 3VIFA 1V0MA 2DGAA 3VNYA 3RILA 3WF1A 1W1TA 2G3NA 3LRKA 2OW6A 3AIRA 1HKKA 4AWEA 3MO4A 4J28A 3OIHA 5A8PA 4LXFA 1V02A 3POHA 2GJRA 5CPSA 3VX0A 4AZ6A 5A8MA 4C7GA 3N1AA 2OWXA 2YDSA 1N82A 4OZOA 1H09A 4AZHA 1SZNA 2W63A 4M82A 2WCGA 2VQTA 4JKMA 3VIGA 1YHTA 3SUVA 2EAEA 4J3WA 1E5JA 2EPKX 4DO5A 4V27A 3PZNA 3GH5A 5AYBA 5HPOA 2W92A 4YHEA 4F9DA 1OGSA 4LYQA 3AXHA 1JAEA 4HZ7A 1DTUA 4PBGA 3GM8A 1LG2A 2BY0A 3ALGA 2YL6A 1LL7A 2O92A 3VINA 1CENA 1UWSA 5E70A 2PWFA 4E2OA 1S46A 1UR4A 3WF4A 1LG1A 1HJVA 2DH3A 2BV9A 1CDGA 2QLYA 2VQUA 1ZS2A 1OGGA 4OOZA 2A3CA 5GNZA 2ZX7A 3OLGA 1QX1A 1ZU8A 3VMNA 5I3DA 2G4FA 2FH8A 5CPTA 3W82A 3W28A 4KRUA 2WW5A 2OWCA 1BF2A 4AIOA 2UY5A 4HP5A 2G3IA 3AROA 3IAQA 3UG5A 2RGLA 2XM2A 3GXNA 2E40A 5A6JA 2YFNA 3SCUA 3CV5A 4QLJA 1KFWA 2J77A 1OT2A 4AZIA 1US2A 2EO7A 1J0YA 2GJXA 3WY2A 1ZB5A 1JIBA 3VDAA 3KLKA 2DSWA 1BVNP 3WNOA 3D52A 4XV0A 3PZGA 1U30A 3ZO9A 3VSUA 1GVIA 1AMYA 1K9DA 5F7UA 4ZEPA 3WH7A 2FHCA 2E8ZA 3N15A 3ZJ6A 4TXEA 3QGVA 4IUGA 4OBSA 4BQ3A 5E6ZA 1B2YA 3ARZA 3OGSA 3CZNA 4CCEA 3EDKA 3ZT6A 5FCZA 3N17A 3SUTA 4FNUA 4B3LA 2WC7A 2WKLA 1VAHA 1GORA 1R7OA 2J75A 3IANA 1M01A 1JD9A 2J8FA 3U7VA 4AC1X 3BSHA 2J7DA 1UH4A 1CGWA 1PIGA 2VTFA 4B3KA 3VUPA 2ZUMA 1G9HA 3GNPA 2PF0A 1DWGM 2G3JA 1XD0A 1H2JA 3T2OA 2VMFA 4W8LA 4PN2A 1MW3A 1C91A 2V3FA 2QMJA 4CN1A 1NM9A 4DUVA 1PS3A 1VFMA 1TFVA 3EDEA 2XFFA 4PTVA 4OOUA 3D5HA 3HG3A 2WZHA 3BAXA 2CBIA 3GXTA 4FLOA 2VUYA 1HJQA 3VGHA 3PZMA 5BXSA 3SCNA 1VIWA 2XM1A 3DDFA 1EHNA 2YLAA 1Q6EA 5HXMA 3BAKA 3T08A 3WDHA 1V6UA 1KXTA 2BVYA 4CU7A 2PWGA 3WMCA 3N18A 1JFHA 1C8XA 4OUEA 1V3MA 3A4AA 5TD4A 2IGTA 5BROA 2XN1A 4RE2A 1HKIA 4H04A 2YBTA 2WVSA 3K8MA 1MVYA 1LWHA 3K1DA 3WF0A 1WDPA 2ZIDA 4NZJA 1P6WA 1UR0A 1ZBKA 3GH7A 4PEEA 4Z2LA 2CIPA 1H41A 2V3GA 4JKLA 5EMYA 3AHYA 6A3HA 8A3HA 2WSKA 3K4DA 3WQ6A 1J9YA 1JYVA 3SCWA 2ZUTA 1NWTA 4D6GA 2X2YA 4YN5A 3MV11 1NARA 5C71A 3UETA 2ZUNA 4PSRA 3K4AA 3HG5A 3ARUA 2D0FA 1WDSA 4LX4A 4WF7A 1C8QA 4M24A 3ALFA 2BY1A 4C7DA 4V2XA 3L2LA 4H7VA 1XD1A 2OYKA 4CD6A 1TVPA 4GPNA 2O9OA 2FDMA 5DT7A 1JYWA 3DYMA 1Q6CA 3NUKA 4YPJA 2VURA 9CGTA 4AD4A 1KXVA 2JEPA 1E56A 2EJ1A 4Z2GA 5A6KA 1V3IA 1W9BM 3W81A 4ZE4A 1WNOA 1CXLA 4GKLA 2OSXA 3ARXA 1HIZA 2CBUA 1XRVA 3AYSA 5LA2A 1V02E 1R86A 3GXIA 2W67A 3UG3A 3I3BA 2J79A 3RM8A 3TTYA 1PX4A 4W89A 4UQ9A 4KWUA 1CGXA 1VFOA 2YA1A 2CERA 5A6BA 4D6JA 2VR5A 4QLKA 4ZXLA 4D72A 5BRPA 3UCQA 3UG4A 1HF6A 3FW6A 4W5UA 3OZPA 1CLXA 3WL1A 1HJXA 2JFEX 3WH8A 4B9YA 1W2VA 1CYGA 2JIEA 4LYPA 3HN3A 5AY7A 1QHZA 2F7PA 3CHFA 3CZLA 1UWQA 1W3JA 1JYNA 1BG9A 3H54A 2D0GA 5M17A 1WZMA 2OLHA 2FYVA 1VJZA 4UFLA 2XTKA 2XVKA 3CUFA 2E4TA 3IAPA 3WQ8A 3CMGA 4FLQA 4XX6A 3VKKA 2A3BA 3CUHA 1CGVA 4JZ5A 4D6EA 1C93A 4QAWA 1ISVA 2JE8A 5D9MA 1CXHA 5IFPA 4P7QA 3KEHA 1UG6A 2D0HA 3NSXA 2YL8A 4M29A 4AD5A 3WFZA 1J12A 1CLVA 2GK1A 1GZJA 4W7UA 2XSAA 3L4XA 2XG9A 2YOCA 4AD0A 4GZJA 1E6QM 3ARSA 1KGXA 4EAMA 2YA0A 3LXAA 2WMFA 4F8XA 2WMKA 3ARTA 2WPGA 1OINA 1HWWA 3N12A 1JYXA 4FLSA 2WB5A 4AZGA 1ISWA 2DT2A 1KXQA 4ACZA 3DX1A 2O9RA 2YL5A 1ECEA 1UASA 1MW0A 2XWEA 3VIJA 2BHZA 3AISA 4P8VA 1RP9A 2JIWA 3AHVA 3GBDA 2EPOA 4PYSA 1LJYA 3UR8A 1M53A 1VENA 4JL2A 1XYZA 1KB3A 2CXGA 5CGTA 4HU0A 1AQ0A 5DO8A 3WEOA 3ZMRA 5A6AA 1GONA 4GINA 3LPGA 1EO7A 2VRKA 4HMCA 1GCYA 3N11A 5HDRA 2WYSA 1VJSA 1UKTA 2WKGA 2PWDA 3B9EA 2VZUA 4ZENA 3NYDA 2D1ZA 1NOFA 3EJTA 3A3HA 1PJ9A 4MTVA 1GJUA 4BF7A 4TTGA 4WKHA 3WBAA 5M03A 2AAAA 1LQ0A 3SCOA 1E4NA 4WKAA 1V3KA 1PBGA 4TUFA 2C8NA 1WDQA 3U5YA 1HKMA 3PZ9A 4M8UA 2ZUWA 2Y8KA 4FNPA 3A4XA 3OB8A 5BXRA 1KQYA 4HOZA 3J7HA 2JF6A 2XN0A 3THCA 5DT5A 3K8LA 3UR7A 4AZ5A 4GI9A 3ZJ8A 1JDAA 3CZSA 2GDUA 2DSKA 4N42A 2IXVA 4TVCA 1QNOA 1KCLA 3A5VA 1UWUA 3B9DA 1WZAA 4P8UA 5BYWA 3WQWA 3CZ8A 2W4XA 2YKKA 3VGDA 2WCAA 2XJ7A 3L2MA 3VPLA 2GDVA 1BYCA 3LPOA 1QWUA 3A4WA 1B30A 1IZKA 4CD7A 2PB1A 2J47A 1O7AA 3QHMA 5JUVA 4CD8A 5C8BB 3D4ZA 1E72M 4IISA 4NXKA 3W4RA 5A95A 2WMJA 1UQZA 4BS0A 2WBGA 1UWIA 3BAWA 4KRTA 3EJPA 2ZX5A 4D1IA 3OZOA 3MSDA 5CGMA 3BVTA 4GO8A 2XN2A 2WVVA 1CECA 5M5DA 1IZJA 4RE4A 3SCQA 3HJEA 3SURA 2O9TA 1ESWA 1ZL1A 3FAWA 5IDIA 3VX1A 2VI0A 4UZSA 5I24A 1GOMA 3WNKA 2BXZA 1LL6A 2E9BA 1V3LA 3PN8A 2VVSA 3DDGA 1XGZA 4F66A 1H0GA 2ZOXA 1ODZA 3LXBA 1EH9A 2A3EA 2VO5A 3WUGA 2WSPA 1QI4A 2WBKA 3ARYA 3NIYA 3HG4A 4J3TA 3TOPA 3F5JA 1JZ2A 3DX0A 5JBDA 5AC5A 3B8SA 4AW7A 3L4YA 2HISA 3A24A 4W85A 4PMRA 4Y7EA 5I79A 4NZCA 3PZQA 3D3AA 1QNQA 4AD2A 3WDIA 4FLRA 1EQCA 1FOBA 5I6SA 1UA3A 4PTXA 4ACZB 1R47A 4Z2IA 1EQPA 4P8WA 2UY2A 3GXPA 2BS9A 1GOIA 4H8HA 4UZUA 3VSTA 1TG7A 1QWNA 1SFSA 1V3HA 1PZ2A 5A1AA 2C7FA 4H8VA 3CUJA 1TR1A 2ZUVA 4W8AA 2YL9A 1VFFA 1G5AA 1XSKA 