2ZXBA

Alpha-l-fucosidase complexed with inhibitor, ph-6fnj
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 161
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zxbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zxbA01
6TAAA 3OLDA 2WMIB 3A47A 2EPLX 1J11A 3AMKA 1AQMA 2WNWA 1NWTA 3VSVA 3WNMA 3A3HA 3D5HA 1GOKA 3U5YA 3A5VA 3PZIA 4ATDA 2PB1A 3MKKA 1UZ1A 3VMPA 2YL6A 1JFHA 1UUQA 4E8CA 3IGUA 5D9NA 3CO4A 1R75A 2CBUA 1M01A 3OBAA 1Q6EA 2XPKA 1ECEA 2QMJA 3HN3A 2NT1A 2J7FA 3GBEA 1V6WA 3PN8A 4NZJA 2BHUA 4HOZA 2C8NA 2V3DA 4OKDA 5I3DA 4KH2A 3WQ5A 4TX8A 2WC3A 2QPUA 1QNPA 3AXHA 2CNCA 1W32A 5A8OA 2WZIA 2XWEA 3E1F1 1OWQA 2J77A 2JFEX 1UA7A 2WKLA 3VIJA 1GCYA 5DEZA 2WYSA 2Y8KA 4XX6A 3BH4A 1LF1A 2YBUA 2WB5A 3WF3A 4PMUA 1E6SM 4GZJA 4DWSA 4TTUA 4GKLA 2AMGA 3AS1A 1LL7A 4PUEA 3VM7A 4CD7A 4V2XA 2FGZA 4JFVA 5D9PA 1C7TA 2DIEA 3AFBA 2J7HA 1YHTA 5BXPA 2CESA 4M8UA 1BG4A 3QOKA 1JYNA 1V6YA 4WJXA 2HISA 3RMEA 2DSUA 4PMYA 3KL5A 1VFUA 5FD0A 4KGJA 4JKKA 3SUSA 4J3UA 3MANA 4P7QA 1HJVA 2XJ7A 4FNPA 1M53A 4M80A 1RH9A 4MDPA 4MNMA 1HWWA 4E8DA 3I3BA 3DYMA 4FMVA 4QLLA 4A3YA 3SCTA 4CCDA 3GBDA 5GNXA 1EO5A 5A2AA 4PMDA 5CPSA 4YPJA 3OLGA 2A3EA 3VDBA 1JNEA 5FL1A 3WEMA 3RO8A 5AC4A 3PZGA 1XYFA 1QNQA 1QNSA 3WF1A 3F5LA 3EJPA 1OD0A 2J8GA 1W1VA 1QW9A 1JZ8A 4D6FA 3CH9A 3AMDA 2D73A 2VZUA 3UESA 1HXJA 2X2YA 3RCNA 5CXPA 4ATLA 2O9PA 2VNCA 4OIFA 2ZX6A 3WUFA 2EPOA 4CD4A 4DUWA 5LA0A 5I79A 4AD1A 1B3WA 3K8LA 1NOFA 1QNRA 1RD6A 3CZEA 1GONA 1V3JA 1UH2A 1TQSA 4F8XA 4QCFA 2E8YA 3VILA 3KLKA 3SCNA 4UFMA 1UQYA 3W53A 2D2OA 2YOCA 3HG2A 4QP0A 4AD0A 1XGZA 1GJUA 2PWEA 1AQHA 4KRUA 2WHLA 2PI6A 4AC1X 1EO7A 4UOJA 1ZU8A 1GOQA 2WVTA 2WMIA 1E3XA 4OZOA 3JUGA 3EDJA 2XVPA 1XH0A 3DX0A 4CGTA 4M82A 2JIWA 3VNYA 1UD4A 4UOQA 1GHRA 3GH7A 1JFXA 2OWWA 1UWRA 1CBGA 4MNLA 5A8MA 1TA3B 2G3IA 1I75A 3G6LA 5BXRA 4W7UA 6CGTA 1E5JA 1EQCA 2YA2A 3WH8A 3ALFA 1CGTA 4E2OA 5JIWA 1UR0A 4D1IA 3TV8A 2BY3A 2FHFA 3WNNA 4LYRA 1W9XA 3ECQA 3RM4A 2RGMA 3WY4A 1GOMA 4R5EA 2CYGA 4UQCA 1E0XA 3MUZ1 2QV4A 1BG9A 4D6DA 1W1YA 1H41A 4XZWA 4P8VA 3ARVA 1V3KA 3TOPA 1HKKA 5HNNA 3BLPX 3WDJA 4D71A 1KBBA 1BF2A 1MW3A 4KMQA 5F7UA 3WNKA 4NZCA 1UWSA 4H7VA 3RDKA 1CDGA 2CHNA 4OJYA 2OSYA 3AIBA 3MS8A 4LYPA 2XVGA 2QHAA 4MNJA 1SMAA 5FOOA 1E70M 3AICA 2D0HA 4MDOA 3HMCA 1VEPA 2QF8A 1G5AA 1BVNP 5AC5A 1ZB5A 5BXTA 1V3HA 2W5FA 1UD3A 1DWHM 1DWJM 3BUQA 2ZIDA 3VOCA 2X2IA 4FLRA 4FLOA 2Y8VA 1HJWA 3VDAA 1H3GA 3GXIA 1XD0A 2J78A 1KGWA 3TTYA 2ZUSA 1UKQA 3EJRA 1PX8A 1DWAM 2VZTA 3NDYA 3IAQA 4PMNA 1HJQA 2NW0A 4AY1A 4DM2A 4TTGA 2YIHA 1LWHA 4HA4A 3QR3A 3T0DA 4C7GA 2VRKA 4NI3A 5BRPA 3LXBA 1VFOA 1OSEA 4OOZA 4PTVA 4CU7A 1TVNA 1FH9A 