2ZXBA

Alpha-l-fucosidase complexed with inhibitor, ph-6fnj
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 161
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zxbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zxbA01
3VIHA 4IM4A 3ZJ8A 1H2JA 1KWKA 2C7FA 1OD0A 3ZQ9A 3UG5A 1TG7A 2C8NA 4OJYA 4AD5A 4UFJA 2BV9A 1MW2A 1H09A 4TTUA 3VNYA 4LPCA 2D0FA 3WNKA 2DIJA 1PIFA 1PZ2A 2G8ZA 3D50A 4OGZA 2X8RA 1CTNA 5A6JA 5IFTA 1HKMA 3CZSA 5CG0A 1VFUA 2IXVA 1WP6A 2W61A 3CHFA 4OOZA 4EK7A 1LF1A 3ZR5A 3UESA 1W2PA 3AYSA 5AY7A 2E9LA 1TA3A 2WAGA 2D3NA 1EIBA 1VEMA 1SFSA 3AIVA 1ESWA 3BH4A 1UR2A 3K8KA 5GPRA 5DO8A 4PRWA 4FK9A 1JXJA 5BWFA 2EO7A 5ABHA 5JBDA 3AS1A 4EAMA 1F4HA 3U5YA 5C70A 4PMVA 2ZUNA 1BLIA 2WVVB 4PMUA 3DC0A 3U7BA 1UZ4A 2ALWA 3GH5A 2YL5A 1UD2A 2WZEA 4ACYA 3BUDA 1CGWA 1ZBVA 1LLOA 3CUFA 1W9VA 4LQ1A 3OGRA 4MAVA 4B16A 3CZLA 3CUHA 4YN5A 3A4AA 6A3HA 4H41A 2XFRA 3KL3A 4GZIA 4UFKA 4OZOA 1W1VA 4GI8A 4ZXOA 5BXTA 4CGTA 3AIQA 4HZ6A 1PZ3A 2PI6A 4AZGA 3THCA 3ALFA 3QR3A 1VFFA 5A2BA 1JDCA 1SZNA 2ZE0A 4UR9A 2VNCA 3K8LA 4IPNB 1EDTA 4U5IA 2F18A 1JI2A 1KXQA 4MNLA 3WDJA 3WEOA 1TVPA 1TQTA 1G0CA 3VSTA 3U57A 2WPGA 1W1PA 3WENA 1V0MA 2VO5A 2ZWYA 2J7HA 2WHJA 2A3EA 4FNPA 2DPEA 3VD3A 1HJQA 1VBUA 2WSPA 4UCFA 1D2KA 3GZAA 1KGUA 2QPUA 2NT0A 1Z32X 3BSHA 1QVBA 5GNXA 3WD1A 2GJPA 4AD4A 4XZWA 2Y5EA 2UY2A 4JCLA 3K1DA 4UOJA 1ISWA 1CGTA 3SCSA 2D3LA 2F7OA 4AEEA 3MMUA 1E4IA 2CETA 2VVNA 3EYPA 4DWSB 1I75A 4Z2LA 2GJXA 4LYPA 2D0HA 3OGVA 4CU6A 1CXLA 3J7HA 4J28A 3AOFA 1MFVA 1TCMA 2HISA 3KEHA 1NM9A 1CLXA 3SCTA 4F9DA 1BVZA 3IJ7A 3WL0A 3IJ9A 2XVNA 1LQ0A 1FOBA 2XWDA 1UR9A 1GOKA 1B2YA 4MTVA 4JCMA 3W38A 3U7VA 1W9UA 1AMYA 3VKKA 3M07A 1J18A 2WANA 1J0IA 4NXSA 3WBAA 2GDVA 3WDRA 5A6LA 2W4XA 4Q7NA 5I5RA 7CGTA 1UKQA 3RO8A 3N04A 1PIGA 1UKOA 4QLJA 2FYVA 5CPTA 3N1AA 3LPPA 2CXGA 3ZOAA 1F4AA 5DMYA 3OA5A 3AZRA 1HL8A 3L4YA 3SCRA 2ZUVA 2D73A 1XYFA 2O9RA 4L4OA 4GI9A 3DX2A 4AIOA 4WK9A 3UERA 4UQEA 2GK1B 5A69A 2BY2A 2DQXA 3U5UA 1OINA 3DYMA 3A24A 3TTOA 3WY3A 3GYCA 3WL1A 3VGBA 2V5CA 3QOMA 3CGTA 1E43A 2A3HA 5TD4A 3VMNA 3ECQA 4PMQA 3BUBA 3AQUA 2E9MA 2W92A 4QCFA 4HOXA 1BFNA 2OYMA 2XN1A 5CGMA 2IXUA 4B3LA 3WUGA 3EDDA 1JF6A 2J25A 3W6MA 1KWGA 5ABEA 3UR8A 3KLKA 1WZAA 3GH4A 3PTKA 1B3XA 1B3YA 1BHGA 4D72A 2ZWZA 3NSXA 1HKIA 3RPMA 1BF2A 4XZBA 1OCQA 3S5ZA 5IDIA 4DO4A 1WAWA 2WZHA 1KXHA 1MQQA 1TFVA 1GONA 1V0LA 3VGHA 3RJYA 1US2A 2PWFA 4AYSA 4MNJA 5E9AA 1GNXA 3TA9A 4PSPA 3SIMA 2DIEA 4PMYA 4XX6A 1E6PA 2YL9A 4DM1A 2BXZA 3MV01 1L8NA 1UH3A 5DEZA 3W29A 2J8FA 1WE5A 1UQZA 2VZTA 3VPLA 2EPMX 5D9MA 2VX7A 3ZT5A 3WY1A 1AVAA 3SEPA 3N15A 2J4GA 1HWWA 3DDFA 4M29A 4NXKA 4J3SA 3CPUA 2WKGA 5BRPA 2D20A 3POCA 1J01A 2UWFA 4JKMA 4Z2GA 2X05A 3VSVA 1M53A 3TTQA 3WD3A 3OLIA 4AZ7A 2YFOA 1H0GA 4TTGA 1GORA 4Y7EA 4Z2HA 3H54A 2D2OA 2D24A 1BTCA 2YBUA 1KQZA 1QHZA 4J3VA 5CXPA 2UY4A 4DUXA 2VVSA 1UD8A 3O2LA 3M7SA 2BHYA 2WMGA 3N18A 1NWRA 3OIHA 2ZIDA 3PZOA 4V28A 4PTMA 5A8MA 1W9XA 3WD4A 1MYRA 2ZUSA 1HP5A 2TAAA 3AXHA 4EE9A 1KXVA 1CWYA 3AHYA 5ECUA 5ABGA 2Y8VA 1UR0A 1E5JA 1B3ZA 4QAWA 3VIPA 1V3MA 2GFTA 3W82A 3EMZA 4V27A 2V3GA 2WLYA 3VOCA 3W53A 1MW3A 1EO7A 1ISVA 1KTCA 1E40A 2BVYA 2XVLA 2WBGA 5LA2A 2RGLA 2PC8A 5DT7A 4AMCA 5A6BA 3QHOA 4AWEA 1H4PA 3LRMA 4JZ5A 1PEZA 5FOOA 1EGZA 1VF8A 1ZBCA 4S3KA 2WMKA 1JZ5A 1R46A 1GQJA 1AQHA 1KR0A 1V3IA 3B9AA 5I79A 1HJWA 4JAWA 3CTTA 4OBSA 4U3CA 3MUIA 2ZOXA 2EABA 1FP9A 1EH9A 4ATWA 4FF5A 5M5DA 5D8WA 2DSKA 3WQ6A 4H04A 4J27A 2XSAA 3A5VA 3SCVA 2WK2A 1EDQA 2XTKA 1CBGA 2FH6A 4MB5A 2WSKA 4UFHA 4Z2JA 1JNDA 2VX6A 5BRQA 2ZUTA 1BG4A 1VB9A 2OWXA 4CD7A 3WF4A 2E4TA 3B9DA 4DUWA 4HPGA 2QMJA 1JAEA 2YA2A 2OSYA 1ZS2A 6CGTA 4J3UA 3N17A 3GM8A 5CLWA 1VFMA 1OGSA 1WDSA 4Z2IA 1HNYA 1XV8A 4BF7A 2VURA 2VC9A 1MVYA 3CBWA 4AZCA 1IZJA 3B9EA 3G6MA 2WHMA 1LL4A 2F1BA 4NF7A 4J3XA 1JDDA 4P8VA 4D6JA 1U2YA 4UOQA 4JFSA 3ARXA 4OUEA 4MB3A 3S2CA 1A3HA 2D22A 1QNPA 2OYLA 5A1AA 4YHEA 1JD7A 4PMNA 2VMFA 4ACZB 1QOXA 3DECA 2WHKA 3UETA 2VR5A 1E3ZA 3D4YA 2QHAA 1R34A 1DTUA 3NUKA 4EANA 4KMQA 3WFLA 3WF3A 1V02A 4PEEA 4MDOA 2EPKX 4AMXA 1NOWA 1ZL1A 5BCAA 5GNYA 2VOTA 3RM9A 3WEZA 2EPNA 1WPCA 1E6NA 4AW7A 2J8GA 1GVIA 2CKSA 2XSBA 4CD4A 4HTYA 3VUPA 5JUVA 2GVYA 3HG2A 1C8YA 2XGBA 2JIEA 1MXGA 3AIRA 4N42A 1O7AA 4W5UA 2EACA 2CKRA 2DSUA 3WSUA 3M6DA 4P8XA 4D1JA 1E56A 4W88A 3G6LA 1SMAA 3BLKA 2VI0A 1C3FA 2FH8A 4NSBA 1DWAM 4WKHA 4FNSA 4LXFA 5FIPA 4HOZA 1E15A 3MMWA 3AS3A 1V6YA 1J0KA 5D8ZA 4FLRA 2O9TA 2DEPA 3GXMA 2Y24A 5I23A 3TV8A 3HG4A 4CN6A 3PZGA 1QBBA 5AYIA 4BQ4A 4UFIA 5C71A 3GBDA 2ZXDA 3CH9A 4UQ9A 2F2HA 3ARTA 2XGIA 2V3EA 2V38A 4ZENA 5A94A 1GCYA 1J9YA 1DWHM 2EADA 3KE0A 1EHAA 3H53A 1HJSA 2WVTA 1UD6A 1FH8A 3QHNA 1UHVA 4NZJA 1UD4A 1UD3A 3BVVA 1V08A 2ZUMA 3F4VA 3BLBA 3VD9A 3CUJA 4WF7A 3RCNA 2AMGA 1EOKA 5BROA 3QOKA 4XV0A 2CNCA 2CBIA 2W62A 4D6IA 1C8QA 1J11A 3VIFA 3MS8A 3DX1A 3PZMA 3EMQA 5EB8A 2WWCA 1J10A 3TOPA 2PWEA 3SUSA 1VEPA 3KL5A 2EBNA 4JHZA 1OGGA 3MSDA 2D0GA 5I77A 1UKSA 2AOSA 1GHRA 3QHMA 1X6LA 4PYSA 5A6BD 5FCZA 2XVGA 5FL0A 2VZUA 2BVTA 3I3DA 3CZGA 3AIWA 3EJTA 3BAKA 3W24A 2OSXA 