2ZXBA

Alpha-l-fucosidase complexed with inhibitor, ph-6fnj
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
442
structure length
442
Chain Sequence
b'RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 161
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zxbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zxbA01
3MMDA 4AD3A 1J18A 2J7CA 3II1A 1NWTA 1TQVA 3AS1A 1UOKA 2WCSA 1T0OA 5A6LA 3CMGA 2JF7A 1NOFA 2YJQA 4U5IA 1JZ5A 5DT5A 4GINA 3SCNA 4JFTA 1QI5A 3LMYA 2XGIA 4GI8A 1UHVA 2CIPA 3SEPA 4W85A 4D6GA 4J3XA 1QWNA 2YFNA 1VFUA 4FLRA 5D9OA 3HZ3A 4Q22A 4YHEA 1WKYA 2VQTA 5AC4A 2WW5A 2WC3A 1E0VA 4P7RA 1QVBA 1JDDA 4M81A 2EPNA 3TP4A 4TVCA 1BG9A 4PUDA 4MJ4A 1K9FA 3W25A 1V0MA 2G3JA 2WWDA 2QMKA 1EOMA 1E1FA 1S46A 3SCQA 1XSIA 1CXEA 1NARA 1EDTA 4L4OA 4AD4A 2F61A 1ITXA 1BTCA 5LA1A 3AZTA 1IV8A 1W1VA 4AYGA 3QR3A 2V3EA 1R86A 5BXTA 1ZJBA 5A1AA 4CN1A 1FP8A 4F9JA 5M3WA 3RILA 4W8AA 4A4AA 1CENA 1TE1A 3W29A 2JE8A 2G3NA 3VGFA 1NP0A 2E9LA 5FKYA 2Y4SA 1G01A 2NW0A 1P6WA 3ARZA 2VOTA 1ZS2A 1H11A 1FFRA 2J25A 1C8YA 3WH9A 1LG1A 1B30A 2ZX9A 1C8XA 1GOIA 1X6NA 2D22A 2JALA 4AD5A 2J62A 1LF1A 4B16A 1FP9A 4CD7A 3VDCA 4CVWA 1E4IA 1GVIA 2YL9A 3D50A 4U3AA 4J3UA 2OYLA 3EMZA 1PBGA 2W91A 2BS9A 4IISA 1H4PA 1VRXA 3VGHA 3RIKA 4UQAA 2CITA 4DWSB 3VX1A 4ZEPA 2XM1A 3GTNA 2WMGA 2WHKA 1CYGA 4B15A 2ZX8A 1OD0A 1J0YA 1TQTA 1FOBA 1GW1A 1JNEA 4UZSA 4FLSA 2DDXA 2JF6A 3VDHA 4D6JA 4YHGA 3W37A 3BUDA 7TAAA 1W32A 3BVWA 4QDMA 3GM8A 1JD7A 2EEXA 1ESWA 3AS0A 4PCSA 2XHYA 1BHGA 1JI1A 1VJSA 5DFAA 2VZUA 5FL1A 3W24A 4BQ2A 1WDPA 3QGVA 1PIFA 3VSTA 1KXVA 3GYCA 5M5DA 2VX5A 5ABGA 5D8ZA 3W82A 4TTUA 2XWEA 1EXPA 2CHNA 2OLHA 3T08A 2XN1A 4NSBA 2XSAA 1QPKA 3BUBA 2X2IA 1H0IA 1JG9A 1D7FA 2WMFA 4W8BA 1J10A 4NZJA 2QHAA 1OIMA 3FN9A 2YL5A 4AZCB 4UQ9A 4M8UA 1UWRA 2G3IA 1ZBCA 2YL8A 3VD4A 4F66A 3MI6A 4W84A 3EMCA 2WCGA 3O2LA 4KRUA 2GSJA 3MMWA 2XIIA 1W3HA 3EYPA 4BCEA 5E6YA 1LL6A 2YKKA 3W26A 4AIOA 3ARYA 4PMXA 4KWUA 4GO9A 5HXMA 1V3IA 1LL4A 1KCLA 1UH2A 3BC9A 3KWXA 3EDEA 4JHOA 3MS8A 2QPUA 1QHZA 3AMKA 5D9MA 1GCYA 2ZX7A 3K46A 5BXRA 3BVUA 1BYAA 1OBAA 2BY1A 2Z1SA 4MNLA 3WNKA 3WMCA 2BV9A 1H0GA 3CZKA 1J12A 2J79A 2HISA 9CGTA 4CCEA 4J3VA 1L8NA 1TR1A 3BXWA 4URIA 1WCGA 3WQVA 2CXGA 2WHLA 2XVNA 2XN2A 4DWSA 5CG0A 3A4WA 1QW9A 3NIYA 2FH8A 2BXZA 3MANA 2VX7A 3AROA 2OW7A 1HJVA 5A6BA 3DX2A 3T2PA 1QNQA 4UFHA 2D24A 4QFUA 3CPUA 2DT0A 1E72M 1JXKA 3L4WA 1C93A 1QHPA 1UYQA 3PZVA 2WLYA 5D4YA 3EDDA 3EDJA 3VNZA 1U2YA 3LPGA 3W4RA 2X2HA 1O7AA 2E0PA 3OGRA 1FHLA 2D2OA 1UUQA 1CPUA 2QV4A 4X0NA 2WPGA 3B9AA 3SUTA 1AVAA 5JIPA 4TTGA 4MJ2A 4MTVA 2VT0A 4AZCA 1UWSA 1HJQA 3TA9A 1MW1A 3WL0A 1OCQA 4W88A 4DO5A 3CZLA 3UR8A 2YOCA 1NWSA 4J3TA 1B3WA 3RDKA 4LXFA 1CNVA 1UKOA 3QHOA 3A22A 4W7VA 2DSWA 4FK9A 5CJ5A 2Y2WA 3N04A 4WLCA 4MNKA 5D9PA 5A95A 2WZEA 1EDQA 3UESA 1W91A 4ML4A 3AYSA 1SZNA 3ZQ9A 1UG6A 2UY2A 2WK2A 3VTRA 3NSXA 3WDPP 3HG4A 3AIWA 1BF2A 4Z2HA 1SMAA 2O9TA 4JL2A 2VRKA 1W3LA 4P7NA 5A6JA 1V03A 3HMCA 3JUGA 1PJ9A 1U30A 2BHUA 2CETA 2Q8XA 1JFHA 2D20A 1XD0A 3WFLA 3L4UA 3A4AA 4KMQA 2CEQA 5ABFB 2BNJA 1QI2A 3WUFA 4TX8A 1G9HA 2GUYA 4H8VA 5A6SA 5CZKA 4YN5A 4WSJA 4C7GA 1B1YA 1HN1A 1V6WA 1CLVA 3M46A 3DX1A 1HP5A 4JFVA 3ZOAA 4NZCA 1MQQA 4CN4A 1AQ0A 3CZSA 2TAAA 1US3A 3DX4A 2DSVA 4W86A 2A3BA 1UR2A 2D3NA 4PSPA 4LYQA 1EDGA 1TQWA 4W93A 1RP9A 4W5ZA 4BQ4A 4PTWA 3CH9A 2WAGA 5A94A 3K4AA 3M07A 2X0HA 1E6RA 3L2LA 1ZBKA 1VFOA 1HXJA 2OWCA 3VIHA 3QHMA 4CU8A 1O6IA 3G6LA 3PZOA 3VD7A 2BVTA 1E70M 2UY3A 2GDVA 1A3HA 3K1DA 3LRLA 5AYIA 4RE4A 4LX4A 2AMGA 1FA2A 1UD5A 3UCQA 1B9ZA 3RJXA 1AQHA 4HU0A 3GDBA 1W1YA 4Z2GA 4PMZA 1CIUA 4HA1A 1UWIA 2WC7A 5E6ZA 4HP5A 3WMBA 2DSUA 2OSYA 1OSEA 1JZ8A 6TAAA 1B3ZA 1CWYA 2VZTA 1PX4A 2OWXA 1W2PA 1G1YA 3THCA 2WBKA 1KB3A 3VNYA 1UA3A 3CO4A 3EMQA 4JIEA 3S6TA 5D9NA 1HWWA 1BLIA 3DHPA 3WNMA 4DWSD 5IHRA 3AXIA 2DEPA 4UQEA 4TVUA 2CBIA 3UG3A 2C0HA 3GH5A 3ZO9A 2ZUSA 3AYRA 3BAYA 1C92A 5EMYA 3L4XA 4PMUA 5A6BD 2XSBA 1X1NA 5HBFA 5I6SA 2DSZA 4GZIA 1CGWA 2OSXA 1JAEA 2FH6A 2E9MA 1ITCA 1BAGA 5A8PA 2DIEA 1JZ2A 1L0PA 4AEFA 3AQUA 1UD3A 4LQ1A 4LPCA 2ZUUA 4OUEA 1E6XM 3WMSA 1DTUA 2XPKA 5CXPA 1JDCA 1UD2A 4QLLA 1CXFA 1UD4A 2RGLA 3LXAA 1ISXA 2WHMA 3VM7A 1XSKA 4X0VA 4PN2A 4JHZA 2Z1KA 3CIVA 3LPFA 1XYFA 1BQCA 3ZJ7A 3SCOA 4PRWA 4HPHA 3OLGA 2J75A 3K8LA 2OWWA 2VX4A 2ESCA 3CHDA 4W87A 2O9PA 3A23A 4KRTA 1DWHM 2O92A 5DT7A 3UG5A 5EFDA 3BLKA 2WXDM 3RM8A 3UETA 4V2XA 1CDGA 3ZT7A 4AWEA 3ALGA 1UA7A 2D0FA 1RH9A 4MDOA 4CVUA 3WH7A 4MAVA 2BVDA 4P8XA 2F7PA 1V0NA 1O7DC 2J74A 2ZWZA 1HXKA 4UQCA 3MUAA 2VTFA 3AIRA 4MB4A 2JIEA 3AICA 2XN0A 3WL1A 5A6AA 1UASA 5EBAA 4ACYA 3PBGA 2F8QA 3ARVA 1VEPA 4Z2KA 1C91A 1H49A 3TONA 1GUVA 1R87A 5AY7A 5A2AA 4WIWA 3I3EA 3A47A 1OGBA 5BXSA 2JEPA 3OBAA 3POHA 3AIVA 3SCWA 4GPNA 4AD2A 1E6ZA 2J7BA 5I77A 3D51A 3WFZA 1MQPA 3OA5A 3U5YA 4J27A 4H41A 2CKRA 5HDRA 1JYWA 3A3HA 4CD6A 1QNRA 4WSKA 3GXFA 2WMJA 4P8WA 3WUBA 5I78A 3KLKA 2FE0A 2HVMA 2PWEA 5I23A 1K6AA 1BGGA 1E73M 2BY0A 1HT6A 4UQBA 3NUKA 1LG2A 2VI0A 2X1IA 3VIJA 4AIEA 1HVQA 3OZOA 4M1RA 1MFVA 1R47A 2VCCA 2QMJA 4OBRA 2YDRA 3OLDA 1HKKA 