4B3KA 4K68A 1ISZA 1WO2A 4DO6A 4UTFA 3FHAA 1US3A 4TVCA 1E73M 1H2JA 1TE1A 2XTKA 3U7VA 3VU2A 4PYSA 4XB3A 1B3XA 4AZ7A 3CZNA 4AIOA 3CZKA 2PBGA 2BY2A 1JAEA 1H49A 1MFUA 1VEMA 2TAAA 3WUGA 5LA2A 4W84A 3TTSA 1V6UA 2C0HA 3WF2A 3WN6A 5GNZA 1ZJBA 4JKMA 3PTMA 3BAYA 1MFVA 3WD0A 2YDSA 3IANA 1FHDA 1JD7A 1UKSA 1JZ3A 4ZENA 1E56A 5A69A 1UASA 3WD2A 1V0NA 1LL6A 2DT1A 1NP2A 4HPHA 1I1WA 1B1YA 1Q6CA 3ARWA 5A8PA 1KGUA 4UFHA 3ARZA 2F1AA 3T2PA 1TA3A 1QPKA 5HPCA 1XSKA 1JXKA 1AQ0A 3L4YA 1Q6DA 2BNJA 4AD3A 4J7RA 3EDEA 1W9VA 4BF7A 5E0CA 2OSWA 3GXDA 1GQLA 3T08A 7CGTA 3N9KA 1Z32X 4OUEA 3AXXA 1VB9A 4DM1A 3H55A 4W8BA 3CUHA 4FF5A 3L4TA 2ZXBA 3VINA 1E71M 3GXMA 3I3EA 4HMCA 1XH1A 4D6JA 2AAAA 4WF7A 4JFWA 2IXUA 2VRQA 2XGIA 1PIFA 4MPKA 1DWGM 1PS3A 2C7FA 5FCZA 2F18A 4JHZA 5A3HA 2QMKA 1V0LA 2JEPA 1XSIA 2E8ZA 1K9EA 4RE2A 2AOSA 3RJYA 1OGSA 2VCAA 2ZOXA 4PMOA 5HOSA 2CERA 1Q6FA 2YDQA 3WD3A 2G8ZA 1B90A 2E9MA 2CBVA 3GM8A 4DUVA 3EMQA 1LG1A 5CQ1A 2GJXB 3QHOA 3II1A 4UZUA 3ARXA 2XSAA 1J0ZA 1BYCA 3ZM8A 3ZSTA 1ODZA 1ZJAA 3N1AA 4B9YA 3ZT5A 9CGTA 3N15A 2EPKX 3AZRA 4U3CA 2CKRA 4C7FA 2XFRA 2XN2A 1WNOA 2YLAA 4TVUA 1R87A 4AMWA 4TVDA 1VAHA 1NWUA 2CITA 3PZOA 2DT0A 1VJSA 2VZSA 2E40A 3AXIA 3TTOA 3LRMA 3ZO9A 2A3AA 2BVDA 2A3CA 4NX0A 1UKOA 2YFNA 3OGVA 1R33A 3WD4A 1B3VA 5FL0A 1N82A 1PX4A 4NXSA 4PUDA 1JNDA 4MTVA 3GNRA 1JL8A 8A3HA 1O7AA 1UR2A 2ZUWA 2WMJA 4HZ7A 4GO9A 5A95A 3NJ3A 2F8QA 1FA2A 3BUPA 1PIGA 1HX0A 4P7RA 1KXTA 4JHOA 3A4XA 3AYRA 3EDFA 8CGTA 2UWFA 1V3LA 4JCLA 2ZX7A 4P8WA 1UOKA 1X1NA 2J7GA 2G4FA 1E6QM 2B31A 1NM9A 5GQBA 4JL1A 2QPSA 3ARRA 4AWEA 3QHNA 4TX6A 2WWDA 2BVTA 4FLSA 1B31A 4CD8A 1JD9A 2F1BA 3DX2A 2DH3A 3DX1A 3MMUA 2WVUA 1Q4NX 4AIUA 5CJ5A 4UOZA 1E15A 5A2CA 3IJ7A 3WQWA 3A21A 2X1IA 3N11A 2YBTA 2XIIA 3BVXA 1HTYA 1KQYA 3NDZA 2FHBA 3WSUA 4FLQA 3HU7A 4MJ4A 3W28A 3S5YA 3AHYA 2DDXA 2JF6A 5D4YA 1EDGA 5M17A 2XN1A 3HG4A 2CETA 4EKJA 5A6MA 5EFFA 4CVWA 5M3WA 2E4TA 1WDPA 1QI4A 4FNSA 4W8AA 3IJ9A 1QWUA 2WW5A 3U5UA 2VURA 2O92A 3UEQA 1HKMA 3AS3A 1R8LA 2EJ1A 3ARUA 4L4OA 2WBGA 4W5ZA 2DSZA 4S3JA 4QAWA 2XVNA 3M46A 2VR5A 3NSMA 1Q6GA 4WSKA 3RIKA 2OLHA 2BY0A 1EXPA 3SCPA 5E1QA 1BGAA 3WL1A 4MNKA 3M07A 4PCTA 3UERA 1NH6A 1E1FA 2CPUA 4PMXA 1OB0A 4MADA 1QX1A 1VIWA 2VZVA 3K4AA 4N0RA 1BHGA 4NSBA 1HVXA 4UFJA 1T0OA 3GXPA 3NUKA 3GXFA 1GUVA 1WZAA 3DECA 3A22A 1KTCA 4XZBA 1KB3A 1WDSA 2GJXA 3G6MA 1WDRA 4PTWA 3T0BA 3O6AA 5IHSA 1HVQA 3FAXA 1DWIM 2D3NA 1CXLA 3N18A 3POHA 5JUVA 1C8YA 1UZ4A 2J7CA 3BMVA 2X09A 3GH4A 1PPIA 3F5JA 2DGAA 2J8FA 1KWGA 3CPUA 2WBKA 4FK9A 3FXYA 5A8NA 2YL5A 3CHCA 1WCGA 4OOUA 4W8LA 2VQTA 3B9DA 2FGLA 5DO8A 4J3TA 3BCFA 4GI6A 2Z1KA 3BVWA 2YA0A 2EQDA 5ABEA 5DT5A 