2CBVA 2ZX8A 1M03A 1ZJAA 1J0ZA 3HN3A 4J7RA 3VGDA 5A6AA 5KEZA 3CUIA 1QPKA 2MANA 1JNEA 2O92A 1Q6EA 4UNIA 3VO0A 2O9PA 3POHA 4JL2A 1M01A 1JZ6A 3WNPA 1QW9A 3PHAA 4GIAA 1PX8A 3CV5A 1CZ1A 4UFLA 1W2VA 3WQ4A 4CN1A 4U2YA 3CMJA 1FFQA 1W9DM 2UY5A 3KLLA 3CLWA 2EAEA 1VFOA 4W7WA 1W3KA 1JYWA 1B3VA 2WMIB 5FKYA 5E0FA 1GPFA 4JL1A 4FLQA 2DH3A 2X0HA 2WMJA 3LPOA 4P7NA 4MAZA 3I3BA 1G9HA 4F79A 2GUYA 1I1XA 1LG1A 4AY1A 1EA9C 3UEQA 1OSEA 4KGJA 3ZJKA 4W8LA 4AMWA 4M82A 3GBEA 3LX9A 1E9LA 2W63A 1HF6A 1PPIA 5A2AA 1ISZA 1CXFA 1W9BM 1LWJA 2F1AA 2J62A 2XIBA 3VIJA 1E3XA 2PF0A 1V02E 2WM0A 5IXEA 2ZXQA 4QDMA 3DX0A 3FW6A 3W4RA 3DHPA 2CCRA 3AMDA 2BY0A 2XFYA 4KH2A 2J7FA 3WBEA 3VMOA 1KR1A 1MQPA 1OB0A 2WMFA 5EFDA 1CGUA 4CCEA 4W7UA 4AZIA 3LPGA 1PX3A 3AI0A 1QBAA 2V3FA 5LYRA 2VZOA 3BAIA 1WZMA 1C93A 1EQCA 4PMXA 3RMEA 4TXEA 4MB4A 3WFZA 3PTMA 2YDQA 1QX1A 1HVQA 4GPNA 2QMKA 3L4UA 2FHCA 2CBUA 1NP2A 1CXEA 2ZXBA 4PN2A 4UZUA 1W3JA 5JIPA 3WELA 4ZFMA 4DWSC 3ZT6A 2WKLA 4RE4A 3VDHA 1XSKA 5I3DA 1XSIA 3MUY1 5EMYA 1VEOA 1HT6A 2Z1SA 1UYQA 4R5EA 1EDGA 4AZHA 4HMCA 3VSUA 4P8WA 4W85A 1GOIA 2JEQA 3HG3A 4ZXLA 1XCXA 3BCFA 3EJPA 3GXTA 3RDKA 3WQWA 1XD1A 3VIOA 4MNKA 3WH7A 3D5HA 1UWTA 4H7VA 1QW8A 1DWJM 2XHYA 3A22A 1BPLB 1VRXA 4YPJA 1YQ2A 2A3CA 1GOOA 3MSGA 1NQ6A 2EPOA 4W86A 1B90A 2V3DA 5BXRA 4A4AA 1UA3A 5BXSA 1OT2A 1FA2A 3WF0A 1DP0A 3AIBA 7A3HA 1E0XA 4H2CA 3OBAA 1NOUA 2J7GA 3L4VA 5M17A 2ESCA 5A8NA 4TX6A 4W8AA 1EO5A 4X0NA 2CEQA 3VDCA 1OD8A 3A6OA 4P7LA 2XWEA 4IPLA 2BY3A 1MW1A 5BYWA 4JFTA 1UG6A 4AD3A 1CNVA 2QLYA 1B1YA 2XG9A 4MJ2A 3O6AA 4UFMA 4WJXA 3FY1A 2WXDM 3ZT7A 5E09A 1GJWA 3UG4A 2XJ7A 1HJUA 3A3HA 3A23A 1GOQA 2YBTA 1TQUA 4C7GA 3O9NA 3ZSSA 3AMKA 4HU0A 2E0PA 2C0HA 1UKPA 4DO6A 2WVUA 3SCNA 4XB3A 3GNRA 1TQWA 3EDJA 3PZNA 4PTWA 2DH2A 2GJRA 4C7DA 5BXPA 3ARPA 5IHSA 1OIMA 1XC6A 5LA1A 3GNOA 1W3LA 2BFGA 4U2ZA 1C92A 3NDYA 1JD9A 3WUFA 2EEXA 1FH9A 2CIPA 1S46A 2J74A 1R87A 1TZ7A 3PZUA 2WC3A 2HVMA 4W5ZA 1O7DC 4MNMA 3K4AA 6TAAA 2XPKA 2XM2A 3HJEA 2WVSA 1KFWA 1B31A 2WC7A 1HVXA 1TA3B 4S3JA 2JF7A 4ZE5A 3VIKA 3DX4A 3WH9A 1TVNA 3WH8A 1G94A 3SUVA 1JIBA 1ISYA 5D9NA 2ZUUA 5M03A 2A3AA 1V6XA 3WY2A 3W0KA 2WC4A 1XH1A 1JZ8A 5A8QA 1CGXA 4MB1A 1UH4A 3F5KA 4PUEA 1TMQA 3CHDA 5KZ6A 1NOFA 4X0VA 3VMPA 3CHEA 3WD2A 3FN9A 4H8UA 1HX0A 1E1EA 1Q6GA 2X2HA 1UH2A 2WBKA 1CPUA 1V3KA 1C7TA 3BXWA 2WWDA 3HU7A 3K46A 2FGLA 3N12A 3L2MA 5M3WA 2ZXAA 5A3HA 3AFBA 4MADA 4D6CA 3SUUA 1GVYA 4NI3A 3MUAA 1KBKA 2D1ZA 1R75A 1VENA 1QNSA 1H11A 3ZO9A 1GW1A 5DF0A 1B3WA 1K9TA 4AC1X 1U33A 3BUPA 1ZBKA 1H0IA 1V0KA 1W9PA 4GO8A 1BGGA 3SCUA 3OZPA 4MDPA 3OG2A 2JEPA 1UASA 1HL9A 9CGTA 4KRTA 4UQCA 4W89A 3VD5A 1NWTA 3T08A 3T2PA 3CZEA 3SURA 1E0VA 3N13A 1QI5A 5HPOA 4BCEA 3T2QA 1HN1A 1H1NA 1CXIA 3WMBA 5A8PA 4B3KA 1TE1A 1CENA 4HU8A 1D7FA 4HA3A 4PMDA 3W37A 3GTNA 4M8UA 3TONA 3OLGA 2YDRA 4P7QA 3GXNA 2GJXB 3AROA 3CMGA 3S6TA 1CECA 3BUQA 2EXOA 3T0BA 3VGFA 4HMEA 2J7CA 3L4WA 2Y8KA 4FNUA 4TUFA 4WKAA 4C7FA 4BZYA 4CD8A 1WNOA 3RJXA 1UR4A 1SR0A 2VT0A 3ALGA 1GQIA 1G5AA 3BGAA 3VILA 3KWXA 2DSWA 1ODUA 2WW5A 5A2CA 2CERA 4HOWA 4WSJA 2WVVA 1UR8A 3WNOA 1V0NA 2JFEX 1LG2A 3ARRA 4IISA 1UWRA 1ITXA 3VD4A 2PBGA 3TTYA 3WMCA 2DT0A 3MU7A 3EDEA 2E8YA 2AAAA 3MI6A 3W27A 3EJSA 3II1A 1QI3A 5GNZA 4FLSA 4GQQA 1JG9A 3BVTA 4OOUA 3OGSA 3MO4A 4OIFA 1ZJBA 4AZ6A 3BSGA 1QNOA 1CDGA 3GH7A 4W7VA 3THDA 8CGTA 1GQKA 2XVPA 1WKYA 2ZX6A 3PZVA 4TVCA 1OGBA 1SMDA 2XYLA 3VINA 1QHPA 4AEFA 1Y7VA 1UZ1A 1QWUA 4KGLA 2A3BA 2JALA 3M46A 2W66A 2E40A 2G3IA 5A6SA 1E0WA 1OM0A 1K9DA 1OWQA 2JIWA 1QI0A 3FNDA 3GXIA 1Q6DA 5HOSA 3PBGA 1UKTA 1MQRA 3F5LA 2UY3A 4KWUA 3BMWA 1JZ2A 3VIMA 4ZEPA 3IJ8A 4L4PA 2CBJA 1HIZA 4JKLA 1A47A 1XGZA 1J0JA 2FHBA 3BAJA 1NWSA 1R85A 4E2OA 3K8MA 2CHNA 3WKZA 3OLEA 2RGMA 2GSJA 1XCWA 3KL0A 4CCDA 4DWSA 1R47A 2VRQA 3CHCA 3KZSA 4AZ5A 1E6SM 2X1IA 3AISA 4E8DA 1LWHA 1O6IA 3VX0A 3AMGA 4URIA 2E9BA 3WNLA 1IT0A 1JDAA 2XN2A 3UCQA 2DSZA 3VM5A 3E1F1 1UA7A 1M7XA 4OKDA 1RPKA 3FXYA 4JFWA 4AD1A 1T0OA 2CYGA 3CZJA 1RP9A 3L4TA 2PBOA 2G4FA 4HA4A 1VIWA 4A3HA 1C90A 4K68A 2VTFA 5D9PA 2YFNA 3IGUA 1PJ9A 2E8ZA 1GQLA 3CUGA 3RM4A 3PZ9A 1KGXA 1XH2A 5A6MA 2J79A 5CQ1A 5JIWA 4WIWA 4UOZA 5D4YA 1R8LA 3W81A 3RM8A 4ATDA 1V6WA 4E4PA 3T2OA 3AJ7A 2ZX9A 3K4DA 2YOCA 3TTSA 3NSMA 2GK1A 4JKKA 4KRUA 4ZE4A 2VQUA 2EQDA 1H41A 3VDAA 2YA1A 3ARVA 3AS2A 1YHTA 1FHDA 3DYPA 1Q6FA 1WO2A 3NJ3A 2IUZA 5CSUA 3WDPP 2EJ1A 5A8OA 3VU2A 1V3LA 4D6DA 2Z1KA 2YA0A 3WUBA 4NRRA 5AC5A 5D9OA 3WUEA 3W6LA 4JFVA 1JYNA 3AIEA 2WZIA 1UWSA 1LJYA 5JBFA 3WF2A 1J0YA 3W26A 1PS3A 2CITA 2XUCA 1JZ3A 1JAKA 4DO5A 3L4ZA 4A3YA 3D4ZA 3LRLA 1HTYA 3SUTA 4P7OA 3MUZ1 4PCTA 4W93A 3FAXA 1W32A 2X2IA 1VJZA 4GXPA 3LMYA 1JYVA 1NP0A 4W8BA 1XHGA 2DT1A 1C7SA 3BAXA 3WQVA 1V3HA 4H8HA 2YLLA 3AS0A 3VIGA 3DYOA 1FFRA 4U31A 1KTBA 3VX1A 4CVWA 4HPHA 3FHQA 4U5KA 4M1RA 1CLVA 3BUIA 3ZJ7A 2B31A 1TR1A 3AHVA 4U3AA 4FNRA 1MXDA 5EBAA 1PX4A 2VR4A 4AZCB 1UWUA 2VZVA 1GHSA 4MJ4A 4PMOA 4TX8A 4CD5A 3BVUA 1N82A 3AZSA 5C8BB 3VNZA 3VDBA 3EJUA 2BHUA 1BGAA 3PTQA 3DHUA 1SYTA 4BS0A 1VAHA 3A4WA 1CXKA 3HG5A 1E6QM 4F66A 3UR7A 4EKJA 1DWGM 1EQPA 4GI6A 