3SCSA 3DX2A 3WD4A 4W87A 3BUPA 1R7AA 4GQRA 1QHOA 3AMGA 1QNRA 3MMUA 1W1YA 4UFKA 3BVUA 5JBEA 1B0IA 3AIUA 1B31A 3DX4A 3VD5A 2XIBA 2D73A 3VU2A 3IGUA 4MJ4A 3AIVA 3CUIA 2PI6A 2WZEA 2VCCA 3WELA 3BVXA 2ESCA 4ACYA 1ZJBA 2CPUA 1BYBA 3TONA 1EA9C 2Z1KA 4AMWA 1OD0A 2D2OA 4JAWA 5A6SA 3RIKA 1DWAM 4HMDA 5A69A 1E40A 3BH4A 4UOJA 2EEXA 2ZXQA 1E0XA 3IJ8A 1KTCA 2J78A 4UR9A 4E4PA 3L4UA 2VCBA 1JNDA 3AS3A 2XGIA 1UKOA 1T0OA 1E73M 2DSUA 4PCSA 2UWFA 2CHOA 1VEOA 3SUUA 3H53A 3L4WA 4JHZA 3A23A 1KWKA 1WB0A 1E15A 4FNQA 2W61A 1HXJA 3AIBA 1GJWA 4X9YA 2Y4SA 3CTTA 1CXKA 1W9XA 1LF1A 1OBAA 3W25A 5CJ5A 1E0WA 1BHGA 1UUQA 3W0KA 1ZBWA 5CXPA 1UR8A 1Z32X 3NCOA 3WEMA 3VIKA 4CVWA 1HP5A 1W32A 2YJQA 1JNEA 3ZT7A 1ZBVA 4W93A 1A3HA 1UZ1A 4A4AA 1US3A 2WVTA 3EJRA 2EBNA 1BLIA 4XZBA 1C7TA 5EBAA 3WDPP 3CPUA 2D23A 4DWSA 1NOWA 5JIPA 1OGBA 4GI8A 1QPKA 2JF7A 1C3FA 3CZKA 1HT6A 1J0ZA 5LA1A 2X0HA 4AZCA 1D3CA 3LX9A 3EDDA 2PBOA 4C7FA 3FAXA 3PTQA 3HMCA 2NSXA 2C0HA 1DWHM 3VD3A 3BC9A 5JIWA 4BQ5A 1I1XA 2WMGA 2J62A 3AS0A 1G01A 3VGBA 5D9NA 1XH0A 2DSVA 1WZLA 4MDPA 4PUEA 1C92A 5FKYA 3TTOA 1HL8A 1PAMA 3BMWA 3WH9A 4UCFA 1G1YA 2J7BA 1W1VA 1J11A 1R87A 1K9TA 4HA4A 4PTWA 3VSVA 1OIMA 1B9ZA 2WNWA 1HJUA 3VO0A 1HJSA 2VNCA 2QF8A 4MB4A 2YBUA 1GHSA 1CXFA 1MYRA 1IV8A 4CCCA 4WKFA 3CH9A 4B16A 3EDFA 3VGFA 3B9AA 3II1A 2XFYA 1BG4A 2BVTA 2BY3A 1NP2A 2X0YA 3LPPA 7A3HA 2CKRA 1R75A 3MS8A 2QMKA 3WDJA 3EJQA 5HNNA 3ZR6A 1GUVA 1EDQA 2WMIA 4ATLA 2Y24A 3S6TA 3RJYA 1BVZA 3G6LA 1GQKA 2EPLX 4E8DA 3PHAA 3HG2A 1KWGA 1HN1A 2XPKA 1W9PA 4Z2HA 1J18A 1FHDA 1J0HA 1EOKA 5E0CA 3QOMA 3CHEA 4RL3A 2WCSA 1FP9A 3T0DA 1J0KA 3CHCA 3TA9A 3WN6A 3TP4A 3AIQA 2GVYA 4NXSA 3T09A 4DM1A 2WWDA 3AS2A 2UY4A 4WSJA 1DWIM 1Y7VA 1E1FA 4TTUA 3FY1A 1CGYA 4UTFA 3SCRA 1UQYA 3PZOA 4OGZA 4UFJA 3CHDA 3S5YA 1TZ7A 4L4OA 4PMZA 1JZ3A 4UQAA 2OW7A 4UQBA 1F4AA 1H3GA 1W2PA 1HL9A 1KBKA 4H41A 1DWFM 2A3AA 1DP0A 2GUYA 5ABEA 3BUBA 1VBRA 5M3WA 3OLDA 4BZYA 1RPKA 2WC4A 1B3WA 3NSMA 3LMYA 1W91A 4QCEA 3O9NA 1GOWA 1R33A 5EFFA 1E6RA 3OBAA 2QV4A 5KEZA 1E4IA 2TAAA 3U5UA 1VB9A 1BFNA 2F1AA 2V3DA 5LYRA 1KBBA 3POCA 1JD7A 3WNMA 5DF0A 2NT1A 2WMHA 3WIJA 2ZXAA 3QR3A 1H11A 2VZOA 5FOOA 3L4ZA 4UQCA 4AEEA 3DECA 2F2HA 4JCMA 1ZJAA 2XFRA 4AXNA 5CLWA 4MAVA 1ITXA 2Y5EA 4N0RA 4ZE5A 3T2QA 1FA2A 4DWSD 3N13A 5D4YA 1FP8A 2WHJA 2X2IA 4MPKA 1W3LA 2E0PA 1I75A 3WENA 1Q6DA 3MUY1 4GZEA 4JHOA 2D20A 4QLLA 2CEQA 2OSWA 4W8BA 4MB3A 5DFAA 1XC6A 1MW1A 5E1QA 4CCDA 4QFUA 4AY1A 3EMZA 3LXCA 3VTRA 2IUZA 2VX4A 1KQZA 1Q6GA 3SCTA 1CEOA 3MKKA 4U31A 3ARWA 2OYLA 4P7LA 3EJSA 2D3NA 3W37A 3BLKA 3CIVA 4PTMA 3AMLA 2V3EA 7TAAA 3MI6A 2VR4A 2WZIA 1LL4A 2CHNA 5HPCA 1EGZA 3NSNA 4QDMA 2OSYA 3VMPA 2JALA 4MADA 1HXKA 4M81A 2QPUA 3DYPA 4TX8A 5A2AA 4U2ZA 3KWXA 3S5ZA 4WLCA 1KGUA 1EOMA 2W66A 1M7XA 4DO4A 1KCKA 3WNNA 2XVNA 3SEPA 1CWYA 3VGEA 1J0JA 1J10A 2X1IA 1V6VA 4P7RA 3WD1A 1UD3A 1UD8A 2E8YA 3QHNA 1CGTA 1NWUA 1EDGA 3WMBA 1ISYA 4P7OA 1MQPA 1PIFA 2BVDA 4XZWA 3UEQA 4MB1A 1FH8A 2VJXA 3AIEA 2ZE0A 8CGTA 3M6DA 4ATDA 3DYOA 2WXDM 3FN9A 6CGTA 3OGRA 3ZM8A 4GI6A 4CN4A 4J3VA 1CTNA 1TCMA 2V5CA 4AD1A 1WZKA 4WK9A 4DO6A 2WMIB 1BGAA 1CZ1A 4OBRA 3KLLA 2ZWYA 4WSKA 3WFLA 1HVXA 4W7WA 3KZSA 2J8GA 4WIWA 3VD4A 4ATWA 5GNXA 3OG2A 1OSEA 5I2UA 1C90A 1KR1A 5CSUA 3H55A 3CBWA 2G3MA 1KGWA 2CITA 1FH7A 2D24A 1BYDA 1TA3A 3GTNA 3I3DA 2J4GA 3SUSA 3E1F1 4S3KA 2J7HA 1FFRA 1QW8A 1BAGA 1QBBA 2VVNA 1JDDA 4TX6A 3A22A 4XB3A 1E6ZA 5CZKA 2VX7A 4AIUA 3WKZA 3AI0A 1VBUA 2FHFA 1E1EA 2X2JA 4J3SA 4HZ8A 3VIPA 1OT1A 3O2LA 5A3HA 4J3XA 4UNIA 2DIEA 1PPIA 2CBJA 4UFHA 5FD0A 2BHUA 4KMQA 1H1NA 3ARRA 3RMEA 3BMVA 3QOKA 2DPEA 5LA0A 3CZGA 1DWJM 3I3EA 4M1RA 4PUDA 1GQIA 3CMJA 4AZCB 1CIUA 7CGTA 3AHZA 3OLIA 1QW9A 2DT3A 2FGLA 1UZ4A 4CU6A 1UR9A 3ARPA 4AYSA 4GIAA 4JFTA 3A6OA 3AICA 1LWJA 2VRJA 3WUBA 1QNPA 4AISA 1X6LA 4CVUA 1GW1A 4H2CA 3WF3A 2BHYA 4D6FA 2PC8A 2WANA 3EJUA 2F7QA 3T0AA 3ARQA 4PSPA 5A94A 4JFUA 3UESA 2F7RA 5A6LA 3W38A 1E5NA 3G6MA 2ZICA 4IM4A 3MMWA 3WDQA 3VMOA 1XH2A 3AXIA 1XCXA 1G94A 1BYAA 4NZFA 3WD3A 1TQVA 2X8RA 2ZX8A 3ZJ7A 3MANA 3AYRA 4R5EA 3PTKA 4KGLA 3RJXA 1PEZA 4HOWA 5I23A 1OD8A 1JZ7A 1WO2A 4U2YA 2X09A 1XHGA 1QI3A 1ODUA 2ZX6A 2XVPA 3ZT5A 3WF2A 4LPCA 1HJWA 1W9UA 4B15A 2W91A 2DSZA 3RDKA 4XUYA 4JIEA 1JGIA 2VL4A 5AYIA 1MFVA 4HTYA 3AOFA 2WLZA 4DWSC 5CPQA 1E43A 4MNKA 4D6CA 4MAZA 1BGGA 1JZ6A 3VDBA 2AOSA 1U2YA 4NRSA 4V28A 1WPCA 3AJ7A 1M04A 1QI0A 2GSJA 2XWDA 1JL8A 4FMVA 2J7EA 1GVYA 1DEDA 1UH3A 2F61A 4OIFA 1OM0A 5CLTA 1OB0A 4LYRA 3WQVA 3IJ9A 3AMKA 1HTYA 1RP8A 2EQDA 2J7CA 3SCPA 1LLOA 1ISXA 2J7GA 3CGTA 3RM9A 3BAIA 3F5KA 5GPRA 1NWSA 1GOQA 3PZTA 5BCAA 2GFTA 3M46A 4RE3A 