5ABFB 3PZTA 3CHDA 3CHFA 1NQ6A 2YJQA 3WQVA 2Y24A 2EBNA 3D51A 2ZUTA 5DMYA 4UQ9A 2WSKA 1YQ2A 3UG5A 1EHNA 5DF0A 1U30A 3CIVA 3VMOA 4N42A 3GNOA 3WQ4A 4U2ZA 2VO5A 3UR7A 1WKYA 3GXNA 4Q7NA 4AZ6A 1HKJA 1OM0A 2X2JA 4ACZB 2WLYA 3AJ7A 5A6LA 4X0NA 2PBOA 2V38A 3T09A 1UD8A 1GQJA 1TQTA 2VMFA 2A3BA 4FNTA 1DTUA 4C7DA 2ZX9A 3SEPA 1V3IA 2Y2WA 2ZX5A 1CPUA 1JZ4A 1ZBKA 3FW6A 3UG3A 2WAGA 4PMVA 3BXWA 2VQUA 1CECA 2OWCA 1V0MA 2VOTA 3WMBA 1GZJA 3BAXA 2VCBA 5E6ZA 4U3AA 3TP4A 3RILA 3BSGA 1KGXA 1GQKA 1BAGA 3DX3A 5AYBA 3DHUA 4HP5A 2WHKA 3ARSA 1HJSA 4UQAA 1E4MM 1BTCA 3QGVA 3PTQA 1UYQA 1GVYA 3DDGA 1EDTA 3AS2A 4M29A 1FH7A 2JALA 1SYTA 3WY3A 1XYZA 3BUBA 1ITXA 1HN1A 2E3ZA 1PEZA 4QDMA 3K8MA 2XSBA 3M6DA 1QI2A 3WF0A 4CUCA 1E1EA 1SFSA 3GDBA 2ZICA 4U5KA 2G3NA 2F7OA 3WUEA 4GXPA 2FYVA 1UWUA 3LX9A 1E5NA 3UG4A 2DH2A 3VGGA 4NF7A 3DC0A 3K1DA 3SCRA 3WF4A 1OGBA 1C8QA 4H41A 3T2OA 1G01A 1HP4A 3WQ8A 1TUXA 1R7AA 3AHXA 2D20A 1ISVA 4W88A 3POCA 2IGTA 5I24A 1WE5A 1AMYA 3ARQA 3MV11 1B30A 1BPLB 5LA1A 1HF6A 5BCAA 1JI1A 3MUIA 2DIJA 2W63A 1BYBA 2D0GA 4BQ2A 2W92A 4V28A 3FHQA 4X0VA 1QWNA 2FDMA 3A4WA 3AIQA 1MW0A 4UCFA 2EPMX 1HL8A 4HZ8A 1S46A 4AYSA 3S5ZA 3W6MA 4GZIA 3CUFA 5D8WA 4DWSC 3WD1A 3RM8A 3H54A 5JIPA 2VL4A 3IAPA 1NWRA 3BMWA 3WNOA 1BFNA 3THDA 1R46A 4J3VA 1WAWA 3SCUA 5BYWA 4X9YA 4U31A 3KLLA 4ZEPA 2WC7A 3HG3A 2BY1A 5E9AA 5ABHA 3WH7A 2E9BA 5ABFA 3BGAA 1E72M 1CXHA 1A3HA 3EJSA 1C7SA 1M03A 2JE8A 1FOBA 1XV8A 3WDPP 2FE0A 3T2QA 4M1RA 4JZ5A 5E6YA 3VIKA 4AZCB 2BV9A 1E4LA 3EJUA 4HMDA 1ISXA 4FNQA 3PTKA 3U57A 1FP9A 2WHMA 4ACZA 3WIJA 2XHYA 2J75A 5IXEA 2XFFA 2ZUMA 4LXFA 5C71A 5A6JA 1CYGA 1VFFA 3N13A 5A94A 1JIBA 5KZ6A 1W3JA 3S6TA 3VNZA 3ZMRA 1HJXA 3VMNA 3PHAA 2JEQA 1UR9A 2BXYA 4NRSA 2CHOA 4UR9A 1OINA 3AQUA 1UHVA 2RGLA 4RE3A 1B3ZA 1GJWA 3BUIA 4LGXA 2FH6A 3DYPA 2EXOA 2UY2A 3SCWA 2OW6A 3CMGA 2WSPA 4PMZA 4P7NA 1JGIA 2CBJA 3EJTA 4TUFA 1WZLA 1CEOA 4PTMA 1IZJA 2V5CA 3VIFA 3FNDA 3VD3A 5I6SA 2DSKA 1L8NA 2W66A 4CKQA 1CLVA 1R34A 1IZKA 4AIEA 2D24A 3J7HA 4F9DA 1WPCA 1C93A 1CENA 1BVZA 1HT6A 1HL9A 5GPRA 3VD7A 3MSDA 2D22A 3B9AA 3CHEA 3WDQA 5M03A 2VC9A 2F61A 3QHMA 3W38A 4HA3A 3AI0A 4W89A 3AIWA 2XWDA 3TA9A 2A3HA 1BQCA 3L4WA 3SIMA 4PSRA 2J25A 3WENA 1QVBA 2GVYA 3A23A 1ITCA 1J01A 1H1NA 2XYLA 3AOFA 2XGBA 1JZ6A 1US2A 1K9TA 3VKKA 2J62A 3SURA 2WCSA 1ZS2A 4DO5A 2XIBA 3PZNA 1FFQA 3VX1A 1OT2A 2Y4SA 1VF8A 2NSXA 1J9YA 4ACYA 2VR4A 1KTBA 2WC4A 2PWDA 3ZSSA 1JF6A 1U33A 5HBFA 3FAWA 1KBKA 2GFTA 1IV8A 3EMCA 4AEFA 2ZXAA 3N12A 1XCWA 3VVGA 2CXGA 1NOWA 3WMCA 2GUYA 2BFGA 1TR1A 3VIGA 3K8KA 3S2CA 2WZHA 4UQEA 4AZHA 2GK1B 1UR1A 4W86A 5A6AA 3WH6A 2E9LA 4J3XA 1B2YA 5I23A 2DSVA 1V3MA 2DSWA 2XVKA 