4V2XA 3EDFA 2YKKA 1UWQA 2WLZA 4X9YA 2X09A 3UG3A 3D51A 1VJSA 4P8UA 3WQ5A 2XIIA 1I1WA 1KBBA 4PTXA 1PAMA 1VBRA 5HBFA 4GINA 3WIJA 1OT1A 3AHZA 1B30A 3SCOA 1FHLA 4AIEA 1R7OA 5JBEA 1JZ7A 3WNMA 5AC4A 3GDBA 1E72M 1UD5A 4HZ8A 2OWWA 1W3HA 2D23A 1DWIM 5I24A 2WHLA 4P7RA 2YL6A 2J77A 1OBAA 2Y4SA 3I3EA 4M24A 4M80A 4DWSD 3BVXA 4UQBA 1JFXA 4WKFA 1KXTA 2NT1A 3FHAA 3NSNA 4MPKA 1D3CA 1TQSA 4AZBA 5CPSA 1E70M 3MKKA 1BYBA 1JGIA 1CYGA 1CIUA 4QLKA 2WCGA 3ZSTA 1JFHA 5DFAA 1KQYA 1QHOA 2G3NA 1H3GA 1GZJA 1X1NA 4B9YA 5CGTA 4H8VA 1BYAA 4QLLA 5HXMA 1OIFA 5I2UA 1G01A 4R27A 1C8XA 1ZBWA 2V5DA 3NCOA 3BAWA 2CESA 2FE0A 1U30A 4TVDA 2G3JA 5E0CA 3ZM8A 3WNNA 3NDZA 3T0AA 3A47A 1M04A 3OZOA 3WMSA 1WDRA 2PWGA 2WNWA 1ZU8A 3D3AA 1LL6A 3QGVA 1QI4A 2FDMA 2IGTA 3HZ3A 4HP5A 2E3ZA 2VX5A 3JUGA 1BVNP 4PBGA 3GXDA 1GUVA 2BHZA 3VVGA 3N9KA 1NH6A 4CVUA 3F5JA 5A95A 1XRVA 3PZQA 3IK2A 3LRKA 3BMVA 5GQBA 5I6SA 2BNJA 1W1TA 2Q8XA 3WY4A 5CSYA 4CU7A 2OSWA 3T0DA 4AXNA 5E6ZA 1HP4A 2DT3A 1V3JA 4ACZA 4BA0A 4PMZA 5F7UA 3CZKA 4B9ZA 3RIKA 2ZX7A 1H5VA 1JYXA 3GXFA 2CHOA 2YJQA 4NRSA 1IV8A 3VGGA 1FH7A 2G41A 4FMVA 1QNQA 1BAGA 4HA1A 1XSJA 1HKKA 2WCSA 1WB0A 2W5FA 3PZTA 5ABFA 3AZTA 4WSKA 3EJQA 4NX0A 3B8SA 4PTVA 1QNRA 1W1YA 2DT2A 3L4XA 1ISXA 1K9EA 5CJ5A 3ARZA 4YHGA 2PWDA 2OW7A 3SCWA 2YLAA 3CZNA 5FL1A 3VM7A 3LXBA 4DUVA 5LA0A 2DSVA 4RE3A 2XFFA 1TUXA 1JXKA 1BYCA 1E5NA 4J3TA 2VJXA 3NIYA 4D71A 5I0DA 3A21A 3VTRA 2O9OA 1R33A 1E71M 3AICA 4LGXA 3MANA 1GOMA 3FAWA 3ARYA 1L0PA 4PCSA 1HXJA 4PSRA 3DX3A 4N0RA 1HKJA 4LYQA 2VCBA 1MWOA 4W84A 1K6AA 2F7PA 2BY1A 1HJVA 3AXXA 3LPFA 1JF5A 5AYBA 3GNPA 2FGZA 4QCEA 5EFFA 2J75A 3EMCA 3AMCA 1MFUA 2F8QA 2JE8A 8A3HA 2F7QA 4UQDA 3WH6A 1UQYA 2WYSA 2VRKA 4D6HA 1QI2A 4JFUA 2XM1A 3H55A 1WDPA 2OLHA 4TVUA 2JF6A 1GJUA 1RD6A 3TP4A 1JL8A 4M56A 4NZFA 3ARUA 3WDQA 1KB3A 3ZR6A 3WDHA 1HJXA 3VIIA 4RL3A 4HZ7A 4AD2A 4F8XA 1JZ4A 1ODZA 4D6EA 5HNNA 2VCCA 3AHXA 3AHTA 4RE2A 3GXPA 2X0YA 2F7RA 1KCLA 3WDIA 1HXKA 4PUDA 2NW0A 2W91A 1KCKA 3OLDA 2VRJA 4CN4A 1UWIA 3BC9A 4AISA 4CD6A 4GZJA 1E4MM 1TQVA 2ZUWA 2X2YA 4BQ2A 1MW0A 5HDRA 2EPLX 1W91A 3OB8A 2J7BA 1JI1A 3NYDA 2YDSA 5HPCA 4DM2A 5E1QA 3AYRA 3SUWA 1CXHA 4GQRA 1RH9A 4CUCA 1AQMA 2WMHA 3W25A 3SCQA 2WMIA 3ZIZA 2PWHA 4XUYA 1GOWA 1EHNA 1R86A 2NSXA 7TAAA 1V6VA 4JIEA 4UTFA 4GZEA 1WDQA 1B0IA 2PB1A 1BG9A 1E6RA 4Q22A 2XN0A 1C91A 3A4XA 1DEDA 3BCDA 4J3WA 2BS9A 3W28A 3RILA 1UR1A 1LL7A 4IUGA 3AMLA 1ECEA 2OW6A 2VQTA 3LXAA 5CPQA 3EBVA 3AXIA 3ZJ6A 4HMDA 5CLTA 4TOQA 3APGA 3CZ8A 3ZMRA 2Y2WA 1ITCA 1J0HA 3VGEA 3WEMA 3CO4A 1BYDA 4D6FA 3WN6A 2X2JA 4W87A 2CPUA 5IFPA 1NWUA 3SCPA 1WZLA 2XVKA 1E73M 5E6YA 4UZSA 3IAPA 1V03A 5A6KA 4FLOA 1DWFM 2DDXA 3CC1A 4JHOA 4AYGA 1IZKA 1PBGA 2BXYA 1J12A 1E4LA 3MV11 4PMRA 5CZKA 1Q6CA 1BQCA 4NZCA 3LXCA 3N11A 1FP8A 3ARSA 2FHFA 4F9JA 3WD0A 5ABFB 3EJRA 3ARWA 1Q4NX 2VZSA 2QPSA 3PZIA 1XYZA 3PN8A 1DHKA 1ZB5A 3HMCA 3IANA 5I78A 1CEOA 2QF8A 1UUQA 4LX4A 3EDKA 1B9ZA 3AIUA 3T09A 1E4NA 1XD0A 2VCAA 4CCCA 2OYKA 4LYRA 4B15A 3DDGA 2J7EA 4BQ3A 4FNTA 2WB5A 4M81A 2ZX5A 1G1YA 2J78A 4OBRA 2VUYA 4U33A 1AQ0A 2QV4A 2J7DA 1P6WA 3BLPX 1E1FA 2ZICA 4CKQA 1WZKA 1CGYA 3MMDA 1X6NA 3S5YA 1NARA 5FD0A 1KGWA 4QP0A 4ML4A 2F61A 2VL4A 2YIHA 2YL8A 1EOMA 2J47A 4WLCA 4CU8A 4ATLA 1V6UA 4AD0A 2GDUA 5E70A 1US3A 4D1IA 3VD7A 4E8CA 1EXPA 4BQ5A 1E6XM 3D52A 1E55A 3IAQA 1WCGA 1CGVA 5IHRA 2OWCA 2DGAA 3ARQA 5DT5A 1UOKA 2WCAA 2BVDA 1H49A 3WH5A 3WQ8A 3L2LA 3CIVA 3BAYA 4AIUA 1QWNA 4UQAA 2VX4A 4GO9A 1R7AA 1BSIA 4GKLA 2W67A 1XH0A 2G3MA 4D6GA 1RP8A 3WF1A 3BVWA 4FNQA 1K9FA 4QFUA 1E6ZA 4Z2KA
chains in the Genus database with same CATH superfamily
2CLMA 3VXSE 1OD0A 4C90A 1QPNA 3WBDA 4OJYA 1RSCA 1K4CA 5EOCJ 5CJXC 1FCBA 4RQQB 2NNRA 5MF5A 2D0FA 4MJIB 5I30H 2DICA 1Z3RA 3QQDB 3S34L 2X8RA 1CTNA 4OUOA 1P6AB 4QY8A 4IOIA 4QT5A 3Q43A 3JUZA 2CK0L 4G8GB 2NX9A 2E9LA 3C08H 1VEMA 3IDGA 3F84A 1F11B 4LOUD 5GPRA 2F5BH 3MDJA 5BWFA 5AD0A 2WZEA 3H2WA 1O94A 1P0DA 3V7AG 1EFZA 1MFBL 3CUHA 4XNXH 2R8SL 1MREL 3MLZL 2VDOL 2KHAA 4HZ6A 1VFAB 4MKVA 4UI2A 2OG9A 1SZNA 1EUNA 4XAKD 2GSIA 3CVHB 2RKXA 4HWNA 3GMNA 4RDZA 4JANA 4OFVA 4YVUA 4N8CH 3EAKA 3FUNA 2WPGA 5LDSA 4PRHB 3KVKA 3LCXA 4UIMA 4YQXH 1VBUA 5TNVA 1EPFA 5DS8B 2GWGA 4PWIA 1KGUA 2QPUA 3QY7A 4ZD3H 3ZGHA 1P43A 4WU5B 4HCIA 1HHIB 3QAQA 2WXJA 4DZ8B 2GCYA 1C5BH 1YSOA 1DV7A 3RE0A 2X6MA 3ZRSA 3LRSB 3E38A 2HDJA 4WY7H 2ZZUT 1U22A 4Q9BA 1T4WA 1BAWA 5F6HI 4HIEA 1T7WA 4RX4D 3PFQA 3JTSB 1BVZA 4L0YA 5BO0D 4Q8VA 4G2AA 4RZ6A 1QTYT 4FTVA 1TUFA 2B1AH 3QXVA 2X10A 2FJFA 1E9PA 2FYVA 4E9VA 4Y5YB 1B0WA 1F4AA 2X2GA 1FYHB 4Y9AA 4KK5D 4E5TA 2AMUA 1U8NB 4MX7B 2LT9A 2DLFH 3F7RA 3DOSB 2ZOLA 3A67L 5HGHB 1I3GL 1JCMP 3PPCA 3W7QA 3U4BL 3CPGA 3MV7D 1SDDB 1GHFH 3EYUH 3DPDA 1AHWA 2J25A 1NLBL 3LCFA 4FQIH 1KIQA 2VN4A 5L9DH 3LS9A 4L65A 5J6SA 1N8IA 1DQJA 4OAWB 3UA4A 4DO4A 1NCUA 4E9YA 1MQQA 1R3JA 2H9AB 3LZ5A 3E12A 3R11A 1SEQL 3GBMH 4PSPA 1V7MH 2Z93B 1DJHA 3HMXH 2BXZA 2XFXA 3RVVC 2WLIA 3OVRA 4PGBB 5I1CH 1UQZA 4MS6A 5AKVA 4O5LH 3FTUA 5KMYA 4KKQA 3CU1A 2X4NB 2C3WA 4ODVH 4PM1A 1TVHA 2H2SD 4GT0A 1XR8A 4ONGL 3QIWC 4B5SA 