1W9PA 1WDQA 2DQXA 2YBTA 3B9DA 3NDYA 3TTOA 2ZIDA 3ARXA 3I3BA 1MW0A 2V3DA 1EHAA 4ZE4A 4UOJA 1W3KA 4S3KA 1NP2A 3WDRA 1HIZA 2EPKX 2J8FA 3VDAA 2QLYA 3GXIA 5JBFA 2ZUTA 3K4DA 4CGTA 1YQ2A 3IAPA 3W81A 5LA2A 1DWAM 3CUFA 3H54A 3PZTA 3TTSA 3I3DA 1M53A 4JCLA 2D1ZA 1VFMA 3WKZA 1KXQA 4ZXLA 5DMYA 3PZQA 3BAXA 3BH4A 1QHOA 4S3JA 3CTTA 3EJQA 1OT2A 2CBUA 3RPMA 2XJ7A 2X05A 2OSWA 5A2BA 2RGMA 5IDIA 2GVYA 2A3AA 3VGDA 1E55A 1BVNP 3AMLA 1JNDA 3CBWA 1J9YA 1V3MA 2VX6A 1CXIA 1R75A 1R46A 1UR8A 1BPLB 3SUUA 1C7SA 3F5JA 1WNOA 4P7QA 2CBJA 4MNJA 3HG5A 2FYVA 2BY3A 2PBOA 1AQMA 2F7QA 3WF2A 1HL9A 2W67A 1CECA 1HKMA 3AMDA 1UZ4A 5BRQA 1PS3A 2A3HA 1NQ6A 2CBVA 2AOSA 1W1TA 2G3MA 2WSPA 5IXEA 1VB9A 1BSIA 1D3CA 3L4ZA 1WZAA 4UR9A 2XVLA 4AZBA 2XGBA 3VMOA 4C7DA 4GIAA 3CHCA 2VMFA 3OGVA 4QP0A 4W7UA 2YFOA 5A8NA 4IPLA 4ATWA 2A3EA 3W0KA 1HJSA 1JIBA 2F7RA 4H04A 4NRSA 1B90A 3VGEA 4PSRA 4HMDA 3N11A 2UY5A 1J0ZA 2VC9A 4BF7A 2J7HA 1W1PA 2D3LA 3LRMA 3EJUA 1F4HA 4R5EA 2QPSA 4MADA 4CN6A 3VU2A 5HOSA 3WH6A 1V6YA 3D52A 1RP8A 4AZIA 3SUVA 2VO5A 1UR4A 1UZ1A 4HOZA 2E8YA 2Y5EA 2EADA 3TTQA 1GHSA 2PWGA 1H41A 3VM5A 4AC1X 1W2VA 4P7LA 3WD0A 1MVYA 1PX3A 4FNPA 4CU7A 1KGXA 1ZBWA 1OT1A 1ISYA 3ALFA 4PCTA 1UWQA 1UR1A 3VIOA 2F2HA 5CGTA 1Q6EA 3PZUA 1EQPA 3ZR6A 3CV5A 3SCUA 1NH6A 1KFWA 4FLOA 3KEHA 2ZX6A 4ZENA 1OIFA 3WF3A 3WD2A 2VQUA 1CGVA 1FFQA 3WF0A 1ISZA 1UKPA 4LYPA 3GH4A 3OLIA 4UFKA 5AC5A 3IAQA 1QI0A 1KBKA 2ZICA 5CLTA 5JUVA 3PZIA 3WDIA 2ZUNA 1W9XA 1D2KA 3MSGA 4AW7A 5FL0A 4NX0A 4B3LA 2VCAA 4TOQA 5ECUA 1LWHA 3ARWA 3CUGA 4GQQA 4FNTA 1OINA 3VINA 2WMIA 8CGTA 4WF7A 3EJTA 2XFYA 5I3DA 5A6MA 3TTYA 1QBBA 3AI0A 4X9YA 2EQDA 4EE9A 4R27A 4JCMA 2XVPA 2BVYA 3AS3A 3K8KA 2AAAA 3UERA 5I5RA 4JKMA 1CGYA 3GXTA 1PIGA 4PTMA 3ARQA 1RD6A 3DYPA 4J3WA 1GOQA 3SCVA 2BY2A 1G0CA 1ZJAA 3ARTA 4PBGA 3AISA 3AS2A 5FCZA 5KZ6A 5HNNA 2G8ZA 3HG2A 3AZRA 1HJWA 4OJYA 3S2CA 4TVDA 2DT2A 2VZVA 4UFIA 3QOKA 2BHZA 4HZ8A 4RE3A 4UQDA 1E71M 3T0BA 1CEOA 5IFPA 3VIKA 4GQRA 3AIQA 1CBGA 4LGXA 2WZIA 4UFLA 3MO4A 1UWUA 2IUZA 2PWHA 1KCKA 4L4PA 4OIFA 3VD9A 3PTMA 3AHTA 1W9BM 5F7UA 4BA0A 2ZWYA 1OGSA 2EO7A 1JGIA 3WF1A 3BLPX 1TVPA 3WIJA 3CHFA 3LPPA 1I1WA 4XZBA 3WY2A 2W4XA 2YA2A 4NF7A 3VILA 4FNRA 3U7BA 1X6LA 3FNDA 3HN3A 1WZKA 4XUYA 3SUWA 3MUY1 1C3FA 2ZXQA 3G6MA 2GJPA 1K9DA 3GXNA 1ZB5A 4FMVA 1FHDA 1KTCA 2J7GA 3AIUA 4P8UA 5CSUA 4PUEA 1GJUA 2VVNA 1US2A 3CZEA 4BQ3A 2XVKA 3ZT6A 3LX9A 1BYBA 1TUXA 1JL8A 1TQUA 4TXEA 1IT0A 7A3HA 1HF6A 4K68A 5JIWA 3AZSA 2DSKA 4W5UA 3CZJA 3CZ8A 1DWIM 1EQCA 3OZPA 4DWSC 1VEMA 1Y7VA 4CU6A 2XUCA 3GNOA 2QF8A 1B3YA 4HA3A 1JZ3A 4ATLA 2J7EA 3POCA 1QW8A 1WZLA 1GONA 3MUIA 5KEZA 2YLAA 3T0DA 1QNSA 3W6LA 2WVSA 1EGZA 3N17A 4WKFA 3VUPA 5C70A 1J0JA 2O9OA 3BUQA 3WNOA 4ZXOA 2E40A 1KWGA 1GHRA 2XIBA 5I0DA 5FD0A 1MFUA 2VRQA 1Q6GA 3OIHA 1PAMA 3ARSA 1BYCA 1VENA 5A8QA 5BCAA 1E43A 1UH3A 2VL4A 1H09A 1HVXA 1MWOA 4UCFA 1RPKA 2W61A 1V6UA 3W38A 1UQYA 1DWGM 3AFBA 2PWDA 1VBRA 6CGTA 2ZUMA 4EANA 4MDPA 4AYSA 5CGMA 2XM2A 3ECQA 2GDUA 1TQSA 3MMUA 5C8BB 3VVGA 1TG7A 3FXYA 2EJ1A 4P8VA 1KTBA 1XRVA 2WMKA 3NYDA 2WANA 1XCWA 2FHBA 4JFUA 3PTKA 4CD8A 3T2QA 1EHNA 5I24A 3MV11 2NT1A 4U31A 3GNPA 5A6KA 1HTYA 2F18A 5E70A 3RJYA 3BCDA 1WDSA 1J0KA 3AJ7A 3IGUA 3CMJA 3GXDA 3VX0A 3OB8A 1WZMA 1TVNA 4CKQA 2VZSA 1UKQA 3WF4A 3EJRA 2DGAA 4GKLA 1QBAA 3WENA 1JYXA 1XGZA 3BLBA 2YL6A 2W92A 1ECEA 3WELA 1XC6A 2ZOXA 1NWRA 5E9AA 1R85A 1LWJA 1R8LA 5TD4A 3AXHA 3B9EA 4QCEA 1SR0A 2GJXB 1H3GA 3LXCA 1FH9A 2F1AA 1ISVA 2EABA 3M7SA 3ZSSA 3EJPA 3U57A 3WNPA 5BROA 1MW3A 3T09A 5BRPA 2ZE0A 3F4VA 1EA9C 3IK2A 3ARUA 1GOOA 5IHSA 3KE0A 4N42A 5JBDA 1BVZA 1V0KA 5DEZA 3WQ5A 1OWQA 4HA4A 4U5KA 4UZUA 3ZJ6A 2WNWA 4Z2LA 1HL8A 2YA1A 1WAWA 4AZ6A 4AISA 4ATDA 5A3HA 5A8MA 1M04A 3ZIZA 1XCXA 2CNCA 3GBEA 4W89A 3S5YA 1E4NA 3ARPA 4M29A 3L2MA 3VPLA 3HG3A 1MW2A 1K9TA 2F7OA 2F1BA 2E4TA 3WQ6A 1XYZA 3MV01 4B3KA 3FHAA 5ABHA 1J01A 1CXKA 2XWDA 3WD4A 4KGJA 2WVVB 1E15A 3WY4A 3WQWA 4JL1A 4DO6A 1TFVA 3B8SA 2J78A 1V02E 1XV8A 3DDGA 1B31A 1GNXA 2EPMX 4ZFMA 3A24A 4GZEA 1TMQA 4U33A 3BMVA 1A47A 4HOXA 1KR0A 1VEOA 4IPNB 1ZL1A 4NXSA 4PMDA 4CUCA 4F8XA 1Q6FA 2ZX5A 1EO5A 3AOFA 2FHCA 4PMNA 2GJXA 1PPIA 3RMEA 5GNYA 4JKLA 3D4YA 1V08A 2DH3A 3L4TA 2X2YA 3KLLA 1Q4NX 3APGA 4OZOA 4P7OA 5C71A 3BAWA 3S5ZA 3VO0A 3NSMA 3L4VA 2E9BA 3VIIA 5CPQA 3CUIA 3VMNA 1M03A 1C7TA 1ZBVA 3CC1A 3VOCA 5BYWA 2E3ZA 3ZSTA 1Z32X 4GXPA 3PZGA 3RM9A 2WVUA 1G94A 3SCTA 1TA3A 3PZ9A 4QLJA 1J11A 3N15A 5BWFA 4M24A 2CERA 3UR7A 1KGUA 1V6VA 4MB1A 2GK1A 3N18A 4KH2A 3AMCA 3TOPA 1VF8A 3AIBA 4AZHA 2PB1A 3PTQA 3MU7A 1Q6DA 5E0FA 1VBUA 1MXGA 2EPLX 1E0XA 3CLWA 2J47A 3PZMA 1AMYA 2WVVA 1LLOA 4E8CA 4PMRA 1XH0A 2CESA 4OBSA 3VIGA 4AMXA 4CCDA 4H8HA 3THDA 1WDRA 3RM4A 1JAKA 4NXKA 1GPFA 4RL3A 1HKJA 4D1IA 3DHUA 3MKKA 1M01A 4N0RA 4UTFA 2V38A 4HTYA 5BXPA 2VR4A 2XFRA 1SMDA 1IZKA 3KL3A 2PWFA 4TX6A 2MANA 3WDHA 2ZXDA 1E40A 1PX8A 3PN8A 3WH5A 4XX6A 3VIPA 3D3AA 3HJEA 2EACA 1CXHA 1XH2A 2V5CA 3OGSA 4E8DA 1WPCA 4F79A 3VSVA 1U33A 1UH4A 3H55A 2PF0A 3ZJKA 4NZFA 5CSYA 2JEQA 5A8OA 1F4AA 2WYSA 1JF5A 1WP6A 1BFNA 3WDJA 3RO8A 1E3XA 3N13A 4UOQA 5CLWA 5M17A 