3GXTA 3W29A 3VPLA 3CUJA 1J0HA 1W9UA 3UETA 2OYKA 1GOIA 4M81A 3WEZA 1W2PA 1UH3A 2G41A 4U5IA 1RP9A 2EAEA 1JZ7A 2GDVA 2DT3A 1CGVA 4WKAA 4ZFMA 3AMLA 2VRJA 4U2YA 4F66A 2YL9A 4FNRA 4D6IA 3L2LA 3WNPA 1QI0A 3LXAA 4P8UA 4W93A 3ZIZA 4AZCA 5HDRA 4GZEA 1H0GA 5BWFA 1WDQA 4MB3A 1LLOA 4LYQA 1V03A 3BLKA 4A3HA 4R27A 3ZJ8A 1OCQA 3KL0A 1CGYA 1V6XA 1EHAA 1JXJA 5I0DA 3B8SA 3EJQA 1W1TA 1SZNA 3VD5A 3LPPA 3DHPA 3PZUA 1EH9A 3VX0A 1NWSA 3VIOA 1QBAA 2W67A 3EDDA 3A24A 5CG0A 4D72A 1TQUA 4M56A 3MMDA 3UR8A 4ZE5A 4MB5A 1X6LA 1CGXA 1PAMA 2W4XA 4D6GA 5I2UA 1G1YA 3KEHA 5DT7A 3WY1A 4AEEA 2X0YA 4V27A 3BVTA 3H53A 3KE0A 4Z2IA 4GI8A 2ZE0A 1UD5A 1UA3A 2BS9A 1C92A 4GI9A 2QLYA 3VGBA 4AZIA 1SR0A 1MYRA 4EAMA 1MW2A 2VX7A 4URIA 2WANA 2EABA 4PBGA 4MB4A 3MMWA 2PWFA 1EOKA 1NP0A 3MSGA 3TONA 1UWTA 1R7OA 4IPLA 5A6BD 1VENA 3ZT6A 4HOWA 3VO0A 1W9BM 4B16A 4Z2LA 2VUYA 1OGGA 2NT0A 2WM0A 2Z1SA 4AZBA 4D1JA 2X8RA 4W87A 3RM9A 4AD2A 3BAJA 3WFZA 2X0HA 4UFIA 3BVUA 1JYXA 1PZ3A 4IM4A 3LXCA 1JAKA 1FHLA 4F79A 3AZTA 4CN4A 1PX3A 3BAWA 3LRLA 1KR0A 4B9ZA 4LPCA 2VX6A 1BLIA 4J3SA 1QNOA 3CBWA 3SUTA 2GSJA 1V08A 3UCQA 3CGTA 1EA9C 1JZ5A 2GK1A 3VD4A 5JBFA 3EYPA 5FIPA 1IT0A 1RP8A 2G3MA 3SCSA 3ARYA 3W24A 1E4IA 4PSPA 4H8HA 2O9TA 3PZQA 4W7VA 4EANA 2DT2A 2OYLA 1KCLA 4HA1A 1VJZA 3MUY1 1NARA 3EDKA 1E43A 1TVPA 4J28A 4JL2A 4J27A 1M04A 1XSJA 5A1AA 4PMRA 3GTNA 4WIWA 4BS0A 1MWOA 4OGZA 3IJ8A 3WDIA 1ZBVA 5ECUA 5IHRA 3OB8A 1I1XA 3SUVA 1J0IA 3DYOA 2ZWYA 4HOXA 4QCEA 3MI6A 1J18A 2DQXA 3DDFA 3VTRA 3OLEA 2WKGA 5I77A 4GINA 1C90A 4WKFA 1QI5A 5AYIA 2VCCA 3AMGA 4ML4A 2O9OA 4AMCA 4H8VA 5M5DA 2DPEA 5CPQA 1GNXA 1UKPA 4ZE4A 2FHCA 3VGDA 4JFTA 4JKLA 3KL3A 5C70A 2ZXQA 3BVVA 3ZJ6A 2CKSA 3ZR6A 2CEQA 2HVMA 1DEDA 3A6OA 3VM5A 5HXMA 2W61A 5EBAA 3SCVA 1R85A 4TOQA 3PBGA 1D2KA 3WKZA 4BQ5A 4E4PA 4AMXA 3AYSA 4UQDA 3D52A 2F7PA 3LPGA 1V0KA 3ZOAA 1CXKA 4FNUA 3F4VA 1XD1A 1UH4A 2F7QA 2EPNA 4HU0A 4M24A 3O2LA 2WVVB 3OGRA 4CCEA 4JIEA 1V02A 3THCA 2X2HA 4Z2GA 1OBAA 3D4YA 4A4AA 1VRXA 2XFYA 4P8XA 2J7DA 1ODUA 1RPKA 2OSXA 1E40A 3BLBA 2J47A 4OBRA 5A6SA 1C3FA 1JDCA 5CPTA 2VX4A 1W2VA 3VDHA 2ALWA 3WNLA 1MQQA 1H5VA 1ISWA 2DEPA 1JDDA 2V3GA 4D6HA 1O6IA 1JDAA 2XVLA 1U2YA 1ZBCA 4KGLA 2VVNA 4LX4A 5JBEA 4H04A 1F4HA 5E70A 4UZSA 1W3KA 2F7RA 1QOXA 1KWKA 1J0YA 4GIAA 1OD8A 5JBDA 1HP5A 4ZXOA 2G3JA 1DHKA 2JF7A 1E0WA 1G94A 3VD9A 4GQQA 5HPOA 1MXGA 1DP0A 3OA5A 5CGMA 4JAWA 2YL8A 2WMFA 1J0KA 4AD4A 1J0JA 4HTYA 2ZUVA 4Z2JA 3LPOA 1GOWA 1WB0A 2ZWZA 2MANA 5D9OA 4CCCA 1BSIA 4JFSA 1G0CA 3ZJKA 1D3CA 1GW1A 3NCOA 2W62A 4XV0A 3LRKA 2WLZA 1JG9A 2Q8XA 3OGSA 4F9JA 2J7EA 4CD5A 4U33A 3WELA 1H0IA 4WLCA 3ZR5A 1GQIA 1E6RA 4EK7A 1TG7A 3VIIA 3F5KA 