2FE0A 3D50A 4D6HA 4UFIA 5A2CA 1WP6A 3RO8A 4UFMA 2WK2A 2DT1A 2J7FA 4MNLA 4MJ2A 2CETA 1G0CA 4FF5A 4GQQA 3CLWA 1GNXA 1HKJA 4LQ1A 3AIWA 3WQ4A 4BQ4A 1DHKA 5DEZA 3F5LA 1UD2A 1TQWA 3CZJA 1R8LA 1D2KA 4CGTA 5BXPA 3O6AA 1UD6A 5EFDA 2JEQA 1V0KA 1KR0A 4NF7A 4NI3A 1CBGA 3RCNA 1V6YA 2CESA 4DM2A 1UR1A 3AZTA 3BUIA 3D4YA 3ZOAA 1UWRA 4W7VA 4A3YA 4EE9A 1E4MM 5IFTA 3AXXA 2EPMX 3AS1A 1KXHA 5E6YA 4FNRA 5ECUA 3VD7A 2W5FA 4QP0A 5HBFA 3PZIA 5IHRA 1BSIA 2G8ZA 1GOOA 2B31A 4PMOA 3GH4A 1TA3B 2VZVA 2WVVB 1HP4A 1YQ2A 4S3JA 2CKSA 5ABFA 3THDA 5GNYA 1JZ4A 2OYMA 1C7SA 1B3YA 1V6XA 3L4TA 4HOXA 3VNZA 3OLEA 4Z2KA 2XGBA 1NWRA 4BA0A 5GQBA 1AQHA 1E3ZA 5FL0A 1FHLA 1UA7A 3WH5A 5BXTA 1JZ8A 1V0NA 2DH2A 4F79A 4UQEA 4L4PA 5I5RA 3BVVA 2VRQA 5CSYA 3ZSSA 1JAKA 4URIA 1U33A 3NDZA 3DC0A 1KTBA 3ZSTA 1X1NA 4JFVA 4BQ2A 4H8UA
chains in the Genus database with same CATH superfamily
3DX3A 3SIZA 1TVBA 5F1UA 4M43H 3VIMA 3WQEA 4C6PA 5LXVA 4JTRA 4K71C 4DWSB 2AJXH 1INEH 1P84J 3MWAA 1I9EA 5CBIA 5CIPB 2MPVA 1JXKA 2WKOA 3D09A 2CWRA 2VZ3A 4N5EC 3PWPB 3TA3C 1YMHB 3LKQA 4BK8A 5FFLA 2WNQA 3URNA 4RSYA 3WFHA 3ES8A 2OX4A 1QLEL 3M41A 3UWYA 1J1PL 2PKDA 3EOBA 3GKAA 2CIKB 1CXEA 3BJ91 1PNDA 2C26A 3KXFB 1IF2A 2F8XC 2RGSA 3QG7L 4DVBA 1C8YA 3VKCA 1L8PA 5M1TA 2W5PA 1ONQA 3KPOB 2YEQA 2DBJA 4UT9L 3F7YB 3SCMB 1TPH1 4DJDD 1Q72H 2AQSA 3GF8A 4LGSB 4NQQA 4HJTA 4QYOA 5CCKL 3U2ZA 3UFYA 1W3HA 3N4FA 1B3VA 5HY9A 3THQA 2IOOA 1PYWA 2X1QA 2ZUSA 3GIZH 4FULA 2F8QA 3EKZA 3Q9PA 4HS3A 2A9ML 1KB5L 5F1NA 4LV9A 1OHZA 4N26A 5CZRA 5E1IA 4AVJA 4AXWA 1Q2RA 1J0IA 3MXVL 4WVRA 1LK3H 2BNRD 3VXMD 1XF5B 1GZHC 5LDUA 2CPCA 1GPFA 3ARDA 4I90A 4LRTA 5BU9A 5IRPA 3NA9H 1P2CB 3EYQD 3QQ9C 4KTDH 5I1AA 1FH9A 1SJDA 5T91A 5GJSH 4ZSOE 4OD2A 4NRYA 3E96A 4KWWA 1OF2A 4JREB 1L9MA 3C2EA 2NY6C 2Y2WA 4CC0A 4HD9A 2W60B 3ECBA 1INQB 3QCUH 2I07B 3B2MA 1PD6A 3VD1A 1NAL1 1QPQA 5ABGA 3S2LA 1KC7A 1A64A 1SF5A 3SGEH 2BSSA 5C09D 1GH7A 1N3NA 1XQKA 5HNUA 4DB7A 4WGHA 1YN6A 2CKBH 4Y4KB 3VGGA 3BGFB 1ITCA 2AQTA 2YLKA 2WLLB 3HI5H 5AD0A 5I73B 3EOUA 2V8MA 3F4NA 3NPWA 3L48A 2XQBH 1E8XA 2RAMA 2DWSA 3EZ4A 4G2DA 1AGBA 4IHCA 2C5DC 3SDCC 3IF1A 2DLFH 3EYPA 3SFKA 1ZS8A 1FV1B 3AU0A 3X11B 3QEHB 3VD2A 1KNWA 3RE0A 2QQKH 4GMTL 3WUFA 1XGDA 1CC3A 4IFOA 3HRZA 2DKMA 4J3UA 1ZEAL 1F11B 1SLUA 1ZT7A 1ZVHA 2VW7A 1R3TA 3LCXA 2NDGA 2OZNA 2DMHA 3O4OB 1CICA 3WY1A 3RX8A 3BGFC 1IFHH 4MQXC 5I0DA 4LAJH 3B8YA 4JDTL 3D18A 4OGQC 2EIMB 4NQVA 2EIDA 5L2KA 3EOTH 3F65A 3MCYA 4S3BA 5DZJA 1FWJC 3GR7A 1FWDC 5KITA 3BLBA 2IAMD 5J7CC 3TN5A 3D25A 5C9RA 4L3ED 3FF8A 3BI9X 4J27A 3N44B 4L2YA 1KM4A 4I0PC 3GZKA 5JXED 3V0IA 1N2VA 2YKLL 3AZSA 3NQVA 5I66A 2OJEB 3O6ML 1A6AB 1XM3A 3EBVA 3RR4A 1OO2A 2DQGL 1QNSA 1TIWA 1TR9A 3APGA 4AQLA 4O8RA 2EADA 2H32A 1NKGA 4L1XA 1VFUA 1UHVA 4WO4A 3DBSA 2EDLA 1X5HA 3UADA 5L9FA 2BOBA 4JM4L 2XUCA 3KVLA 4GABA 3I2CH 3K8KA 3QW4B 1OYAA 4IRJB 2IF7A 1L0PA 3OXRA 2BMKA 4TPRH 4BUHA 3R2GA 4JY9A 4PRRA 4LOUC 3CPLA 2W8CA 1IL1B 2BCKA 2Q2LA 4EXBA 3JVAA 1HIMH 5F9WC 1S7WB 3VXUD 1T7WA 4GRLC 3LKNB 4X0NA 3WTTA 1W3KA 4YWIA 5AYXA 1U8NA 3DHPA 3SIMA 3N44F 5TQ2H 4RZ5A 5SWSB 3S2CA 3A6CH 3G1DA 2E7DA 4Y4FB 3RAJL 5FL1A 1L9WA 2DZEA 4KY1H 5FOBA 4R9XA 4LSQL 4TVSa 2ZXBA 3V0HA 4GMSL 1HX0A 1K6QH 5DK0A 4N9GA 5D1ZI 4UAOB 3TZFA 3RU6A 3VNIA 4LRIC 1W3NA 2XKNB 1ZAHA 3QQ3A 4FXGC 3GD1C 3VCCA 4G1EA 5I28A 2A5UA 1GGIH 3N3MA 3O9WC 5G5DA 4H26B 2VX6A 2QSCH 8TIMA 2FYMA 2ALWA 4P61A 3F7QA 3QRGL 4JK0D 1SFLA 3HPXA 5DC9B 4MLSA 4I87A 2L04A 1K3IA 1X9QA 2H9GA 3DN5A 5FF4A 1QOXA 5I78A 5EU7C 4LWWA 3UWVA 1LO5A 4FYTA 3PPHA 4NKDA 3VOIA 5ACMA 5J13B 2BG5A 4D71A 1ZHLB 1JCKA 3R12A 4AIZB 5C6PB 5D03A 3VFMB 4KFNA 5C2BH 4NI8A 5ABHA 4MD0B 1EXUA 3FQNB 3P0YH 2FMNA 4CVZA 5JBFA 4HZ6A 3VIHA 1PX8A 1KLUB 4GGBA 5D9OA 5ABFB 3KLDA 4LK4A 5D6DC 4FALA 5CWSA 3H42L 4TNWK 3HE6A 3Q3GA 3WIFB 1QRNA 4KKAC 1AS7A 4M19A 1HAWA 3U9PH 1JUEA 4Y5YB 2F18A 3GJFB 5JLZB 4XPBL 3P1VA 1UBPC 3OKMB 1GZQB 2Z27A 4HWUA 1CQKA 1JF5A 2VXUH 3O3DB 3R19A 4S11A 1K4DB 3V9FA 4ERIA 5F7YC 1J8HA 1G7IB 2NNXA 1PKMA 4AZ7A 4FNSA 3QEZA 2C13A 2HVKB 3QNXA 4I3GA 1CB4A 1F3DH 1A3QA 1H7OA 4NAFA 1SVCP 4RQQA 1CDJA 4EN3B 2IQ0A 3V52L 3BXWA 2IQ9H 3MNZA 2WLMA 4O2FA 3IIOA 2NQ5A 2O61A 2D22A 3MMDA 1W0WA 2XZ9A 4IMAA 3G6JF 4FG6D 1U8CB 1BIIB 2LU4A 4PTUA 1OGPA 2WXOA 4TS6A 5DS8A 3U36B 3BAEL 4EN2A 3MYJB 2CK2A 1IQ8A 1DVUA 4NU7A 4LEBA 2OMBA 2IPTH 3HZ3A 2EDMA 5FIPA 1MFCH 1PDKA 2DICA 3EO0A 3EOEA 2FJGB 4DJDC 4DJFC 4L5FL 4O53A 5PCYA 1MQRA 2IH3A 4J40A 4MA7L 2J5WA 1K1DA 1QKZL 3SDAB 3U25A 3UF9A 3GZQA 4CU8A 3NJFA 4BH8A 3KZPA 4PJCF 4OF8A 5T3XD 2VKWA 1NCJA 2WUCL 3LRMA 4P23B 5D1XD 5FUZH 4AYGA 1N0XH 1PQZB 2FECI 1T04A 