3NPVA 3O2VL 4B4FA 4AIZB 3N18A 1MF2H 3R43A 1KEGH 3BW2A 4C83B 2H0PA 1LBLA 1QSVA 3AXHA 1CWYA 2HPOA 2BIHA 2EC9T 3VIPA 3ZZLA 2QJNA 4A37A 2BVYA 4JG1L 3QCVL 4Z7VA 1XIMA 2WBGA 4H25B 3TOYA 1WAAA 1AIFA 3MFGB 3IF1B 1F6YA 1AR1D 2C4FU 4M6NH 1CI3M 5GGQH 1AJ7L 2A9MH 3T9WA 1W6LA 3QNXB 5IBUG 3DUSB 1OP5H 2Q3XA 5EOTB 3T4CA 3KNBA 4DAIA 1FP9A 2EH8L 4I9WD 3T3MF 1N64L 4YHKH 5TPWL 2XX0A 3F2BA 1S7RA 3IMBA 3CB3A 1Q9KB 1XLAA 4OQTH 3U36B 4DVOA 1V77A 3N17A 3FUFA 3B8VA 1MWAA 1WIPA 1XLLA 1XV8A 3WNIA 4HJIA 3NQ7A 5EBGA 5DZLA 2GT9A 3UYPA 4MMXB 1PD6A 3UIYA 1BWMA 3KPSB 1DANT 1WAUA 4K94H 1QNPA 2X89A 2ADFH 5BWAA 2VMFA 3ULUC 3D85D 3VD1A 4KMQA 3WF3A 4HD5A 3S0PA 3N40P 1ZL1A 4HT3A 2YC1B 5C0BD 2DJSA 3FYYA 2GK0B 4KXDA 4U1GB 5A8GA 3V4PB 3V18A 1P2CA 2XGBA 4XVSH 4Y8EA 2CHDA 4P9HC 3RAOA 1E28A 1MI5B 4KITB 1H6TA 3NIGB 4EXAA 1EUTA 2WSRA 2W65B 4XBMA 2VFFA 3LDBC 2HVJB 2ARJA 4M9OA 3W1PA 1G7MB 3VW3L 2F8XC 5I23A 2OMAA 3HG4A 1G6RA 5CCKL 1QBBA 4D7PA 4RAVB 2QDDA 4FQXC 5C3TA 3CAVA 1ORSB 4K7FB 4QSHA 5KETA 5IG7A 4WXZA 3F4VA 3VD9A 4O15A 5D1XA 2PDKA 1OAXL 1DIKA 3RGVD 4IX2A 4M6VA 4NN7B 4E4FA 2CW6A 4JYEA 5CM1A 2P5WA 3PWLA 5LNUA 4PAZA 2YR1A 4HCHA 3SDCA 4HJJH 1FV1B 5LSMA 5JO5A 3QJQB 3QEUB 1E5BA 1A6VL 4ZMVA 1ZJAA 5CSSA 3SGDI 4Q4PA 5ETUA 4EOUA 4XG1A 5L4JA 2O92A 3VO0A 1G9MC 2NPLX 4GIAA 1TIMA 3CV5A 4NKCA 3MRHB 3TO4C 3LDVA 2HRLA 3WLBB 3CLEL 1KTDB 3CXHK 4ZGYA 4DNHA 2NSOA 2PDIA 3H9ZA 1K8XA 4HIHA 4FQ1H 4NNBA 4HFWA 3GFZA 4Y5XC 2HVKA 1DJIA 2XH7A 3E2HC 3P81A 1AZRA 3F7YA 5AB0A 3T05A 4KGJA 5CPNA 1IVTA 2F19L 1BD2E 4Z7WB 5F7DB 4UDUA 4C6CA 1CG9A 1IQDA 4C5ZA 1YMHB 5K39B 3T2LA 1IEBB 2BS71 4Y9NA 3KPPA 4I0CC 5DMIL 1IE4A 2QGEA 1F4XH 1ZVSB 3NQ8A 4BR1A 1CIDA 1P4IL 1O6SA 4G3YH 5IM7B 4L64A 1DBJH 3GRWA 2R0LH 1H9DA 1I9EA 2YEZB 4RZ4A 1EGJH 1X5GA 1AD9A 4JRYB 5HHMD 2ATPA 2VZOA 2KL6A 1J8HA 1EQCA 1CI5A 4YHIA 4TXEA 5EC2A 3TA3D 2VXUL 1CXEA 1KBVA 1U2CA 4WTZG 4LU0A 5L2KD 5T9CE 1DO6A 4YCPA 3ITGA 1SYVB 1N2RA 1EDGA 4GRWH 3OA3A 1P4UA 3DV4A 3Q6GL 3WLRA 4FA3A 2ROXA 1AI1L 1DJGA 5D2NA 1DWJM 2ZYIA 3A22A 2X1PA 2AKMA 4ZQRA 3HC3L 2Z31A 5I1GH 4LY4A 1ASQA 5DBTA 2FK9A 4N2YA 1FUYA 1DJQA 2XWBA 1LD9B 2ISVA 2GJZB 2CEQA 1F00I 5DT1L 1F0LA 4CNNA 1B1YA 3ME3A 3E6EA 1F3TA 3VFLA 3ZT7A 1F74A 2B7QA 1MJUH 1RV6X 4JD4A 3C4UA 4HUKB 4A55A 3LLXA 2VEKA 1QABA 4MY9A 5EZJA 3TWAA 4OFQA 3TCLB 4ZSOA 4PRPB 5BXFB 5LN4A 4XCYB 2ZNWA 2EDJA 2H4EA 1TA3B 4BDVB 2J43A 3VXPB 4X6FB 4GLRI 3KVPA 1F8TH 2GSGB 1AXSA 2X6AA 1ECQA 3RTQD 4Q4QA 2H6OA 3UZEC 4FX6M 5EDSA 1P1MA 4NZ3A 5C7XL 5KZ6A 4OF8A 1TYJA 1EHXA 5KUKA 3IMWA 1CBJA 2VDLH 3EGXA 2FGLA 3STGA 2B5IB 1R3IH 1L7IH 3HZMB 2AGKA 2NUPA 4DPAX 3LB6D 1OAQH 1B3WA 3KEDA 3RX2A 1HK6A 3FU7B 1IB5A 1UASA 5E8NB 2ED7A 4L1LA 3KPTA 5CZJA 3K72A 1RSYA 1L6FA 2IADB 1QI5A 4D9QE 1PXGA 1E6JH 3WSQH 1QO3B 2WJDA 3GXNA 4IM8A 5IHWA 3N2XA 3KXFB 4BWTA 2VR2A 5C07D 3VFGL 1A5LC 3L4WA 2YR3A 4LSQL 3ZL4H 4O14A 2BLEA 4FQHA 1M7DA 1UR4A 4RXFA 4H4IA 1F7BA 3R8HA 4LPUA 2RBLA 1I8MB 1ODUA 3LIZL 2O6FA 4F3FB 3H6JA 1P7QB 4EDWL 2J27A 4IBSA 1ZT1B 1AKJA 3SGDH 4QIRA 2A1WL 2BVWA 3SZKC 2VDIA 2PCFB 3FCTA 4GQQA 5CLXA 1NA8A 4JY5H 3QXBA 1A7RL 4OOUA 1JRHI 2G75B 4J2XA 4ENZA 2FNBA 4U6VH 4QI3A 3GH7A 3MU3A 1AZCA 3TW7A 4POUB 4F2ME 1SMDA 2G5BB 2A6JA 1QWUA 2JI1A 2L04A 3OP2A 3RKDD 4FZEL 1G9EA 4L4TD 3PABA 1DSFH 2E68A 4F3HA 2UY3A 4X2PA 1A49A 1ZTVA 3LJ3A 3SYOA 3IVSA 4G9FB 3MLXH 1OCCB 2J12B 4WCJA 5C9KA 3EIFA 2J8TA 4DGVL 2WWOA 2VGFA 4E8DA 1IT0A 2CZ5A 5EU4B 5D7LE 1TE6A 2AQVA 2C3VA 1X5IA 2PRLA 3L4TA 4HJSA 2K45A 4UUJA 4WZ9A 2QKIA 1DDTA 4OFCA 1PCXA 2H3NB 2VAAA 3KCWA 3B0VC 2OODA 4NHUA 3BHBB 3NRQA 4KAQL 3AJ7A 4B7LA 3SJVA 3TTSA 4B9PA 1RURH 1EXUA 2ADIA 4DJDD 3ARVA 4MFDA 4MMZA 3DIFA 2Z29A 1TKWB 4Y9MA 2ZWKA 1YDPA 3OJVC 4DJMA 3VB8A 3FU3A 5CJOL 2BNQD 4Y8AA 1F58H 2MWCA 4R90H 4C6FA 4HUUA 5DYFA 5JBFA 4Y2WA 4O0KA 1UXSB 3S3BB 4F8NA 4P7OA 5SWSA 1XQKA 1YECH 3O7UA 4KEVA 1R5WA 4XWUA 1MVFA 4C1NB 1KTBA 1H5BC 4U5KA 3BUIA 5KVEH 1Z9SA 1MLCA 5FI8A 1HOCA 1ES0B 1TPB1 1UACL 1DBBL 2BP0B 2XQYG 3GF8A 2AJXH 4ZYKA 3GAKA 1UEYA 3OZ9H 4Z7UF 3WKYA 5FF6B 2FIRT 4K4KA 2F08A 5D04C 1FZOB 3OEXA 2H2PC 3TIDB 3MRFB 3MXVL 1MO0A 1BD2D 3N9SA 4ES9A 2C9PA 3HZKB 5ESQB 4MWAD 1FCUA 4DZBB 4UTTA 2J6EH 4GLRH 1PHWA 4TQ8A 4F9LC 5F9AC 3WQ5A 4W9GC 3G6AB 1VBRA 2AJ3A 4GINA 3QUYB 4V1DB 1JZ7A 4XVOA 1E72M 1YYCA 1CCWB 1H3VA 3BVXA 4L80A 2AJVL 5J5DA 5HHPB 4A6YL 1J79A 3T8LA 3MKKA 5F4XA 1AFVH 3NP3A 3KW7A 4F57H 4PFMA 1OTSD 3FQNA 3QN3A 5DRZB 4WDUA 2A6KA 5I2UA 3KJ4B 3TJXA 1GGCH 2VC7A 4L5FL 4FLHA 1LT8A 4HNTA 5A2JH 1FWCC 1RFDH 1WDRA 3D3AA 5AYYA 3BZEA 2QTEA 4S3AA 3HZ3A 3MRGB 1MCIA 2LE9A 4X5WB 5GS2D 1ZA3B 3PL6D 2CLKA 3OKDA 3WY4A 3TNBA 3F3HA 3N91A 1YJDH 4KQ4L 4PMZA 4R7JA 1A1OB 1NGZA 3T40A 1MUJA 3UJJL 3TROA 4G6FD 3VGGA 2R2BB 2VDMH 5E6UB 1BAGA 4HA1A 3C5QA 4BFJA 4GOAA 1HH9B 3WK1A 5HHQA 2PNDA 4IEFA 3QQXA 1OEZW 4XN9A 4XGZA 2ZYSA 4ELKB 4XO8A 4AXWA 2VE6B 2ID5A 2BOCB 3CHPA 1YXDA 1BYCA 3AU2A 4ETQA 4PJAE 4AKOA 1R33A 2FVLA 1YEKH 3AICA 1J1OL 3BKYL 4KFZC 3FT2A 4HSNA 4F1ZA 4Q4KA 4N0RA 3Q2WA 3V0SA 3QH3B 3DFTA 3CZFA 1MWOA 3HF3A 1YX1A 3OJ2C 1ZENA 3QW9A 3EA2A 1D5BB 1CLKA 