5GNYA 1G9HA 5I78A 4WSJA 2ZX8A 1UD2A 1CNVA 1CWYA 3RJXA 3AHVA 2OYMA 3GZAA 2XG9A 1OIFA 1QI3A 1WZKA 1V02E 4AD5A 2YFOA 2V3EA 3SUUA 2OW7A 3ZJ7A 1W3HA 1KCKA 5EMYA 1C8XA 4AW7A 7A3HA 2W91A 5BRQA 3NIYA 1UD6A 1GPFA 1UKTA 1A47A 2ESCA 1EGZA 3CZGA 4UFKA 3AS0A 4PCSA 2XM1A 4W5UA 1VFMA 2GJRA 1JI2A 1CGUA 4CVUA 1K9DA 3NYDA 5D9MA 2WMKA 3MUAA 3AISA 4BQ3A 2ZUUA 3A4AA 1X6NA 4ATWA 1CGWA 3FN9A 2VJXA 2IUZA 1TQWA 4GPNA 5TD4A 4KRTA 4J3WA 4W7WA 2YKKA 2UY5A 3WBEA 2V3FA 2EACA 1UWIA 4AISA 4D6CA 3WUBA 1EQPA 3AHTA 4QFUA 5A6KA 1FP8A 1CXFA 1MW1A 4BCEA 2J79A 3HJEA 2EO7A 4YHEA 1UQZA 3WY2A 2WVVA 4YHGA 1PZ2A 3W27A 3BCDA 4TXEA 1AVAA 1F4AA 3APGA 3SCOA 4DWSD 3MU7A 1W9DM 2J74A 4CN1A 1GOOA 5FKYA 2WMGA 3OZPA 2WMHA 4OBSA 2JIEA 2VZOA 2VX5A 2PWGA 1MQRA 1PBGA 2WHJA 3CMJA 2Y5EA 2D23A 2WWCA 3CC1A 2UY4A 1HIZA 1B3YA 4H2CA 1KXVA 1EOMA 4AXNA 4B3LA 3VDCA 3T0AA 4WK9A 1LL4A 3WDRA 5A6BA 2WK2A 3CZJA 2UY3A 3VSTA 3AMCA 1B0IA 1UR8A 4WKHA 4DUXA 1D7FA 1K6AA 4UNIA 3MO4A 3GH5A 3W25A 5CSYA 4Z2KA 3DX4A 3TTQA 3OZOA 4AZ5A 1XHGA 4W85A 2WCAA 1KXHA 1B9ZA 1E0VA 3VIMA 3SCQA 1O7DC 1TCMA 1R47A 3ZT7A 4MB1A 1HNYA 1BYDA 3SUWA 2D1ZA 1E55A 5DFAA 3VIPA 3D50A 1XH2A 2CCRA 1KQZA 3L4ZA 4NXKA 4BA0A 3AROA 1CIUA 1EIBA 4L4PA 3WL0A 1W1PA 4NZFA 1KXQA 1GVIA 2XN0A 3BSHA 2D0FA 2F2HA 1CZ1A 4PRWA 4CD6A 4LQ1A 3AIVA 4HPGA 4P7OA 4B15A 2BXZA 3W81A 3W26A 1VEOA 1Y7VA 5KEZA 1QHZA 2V5DA 3L4UA 4AYGA 3OLIA 4CN6A 2ZUNA 3CTTA 2VT0A 5ABGA 4PTXA 3CZLA 7TAAA 3BC9A 4HZ6A 4IUGA 3PZMA 2EEXA 5BXSA 1E6XM 3CLWA 2WXDM 1KR1A 3ZQ9A 1HKIA 3KWXA 4KWUA 1ZBWA 3RPMA 1TFVA 3N04A 3W6LA 3EMZA 1FFRA 5D8ZA 1TMQA 3D4ZA 4PN2A 4ZXLA 3W4RA 5IFPA 2FH8A 5A8QA 5AY7A 2J7BA 2YLLA 3NSXA 2PF0A 5CGTA 3LPFA 4IISA 4Q22A 1GORA 1UWQA 4P7LA 4NRRA 4BZYA 3WDHA 1V6VA 4PMQA 2WVSA 2EADA 3WH5A 4PEEA 3K46A 4RL3A 3WQ6A 1H09A 1K9FA 4MJ2A 2J4GA 1J12A 3VUPA 1XCXA 3NSNA 2PC8A 5LYRA 1GHSA 2YA1A 5BROA 1M7XA 2WCGA 4HMEA 3WH9A 4MAZA 5I5RA 4GQRA 3VGFA 3W37A 1W9PA 3VIHA 2PWHA 1FH8A 3CZSA 4CU8A 3BUDA 1VBUA 1LG2A 5IDIA 1H4PA 2VTFA 3BAIA 2GDUA 1L0PA 3N17A 1E4NA 1UG6A 1JYWA 1CXEA 3KZSA 2X05A 1LQ0A 2CBIA 2YDRA 4DWSB 4S3KA 3WBAA 5A2BA 1WZMA 1E6NA 3GNPA 5E09A 4CU6A 3L4VA 3HZ3A 4DO4A 1QHPA 3CV5A 1HJUA 3AHZA 2BHYA 2O9RA 2BHZA 4QLJA 2IXVA 5CLWA 3CUGA 2VI0A 1CLXA 3VGHA 4GO8A 4H8UA 3QOMA 1ZL1A 2XM2A 3U7BA 2CIPA 1PJ9A 4QLKA 3ARPA 3MV01 3W82A 3WMSA 4BQ4A 5C8BB 1QBBA 3OG2A 1E6ZA 3ARTA 4D6EA 1J10A 3VGEA 3FY1A 1UR4A 4Y7EA 3BAKA 4JFUA 4UFLA 2OWXA 3AIEA 3GYCA 5E0FA 2VVSA 3WFLA 1QW8A 1E9LA 5EB8A 4YN5A 1R86A 3HG5A 3LMYA 3PZ9A 3M7SA 2ZXDA 1P6WA 3ALGA 2GJPA 1XRVA 1LWJA 4MAVA 3CZ8A 1MVYA 1MQPA 5CSUA 1ISYA 3D3AA 4Z2HA 1HXKA 1JZ2A 4RE4A 1BYAA 1BGGA 3B9EA 1NOUA 1LJYA 4EE9A 1ESWA 3O9NA 1JF5A 1E6PA 1W91A 1OIMA 1EDQA 3I3DA 1TZ7A 3AIRA 1KFWA 1W3LA 3W0KA 4XUYA 2E0PA 1WP6A 4UQBA 3L2MA 3L4XA 1MXDA 1OT1A 1C91A 2XUCA 4IPNB 2D3LA 4AZGA 3OIHA 1CXIA 1VBRA 1TQVA 1H11A 1JYVA 3EBVA 5IFTA 2WZEA 1E3ZA 5CLTA 1CTNA 3K4DA 2BVYA 3AIUA 1SMDA 1DWFM 3WEOA 1XC6A 3VSUA 4JCMA 5CZKA 3PZVA 3IK2A 5EFDA 6A3HA 1QHOA 3CUIA 2WPGA 3AZSA 4HU8A