1T5XB 2ENPA 2WWNA 3G6JB 5T1LD 3V0JA 5A2BA 5KS9F 2ZNWA 3HB9A 4AVFA 4YIWA 2HWZH 3QH3B 3SKJL 5L9DH 4F2EA 1OZMA 3HS9A 4GXMA 1NBYB 4PRWA 3BE1H 4N2BA 3W6LA 6PAZA 2FK9A 5F1SA 5FA4B 4ODVL 2NY6D 2X7WA 3EJJX 4MKVA 1Z69A 3CQPA 4MD5A 1NOLA 2XETA 3ZO0A 5CEZE 4AMXA 2N3JA 4P2RD 5C55A 1NEZB 5KTEH 4Z1AA 3ATBA 1RXLA 2BZCA 5JA9A 1NQ6A 1A7RH 1Y18B 5MEPB 2WXLA 5EMKA 4OZGF 3ZIZA 1P4BL 1LO4L 1QHPA 2YIHA 3C5ZA 1S1PA 4UDTB 1RJZB 5B1BB 3AJXA 4NUMA 1QEWA 3ZXAC 4KX8A 5FKPB 3MC5A 2WOYA 2WLYA 4TO8A 2IWKA 2PXYD 5K39B 2K0RA 4ZX3A 5MHBA 2ZUXA 4ZXOA 1L5GA 4L4TD 5K9KB 2GEQA 4JIIX 4URTB 3FMGL 4BF9A 1WBYA 4K7FA 1G0CA 3OR7B 5LZLA 1UKPA 3FA3A 1HH9A 2JJSC 2PP1A 2OJZH 2K9FB 4E5XB 4LCWB 3ZRCC 3ESOA 2ASHA 1XZ0B 1U8IA 3UZQB 3MYZA 4E5XA 5HD8D 1LL1A 3WNLA 4XIMA 1LP9F 3WQGA 2PLTA 4X7SH 4QHUA 1C16B 5HHOA 3IV3A 1BIHA 3G5YA 4JO3H 1DDHB 1FLTX 1G9NL 2F6UA 3L81A 3AB0B 1IBDA 2ZCZA 5K9KA 4BKNA 2VOTA 2OODA 2A2IA 5B1CA 3PGCA 3QYCA 3STLB 1PDZA 1CI1A 5I8CA 3WD2A 4GAGH 5T1LB 3D2UD 2YYUA 1YAIA 3TSDA 8XIMA 4HZ1A 4P2QE 5CBEA 3U9UB 3JUGA 3UYCA 3U2EA 3FNDA 3ZKQD 1QBAA 1JPFB 3ILDA 4QLWA 2V5DA 5BV7H 4RAHA 3P4NB 3ETTA 4K3DL 1OY3B 4O4WA 4PS4H 4A8RA 3UJFA 4KY1L 3TBYA 1GQJA 2UZYA 4WDWA 2FATH 3BVWA 4U3CA 1Q8JA 1VADA 3LNMA 1JTPA 1KGCD 1WIOA 4XAWH 4LOUD 2H8PA 3A4JA 1E4XI 4U5IA 5BVJA 4M4RA 3RWCB 4H8NA 1PKQE 3NDYA 2WJZA 4FQIL 2E68A 4M1CD 1IE5A 2W0FA 1PQZA 3WY4A 3FUNA 2ZZ6A 2VDNB 4PJ7B 3WJLC 3WXWL 4JFWA 4PWFA 2PNDA 3VE0A 4EKJA 5A2IH 2F74B 3VA2C 3PPSA 3QG6B 2V38A 3FFCA 5C9XA 3TYFA 3ABQA 1NAMB 2E28A 1XF1A 3BYYA 2VT0A 3NIFE 1BVKB 2F1BA 5CQ1A 1KBIA 2OWWA 2A9NH 3IU3B 4OM1H 3NIGE 4FXTA 1RHHB 1ZE3C 2XYBA 3C5JB 3HS8A 5IHZA 3KBWA 3R43A 4FXKA 4BWUA 3T05A 2KS0A 3W1RA 5C7HA 3FB7A 5I19L 2HMIC 3UTTA 4ZMVA 4AMCA 2V6HA 5A8GA 3PV6B 4H25A 4FKHA 4AENA 4KO5A 2PRMA 2X16A 5FEPA 2OEKA 5DXYA 1W72B 4M62H 3TTSA 4C47A 3IWUA 2RJHA 4FK9A 5GRUH 2PO6A 1Z7AA 1B0RA 3FTWA 3BAYA 2RUSA 3S4TA 1J9SA 4K7VA 4RETB 2FT7A 1AZRA 2EXYD 3LRHA 3MRCB 2GJZB 3EA2A 4LLYA 4Q4MA 2YZRA 5FO9A 1CR9H 1JI2A 3C0SA 1E28A 4BFGA 3BP5B 3ARVA 4GUQA 4HS8L 5D7HA 1DHPA 1WV2A 4JQVC 1FWAC 2V68A 1OB1B 5FV1L 4BK5C 3AQUA 4FOKA 2K8MA 4PJ8C 1S5HB 1M7IB 1MCPH 3GXMA 12E8H 1D3GA 3WLOA 3BH8B 3HFTA 2ZRWA 3IFNH 1KF9B 3MZGB 1BA9A 3C8NA 3DU0A 2JXMB 3AZRA 5JZ7D 5EB8A 4YCPA 4AL8L 4O10A 1PYFA 3GBLA 5F7EH 4M56A 5LO7A 1XGUB 4JRYD 3RGVC 3ATEA 3VFMA 2IPTL 4PWGA 1MDRA 2VUKA 4G7SB 4K9EH 3LH8A 3UR5A 5CLXA 3S7GA 4J8RB 2H26B 3H1ZA 1OWQA 4PULA 4JAMA 3S6CA 4PZVA 3FU7B 2HT4D 3T0EB 4CUCA 3QCTH 3MTRA 5IMMA 1RZIB 3RPIB 4X5WA 1VCBC 3EXLA 3ZU8A 1B3XA 5TE4H 3I4EA 1NH6A 4NPJA 5CUSL 2QVTA 4JCLA 4PLKC 4D1JA 1HNGA 3SO5A 1I85C 3G7TA 2P8PA 2VSMB 4JG5A 4EF3A 1C5CL 3MHZA 4GH7B 5BUPA 1JF6A 4DUWA 1L0XA 3MVIA 2B2XH 3ZDXF 2VEMA 3WKNA 1DQLL 1ECYA 2QV5A 4NO2A 5CFAA 3THAA 3WEZA 4PJDB 4F92B 1O6IA 2FWOB 5F88B 1TQBC 1SPDA 2DQUH 2Y36L 5D32A 4Y4FA 2B4CH 4RV3A 1QBLL 4RKAA 3U2CA 1MNUL 2VC6A 4BK9A 1XB8A 3NZ8B 4IW4C 3T0BA 1V0LA 3F7RA 4Q6KA 5LQBH 4K15A 1EL3A 2WO2B 1W6TA 2VX5A 1PFCA 2ZG1A 1XS2A 1OAZL 4TQPA 2QJIA 2HKFH 1MRDH 3WUWA 3E9UA 3VW3H 2XC8A 1YXDA 1DJHA 1PF3A 2E4FA 3UAJD 4FJ6A 4NCC1 5H2BB 3WIHL 4AM0B 1KFAL 3FTUA 3PWAA 4V15A 3T1WA 3QHZH 5JIKA 5XIAA 5BRQA 1TE1A 2HLAA 2DZUA 1ORQB 1JF1B 1W0YT 1UB6B 3QDJA 2OBGA 4NO0B 1GG0A 1Q4NX 4EI6B 4Q7NA 4XMLH 2JKRM 3KL3A 1W80A 1YX1A 4DSYA 1HU8A 3FTYA 5DQ9B 3V16A 4UIMA 5HPMA 2DWYA 5E6IC 4KKCC 1Q6FA 4JN7A 3OYXA 1C8VA 5IKCB 3NT0A 5TNVA 4B95C 5I3IA 5F3FA 5JPNB 4ML4A 2WNZA 2IXQA 1UM5H 4GLRH 2BX7A 2ZQ0A 4OCLC 1XLEA 4UBDD 2R0WH 3W53A 4BWLA 3CX2A 4MY1A 5MEND 1GYLA 1EJTC 3HAEH 3BN9D 4JVWA 3MRKA 4OCRL 3T4AB 4IRSD 2JGYA 4JG0L 4ZAKB 1U41A 3JWOC 3RM4A 5LN8A 3FL7A 4PJEA 5IJBC 1E9LA 4U1IA 4J5NA 5CPNA 4N8CL 3DGBA 3RY6A 1IARB 4E0RA 1N2RB 1FFOB 4JHVA 2DIJA 4TSCL 4TTDC 5T3ZL 1M03A 3C86A 3LHZA 3TTQA 1HZKA 4MSWA 1E2ZA 1JXJA 2KLSA 5GZOD 4ZMWA 4LKCB 4LSVL 4HZLB 1OIFA 4H00A 3ZN6A 5FLUA 1OFDA 1N3NB 3P0VH 3TJXA 5I3FA 3EH2A 4KTYA 3MACL 4DPBX 1XHHA 5CILH 3GNRA 1O5DT 4GP8B 2OCCB 1DSWA 3QFJD 4U1KA 1OAKH 2R9HC 1JRBA 1AIZA 1V7YA 3MSGA 1EHAA 1DIEA 3FHAA 2AQ2A 3GXUB 5C0AE 4US6A 1Q6LA 1RQEA 3QXDA 2QQKL 4GMTH 2GGJA 3PSWA 2WXRA 4PMDA 4Q8PA 1OTSC 4TUKH 3VIFA 3ARDB 4Q52A 2DGAA 3KW8A 1MG2C 3F64A 2Y7NA 3RILA 2GSIA 1OTTD 3FZUD 1FGVH 2G3NA 2OMTB 3C60C 1RIHH 3MC0A 4DN4H 1ZT1B 5DEJA 1IFHL 5FB8A 1FQ9C 3TURA 4MG4A 2NXYB 5TIMA 2NQ3A 2OW6A 4Z7QB 2V9QA 2E1WA 4NM8H 4BGLA 3ABXA 3G2GA 5CCJA 4J28A 3OIHA 1JFQH 5LG1A 4YWGH 5BOJA 3ITCA 4MLRA 3CHRA 3POHA 2KDGA 5I8KH 4QTFA 4WO4D 5DUML 5F7AA 3VX0A 4IPPA 1NC2B 4LANA 4C7GA 1F18A 4JIRA 4C6BA 3BEWB 4FGMA 1N82A 3LHWA 3EBHA 3KPQA 3KR3H 4I4WB 4E41D 4P2VA 