3TS8A 3AMCA 4LCIL 2CRIA 2JE8A 3L3KB 1HEZB 3PJSA 4PJ5A 2LR4A 1FYTA 2NY6B 2JLLA 1EQWA 1BAFL 3BW3A 3H55A 3E6HB 4DJEA 4FCHA 2EE3A 1TTIA 1XLJA 2KUTA 3VXTA 2R27A 1OGAA 4K2UH 3CIWA 1ZWIB 1JS4A 4UM9B 4KY1L 5J04A 3INUH 3VTAA 3CVDA 4OZHE 4YJ5A 3K5RA 1AANA 2HTKD 1RV8A 5TDOA 3GHUA 1AGBB 3ZTDC 2QYGA 4G1EB 1DVFC 1KJ2H 1IGYB 2OK0H 3BFOA 2FZ3A 3CL7A 4TMPA 5FYKE 3URQA 3V6OE 4DQWA 1W91A 1QWHA 5G4EA 3NYDA 4JFDA 2CWXA 2GGGA 4WGWB 2EKGA 1J8RA 3GI8L 2CRZA 2O93L 4I5XA 4BXSV 4WQOA 4A2SA 2C6QA 3MI2A 4PWKA 5C0CB 1IQWH 3TPUA 2WMIA 3BT0A 1ONRA 3GAYA 5E00A 4OE7A 1BLNB 1OTUD 3QIUD 4A7QA 1B0IA 4AU0A 3LKPA 4F8OA 1L3WA 5BO1H 5J06A 4N3UA 4A7GA 5AW0B 1YNQA 3VWKB 2WSYA 1CF8H 1UM5L 2YCIX 3L3HB 4JFFB 1P4BL 5E95B 2GTWB 2IG2H 3WEMA 4PWFA 4IGSA 3CO4A 4PW4A 2I9EA 2PLCA 1N6UA 2A0NA 4LLDA 1E73M 2YD5A 3H9SA 1QSEE 2R2EB 4JIIX 1CD9B 1HWGB 2EVHA 4HUWA 4Y5VC 3ZE0B 3D6GA 5D7HA 3KWUA 1WG3A 5D93B 3DFPA 7ENLA 1SY6A 2G9HB 3UGEA 2ZG3A 1HHIA 5F2IA 2XZCH 2QPSA 3MV9E 5IFHL 4MRCA 5LHFA 2MHAA 5L7XH 1AJ0A 3B83A 4X83A 3GMRB 4LX4A 1XX9C 4XN4A 4IRZL 4NT6A 1QU4A 2IXQA 4F0RA 5DQPA 5C09E 1J6PA 6TIMA 3GHPA 1YEGL 2BVQA 4EPBC 1OX4A 2JTYA 1PZ0A 4CKQA 4ZT1A 4NRZA 1DVZA 1NKRA 1FWBC 3C2OA 3ZDYB 5BW6A 5H94B 3M64A 4EX4A 2YEQA 3RF9A 4K5OA 5I8KL 1B3JA 3LS5L 4URTB 4YO0B 4C59B 3MJ7A 2K78A 4MX7A 1XIWC 4U6XB 4UT9H 4IIFA 1J87A 1J5CA 3N5AA 2DGAA 4PJEF 2K8MA 4IP5A 1EF3A 1AH1A 4AIXA 2DUXA 4BJHA 3NVTA 1XH0A 3FUEA 4NENB 3V35A 2QCDB 4WJ5B 1DIOA 5EBWA 3ZQ9A 3FUDA 4PVNA 3BQ5A 1G9NH 1HQTA 3R1GH 4XO9A 2Z8WC 4DVBB 2ZKYA 2DIKA 4HWEL 3M5VA 3TJEH 3M8OH 5CG0A 3TBSB 1FCVA 2LVEA 3Q8FA 2BNRA 2VLLA 3CFCH 2JQZA 1L9PA 1XT5A 3TEXA 1SHXA 4HBCH 4WY0A 5M94B 4A22A 1UCBL 3U9PH 1F4HA 2VMCA 2V33A 2X4NA 5FKAA 2KQMA 4LQ1A 3DN5A 3VQLA 3APTA 4H41A 2ZYFA 1T5XA 4PBWD 1OTTD 5DMNA 4ZXOA 4E6MA 3KPLB 1JF1A 2RUSA 1LMKA 2VXNA 4ZO8A 3OODA 4G6JL 4NNXB 5E9DD 3MJYA 1P7KB 3QH2A 3UZQB 1HQ4B 2R29H 5E2UH 2RQEA 5JW3L 1G4TA 3I9GH 5FUCE 1OAJA 4KKLD 3BPWA 2NLJB 4OZIE 1U4FA 2TSBA 4DEUA 2DKMA 4N0CC 5FK9B 1FCCA 1TFHA 2DI8A 1Q85A 2PLJA 3MMUA 2CETA 5I6PA 3IV3A 3N1FC 4CU6A 3R7MA 3B9VA 2VKWA 2H8PA 1D7KA 1NAKL 3KEHA 5ECGA 1YEHH 3SCTA 3URNA 3TPKA 1W15A 4YXKL 4OTXH 4HWBH 1FOBA 3V7PA 1AMYA 4S1SH 3FHEA 1IEXA 4XBGA 3UXDA 2EXWC 3T8XB 3UH8A 2GDVA 4HETA 2LLEA 1A0CA 1JK9A 2JKPA 3HHSB 3AZRA 2DYPD 1OP9A 3SCRA 1XYFA 5F72S 4HFUH 1P1XA 3I84A 3KBEA 4XNQA 4F7EA 4Q4EA 2FEEI 4CJ1A 3F2DA 2X3BA 1SU5A 3C60A 3BUBA 2W92A 4YZFF 4NUJB 1NPNA 4Z0XA 5DJ2B 4OU3A 1RLDA 3LQAL 1T0NB 3V4PA 1FAKT 5GGUA 5L2JB 1FN4A 3HPAA 4N90D 4ZUWB 1GONA 3H1ZA 3VGHA 4M43H 3RJYA 4TM9A 5IMMA 1XCQB 4PMYA 3EYFB 3MLWL 2YCKX 3MV01 4JRXB 1CDUA 4NG3A 1DQLH 1K72A 4JO4H 3X12A 2OVLA 1XGUB 2WZPA 2VZTA 3EWXA 3U2CA 1ACYH 1IGFL 3WY1A 3W7MA 3SEPA 4GUFA 3DDFA 2O6CA 3NJVA 5IOPA 4KRPB 2EVIA 2P0IA 2P3ZA 4TTGA 1GORA 3VACA 4FFZH 3H54A 2D24A 1BTCA 3RWGB 3T0EE 1KQZA 2FX9H 3WEXB 4MMYA 4KXCA 2ABBA 2C3HA 3IU4H 3UPRB 1OE1A 3GNNA 3AHYA 4GRLC 4ZXBC 3BLIA 3BLOA 1BJ8A 1FV1A 4I4WA 1TETH 3BZ4B 1X9RA 1JDEA 2VN3A 2WP3T 4PREA 2R1KA 1R3HA 1F1GA 5ICUA 5IB2B 1ZHLA 5FJUA 1EGZA 3HFML 4YSUA 1UMLA 1JZ5A 3P4MA 1A1NA 3HMWH 3B9AA 4R8WH 1VC4A 5H4YA 1IGSA 1WIUA 4JAWA 2PDCA 5M5DA 5IHZA 1KKOA 3A3YB 3WLBA 3OKOA 2OM5A 5L0QC 1KTDA 3A5VA 1XFBA 3PNZA 1PKYA 3UTSB 5JORA 1PV8A 3PGFL 1ZK9A 5E2WH 4XMVA 3O3EB 4BF7A 4ASTA 3D12B 3PR2A 3O0KA 4RMRA 2GJ6B 3KWWA 4AF0B 3NIDB 4PJGF 1Z9MA 3V5FA 3ARXA 1LNUB 3Q6FA 3GVWA 1CICC 2D22A 3VG0H 3PJWA 1OCWL 3DECA 3O2WL 4GB9A 2BPBA 1BQHG 4DN3H 2FJSA 4FDWA 3SKOB 1DBAL 4P2OD 2A9CA 5GNYA 2E6FA 2YGVA 3FH5A 4FHBD 2COQA 2NY1D 2MTAA 2CKSA 5EBUA 1SGKA 1JZGA 4WR3A 5BMFH 1GVFA 3CFJA 1MI3A 2GVYA 2AK1H 2Z91B 3QJHA 1LEKB 4XXDA 4GAAA 4L4VB 4KUCF 5JYLA 1YVLA 5J6GB 2PCQA 1RZ8A 4MWFA 3GUTB 5EU6B 1F97A 3U2IA 4CDHA 3IARA 3ARED 5IHHA 1ZRUA 5AW9B 3VA8A 1NFGA 4B92A 4BCXA 2Y24A 3PAOA 5CGYD 5LBVA 2F58H 1NIFA 1I0DA 3CE1A 1DWHM 3VABA 4AEIL 3PV6B 2X9ZA 4RFNC 1CR9L 1DSYA 3LKSB 4IDLA 2PO6C 2R0ZH 3DX1A 1MRFH 1UB5B 1VS1A 3LN5A 4X4KA 2EG6A 4X98A 4TNWF 1WYIA 1KYAA 5FCZA 2XVGA 3PHSA 2R2CA 3UYOD 5GJSL 1K8DB 2OSXA 4A2RA 3GBLA 4J7RA 2YLHA 3E6FA 2V68A 3I2CL 1Z0MA 1KBPA 1M01A 4H6RA 1FWHC 3KJ6H 2VDKB 2GABA 1MCHA 3Q5YA 3CYJA 2DJXA 1TV5A 1DQKA 1F61A 1XH3A 2G50A 3OR6A 4EI6A 4X7SH 4RR4A 2DH3A 3RU8X 5KYYA 5LGKA 4MS8C 2IFFL 2UXGA 1EJSC 3QVAA 3LH2L 1QFUH 2QUTA 4W8LA 2IH8A 25C8H 2W63A 4CNIB 3ABSA 4XAKE 4B41A 5L8KB 4MZ2A 4JTGA 4LGPB 3FYOA 3IFOA 1D5XB 4M1DH 3DHPA 5DSCB 1EEPA 5JPMC 4U3HA 1KR1A 1LK2B 2PDWA 1B5TA 1OSYA 3IJSA 1GPOH 1CGUA 4CVZB 4ZVJA 1X96A 5E8NA 2RJHA 4F0HA 1X9QA 2J21A 1NBCA 4PN2A 3U9WA 2KLSA 2KZWA 5HGAA 2V2DA 2NY4C 3TZVB 3DXAE 2UWEF 2WKLA 1FG2A 1PKQA 3SO7A 4P46A 4XZUA 3EH3B 3S88L 1HINH 1GOIA 3EYSL 3I7QA 4NKIL 2J55A 4ZK8A 4F58H 3WH7A 4JM2C 4QYOB 4XSLA 3RG6A 5HI3C 2G0LA 5AVUB 5C0AB 2FO4B 5GRZA 2DW6A 3HZYA 5FM8A 1TPXC 3DJSA 4AQ1B 4GG6A 5GGTA 2VMJA 2X4OB 5LXGL 4YLCA 3ORWA 3ECBB 1E65A 3N4AA 2PCFA 4X0NA 5CGBA 2J6VA 3TYDA 8RUCA 3HPFA 5GZNA 3VA6A 3QZOA 1JHTA 3MV7E 2HG5A 4ABVA 3UFYA 4YCOA 3FY1A 4OW6A 3FK3A 1XLHA 1RAKA 2NNAB 4OSUL 4IP4A 3TVMA 3RU8L 3GT6A 3BO8A 3BSZL 