chains in the Genus database with same CATH superfamily
2VJ0A 1MUJA 4L4TE 3INOA 3R06A 1QRND 3QIWA 1F56A 2GTZB 1RK0B 5CFAA 1XKJA 4FQ2L 5B1JC 3QGAC 5D9NA 5IB4A 4LDCA 3GW0A 1V6WA 1ORSA 4OKDA 1TPEA 2UX6A 2ALDA 4POZC 4O1DA 4MNGA 1PZUB 1E42A 1GCYA 5JXED 1ZWIA 4V1DB 3LMJL 5LWYL 4LFHG 1FO0B 5IF0A 3LV3A 5SWQA 1X5GA 3T3PB 1R5WB 1BG1A 2EEBA 4XP6H 3KL5A 3IIOA 1MHCB 4QLLA 2XJKA 3ZKND 2C14A 4AY7A 4ZNCD 1F18A 1XYFA 4HUXB 1QAWA 2K7PA 3E96A 3SR7A 1XB3A 4D6FA 3P77A 3QKEA 4PMEA 3H23A 2AQQA 3MCKB 3B4YA 3H6OA 2QSCH 4AD1A 1MNUL 5T3XL 3DI2B 3JVGA 1N7KA 1UH2A 1KBVA 3GPSA 3W53A 2ITCB 1TTBA 4POCA 3HS0C 4C6LA 1GIGH 5ABDE 2JV6A 1OF8A 1A3QA 5K9OA 3VNYA 1KRCC 4G9PA 1W16A 1RZKC 2ZP0T 6CGTA 4GFIA 1EQCA 1WBJA 2ISWA 3HC2A 3DGRA 1YXDA 5LIXX 4QNPF 3NTCH 4PJIF 1UM5H 2F68X 2ZQ0A 4P2RB 2WSYA 3S36L 2ANUA 2X87A 5B38A 3KXFB 4UQCA 1XCTA 3TW9A 2G60L 4QJ3B 3D69A 1LWIA 5D7SL 2EDYA 3QIBC 5F2IA 4W9JC 2EDMA 4NL1A 3TOPA 3C8DA 4C6NA 4PUBH 3WDJA 1XLJA 1U93A 4KJWC 5D1ZD 5C0IA 4Y1TA 1AXTL 5HGGS 1UWSA 4H7VA 2XVGA 4PLKD 2JIXD 3A3XA 3Q5YA 3OP2A 5D2LB 2CUIA 5L4JA 2E6PA 1ZHAA 1P0DA 1XF3B 3BN3B 2NX5D 5SWSA 4X4ZA 1G9ML 4X2RA 2C3VB 5E0QA 1HKVA 3DMMB 4PGEA 4HSAC 2K45A 2VZTA 1LWHA 3DOIA 1CZ8L 1PG7X 3PPSA 3EOUA 2IQ9H 4OOZA 3ROOB 1T41A 1FH9A 1TVNA 1HCZA 2WAHA 4ENLA 2Z7KA 3U7VA 1FIGL 5FB8A 2ACQA 3CLEL 3CZKA 3BW4A 5E8PB 3B8TA 1UGNA 5IT2L 1EBPA 32C2B 3RI5F 1G43A 2Z4QB 3MUGA 3WD2A 2DEWX 2JQZA 4Z18A 4TR9A 5MEQA 1CICD 2B14A 3MJ8A 3M17A 1R3JB 3QBUA 3LTSA 1TA3A 1QA9A 5L2JA 1IARB 1VHPA 3GSNH 5DQJB 3I7SA 3DXAE 2GJNA 2DV6A 3EDEA 1W9VA 1YNTA 4WO4D 5H1WA 2NLYA 3AXXA 4JTHA 3GLCA 2X4TA 3PHOB 5L88L 3MZ2A 3CUHA 4OTKA 1ITQA 3L4TA 2GCYB 5I0ZA 5AAWC 3VINA 3DIFA 3QNZB 1XH1A 4IKIA 5FYKE 1WKFA 4KTEH 1P4LB 4F15C 1UYWH 4GFXA 1RUAH 5DHMC 4GQGA 4MA3B 5IBLC 5ICXA 3HMXH 1PZ5A 3BAEH 3FYIB 2QMKA 2JEPA 3QLLA 1XBRA 3RJYA 4G7EA 4B5NA 3KGUA 1B90A 4RQQB 2BXVA 3LHAA 2OZ4H 5CIPH 3RVVD 3MXWL 3QHOA 3KCOA 1I53A 4RXFA 2CDFA 4K94L 1JWSB 4I9MA 5BOOA 1GAFH 1IBZA 3N15A 3SGDI 4EI0A 5TE4H 4X5WA 4LSPL 3GR4A 5TTRA 2NQLA 3EKLA 4YC2B 4APQA 1W5OA 2EH8L 1KCVH 3SDCB 1ZVYA 3LKQA 4HQQL 4GO6B 3BD3A 1T66D 2BZCA 2B1OA 3NGJA 3AYRA 3SJ3A 4MMWA 2ZX7A 1U92B 3VI2A 2DQEL 3WKYA 3QUXA 3NQKA 3H3PH 2HEJA 4DPQA 5AHLA 3MRKA 1Q4NX 3HNTH 3FZUC 4AZUA 4HCLA 1ACYL 