5LYRA 1E1EA 1B3VA 4Q7NA 1DEDA 1HJXA 5HPCA 1GQLA 1GVYA 2B31A 4MNMA 4EK7A 2WMIB 4V28A 3SCRA 5ABEA 1QNPA 1VJZA 4D6FA 3A21A 3M6DA 4PTVA 4ACZB 2Y8VA 4OOZA 3U7VA 2CYGA 5IFTA 2W5FA 2YBUA 4W7WA 4AIUA 2BFGA 1CZ1A 4JZ5A 1IZJA 1QI3A 1JXJA 3DC0A 1W9UA 1EOKA 3EJSA 1VIWA 3EDFA 2DT3A 1UD8A 3AHXA 3F5LA 4H8UA 5CQ1A 3MUZ1 2C7FA 3F5KA 2PI6A 4CD4A 1UR0A 4J7RA 4PTXA 3DYMA 1KBBA 4F9DA 3BVXA 2GJRA 1E6SM 1XD1A 3FY1A 4JAWA 3ZT5A 1PEZA 3CZNA 1I1XA 5CPTA 1JZ6A 4JKKA 3VSUA 2YLLA 1NOUA 2IXUA 3N9KA 1QX1A 3VDBA 5GQBA 3MSDA 1W9DM 1YHTA 1JFXA 2NSXA 4ZE5A 1LL7A 1J0IA 4FLQA 1E3ZA 5DO8A 3CZGA 4HMEA 3CGTA 4W8LA 3BAJA 5E1QA 3KZSA 4PMOA 3BVTA 1UWTA 4D1JA 4A3YA 4A3HA 2W63A 2X8RA 3WBAA 4AMWA 5EB8A 3WD3A 2D23A 2O9RA 2WCAA 1OM0A 2VURA 4DUWA 3VIMA 1BGAA 1XSJA 5AYBA 1CTNA 1V3JA 1GOMA 3BGAA 4HPGA 4ACZA 4GI9A 4EAMA 3WBEA 4BQ5A 4CD5A 5GNXA 4WKAA 3VD3A 2XFFA 1JYNA 2VNCA 4B9YA 3GXPA 2GFTA 6A3HA 1E0WA 4GZJA 4M82A 4B9ZA 4OOUA 3U5UA 3WH8A 4CCCA 1V02A 2WC4A 1TCMA 3BSHA 2FDMA 1WB0A 2OW6A 2WBGA 3E1F1 1JF6A 4JFWA 3QHNA 3W53A 4J3SA 3D4ZA 3O9NA 4H2CA 1JD9A 1OGGA 3WQ8A 3BUPA 4FF5A 3O6AA 4E4PA 1Q6CA 4HU8A 3PZNA 4AZGA 3IANA 1JI2A 2OYMA 1DP0A 3RCNA 3ZM8A 5I2UA 1CLXA 1OD8A 3ZJ8A 2XTKA 4Z2IA 4QAWA 1E9LA 1MXDA 3WDQA 1MQRA 2Y24A 1JZ4A 1N82A 2C8NA 3BCFA 2XG9A 4U2YA 2W66A 2X2JA 1HKIA 4HZ7A 4DM2A 5HPOA 2XVGA 4PMVA 5LA0A 1E5JA 2G41A 3HU7A 4MB5A 1GOKA 1TZ7A 3WSUA 2WMHA 1VAHA 2WKLA 3WUGA 3BAKA 3L4YA 3AIEA 3DX0A 3FAWA 3A6OA 4V27A 3BAIA 2J7FA 1R7AA 1EO7A 3FAXA 5E09A 3SCPA 3DYOA 1J0HA 3NSNA 3BUIA 2ZXBA 4M80A 4U3CA 2D0HA 3W28A 2UY4A 5FOOA 3T0AA 1KWKA 2JIWA 2DH2A 3WNNA 1PZ3A 2DPEA 2X09A 3KL5A 1GZJA 3CHEA 2IGTA 1XH1A 4XZWA 4Y7EA 2YDSA 1HP4A 4DM1A 3WN6A 2VVSA 4WK9A 4BZYA 4FNSA 3IJ8A 4AEEA 1KXHA 2WM0A 4M56A 1UKTA 4BS0A 1E6QM 4DO4A 1ZU8A 4AZ5A 1ISWA 2V5DA 2Y8KA 4AZ7A 3VGBA 1SFSA 3VD5A 2DIJA 5JBEA 2UWFA 2JFEX 1XHGA 3DECA 4J28A 4D6IA 4FNQA 2G4FA 3SUSA 1LQ0A 5A69A 5GPRA 3J7HA 2VZOA 3T2OA 2V3FA 1H5VA 3DDFA 2CKSA 1VFFA 4QLKA 1JDAA 2BHYA 1GQJA 3LRKA 3FW6A 4FNUA 1SYTA 2WZHA 2DT1A 1PZ2A 4D6DA 1QWUA 3H53A 1UD6A 7CGTA 4H7VA 2WWCA 4D72A 3WY3A 1QNOA 2J8GA 3GBDA 1B0IA 1UR9A 2FHFA 2YA0A 3W27A 1C90A 3W6MA 1CGXA 4AY1A 2V3GA 3N12A 4HZ6A 3SCSA 3WEOA 2OYKA 4UFMA 1E5NA 1HJUA 2VUYA 4KGLA 2ZUVA 4XB3A 1B3XA 8A3HA 2IXVA 4C7FA 4AD1A 1B2YA 4AXNA 2X0YA 2WB5A 3QOMA 3LXBA 4UFJA 1UKSA 1ODUA 5DF0A 4GI6A 1WO2A 3A4XA 4D6HA 1OB0A 4NRRA 2A3CA 1GJWA 1CGTA 3GH7A 4XV0A 5E0CA 1CXLA 2EXOA 3LPOA 4MAZA 3UG4A 3GXMA 1QI4A 2ZXAA 4QCFA 3SIMA 4U2ZA 2VJXA 3IJ9A 3AHVA 3ZMRA 1EH9A 1K9EA 5ABFA 1GQKA 2XYLA 1V3KA 2FGLA 1NM9A 1HX0A 3AHYA 3ZR5A 4LYRA 4PMYA 2ALWA 3WD1A 1KGWA 2CPUA 1NOWA 3PHAA 5A2CA 4YPJA 1FH7A 3ARRA 3SURA 1DWFM 4GO8A 4MB3A 3EDKA 1NWUA 4NI3A 3AXXA 4EKJA 1H1NA 5FIPA 1W9VA 1V0LA 3GNRA 1W3JA 2EBNA 3A5VA 2D0GA 2WLZA 1JYVA 3BVVA 1CGUA 2WSKA 3UEQA 1KR1A 1TA3B 2D73A 2W62A 1UQZA 2VCBA 2GK1B 2YDQA 4OKDA 4D6CA 2VRJA 1E6PA 1GORA 1HNYA 3BMWA 2PBGA 3WUEA 3EBVA 1H2JA 3DX3A 2WHJA 1LJYA 2FGZA 4UOZA 3WEMA 4AD0A 4IUGA 5EFFA 1V3LA 1BG4A 1WE5A 5I79A 1E6NA 3N1AA 1ODZA 3OLEA 1I75A 2VR5A 2EPOA 3WNLA 1GQIA 1KQZA 5GNZA 2NT0A 1GOWA 2YIHA 1JZ7A 2CHOA 1V6XA 4WJXA 4IM4A 3OG2A 3TV8A 4PEEA 2PC8A 3CUHA 4D6EA 4PMQA 1KXTA 3FHQA 2J77A 2ZUWA 4RE2A 1E4LA 3AHZA 3D5HA 1DHKA 3VKKA 3BSGA 3KL0A 4E2OA 1KQYA 3IJ7A 4Z2JA 2J7DA 3NDZA 5M03A 3WQ4A 1R7OA 1R33A 3WEZA 3NJ3A 4DUVA 4AMCA 4JFSA 4DUXA 1C8QA 3K8MA 1QOXA 1E56A 5CPSA 4HOWA 1R34A 5D8WA 3CUJA 3VGGA 3GZAA 1FH8A 4TUFA 2J4GA 4MPKA 4WKHA 2EAEA 1MYRA 1BYDA 1E4MM 1DWJM 3VIFA 3WY1A 2E8ZA 2WKGA 4D71A 4UNIA 1EIBA 1V3HA 4PYSA 2WVTA 3NCOA 3VMPA 2BXYA 4OGZA 1M7XA 4HMCA 1G5AA 3AMGA 2CCRA
chains in the Genus database with same CATH superfamily
1GGYA 4DK6A 2QVIA 5INCA 2O1AA 4X4ME 4NHCH 3F6IA 3WUWB 4U5IA 2UX6A 4LEOB 2OL3H 4JFTA 4RFOH 4GI8A 1EP2A 1M57B 2R0LH 4GT7A 2VLRA 2YFNA 1VFUA 4LCSA 5I8EA 4KXZI 1IMHC 1W3NA 1H50A 1KBLA 1ZFJA 2Y07L 2AJYH 3O1NA 3V0VB 4S3GA 1P5UB 3NQ2A 3DGGB 4LCVA 4Y7MA 3SQMA 5IB5A 4E9WA 4BCXA 3WBDA 3ZY7A 3OKLB 3FT9A 2DICA 3GSUA 1K77A 4EUPA 2W0FA 4LW7A 4O57A 2VERA 1N5YL 2DQUH 1SQ2N 2J25A 2RDWA 1GYAA 1AKJA 5F6HI 4HXAH 1LF1A 1WBZB 4UT6L 3SCMA 4HWEL 2Q02A 4B16A 1IEAA 1BEYL 4LLDB 3B2PA 3DI3B 1B0GA 1IFHH 1BA9A 3GNXA 3BVNB 1A5LC 2WHKA 4LCYB 4IKIA 4PRPD 3QCVL 4HPNA 1ZLDA 1PL9A 2ZCHH 5C09E 3HZVA 3F58H 5DZ9A 1SN0A 1XMWA 3E5PA 1U2CA 2P5ED 4BQ2A 3OTRA 3B9VA 4Q4SA 5I0XA 3F83A 2GQ3A 2CHNA 4Z7VA 4E9QA 4LVBA 1XCQB 1C9SA 3BGMB 2WMFA 5AL8A 4HCGA 4BUGA 2YL5A 1P7QA 4JBRA 4YXKH 1ZBCA 4M6OL 1WKFA 1X4ZA 4G9FB 1F2JA 4I9WD 3QZWG 4BCEA 3EYPA 1D8WA 3GKFA 3L0GA 4G7YL 5IBLD 1A1NB 4EDXA 3WK3A 4K3GA 5LQBL 1DUYA 5D9MA 4E5TA 4Z1CA 3AFLA 2O93L 1RD5A 3WAKA 1L8NA 3NIFB 1UIOA 5ALCL 2ZCKL 3VNDA 4YTSA 2Q20A 4E42A 3CUXA 2ISVA 1H5BB 1QKZL 4HFUL 1ZLVH 4WWKC 2TYSA 1UM5L 1EYEA 1V55B 3F7RA 1LT8A 3BARA 4N68A 2DT0A 3FSTA 3NJMA 1EF3A 3VXME 3EO1A 3EDDA 5HPMA 4YWGL 4YQXL 2X2HA 4URTB 2J27A 3MLWH 1UWSA 1HJQA 6PCYA 5G5DA 3CZLA 1O1ZA 3QHOA 1EVUA 2CR3A 1OP3H 3FFOA 3C61A 3FB8A 2D7TL 5D9PA 4L29B 5HHMD 1NFAA 3LQGA 1OZUA 4K8RD 5HDBB 3AYSA 3ZQ9A 1TWDA 3IJHA 3AQXA 3IXAA 1HC1A 