2ZXBA

Alpha-l-fucosidase complexed with inhibitor, ph-6fnj
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
total genus 161
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zxbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zxbA01
4WK9A 1DWIM 2ZUWA 4W85A 1TCMA 3EJUA 2ZUTA 1QI3A 3UR8A 1R86A 3AIRA 3W4RA 1XRVA 1V0LA 3LRKA 3ARZA 3NDZA 7CGTA 3DX1A 3VU2A 2BVTA 3AOFA 1C3FA 1PX3A 2WMIB 2FYVA 4GZJA 1VEOA 2FE0A 4EANA 2XVKA 5TD4A 1C8QA 4GXPA 3MANA 3GNRA 1KR1A 3LMYA 1NQ6A 2F7QA 2VUYA 1WDSA 4CUCA 4XX6A 4CN6A 2W66A 2E8YA 4TX6A 4OBRA 2WXDM 1W3JA 4LYRA 1KCKA 4QLKA 3LPPA 1J0IA 1EH9A 1VB9A 3IAPA 4URIA 4UFJA 4CCEA 4AD1A 3CH9A 1W9XA 3UERA 4HU8A 1NWRA 5A8PA 1NH6A 3NJ3A 1XD0A 4D6DA 1H4PA 4ML4A 3OZPA 2V5CA 3WMSA 5I5RA 1JAKA 1JDDA 4U3CA 1ODUA 3W37A 3WY2A 5BRQA 2GDVA 3NUKA 5A8OA 2YKKA 3ZM8A 3CZGA 3ECQA 1S46A 3WFZA 1B30A 1XCWA 1J0ZA 2YIHA 5FKYA 4LQ1A 1XSKA 4E4PA 4TVUA 3KEHA 4NRRA 2EPKX 5JUVA 3T09A 4MB4A 3WNMA 4GO9A 2XJ7A 2OYMA 2UY3A 3SCUA 1OINA 4D6GA 2IGTA 3UESA 4H2CA 3WQ6A 2PI6A 5IHSA 3ZR5A 1AMYA 1Z32X 1KXQA 2V3EA 1IT0A 1NP0A 3MS8A 1G9HA 4MB1A 3VIFA 1UKPA 2EQDA 5D4YA 3EDKA 3U5UA 1CXLA 4ZEPA 1V3KA 1EQCA 1CGTA 2ZWYA 2J78A 4W84A 3SURA 4U31A 1VEPA 1G94A 4BCEA 3LXCA 3H53A 2WZIA 4MAZA 4MB3A 3GBEA 3WD3A 2GK1B 3CMGA 5E1QA 4AW7A 2E4TA 3TTSA 1XH0A 2XG9A 1UA7A 1H3GA 4JZ5A 4XV0A 4PEEA 3CMJA 4HU0A 4MPKA 1TR1A 4RE2A 2X0YA 1V6YA 2WVTA 1MW3A 2NT0A 2UY5A 3PN8A 3NSNA 2YA1A 1HN1A 1JI2A 1VIWA 1R46A 4GINA 2OWWA 1HP5A 2Y4SA 1EHAA 1UZ1A 4JFTA 5DEZA 2C7FA 1QNQA 2YA2A 1PS3A 1KGWA 4XUYA 4OZOA 1BGAA 1AQ0A 1WZAA 1E0WA 3ARSA 4JFVA 2GFTA 1JF6A 5A6JA 5AC5A 5HBFA 2WSPA 5CJ5A 4ZE5A 4YHEA 3AMCA 5LA2A 2WPGA 5EFFA 1BHGA 2XVGA 3AZSA 1X6NA 1OM0A 1Q6DA 3TTYA 1HKJA 1KBBA 1WCGA 2ZUUA 2VCBA 4JFWA 1JZ6A 3AZRA 4RE3A 5I0DA 2PBOA 1MQPA 1QBBA 7TAAA 1EDQA 3RILA 3PTKA 1YHTA 1SMDA 1CXHA 1OBAA 3ZSTA 2O9PA 4QP0A 1UWIA 2YFNA 3J7HA 3N13A 5IFTA 3LPGA 3BUIA 1KQZA 3D4ZA 1E70M 4GKLA 3N15A 3VMNA 3IGUA 3DYOA 1OD8A 2G41A 3RMEA 3AHTA 3CZ8A 3BMVA 3OLEA 1CGXA 3WEZA 2ZWZA 2J4GA 1PZ2A 3WQ8A 3BCFA 3DYPA 4AIUA 3A4WA 4MNKA 4BA0A 2VJXA 3AIEA 5M3WA 3MUZ1 1FFRA 2UWFA 3CIVA 1HJVA 4TVDA 1GVIA 1GOMA 3IJ8A 2F61A 2ZX7A 3L4YA 2XVPA 2BNJA 1VENA 4B9YA 2VO5A 3EJQA 1JXJA 1UD4A 4AZIA 1TQSA 4U2YA 4F8XA 1XCXA 1E72M 4UQEA 3SCWA 1W1PA 1NM9A 1C8XA 4J3UA 4B15A 4DO6A 4UTFA 3AIBA 2D73A 2D0HA 4AIEA 3TV8A 1ZBVA 4DWSB 1UWQA 4K68A 4D6FA 2VZOA 1CEOA 1QWNA 3O6AA 4H7VA 5ABEA 4AEEA 4JIEA 5CLWA 3IJ7A 1KGUA 4CGTA 3MSDA 4W7VA 2ZUSA 4PTVA 3B9AA 3GXFA 1SR0A 3EJRA 1ZBKA 4Z2LA 2F1BA 3VDHA 2CNCA 4WLCA 2WC3A 3MUAA 3BAIA 5AY7A 2ZXDA 1V02E 4C7DA 2W63A 1BG9A 3TONA 3I3BA 2E9LA 4U2ZA 2ZUNA 2YA0A 3CBWA 2ZX5A 2X05A 4CVWA 1KXTA 5A2CA 2XFFA 3VGFA 4QLLA 1V6WA 1U30A 3A3HA 4BZYA 1UD6A 5EFDA 3WL1A 1QX1A 1C8YA 2VVNA 1QNSA 3VIPA 3CPUA 2UY4A 3ZQ9A 3DX2A 4MNMA 4CU7A 3BH4A 1A47A 1FP9A 3EDEA 1CYGA 1OIMA 4QLJA 5JIWA 4P7NA 1XYZA 3OGSA 3L4VA 4QDMA 1H0GA 4OOZA 4P7LA 1PZ3A 4ACYA 4XB3A 3SEPA 2QMKA 1CDGA 1WAWA 3BXWA 2VQUA 2YDQA 3WY3A 3EJSA 3WUFA 3BAKA 1Q6EA 1ZU8A 3WELA 4IISA 4EE9A 4PMRA 3IJ9A 2PWGA 3VO0A 4P8UA 2ZXBA 1DWAM 4UOZA 2GJRA 5BXPA 4YHGA 2NT1A 1J12A 4NX0A 2A3BA 2QLYA 3DDFA 3II1A 4V28A 5BRPA 2BY0A 5D9PA 1XC6A 3AHXA 1OD0A 3OLIA 4FLQA 2XIIA 1J10A 5GNXA 3WY4A 2VR4A 2WVVA 1HJSA 3VM5A 2DT2A 1TG7A 3VTRA 4QAWA 2BVYA 4UCFA 4CD8A 2ESCA 4KH2A 2BHYA 3WBAA 1BYCA 3KL3A 5CPQA 2Q8XA 4W8LA 5ABHA 3N18A 1E6NA 1FA2A 1W3LA 5IDIA 4C7FA 1H0IA 4U33A 4Z2GA 4W8AA 4UR9A 1UH4A 1UQYA 4U5IA 4Z2JA 1JDAA 5E09A 2WVVB 3TP4A 4GPNA 2YLLA 1OSEA 3WN6A 4PTMA 1VEMA 1LG2A 5A8MA 5JBEA 3DX3A 4FF5A 2VNCA 1J18A 4LGXA 2FHBA 3VGBA 3FAWA 1UD2A 2WCGA 3TOPA 4BS0A 1D3CA 2WHJA 4AMWA 1J9YA 3SUVA 4AZCA 4A3HA 3EMCA 3FN9A 3L4XA 3A21A 1B31A 3GBDA 4TTGA 4C7GA 2Z1KA 4AMCA 5DO8A 5EMYA 1JZ3A 3N1AA 2VURA 5AYBA 4KGLA 4NXSA 5IXEA 3WNPA 4UFKA 2Y8VA 3GNOA 3PZNA 2VX5A 2HVMA 3VX0A 4KRUA 1KWGA 2WAGA 4D71A 5A6AA 2XIBA 3SCOA 4JKKA 1XSJA 1R34A 1MFVA 2D24A 1UG6A 3D50A 1D7FA 3LRLA 3CZJA 2GUYA 2WKLA 5EB8A 3VDAA 2QF8A 2Z1SA 5CXPA 1E6XM 2VZSA 5AYIA 5GQBA 3L4WA 1V0MA 1JDCA 1UUQA 4F66A 1DP0A 1OT2A 1W32A 5FIPA 1HXKA 1JYVA 1V02A 2ZX9A 1K9FA 2WZEA 2HISA 4CD6A 2G3NA 2OWXA 1KR0A 2XPKA 3CV5A 3BUBA 2D20A 4CN4A 5A6BA 3VD5A 1ZBWA 1IZJA 3A23A 5A6MA 3QOKA 3H54A 3KZSA 3D4YA 4GQRA 4J3XA 2OWCA 3CUJA 3WF0A 2F7OA 4NZCA 1MW0A 3AI0A 1JFHA 1O7DC 1LL6A 3FXYA 3PZTA 2DIEA 4BF7A 3T08A 5CPSA 1V6XA 4UFMA 3T0AA 4WSKA 2E3ZA 4CD4A 5A6BD 1LJYA 4JAWA 2VTFA 5E70A 3SUWA 5LYRA 3SUTA 3UR7A 3UG5A 4CD5A 3WF2A 1J0YA 4X0VA 1HL9A 3VD7A 1ESWA 4H8UA 1K6AA 4J3SA 3DC0A 2NSXA 3CO4A 3HU7A 2DSUA 4EK7A 5A8QA 1H09A 1TA3B 3OLGA 2DGAA 1BSIA 4WKAA 4FNTA 2AOSA 1LWHA 4TOQA 1HXJA 4GI9A 1JNDA 3CLWA 5BCAA 3WDHA 3EJTA 3ZO9A 4PMVA 1CGUA 3BUDA 2WHMA 1W1TA 3CHEA 2XVNA 3AXXA 1R75A 1FHDA 4MNLA 3CZNA 3WQ4A 1EOMA 2DT1A 1DWGM 4KWUA 1QNRA 1NWSA 4J27A 2EABA 2XSBA 2WLZA 3NDYA 5GPRA 3UETA 1V3IA 1M01A 4Z2HA 1GOKA 1KTCA 4CCDA 1ISWA 3U7BA 1TA3A 1UZ4A 1V03A 4ATWA 3PHAA 1GORA 3BUPA 4PCTA 3WENA 1ECEA 4UQAA 1OB0A 4TX8A 1E6QM 1UOKA 3VD9A 4J7RA 5D8WA 3W27A 4WIWA 1G5AA 3ALGA 1CGWA 4UQCA 