3QG6B 1QKZH 4MDJB 2Q8AL 5IHSA 3L3IB 4P5UA 4F0SA 2WJ7A 3MBEB 2R23A 3LSOB 2F74B 1U8HA 4UM8A 4ZE5A 4XT1C 3EXLA 1TNMA 1IBGH 4HZLB 2ICWB 2QZQA 3X2QB 1U5HA 3IIPA 4Y19D 3P4NA 3DVGA 3TV3L 3UIZA 1S7XA 5RUBA 4GRMB 5HDBB 3UPAA 3SDAD 1GGYA 3E3QC 4DKEL 2JLPA 1S7WA 4C57C 3ESVF 2D1ZA 1AGEA 2C79A 4KHXL 2W80C 2PR4H 1BF6A 2FGWH 4WAFA 4M8QB 2APVA 3D0VA 4WW1A 4IOSA 3OYXA 2AJUL 4APQA 1WRFA 2EDQA 3QWRA 5AHNA 3L5WB 2P8CA 2XV2A 1H1NA 1MLBB 1A2YB 3VI3F 3FTWA 1L9RA 3TEUA 1R6VA 1ACCA 1BOGA 1TX0A 1GYCA 2XZQL 5KVGH 6FABL 1QYGH 2DSWA 3L95B 4RCXA 1REIA 2FGBA 2DI7A 2HVBA 3ROLB 4JHUA 1F73A 3WKMH 3ARGB 4B9IA 3HAEA 5I1KL 3NRPA 4YDNA 5EU7C 4B3EA 4GQBA 1ZJBA 4K1GA 4FA8A 5G5DA 2A2IA 1MCOH 4GAGH 5KN5B 5C0BE 4NKMB 5AUMA 3LI1A 1YNTB 2W66A 4ELME 4V1DA 3VC5A 3NSCA 5GRWA 5K9XA 4FXJA 1IM9B 1DJXA 3HE7D 5MEND 1CK0L 3OV6A 4IIEA 1XINA 2EKSB 2HYMA 3RIFF 3FU0A 4FALA 3B6SA 1XGZA 3QCTH 3RY5A 4CSSA 4NQUA 3SE9H 2EUZA 4DWSA 1MCCA 1VSCA 4L9LC 4H9TA 2HWZH 3UJ2A 2E74C 1ERNA 4PJCF 2WINB 1ORQB 4L48A 3F7LA 4I88A 1EC8A 3LV6A 4UV4H 1FIEA 2R4SL 4I7ZC 4MA8L 2EIDA 3W87A 8TIMA 4XC3H 2CU9A 3T4WA 5FYJU 4N2GA 1O5RA 4GCXA 3T07A 1V6TA 3DEQA 1ZLUH 1L0YA 1LM1A 5DC4B 5EO9B 1MRDH 2CGYA 2ZX9A 1KJ3L 1W0YT 5AB1A 1B4KA 1GOFA 1X5XA 1KMGA 2ICSA 1EYEA 2A2QT 4LARL 1YHTA 3NK4A 2PDQA 1WEJL 5HVHB 3SADA 1YEFH 5KSUB 1XKYA 4JN1H 4OCMC 4QTHA 3WUBA 1XEDA 5D9OA 5IJKC 3QUMA 2AAVA 2X6VA 5JOFA 2VE6A 4XN5A 3GR8A 1PS3A 2ORBH 4XAFA 1Z5HA 3H2FA 3L4ZA 3OKMB 2DQJH 5ADOH 5BUGA 4PR5B 3WXVL 1ITUA 3PJNA 4H8HA 3NGJA 1SDAB 4NYYA 4RESB 4HPHA 1ZVNA 3KYKL 3QBUA 3ZJ7A 5BS0B 4UQ3B 3GTXA 3EYVB 1HIMH 3IEAA 1TJHL 3N3TA 4QHLA 2TMDA 4TX8A 1EANA 1NBZB 1K8ZA 1N5AA 3EJUA 4UTHA 1P84J 3ZKQD 5ECJE 1HGWA 1MPAL 4FABL 3V5KA 1JDFA 4QROA 1J5DA 3FO0L 1J1XL 2HXAA 1DE5A 3ML9A 1DWGM 3NCJH 3QFEA 1UWQA 1SVBA 5HHME 1PFCA 2APXA 4OTKA 3K6SA 5JHLA 5ICZA 4LAUA 3EKZA 1AGBA 5L2KE 2K6WA 1KFCA 5JBEA 5IB3B 2O5XL 3D9AH 3RGTA 2FBJL 1Q0XL 5I24A 5EWIL 3QI9B 1LTXA 1OBAA 2ZONA 4QE4A 2VEGA 4PUMA 1CIUA 3DXAD 3H56A 1S9VB 5DFAA 3ZS4A 3FPYA 1NPJA 1OIFA 2GTQA 2ICEC 1W56A 2J7LA 2A3TA 3NDZA 1PL3A 2NX5A 1TWZA 5DI8B 1KBWA 3WTYA 4N2FA 4FFWC 1M04A 1W54A 2WXMA 4LC8A 1QI4A 4NZ4A 4WWKA 3V0WH 3E2VA 1MFAL 1YEJH 4LAOA 2KZ1B 5LNSA 1OAZL 3NEVA 5A95A 2APWA 4PTUB 3PZQA 3PIQB 2RMNA 4O12A 5GIRA 1Q72L 1JWUA 3GO1L 1QK0A 3FC8A 3LHTA 3CT2A 5CJ8A 1M2VB 2FB4H 1IAMA 3NFSL 4MNQB 3CLFH 3QW4B 3BPNC 4MJHA 2ATKA 5I6XC 1FZJA 1W8SA 1EAPB 3NZHH 1TSHA 4HXBL 1A7PH 4P5KA 1R38A 2GHZA 1D7BA 2PWDA 4H5SA 2H9GB 3K7UA 3LY6A 2XFFA 4PRNA 1LILA 5T8GA 4J3TA 2VJXA 3GSNL 5DZVA 1PWMA 3UO8B 4V1XA 4OD1L 2BOBB 1L0PA 3K2UH 4KX8A 1H15A 1K4DB 1N67A 3HFYA 5INCB 2AI0L 5DS1A 2OXGB 1NCDL 3S3PA 4AUUA 5B8CC 4LLMB 3WG7B 1GR7A 5EC1B 1W72A 1HGYA 1HHGA 1LO2L 1I1AB 2CUHA 4E0RA 4DK6A 1V5XA 2LOEA 4Q4SA 1IILE 2R9HC 3P9MA 3VIIA 4OLXH 4UTBA 2E5CA 4F8XA 4YDIH 3PP3H 2HTLD 3AHXA 4OT1H 3FCUB 4LDOB 2NQHA 1EB3A 3CHOA 5LBSH 3DI2B 3QJFA 3MRMB 5C07E 4REQB 1UJ3A 4JAMA 5D4HA 3VH8B 2GI0A 2GBVA 2FL5B 1W1IE 5F2MA 4JYDA 1GOWA 3LSBA 2WQUA 4E0CA 2RCSL 4UTFA 3DFSA 2J13A 3WIHL 2LVCA 1ADDA 3W28A 1UR1A 4CCZA 1OEPA 3W57A 3HB9A 5I8EA 1IBBA 3KBHE 4FC3E 2UXVA 3VGEA 2BFVL 1BYDA 3T55A 3PXLA 2FT7A 3PPSA 4AM0A 2AJYL 2VDPB 4LLVB 2WTRB 3GMOA 3QZAA 1V03A 1KBLA 1Q7QA 4LY8A 1LO3H 1IZKA 1BVKB 2E77A 1MEIA 1CTOA 4L4TE 1Q6CA 4YL4A 1EXBA 2WD0A 1G7PA 2XJKA 3GMPA 1LRTA 3MRCB 4DKDC 1O7VA 1T7ZA 2K6ZA 4BFGA 3FO2B 5D2TA 3C09C 2F0CA 2W1NA 2QUUA 1B9ZA 3AM8C 4HS8H 1GEHA 1EPVA 3ML8A 4MA3B 1E4NA 1ZSHA 1X3DA 4O17A 4LYRA 4PS4L 4U33A 4A7SA 1S5HB 3AGWA 3VYPA 1WZKA 2BSTA 3URBA 1XF3B 5FFOA 1H7RA 4LVOB 3T8XA 3DX8B 1QASA 5SX4I 4US6A 1LZOA 1TSRA 3QISA 4MA7H 2CC0A 1FNFA 4DKFH 3UY8A 3UTTA 3P0YH 4HA0A 3NAAL 4DESA 4KWWA 3UXAA 2J3SA 2VW7A 2DEXX 4L3AA 1RJQA 2G3MA 4OFYA 3NL2A 3IJHA 3LG3A 4N0UE 2OL3A 2BNQE 5F6IB 4GG8B 2DQDL 4XODA 4Z8FL 3UWUA 1XIEA 1PIFA 4OLYL 3GNML 1P0NA 5D2VA 3NABL 2HT3D 3CH0A 3CHFA 4LEFA 5KS9A 3SO3B 3AABA 3DGGA 1UA6H 4W9LC 5BNXD 2V2XA 4GMSH 4NJIA 4JG0L 5AYTA 3AS1A 2WTOA 2IAAC 1BKSA 4XBPB 2ZUNA 3U6WA 4NZ8A 2NR6D 4BFNA 1KEMH 4JHBA 3MUGA 3EO0B 2IKIA 2WLLB 2HVNA 3R0DA 1LEIB 4MRBA 3QR3A 4OZGB 2FJUB 4MWAE 1I7RB 3W7IA 3LK6A 3GHTA 3F6JA 1T5AA 3A13A 3OVPA 4EPEC 3NO3A 3ISYA 1N4XH 1TVPA 4KVNL 4EZKA 4QRAA 3KLSA 2Q09A 4FI4A 2CR6A 2RHGA 3B7TA 4B60A 5F3BA 1LP9F 4PB0L 2W0LA 1SHSA 4XN8A 1PZUB 3EOEA 3DCPA 3QORA 1HXYB 4H83A 3TMQA 1E4IA 4PUUA 1SN5A 4L3EA 4ECLA 4P4KD 5CEZL 1NM9A 2G3XA 3KDPB 1B2YA 3VXOA 4DP9X 3OPUA 1KPUA 1K4HA 2ICWJ 1Q3NA 4BK5C 5I5RA 1PZDA 2GJ6A 1NL0L 4AF0A 5DMYA 4N87A 5KBPA 1S9WB 2WM1A 3MHGA 2PXYD 1INEH 1LXMA 4P59H 5JYMA 3IRSA 4RDWA 2O9RA 1GZQA 2MOQA 4N8VG 3UTQA 2BY2A 4L8DA 5DQJB 1ZS8A 3WY3A 3L17A 2JJSA 4NUGH 2V7HB 1D6VL 4HU4A 1XL6A 3BSMA 3MLSL 2QT3A 4GQGA 3L2NA 3SO5A 2Z7KA 3C6EA 3I02B 4JQ2A 3KVLA 4EDXA 2H5UA 2VH5L 4OD3H 1RL1A 4M1GL 3LQMA 5IQ7L 4Q9RL 1IL1A 2XXFA 1IVLA 4N28A 2DQTH 5KSWA 3HBZA 4RKAA 2QKSA 4Y4KD 1XLIA 1YPZE 2XTJC 3VXQB 2F53D 2AXGA 5EOQH 4IQLA 4I3SL 5D9MA 2HBVA 2V5JA 3QJZA 1T1YA 4L8CA 4MNHA 4M29A 3VXNA 5BRPA 4HC1A 1RZIA 4Z2GA 4E41D 2VDQL 2X05A 3WEAA 2W0UA 