5JXAL 4AZHA 1WDAA 3SYQA 2W63A 1OWRM 5BRZD 1MDTA 3VIGA 4K94L 5HI3C 4M3KB 3RIAK 3GD6A 4QG8A 5E5LA 1R3VA 1YHTA 1VGEH 4HS6A 4N9CA 2LFEA 1NAMA 1EC8A 5DR5L 4F7TB 5GGQL 5GS2H 3QDGA 1MNZA 1WCBA 1E4XL 2JCCF 1W6WA 3PWNA 4MZIA 4NFCA 4QTIH 2XTJD 4W9ZA 1B5TA 3JU2A 3PZNA 2UWEA 3SBWA 2FL5A 3MV7B 4HBQA 4WQOA 3BANA 2V7HA 4G6FB 2XV6B 3DMMD 4PGDA 4PG2A 5HHMD 2NUYA 5JIHA 2WXHA 3SN6N 4HSHA 2X28A 4HZ7A 4NZDA 1YKWA 4L8BB 3GM8A 4PI2A 1GHFL 3WLBA 4AK1A 3ALGA 3RZCD 3U4BL 4DZHA 1AIFA 4G70B 4CBZA 3OKDB 5KG9A 1J93A 1LL7A 2IPGA 1GKOA 4XPHH 2FB3A 4YBHA 2ICES 2PPGA 3GB6A 5DGQA 1EJ7L 3FUMA 4L4MA 1GVEA 3Q65A 3NQKA 2F5BH 1MQKL 1P7QA 3KBEA 4MZ2A 3RGVD 4BDVA 4OZGB 1U3HC 2ERJC 5GGUB 1OM3H 4HK0B 1X5IA 1LG1A 4N2KA 2V2CA 1UT2A 2V5TA 2WBJD 2NZIA 4NJAH 4RESB 2QLYA 4XBPA 3ZE2E 2BV9A 1TEYA 4GIRA 1YNLH 2EDKA 5C1MB 2BOLA 3D39E 4G5AA 3P9WB 2BPBA 3MGTA 4XAKD 4D3CL 1D5MA 1DDHA 1RZKL 1XEDA 1PD0A 5DI8B 1AK5A 5EEYA 2A3CA 2IDCA 3OLGA 4P0DA 1CG9A 1QX1A 4WI7A 1YE6A 1WZ1L 3QDMB 4UR8A 5HAOA 5TFSH 4X4XB 4Z77B 2MCMA 1KCUH 4Y6GA 1XZ0A 3FKRA 4NN6C 4KQ4H 2M8XA 5T5FA 1KCRL 3CHXA 2GGIA 4KRUA 2OZ4H 1AACA 4QXGH 3HE6C 5C2BL 2WW5A 3QQNA 2H3NB 5BS0A 7XIMA 2FJHB 2OWCA 3SDXE 1OD9A 5EUOA 3LNGA 1SFJA 3RHGA 4D9PA 1OK8A 5J89A 2ZUQC 1UIOA 2XN9A 5B7ZA 5I0YA 4HP5A 4GG8B 3IAQA 2F0CA 2FT8A 4MJ6B 2WN2A 4HHHA 5E7FA 5IFJA 4WJEA 3KBFA 4AL8C 2X1RA 1FNEA 4YNYA 4P4RB 3KGRA 4MCZA 2EGZA 1JGUL 3MQIA 4HAFA 1I9RH 2VXUL 5A16A 3IRPX 2AAVA 3DX9B 2Y7EA 3C2YA 3GTIA 2FJFB 1URLA 5F7MC 1US2A 2P5PA 3TN0A 3KCPB 4GG6E 1J0YA 2OELA 3HAEG 2H3BA 4AX3A 4MVBD 2A6JB 3ME0A 2UY6B 1F41A 4R97C 1VHPA 2CLVA 3TLRA 1MRFL 2OXHB 4GRMB 4KPHL 3N43B 2V5RA 5ETUA 1TTUA 2CK0H 4WVXA 2Q5BA 4ZYKB 3MV9B 3O8AA 3D52A 4JQXC 3JUZA 4N2GA 4IGHA 4KKCD 2BC4A 3JV4B 1AMYA 1QASA 1U6AH 3PBMA 1JPGA 3DK2A 5FK9A 1MVUB 4X6DE 1YECH 1QW7A 2R4SH 4U1HB 5B4MC 2IMRA 4N8CH 5DANA 4YC2C 2HVJB 3EOSA 1I8AA 1PV8A 3QGVA 5T3XE 2EXWD 2HVOA 1S5IL 1S2WA 1ACCA 1S9VA 4OBSA 5E6ZA 3OGSA 3ARZA 3B5GA 4CCEA 2FEDC 3DRQB 4X83A 5CN1A 3WLRA 3GIYA 5JPMC 2VISA 5LWYH 4S38A 4OT7A 6FABL 4ODTL 3SUTA 2XPGA 4KXZI 3P02A 4G8GE 4B3LA 1EEYB 3ZKXB 3CC5B 1FJ1B 1GORA 2J75A 5BV7B 2R1MA 3HRPA 3V0DA 1AO7A 5ISZE 3IANA 1CD8A 2N7AA 1O6SA 5JIQA 4DI8A 4PWKA 2DLFL 3WYZA 1FL5A 1F58L 3BSHA 2J7DA 4RMBA 5DY2A 4PJ5B 2HS6A 1OG0A 1QFWM 1CGWA 4QISA 1ESOA 3E8UH 4NNYB 1JFQL 4O58L 1UURA 3W3OA 3LSCA 3WG6A 4O57A 4PS8A 3NPUA 2ZUMA 4B5ZA 4NRXA 3VFUA 1G9HA 5FW7A 4XO9A 3NJJA 1DWGM 1DXEA 2OR7A 3MJMA 1H2JA 4XNYL 3T3MF 3FQNA 4BFAA 3T2OA 4N9EA 4MBOA 2VDOL 3KW3A 4PN2A 4W8LA 4AVOA 2DQJL 2C3VB 4NQCB 4W4OC 2HS8A 3WLPA 1E4KA 4WI0A 4JDBA 3RCYA 1MW3A 1Q0XL 2R4RL 1I1YB 3BPLB 2OQHA 1TNNA 2Z31D 5E5UB 1OX4A 4WDUA 2RDTA 1RBLA 3ME3A 2Y7QB 4S1FA 3UDWC 1O5XA 4V33A 4NBZB 1JPSL 3D05A 1DIDA 2WNXA 1WFIA 2BGSA 3L08A 3CFIC 2OI9C 2DS4A 4H26A 3DV4B 1YPFA 3VZZA 1NM9A 1UVQA 1TFVA 2Y7LA 4HJGA 1B4EA 2CBQA 4XC3L 4DLMA 1P1ZB 2QAFA 3T4YA 2ZPKL 5DMGD 2MHAB 5MI0B 2DMCA 4AQEB 4REQA 3IMVA 1JK8B 5D6DA 3W2NA 5KSWA 3BAXA 4X80H 2CBIA 4GX8A 4NGHL 2QYGA 3G5ZB 4EZKA 5I71B 1V77A 1BZ8A 4XCNA 4MMZA 3MNMA 3SCNA 1VIWA 3LKRB 2XM1A 4JHUA 3WTWA 1EHNA 1DJIA 3FB5A 5KBKA 4LPVA 1YN7B 4OF6A 4QRUA 2IANA 4XAWL 1W5PA 2J27A 1VYSX 2NVCA 4FMFA 1G43A 3JV4A 3TN6A 1YZZA 4BCXA 3F2LA 3SPVA 3CJPA 4GS7B 4M51A 1HI6B 5ABDE 2FVMA 2NXYC 3CASA 4OI7A 4AZUA 3VWKB 1LRTA 2Z34A 1J05A 4TNFA 4DAGH 2A83A 1AD0A 1M1SA 1CBVH 1JFHA 3GTTA 5D7LE 5HHQB 2JGQA 3BVJA 4OUEA 5F2FA 1VADB 1HGWA 3LBCA 3TWCL 4ZJ9A 5FGCE 3D08A 4XH2B 3GUTB 2LU5A 4IIEA 1JNHB 2XN1A 4I18A 5LAXB 1PVHA 6PCYA 1I0DA 1PHQA 4NN5B 2JKLA 3BOFA 2OMUA 4H04A 4XR8C 2YBTA 1M1BA 3CEUA 4I7UA 3U6WA 3UW6A 3AREB 4OD3H 3K1DA 1NSJA 2VERA 4P5TA 4H0HB 4YSDA 3JV0A 3RB5A 4FA7B 4AG0A 3W9EA 1DBAL 3DROB 1R0AL 3GHTA 4KW2A 4WHTA 4KWOA 2G3FA 4C6MA 1XXXA 2CIPA 2B9BA 4IKJA 3EFOA 4JKLA 1T5WB 2YPVH 4YQXH 5DJ0A 5EMYA 1Q9KB 3ZL4L 1J6PA 1XAKA 3L3GA 3RBGA 4XX6A 2CLZB 4NNCA 1J9YA 1WRFA 4GB9A 1FFTB 1E30A 2CM5A 3ALWA 4AKPA 3SCWA 2ZUTA 2W6RA 3DVGA 1TJGH 1KBPA 5DA4A 3OAZH 1JXGA 2X2YA 4M02A 5EOCL 3MV11 1JUFB 4O15A 3D2UB 4FS0A 1AGBB 4W9IC 3IDXL 2VXSH 5ESQA 1B6DA 4P2AA 1VF5C 1RY0A 3UETA 2ZUNA 4PSRA 1N18A 4M4PA 3G0SA 4UAHA 4Y16D 1C8QA 1E0UA 4JJ5A 4MXQD 4EZJA 1IX2A 1A0QL 4G82A 3ALFA 2G0KA 3DERA 3E74A 5D1QB 4M24A 3PNRB 3UXIA 2FX9L 3HPZA 5CBAA 4PHZA 1MREH 3HNVH 3O4LD 1JPKA 2BJMH 2B77A 1AMKA 1CN4A 4Y19A 1DVQA 1CFTB 3BFOA 4WJG3 1T1ZA 2FNWA 3GK8H 1ZY9A 2C9AA 2E7LA 2WY3B 5D70L 5CN2A 4P2RE 4ZOAA 2O9OA 3L1OH 4BSJA 1O5QA 2FDMA 1VHNA 1PCWA 4M5PA 4NUPA 4EOWH 1JYWA 3L9CA 2N1KA 1Q6CA 2X0VA 4MD4A 4A6YL 2PU0A 1PYWB 5T9BG 1T6BX 2X4NA 4JN1L 1L7TH 3MFGB 3BIKA 1QR1B 