1ISZA 5A6KA 3QHOA 1E5JA 4AISA 4E2OA 3PZVA 1V6VA 5I2UA 1JZ2A 1U2YA 1JF5A 4AZBA 1UKTA 2PBGA 1TMQA 1LF1A 3W28A 2YJQA 4AD5A 4CCCA 4HOZA 3WY1A 1K9DA 1JXKA 3F5JA 3AMGA 4H41A 5A95A 2C0HA 4XZBA 4AC1X 4DUWA 3S2CA 3VIMA 1H11A 5EBAA 2WVSA 4LPCA 1PAMA 3EDDA 1Q6GA 2BXZA 2RGLA 2VCCA 5A8NA 3ZT7A 3GYCA 1C7SA 2J75A 4H8HA 2BY3A 3ZIZA 2VQTA 2EO7A 3AHVA 1WDPA 4DM2A 4L4OA 3ZJKA 3W38A 4PMDA 1HKKA 3N12A 3MUIA 2GJXA 3VGDA 4D6CA 3WF4A 8A3HA 1UD8A 2DDXA 1XGZA 1EQPA 4D72A 4JL1A 3AXIA 4Z2KA 3WNKA 1EHNA 1N82A 2E0PA 1UWRA 4OJYA 3B9DA 1JZ7A 2WNWA 3BVXA 4UOQA 1PEZA 4W7UA 5CSUA 2WVUA 2VRJA 1JYNA 1C92A 1CPUA 4GI6A 3G6MA 5I3DA 1L0PA 2XUCA 3SCRA 5AC4A 1Q4NX 2Y8KA 2DIJA 2DT3A 5I78A 3K8KA 3WDRA 4F9DA 1RD6A 1E3ZA 4OBSA 3W29A 3GZAA 4HPHA 2WZHA 1SYTA 4P8WA 2QPSA 1WE5A 2VRQA 5GNZA 1OGSA 3U57A 2FH8A 4FNSA 2XWEA 3SCPA 3VGHA 1RH9A 2BHUA 5E0FA 1ZL1A 4E8CA 1GJUA 3WDJA 5D9MA 2VX4A 1DWFM 3VVGA 3H55A 1VJZA 1W2VA 2BY2A 1UWTA 2WCAA 1BVZA 4BQ3A 1MFUA 1E6PA 3WF1A 1UH3A 2YFOA 1HVQA 7A3HA 2G3JA 3CZKA 4NRSA 4P7RA 4AYGA 3SUSA 2EPLX 1JYXA 3WNNA 3FNDA 3SCTA 3PZQA 5HOSA 2WBKA 5C71A 3PTMA 1HF6A 2QV4A 1KBKA 4HOXA 1E3XA 1ISYA 1EOKA 4M81A 2W5FA 2QMJA 2AMGA 4JCLA 2ZUVA 2E40A 3WNOA 2CETA 3B8SA 4PN2A 2XFYA 3VIJA 2OSYA 2VCAA 5C70A 3WEMA 4KGJA 1GOWA 3WDQA 3BMWA 3L4UA 3BGAA 4PMXA 1R87A 1J0JA 4PSRA 1OWQA 4CKQA 1TQTA 3CZSA 3EMQA 1E43A 3BLPX 4AD2A 5FL1A 3VDBA 3VD3A 1JL8A 1QI4A 1W3HA 2A3EA 3N11A 1QNOA 5HNNA 3OB8A 4YN5A 4AZCB 1R47A 2X2HA 1OGGA 1E55A 2J74A 1MXDA 1M04A 5ABFB 3IAQA 3VX1A 3GDBA 5I23A 1CXEA 2CESA 2GDUA 1EO7A 2VZTA 2XSAA 3OIHA 4OGZA 2WHLA 5JBDA 1UWSA 1E5NA 3AICA 3AMDA 3ZSSA 5DMYA 4HMDA 1W3KA 2GK1A 2GJPA 4IUGA 1BPLB 1W9DM 2X0HA 1W9VA 3DDGA 1V0KA 3SCVA 4M24A 3ZJ7A 3HG3A 2CYGA 4ATDA 3VD4A 3RM9A 4E8DA 8CGTA 1X1NA 2QHAA 3AFBA 2E8ZA 2CBVA 4HA4A 1GOQA 1OCQA 1AQMA 3LPFA 2D23A 1W1YA 4FNPA 4UZSA 3K8MA 4UQ9A 1JZ8A 4U3AA 2VC9A 2BXYA 2EPOA 4LYQA 3VKKA 4F9JA 6TAAA 4AEFA 2WMIA 1KQYA 1JZ4A 1EA9C 3WH9A 5F7UA 3WIJA 1UA3A 1MQQA 2DQXA 1CXKA 4BQ5A 2YL6A 1NOUA 3KE0A 3U5YA 4OUEA 1JNEA 2F18A 2BFGA 2WANA 2D22A 3OZOA 1TQUA 1XHGA 2YL9A 3BCDA 4NF7A 4B16A 5CG0A 2J62A 1E56A 1HP4A 2WMJA 3ZT5A 1H49A 1H2JA 5GNYA 4MNJA 1E71M 3WUGA 4PUDA 3OA5A 2DH2A 3ARPA 1MXGA 2D1ZA 3F5KA 1DHKA 3TTOA 4AIOA 4DO5A 4B9ZA 1CXIA 4DUVA 1MW1A 1OGBA 3WD0A 4Q7NA 4HPGA 4AZGA 1FOBA 2XVLA 1DWJM 4PMOA 3I3EA 3PZMA 3CTTA 1H5VA 1HNYA 1CGYA 2CBUA 3CHDA 2CXGA 4RL3A 3MI6A 2JEQA 5ABFA 2O92A 1SFSA 1PIGA 5C8BB 3L2MA 1JFXA 1WZLA 2VRKA 1R7AA 2WWCA 3W81A 4YPJA 3F4VA 3ZR6A 3UG4A 1BYBA 3WH6A 4AD0A 1EO5A 3E1F1 4DWSC 2VR5A 1QHPA 3AZTA 2WMKA 3GXMA 2WWDA 3D51A 1FH8A 3A24A 3W53A 1UKSA 3QOMA 4Q22A 5A2AA 5E0CA 3LXBA 1CECA 1EXPA 5BXSA 3BAJA 3W82A 5DT5A 4JL2A 2W62A 4WKFA 3S6TA 1ZS2A 2WCSA 2CIPA 4B3KA 1B2YA 1VBUA 1QI5A 1E15A 2CBJA 3FAXA 4S3JA 3VSTA 4PCSA 3BSGA 1JD9A 2J79A 1BG4A 3VM7A 4RE4A 4XZWA 1GVYA 1AVAA 2VL4A 1LQ0A 3RJYA 1GHSA 1BLIA 3WDIA 3WBEA 1YQ2A 1JG9A 1W2PA 2AAAA 3EDJA 1NP2A 1VBRA 3DX4A 2EPMX 5M17A 4AY1A 5IFPA 2WYSA 2EACA 3THCA 3GXTA 3DECA 4M56A 3T0DA 1ISXA 2VZUA 3DX0A 1V3MA 3NSXA 2VX7A 6CGTA 1EDTA 1UWUA 1JIBA 2F8QA 3SCQA 1CZ1A 2CPUA 3KLLA 5BXRA 2WB5A 3SIMA 1CXFA 1G0CA 3AJ7A 2Y24A 1GONA 4HZ8A 4UOJA 1Y7VA 1JD7A 1PPIA 3BAWA 5BWFA 3BLBA 4DWSD 3UG3A 3ALFA 5LA0A 5I6SA 3A5VA 1O7AA 3AIWA 1C93A 4H8VA 2OW6A 1RP8A 2D3LA 1B3WA 3S5YA 2VZVA 4JKLA 3PZGA 1CTNA 3FHQA 4J28A 2EEXA 3A22A 1V6UA 2D0GA 2A3HA 3WKZA 4NI3A 4AZ5A 2W4XA 5KZ6A 4M82A 1JYWA 3ARTA 1HJUA 1B3VA 3WQ5A 3PZ9A 1E1EA 3B9EA 1HL8A 2YDRA 1MVYA 2E9BA 2IXVA 3AS3A 2DT0A 4CN1A 2CKRA 3K1DA 4UNIA 3WNLA 1E40A 1R7OA 4P7QA 1V3LA 3ZOAA 1L8NA 2F7PA 3MO4A 2ZX6A 2XHYA 3BVUA 4HMEA 3VIGA 2FGZA 2BV9A 1QW8A 1XYFA 4AWEA 3GH4A 2GSJA 3QHMA 4FLRA 3VNYA 1GPFA 4FLSA 1KGXA 3GH5A 2B31A 5FCZA 1G1YA 4FNQA 4F79A 3HZ3A 4DO4A 3VDCA 1BYDA 3N9KA 4V27A 1GJWA 1UR8A 2CHOA 2G3MA 2F1AA 4PBGA 1E1FA 3WEOA 4PMYA 3A4XA 2OSWA 1ISVA 1K9EA 3A6OA 1X6LA 3NYDA 1T0OA 3VIOA 4M80A 2PWDA 3DHPA 1CWYA 2J7GA 4MJ2A 3WUEA 1WDQA 4N0RA 2F7RA 3W25A 3VPLA 3WQWA 3EDFA 3VIHA 1HKIA 3HJEA 1VRXA 3BVWA 1O6IA 5I79A 1OT1A 2NW0A 3BUQA 2A3AA 3IK2A 2WBGA 3MMDA 1VFMA 3UEQA 1GQKA 3D3AA 3RPMA 2J7BA 3BVVA 4P8VA 2JEPA 3SCSA 2D3NA 1FH7A 3EBVA 3VINA 1I1XA 4ATLA 4EAMA 3AQUA 2J47A 4GZIA 4X0NA 3VIKA 2ZXQA 3WH7A 4NZJA 3BLKA 2ZXAA 4KMQA 1LWJA 1ZB5A 5DF0A 3DYMA 4TTUA 1E9LA 1GZJA 2J7DA 2JF7A 4MADA 1NOFA 2FH6A 3OLDA 4AD3A 3PZOA 4QCFA 4P7OA 4KRTA 4UFHA 3QGVA 1QI0A 1HX0A 3WMCA 3VILA 4GZEA 2EADA 4J3WA 4H04A 4LYPA 3ARQA 1UD3A 3ARUA 3APGA 2OLHA 3VUPA 1G01A 5CLTA 4JKMA 3K8LA 3AIVA 3GH7A 2W92A 4UQBA 4PMQA 9CGTA 5JBFA 4FNUA 4U5KA 4BQ2A 3W6MA 3LXAA 2YBUA 3AS1A 2WM0A 5KEZA 1CENA 1UR0A 1QHZA 1QBAA 2XN1A 4ACZB 3THDA 1QVBA 2VMFA 3QR3A 1ODZA 2FHFA 4R5EA 2XN2A 1Q6FA 1MWOA 1UR2A 1VFFA 5FD0A 1EGZA 3GXIA 4MJ4A 1QI2A 2BVDA 3CZEA 1RPKA 3WD4A 1VFUA 1UHVA 1BF2A 1ZJBA 3RO8A 1NWUA 3N17A 3MV01 2WHKA 3CHCA 3WSUA 1J01A 1K9TA 4PRWA 4HP5A 2WK2A 1WZMA 1CGVA 1UKQA 3EJPA 2ZE0A 2DPEA 4OIFA 2DEPA 2MANA 2G3IA 2V5DA 6A3HA 3AS2A 4HOWA 3AS0A 1B90A 5HPCA 3L2LA 4CVUA 2CHNA 1GOOA 1HWWA 3WQVA 4GI8A 1KCLA 4UFLA 3AHYA 