2NNXA 3O6FA 3LN3A 5C97A 3ZDXE 2DDXA 2JF6A 5D4YA 3MFFA 3W9DB 3CAFA 1T7VA 3JYCA 5HYQA 1AFSA 2Y61A 1NLDL 2K70A 1FFPA 2WKOA 4NFCA 1QWUA 2O92A 3KUMA 1SZGA 4ZPTB 2V2XB 4W5ZA 3M46A 4QAWA 4Z1AA 4Q8TA 5KN5B 5CHNB 4WSKA 5PAZA 4X9HA 2CPUA 3FQUA 4ZVJA 3M0JA 1WOBA 3CFEB 2WWMD 4ZMPA 3UAAA 2PTXA 3CQIA 3CC5A 1TTUA 1WDRA 4HS6A 5EF0A 4I5BA 1FXPA 2ACRA 3QP3A 3K7UA 3EWXA 3P67A 3EYFA 3CHCA 4H1ZA 1WCGA 3QFGA 2CIKB 1RIVH 3Q6GL 4EBQH 4OJAA 3CFKB 5C0RH 2MNWA 2VERA 1VS1A 5IOPB 3RCYA 5KTEH 4AYFA 5K9XA 4BWTA 3MW7A 4YHKH 1J8SA 1EHNA 3C0QA 5HDBE 3H2AA 3SDYH 3D9AL 2PXYC 4YO0A 1RZFH 3KBPA 4DEFA 4B96A 3RVTC 3GUTA 3IIVA 3MV7A 4NHCL 1YEIH 4F33A 3EF7A 3RZWA 1EERB 3BSZA 2DWTA 2Z92A 3B9KC 1QBMH 1ZBKA 4JX0A 2JKEA 4JO1L 4L9LB 2X53A 4I2XA 1JXDA 1GQKA 2OJ1A 1A4JA 2WBJD 1DIKA 2XETA 3DVNA 1E2WA 4JFXA 3GFXA 5FJUA 1WYJA 1V79A 2VLRB 3FJTA 1V7NL 3E0WA 1FH7A 1RLBA 3WY3A 1OZUA 2DVTA 3HG1A 1ZSXA 4QDMA 2ERJB 2XSBA 4P99A 1OARL 4JRFA 2PYEB 1QT1A 4ZTXA 1S39A 3FRUA 2G3NA 4LBSA 3TURA 3GVRA 1SW7A 1G01A 4HISA 1SSDA 2VGIA 3I6SA 5IQ7L 2YAFA 3MBWA 2IALB 4DZ8B 5L9FA 3NIDE 3K30A 2DIJA 4DK5A 3OYZA 1I7ZB 2ENQA 4HWZA 2J5WA 3ZLHA 1CLYH 3I2CH 3A6BH 1OADA 5KBLA 2OMVB 4JTQA 4EDXA 5JIPA 4A2DA 1BFNA 1N55A 1IBGH 3LTYA 3VXPA 4MHHI 3WOVA 1IYXA 3M88A 2P8PA 1X9LA 5LDUA 4LU5H 1NBVH 1M2VA 2DL2A 5EY5A 3C6LA 5I03A 1Q1JL 2XGZA 3CLFH 3I7RA 4JFEE 3HN8A 4M1RA 1MEXL 4A39A 1SJEB 1CB7B 3W01A 5LIUX 2Y1HA 3ARFC 1I4FB 4FJ6A 5HMDA 3GKFA 3DZ1A 4NHVA 2KX9A 4A37A 2PRHA 2CZFA 4MNQE 5L2KE 4DOHE 4D8ZA 1UP3A 4Z7QF 1JIBA 3BH8A 2VGFA 3KZ8A 2TSBA 3QJFB 5I30L 3DGGA 3UTQB 4PR5A 4WWOA 4WNJA 4I9WD 3HFML 4G56A 1SXBA 4XGZB 2CBJA 2W79A 3IMWA 4LS1A 4UNUA 3FL7A 3MREB 3WFDH 4A29A 1FHNA 4GRMB 3T0ED 3J7HA 1NGPH 4X4YB 2PLMA 3VCCA 4I48B 1L9QA 3CHEA 4BQ8A 1ONRA 4AUJA 3LCYA 4XNUL 4DELA 2HBXA 4NKOB 1N7ML 3BP7B 3L4WA 3PTDA 4ONHA 2X4RA 2ZDSA 4MMZB 1EHKB 5IJKC 1SN5A 4DO5A 4Q33A 4L37B 3SPIA 3MJ9H 1NCWH 5KYNA 3ULVF 3S2AA 3LGEA 4KKXA 2TRSA 3UZYA 2W0UA 4I18C 3LPWA 4DCQA 3K8KA 3MVIA 3E7JA 4WCJA 3PL6B 3X11A 4W86A 3FQRA 4AHQA 3IARA 4XPGL 2E9LA 2AJSL 2A73B 4OZFH 3VPLA 5AKSA 5AB3A 5IVXB 4AYID 4HJSA 1TZ8A 2X4OA 1NCCH 4Y9GA 1FC2D 2CK2A 2FPYA 1RBAA 4IIQA 1ZTMA 5JH2A 1MWAB 2FWOA 3D08A 1QI0A 1WDQA 3VCLB 3W9EB 3OXRA 4PUWA 4F20A 4DK3A 1V6XA 1EL3A 4XVSH 1B4EA 3UAFA 2C9SA 4D9RE 3H8NA 3QORA 3CHVA 2QCHA 3UFYA 3QZPA 1AP2A 3ULVL 2Q3AA 3W1MA 5T1LA 5KSBB 4DJEA 3IS4A 3PHQA 5T8GA 1FZMB 1H5BC 4OFIA 2W81C 3QUKB 3JWDL 3SKOA 2IFFH 1D3GA 3OWEA 4H4IA 1AACA 4RFOH 4OCYH 1NP0A 3MSGA 2NYYC 3GG8A 5JQIB 3SJVB 4LOCA 1WX0A 3W7NA 4GP8B 5CEZH 4JFZH 2XH7A 5IUSA 2B5IB 1X5YA 4QRTA 4AD2A 1W8SA 4J8RB 1RQHA 4Y4HD 4PMJA 1FGVH 4IGHA 3T65B 