4RNFA 4S0TD 3MRLB 1LYQA 2OR9L 3I84A 5CINH 1LYXA 2MUCA 3GW3A 3FUJA 1ZGLA 2P53A 3MBEC 2DVUA 2EJ1A 2ZYHA 4MZ3A 1CURA 2VDGA 3NM1A 1X3DA 3VG9B 3W81A 1N26A 5CFHA 5E8DL 1BX2A 3QXDB 1WNOA 2Y89A 1CXLA 3ARXA 4GKLA 5TE7L 5C0CD 2CBUA 5FYLL 2PGFA 3G77A 3NQ7A 4IKIA 5LQBL 1ILUA 3DFOA 1AO7E 1GC1L 1RK7A 3VRIA 4P23C 1G4RA 1MCOL 1KJ3H 3R18A 3MGOA 5TF0A 5KTEL 3GXIA 3TJ4A 3TEXA 4A2MA 5CD5D 4FTDA 1UA6L 2C1PB 4HPNA 5TH2B 4KTEL 4DGVH 5HHVL 1N5YH 2ZE3A 4XNYH 3UG3A 3I3BA 4EN3A 3I9GL 2NR6C 3HQPA 1PX4A 4H13C 4ONHA 2B7NA 5F96H 2C1HA 4UQ9A 1SZFA 1IC1A 3F1QA 2ZONA 3SPHA 1BGXH 1CGXA 1YBQA 4WFED 3HZVB 3FU0A 4ROQA 1II4E 4S2BA 3K4WA 4LVGA 4ZXLA 2WQXA 4D72A 5BRPA 4TUOA 1OGAB 4X98B 4QD2E 3UG4A 2OYPA 4Z7OF 2VQ1B 5J6SA 4W5UA 1GC1C 4CNPA 1SLWA 2BVPA 1ADSA 2VFHA 1JPDX 3LNHA 3S0PA 4AIZA 1P7KA 5I1CL 2LVCA 2GSHA 3LLDA 2JIEA 5IMOB 2W1NA 2ITFA 3FU5A 2ZOOA 4E8CA 2DF3A 1QHZA 4DNMA 4HXAH 3LEVH 4QQ3A 5GGTA 4M6QA 1BM7A 1JYNA 4LALA 4U6XA 2Y23A 1N8OE 4AM0A 1P43A 4P04A 3TA4D 3ATFA 3F01A 2XQ0A 3ENEA 5I1LB 2V5JA 3N42B 4A7GA 2VQ4A 1G1OA 3H54A 3QCUL 1K8IA 1G4EA 5M17A 5TPWL 3VJ6B 3NO1A 3QZAA 1UJ3B 4IPJA 4LUYA 3GMQA 2VWEC 1TT6A 1SEQH 1VPOL 2ZKMX 4NI6A 5EU6E 5B8CB 4EO5A 4B0MM 2OLHA 5D2YA 3RLHA 4F9DA 2F53A 3EF7A 3Q6FB 4D9QD 3M0HA 4YJ5A 1KPVB 3CUFA 2E4TA 4JD4A 5IKCA 3VXSE 3HG1B 3U48A 3SN0A 3QIWA 4G6JL 3CSGA 3GS7A 4UF7C 5FS5A 5K9QG 3SDAD 2VSCA 2QUMA 4XO7A 4XSLA 3CUHA 1CGVA 3GFYA 5CP3H 3MMEA 3PP4H 4QAWA 4EXQA 1OZUA 1TTIA 5D9MA 3NN8A 1PIIA 1JUKA 3HCVA 1KY7A 1OSZB 4P7QA 3QXAA 4HEPG 2O4MA 2E9WA 2NSMA 2GOUA 1FCCA 1YXYA 2VDKB 1FWHC 2A2QT 2VDML 1K70A 5K1JA 3M5ZA 3KWWA 2B1HL 2E9JA 1CLVA 2BIMA 2E27L 4B9FA 5IQ7L 4UTJA 1HL4A 1H8LA 3GZOA 1AGFA 2XSAA 1TFPA 3KOFA 5CN3A 2ADAA 2JJVA 4AY0A 4O1CA 4QWWD 1AJ2A 2OOFA 3ARSA 4KFZC 2EE3A 4DF9A 4YO0A 1KGXA 3NFPA 4TQEL 4NIRA 4AT6A 5C8JA 3FO2B 2QVKA 1PZ0A 1U4FA 1ASPA 1ZTXL 4IIQC 1ZJIA 2Q8ZA 1SOKA 1GYAA 3CH1B 3BJTA 4U7MA 3KDMA 1K7XA 4F8XA 3S83A 4JMXA 3ARTA 4ES9A 5AVSB 3MBXH 1HHGB 5FO7B 3KAOA 3P82A 2QKSA 1VFHA 3BXNA 2Z25A 5CSGA 1FWTA 1XP3A 3ZKMC 2MQ0A 4ZDHB 3BURA 4HAGA 4LLQA 3UZJA 4NWTH 1IIIA 1RV6X 2WTRA 1KXQA 1HWGB 3MJ7A 4NNYA 3RGVA 2EDDA 2Q7YA 4TPRL 2QCDB 1UYWL 1MW0A 3VOGA 4I77H 2XWEA 4KHXL 4RFOL 5ENWA 1NCHA 5INCA 3QA3A 4YDLC 5TF1H 3FO0H 2ADFH 2O55A 4P8VA 1NEZG 5I06A 3QGKC 1RP9A 2BW4A 1FP5A 2ZCLL 2VMJA 3O3BA 1RALA 1MCLA 2DQMA 1TYJA 3GBDA 4PYSA 3IGAB 1U8QA 3SB0A 4I9WE 4Y16C 2RHGA 3KPPB 3UCCA 3UR8A 3ULUF 1KFGA 4G5ZL 4JL2A 1NU5A 3QY7A 4HU0A 1OFPA 4MXVF 1AQ0A 3SB3A 2JI2A 3GB7B 3WEOA 4ADJA 3ULVH 1YY8B 2PCFB 5A6AA 3BPCA 3VTTA 2AV1B 3LPGA 1NBQA 1IEXA 2GZXA 1RULH 3UGUA 1AZ2A 1GCYA 4NDMA 2UY7A 4UNUA 2C18A 2X4QB 3EG9A 3QZMA 2Q76A 2WYSA 3WLTA 2QUVA 4JX0A 2XH2A 1SXSA 1A0DA 3ZYIA 2AJSH 4XNMA 5FSDC 4ONOA 3GIQA 2M83A 1IAOB 2VW4A 5GGRA 2MOGA 1IC7H 2YXVA 5DQPA 1KJ3L 3LHTA 5DJDB 4ZENA 3T8LA 1DQJB 1HO4A 3MNWB 5LBSA 1EJXC 4JGUA 4WKZA 3ZE1F 4KMTH 1KBVA 4ABWA 3PAUA 1GJUA 4MTVA 5GRWA 1KJMB 3FTXA 3CDGB 1HYSD 4BF7A 4FYSA 3EOAA 4PJEF 3QSTA 3C6LB 5CR1A 1VKFA 1C9SA 4ICCX 2CXKA 5M03A 1IEVA 2YPKA 4WKAA 1V3KA 1LWIA 3KLQA 3WJLA 3CE1A 1PBGA 1WDQA 3M6YA 4JPGA 1DFXA 1YUKB 3FCPA 1N7ML 1EJOL 4TU1A 5EN3A 4YSAA 4OZ4B 3U5YA 3PUGA 2ZUQB 3FCSA 4FXKB 1BJ1H 5CD5C 1ZHNB 4BI7A 2V2XB 4FA8A 4ZS6C 5B3NA 1UR3M 5IJKC 1KTJA 4QI3A 3NSDA 4HOZA 4O51A 2COVD 2JF6A 3OBEA 4JY8A 4YDVA 3ZDWA 2Z1PA 3K3QA 4KO9A 4U28A 2OQLA 3THCA 4M6UA 3MROB 2F19L 1EBPA 1UM5L 3GSWB 1PKNA 2RDWA 4HJUA 4R2GD 4AZ5A 1R1CA 5LUMA 2Z1BA 3ZJ8A 1JDAA 1AG6A 4A2DA 1FYHB 2GDUA 2P1FA 1MSSA 2DQTH 3VC6A 3VI3E 5I6KA 3UYIA 4N42A 4NPYB 1QNOA 4OGXH 1SJEA 5JPMA 1H3PL 2GEEA 4WW1B 4C65A 5J5DA 4C1NA 1Q1PA 1Q9KA 3HVNA 4LCWD 2NNAA 4JY6A 3SR7A 1L0QA 1WAAE 3KS0J 5BYWA 5IB2B 1YPZB 3WQWA 5J6GB 4AU0A 1W5OA 3BQ6A 3ZIYA 2ZA3A 3P3TA 5F97E 2XJ7A 4TNVK 3L2MA 3ULSB 3BZEB 3PHOA 4OLYL 4GH3A 4OZGA 5D2NA 1KJVB 3LPOA 3SOBL 5MEPA 1HJBC 2IMMA 4I9JA 3K2MC 4F2UA 4J9JA 4IOIB 3D48R 3ETSA 4BWTA 1OAKL 1XZWA 4WW1A 4BFIA 1RJCA 1LP9A 1T1YA 2TMDA 1NJ9B 1ZLEA 3FO1A 3NSJA 5KJRL 4Q74A 3QHMA 5F2IA 5D7EA 3W4RA 2CDFB 1WBXA 3C6EA 3GM0A 4XXDA 2Q8BH 3SPJA 3E6HA 1I2RA 2V5CA 4FQXB 1UQZA 3CBJB 3CQHA 4NZ8A 1OGAE 1UWXK 1RR2A 3VWKA 4BZ1A 1WBJA 2FBRA 5G4EA 4G6ML 5JW3L 3BAWA 1F4YH 1DUZB 1AHWC 4P5KB 4X99A 5D7KD 3RU8L 2Z4QA 3PULA 4D1IA 5JMOC 3KPLB 4IDJH 4PJHF 1XVSA 1TPXB 4R90H 3KVPA 1VLIA 4X4ZA 3ZZLA 1MI5B 2E7HA 2XN2A 3SKMA 3UDWA 4DK3A 1UC4A 5EBMA 4QSHA 3HTWA 3LCFA 3SCQA 4HNCA 5F3HB 4RFNC 4S1RL 4CW1A 3PPGA 3TF4A 2O9TA 3QJSB 5EPDA 2ZA2A 1QTSA 5PAZA 3FAWA 2OJZL 3A3YB 3MUCA 5FF0A 3KGSA 4Y1TA 4G71B 4CSPA 3QH2A 1GPOL 1DE5A 1FRBA 4AB4A 3GDTA 4ABVA 4DBDA 1AR1D 1IC4H 2E9BA 