4ACZA 2D2OA 1RP9A 3CGTA 3S5ZA 2J25A 2CITA 2DSZA 5CGTA 3KL5A 2WMFA 4D6JA 5CGMA 4HTYA 1UQZA 1UH2A 1V3HA 4CD7A 1GOIA 2VT0A 1E73M 5A2BA 2RGMA 4FLOA 3MMWA 1P6WA 1CLXA 1GQIA 1NOWA 2EAEA 3CZLA 4W93A 1HJWA 1IV8A 5A6LA 1XH1A 3N04A 5HPOA 2IXUA 1XSIA 5HXMA 1NWTA 4GIAA 3RM4A 1HT6A 3A4AA 3AYSA 2ZIDA 2J8FA 3VMOA 1FP8A 4MDPA 3K4DA 1TE1A 3EYPA 1R85A 4FMVA 5I77A 1VAHA 2CEQA 3MKKA 3FY1A 1C90A 4FK9A 4Z2IA 2PWEA 3T2OA 1V08A 2J7HA 3EMZA 1DTUA 4R27A 4D1JA 2JE8A 3O9NA 4PTWA 5CPTA 2JALA 3POHA 1OIFA 1E6ZA 2Y5EA 3GXPA 3AISA 3WF3A 1R33A 3HN3A 1FHLA 3KLKA 4W8BA 1E4IA 3ZJ6A 1VFOA 1W9BM 1FFQA 2ZOXA 3TA9A 4TUFA 4W5ZA 1B3YA 3L4TA 2CKSA 1QWUA 3ZT6A 3M6DA 2XFRA 1W1VA 1I1WA 4TXEA 4UQDA 3LRMA 2TAAA 3AYRA 2X09A 2DH3A 2Y2WA 3QHNA 1E0XA 1F4AA 2J77A 2CCRA 3M7SA 2CERA 4AXNA 1W9PA 1LG1A 2A3CA 3SUUA 2DSWA 1WNOA 4CU8A 1E4NA 3GM8A 2IUZA 2YOCA 3AXHA 4WF7A 2WMHA 1VF8A 1PIFA 3K46A 5M03A 3WH5A 4LX4A 4HA3A 2V3GA 2XYLA 4J3TA 3AMKA 4W5UA 4S3KA 3W0KA 2J7FA 5A1AA 3ARXA 1R8LA 2JFEX 1US3A 1DEDA 1SZNA 1I75A 1UR9A 3BC9A 2WC7A 4V2XA 3HG5A 4A3YA 2W67A 3F5LA 3VMPA 3WUBA 3PZIA 1EDGA 3GXNA 1WP6A 4JFSA 4NXKA 1DWHM 1J11A 1HVXA 1PJ9A 1KWKA 3WL0A 1B3ZA 3PTQA 4L4PA 3M46A 4N42A 2YBTA 3CC1A 2GJXB 3M07A 4DWSA 2JIEA 3NCOA 4DM1A 5BXTA 1H1NA 3HMCA 4OOUA 1C7TA 1KXHA 2O9TA 2BS9A 3FHAA 1TVPA 1GHRA 2DSKA 5FOOA 3VGEA 1J0HA 1V0NA 4D1IA 1ZJAA 3L4ZA 5CSYA 2WMGA 1PBGA 3GXDA 4HA1A 1WDRA 1BAGA 4W87A 3RCNA 4TVCA 3ARRA 1QPKA 1CBGA 3T2PA 5A94A 1BQCA 3ARVA 1GW1A 4JHOA 3RJXA 2EBNA 2PWFA 3BSHA 5DT7A 3AIQA 1CLVA 2ZX8A 2E9MA 4Y7EA 3RDKA 5E9AA 1NARA 4A4AA 3OGRA 1JI1A 2GVYA 1HIZA 2XM2A 1W9UA 3MSGA 4J3VA 4X9YA 4GO8A 4OKDA 4WKHA 4AZ6A 3NIYA 2XGBA 4MAVA 1UYQA 2XWDA 1LL7A 3KL0A 3A47A 1MW2A 2FGLA 4UZUA 3AHZA 4MDOA 2VX6A 2ALWA 3CUGA 1GQLA 3MMUA 1UR1A 4P8XA 3G6LA 1JAEA 3WD1A 4AYSA 3BAXA 1KXVA 5HDRA 3ARYA 1E6SM 3WDPP 3IANA 3BAYA 3FW6A 2X8RA 2UY2A 3VIIA 1US2A 2OSXA 2PWHA 1XH2A 2WLYA 3CUIA 1MYRA 4W89A 1GCYA 1H41A 5I24A 3ZMRA 4MTVA 4B3LA 4PMNA 1BTCA 2V3DA 4MB5A 2XGIA 4CU6A 1GQJA 2FHCA 5LA1A 5BROA 3T0BA 2QPUA 2J7EA 1BFNA 3JUGA 3VSUA 2EPNA 5M5DA 1WZKA 2V38A 1UASA 3VGGA 3ZJ8A 1C91A 4PUEA 1GUVA 1AQHA 4IPLA 3W26A 1XD1A 4PMZA 3VOCA 5D8ZA 4UFIA 1GNXA 1VJSA 3MUY1 3W6LA 2XTKA 1LLOA 4M1RA 1ITXA 1QNPA 5JIPA 1U33A 2X2JA 5D9NA 4W7WA 3VNZA 3WD2A 2F2HA 1TZ7A 3AIUA 4PTXA 1MQRA 1E4MM 1M53A 3VSVA 3NSMA 2YDSA 4PYSA 1EIBA 3HG2A 4LXFA 5A69A 3CHFA 4AMXA 3OG2A 1ITCA 2J7CA 4NSBA 5FL0A 3TTQA 2VOTA 3CUFA 2YLAA 1TFVA 1B9ZA 3POCA 3BVTA 4PSPA 1B3XA 4ZENA 3SCNA 2CBIA 2XM1A 2C8NA 2JIWA 2WW5A 1F4HA 4M29A 3MV11 2G8ZA 2ZUMA 4GQQA 1KB3A 2YL8A 1SMAA 4HZ7A 2BY1A 2DSVA 3D5HA 4PMUA 3K4AA 1JGIA 2EXOA 1HJQA 1QOXA 4AZHA 1E6RA 2EJ1A 1A3HA 2VI0A 3U7VA 4JFUA 4BQ4A 4IM4A 1UKOA 4D6HA 5CZKA 2O9RA 4QFUA 2XN0A 3MU7A 3RIKA 1W91A 1HJXA 1PX8A 4D6IA 1ZBCA 2V3FA 4HMCA 1WPCA 1KFWA 2FDMA 3PBGA 1Q6CA 2ZICA 3GNPA 2J8GA 1E0VA 1V3JA 5IHRA 2JF6A 4HZ6A 1XV8A 2W61A 5BYWA 1QW9A 2BHZA 5ABGA 1TUXA 1BGGA 4M8UA 4D6EA 3LPOA 3W24A 1KTBA 2X1IA 1TQWA 1JZ5A 3AMLA 1WO2A 1J0KA 4AZ7A 3CUHA 1TQVA 4DUXA 1UR4A 5A6SA 5E6YA 4ZFMA 3DHUA 2X2YA 3HG4A 4NZFA 3GTNA 4ZE4A 1UD5A 3ARWA 1BYAA 4WJXA 3OGVA 4JCMA 1D2KA 1LL4A 5D9OA 1PX4A 1TVNA 4JHZA 5ECUA 4WSJA 2PC8A 1IZKA 4W88A 3OBAA 4QCEA 2O9OA 4ZXOA 2WC4A 5A3HA 3UCQA 3WH8A 2WSKA 1B1YA 1M7XA 2W91A 1FH9A 3AROA 3PZUA 1BVNP 2OYLA 3WMBA 2WKGA 3I3DA 3O2LA 4ZXLA 3WFLA 2YL5A 3T2QA 4IPNB 3KWXA 1CNVA 1QHOA 5E6ZA 2OYKA 5CQ1A 1CIUA 2PF0A 1WKYA 2VVSA 3LX9A 4EKJA 1M03A 1B0IA 2D0FA 1E4LA 4AD4A 5DFAA 2X2IA 3D52A 2OW7A 4FNRA 2G4FA 4W86A 3RM8A 1HKMA 1WB0A 1HTYA 2PB1A
chains in the Genus database with same CATH superfamily
3CN2A 3V4VL 4QO1B 3C2SA 3CWNA 4YVXA 3MREA 4P5KA 3DZ1A 4LS0A 1D5MA 3E9UA 5JIHA 3EJUA 4MX7A 1V54B 4XNAA 4ZS6C 4BFJA 3RG1C 2O4QA 4K9JA 3KPRA 5AG9A 1AKJB 2VQ1B 2VC2L 3GLAA 3AIRA 3O0FA 4C6KA 4O8AA 3FKUS 4I48A 3DO3A 2F74A 3PAUA 1GY2A 1FE8L 4PJDA 1XGYL 4G6FB 4ELME 2HPIA 3UTSD 3NDZA 4IMLA 1E27B 1TELA 1L9MA 1XF4B 4F8PA 2FIQA 3FEQA 3VU2A 5EU9A 4NQXB 3VFMA 2VFIA 1FH5L 1HKFA 4YZFF 5D2LF 2A99A 5T1MB 4BFRA 4Q6YA 4RBPH 1SOKA 5EU5B 2EEDA 4EANA 4JTRA 2XVKA 3C2YA 2OZNA 4GXPA 2D31B 1N26A 1BAFH 1WGVA 1NQ6A 1TZGH 2F7QA 3TH6A 3V4PB 1TJRA 2VUYA 2EC9T 4WNQB 1PLBA 3D87B 3TE9A 1FP5A 4CN6A 2W66A 3P2BA 1Q1PA 2CIIB 2LU7A 3FT3B 4MCZB 3M88A 1M6JA 1RY0A 4JTDA 3N3TA 5F8RC 1XIEA 1HL4A 1P1ZA 4L1HA 5HYSB 3TV3L 3WFBH 3M5VA 1Q0EA 4KI5C 5FO7A 3TCXA 2R56L 4JO3H 2HTLD 5I1HH 2HUEA 3O4LB 1CK0H 3DJ9A 2I57A 5I3KA 3UERA 4A05A 5A8PA 3GMMB 4NEHB 2WLIA 1NEZG 1NH6A 2IDFA 1XD0A 3NZHL 2RJGA 3RG6A 4EZLA 5TGBA 1ZXKA 3G6DL 4XXWC 3WLSA 4OI8A 1KF9B 2EG8A 4OLYL 5MENA 1QR1B 3OZPA 4YXLH 3FQXB 4BKSC 1JAKA 2C3GA 1JDDA 4GQGA 4O2CA 5IKCB 2DJUA 2NNAB 3E2HB 3M17B 4PV8B 2FQEA 4X4MA 1WIUA 2LVEA 4UYQA 4XO8A 1RUAL 4HJUA 4FXGC 1MMFA 4XD4A 5AYZA 4JRYA 1F7BA 4TUJA 5BRQA 3TNMA 2D4FA 1H15B 2GYSA 4NZ1A 3NN8A 2MEJB 3WD5H 1ROCA 1GKPA 4PGBA 1TR7A 4F8QA 1S7VA 2DIAA 3OVGA 2YKKA 1DTNA 3V5FA 3ZM8A 2IXQA 3ECQA 4G2AA 1TJGL 1B30A 3SPIA 3WMQA 3SYCA 4M8RA 1SM9A 5FKYA 2DQHH 5E4EC 4ZZFA 4I0PD 4PRDA 4M7LL 2A3LA 3GB6A 4WI6A 3OSVA 3IYLW 