2X3BA 1JE6A 5J5EA 3GBNL 4TQTA 5CP7B 4G8FB 1AG0A 2B9AA 5FGCB 3NGJA 3WG6A 1PJ9A 3GIYA 1I3RA 2Y5TB 2Q01A 2X16A 4G8IA 1NIEA 2NXIA 4WEBL 4LSTH 4PWIA 4OCRL 5A6SA 4XZMX 1PLGH 4C7GA 1F6KA 4NQEA 3UD6A 4JFVA 3QQDB 4DP4X 2A74A 1HL2A 2JK5B 3UP8A 5CZXC 1R3HB 4AI7A 3DX4A 3TF4A 5LO7A 2EDEA 3MV9B 4J2XA 3CH9A 1S7WA 3KR3H 1KIRA 3LZOA 3CVBA 2OWCA 5H2ZA 2OR2A 3G6LA 3QZPA 2ADYA 4KJQD 2HMCA 3FBKA 1N0XL 5F44A 3HPLA 5BQ7B 3QJUB 3EJCA 3GDBA 2WXLA 3GU1A 4IH3A 3RPDA 1OSEA 5I6PA 2ACRA 3GMPB 3NPUA 2VZTA 4JQVA 5EHFA 5H37G 4EOUA 4LF3B 1Z5LA 4KVCL 1DSFL 3RX4A 5TFSH 4WHCA 3P4OA 5TGBA 1WSST 1HK6A 1N8ZA 1KLFA 2WP3T 4X6DE 4MAYB 2ADFH 1C8PA 1CGWA 4GC4A 5T5FH 3AQUA 5FF6B 1ZVYA 2MPAL 3RNKB 3T6CA 3AUJA 2QSVA 2R4SH 1X5FA 3HS0B 2IMRA 2VDLL 3OLGA 2ON3A 4GAFB 1D6EA 2VX4A 2ESCA 1VYRA 1RXLA 2O9PA 4I89A 1P0EA 2WXDM 3P0XA 4LNCA 3ZE1F 3PL6D 4LF1A 2D0FA 4P2RD 1OGAA 5E9DE 2PDXA 5CN3A 1O7DC 5IW1B 3H4HA 3S5OA 1IBFA 5T9BG 3WI9A 5KAQF 3ARVA 4OJFH 1BQLH 3SGEI 1V8EA 3UWZA 1QQDA 4DKFL 3MR9B 1FE8H 4TV5A 1YDVA 1PDYA 4I0PA 4N1CA 5F7NC 4P2AA 1UUSA 3DCPA 4M48L 3MU3A 3QIBD 1JYWA 3GXFA 4UIMB 3MGOA 4JPVH 5A8GA 4WY7L 4DQOL 2GQ9A 3NUKA 1MHEA 1NFIB 1QOPA 4Z0SA 1MUMA 3OLDA 2XV2A 4PPTA 2X70A 1NLDH 1YEFH 4BSWA 2Q8BL 5G4WA 2FJGB 3HNTL 2ZIDA 1EHAA 1UIPA 3WDRA 3QXWA 1AS6A 3P1VA 4NIRA 4TRPH 2BP0A 5DK0A 4CGTA 3W81A 2WQXA 4UT6A 2B2XH 5E94B 2VLKD 1CYXA 4OCSL 1M53A 2LOEA 2BOLA 1V7AA 4ZS6D 3ZE0B 3WLRA 4WUUB 1LMIA 3GJFA 4F37K 1RUQH 2VW4A 4WTQA 1E55A 4JM2A 4GIRA 1V3MA 2BLFA 1O75A 3IFOA 4IKNA 2NVDA 5DQJA 2RALA 1RZMA 3Q8CA 1REQA 3K0YA 2OXGA 1PS3A 1NQ6A 1MEHA 3LIZL 4LUJA 4LCCC 2VDKH 3BZ4A 1DANT 2ED7A 2MKLC 4OI9A 1KB5L 3C60A 5D2XA 3UPMA 3IPEA 3SB3A 3QKEA 4B91A 3QUMB 4KUZL 4QEHA 4KI5E 1UJ3C 1DN0A 4MJJA 2QQKH 4ABWA 4TNVK 1T8QA 4TUJB 1PZUB 1TREA 4NZRL 4L4TE 3P11H 3PHQB 4I7WA 2IV8A 4WFEE 1AQKL 1UR4A 2P4AB 3C2OA 6REQB 1KFGA 2RFXB 5JXAH 5DBUA 4MCYB 3SR7A 1R30A 4OZ4A 2BFVH 4JB9H 4CU7A 4EXPX 3OVQA 4DJED 3TLQA 4LGRB 4MS6A 3REWA 4Q6XA 4NZ4A 3PS7A 5BO0D 2TRHA 2VQUA 1CGVA 1J87A 1UB5A 1ZENA 3Q8FA 3I6KB 1KDIA 3OAUL 2WYZA 4HT1H 3ABGA 1Z9SB 3G04A 2E9WA 3MSGA 4K8RC 4TOQA 5D05A 2HJPA 3HR6A 5D7LD 4ZG1A 4X8JB 2WINB 4IJ3B 3RF9A 4GQ9L 1HQTA 1P0KA 3V4VB 3AS3A 4JKMA 5J0BA 4IBTA 2YSSA 1ZTVA 1ZAIA 3S1GA 3ARQA 5AW8B 1BYOA 2AITA 3DFTA 3W1LA 1F74A 4MA8H 4CEXC 1SDAB 2WB1A 3WKML 2C3HA 4RVBA 1S7TB 1AMKA 1A9VA 3LPWA 1PQZA 3CVHB 4TNGA 4ZTXA 1OCWL 1CLOL 1CBGA 4LGXA 4F27A 2GB2A 3M17B 1GMIA 3QVQA 5FK9A 2NWSA 3OKKA 3GMMA 2AV7B 3U6RA 3WY2A 2V4LA 4KJQC 1XLFA 3VILA 1IC7H 2IIJA 3WMPA 2Z28A 2IQAB 4EF8A 1KTCA 1CO1A 2QAPA 5CSUA 3C6SB 2CZFA 3DIFB 5T1LA 3FZUD 2KDGA 1KT2A 2BK8A 1TQUA 3GIVB 5C09B 5EA0L 4XWGL 3S3DB 2AJUH 1VEMA 1TLMA 4QXTB 4C6FA 1JZ3A 3EG9A 3ZDXE 1L9OA 3EX4A 3W6LA 1YJDC 4B92A 4R96A 1K4HA 4AWTA 1T7YA 1YNLH 1ZPUA 4MDJA 2QUVA 1MZRA 1R3WA 1N6QH 1POKA 4G7SB 25C8H 1EHXA 3CDYA 5L88L 1XBVA 3MBWB 4TSAH 4OSUH 1WA2X 5HATA 3T71A 2F7IA 4RIRA 4GT0A 4I90A 7PAZA 4GEIA 4WGKA 1RVFH 2GDUA 3FSVA 2DQEL 1QLEL 3U30C 1U4FA 4JFUA 3M8OL 1VCFA 2VKWA 1FWAC 5D7HA 3GNPA 4Z1BA 3B7RL 1IGFH 1UMYA 1WZMA 3FSUA 4ZFFA 4PS7A 3UZQB 1TWSA 1MUWA 4TS6A 5FPIA 3VXMB 2JQXA 5BS0E 1H1ZA 4Z42C 4YTRA 3UIZA 4GUCA 4N8CL 3CLMA 1PZ5B 1WWAX 3ZSSA 3ZHKA 1FBAA 3HPXA 5KBLA 3INUH 1S7XB 3L1GA 3TW9A 4N42A 1XGDA 5K5YA 4XZ9A 3KHDA 1MI5A 4MNQD 3ZTNL 4XO4A 4V33A 5DT1H 3L3OC 2VGLM 1XXDC 3F05A 1IM3B 5AAWA 1KC7A 1OQFA 3IJLA 2YXMA 3EH3B 3S5YA 4Y4HA 1F3TA 3CN1A 1GKRA 3NIDF 3WHE1 1A80A 4Y2DB 4LNRA 1KNOA 4B0MM 1E15A 3BTNA 1FLTX 3UYOD 3PNWB 3QY8A 4XVUD 1DSYA 4PMDA 2UVFA 2FB4H 5DU7A 4TQHA 2YCEA 1ZSDB 1BVLA 4LOCA 1U8LA 4ORZC 1V08A 2Q8AL 1F76A 1AJ2A 3B4YA 4J5VA 4H4NA 1OAXL 5IHUH 2Z26A 5EB9A 3AACA 3WQPA 4NUWA 1ZNNA 3GB7A 4PB3A 4NUQA 4UAOC 1Z3GH 1OFBA 3CC1A 4WKXA 1T5WA 3VOCA 4KQ3L 2P1FA 5BYWA 3GR8A 3LCHA 3UBXA 3O3AA 4PR5A 5BVPL 4DWHA 4JO4H 3RGVD 2ADIB 2H1PL 1I8UA 4XNXL 5FAJA 1KGUA 2HZGA 4MB1A 4OQTA 1K72A 1FYTD 2XN9D 4ZZ9A 4N25A 4H20L 3PTQA 4GVIA 1MXGA 2H26A 4FKEA 4H8QA 1NJ9A 4OBSA 2ATPA 3V0SA 4Y16B 5HULA 2BOBB 1AYOA 3LS4H 2CHZA 2V0AA 1KB5A 4ICNA 3HZKA 1JRHH 3VQ2C 4IMFA 4L8BA 2VIRB 5I66B 1SJXA 3HJEA 2B15A 1L9PA 4F79A 4XD5A 5JPNC 2N1KA 2JEQA 2CNZA 4LSRL 4E68A 2WYSA 1TZIA 1E3XA 2Y5JA 4PV1C 4DPAX 5DXWA 3CV6A 1GVRA 4MNMA 4EK7A 4V28A 2F74B 4NX5A 1A4CA 1V10A 4IX2A 5E9DB 1JVKA 1HCZA 5AZ1A 4X9FA 5DFVC 1EOKA 4N2EA 1W8OA 2H2PC 1QNZL 1E1CB 4YDIL 1GTFA 3P62A 3E6FA 3KXFD 5LXGL 3C5SA 1HSAA 5GGRB 2V5YA 3ZGHA 5FW7A 4IMCA 4ZTOL 2UWEF 1YHTA 5IWLC 1B6UA 3GWQA 3IIXA 4ZAKC 3CZGA 3EOOA 3BAJA 4W8LA 4PB5A 4HJTA 1MEIA 3NQKA 4J4PD 3T07A 5FYJE 3RRQA 4W9TA 5AW5B 1U92B 5K9JH 2VLMD 3WBAA 43C9B 3D46A 2O9RA 3K71A 1GVQA 2IVFC 1R3SA 2YAEA 1ZLUH 4M6MH 4GWEA 1B88A 2EEFA 1CF8L 3FZUC 4GI9A 3WBEA 3PFQA 3BK0A 2JBMA 2BIQA 3VD3A 4WKAA 2XFFA 2GFTA 3SQBA 4L2YA 5IHWA 1E2VA 1TEFA 4CCCA 4GG6F 2CRMA 2DL2A 1PWMA 1QXLA 3L3KA 1RUPH 5IVXB 4N3UA 3CQQA 4JHBA 1ZGLP 3H2FA 2XQ0A 3ULVD 5F7BA 1HCVA 4YR6B 1TJXA 1UQSB 3GSRA 3ZMEA 3RLHA 1WGVA 4K3EL 1LP9E 3US1A 2Y06L 2GBAA 2OMTB 4FXGB 4HZ7A 2E76C 5KBKA 2R69H 4ZD3H 3FGCB 3EX6A 3CC5B 1E5JA 4WK2B 4R90L 3F01A 2RGSA 