1BTMA 5DS2A 3D3VD 1JWMA 4X9IA 4W4OC 4Y7EA 4XNAA 5GJTH 3UJFA 1NGWA 1WBZB 5CD3B 2DZSA 1UD8A 3M7SA 3ZR4A 2WMGA 3PZOA 3DROB 3K30A 3SPHA 2DEWX 1A9EB 1TJ2A 1VPYA 2BW5A 3GS7A 3JS3A 4NQVB 4Q6YA 1CFQA 1D6EA 3KTCA 1BKHA 1FY6A 1Q9WB 3W53A 4WHTB 1K8DA 3OGCB 1X9LA 1O5KA 4RZBA 3O9WD 1HO4A 1JCNA 5SX4H 3SDYH 1TPVA 1WXZA 3DBNA 1BM3L 2VEMA 2ZOXA 3W02A 1L5GA 1NQKA 4Y9CA 5KG9B 4OQVA 1QAWA 1QCWA 1WWWX 1RZKC 2VX6A 2Y1ZA 4NCC2 3A5FA 1MCEA 2WXKA 4M6AA 2OI9B 4JG9A 1VFMA 5BRZA 1S5TA 2ZOKA 4UQ2A 5DJZB 2A7RA 2BP1A 3STLA 3LN3A 1WDAA 4F9PC 5HGGS 2XIDA 4ODSL 3W74A 4OZFA 1RUAH 2VWEE 3S8GB 1A65A 3GG7A 2PUZA 1D2OA 1I2NA 2IPTH 1NCJA 1F02I 1XZ0A 1V02A 1CVRA 3LKNB 3QR0A 3FA5A 2VXTL 5BCAA 3DVNA 4YIQB 3WEZA 4MLSA 1GVIA 4H88L 4BH8B 2BNUB 5ITBL 2IH9A 4HZ1A 3ZUNC 3TCXA 4H20H 2CKRA 5KSAC 2DBLL 1LOLA 1BV8A 3VVVA 4XMTA 1G6CA 4GBXB 1ITBB 2BIOA 1PYFA 3O8XD 2ZZ2A 3MRRA 4FIQA 5GZOC 3BUYB 4KVCL 5HHNB 5K9OA 2RACA 3US0A 5I18H 3MRQA 5ID1A 1JPTL 4CN6A 1HS6A 4B2DD 2H1LM 3GBDA 3DMMB 4JTKA 2R51A 2EDMA 3N42B 3KVDD 3HI1A 4J39A 2WVTA 3JV4A 1U95A 2VR9A 4G7VH 3OPZL 4R97C 1JPSL 3O11A 1IGML 2C9AA 2AGJH 2FX8H 1XRTA 1N5YL 4OJFL 3PZMA 3LVEA 4GEIA 4ZUUB 3VNLA 5GRJH 1H6FA 4MCZB 2BB0A 4HF5L 1UKSA 2QW5A 4N5ED 4NO0B 4QNPE 5BV7C 1ILSA 1V51A 1YPXA 4HN8A 3HZVB 5FL0A 3DRTA 4BY3A 1P4LB 3FQRB 4OFKA 5DCBA 2PFHA 4GI4A 3TQVA 1U2HA 2JJTA 4DVRH 4XNDA 5IB5B 4JRLA 2H6UA 3LHYA 4M4PA 4G6CA 3TJHC 2OCFD 4HQQL 1CFSB 3BXNA 1IZCA 2P53A 2Q8ZA 3L1FA 4TSAL 3D1MC 3TR2A 3MRNB 5T1KA 2X0HA 1IM3D 4W6WB 2GUYA 4P9MH 3PWVA 1NMBL 4MAYB 2OGJA 3QAZB 3IKKA 5ANMA 4JKNA 4K5NA 1XBXA 3KRSA 4AMWA 2AEQH 3GBEA 3IIZA 2V5BA 4KNSA 3OR7A 2IDQA 2E9JA 5E9DE 1F6AA 3I68A 5GS1C 1T22A 3TN6A 3R0NA 2L4OA 2CCRA 4HUVB 1EJRC 1DYSA 5I1JL 1RJZA 1EDHA 3T0WA 3LZQA 1PX3A 1UZ8B 4Y9FA 1NFBA 1NGYA 2ENJA 4XX5A 4Y1TA 3KPRB 1AJZA 3T78A 5GHWH 4PJXB 1FRGL 4KNQA 3HC4H 1T7VA 3AXLB 1JR1A 3HA1A 1HL4A 1YTKA 2VC2H 2WTPA 2CAKA 3JWOL 2JEQA 1YN6B 2IBZX 1SJDA 1OPGH 5HJXA 5EGRA 2XHYA 1KT2B 1OHLA 1F1AA 5TQ2L 4EI5B 5D70H 4TX9A 1B90A 2ITDA 4EO5A 5BXRA 4JTFA 3NN8A 2YXXA 3MRLA 1HILA 4K71C 4NJKA 2PTZA 1A4AA 9RUBA 3VDCA 3A6OA 1KIPA 1TENA 3TLRA 1QQDB 1MRCH 3TTEA 1A64A 2XG9A 5FPIA 4ZAKD 1LO0L 1OARL 2FPVA 2ROYA 5I1DB 1JFQH 1RZFH 2YBTA 5KZDA 2I7GA 2I5YL 3CU2A 2EIZB 3FKUS 5GS0D 1SJEA 4ODXB 3I85A 4N90E 5LA1A 3GNOA 4FOKA 3UU0A 3C9NA 2EEXA 2ONEA 5E6RB 1KN2L 4AXKA 1ADSA 3K4AA 2FQDA 3PPGA 5FO8B 3VXUB 5FJPA 4QM1A 1A8ZA 2XBDA 3DX4A 2VLRA 1XYAA 1MHPL 3JWNC 4YWGL 3G6JB 2QADD 4IHCA 2JXMA 1MWAH 2A6DA 4Q2ZB 3MV8D 4QF1B 2Y72A 3OQEA 4Z3HA 3Q01A 2X2HA 4UINH 5GSVB 3C5ZD 5B80A 4UU9B 3RVXD 5M3WA 3EOOA 2ZXAA 4AH2A 3MO1A 1RK7A 3SB0A 4D6CA 2AQPA 2NXYB 5GSRA 4UTAA 4YXHL 2NNCA 1VR6A 3TN0B 2I14A 1H11A 1R2TA 7FABH 4RJEA 1K9TA 4B5XA 1WFJA 3LBCA 1C5DB 4Q4IA 3IGAB 1EP1A 4Y2NA 1QRQA 2HRGA 2PDPA 1BGGA 3P82A 3L65A 4FF7A 4ZTOH 2JEPA 3FYIB 4POZD 3B9KB 1EZVY 3O3RA 3IGFA 3EOBB 4I9XA 5I2IB 1FNSL 4HPOL 4RQQA 5A8PA 4MJIA 4HA3A 4KZDL 3QQDA 2WOYA 3ABRA 4ZFQA 4HMEA 3T0VA 2EXTA 4AJYV 4RWHA 4G8GA 3HV8A 1G6RH 2WNQA 1N7MH 1F11A 4QEGA 3I50L 1GQIA 1NBYB 3BN9C 5H8DA 4N2AA 3WJWA 2RDUA 4JR9L 3MUHL 1L6XA 4ORMA 5I75C 4YWSA 2CM6A 1ML0A 5ILTL 3EX2A 2XWCA 2PGEA 4UR8A 4QOKB 1FLRL 1VFAA 2C9RA 2Q10A 4OM0L 3SQOH 3CVHA 1NANI 1I8AA 2MQ3A 2ZX6A 4KUCD 1IE7C 1F4YH 3VINA 4OR1A 1EFQA 1Y7VA 2ZPKH 1HEHC 1NGPH 2XBTA 1N8ZB 1RQHA 4PRHA 3QUZD 2QFRA 5TQLA 4PJIE 3TC3A 1FO0B 2IPUG 5DS8A 4HS6B 1HI6B 1X7SA 4A7UA 4ZEPA 4WU5A 3ET9F 1FE8L 1JWSB 3SDDD 4C4KO 4RRPG 1I8KB 1QPXA 4DZ8A 2FZDA 3P2VA 2PRMA 1KYDA 3LRSA 3P3YA 2YRZA 5EZIH 5EU5B 2E9BA 5C0RH 3JTSA 5D1QC 4L5ZA 5FGCE 3EOUA 2TYSA 1JDAA 2XN2A 3BGGA 1EWHA 3BAEH 3OTTA 1EYWA 3IDNB 4JFWA 2QQNH 4FJYA 2G4FA 3LZFH 1OAUH 3AJXA 3D2UD 2CM5A 5A6MA 3NL6A 4W9DC 4Y5YA 1TZ9A 1U8NA 1UB3A 3GRWH 1AD1A 5C2BL 1QRKA 3OKNB 3DOSA 5HGHA 1M56B 4MHHG 1UC5A 1EBHA 1KB9K 4MZ8A 1L6GA 3QXTA 1SDDA 5HDQH 1Q6FA 5E0KA 4GW4B 4PH8A 3MPCA 4NRRA 3G6DH 1ETZB 4OAWA 5DD3H 4KTDH 4L05A 2P28B 2H9AA 4E9WA 4UZGA 5IEHB 3USZA 3BQUD 1AQKH 4HZMA 3LRLA 3MUZ1 4DBUA 1N2VA 2Z93A 3C6LD 5TQ0H 4Q9QL 1W0VB 1NP0A 5INDB 3TLLA 2D7PA 4PGBA 5FR3A 4HNNA 4CVWA 1VHPA 2I60H 2VXQA 2NUWA 3BKML 4JFEB 3T0TA 2PGWA 5D71H 1UZDA 4OT7A 5D1ZC 2BINA 4TYUA 2YD0A 1Y5VA 1TTGA 2AZAA 3P9LB 1LBFA 4DGYH 4QGCA 1BP3B 1QPQA 3HFFA 4AIZA 1E6QM 2BWGA 1KLGB 4C83A 4RNRB 5C08B 2QGYA 3S37H 4BF5A 1BWVA 3KHQA 5C0EB 5CBEB 3Q2CA 1P6CA 1OXYA 4H25A 4AIEA 3GC5A 3IF1A 5AC4A 4FOJA 2FB2A 3F4NA 3R2GA 4WKFA 5F70A 3QNXA 3DUSA 4L1XA 1OCOB 5EOTA 3GK8L 1IR1A 1TZ8A 1PD0A 1WUNT 3VC6A 1CYGA 5HI5C 1A6ZB 4LHUD 2XWZA 4EIVA 4PCKA 5CGTA 4QJ1A 3K2IA 1E0OB 1J88A 3NNTA 1RKRA 4Q33A 4K23L 1LCOA 2V5DA 1U83A 2GB2A 3GS4A 1RK5A 5D5MF 1Q9KA 3QIBD 5DHDA 1INQB 3W76A 5AWNH 1YYMH 3U36A 3UYIA 5EZLB 4DELA 2MTPA 4OM1L 3L5LA 1G7IB 3TDFA 4PJFE 2ACUA 4RMBA 5C0DB 1RUQH 1MFCL 4MMXA 4X7TB 2ZC8A 4CVUA 3F5JA 3KPSA 1P69B 5E94B 3BMVA 4YWIA 5CSYA 4JK0D 2OS7A 3MZNA 2R91A 5CZ0A 4AVKA 3EBGA 5HNTA 2HFEB 4IQJA 4KZEH 3KHJA 4K6AA 1LLZA 3NQBA 3HMJG 2QQLL 2E7BA 3B8WA 3RPKA 2YAHA 1L6WA 2YC1A 3KBJA 4M7JL 2GK0A 2DMBA 2NCEA 4M61B 3UTZB 4M6UA 