5HWMA 4BELD 5DHVA 3UABA 3V0WH 1OCWH 1H1ZA 5F7YC 1CFMA 3GMPA 3WNMA 4GMEA 3D69B 3DV6B 5IUCA 2OYMA 1YDYA 1IAOA 1NGZB 3F00A 3SYPA 3ZDYF 2HVNA 2O4EA 2VXVH 3GIPA 2I5GA 5LKYA 3UESA 2VGIA 5IHSA 2C3VB 5L0QC 3BOXA 3B6SA 4ACPA 3TC6A 3OX8B 2V3EA 4NPKA 2VFDA 1IT0A 2OZ4L 3MV7D 3H2AA 3VFGL 1NP0A 2C4FT 2Y85A 3INOA 2DQGL 1ES0A 4XHJD 2WQ8A 2R2EB 5D1XC 3S6CA 4IFOA 3VIFA 4WXYA 5I1JH 4L4TA 4MQTB 4RGNE 2EUZA 4JFQA 1SJVA 1UEMA 5AEAA 2J88H 3PWPB 3FOLA 4FRWA 1WIPA 2UZPA 3CFUA 5D2NC 3T71A 5LAPA 4NU7A 5D4YA 5EGRA 3QWOB 5H91A 4DGIL 4LUJA 1U8JA 1JHTB 2PZ0A 3SURA 2PF8A 4V15A 1VEPA 4M7ZB 2A6DA 4Y5VA 4PJIA 1KLGA 2X1XR 4PGCA 4A7SA 8PAZA 3A4JA 4OQTA 2Z4TA 2JJSC 3F2BA 1RL1A 1U3NA 4KMTL 5IVNA 4P4RB 1H7XA 4S1RH 1WXJA 3OMAB 5F1IA 3UAEA 2E4TA 3UY8A 5JXED 4UTAA 5FECB 5CNHA 2OULB 2A9DA 1OM9A 3HGSA 2A3TA 2O6FA 4RMUA 4U4MA 4OD1L 4A35A 1Q0XH 1NLDL 1MIEH 3BXNB 4PEEA 1IBDA 2EVIA 4MPKA 4B2DA 1U8QA 2NY0B 2VMEA 1R2RA 5J13B 2X0YA 5IQMA 1V6YA 2PDIA 4NL1A 4XOEA 2WVTA 3IV8A 5F9OH 1JTTA 1MW3A 4CQ9A 1O5DT 4KTDH 2HK1A 4KY2A 3FO2B 3U48A 2YA1A 4PBVC 1LT8A 1JI2A 2GB2A 3E8UH 3F6IA 1VD6A 1XICA 2ZKYA 2AXHA 2VCOA 3NPZB 4NKIL 4GINA 1CICB 1H3TA 2P24B 1NAMH 1UJTA 5FYJE 3EA1A 1DYZA 4HIJB 4O2FB 4TXVB 4Q9RL 5EORL 1G6CA 1UZ1A 4RUBA 5C86A 5I75C 2DN7A 1EV2E 2J1KA 3MODH 4I9JA 1PS3A 1KGWA 4IPJA 3GBNL 1FCQA 4XUYA 5GVJA 2OCJA 3TEXA 5KYWA 5D70L 4ZXBB 1BAFL 4OZOA 1SNRA 1Q9OB 3NCCB 2B3RA 2EIZB 4P46B 4U1MB 4KXZI 4E9VA 4JFVA 4GGHA 5KITA 5DRXB 3U2IA 2OKMA 1GZ1A 2VEGA 2J5WA 1LTDA 5CJ5A 2QKFA 4AWTA 3IMBA 3BQUB 4E9RA 5FJIA 2WPGA 1Z44A 2WBJC 1TJIL 1FL5A 3V0VA 4MJIB 5I6LA 3HJ0A 3TV3H 3WFBL 1KM6A 3CL6A 5E7FA 2XVGA 3KWWB 3AZSA 2H32H 4QS5A 4B2DD 1IWBA 2Q7AA 1X6NA 1BQHG 3KVDD 5LUMA 3AGVA 1K8YA 3MKVA 4NVTA 5BRZE 1Q9WA 2WAQA 3PV6B 2HPTA 3RWIA 3QB7C 3SCMB 3MLUH 4GAFB 3WS6C 1FORL 2F1EA 3IDNB 5H35A 1TX0A 5FUCE 5A3IC 4E9YA 3RU8X 2NTFA 2Z7ZA 4Y89A 4GRLC 5HDBF 5AWNH 1B0GB 3AZRA 3CUXA 3LRSB 3DFHA 1CF8L 1XLMA 3FFOA 3W73A 4CBZA 2LU5A 3UIYA 1U42A 2PR4L 3EF7A 5MKGB 4UR7A 5F7LB 3L2NA 3GSRA 1R3KA 5F3HB 4EUPA 5J11B 3APYA 3PTKA 2ZKHH 5I26A 1UFGA 2FEDD 3VXOA 3S8WA 1P6CA 2QLVB 1OBAA 5IOKA 3KXQA 4OJFH 4WWKD 2FT8A 1JPGB 2J12B 3O45A 3U36A 3J7HA 3KLHD 1TJGH 6ALDA 2P28B 5LQBL 2Q20A 4WUKL 5CU5A 5TQ2H 5DJCA 3UTPE 3WSQL 3SKJL 2ZNWA 1FCGA 4M7LH 5FDWB 3QQ0A 1BFOB 1KLZA 4M6UA 4XBGB 1LWRA 4XGZB 5EKYA 5K1JA 1IEHA 3T3PB 2B0MA 4TVSa 3O3EB 4A2SA 1JGEA 1IBHA 1N0XH 4Z7UE 4GKLA 3N15A 3RWDB 3CLFL 3I85A 2A9ML 4L1SA 4QRSB 5DC4B 5J6HB 5B80A 2AQ3A 3IGUA 1CI5A 5AYYA 1EYEA 4OD3L 2G41A 3V5OA 4XVOA 1PCXA 3RMEA 1T7WA 2P5WD 3U9UA 5IREA 3WQ8A 3UAJD 3MO1A 3DYPA 2ENSA 5IW1A 4QYAA 4UUJB 4JDEB 1ADSA 2VJXA 5LNUA 5BZDB 3AIEA 5K93A 3VXPB 1PWLA 2R29H 3UZVA 1SEQH 2EH8H 5E08H 1ZT1B 3KZ8A 2ZP0T 2PDWA 4R34A 1EO8L 3KM2A 1IVLA 1XPGA 4K8EA 4XCNA 2GGHA 2E7CA 4B97A 3IJ8A 4CSSA 2F61A 4JANA 5C0GB 2MNRA 5HJXA 4MG4A 3MLXL 3L4YA 5JXEA 2APXA 3A4EA 5EA0L 2BNJA 5JW3H 1AJ2A 2IANE 1VENA 1JPGA 2E7LC 2VO5A 4GUPB 5KJRL 1KD0A 1ETZA 5H94A 1H3PL 1QPNA 5EU6E 4AZIA 4C6MA 4NDMA 4PUKA 5E00B 4U2YA 2GTZB 4F8XA 2NXZD 2XQYA 4HN8A 2NY6D 1E72M 4KI5F 4PV9B 2Y7QA 2YD4A 2EVHA 2D31A 3FTYA 1EJFA 1DOSA 1DKWA 1NM9A 4XC1L 1OW0A 1B3OA 1YEYA 3KZPA 1ORSA 4J3UA 4B15A 4DY1A 5EHFA 2W81C 2GSMB 2H4EA 4D0DB 3VW3H 4AIEA 2VLKD 3T6VA 1OFOA 3Q1SL 2AQWA 1EAJA 4JBRA 4DWSB 3TAKA 1SU5A 4D6FA 3K0YA 3E5BA 3X11B 1CEOA 4ZODA 4QE4A 1OGAE 1QWNA 4MNGA 4Y2OA 3WGUB 2QCNA 4PR4A 1RZIB 3QEQA 3BP7B 3W2KA 3CU2A 3CFKA 2L7QA 2MCPH 4H7VA 3ZQXA 3NQIA 4AWUA 4AEEA 4E41B 4Y88A 3E3QE 2OO0A 3PGCB 1JV5B 1YMMA 3T40A 2ZCKH 3KCLA 3MSDA 4JIIX 3CQPA 3D3VD 4M5ZL 4DF9A 5JQ6L 1A3XA 2TYSA 1UWYA 1A21A 2ADJA 3NGBB 2X4NA 1VGKB 3GXFA 4RLIA 3EJRA 1ZBKA 4DJEA 4Z2LA 2F1BA 1W0VB 5E4IA 3NSFA 4G1KA 1FQ9C 4JFPA 4NO5B 3DFNA 4O2CB 2BRQA 4WLCA 5IKCA 3CFEB 3GVGA 3TU9A 1V02E 1FNEB 1LLZA 2NOYA 3QMTA 4KESA 4YVNA 5E56A 3I3BA 5AB1A 3TXAA 1TJIH 4NI6A 5ALBH 1VDGA 1G1CA 3Q8AA 1FL6A 5DVMA 3IVSA 2JKEA 4OFIA 3MPGA 3VGFA 3QUXB 5I1HL 1D6VH 2LABA 3N50A 3GMOA 3P0GB 3W5MA 5EC2B 4JY6A 1UD6A 4I13B 4BZYA 4Z7UA 5T1JA 2BHFA 3NZ8A 3D6NA 5H2ZA 3OOQA 1A4CA 2YD6A 3DGGB 1EF3A 5BOJA 2DDQH 3QXVA 1MPAL 1CF8H 3CBKB 3BSZL 3Q2CA 4OM0L 4PBDA 5FGRA 1EC8A 2OEMA 2QJJA 3UADA 4HIBA 4IQJA 4HXBL 1IAIL 2BIIA 2PR4H 3VIPA 1WC7B 2J8TA 5ACMA 3Q05A 4GQZA 3DX2A 4HCRL 4JFOB 4DZIA 4CU7A 1RULH 3BH4A 1XGUA 3DROA 4FX5A 4TRPH 4ZB5A 1DQTA 5EIIB 2VHLA 3CZUB 3H9SD 1WVZA 5HVGB 1D7KA 2EDQA 2ANUA 3HPJB 4DAFA 1BZ8A 2CM6A 3LZRA 1OIMA 1HOCB 1SGKA 3QPXH 5JIWA 3H2OA 4P7NA 1GW0A 1YBQA 5FA4A 4ZFGH 5DMJB 2B39A 3V0IA 2J1YA 3BZJA 1TQCB 1SO6A 4QRUB 3BEWB 3RL2B 2P8PA 4IGBB 4RJEA 1AY1H 3I84A 5I66B 5KVMC 4MJIA 3S3JA 1CDGA 4BFBD 3BXWA 3W1NA 1N6QH 3ASNB 2YDQA 3AWNA 3WUFA 1G4MA 3BAKA 3SQOL 4XPAH 5ISZD 4KROC 1ZU8A 3NTCH 3ZWSA 1L3WA 2VXSH 5I6OA 5EH1A 1X7QB 5C0AA 3FU9A 1DJQA 2ZXBA 4UIMA 4GRSA 5DWPA 5BXPA 3QWQB 1CFVH 1NFDF 4NQDB 4E9SA 1VJIA 3RLHA 3Q5YA 4IRZA 5IMLA 4XBPB 5SWSD 4V28A 4PJAA 1ADOA 2QQLL 2EE6A 4IRSD 3GSNA 2FPYA 4PWHA 1XS2A 1S7VB 1NCWL 3AACA 5FYKE 3IVTA 4JTIA 4TQHA 1G4TA 3GW0A 4F27A 5BVJA 2F54D 2DZUA 4Q52A 3USBA 