5MHBA 2V8MA 4H26A 2BVPB 3Q01A 1CWVA 5E08H 1IE5A 5F2FA 1GG0A 3PPSA 4S11A 1X7QB 5IEKA 1MJUH 2EDBA 1HWGB 2L7UA 3F3HA 4K3ZA 3VABA 1S7VA 2JIWA 2EKCA 2PA6A 1KCVL 4Z76A 3D85B 2XHNA 1E67A 2HAZA 1FN4B 2B59B 5LIXX 4LK4A 1GVFA 4RV3A 3TCEA 2IGTA 1F05A 2HJFB 3MROB 5PAZA 2UV8G 1U3NA 4J6RH 1S2AA 3SGZA 1BOGB 4A04A 3OKOB 1ZU8A 2VMJA 3IDMA 4FOUA 1ITUA 3U25A 1XEDA 3E3HA 5DCDA 3VCNA 1E4XI 4M1GH 2HS8A 2QADD 4NCC2 3T6WA 4JNXA 3DARA 4IGBD 3O3BB 3SPCA 3JTTB 3GTHA 3CWHA 5J5RA 4F3FB 1NGYB 2J56A 5TE6L 4QMEA 3BWUF 1UR9A 4R84A 4LIQH 1PNCA 1O9ZA 4GRMA 4NGHH 1YUKB 3BW9A 5D96C 2XG4A 4EOWL 2NQZA 1VCVA 4HKPA 2IXVA 4AD1A 4RSYA 1TKWB 3VWJB 4PWEA 4MM1A 5LG6A 4ODXB 4RDQF 3GH7A 1J96A 4KKRA 4ZQRA 5T5NF 1RUSA 1KGCE 5HGAA 1ZLVK 5CEZH 4TNEA 4BSVB 1XIWD 3HE6D 3L7FB 1GYUA 3ZMRA 1PXGA 4XOCA 1QFOA 3RLUA 1TZOA 2NYKA 1NM9A 4TPRL 4P3DB 3S36L 1HFBA 1FDJA 4PWFA 3ZXWA 1Y0LB 1I7ZA 3DBNA 2AJZA 4EKJA 1TSRA 4AVIA 2ASHA 3K2KA 4YDMA 3KYAA 1YXYA 3B6SB 4P4KB 3OZYA 3GDMA 4GUPA 4WGWB 2YDQA 2N01B 1KBVA 3LEVL 1ZS8B 2UZXA 2VL5B 1P6FA 2YZ5A 1EFZA 2NYYC 4TUUA 4C83B 4W9LC 4L2LA 4AD0A 1EX0A 5EFFA 1N5YH 4M1DL 5I79A 2PDCA 1G6RH 2QZ5A 1TJRA 3ZDXB 2Y7SA 3OMIB 3WK0A 4N87A 4Y4KB 4UT6H 3Q2WA 4HWEH 4GS7C 3UC0L 4K3JL 5E8PA 4F7EB 1O0VA 2OA9A 4PEEA 2EICA 1BCIA 3F04A 1M1BA 3SYCA 3QCVH 1WISA 3LDBC 3TNMB 4YFLF 4S3FA 1C8QA 4B2DD 3U0PA 5E0QA 4L9XA 3HGJA 1I1AC 4RZ6A 1D9KD 1T40A 3DTXB 3WY1A 1OSZA 3ZVIA 3QNZA 3QW4B 3DX6B 2BW4A 3NCEB 4NNPH 4YO0B 3NL2A 1NWTA 3CMGA 1JZ5A 3EJYD 4XCCH 4XKYB 3U2CA 3LOWA 1E0TA 3PQYA 4LMQI 5BS0B 1LLWA 3P67A 4Q22A 4IIGA 2BP8B 1HNGA 5LQBH 1GGBL 4M81A 1EAPA 1KFJA 3QJZA 5TDNB 5KMYA 4AVHA 3MZNA 1JGMA 4NUJA 4LFHD 1V0MA 2XWBB 4XN4A 2R9RA 4HKXB 4JHAL 5BOPA 5ALCH 4F0SA 1XSIA 4LVNC 3COOA 4X42A 1XF4A 1NARA 5HQLA 4PC8A 3AQYA 4HFUH 2VLLA 1HHHA 3QR3A 3STZA 1R86A 2NLJA 5A1AA 5E1AA 4J4PC 4MJ6A 1AGEA 4Y1TA 3RIFK 1U8QB 3QV7A 3NVTA 2Y4SA 1G01A 2O72A 1SLUA 1FKWA 3LV3B 4A39A 1KYFA 2ZP0T 1G7VA 4YS1A 3IJDA 1I1FB 3U2SA 1FP9A 1Q65A 5FB8A 4GW4A 2NMSA 1H4PA 1WFNA 2E47A 2D7TH 3CUPA 3VX1A 3KDOA 1OAYL 3ULVC 1GW6A 2DKUA 3VDHA 3ABQA 3FTGA 4D6JA 4K2UL 1W32A 1WDAA 4QDMA 3GBNH 3K72A 1ESWA 1GGUA 1P4LA 1OK0A 4PHZA 3KPPA 2ARJB 3WO4C 4IL0A 5D8ZA 1A5NC 3VI4F 1YC7A 2PUQT 4WEBH 3TIEA 1FGVL 3B5HA 3H8NA 1WUNT 3DJ9A 4XN5A 1XINA 3PB0A 3QORA 4UTCA 4IU3A 4W84A 3ZE2E 5C08D 3DK2A 4O10A 2P80A 2IOIA 2HWZL 1JSYA 3BH9B 3AMKA 2JNZA 3K46A 2EEBA 3INOA 4BRVA 1INDL 2UY6B 5K69A 3CZKA 1TF4A 1N0XH 1OCBA 4N6EA 3ERPA 4MS8D 2IDSA 4BFGA 1QW9A 1BIIA 1A6ZA 3S8FB 4W9DC 4XT1C 3DX2A 3BO8A 5AHEA 3CPUA 4ABQA 3XIMA 2A6IB 3TBSA 4TXVB 4M6PA 2CLLA 2QADC 5FLVA 5MEPA 4ABVA 2AMXA 1BG1A 3L0NA 4PREA 3B9AA 3SUTA 2DI8A 3HA0A 1JV5B 5GS0L 4I9AA 5INDA 3TA9A 1BDYA 2X30A 4DO5A 1AR1B 1YNKL 2DQIH 2QGDA 4YIQA 5I0VA 2MPAH 4MNKA 1EXGA 4BY3A 4UV7H 1EJ7L 1LORA 3PPCA 1Q63A 1KJ2A 4FTVE 2O9TA 3CFCH 3N4FA 1MEWA 2FUTA 2GBUA 1VYPX 2J6EA 4ZTPL 5I1DA 1U30A 2CUHA 2Q8XA 1Y07A 2YUVA 3MRFA 3P93A 1ONQB 1RURL 5ABAA 2NNAB 1JPGA 3T0CA 4JYEA 4WIQA 4PRRA 4GPVA 1WYJA 1CLVA 5D7IB 4HJEA 5F7LB 2GJZA 3RTQD 2UYLA 2G9HB 3TZVA 2BSDA 5LGHL 5H8MA 1S3KL 4GA8A 4WDXA 3TN0D 4AQ8A 4X9SA 4QJ5B 4UMBA 4P2OC 2COQA 2G4EA 4MVBC 4OIIL 3L9CA 3EYQD 1TEYA 3L3HA 5CHNA 2XNAA 2AK4A 4F1SA 1U42A 3WO8A 3K1DA 2Y2TA 4M48H 2XQYG 4ZB0A 3Q37A 2QR6A 4MMWA 4Z2GA 4WY7H 1Q0XL 2GSIB 3KWUA 4DQOH 3IMRA 5DVOA 3QDJB 3CSFA 4OV6F 2IAMD 2OWXA 1A50A 1KB3A 4WI8A 3BRGC 3VWKA 2X4QB 1JWUB 2WWNA 5I0ZA 2J72A 3HNTH 4MNHA 5DJ2A 4HKBA 1G7IA 2SODB 5AECA 4PRIE 2QDGA 2QKSA 1LNUB 3WFHA 3RN6A 4XAFA 2JB5L 2XSBA 3OO2A 1D9KC 3BXNA 3S0CA 1VRDA 2X0SA 2DIEA 4AEFA 4ALAH 2W9LA 2FPYA 4G7FA 4BR1A 3SGJC 4H3DA 1Q9WA 2AGTA 1BMWA 1EZ2A 1SOKA 1UD4A 1XSKA 4X22A 4NQVA 3EJYC 5AVNA 1SBSH 3LPFA 3IU3B 3WHXA 3L67A 4KJPD 2ITDA 3BJ91 4E2DA 4NZUL 4AG4L 1S5IH 1HQ4B 1MHCA 2VC6A 2WB7A 1SQMA 4PODA 3LIZH 3ALGA 4LLMA 3T1FB 4ZMXA 5E24E 2V17L 2CG9X 2JIEA 3STGA 4UT9L 5DSCA 2BSRA 1UASA 4XNUL 2E6FA 2YW4A 2F8QA 1TT6A 3SDCB 3I3EA 1AQKH 3BN9C 1T6VN 1KTNA 5EWIH 4X7CC 2IANE 3NPSC 1C5DB 2I7OA 1T1WA 1ILSA 3HW7A 4H41A 4XNBA 2QELA 5HHQA 3IGAA 4S3AA 3W0WA 3KLKA 2FE0A 2Y62A 2ICEC 4Z3IA 3EYSH 1XGTA 3N9GH 3VFNA 2Y6TE 4JE0A 1KFEA 1WDQA 4R5TA 2LGNA 3WXVL 4NAMA 3OC5A 4BQCA 4DP1X 3CEUA 2BNRA 2EPKX 1RBAA 2AXHA 4GQ9H 3GXIA 5XIMA 2FIKA 3QRLA 4J3OC 5JDSB 3CUFA 5SWZE 1ETZA 4GW1B 5B38A 4XPAL 2Y8UA 2GVJA 3N34A 4JK0D 1EA0A 5DJZB 4NLAA 3IFNL 5SWSA 1AO7E 4HLZH 5EZJA 4MA1C 5DJXA 3KVPA 1OCWH 1W5QA 1YZZA 3SUUA 3D9AH 1NQKA 3NCYS 4D7PA 4URKA 8TIMA 1LD9A 4E2BA 4Z9KB 4N2DA 1XX9C 5I6LA 4GYPC 3ILEA 3L4ZA 1WZAA 3S4SA 4FLHA 3PABA 3QGKC 3TBYB 1T89C 4JFXB 3LQAC 3KOZA 5E4EC 5F8QC 4MS8C 2W59A 3BEVA 4BF7A 4ELKA 4HH9A 2YAMA 4W9FC 2H6PB 5L6UA 3FOMA 2J2ZB 2NY1B 4AZIA 3RBGA 2J88A 2Y5EA 5EA0H 4NO3B 2YD7A 4XWGH 3TIMA 1MSSA 2FT8A 4RMVA 5I1KH 5E5RB 5C07D 3KEHA 4WGXA 5C0CA 4MAYD 2MTPA 3PP3H 1QAPA 2GABA 1WV2A 4DJFA 3QYNA 4R2GC 5L88H 1OSPL 3SPVA 5ID0B 4U1JB 4R5XA 1CR9L 1FIGH 2WUBL 1JHTA 5GJTL 5C2BL 4XO5A 4MIMA 2VC2B 3FQUA 4O2FB 1E9ZB 4XAYA 3E0VA 2EQDA 5E8DH 3QFDB 4JCMA 1QLEH 3SOTA 4JO2L 3M8OH 4ORMA 1AGCB 4PGCB 5HY9B 4XO9A 4RLDA 4YWSA 