2O61B 1YDYA 4L29B 5GGQH 3ZTJG 4NAMA 3DDGA 1XGZA 1KB9K 4BV1A 1CB7B 4XCEB 4PG9B 1H0GA 2ZOXA 4RV8A 1DEEA 5ANME 4NGHH 3A12A 2QADC 4JX6A 1JWMA 4Y9EA 4DWHA 3ULVD 4N2OA 4XBEL 4GC3A 2XDHA 2VO5A 3OKMA 4P2OA 3WUGA 3QYMA 3TQVA 4OTXH 2XSKA 5FWRA 1L6GA 5LIXX 5DHYA 1P4LA 3RZCA 3NIYA 3I6GA 4EZMA 3AQYA 4Z3TA 4MGGA 4J3TA 3VE9A 3DX0A 1AL7A 4BEQA 1YC8A 5FFGA 4OZHF 4B96A 5AC5A 5JBDA 4GKSB 3HPFA 1KJ2H 1MUJB 2NQDA 2H6PA 1EXUB 2VWEE 2DI7A 3AWFA 3BP6A 4QRPE 3EXTA 4O2FB 4LEQA 1AW2A 2WKJA 1WWWX 3L54A 2YQBA 2R15A 2P24B 1NZRA 2YBGA 1ZNNA 4W85A 4LVOB 4Q8BA 4WEBL 1OSPL 1OJXA 5I79A 1DUYA 3UCDA 2LLEA 1SEBB 3WK3A 3PZQA 2GBUA 2YQ3A 1AHKA 1TLMA 3QJRB 1A6UL 1UXLA 4P5TC 2XG4A 1GY1A 1ETJA 3ZLQC 1LDCA 2H32H 2CD0A 1PWMA 1TR7A 3K91A 4PRAA 4Y8DC 5GGRY 2DV6A 3WDIA 2H3XC 4A8LA 3MRFB 4TQ8A 4R5TA 1FNHA 4PJAE 4Y89A 2Q7YB 1TWZA 1YIXA 1UXWB 3LYRA 1S7XA 3PIQB 2QVIA 2E7BA 1M4KA 1R19A 2GITA 2VERN 1QRNB 1EMTL 3QQ0A 1KB9J 1KKOA 1IBFA 1NBVH 5IJVB 3KDOA 1IIKA 1HHGA 5FO7A 3V4LA 2UZ9A 2EYTA 3QP3A 3SJNA 3DGDA 1H19A 3GLDA 3TZVC 2AKZA 4F57H 2VGGA 4NVTA 5HHMB 3MNVB 1QWNA 1EXHA 4MYXA 4PFEA 3R8QA 1UFGA 3LZOA 5C0BD 2EDWA 3FQ2A 4U1HA 3PBYA 2FO4B 2ZSWA 3LKNA 1FF5A 4NP4L 4XZHA 3VKAA 2X1PA 2EHHA 1YJDL 3I4KA 3QFDA 3QJOA 2OEMA 5T5FH 2FB2A 3DX2A 4OHQA 3WE6B 1SU5A 1GTEA 2PDYA 1F05A 2ZADA 3GSRA 4GQRA 2CDGA 1CD1A 3AUWB 1KIRA 4WFHE 1QHOA 3U1QA 3RWFA 5JHLH 2BVQA 1XH3B 2F19H 3TVMB 2DQCL 5FV2A 1UCWA 1XF0A 1XGYL 3VXNB 4DRSA 2WXQA 4L4TE 4UTCA 3ITYA 2CKBA 4ETQA 4JTCA 2A0LC 1KB5H 1X7QB 3BVUA 2EIJB 3LVTA 1B0IA 2VXTL 3NAAL 4N0CC 1EGVA 1HGYA 2F6XA 2DQTL 4PJCB 4ECLA 4BUQA 2BDNH 4XK2A 4LE8A 3LZFH 3I6TA 1PLCA 3SAZA 2HX8A 3GJEA 5DS2A 5FHBH 3VD5A 4Z7AA 2LTQC 1Q45A 2IOMA 2XN9E 1FAIH 5AB2A 3VVVA 4HGMA 3VU2A 3EWXA 3S9YA 3ZDXB 5D1ZC 2GUUA 3OKLA 4C58B 1D7CA 1ZAGA 3JWNC 5IFJB 2WZEA 4FG0A 1G7QA 4W9TA 4K8EA 5DJAB 5J1AA 1I8KB 4GG8A 2CGRH 4LRNL 4XE5B 4S1DD 4ZO9A 4PUWA 1BYBA 1Z3GL 4WZHA 1R5WB 4YUEL 3BO9A 4LB3A 4US5A 1BXAA 2W07A 3OTTA 1WAAA 2O1AA 1SUHA 2PCYA 3QI9D 2R2BB 4YR6B 2JKPA 2BOBB 1POJA 2NWRA 2H90A 1RUAH 2PCQA 1IGFL 5B3JF 4GISA 1QR7A 3QCVH 3KCLA 5A69A 4KROB 1KG0A 3OB0H 3K6SA 4RRPA 4UOJA 4FCHA 1W17A 1AO7D 2Y36H 3C6SB 1B4JH 4PD4J 4UXDA 4NWUL 3TOYA 3V5CA 3G08B 1YCSA 1AXSB 3L4UA 1KGCE 1E2VA 3PREA 2CGYA 3H7BA 4Y4HB 3REWB 4F7MA 1O94A 2VCBA 3M0YA 5HHNB 5E94A 3U4FA 3MAWA 4XNDA 2PTUA 3QULA 1N55A 5I1KH 2W9DH 5E2UH 2GVLA 4PCSA 1Q65A 2V17H 1XUUA 1V5XA 4FFWC 3A9IA 5BVPH 4MZ8A 4ES4A 3PWUA 3OQRA 3OVRA 1SJVA 3S5OA 2HXUA 4HBCH 4KWSA 3L4WA 4JHZA 2ZXEB 2NCMA 2J8OA 6ALDA 3L6FB 3IDNB 4ZB5A 1ADDA 1J5IA 3BKYH 4X7CC 1H15A 3NO5A 1K8XA 4KIRA 5EU4A 5MP6L 5DZAA 1F5WA 2I17A 3AIBA 3PF3A 3TT1H 3UJ2A 1Z44A 3WNIA 2BCMA 4RISL 1IEQA 4A6GA 4XHJD 4F40A 1UJQA 2FDSA 5JQIB 2K6ZA 4JM4H 5C0GB 4LL1A 1D9KC 5IV2A 1E0WA 1BHGA 1FXPA 1UUQA 5AVZB 2EVFA 3C09B 4BKLA 4Y9NA 5FAJA 2GBVA 3KTSA 4Z3GA 4HPOL 4APQA 2Z1XA 3I74A 4WDTA 3ALPA 2RD0A 4A68A 4JPQA 5H37G 2CLPA 4OCSH 5GRXG 3PE9A 1EP1A 3P81A 1BD2E 2YJQA 5KVDH 1JNEA 4M93B 2DQIL 1KENH 4YZFF 4OQTA 2ED8A 4HXAL 1GAFH 3G08A 4WU7A 3WYRA 4UZGA 2QDGA 2PDMA 3BHBB 4HKXA 5I1GL 1WA0X 4YSSA 1M3IA 2Z7YA 3HI6H 5DD6A 1K6QL 1US3A 1EFXD 1I3VA 1W5QA 2TSBA 4TMBA 4BBWA 2V81A 4HA0A 2W65B 1C7TA 4HEMA 4PP2A 4XZBA 2D23A 4DQWA 1JJUA 4ENLA 3GSMA 4DWSA 4YIQA 3S88L 3OKKB 1OGBA 4H20L 4JTQA 2EIBA 1KRBC 3H7LA 3OIXA 4RGNC 1QPKA 2FD6L 3LZRA 3WQPA 1ZT1A 5FB8B 1FPTH 1OSPH 3LS5L 2AQPA 1NCNA 5L4FA 2XH4A 1LEKB 1KFCA 3E2RA 4XVJH 3R8HA 2Q0ZX 2VN3A 1NWPA 1UJ3C 3LX9A 2PBOA 2BMBA 1AC6A 1CFTA 1XLBA 4LCIH 1YNTF 2EEAA 5GS0C 3FAXA 1BMWA 1WFNA 1NCDH 3BD5A 3HMCA 4KJQD 2Z0UA 5D7IA 4QT5B 3V9EA 1TNMA 4U1KB 5G4OA 3BC9A 3VD3A 4BINA 3MUUA 2ONEA 3K5XA 4Q56A 3L1GA 4WY7L 4J1UA 1I1XA 2WMGA 3GZ3A 4XTRD 3T44A 1G01A 3CN2A 5DRWA 2ARJB 4F8LA 4CDHA 5C9UA 1R3YA 2C1IA 4HW6A 3DURA 4U6HB 1EXGA 4MDPA 3USZA 2F58L 1IM9B 1VZIA 2WXGA 1TVBB 4L4VD 4U1IB 2N01B 3FT2B 2JIXA 1FG9C 1C92A 1PAMA 2RDXA 3H6AA 2NPLX 4L3AA 3WH9A 3IPBA 4Y9AA 1G1YA 1M71B 4UCFA 3F04A 1MDLA 2J7BA 3TQPA 3W1TA 3FFCE 4TSAL 4IMKA 2Z35B 1VJIA 2DFAA 1K9TA 1ZTMA 3AGWA 4MQ7A 4PTWA 3B2UC 2X6AA 1NGYB 4HPXA 2CLKA 2WNWA 5HP5A 2YGNA 1HHKB 3RVUD 4C6QA 2IPUK 1S2VA 2C9PA 4MNGE 2I57A 4N2EA 1SJXA 4YBQD 4WKFA 4UMSA 1G0XA 4LFHD 4B16A 5F6HJ 3EDFA 4OR1A 4X6FA 3VI3F 3TBSB 5EF3A 1PTGA 3B9AA 4Z7NE 3GYEA 3NL3A 3GHEH 2BVTA 5GJTH 3EAUA 1M9SA 2BY3A 2VXQH 2XWXA 4S3FA 1T20B 3LPPA 4L5FH 2ZJSH 1SXNA 1U93B 2R2CA 4S0HA 3PGFL 2DM2A 3GRGA 1TTCA 1T6MA 1F00I 2CKRA 4RNRB 3VFWB 2XIMA 4XP1L 4NQED 1RZFL 4M1DL 3MS8A 3NOYA 3JWDL 3R1GH 3CYVA 4ODXB 2HFEB 1DN0A 2QPDB 4ZQKA 1X96A 3G0UA 5HNNA 5F2LA 2NW2A 4LCVA 5KUKA 4OV5B 2WMIA 