2FJUB 1OD0A 3QPEA 3OM3B 3OLIA 4LYPA 3TYCA 2PP1A 2J4WL 3DSNA 1J10A 1E9QB 1F8TH 3DROB 3FF7A 4LLVB 4OM1H 3SDYL 1TYJA 3MLXH 5IFJA 2H3NB 3WY4A 3CPLB 2VR4A 5GNXA 1BM7A 2AJSL 3MRRB 2IANB 4KMLB 5HJLA 3IARA 2F0CA 2H8PA 2GOKA 2UYLA 1FCVA 2XN9D 4QAWA 5C0BB 2QDHA 4NZRL 12E8L 1CICA 5ENLA 4F40A 3B8WA 2IKJA 2A9BA 2SFPA 3KPTA 1NC2A 4CD8A 2HJKA 1KB5H 2Y5JA 1T1WA 3QI9A 1NFGA 4X7TB 2PP7A 5F2GA 5IM7A 3AG3B 4W4NA 3DAQA 1FAIH 4W8LA 1UCTA 1YY9D 4B5ZA 1DBAH 3O6YX 2Y8UA 3KW7A 2PF6A 1W3LA 2J6VA 5FF7A 4L4VB 4FQ2L 1Q9OA 4DGWC 5HNTA 3GG0A 3F3HA 1WA0X 3S37L 1GVEA 3HE6A 3DG7A 1KKRA 1KDIA 3EO9L 4X4XB 1CMOA 1XKJA 2P0OA 4H5SA 4ATTA 4Z2JA 1JDAA 1BG1A 5DQJB 4PJ5D 2WVVB 1Z48A 1E67A 1AJ7L 1TEYA 1OSEA 2IWEA 1JPKA 3K5XA 4DNMA 1VEMA 4GAGL 1HH9A 1TV3A 2GFBB 1O95A 5JBEA 2IQAB 5C07E 4LY4A 1KELH 3DX3A 3HBZA 2VNCA 5T1KA 4LGXA 3MW7A 2A6DB 1Y0LA 2XETA 2FHBA 4Y5VB 5AL8A 3VGBA 1K3IA 5SX5H 1A3ZA 1PSKH 4CVZB 4YTQA 4LHUG 4A3RA 3TOPA 1HI6A 1T7ZA 3FT4A 3HQPA 1P69B 5D9SA 2B1AH 3O6FB 4MXVE 3UOAB 3WMLA 4F0LA 1YAZA 1TTCA 3VI2A 1MRDH 2QHRL 4DGYH 5HR6A 4AZCA 4X2PA 3EKCA 4GIYA 1Q38A 2CBMA 4HZMA 2DJ4A 4X80H 4C7GA 1L6ZA 4OIIL 5AKTA 1V4YA 2Z65C 5DFWH 4HW6A 5ACZA 3G08A 3A6BH 1P5UC 1FVEA 2BSED 5REQA 3WIAA 3N1AA 5A6IA 2VURA 2P5EB 4DAGL 3W7OA 3TYFA 4KGLA 3PWGA 5BU6A 1VPOH 1P4CA 4BEQA 1LVEA 3MI3A 1U91A 1IBZA 2A0LC 4YVVA 2DDQL 2Q76B 3FQUA 3FUFA 5FLUA 2XBZA 1FLRH 3WNPA 4JLRB 2Y8VA 3G24A 3FFDB 5DJ6A 3R0MA 1TPXC 1EJ8A 2HVMA 3PZNA 2WAGA 2W0LA 3ES6A 4JPVH 4QQ3A 4D71A 5A6AA 3L3IB 4BQBA 4E5XA 3SCOA 5HMFA 4JKKA 2RALA 3MCLL 3KPNA 5FGCE 4HFWA 1MFVA 3IPBA 4CVXA 4I2XB 2D24A 5B39A 3WBXA 4YSPA 3BPNC 3O2WH 2VERN 4JDBA 1A4JA 3DJRA 5CO1A 3ZUNC 1YMME 3CZJA 3EKZA 1I4NA 2WKLA 2VMCA 1Q66A 2ICSA 1KM1A 1K5WA 2EVJA 4EACA 4L4VD 1F6PA 3VXUB 2QF8A 3FB5B 2VZSA 2ISSA 2WLJA 4G9FA 5D9SB 4WSHA 1SJXA 3VXQB 3RTQA 3DC8A 2J21A 3L3HA 3G0UA 4LLQA 3I50L 5DC9B 3NYKA 5IOPA 3CFQA 1AY1L 1OT2A 1UUQA 3QNZB 4JFHE 5EN3A 3QY7A 2X4RB 4HAKA 4BHYA 4GG6F 3APTA 1T6MA 1SXSA 1T83A 5CILL 2G3NA 1MJUL 5SX4I 3APDA 4MA8L 4JQ1A 1KR0A 4UT6A 1THCA 1XXDC 2VM4A 1WJ3A 1E6OH 2VXSL 4PJ7F 3KYKH 4RRPG 4GBUA 2QAFA 2D20A 1ADWA 5AC8A 3RWJA 4W70A 4ADGA 5IFJB 1SZRA 3BL3A 1PVHA 4N4YB 5DJXB 2NCEA 2NR6C 4HHWA 2XY1A 1RCQA 3NJJA 1TWSA 4PJ5E 1NBZB 1CN4A 4YFEA 3A23A 5IW6B 4LP8A 3EYUL 1VP5A 3TJ4A 3K71A 2P8MB 5AD0B 3FL7A 5B8CC 4FNLH 3W87A 2DQEL 2F6KA 4F7CA 4JTEA 3D4YA 1GGYA 1XT5A 4J3XA 3LV5A 3LNFA 2I60L 5AOZA 1IFHH 5FGSA 5T3XE 4NC1C 2CZ5A 4B96A 3ZE1F 1NTDA 1XF1A 5K9QI 3WF0A 2FEEI 5HGHA 1KNWA 4XVJH 4AIXA 4AM0B 5IBLD 3GHTA 4JMXA 1ALDA 4BK5A 3BJTA 3EUUA 2PS2A 1PTAA 3PF2A 2R0WL 4G1MB 3BGGA 3GB7A 3JTBA 5C0BE 3W2DH 4NZRH 3O3RA 3LSOA 3FXYA 2DIEA 4G9FB 4K2SA 5G4HC 1BOGA 4J5NA 5JW4N 5D03A 4F7MB 1EJUC 3SPCA 1DVTA 1QFWM 4RX4A 1VFBA 5GJSH 4WSKA 5BXFA 4LU5H 5CEXB 4GXFA 2LLEA 3W01A 3NXLA 4XBJA 4ONOA 4WHCA 4X6DE 4P3DA 1QW7A 3FPXA 1LJYA 1G6RB 2PUQT 4N6RA 3RWCB 3WK3A 4Y1TA 2YRLA 2OU4A 3NPSB 3UJTL 1D8WA 5LYRA 2DLTA 4C5YA 1NCCH 4LBAA 4NKDA 3SE8L 3U0PB 4TQEH 4CD5A 4PB0H 3J27A 1JK8B 3BPWA 1F1DA 3WFHB 1HL9A 4RK8A 3LEYL 4IOSA 2JKWA 4QTIL 4W9GC 1AO7A 1UWFA 2DL9A 3CIAA 3DARA 1G7MB 3BT2H 1ESWA 4FS9A 4H8UA 5KANI 4J3SA 2X2GA 3S5LG 4H88L 4YBQC 2BGNE 1KELL 1AR2A 4JRWA 5HYIA 2Y3AA 1IGIL 1YECH 4NO3B 2DSUA 2P0IA 1FVEB 4TNWF 4ZD3L 4JPIA 1PSKL 3R7QA 3OLGA 1L2QA 4LUIA 5HJBA 1ZV5A 4PTTB 4UANA 5FHAH 2AMXA 3MTWA 2AOSA 5CCGE 3ULVF 4ICCX 3N85H 4K3EL 5HHME 5J1TC 3A67H 1ENUA 2DWYA 4DGYL 1HXJA 5IK3B 1V8HA 1OX6A 4DAIA 2Z64C 1JNLH 1AD9B 2OXHA 1AGCB 1KBIA 3JUYA 4NJGA 3CX2A 5CD5D 3RPIA 5LJYH 5LXXA 3FSVA 3A5FA 3EJTA 2Q9OA 3TTEA 1XLBA 4PMVA 2WHMA 3LQAC 2WAHA 2BH0A 2WWKO 4EN3A 3CHEA 3RZCA 3A6BL 5DBTA 2EIKB 3CZNA 2OTUA 2VAAA 3FFCE 1OIOA 4HG4J 1W8OA 2H90A 4DAGH 1TTBA 2MKLC 2VENA 9RUBA 4O02L 2ZCGA 4I3SH 3MGOA 5HUPA 4KWWA 1IAMA 3CBWA 1OY3B 2ACUA 1NLBH 4JFXB 4K8RD 4TV3A 1T1XB 4XNQB 3T8MA 1PDYA 1XRFA 1FLRL 4NUGH 1DLHA 5DJDA 3BHBA 1T5XB 4ONHB 3MLZL 2H0JA 4JPVL 4K23L 4NZDA 4NGHH 3MCLH 1JDEA 1A6UH 2XXGA 1V3IA 3URNA 2X4NB 5IB5A 2V5TA 2C1HA 2DL2A 4HUMB 4US5A 2XOTA 4NP4H 5I00A 1KTCA 1GIGL 1V27A 3CFEA 4H3DA 4N6QA 4CCDA 1FG2A 2DM3A 2HWZH 3U7BA 1CDJA 3UJ2A 1UZ4A 5BO1L 5BS0A 3CQJA 4AZ8B 3BN9C 4DXVA 1NCNA 3WIFB 1GORA 3WCYA 2VLJB 3EPNA 3CSPA 4PCTA 1F41A 2AJYH 4XNUH 3UH8A 2G97A 2CSPA 4FE9A 1G7HB 5D93B 3OXSA 3VD9A 2IAND 4J7RA 4JFDB 2CHZA 1KCXA 5D8WA 2ZTBA 4LAJH 2CR0A 4MA8H 2AV7A 3IF1A 3QHOA 1NICA 1QBLL 3NSJA 1N8OE 1GMIA 1KN2L 1OTTC 5D96C 3C5JB 3VOGA 1SVCP 1N6UA 3TX4A 3S3CB 3CFDA 1JZ2A 1GXEA 3PK7A 3WFAA 1JF5A 5DVKA 3QPKA 1Q72L 3EH2A 4NIYE 4XCFL 3HM7A 1WC7A 3LMZA 3H9SA 2IFFL 4XNBA 4JX5A 3W28A 3IRSA 4S1SH 4XAWH 3BPCA 2EZ0C 2DQFA 4AD5A 5DT1L 1BM3L 3EG9A 1Q6LA 2VLKE 4FNLL 2DQEH 4AKQA 3STLA 3B5HA 3IJ6A 1T5XA 4HK5A 3L13A 4XX1E 4FC3E 4CEXC 1A1MA 2I60H 1IFHL 5AOLA 43C9B 4H41A 3VABA 3STGA 5A95A 4BSWB 4U6YA 3S2CA 2OTDA 1S2UA 2XWRA 2C7UB 1DBJL 5CF3A 2BXZA 1Q6GA 3LM7A 1JZJA 3VUAA 4DCQB 4UB0H 2N0KA 4N6FA 1NDMA 1UC4A 3WLTA 1E9ZB 2B59B 3GHEL 4I0PA 4N0YH 2PDPA 3K5SA 2ISFA 2J75A 3NL3A 2LE9A 5T5FL 1MSPA 2N4IA 1CT5A 2XA8H 1X5JA 4H8HA 3FPYA 