5AOIA 1QSFD 1F3DJ 4GBDA 1P5UC 3S2JA 3RTQC 4NDMB 3T3PF 4BYHA 4RE3A 4UQDA 2HRWA 2XWTB 4KEUA 4WW1B 1L6XA 5I8CB 3WLKX 5I1GL 1JNHA 1MFBL 3K6DA 2NX1A 1GYVA 3B40A 3EYQC 3U4EB 4N8CH 1N9PA 3H7UA 5EBWA 1F2XK 3JZEA 2PZ0A 2VUOA 5FF4A 3FNDA 5AVQB 1FCBA 4XUYA 1HXMA 2NQCA 1DQUA 3NK4A 3NRQA 4ZW3A 4L4JA 4QQ3A 3BLDA 3GPEA 3E8VA 4OZFH 3WEXB 1URZA 2Y22A 2EIKB 2IAMC 2D2CC 5F9OH 5JHBA 2Y69B 5TDPA 4HA0A 1IEBA 3CZJA 3SFKA 1LZOA 4LHQB 2HPTA 1XO8A 2KAUC 3POCA 1C5CL 1VPYA 1JP5A 1INQB 1X5JA 1QNSA 4YDJA 3AY2A 3TT1H 1H3WM 3S5LA 1SEQH 2H8ZA 3BZ5A 3ZE2B 2XIBA 1FDLH 4I4WB 1J8HE 4US5A 1EEXA 2Q8AH 5C0AE 4L8SB 2IH3A 2VD9A 3F7VB 1P1VA 1H09A 1HVXA 4LFHG 3AFBA 4ES4A 3BOLA 4KQ3H 3F84A 2R1YB 1DKWA 4RRPM 3JVAA 3NCWA 3FSWA 5BVPH 1BJ1J 5A6KA 2EP6A 2F2KA 1J0KA 2PE4A 3V8CA 3CMJA 4GIEA 4MQSB 4GHRA 1WF5A 3UPBA 5GGSY 2W92A 5DK2A 5TH2A 1SM3L 1KBPA 4PH6A 1H5BC 3P0VL 5HGDA 2P8MB 3EADA 4QCEA 1BV8A 1OGTA 2FZDA 3N41B 1FH9A 1SJDA 4N8PA 1RJZB 5KSVB 2NUPB 3VA2C 5BROA 2UUDH 3B0VC 3I02B 4UT9A 1V0KA 3GF8A 4U5KA 3V9EA 1BQGA 2QJJA 5CZXD 3Q7JA 5F1IA 4LSRH 3NZUA 3CSYA 4W89A 4FTVB 5TPWH 1XRSA 5DFTA 4XMXA 3VPLA 1EJWC 1W72A 3ABZA 3W5NA 1U8KB 3KH3A 4JL1A 5K9QI 1J5TA 1NY1A 5BZWA 4KFZC 5I16A 1SDYA 3WLBA 1IAIL 4ZPTB 4MXWL 5D1QE 3VKJA 1QNZH 1QZNA 1OX5A 2GJXA 4C1NA 3RMEA 4X4XA 3MYPA 2DH3A 3GUTA 1WTGT 4N2AA 4LB4A 3PR2A 4ZQOA 1I7RB 1H3VA 4HJWA 4BE5A 4LSSL 1BYPA 5BVJA 5H35A 4ZTOH 1CI1A 2HJKB 1UXLA 1YRKA 2WVUA 3WS3B 4D9RD 3ABKB 2D4DA 3WX7A 1NGZA 5EGRA 4K7YA 1ICSA 3Q65A 3EKCA 5EEWA 4W68A 2QS8A 4A3UA 1Q6DA 1LBMA 4DP9X 2C34A 4YVNA 4B9IA 1CF8H 4E8CA 1FHGA 3LKPB 1S7RA 3G22A 2A7PA 3SPIA 4XX1E 4H9ZA 4NPYA 5F1SA 4S0SD 1FH2A 2C91A 5A2KH 4MMXB 2VR4A 3X3FH 2C1GA 4HAFA 5T1DL 1SMDA 3DOSB 3QCUL 2BM3A 4LHUB 1FL6B 1HYSC 4NQDD 4FDWA 1XH2A 4HUMB 4MAYC 1KSRA 1EK3A 3FU0A 5CSYA 4K3EH 5I71B 1BJ8A 2YXWA 4J2QA 4R26H 3M0JA 4RBPH 1QEWB 5K9DA 3I9PA 1U3HA 1RH8A 2BJML 3WLQA 3PAUA 3TBWA 5HSFA 4MZIA 2W88A 3TM6A 1UC4A 3GMRB 4AL8H 1U8IB 2OB3A 4OOZA 3HS0C 2CYGA 5IFTA 3FH7A 4O9HH 4R90H 4DCQB 1K5NA 3V5FA 3VH8G 4QSFA 3SPJA 1QI3A 4PRDB 1F97A 2X4RB 3BP4A 4Z18A 4JHWH 3NH7L 4LCWD 1W3IA 3CYVA 4XO7A 3KBMA 5I82A 3TT3H 1NC4B 1KCVH 3LKSA 2IANB 1GJPA 2J24A 3CFMA 3JUYA 2DZAA 1H63A 3QEQD 1FDZA 1YEKH 5A7EA 4X6FA 3P77B 3SPHA 4MD5B 4AEHL 3TSMA 1UWTA 5AEAA 1N6VA 5FF0A 4APXA 4UTTA 4M7ZB 5EMKA 4DUWA 2IPWA 1BGAA 1ZGLM 1V3JA 4MZ3A 1N5AA 4EAMA 3BG5A 5LGZA 2VNCA 2DM4A 1R3JA 1IM3D 3GSNH 4B9ZA 2ACQA 3QFJA 5TE6H 3WKNA 5PCYA 5LNVA 5SWZB 4MCMA 4Y2DD 4EOWH 4H83A 2VDPL 3O9NA 5I02A 4IP7A 1PKQB 3DROA 3PZNA 3RWCB 1AO7B 5DRNA 2MCAA 4JANA 1OD8A 1MXDA 1XQ4A 1EFXD 2Y24A 5EU5B 3B06A 3BWAA 2G4JA 2X2JA 1KO0A 5DHDA 2ZQ0A 2B3IA 3WIFA 4WW2F 3WJWA 2G41A 1GOKA 2AKZA 2MIZA 1F00I 4IM8A 4EEEA 1EXUA 4NRZA 3TLRA 3OVUB 3A6OA 4WVRA 1VF5C 3EBAA 1HILB 1XGQA 2Y7MA 4U1IA 4S3EA 5KSBE 1I0DA 3RIAK 1P2CB 2FDBP 2OT1A 4ANKA 5FOOA 5D2LF 2ZBTA 1PZ3A 4AQEA 3O07A 1YY8B 2I27N 1GMEA 1GZJA 3UWEA 5LJYH 3CHEA 3RPIA 1J5HA 4XZWA 3QEUB 3ETTA 4ZUWB 3VXSE 3BQ6A 3QH3A 4DAFA 1QPPA 4I9MA 4QRSB 1FBIL 3UX9B 2DZUA 2NSQA 4K3JH 4ODHL 4NKIL 4BCYA 2VITB 3OM3B 4OJCA 1GS8A 2ZRXA 1GVOA 1MUCA 4JFPB 3I6GB 1LDPL 3MRLA 3HHSB 3G1XA 3W70A 2VWSA 4FI6A 2DTMH 3MKGA 3BGFB 3SY0B 3H56A 4B9KC 3FW6A 1UXMA 1LK3L 3BHBA 3PDGA 4IGHA 1IAOB 3GDKA 2R23A 1B0IA 4IBZA 3ECVA 2P28B 3H9SA 2YD6A 2YD9A 1X5KA 4IJ3C 5DYOA 4EXAA 4UFJA 2H32B 4MMYB 2YZ1A 3VB8A 4D6HA 3W7EA 3PAJA 5F9DC 4XV0A 3GQFA 2EXOA 1EXHA 5GRVK 1UZ6F 2ZXAA 4L3EE 3KBJA 1OE1A 1TWIA 1GQKA 1ZAJA 1PD1A 1M6OA 2VENA 1FH7A 3ARRA 5CGQA 4UC5A 4JRFA 2FLRT 4JHAH 3MYOA 2B7DT 2D7NA 2Q7YA 1ZWIB 3VI3E 4PJXF 4OCXH 4RMTA 3QS3A 2F54A 1FNGA 1I7TB 1PY4A 1KR1A 5GGSA 2NR6C 4I18A 3UWQA 4MJIE 4A2FA 4HHAA 4DFIA 3QXBA 2KL6A 3AU2A 2INZA 4UOZA 3WEMA 1WE5A 1SXBA 2BWDA 1R38A 1S5VA 2QUMA 2CHOA 3WYRA 1XI3A 5E9NA 4OFCA 2IDQA 3MRNA 3U2OA 4N86A 3ZQWA 3PGDA 1KELH 4RE2A 1DHKA 1MFDL 1PAZA 2WGNB 5REQB 3T8LA 5FM8A 2TSAA 2P42B 3DPDA 4K2UH 2HEJA 3IJ6A 2ZRVA 1BXVA 4F40A 4JJ5B 5HDQL 4GBXA 2A73B 3KM1A 4B9FA 4Z7NF 3GU9A 1FGVH 2ED9A 4AENB 2QVMA 1UCBL 4YEEA 2ATSA 1TV2A 3QSKB 4Z7UF 1UOKA 3K0WA 1NOFA 1YUHB 5EBUA 3SY1A 5DT5A 4M61B 4UUIA 5K9KA 5BRZA 4J3XA 2IMNA 2A6KB 2BCKB 1J9QA 2CJUL 5DJYB 3TC6A 5AQ0A 2HWZH 4IBYA 2Q6ZA 3ZZ1A 4PUDA 1J9CT 1INDH 2EH8L 4H8PA 3K80A 1AHKA 1T99A 5F70A 3KWTA 4MQ7A 5F7FA 3LZLA 3RWJB 3MRJA 4KZEL 3D0VB 4P23B 3NDOA 2GTWA 2AV1A 2E6DA 5IHZB 5BXTA 4Y9NA 2C19A 2BNUB 5IJCC 2UBPC 4OQTL 1OK6A 4XP4H 4PLOB 4HNUA 3ARZA 2IH9A 4NO0D 3E80A 1JXGA 2F8OA 5ICYB 5EEYA 3TH4T 3HOGA 4U6VL 1TVHB 4QEGA 5TBOA 5GS0H 3ZN6A 2J62A 1TR9A 3SRDA 2C9PA 3VDCA 4YSUA 1YNKH 3D50A 5HK4A 4IISA 3GNNA 4Y2DC 5T33H 3RIKA 2CITA 1JDEA 4CSTA 2ZSVB 1H15A 1AGFB 4RESB 1KW1A 1HUVA 1P7KB 4XO3A 4FLSA 2ZVRA 3VWJD 4HUKB 5AVRB 3VXUE 4KMLB 3G08B 5DWPA 1X5YA 4U1HA 4L56A 4LLYB 5CJBA 4ZTPH 4RZCB 3LH2L 3VSTA 3AQDA 3GBMH 4FXSA 3JTSB 5TK2A 4JX5A 4OLYH 1ZA3A 3QR0A 1XX1A 3NAVA 1D7FA 4NZJA 3S3JA 5T8GA 4UQ9A 3LKNB 3VD4A 4H19A 2OO0A 1LOLA 3EMCA 4KETA 1KM6A 3Q2VA 1KIPB 5LGHH 3QXDA 3GVRA 3MMWA 3OBKA 1ACYL 3NRFA 1L6YA 3NIGF 3FYYA 4GD0A 3NJFA 5A7BA 4YHOL 4LDLB 3PHOB 