1FIGH 5CF3A 5IGXL 4PTVA 3ZYOA 1ISXA 1QNZL 2X30A 1MI5A 3QTGA 1VBGA 3O16A 4RE3A 3H85A 1W17A 2W65A 2IQ9H 4WNSA 4Z7QE 3UABA 1NANH 3QZNA 2HVJA 4LSSH 2TRHA 1E7VA 1KCSH 1G7MA 3W2DL 4Y19E 4HK6A 1KPRB 2H26B 4JM0A 1K6AA 4RAVA 3R4IA 4K3JL 4JKWA 4IGNA 3H2OA 1WBJA 5G55A 7PTDA 3MKCA 1ORSA 4K7FA 2F8QA 1Y6MR 1PVHA 1IAIM 2AQWA 4D6HA 1SHWA 1QI2A 3PG8A 5HHVL 3L7FB 2VEFA 4PRID 2HSAA 3LRHA 3TC9A 1SZEA 3WMLA 4HEME 1KZQA 3QIWB 5JNYB 3USBA 1Q0EA 5I30L 3TT3L 2Z92B 1VPQA 1YTEA 3T1FB 1DQMH 4B97A 3ZWTA 4N2DA 5EU3B 3GTHA 2XN9D 1E2VA 2J8UB 4BE5A 3ZVIA 3ZZSA 3QEUA 3C08L 2CBQA 4IL0A 5KINA 5E8DL 1KY6A 4XO3A 5D2LF 1NFDB 4GY4A 4OF0A 5DVOA 4OJAA 3MRHA 4GC4A 3X3GH 4PBVC 4NASA 1Q6RA 1C12B 3HPXA 3ZKXC 1NINA 1QTPA 3QM3A 2PWHA 3EGDB 3LOWA 3ILQD 3WTXA 3EH4B 4J3WA 4IUGA 2O6EA 1FORH 2B2XL 1AC0A 4Z7WA 5IW1B 3AXIA 1J2BA 5F7DA 3NH7H 1ME9A 1MIEH 2PE4A 1YMHA 4LSPL 5K39A 3FOMB 5DO2C 3R8QA 5I5JA 1IEBA 3N1QC 5IBTL 1ZVSA 3EUDA 3CUPB 2DDXA 4ZD3L 5IM7A 4IQHA 4FG6C 2VM9A 1T03H 4O19A 2Y7LA 2YEZA 5DFWH 3E74A 3LXCA 5MENE 4JRYA 4AWSA 4XCFL 1W5QA 3MBXH 2Z7WA 3WD0A 1GMEA 4WY7L 3M0XA 2DMKA 1VGEH 3JT0A 3L12A 4EBQL 4DO7A 1LRQA 2PETA 4K0OA 2APTA 1SYVA 1QLEH 3SBFA 1XD0A 4CCCA 1ODAA 4S39A 1A53A 3PJUA 4TQHA 1JZJA 2ZX5A 1HH6B 2B1AL 1NC4D 3FTGB 3LDBB 3C8DA 4DBWA 4QRPB 4ABWA 3C0QA 4GRWF 2DLFL 1LTDA 1EOMA 3TFKC 4K7PY 4MHHI 2QEZA 4G82A 4FQXB 1LD9A 3WLHA 2GJZA 3IAQA 4HEPA 5IHRA 2PYFB 4IU2B 5DT5A 3BJSA 3F01A 5LGJB 5DMKB 4ZRGA 4FQIL 1V7YA 3SGUA 4BZ1A 2V7HA 1F3RB 2DQMA 2FEDD 3APDA 1UFUA 4IKLA 3HIJA 3P0GB 4AQEB 4AD5A 2GW5A 4IFRA 1V7ML 1H62A 4KTEL 4DCQB 1LM8V 1MG2C 2R82A 3EHBC 5I1CL 3TCLA 3D50A 1F41A 2WO2B 2BVPB 4KDVA 4NSKB 4PRPA 5BXFA 2PYED 1HE7A 2WSDA 2XBZA 2R4RH 4XCYA 3EGSB 3XISA 4ODVL 4BDVA 1TA3A 1F2QA 3VXPA 4X6FA 1YXCA 1UR2A 5HUOA 3TO4B 1JPKA 1Z9OA 1JXJA 4XO5A 3V8OA 2GSGA 3CAQA 1JCXA 1HDMB 5DMJB 5HHXH 2NY5C 4Y5XB 3RL1B 4EPKA 6A3HA 1KEGL 1FJ1B 4D8AA 3E2HB 4IJTA 4E68A 4O4VA 3SBQA 1F8IA 4AZGA 5IT2H 2J2ZB 5CEXB 3HZMA 4FXLA 5FFLA 2VC5A 3RHWF 4FXKC 5GGQL 3O6ML 2A9ML 2XH4A 1TJIH 3VFPB 4KCVA 3FU7A 4LCWB 4GYKA 4GUJA 4QAIA 1UOWA 2Z26A 1G1OA 4PJ9D 3T4AC 4NBZB 4HTBA 4M6PA 1VBHA 2GJPA 2IADA 3RAJH 3K1DA 4RISL 2CJUH 4MYXA 3SCSA 3OJGA 1JHLL 3STCA 4AG4L 1QO3A 2Q3OA 1CXLA 2HX8A 4DK5A 3KXFA 4NY2A 1SJMA 1ZAHA 2R1LA 2V5SA 4F9DA 1NFIB 1UR9A 4FL4C 4K94L 1I8MA 1JHKH 5AAPA 1GYNA 5CEZD 4L5FE 3PUCA 3U8GA 2ADFL 1MNUH 4F3FA 1P7QA 2YARA 1U6AL 2FATH 1UKOA 1ZT1A 1HKLH 1FRBA 1TPUA 2D73A 2I17A 4X8GA 2WIIB 4X60A 1EWDA 4WK9A 2G75A 5CEYB 2NLYA 4YUEH 4G7FA 3NXLA 2AGTA 5GS0L 2GGHA 3A24A 5JPNC 3ECQA 2G5BA 1HFBA 2ISFA 5CGMA 4ELDA 2Y36H 4LOCA 4XX1G 3WUGA 4KO7A 3BLFA 1DVUA 1UPMB 1NMAH 2UXTA 2YK1H 4GQ9L 3SDXB 4YVPA 5KJRH 3C12A 4XZBA 1GKRA 5IDIA 4F0KA 2YAQA 1CC3A 1RY7B 2CLIA 1ZNNA 1W8NA 1US2A 4JPIB 4G9FA 3THMH 3ZHKA 3GU9A 5DHMC 5KSBE 3SKMB 2E76C 4ERGA 2CBOA 1IU1A 5HD8D 3WUWG 2X0VA 2NY2C 4DPPA 3O41B 5EU4A 4PI2A 4AOFA 3POCA 5HI4D 3MP3A 2WWMD 5DRXB 1N0LB 3MTRA 1DQUA 4EQ2A 3VI4B 1F3JB 2H3NA 1ZQ5A 4R7NB 1QHZA 4NPYB 3BHBA 3O2LA 2VKXA 5DK0B 4HJJL 4DQOH 2AK4B 4ZUUA 1J5SA 3T0XA 3NTYA 1S5NA 4AQOA 5ABGA 5EPDA 3D39D 5D6CB 1B3ZA 3NPWA 2CO6B 2A7NA 4B5UA 2ZKWA 1SY6H 1E40A 4RCAA 2HE8A 1TKWA 4AMCA 1K5NB 1JGUH 5AVZB 5BJTB 5DXYA 3N6YA 4C6QA 2WMKA 1KR0A 5I79A 3WJMB 1U3HC 3ARDD 4FQ1L 5JXEC 1TV8A 4GZ7A 5D8WA 2JV6A 1KCVH 4MPQA 1UXSA 1KENL 4NYLB 3UO1H 2NW3B 4WUIA 2D9QB 4HGKC 2WZAA 4U10A 3GX9A 1O68A 4NP7A 3WF4A 5ADPL 4C1NA 3BG9A 3U6RB 3IFPB 2YBRB 3NSDA 1ES0A 4PP1D 1CI1A 4XPGH 2DY2A 2BP0A 3OAZH 2R0LL 3R89A 5FF6A 1U2YA 1FZOA 4OUEA 1EGJL 3TIDA 2OMZB 3MRFA 5A1AA 1W5PA 1PY0A 2WXLA 4XMXA 2QHAA 4NU7A 3HZKA 3IKCB 4KQ3L 5ESQA 2ZWNA 4BJLA 1SR9A 4PEEA 4DZBA 3MWAA 1F3XA 1M6OB 4DX3A 1KBGH 4NZDA 2C14A 4AW7A 3G6AA 4NQED 3CIQA 3BDXA 4JE4B 2XSBA 1VD6A 3QUYA 3WAKA 1P7TB 3L21A 3AIRA 2QQKH 3A4DA 5EIIG 3ATBA 3NQMA 1M42A 4RWYL 5HHPA 2FH8A 4WKHA 1T41A 2XG4B 5KBKA 4ONFL 4BI6A 1F6LL 3B5HA 4IRJC 5L8LB 2H1PL 1Z3GH 2CUIA 5DRZA 2FBRA 4F0MA 2NWSA 4IOFC 4X22A 3P0WA 3HAEG 1MAKA 2ZUXA 3M4HA 2F2HA 2PPGA 2BERA 4F93B 2PU0A 4AFYA 3ARBD 1EHAA 1DOSA 4IGHA 4F37F 2Z0BA 3KYOB 3BD3A 1X38A 2ZUMA 3T6QC 5LWYH 2ZTKA 3MRGA 4X5WA 2WZTA 4ZFFB 2CBIA 1ZA3A 4U6HB 5AYZA 1YY9C 4ZMZA 4HHMA 1K8CA 1IGCH 1H1ZA 5I3GA 5FHBL 3FV9A 2NY7H 3CBRA 1A1OA 2EBNA 4HJGB 5AC6A 4YLWA 2WNKA 5BV7B 2R2BA 3JR2A 4ZMOA 3ULSB 1HH9A 4XMLL 1E4XI 2Y8UA 5KEZA 3CUIA 2CHZA 3B3BA 1WAAF 1WLHA 3QC5X 1CZ1A 4L1HA 2WY3B 4ELKA 2UY5A 3CLWA 2BOCA 3JWDH 4WU7B 2ARWA 4W7WA 3QZBA 4MF4A 4AJ0A 2OZTA 5C9JB 3I6RA 4B5NA 2ZBTA 2VDLL 1NTHA 3WFBH 3L5XH 2OEJA 5DJYB 1UZ6F 3QH3A 2F54B 4PGEB 2HROA 3NDOA 2G96A 1H5BB 1D5BA 4HN4A 3UAJD 5C2XA 1OAQL 4WHYH 4F1SA 3SJNA 5IROA 3L3KA 1HEZA 3QJAA 3S83A 5J4MA 4L61A 2IPKB 1A14H 3E6HA 5FAGA 5FYLH 1QLFB 4WW2F 1ZWIA 4UM9A 5AAWC 4AZIA 2BRQA 2P5ED 5A7BA 1E6JL 3WSQL 2V3FA 5GRVL 1WZMA 4PMXA 5LG1A 2VO8A 2EG8A 4O2EB 4G1EA 3RWDB 1IGYA 3C2VA 1XSKA 3NJFA 2H0EA 1KFKA 1G7HB 3VSUA 3HG3A 1XCXA 1HKVA 43CAB 4QJ5B 5TF1L 4JN8A 3TBBA 4GKOA 3SSJA 5C0CA 1YEIH 1XWYA 4O51B 4JY5L 1BLNA 4LWWA 3MNDA 4JTRA 4U6VL 4KO6A 1E0XA 1NC2D 3VWKA 5A8NA