2FB3A 5E5LA 1KCWA 3AHVA 1OZMA 2AJUH 3HC3H 1YNLL 1SJBA 4TQ8A 1WDPA 4L4OA 4N8CH 3MRMA 3SADA 1QO5A 4LW7A 5PCYA 2FJGA 3MUCA 2X1PA 5JZ7C 4APQA 2WZAA 1Z7JA 1XH3B 4KVCL 3AU1A 5HDOA 5GZNC 3TSDA 2KQNA 5DJ2A 5E95B 5IT2L 4PG9A 4Z8FH 3WF4A 1JXGA 4NN5C 4X4YB 4TO8A 3SY6A 3IDIB 3QDGA 3RUGB 3F7RA 3EYSL 3O3DB 1W5QA 1WKEA 2F5AL 4TVPL 3GIZH 4XVTH 1J2BA 1T5AA 1A4MA 5HR7A 3KPMA 4IBQA 1EQPA 5FEWA 3IJDA 4D72A 4ZFOB 4XKYB 3AXIA 1EHNA 2E0PA 1UWRA 1ZGLM 3PJXA 1DANU 3V0FA 3Q45A 2M26A 2ESVB 4RDBA 2GPTA 2KUTA 3HC4H 4N2EA 3A64A 1YECL 3EJZC 3L4CA 2YSSB 3Q8EA 4X6FB 4Z7WA 5CSUA 4GKOA 1SVDA 3PWAA 1J9SA 1C92A 1XGQA 4JRXD 3LCFA 1OHZA 5IQOA 3FSUA 1NQKA 4IG2B 1FCCA 4LQFH 3ZVHB 3H9HB 4U1GB 3G5YB 5I3DA 3TBVB 4ETQA 1DBTA 3ORJA 1UZ8B 3HB9A 1L0PA 4PGEB 3TW9A 1U0QA 3KCJA 2WYTA 4MJID 1VS1A 4MLSA 1VZIA 1LUCB 3NFNB 4S1DD 4ASTA 1PHQA 4Z3FA 3ZLGA 4Z1AA 3UXFA 2WXOA 1HGYA 5FSDC 4BQ9A 3QHZH 1XR9B 2H26A 3FS2A 2EDRA 4GABA 4GRWF 3N1GC 2BWDA 1LNUB 2EDWA 3WFCH 4BV1A 5FEZA 2YLHA 3V75A 5C08E 1RD6A 5D72H 3JWNE 1IMHC 3SQSA 4HPHA 4DELA 4JYDA 1ORQA 3S3SA 3VXRD 2D7NA 2RQ8A 3DTUB 3LENA 4AZ8A 3WG6A 4Z7NE 2SEBA 1NLBL 5AKSA 1AD0B 1BCIA 3LMJH 3VG9B 1NDWA 6REQB 2MPAL 4Z7QF 5EFIA 3SDCB 2B1OA 3UX9B 2CIKA 4E5XG 4MIMA 3KS0H 1WE5A 4N6EA 2K6ZA 3EH1A 4LCIH 3M9YA 3BSMA 4PLJC 3QV7A 4KKNA 4S3AA 5GNZA 5BRZD 5F7BA 4TL5A 5LNGA 2CLMA 3S2JA 4NQVA 3PDGA 1TEGA 2PPGA 4ZUTA 1UA6L 4EZMA 2ESVA 1BXXA 4KK8D 5DJXA 2EEFA 3SZ6A 2NY0D 3NRFA 3SCPA 1RUQL 1QRNB 4KX7A 5CJXA 3MOBL 4IFRA 5E0FA 2ISVA 3HTWA 5SWZD 1ROWA 3VXSA 1EFXA 1AGCA 3OAYH 2VLJE 4HPJA 4NIRA 4BKNA 4FZIA 3QQNA 4DLMA 4NHCL 5DD5L 4HPXA 4KDWA 4L1LA 4WO4B 4WHDA 5EU6A 3QG7H 1PO9A 3ATBA 1UWTA 3JTSA 4BQ3A 2CUMA 1TZHB 1MFUA 2QUTA 1A1MB 1QASA 1T4KB 2UUDH 4L0PB 3VE0A 1TPC1 1FO0B 1UH3A 3MNVB 4G59C 4R0LA 4QYOA 3RX3A 1LO0L 2YFOA 5L8JB 2R1XA 1R3SA 3CZKA 1IAKA 2BC4A 3DIDA 4AQLA 5AVSB 3WEBA 4DCQA 5ADOH 2XYCA 3RI5K 2Z0BA 4BRJA 2Z0IA 4KZEH 2ZFAA 2R6OA 1FHVA 1A1OA 1KPRB 1OP4A 4N2MA 4XZUA 2V69A 1AFSA 5C71A 4L64A 2XV3A 5CP3H 5GGQL 4FOKA 3BH8A 4TV5A 5E9XA 3PWPD 1OADA 3REQB 1BM3H 3BH9A 4NAEA 4K3DH 4PGBB 1ISYA 4YPGB 2HROA 4PRNA 4UQ2B 4JCLA 4B91A 2ZUVA 3FN3A 3MB9A 3D9AH 4S0SD 5FCUL 3LTVA 4M4PA 1HSAB 4BWWA 3ITTA 4JQ3A 4PN2A 1G7IB 3NSYA 2VJ8A 4UT9H 3VIJA 5MERA 2VCAA 3JRKA 3AT0A 3WEMA 2FB4H 2OGYA 1TTQA 2VWTA 4KGJA 2D3JA 4DX3A 5CC7A 4D9QD 3CVHH 2Y7LA 3L4UA 4WO0A 1QVOB 4QDPA 3BGAA 1AL8A 4H19A 4Y7OC 4FXRA 3FKRA 1NGZA 4KNTA 4RVBA 5CPLA 3WLBA 3HZVB 5DWUH 1CQKA 3EMQA 3N1FC 1G7HA 4AG4L 4F24A 2CO6B 5CGQA 1MHCA 4AD2A 1QLFA 3BOVA 4TVPD 1H63A 3MJ9H 3EUDA 4CADB 4M8QA 4MUZA 2ZWLT 4HETA 2EYRA 1ZCOA 2O5XL 2YBRB 3BGFB 4KVCH 2J66A 3RGHA 5DUJA 2XNAB 2DY3A 4Y1AE 4WO4C 5IT2H 1M5WA 3MLYH 4NT6B 4WTZA 3O16A 3T78A 4Z77A 1ONQB 2DLHA 5AALA 3TJIA 1P84K 2J9XA 4Z7VF 2X28A 2F5AH 4TVPH 3GIZL 1G4SA 2W0KA 3NIDB 2OMYB 4GNJA 3GVQA 3NFNA 1ZEAL 5LIUX 1E4WL 3O2VL 4B27A 1MXDA 3BOFA 2ALDA 3ZE0B 1OQOA 5JZ7D 2NY1D 1SJEA 1XIDA 2BODX 2A0NA 1BXVA 2CESA 2E9IA 1EO7A 3W2UA 2DZAA 3MGOB 4OGZA 1A66A 1TPH1 2BBFA 4AQAB 2CRIA 5JBDA 4JJOA 4ODVL 4A6GA 3LVTA 3K6DA 1J79A 3AICA 1J1OL 2FIRT 3BHBB 3EB2A 5E6IB 1REQA 2QVMA 2AAMA 4Q9BA 1BBDH 1V5JA 4LKCB 4XO3A 4A7UA 3L12A 1HFBA 4B95C 1ASOA 3ARDD 2JKXA 5CHNB 5FACA 1QPQA 3KRUA 1CZ8H 2F6UA 3C60C 4DXXA 2X0HA 3QHZL 2ASHA 3OPUA 3T0ED 1YPZF 1Y5WA 4FKEA 3DDGA 1V0KA 3SCVA 5I6MA 1KUMA 2RH9A 5E1GA 2X6AA 1QWHA 3BP4B 4L1DA 5FYJU 4EDXB 4DJDC 4MKTA 2VEFA 5HMSA 3LHUA 4QE5A 2P24A 4ZUUB 1VQTA 2PP0A 1R19A 5DUML 2Q02A 3LZ3A 4HNOA 4MJMA 1QT1A 3Q6GH 4JGMA 1GOQA 5I09A 1ONXA 1EFXB 1IC1A 1AQMA 3LMJL 4YL9A 4FNPA 3GRWL 4H25A 4RXFA 2YN3A 2XCMC 4UQ9A 1TZZA 3R79A 1PW3A 4K1WA 3WEXA 2FX9L 2BXYA 5DZJA 4AEHH 3W0WA 4AVKA 4LYQA 4AU0A 3TZVD 3RZCC 1EWEA 4I2XE 1FF5A 1J86A 1Q94B 5G2NA 2GUOA 4PEKA 4EKXA 1JCXA 3Q9PA 3ZW3A 4ADTA 2WMIA 3FONB 1KQYA 3WX7A 5CAKA 3KYOB 3QFDA 1DIDA 1SM3H 3VXME 5F7UA 1KIPB 2G60L 3WUWG 2YJLA 5E5MB 3Q2DA 1MWAH 2Y7OA 1H8NA 1WH0A 2E7DA 5DD1L 2CLPA 1M7DA 2W1NA 1J5TA 3P62A 3DIFA 5ANMA 5HPMB 4AB4A 5AZ2H 2P44B 4PJIB 4JNYA 4OZHA 1MCOH 4GQ9H 1I7RA 4PTNA 3QJAA 4V33A 1L9SA 3ELAT 4ZMXA 5JR1L 1AGFB 3ABXA 2GHWB 4WGHA 2XDHA 2F18A 3NNTA 4PP1D 2MWCA 3RKDD 2ICWI 1FBIL 2J1XA 3GSQA 6PAZA 2D22A 3OZOA 1N59A 2R27A 5HHOB 1AG6A 2YL9A 4QG6A 3TUUA 1CD8A 1CLOL 4NF7A 1YTKA 2VUOA 2QKIA 4J3OH 5C08A 2IH8A 4Y8DC 1J5SA 1O5QA 3KJ6L 3SDXA 5GGRY 3BARA 1HP4A 5F97E 2ICWB 5EU7C 2Z00A 4NYUA 3RDJA 1RH8A 3RWEB 2E5CA 3ZT5A 1DJSA 3F2CA 4HJSA 5I15H 4NWUL 5GNYA 3W7JA 1HOEA 3WUGA 5JTWA 2OMWB 4FL4C 3T4AA 5HGDB 3D9AL 3UJSA 4IDJH 2CAKA 4MJ6B 4Y2DA 1MXGA 3ESVF 1CDCA 1OEPA 3H7UA 3GO2A 3P30L 1VZGA 2PTUA 4AH7A 4ZSUA 1JCNA 4DUOA 4GX8A 3F04A 4KRPC 3FTWA 3CVBA 2CKNA 4BR1A 3FUIA 4OF8A 4HPGA 1MLCB 3KPMB 3DI0A 4XB7A 1DWJM 4PMOA 3CN4A 5BO0D 4HK3N 4IOFC 4C90A 2I27N 3LB0A 1U8NB 3KLAB 5DWUL 5EZJA 4PJEF 2CJUL 3WGVB 2CBUA 1CG9B 5AYUL 4RL3A 1A6VL 2C6QA 2PETA 3MBFA 1P5UA 1LOLA 1FI8C 5KYXB 2QT3A 2CKBA 2X6UA 3QEZA 4NX5A 1WQ5A 3N3EA 2IPTL 3FSOA 5FFOA 1CO1A 4HWUA 1R24B 1SFSA 3T2NH 5B8CB 1N5YH 4MY9A 4BFAA 4TKWA 1ECYA 4POZD 5D93C 3L2MA 3ROOA 2ZCHL 3OVRA 1VCVA 3X13A 