4GUFA 4NENA 4L4VE 4WHYG 2BY1A 1ZHKB 1I1YA 3HIJA 3HN8A 1QK2A 4UMCA 1NCJA 3EFOA 3V4BA 4URIA 2VDQB 2VSMB 1N4XL 2CHWA 1Z66A 1KM3A 2P5WE 2JKWA 5DFVD 4Y16C 5EO1B 4L1HA 1NBVL 2NY7L 2GGGA 3CXHK 3S8HA 2H2PD 3CZFA 2YXOA 4Y4KD 2Q87A 2DW6A 3M5XA 5FUZL 1PYWA 3KW8A 1OFRA 1X8FA 2HN7A 3NXLA 3C8HA 3PZVA 1J1XL 1VADB 3DX7A 4NASA 2GC7C 3SRHA 3EA1A 2KDYA 5I26A 2EYSA 3CDGA 4N2OA 4DETA 2R94A 2JB5H 5B3JE 4LKCB 4QTIL 3WL0A 1BQHG 3H0TB 4ZAKD 3LN4A 5I3IA 1JNNL 3ESNA 4Z0XA 4XSLA 4DP7X 1A6VH 2AI0H 2DJLA 3EPOA 1BF8A 1BF2A 4PBDA 1UUOA 4P3CH 5IFJB 4NZUH 4W6XB 4IHCA 2CETA 3KPSA 1JFHA 3WFLA 4R53A 3QIUB 1QI2A 3WUFA 3TC7A 1G9HA 4K9EL 2ED6A 3LMJH 2R82A 2DDQL 1J5OL 2W8CA 3CVCA 1CFQA 3PBUA 4XNUH 1CICB 2IOMA 4N9GB 2X3AA 1A4KB 2QPFA 2PO6A 1AQ0A 4L1GA 3H70A 3V0GA 4PUMA 5FECA 2H0FA 2H9GA 2F53D 3K4AA 1JCJA 3OJ2C 2RHEA 2GDVA 5LIWX 3WE6A 5A40E 4R97B 5EC2A 4E9TA 1EJTC 4PMZA 1YDOA 2VN7A 3RY6A 2DSUA 3TDFA 4S1RL 3TYFA 4HIHA 3HHMA 4B96A 3UWYA 1TTBA 3W84A 2PF8A 3PDOA 1UA3A 3ORJA 4FFZA 1IX2A 3WXVH 4ODWA 3IBEA 3NCYP 3WFCL 4JFZH 1OARH 4WFGD 5IUCA 3UZVA 5ITFA 4OI7A 2ZUSA 5IVOA 4G1EA 4FOJA 4TQEL 2X3CA 3PCYA 1EC7A 4QXWA 2QLVB 2I60L 1JAEA 4AYMC 3PWPA 4N90D 1ASPA 4XPAH 1J8RA 2ZTJA 3SD5A 3ABMB 4FXGC 4OCNC 2XPKA 1MCPL 4R7NA 3P82A 5KSBB 3IFNH 4ZQKA 1GVEA 2X9YA 4JRXA 1QNVA 2HX8A 3U9UA 2CH8A 3W7LA 2LLLA 2J75A 2XZ7A 4IS6B 2PU0A 1AGDA 4XTDA 3HMJG 3PSVA 3D69B 5XINA 3KDNA 3I50H 4AGPA 3VXSB 1BXCA 1RH9A 1JRHI 4HUNB 5C0GA 2P88A 3ASNB 5HR6A 4BWWA 5A6AA 5KYYA 5HBBA 1HHIA 3U46B 3QDHA 4WEVX 2FFCA 4LRIA 1YPZE 4HIJB 4M8VA 3OBAA 2WZPD 4UNKA 3KD4A 3OR6A 5CEYB 3V5HB 3NAAL 1T6MA 4BH8B 4EUPH 1AD9A 2NTFA 3QDAA 4MD0B 2WMJA 4P8WA 3TEWA 2VXUL 4KHTH 2V7NA 3T8XB 1CS6A 2BY0A 4OR1A 1SJEB 2VI0A 2BW5A 4Q8BA 1NLBH 4ZQCA 1V7NH 4YYCA 1G4MA 2YBTA 4Q9CA 3S96B 3L7EA 4CADA 2WUBH 2NYYD 4L3EB 4D2JA 2VXNA 4CMHB 3VXPB 3VWJC 2VN4A 5GJMA 1E6JL 4X6DB 1YQ2A 1KFCA 5I3FA 3L1OH 3FFCA 2B4CH 4JO2H 2NQ5A 2D1ZA 1XYMA 1E8WA 5FLUA 4GKNA 3BH4A 4QXIA 1GHFH 4G5ZL 2CBUA 3RPMA 3KYNB 3LY6A 3TWCL 2ZF9A 3DIVA 3Q1EA 3NQDA 1TZHB 1J9YA 2UUDK 4FADA 2DWDB 4C5ZA 3AREA 3HUJE 4ROPA 4EACA 4JO8A 4XVDA 1UXWA 5I1GH 1I1AD 4MNJA 1AQMA 1HEZA 1HKMA 2CR0A 2AQ1A 2EKSB 4Q4PA 2CU0A 5ICZB 4A8NA 4P4KC 4B9PA 4LCQA 4G72B 2YQBA 1BSIA 1XF2B 2QQNL 2VSKB 3C8NA 4MUPA 3S5NA 3VYLA 5T3XE 4OCYL 1TV5A 5J12B 3Q4DA 4L3CB 1RFDH 4DYEA 2QDHA 4NRSA 4I3RL 4PBXA 2XFWA 3EGJA 3N11A 4E41D 2UWEA 1YYML 2HXAA 4Q3MA 1R4XA 5KG9A 4HSNA 4FQXA 3LRMA 3VU2A 5JO5A 5HOSA 4Y4KC 2XV3A 5EU4A 3CAKA 4XCEB 1E9IA 4U0QB 1FZJA 2GJNA 1EBPA 2PWGA 1H41A 1A2YB 3VM5A 5LUMA 5ICXB 2X7LB 4KCUA 1OT1A 2K7PA 5CPOA 4H9YA 4P9HC 4EPDC 3CV5A 3WQDA 4UM9B 2XY1A 2J8TA 2I9UA 4PP1D 3WOVA 2EDOA 4GG6A 3OLIA 2IALB 5CLTA 3WDIA 5IEHB 1LQBC 1EBHA 4AW7A 1G4TA 1M6UA 2IFGA 1D5BA 3CUGA 3D34A 4EWJA 1ZCRA 5FA4B 5I3DA 3SYPA 1P1MA 2Z4QB 4PVLA 5AKVA 3AI0A 5B7EA 4EE9A 3KHJA 4MDIA 1GZQA 2TRSA 1TV7A 2AAAA 5ADOL 1Y1DA 3GXTA 5B4MC 1E42A 3C2EA 1S9WB 4RCAA 3A9IA 3AS2A 4BZ1A 3VFTA 2G8ZA 5CN2A 3MSPA 2DYPD 2P24A 2IWKA 1T0MB 5F2IA 1YC8A 5EMMA 3VIKA 3NZRA 1SM3H 4D7BA 3LGDA 4HCFA 1E9QB 1UWUA 4MWAD 4DT2A 1FWDC 2CXEA 4KDWA 2WQDA 2IKJA 1LRNA 4OF6A 4E5XG 1BZ8A 2P49B 1TVPA 4LTSA 2HP4A 4XZBA 3R8RA 4M7LT 4RBPK 1JMZA 2PLCA 4FSAA 1BVKA 4K7PY 3F8UB 1DFBL 3JYCA 4Z5RA 1AXTH 4NQXB 4WOQA 2MEJB 3H2OA 3Q06A 5EV7A 4NILA 1LEIA 4IIZA 3LX9A 1N0LB 3IFPA 3VXUB 2V67A 1HF6A 4L4TB 1F8MA 1D2OA 2XXFA 4W5UA 4WENB 2Y0FA 3N85H 2XUCA 1IC0A 2ZOTA 3GNOA 2B1HL 4HA3A 4IU2B 4WI5A 2D31A 2J7EA 1M2VA 1G4SA 3L5WB 4U1NA 3MB9A 1W6TA 2Z2UA 2ICWI 3B03A 1X5ZA 5I8OL 1N55A 4PZVA 1OOAA 2G3XA 2FEJA 2OTWB 1IQDB 5DHVA 1E0OB 1G9ML 2A38A 4PL1A 1F11A 4Q8PA 3UTQB 4GAGH 1F3JB 3Q5OA 1KJ2L 4JVWA 5F7DA 1TZGL 4L4VB 2R7EB 4X6EB 2APFA 3SDDB 2EJ1A 4LSSH 3FF8A 2J6EL 3T2QA 4JFOA 2P5WB 5JPMB 1NGWB 1SLVA 3P84A 1HZHL 1TVNA 4P46B 4XBMA 5MKGA 2YCKX 4HFWB 4QRRD 3VU1A 2YC1A 2HH0L 2BSEA 3PFUA 2HYMA 2RCSL 3PJSA 2H90A 5DJ8B 3KCWA 4OF5A 2IH1B 3UZXA 2CO2A 3NJVA 2EECA 1MO0A 2I9TB 1JWMA 2EABA 2FR4B 1USQA 3REVB 4GY4A 4OLEA 2Y07H 3T09A 5FF2A 5T1DH 3KVJA 3ARUA 3D0AA 3W39B 3HF3A 4QDPA 3ZDZF 3STLB 4CNPA 4IDLA 1PF3A 1T22B 4ATDA 1QVOB 3T4CA 3LKQB 1AR1C 1ROWA 4P2OD 5KVGL 2N0MA 4MVBD 4CMMB 5ESAA 2BJMH 3KBPA 1OP3K 1LM8V 3DXAE 1PCKA 3CSGA 3E12A 5IESL 1X5MA 3JWNH 5D2WA 5CS7A 2H2SD 3JV4A 4XGZB 5BUAA 3VUSA 4UTMA 2MQCA 2Z7GA 4O1CA 4F0HA 1CL7L 4GZEA 5CH9A 1IGYB 3G1YA 1MJJB 3RZWA 1BEYH 2ISFA 4ZCWA 1YNYA 2YO3A 3UFYA 2CKBA 3NH7H 4DKDC 5AOLA 3AOFA 1PPIA 1Q4NX 3N6YA 3BIAX 3GJFH 3W72A 5EU6D 2QVHA 3CUIA 1LE5B 1X9LA 1ETJA 4C1LA 4G1KA 4PG9B 1WZ1L 2FJFA 5KSUA 1W0MA 5C0JB 3CT2A 4JG1L 5AD0A 4L7ZA 1RZGA 1ORSB 2BMKB 4DP6X 3Q05A 4XNYL 4R7LA 1TA3A 3PZ9A 3SDOA 1P6AB 4LAZA 2CLRB 4M6OH 4R7WA 1S3TC 5M95B 3T0EE 3NMEA 1T7LA 3GPSA 2PRHA 1A0CA 4G7YH 3BLIA 4NKOB 4AMXA 4NZTL 4EBQL 3PBWA 1WDRA 2Y1ZA 3R0UA 4D1IA 1FCUA 1SXZA 3MLTA 4HTYA 4GP4B 4XD4A 5MHSE 2A2QT 4PTTB 1JZIA 2VDPH 2ZCKH 1N19A 3BLLA 4PP1C 1XIBA 1QKZH 3GZQA 1UM5H 1PLCA 2PDKA 2A6DA 3BN9D 3WJMB 4UIKL 3BGGA 3KBFA 4LLUB 4YQXH 2X5PA 4YWGH 2OMWA 2B9BA 1VJZA 1CDBA 2LU5A 2RH9A 3GXUB 1S8DA 1MELA 1FCCA 2BFGA 