3QUKA 2IPJA 4MY9A 1KYDA 3L1OL 3S6TA 4KWVA 4RFEB 3OMNB 2BSRB 1OLLA 3B3IA 3G6LA 2ZAIA 3FSZA 1LEGB 1OVDA 1GQKA 3FJNA 2VLRB 2I24N 1G69A 1IGFH 2VN7A 3NJIA 5SWSD 4WK2B 3TN4A 3UWEA 4E8DA 1GQNA 3WAKA 3NZ8A 1UIPA 3QWQB 4PJHE 2DL2A 1UPPA 1NMCB 1VP5A 3BWAB 4HK7A 3ZL1A 3KWTA 5DJ2B 2KLRA 4S1DC 4XC1L 4YE4H 4JGNA 2YCIX 3BN3B 4GUPA 3L12A 2YUZA 1R3HA 3S5SA 4MFDA 4B5WA 1LO4H 3N50A 4KMTL 4WTZG 2P7TB 3ZVIA 4LEOA 1MH5B 4TVPL 3T0DA 1BZEA 2X4SB 2W9DL 1J0KA 1BLNA 5E2UL 1X9LA 3S8FB 3DKJA 4J2MA 2OQJA 4V1DD 3RX9A 2X4OB 3UJRA 2HE5A 3FMGH 4NXSA 4F4RA 3GVRA 4X3ZA 5I1JH 1E9QA 1GVQA 3AS2A 3K6FA 3KFTA 2DM3A 1MFMA 4WSJA 1WV7T 2QKIA 3A67H 3C9NB 3IDYB 1E1FA 1H7PA 4B5UA 1XLIA 2VL5A 3C3UA 2QQNH 1R3HB 3LXUX 4FNLL 1CGYA 3M64A 2WQ8A 4RISH 4J8RA 1AH1A 4WI0B 5DK3A 1JVNA 3MRPA 3ILEA 1TV4A 2WWMD 1UQYA 4E0CA 4HJSA 4HWBA 4OGZA 1E8YA 4KVNH 1K6WA 1DVFA 4LU5H 3GC3A 3S5YA 2PYFA 5GRYA 4IIHA 1JZ3A 3N2CA 3W39B 1G6RA 2YAFA 1QLRA 2CO1A 3F58L 2D7PA 4R8WL 4IIDA 1REQB 1AW5A 5D2XA 1YY9D 4OGAC 3SSJA 43C9B 2C1GA 2FX7L 4NYYA 3V95A 2A7PA 3LLFA 4H41A 1WBHA 1ZANH 2HH0H 4N6FA 5GGTH 4KRZA 3NWRA 1DWFM 2R2EB 2VB5A 4PQXA 2DYPD 3KYKH 3T0EC 3QWNA 4OU3A 4IKNA 4NQCD 4E68A 2GJ6E 2OTUB 4PJGA 2PGRA 5LG6A 2WSRA 4OCXL 3NCBB 1LGVA 4O1FA 3GMMB 4G8EA 1A14L 2GUYA 4X50A 1KULA 4HHLA 1KC5L 4IGSA 4LSBA 5CJ8A 1G9ML 3OMZA 4DBWA 5FCSH 5I5IA 4B41A 3QHFL 3OLDA 5D1QE 2HRHA 3TIDA 4BZYA 5C0RL 3U46A 2OK0L 1TYGA 2FGBA 2MEJB 4GAYA 3NCMA 3ULSA 3DRQA 4O9HL 3UTQB 3BZEA 4U1JA 1W91A 2F8IA 4J39A 1B3WA 3LMYA 1YMMA 3SDCD 2P52A 4JDVB 3O9NA 3UBXG 1MLBA 3R89A 1WUZA 4HGKC 5BV7C 4P2YA 1R33A 4OM1L 5AAWC 5I1EL 5FSEC 1TPUA 3OBAA 4MQ7B 4S10A 1ZCOA 1VRDA 1HDMA 5DJZA 4XVDA 5JIDA 1BFNA 1S7WA 3TYFB 2HCVA 4FP8H 4MQXD 5B1AB 1CICD 3POCA 3H8AA 1KV7A 3UX9B 1T1WB 3P93A 2NT1A 3WIJA 4Y4HC 4I3SL 4IJBA 3RVWC 5FOOA 4MA3A 2XFWA 3CVHH 1IFGA 4IM8A 4R7NA 1GG1A 3DECA 4XP9L 3PUCA 1MJUL 3ML9A 4QXUL 5HGDA 4KRPD 1GTFA 1ADOA 2I1OA 4PEKA 3JXAA 3DSFH 3JT2A 1F73A 1OL0A 2KBGA 1FAKT 2VDOH 3NH7L 1BXXA 1T0MA 3CFUA 4PRIE 1VCVA 4GYKA 4MAVA 4RDYA 3XISA 3HZMA 1NFBA 5ABZA 1FA2A 5CMAB 4GW5A 3B05A 3P0WA 1NGPH 4R97B 4BZ2L 2ZFAA 5C0AA 12E8L 2ANUA 1FNEB 1EPXA 5D4YA 2P45B 4NO5A 2XWZA 3PAZA 1V79A 2WHJA 1U5JA 2X2IA 5CKAA 2AMXA 4P2OD 3N1MC 5L2KB 1Q6DA 4PB3A 2CEQA 2OSWA 3B9VA 1XC6A 2G0WA 4L7ZA 1HIML 3FUIA 1OE3A 4F9LA 1R4XA 4UT7L 4JRXD 3B9NA 3M8OH 3S37L 1BZQK 1Z9MA 4I89A 1TUFA 1PO9A 4UTLA 5ID0A 3NFSL 4DEPC 1HH9B 1YNKL 3LXCA 2I5YH 5D7LA 4QJ5B 1I9JL 4RZ6A 1HC1A 2ZSVA 3VH8G 4MWAB 4K8RC 4U1SA 4JGMA 4YYCA 1SBBA 4HJJL 1KB5B 1X5ZA 2C91A 3EFFA 2GI0A 1YEDA 4NO3A 2OYLA 4LUTB 2D3NA 3J27A 4IXHA 5GS1A 3AB0C 3SODB 3ID7A 2PP8A 3AMLA 3D85B 2NQZA 2V3EA 1PVNA 2YO3A 1XTLA 4H40A 3BKJH 1F6KA 3D0VB 1KFJA 1QPNA 2HSAA 3B0VC 1M2VA 1QYGL 3MI6A 1RVFL 1U58B 2A6KB 2AEQL 1ED3B 2I9LB 3O81A 4R96B 4XC1H 4YE4L 3U2IA 3Q6GH 3HGSA 3KRZA 4ALDA 2K1MA 3IAGC 3KHQA 3Q1SH 3WTUA 3SJVB 3RO6A 5KMYA 2YYTA 2VM3A 3U4EA 1A2YA 2JALA 4HCDA 4MXVE 4LAZA 4QDMA 4HS3B 2XZ7A 3RFAA 4MVAA 1YDNA 1FCGA 2EH7L 2ZKHH 4TX8A 1TRDA 4MUZA 4H9YA 3KWXA 4L6DA 1T8QA 3LNFA 3FRPG 4EPEC 2BP1A 1E9PB 4HUNB 5DSCA 4AXKA 4DO4A 2G75B 5FPIA 5HDBB 4Q7IA 4AX6A 4XMLL 1HQ4A 1TU2B 3TBTA 4AZ8B 1GYVA 5HQEA 4WWID 1RAMA 4X63A 4L9DA 2E5BA 1B2WL 3SEPA 3FQUB 1N7MH 5C8JB 1E1EA 4I4WA 1DE6A 3ESUF 2X1IA 1RZJH 4JM2C 3WD1A 1UD3A 5I16A 3CNYA 1AJ7L 1Q5MA 4LU5L 1XLGA 2E8YA 5J6HA 3V52H 5LNDA 3IJEB 3OHXA 4G8GB 1HZHH 2VXSL 1JNNH 3ZZSA 1TZGH 2WINB 2X4OA 3BLFA 4EDWL 3NL5A 2X41A 4V1XA 3S37X 3Q8BA 1SOXA 2PTDA 4M3HA 5KS9B 2BVDA 3T6VA 2RFXA 5B38B 4XZWA 4Y90A 4PRTA 3P60A 5DBTA 4ETYA 2DJMA 5G2NA 2HJKB 1FH8A 3HNSH 2F54D 3QIWB 2ZE0A 5HDBF 3QDMD 5KBDA 1BOGB 4XCCH 4Y9PA 3B3DA 1ICSA 1N8ZB 5FUZL 1XR9B 4PJCA 2O93L 2HN7B 1UCBL 5DJCB 2IFGA 4WO0A 5IOKA 4GG6A 1FZOA 1I2PA 2WXDM 3OGRA 4GI6A 1NPUA 2OX5A 4HZLA 4EN3C 4MD0A 2K78A 1OYBA 1CTNA 1XYCA 5FKAA 3T0ED 4ROPA 1TCMA 4MSWB 3SGJA 3ZE0B 4L4TB 3BE1L 2X89D 4NKMA 4Y0GA 5C07D 4V1DE 3MO7A 3FONA 2V2DA 1NMAH 4RGNE 5AHNA 1CZ1A 2D03L 5HGHA 3KLLA 3WE6A 3WFLA 2NY5L 1HVXA 5SWZB 3TO4B 3H2OA 4IEFB 1IQWH 4DHLA 4HHAA 2BSTB 2YN5A 3U6XA 1RIHL 2BIPA 3SI9A 5CEXA 3HB3C 1OSEA 1VBJA 5I2UA 1I9IH 4AQZA 3CIXA 2KL6A 3N34A 4KNUA 4NBXB 5FXCH 1OANA 3WJJC 1N67A 4N90E 1D9EA 3CBWA 3WD5H 3X14A 3QJHA 1YYCA 4OZIE 3GBMH 2A1YA 3IMUA 1BYDA 1RVGA 3W71A 1ECZA 3X14B 1W1B1 2P4AB 3GTNA 3R7MA 2GITB 3I3DA 3KLHC 3QJFB 3KNBB 4DCQB 1CICC 5TDNB 3SUSA 5AVUB 2BZNA 4ZBJA 4E5XG 1U3ZA 3IIXA 4TX6A 3A22A 3GLAA 2P76A 1GGBL 4WDXA 1M71A 3NPSB 3UAFA 2X70B 4A8NA 4AIUA 1Q0YL 4JIHA 2NRDA 5EZPA 4F33B 3F2DA 2VDKH 4IOFD 1PFOA 3NCYS 3RTQC 1IAMA 5DVMA 1OQXA 1PBYA 4LSDA 4FQPA 2EUVA