1WZLA 2VRKA 5D2YA 4N8VB 3EFFB 4YDZA 3UG4A 5ITFA 4GRMA 1HO4A 2OSLA 3OJMB 4PREB 1OX4B 1VFSA 1NEYA 4EXQA 5L88L 1AZNA 1EO5A 1FFOA 4HWBL 2GSHA 4A8NA 2XQ0A 3IEAA 2IWKA 2PP9A 4H9MA 5C9JB 3DFQA 1IIIA 1YY8A 2JV6A 3IDGB 2WMKA 4HSHA 3P3YA 2YHGA 4WR3A 3WLMA 2IQ9L 1C5BH 5F1IB 1G9MC 3GTXA 4P9HC 4HIHA 3MCOA 4CMMA 1MAJA 1XTLA 25C8H 1EEYA 2SEBB 3D51A 3H9ZA 5I1IH 5A6TC 3HS0A 1OP5K 5IJBC 5DDHA 2JB5H 5E0CA 3GAKA 4XTIA 1EXPA 1HXYA 3JXAA 3P7YA 5BXSA 4GUCA 2N56A 1BFVL 1I3RA 4FMFA 3QORD 3V4UL 4Z3TA 5DT5A 3UTTD 3MYJB 4K94C 4BEUA 3T8XB 1K8IA 1ZS2A 2WCSA 1I6NA 1OHLA 3CEUA 3IMVA 3EXTA 4Y4FD 2EYRB 1A1NA 3TN3A 1QI5A 1GGIH 1ILUA 2CBJA 4WUUE 5FK9B 2OKTA 3FH8A 1BZDA 3PABB 4GG8B 3G1XA 1FFTB 1BG4A 3WLQA 1O9WA 1MNSA 4WVRA 2HRPH 3KYOA 2Y72A 3HB3C 3QFDB 4FTVA 3MV8E 4HLJA 4LF3B 4L2YA 3WUZA 2JF1A 1U3ZA 2C3VA 3BWUF 3UTSB 3HHRB 4RDQF 2OR2A 4Q33A 4XMPH 2VL4A 4NQCB 2F53D 2JMRA 2Z24A 3RJYA 3SQBA 1WT5A 3QY6A 3GRWH 3VI3E 4QRRA 1IEBA 1EKOA 3WBEA 2D69A 4LPYA 5AVUB 1F90H 4QHUA 1YQ2A 1J93A 1QPPA 1W2PA 1XLKA 4XAKE 2OMXA 3EDJA 1SOXA 5EPMA 1KXTB 4J4PC 2R8SH 1SW3A 3MRGA 4GI4A 4JQ2A 3KVQA 2BGSA 3V4LA 5IFPA 2EACA 4J12A 1S9YB 2R91A 1LUCA 4QG9A 5EEVA 3R10A 1WT5C 4M56A 4PN6A 1ISXA 2CJTA 4IK6A 4AXKA 1XBRA 1ZTMA 4QJ5B 1QR1A 4PYGA 3NSXA 2J44A 2IKHA 2BNQB 1CBJA 3QUXA 1KV3A 4FQQA 4HKJA 3VSQA 1EDTA 3EGSB 4F8NA 4MGGA 1JIBA 3IAGC 3DGGA 4Y16C 1FO0L 4F33B 2A79A 2Y36H 4ZB0A 3SCQA 3WU1A 1FBIH 2CPUA 4Z6AT 3KLLA 4M6NL 3SIMA 4RQQB 1GZQB 2VLRB 4LEEA 4EI6A 4B9KC 4LF1A 4MZYA 5EOCL 3BP6B 3QDJB 1YYML 3AJ7A 2CA3A 2Y24A 4RFNB 3TPKA 3MHUA 4X5XB 2JJTC 4U6VH 4IUOA 5ABDE 1SYSB 3H2PA 4YXKL 2VSKB 3BAWA 2HVOA 4H8NA 4WI3A 3BLBA 4GKNB 5SWSA 3L7EB 5BWFA 3UG3A 4ANVA 1Q13A 3ALFA 1FWHC 1F4YL 4MWFB 5LA0A 5CBBA 2OT1A 5ANME 2OW6A 5FF6A 1RP8A 2ORBH 2LGNA 1F6FB 2YAPA 1B3WA 1HCYA 1DN0B 1QLEL 1EWDA 1I60A 3NEVA 4KPLA 5AKQA 1PFCA 4HC1H 3N4EA 2M1KA 1CTNA 4IMAA 2EEXA 2PNDA 1Z41A 1TUFA 2CZVA 3BQ6A 3WTWA 3OX8A 2A77H 5IG7A 3DO7B 1YPIA 3WKZA 4NI3A 3KXFB 1PZUB 3KM8A 2W80C 3U7WH 5T3ZD 4JD4A 1HU8A 5HPMA 2NX5B 4Q9QL 5I5MA 4P4KA 4PU2A 3KPRB 4C6DA 2HT4D 1AO7E 4WJEA 5MP6L 4QE1A 2XLLA 2X9ZA 4NZTH 3PZ9A 1NDTA 2FLRT 3MZGB 3LEXB 3IU4L 2F54E 5EUOE 4FXLA 4TMBA 3B9EA 1HL8A 1MCSA 5DLLA 3RFAA 4AQ8C 4IKIA 2VL5A 2CKBH 3P9WB 3VNIA 1TDQA 4TN9A 3TA4D 4J40A 4EI6B 5I0ZA 4CN1A 3HI1B 2X1OA 1VZHA 3S3PA 1G7QA 2DT0A 3MXVH 3OD3A 2O7SA 5IMKB 4L6HA 4EOUA 3NABL 4X6DF 1E40A 4TUOA 1R7OA 1P4LB 5AW6B 2AMUA 4N5ED 3O15A 3BRDA 5I8EB 3WKQA 1ZIBA 1U1UA 3MO4A 2GJ6A 2X0SA 3NJNA 1NZRA 1J9QA 1TV2A 1PBYA 4TMPA 2UYLB 2UZXA 1AXTH 4BFIA 1UOVA 2WWMC 2X89D 3ECUA 2VDRL 4HEMA 2QCFA 4FLRA 1A7QL 4W68A 3E0FA 3G1AA 4GO6B 4UQ3B 1PZDA 3JV4A 4IU3A 2B31A 5DBUA 5HD8D 1T03H 4TR9A 1FXPA 3N0AA 2PRLA 5SX4H 2JCCA 4GXWA 1T7YA 3SGJC 1KKOA 2PDHA 1P5UB 2UXTA 4A2RA 4LLUA 4PRPE 3B9KC 5IVXE 1NEUA 4J6RL 3GI8H 4IHCA 3GK8H 1GGIL 2QR0B 2QADB 3QEQB 4NRZB 1EIXA 2FWLB 2OELA 4IRJB 1J5HA 3M0VA 4KUZH 4V27A 4LLDB 3VI4F 3G6JE 1G7PA 2BP3A 2UVEA 2Q86B 2F58L 3VFPB 2CO4A 3BLIA 2V4LA 5T1LD 4YX2L 4UTCA 1U3HD 5IM51 3ROLA 2HFFB 5KVFH 3LN9A 4ALAH 2OCCB 1O68A 3V7AE 1FWCC 1UUMA 4PMYA 3K2MC 4Y19A 4LAOA 4DQWA 1MI5E 4PUMA 4F15B 3A6OA 1X6LA 2EYSA 3AWGA 3HZMA 3ZHDA 1YXDA 4IBZA 1T0OA 2Z6FA 4TUOB 2CJSA 4K7PL 1TCRB 1BQKA 1B9KA 2J7GA 3APNA 4M1DL 4ZFZB 3ZDXF 4H8WC 4IFKB 1JFQH 4GAJH 4F91B 3SDXF 3VE9A 4R96A 2P26A 3BZEB 2R8SL 1T6VN 4NM4L 3EDFA 4Q2ZA 2UY7B 3K4WA 3GSVB 3TIDA 1SN0A 3RVVC 3HJEA 4D9RE 3E5PA 5B7FA 1PY0A 4CJ1A 3SGZA 4AEOA 5FESA 2GTWA 5JVLA 3REVA 1G6RH 4B53A 5C2BL 1B0GA 1O6IA 3BDYL 1OT1A 2CMRL 3OGOE 1O5KA 1OZQA 3KHDA 3UBXI 4O02A 2NW0A 1LDSA 3G9VA 3TVMC 2VDPB 4ETYA 4N02A 5E00A 4L56A 1JDFA 3VNJA 2BOBA 3QIUA 4LUTA 4YDIL 4D2JA 4KQ3L 2A7BA 5DVPA 3VINA 5I03A 2R51A 4EAMA 2PCFB 5IWLC 3C5ZB 1MFAH 4H25B 3QWOA 3C9NB 2DLFL 4KCTA 3NQEA 3NQFA 5K1VA 3QDGE 4PJAF 5AUMB 4ANXA 2JLPA 3UAAA 1INDH 1NDVA 1NGPL 3U7AA 1Z3GL 2X9XA 2BDNH 3MDJA 1FLTX 3SJVA 3CHXA 3FQXA 4D7PA 4Q8MA 5G5DB 4PRAA 5D7JB 1OY0A 2WQAA 3OPZH 4RNRB 4JVUA 3ILQD 4FERA 3WS3B 3PHQB 4N20A 3QF0A 2FH6A 5C09E 1HFUA 4OV6F 4JRYB 4OI7A 3LGEA 3QGVA 3TWYA 3BIAX 1IM9B 3OKLA 1QI0A 2BVPB 1QSVA 2YAEA 2Z93B 3Q43A 5GS0H 3QLLA 1CLZL 1M1XB 4GY4A 2A77L 1R30A 4H04A 1KZYA 4KDTC 4PRHE 2X6VA 3GPSA 3QS2A 3APGA 1N9PA 3KPOA 4KKPA 4DZAA 1YEGL 2HT3C 4M5TA 5D7EA 3HRZC 2OLHA 4QY8A 5DURD 3N9RA 4K3ZA 4QHRA 2ICCA 1R5IA 1FDLH 5DQDL 4JTTA 3GH7A 5CZVH 1AZ1A 4O52A 3FO2A 1HDMB 2PTTA 4JM2D 4BQ2A 1L3NA 2EGZA 4OZGA 2X6MA 2YBUA 4P9HH 3QA3B 1C8PA 5KAQG 1KJ3H 1SLUA 5EBWB 3T4CA 5KEZA 1A5KC 4KCWA 4KX9A 3NCWA 1UR0A 1EGJH 4MDIB 3SE4C 4LOFA 3LSBA 1TQCC 3HAEA 3P0VL 4XPTH 2HVBA 4IU3B 5HGDA 2XN1A 5KVGL 1D7BA 5GJTL 3S8FB 3H2MA 3VFRA 3G6JA 3ZQWA 2VMFA 3ZTEA 2PDYA 2KBGA 1E5YA 2FHFA 4FQ1L 2G2NA 2GTZA 4BH7B 2FDSA 1Q6FA 2VDIA 3CPGA 4R5EA 5AAWC 3F7PC 1VFFA 1P4BL 4XP5H 3L66A 4HS8L 2PDXA 1R3YA 2Z1XA 2G5RA 4PWEA 3NQAA 1YLVA 4LAQH 2ZYRA 1RAKA 1PFOA 4MJ4A 1WDAA 1QI2A 4GJJA 4LCSA 4JZNA 3L9EA 3IVUA 3CZEA 4NUMA 2VDRH 4E2BA 2QDGA 4DN3H 4GBXD 1BF2A 3LIZH 1EPVA 4HCGA 4WWOA 5ES4B 4OQVA 1UQSA 1VA9A 2XTLA 4XXDA 1NPUA 1S8DA 4J4PD 