4JZ5A 3VI4A 2GGJA 2J7LA 3DC0A 4EI6B 5KBMA 3EAKA 4NP7A 3MC0A 4IOIB 4F0MA 2BLEA 1HCFX 3K30A 1WS8A 1F6FB 5FEZA 3W9DB 3DVIA 1YPZB 3MZTA 4WJEA 1NM4A 3ES6A 4H8WC 4BFRA 1QDSA 2QSQA 1PEZA 2D4FA 4MWAC 1YHPA 2YLLA 4ZSOE 1NOUA 3QG7L 4J3OD 3SDCC 3L95A 1I82A 4RNRA 2J6XA 4QD2E 2NV9A 1DCLA 1FBIH 3ILQC 3CGTA 4OCRH 3KZSA 3WJLC 3GHUA 4JXCA 3OWRA 4F80A 3RRXA 3VAEA 3TPKA 3NEXA 5KS9A 4M00A 4Y8FA 1FDYA 4K5LA 5L6YL 5F7HA 1LK3H 2DM2A 5BRBA 4BQBA 2J88L 4A2MA 3QZWA 1H61A 4WDTA 1TTQA 4ORIA 1E27B 1KTLA 4HS3A 1WUZA 4JN7A 3W53A 4J3SA 4PD4J 4JKNA 3KPTA 2PP1A 3VQLA 3NL3A 4M5SA 1N3NB 4JX4A 3HLKA 2PTDA 4I2XE 4KVCH 1DSFH 1JGDA 4QNWA 1WOAA 4PW4A 2JIXA 1E4JA 2ZKYA 3M5YA 4HSHA 2P3YA 2BGQA 1UW9A 4DKEL 3BAKA 3L4YA 3SE8L 4XCNA 1IAKB 3V5OA 2J7FA 2HZHA 1U0QA 5D37A 5GGVY 3CV7A 3NZPA 3BUIA 4RX4D 4R2GD 2XPGA 3LIUA 5AZUA 3GWJA 4GP8B 4NQSB 2HK0A 5EPDA 3GMOA 2VDLH 4X7SL 2JKPA 1EJSC 2XICA 5H2BB 4UTWC 1PTZA 5C6MA 4DM1A 2CLKA 2VVSA 3NACL 1OFDA 4A2DA 1H51A 3SY5A 2NY1C 3BDBA 1VCBC 2WTRA 1DIKA 4U4MA 2G4FA 1MFDH 4U6YA 4JJOA 1YMMA 3T2OA 1KTDA 4AGLA 4GOAA 1C29A 3ZBMA 4U6XB 4DKFH 2C9XA 3P6LA 3NNTA 1QNOA 1NIUA 2J8GA 3U4FA 3W27A 1W1ZA 5HDQH 3D08A 1W17A 3N12A 4HZ6A 4WHDA 2H2SC 7REQB 1OJXA 5KYWA 4EF3A 2FT6A 4EIUA 4X6BA 1Z7AA 3C6EA 1XGYL 4G7RB 1E5UI 5GGVL 2NLIA 4FQIL 1WO2A 3A4XA 1SUJA 4NRRA 3RWDB 5JMRA 3F65A 3DFHA 5EEVA 3PXHA 1ZHBB 4OGYL 2OO6A 1LP9B 5BMXA 3QY6A 3KDMA 2Q8BH 1CB2A 1F13A 3MRCB 1CN4A 1SYSB 3M0YA 2FGLA 3RWHA 1BWMA 2EH8H 4X63A 5H37A 1UGNA 5CPLA 1TO3A 2QZRA 2YN3A 2C15A 4XMVA 1SYVA 4ZMPA 1ND0B 1KCXA 5DY2A 4OCSH 1EEYA 3BG9A 2WLZA 1CGUA 2GEQA 4PJEF 2W62A 1TKKA 4RKAA 2C7UB 4OQTH 2I32A 1XLKA 2VUNA 4FP8L 3UTOA 4R7DA 5D1ZB 4CEUC 1E51A 2BP1A 4G9FD 4KDTA 4N3TA 2RH0A 5KVDE 1SHMA 1TTFA 4IHOA 4JZJA 3LHTA 1UFUA 2RA1A 1CTOA 1KB5H 3QEHA 3UBPC 3ET9F 3OHIA 4FEMA 4KUZH 2J8UE 4TSCL 1YXCA 4LUYA 5IIEB 3HKFA 4DZAA 4N20A 1PTAA 1TQBB 4A8LA 4NZRH 1F3WA 4MAUL 2Q2EB 4YN3A 5KZDA 4XAZA 3CFKA 4KKAD 4EIBA 1YPIA 1V3HA 4P06A 4LB3A 4NO2A 2WXGA 4L8SC 1V7YA 3R1ZA 4OFKA 1W72L 2JTDA 5EU3B 3KPLA 4NZ1A 1TQVA 3ZHLA 4X0KB 1TYEB 4C4BA 3FU5A 5EMUA 3H3KA 2ZUXA 1YAIA 5LXVA 2RHGA 3O2DL 3OAUH 2ZDRA 4CC4A 3WMQA 4GY0A 1WKYA 3STCA 1I2PA 4YHOH 3IRZA 4R3SB 3RX2A 4C58B 2EPNA 3GZOA 2FB2A 3VFCA 3Q3GA 4HEPA 5FCUL 2GW5A 3V79C 4G6JL 3K6NA 1FWHC 3X11B 5D2VA 4JEQA 2Z3FA 3CJJA 4PJ9A 3KYKL 2JKLA 1NBVH 2NY7H 3PU7A 2AKMA 3EH2A 2HFTA 5T1MB 3WKMH 3DVGA 1NP0A 2GQ8A 1KM4A 1O5KA 1AZ2A 2IJ0C 2PETA 1VCGA 1CLOH 5J9PA 2J4WL 5TDOB 2ZX9A 4P5UA 4RNJA 4PI0A 4O18A 3H6JA 1FNFA 3MV9D 5DRZA 4F7MA 2ZWLT 3NFNA 2YL9A 4AQAA 1SVDA 5A16B 3P14A 1Q9OB 4R5VA 2X87A 4PWKA 2XKUA 3QJRB 2QCEA 1BJ1H 5JIHA 5AHIA 3BUDA 7TAAA 4NP9A 4LEXL 1TTPA 1O6VA 1JI1A 3QXUA 3X3GL 4JQ3A 3FB5B 2OX1A 3IPFA 2DQMA 4I48B 1NDGB 4Q4QA 1OTUC 4IRJA 4XVEA 3PXLA 3UTTA 5KTLA 4K9EH 2J1KA 3LTSA 1HYSD 2DDQH 3NCBB 4NNYB 2COVD 4YVPA 1JPHA 3GG8A 4PJ8A 3TBTB 3T0EB 2XIIA 4PYGA 4ZUUB 4FEZA 1OP5H 1RK0B 1LL4A 2QPUA 3BVUA 4F57L 4YMZA 4C54A 3KGSA 3IVKB 2Q2LA 4OV5B 4CCEA 1L9QA 3WQVA 4TVPD 1KG0A 3HO8A 2DQEH 3C2AL 3KWWB 2X1PA 3BZFA 3BP5B 3H85A 4ZX6A 4MMXC 3IJYB 2CO6A 3PWVA 2WQ8A 5L8JB 1JXKA 1QHPA 5HTSA 3KOYA 1Z89A 5D4YA 3HE7A 3WFCH 1H9DA 3UCCA 2RTTA 4X0NA 2WCPA 3H9HB 4X7TA 4ZUTA 4TQEH 4FAAB 1U6AL 5I71C 1XYAA 4M8QA 3BD5A 3MCYA 2PYEA 5LAXB 4I5UA 4Q2ZB 3C87A 3MA7A 5BW7C 1UKOA 4RDBA 3PYCA 4WFFD 3PWIA 3GVVA 2HFEB 3IARA 5ESVB 2FJKA 1ZTXE 1U58B 3UESA 3ANUA 3ZTNH 3NTCL 2YXGA 4WJ5A 3C2VA 2F58L 3DUUB 3NOIA 4MA7L 1CLYL 4OGXL 2Z8VC 1WA1X 5ID1B 4XP6L 3UTZB 3WMLA 4JY6B 4ZSOB 5C2GA 2BSTA 1MUJB 3QULB 4H8VA 3WLMA 3CN0A 3P30L 4D3CL 2VR3A 3IT8D 1RUKL 1VLXA 3NO5A 3NEOA 1LHZA 2D3NA 2ALAA 1ITQA 1RV6X 3WSQL 4FULA 4WUUD 4U1MA 3NCXA 4JNYA 4CU8A 1OAXH 3VD7A 5FX3A 4GG9A 2EKJA 3L0KA 5FYKD 1BBJB 3ML9A 1KACB 3NAAH 3CHOA 1RBOB 4M7ZC 3N1QC 2VXUH 1ZLUK 3CQFA 2V5SA 3O4OB 4JFHE 3CAWA 2F08A 1JDFA 1BVNT 1JZ8A 4NC0B 3DFNA 1W2PA 3TXAA 2GSMB 2H1PH 4PW9A 2ROXA 4XNXH 1KFAL 4ZMQA 4JIEA 4I2XB 3QK0A 3HFML 2Z6FA 5DBTA 2I5IA 1DVFB 4H20H 5IT2L 2XWZA 2R39A 1EHLL 3W85A 2CBIA 4F7CB 1QAWA 4IP5A 5EMYA 1E6JH 2BSSA 4B5VA 4KKAC 3EBIA 5HJYA 4LQ1A 1C16B 4OW6A 4OUEA 3EB2A 4NG3A 4LO9A 1OWWA 4FI4A 4QLLA 2C0AA 4IQJA 4R0LB 3WNJA 4WWOA 3QR1A 5JHDE 1S1RA 4WSHA 3MRGA 3EPNA 2Y88A 4DVBA 3CIVA 5HHXL 1YYAA 2G4GA 4K07A 2HJLB 4ZL1A 3ZPDA 4W87A 4J3OG 2FO4B 3A23A 4PRPA 2HLFD 5EFDA 2DWYA 4MD4A 3ZT7A 1BMGA 3MJ8A 2QQNH 4IBLT 2IQ9L 2OMZB 3WCYA 4OCYH 3IVTA 2HVJA 1YYMH 2PPFA 3WU1A 3O2DA 3MNVA 4Y8AA 3VXOA 4MBRA 2I16A 3EHBB 2AEPL 3QJVB 5E8NA 4YDIH 3DGRA 4ZFQA 2CIIA 3OJDB 5LXGH 2ZP8A 3ZXAC 5GIRB 2IWGA 2ANUA 1EP3A 2VKXA 4JFDE 4EE2A 4N2NA 3BGFC 4I3SL 3LSCA 4PGLA 3UXIA 3O6CA 4UOW1 1K6AA 5DTFB 4M1RA 1X6UA 2H45A 1EIXA 3V5DA 4HB7A 5J04A 1JOIA 2A9NL 3L5AA 1GC1C 2NR6D 4JDVB 4A6YB 4P4RB 2DQXA 1QRQA 1MW0A 2ZRZA 1WDDA 4AUUA 1NP2A 2ZZ4A 3IXTB 4Q8QA 4H2AA 3QQ1A 3D05A 1WCQA 4PRIB 5CJQL 4PGDA 4XBKA 3LNGA 2I1OA 2CFFA 3E5BA 5C09D 3NR0A 4QG9A 5ADOH 4WRHA 4O8RA 1GPOL 2OMUB 5DMYA 4W4OA 1QHOA 3SO5A 2Z7YA 4Q8OA 2GVYA 3AMLA 3CBWA 3P0GB 3WUWG 4C56E 4OCLC 3DENA 3GI8L 3TURA 2CBJA 4HGKC 3FQXB 2Y06H 1CECA 4FXKA