3FDKA 4FQCL 1FJ1B 1YPZB 3MV01 3MMEB 4Y16A 1REIA 2VITA 3NP3A 5AOKA 2OK0L 1LRTA 1UM4L 1I2NA 1TWZA 3WSUA 1G6RA 2D7OA 4XPFH 4HP5A 3OKOB 1QQDB 5KZCB 3VCRA 3EFFA 1R8LA 3GI8L 2A6LA 5EOTB 4L9LC 3SGEI 3T6ZA 3IGFA 4GZ7A 3UWEA 3GIQA 5E8EA 1UM6H 3X1GA 2MANA 2WQRA 2FL5A 4YX2H 3C8KB 3WN5B 3UNDA 4JPKH 6A3HA 2VWEC 4GRLB 2XXMB 3LKQB 3AS0A 5TE4L 1B90A 5CEZH 4HUNB 1CIDA 2PYFB 5D1QA 3IPEA 2FWSA 4ALAL 4LH8A 1J1PL 1GOOA 3WQVA 4GI8A 2OODA 2P5ED 4NAJA 3M5ZA 4P07A 1KFEA 2V30A 1XCQA 4M7SA 1RP9A 3CGTA 1W1IE 4MOZA 3TWAA 2VSDA 1B4LA 2BPBA 1BFOA 1X7TA 1KBLA 3RAJL 4B5WA 1YXCA 5K9KA 3DFSA 2YGOA 4GT0A 4Y5YB 5ESAA 4HTYA 2ATPA 1VHCA 3KP1A 3BIKB 1TZ9A 3MLSH 5AOUA 3HRZA 4G6ML 1M4KA 1CDBA 2WTPA 1GOIA 1IGML 4I90A 4P46C 3LEVL 5ICZA 4LVBA 4PJAE 3U4FA 3G8EA 5C2BH 5A2BA 4FLOA 4XPBH 3VXMB 4YSUA 3VCNA 1V05A 5MHSD 5HGHB 2CIIA 2RAMA 5DLMH 3CZLA 5KG9B 4MAYD 3LZOA 1HWHB 5AZEL 5DEGA 5ID1B 3D4CA 4JY9A 1XH1A 1UJPA 3PWPA 1TYGA 4Y9GA 5FAAA 3ZL1A 4Y9MA 3DA0A 4YDIH 4KQ3H 5ILTH 4LF2A 3M6YA 4LRIA 1R3IL 3V9EA 1G9NC 3GMMA 4LGRB 1WAPA 2HT4C 2I32A 2XQBH 3NCXA 3S5LA 4XTDA 2WTRB 4W9IC 5B39B 1Q9WB 3RWIB 2R2CA 1HT6A 2XZQH 1WICA 3L45A 4NPYA 3UDWC 5CEXA 3FUEA 2K78A 2J8FA 3VI3F 4HBKA 3SPGA 4Z95H 1FP8A 1LMKA 5I6KA 1NCOA 4GG9A 1NGPH 1QEWB 3AXLA 1D5ZB 1TZIA 1S7WA 3TCEA 4RGOH 1FG2B 4L3CA 2B0SH 3QO0A 3NJFA 2R24A 3BUYB 4RAVA 4S3CA 1QSED 2CEQA 3OPZL 5HDQL 3FTGA 3WIIL 3C0JA 3FY1A 3HPLA 2IALB 3PJSA 4FK9A 4ZZ9A 1QLEB 4Z2IA 2PWEA 4P3CL 3ZFHA 4JRYE 1V08A 3QDHA 5EBLB 5ICYB 2JKAA 5JHLH 4G8GD 1WV7T 4R27A 3ZL4H 1WUZA 2N59A 3BQVA 5GS0L 2JE8A 3EOTH 1PL9A 1DSFH 2GKIA 3AITA 4L2LA 3V10A 4IMLB 1YVLA 2YGVA 1B57A 4ODSH 2NXIA 1FDLL 1R33A 2I16A 1SBBA 5JH1A 2AS5M 2HFGL 4GOAA 2E6QA 1DUZB 1ELSA 3C6LA 2V63A 3P3TA 4NI8A 1FHLA 4JJHA 3RU6A 3THAA 4E38A 4HVXA 4NFBA 4QXUH 5T8GA 4IM8A 1BJ1H 1Y1UA 4IRSB 5FO9A 2X30A 2YYUA 4AAJA 3C6SB 4N0UB 2Z31A 1L6FA 2W07B 1DZBA 2BCKA 5SWSB 4FALA 4JJ5B 3RY6C 4AQ1A 4R33A 4ZXBA 3W23A 3FDGA 4WENB 1CLKA 1MFDH 4RISH 1BF8A 4LVGA 4Y2WA 5LCVL 5DK0B 5T5NG 1UPPA 4W5ZA 1B3YA 4ECLA 5GZND 3THQA 2IOOA 2D3VA 4TSAL 4QWWD 3QQ9C 3ZT6A 1X7SA 5ISZB 4DBUA 4R4NC 1R6VA 4JO8A 2BASA 4ELDA 5D7HA 4KFPA 4NFCA 2Z4QB 1T8XA 4G8GA 4BUGA 4GKSA 3VQMA 5FOOA 5LNWA 2X09A 2DH3A 2Y2WA 5F8QC 1FZJB 1GPOL 1A4JB 2R23A 4JRXA 1W1A1 1E0XA 1WDWA 2BMKA 3LIZL 5HGBB 2J77A 1Y8BA 4ENED 2WB7A 2GITA 4E4FA 4NT0A 4AXNA 4NUJA 1LLWA 1KM5A 5DC0A 3S0PA 1UCBL 2YKLH 4MMXB 3UROR 2Z25A 1OSYA 5JQIB 4AMKH 5FECA 1VKXA 1YZZA 5GGTH 1WHOA 2H2SC 3MBWA 1Q8JA 1E4NA 3U0TB 3FQTB 4F3FA 4Y5YA 5JHDD 4Y9CA 2WXFA 1XAUA 1ADQH 1UM6L 1IEAB 4P2CG 2YOCA 4YGVA 1VF8A 4FI8A 2UBPC 3DTDA 3FZUC 1U58B 3DPBA 4JPKL 5M03A 4WFED 1DL7L 4U0QB 5JOFA 1FVCA 1VGEL 4V1YA 3R6IA 3EFDL 4M5PA 1F42A 1EBAA 2FSDA 2JIXD 3NVTA 4AQ8A 4AIZB 2CWXA 3B3DA 5C54A 1RXLA 3QFGA 5K5YA 3EOOA 3MV9A 1IT8A 3QCUL 1OABA 2Q5BA 1UEYA 3RX7A 1M6UA 3B9KB 5F7WC 4I7UA 4XKMA 3W0KA 3BT0A 5DRWA 3QNXB 1KEMH 2J7FA 3QC3A 1YNTB 4O9HH 2PE4A 3QFWA 4KDTA 1XX1A 3QC6X 4R7VA 1SZNA 3Q37A 4X98B 4F0RA 4MM1A 1IGMH 4JGJA 4O51B 4V2XA 1MNUL 3LCWA 4YTTA 2GJZA 2Y5TB 3PREA 3OYXA 3CCHB 4P4KD 1USZA 1HEHC 4G82A 2EDLA 1RXOB 3KYMB 2ITDB 3QXWA 2NV2A 2O4MA 3FFDA 3BQUA 3AREA 5I1AB 5JPMB 3ABRA 4BE5A 4IXXA 1XGTB 2BIQA 1N10A 4YHNA 3GXNA 2HX7A 3LRGA 5AZEH 4E41D 3TK7A 2ZPKH 5T1DH 3UBXB 4QT5A 5FC9A 2WWKT 4M1BA 1PJ9A 4XVDA 3I9GH 4IK7A 3LKOA 1A49A 3RAOA 1OKEA 2J6EL 4IOTA 3UPWA 1XLAA 5AOIA 3I74A 5KS9E 2E6DA 1PD0A 5D7SH 2OJEB 3CC1A 2XZQL 4LT7A 5B1AB 4M7ZC 3GNML 5DJ8B 5M2FX 3VFCA 1FHUA 1Q63A 5LHFA 5F93C 5LNSA 2F15A 1EJOL 3QIUC 4P2VA 2JKPA 2BOFX 2PXYB 1HDMA 3HV8A 1H1NA 3CPRA 4KI5D 1TSIA 1RV6X 4RGOL 1II4E 2HTLC 3U7YL 4BDVA 5I16A 3B97A 3IU3B 5DQPA 3CDGA 4QI3A 1NA8A 5FF0A 2RUSA 2PPDA 2DVTA 1GHRA 5DZOA 2OXGA 1CC3A 2ZRYA 4LBRA 2WBWB 1XF2A 5HJYA 1ZRQA 2WCPA 3MNDA 3QEGH 4IRSA 5F1KC 5IROA 3U4BH 2WMPB 5FO9B 1J6OA 1X5HA 1IKNC 1V0NA 1ZJAA 2VP8A 1W1B1 1L5GA 3LH9A 5EUKA 1C12B 1TENA 3VXMA 3US0A 1LWIA 2NNFA 2Y1ZA 2QPDB 4FGMA 1PBGA 2WMGA 1BAGA 3EWYA 2YSSA 3EOTL 4Z7WB 2QPEB 4C56D 2B8OT 2EKSB 3I9AA 1AS7A 2B4CH 4UINL 1JGLL 4UM8B 5EU3A 3GAYA 4S3GA 5C0AD 4FAAB 2PTYA 4OZHE 4XH2A 5DO2D 3HW7A 4ZX3A 2HFGH 1GW1A 3NPXA 4LWWA 3RJXA 4B9JA 1URZA 1WUEA 4QXUL 5D2LA 2WNNA 3MQIA 2Z26A 2PWFA 2R9HC 4KY1L 1PLGH 3BSHA 4G8GB 5DJAA 4L5FE 2N3JA 1AHMA 3MACL 2E9MA 2D9CA 1U6AL 2GIMA 4U6YB 2V7HA 5E6UB 4Z3IA 1PDKB 3RDKA 4ZOAA 1Q2SA 1DJYA 3KLDA 2P5PA 1M05A 3OGRA 1YNKH 1F56A 1YAIA 1JI1A 2GVYA 3AXLB 2JJSA 1HIZA 5FSEC 3VWJB 4RMQA 4YC2B 1M56B 3O6FA 4LVAA 1KJ2A 1GYMA 3Q3GB 1T99A 1S5HB 4PWJA 1UJQA 1EXUB 1KCSH 4LIQE 1IM3B 5EDSA 5TBOA 4K15A 5BXFB 4MS8C 3MTXA 4Y9AA 4AZ6A 1N7MH 3WN5A 1BMWA 3V52L 5CUSL 4MLIA 2PYEB 1HZLA 1IGWA 3IK4A 4R9XA 1FNLA 3X17A 2NY5L 4OLVH 4PYHA 1UYQA 1KM0A 3G08B 4X7DC 3KL0A 3P54A 1IIGA 4NJIA 4ELKA 2FGLA 4H2HA 2E56A 2L8AA 1HIML 3FA4A 4YBLC 3DJTA 2EHHA 1YEHH 1P0SE 3B2PA 4N22A 2VX6A 4HK0B 4QDWA 1W6LA 2ALWA 4R4ND 5FEBA 5FAJA 1UR1A 3PG2A 1WBYA 3NMEA 1XLFA 1KCUH 4L6OA 2NY2D 4WSGA 4AIBA 2MKWA 1SJHB 1FFNB 4IU2B 3U2ZA 1TYRA 5ESVA 2DBJA 3P9MB 4HHAA 1ADQL 4MJIE 5HDRA 3D4GA 3G6JB 4JFED 1CFNB