4LPCA 4QHNB 1KCRL 2CM6A 4I0PB 3VTTA 5KVGH 3GSRB 5I76B 1FI8C 2FEJA 5EU4B 3GSQB 5DC9B 5JR1L 3P5YA 2XTJE 3NACL 4KHXH 3V2AR 2DT2A 3V0VA 3SECA 4XISA 2YCLA 4L1GA 1EUAA 1C12B 2ZOLA 4OB5H 1T7LA 5FJTA 3GTNA 3NESA 4DQWA 5DHVH 2NZ9D 2QGBA 2QDWA 3HMWH 3G1XA 2V7HB 5F1IB 1IO4C 3Q5OA 1KCUL 3U4FA 1J5TA 1BIIA 4Q4IA 3TZVA 1KBGL 5HHXH 4ML4A 2GT9A 4EVZA 3V4PH 5AVUB 4B9KC 3KL3A 1L5GB 3NDZE 3V52L 2J3SA 7REQB 2WOBA 3G18A 5EBAA 4ALAH 1XIWB 1QEXA 2E6DA 4G42B 3DO7A 3NCYS 1ZE3H 4JM2A 3H12A 1IAIM 5E6IA 1WA2X 1DJZA 4M3JA 4MJIE 4AWUA 1XD1A 1I7RA 1R3RA 4G2AA 1F97A 1Y18B 2AP2A 2E9GA 1MI3A 4U3HA 4R7OA 4H26A 1NU5A 3XINA 3KS5A 1BVKA 1GPWA 3NOIA 2A7NA 5AYUL 1Z66A 5PTDA 1ODUA 1KTDB 4E9TA 1YRRA 1VYRA 3UCRA 2AI0H 1C3FA 4IXXA 3SRDA 2WIIB 5HMEA 4WU5B 3T8MA 3P4MB 3D30A 1JDDA 1REQB 4OFCA 2TRYA 3K6OA 5HVHC 3EO9L 1W3KA 4YHPA 4HUNB 1P4IL 3LSBA 2MCMA 4Q4SA 4ZXOA 1GC1C 1O5XA 1MH5B 4I3SL 3ULUF 1DP0A 4UT9L 2K3HA 3RDTC 2R1XB 2ZWZA 3IDNB 3TA6A 3H4WA 5EGRA 3LSCA 3MRBA 2FJHA 2ZCKH 4OV5A 1O12A 3QDME 4ODXB 4Y4KC 4A8LA 3UJIH 1GQIA 1ZAGA 1TG7A 4R5XA 4K8RC 2DZWA 3MLPA 3JZUA 2J7LA 4XMLL 3G5EA 4ZTPH 4QYAA 1SM3H 1L9WA 1C8XA 1S5NA 3WJMA 2F74A 4LYKA 2OX4A 1D5BA 3PWVB 4AKQA 1M1XA 1A4BA 4Q4OA 1FWGC 4HLJA 1VFMA 1KPVA 3QEQB 1HZLA 3CQPA 3LLDA 3M1BA 3IJEB 3NVTA 1KKRA 4GQBA 2UY5A 2VDOB 3AB0C 4AISA 3ULUL 2WNQA 3AABA 2Z28A 5BS0D 3FQTA 4YHEA 1AH3A 4PJXE 3T1WA 1FWXA 1GR7A 2ZQKA 5DVLA 3Q1SH 2DN7A 5EU6A 2PGEA 5DFWH 5EO0A 3G6JF 3QJHA 2YC1A 1A6TA 1X38A 2QJGA 2BPBA 2PWGA 5T5NG 5JTWA 3SYCA 1MJ8L 1VP5A 4N2YA 1F3JB 5A8GA 5G5DA 4AXNA 1K85A 4B3LA 2YD2A 1EAOA 1WBXA 4WK2B 2WMPB 1I9IH 1H6TA 3GLDA 4DUXA 3OODA 4XPTH 3I84A 3S8GB 1X97A 4WWPA 5BV7C 4GG8B 2VUOA 1R47A 4LC6A 4IF2A 4HJGA 4AE0A 5IEKB 1GYLA 2Q3OA 4U05A 2NYZA 1K8IA 1GZQB 2CPCA 1KXQA 2Y1AA 1H50A 2F2HA 3C8KA 1NFGA 1FG2B 5AUMB 2G0WA 3UJEA 1XJBA 1CFSA 3K6IA 1UB5B 2A74C 5I1IH 3ASOB 3Q9PA 1XX1A 1F58H 3VRJB 3FQNB 3VI4F 3QUYC 1YMMD 3APCA 5CJQL 3QPQC 5E2VL 6XIMA 3SDXB 3IMUA 4E41D 2JELH 5KS9F 4IIDA 4WDTA 2K6YA 1FNLA 5A8QA 3GEFA 4LCWE 4XXWA 1UCWA 4Q22A 3QAZB 5B8CA 5BOPA 4JRWA 4PEEA 4RL3A 3OMAB 5EUOB 3PF3A 2H1PH 4OUUA 2P53A 1FBIH 1FWIC 3HRZC 2DYPA 5BROA 1TETH 4XBSA 4HMEA 4DJFA 1VLIA 4DP6X 2QKIA 1N0XL 5D55A 3BUDA 3UDWA 2EC9U 2JQMA 1EAQA 4BFNA 2X05A 1XLIA 2NNCA 1A6VL 5CEZD 3WQPA 1WZMA 4AGPA 5LGJB 3GNPA 3AXLB 3NRQA 1RURL 1N70A 4R5TA 4XP9L 3Q7JA 4US6A 3N41F 1RUPL 2CK0L 5DRZA 1IXOA 4BQ4A 3MV01 3I75A 1I1AD 4EPDC 2WXGA 4N5EC 1TIWA 3VYPA 4GAGL 1QW8A 2ZA3A 4DTGL 5EB8A 2AV7B 1GZPA 1J87A 3GIVA 2N7SA 4NQEE 5FFGA 5CSUA 1BYAA 4MYAA 1E6PA 1BD2D 5JOPE 1E28A 4XUYA 1KRAC 4ZW8A 4JKNA 5LNGA 3GHEH 5C09B 1ZGLB 3TFKC 2WM1A 2LAAA 4JTRA 4NCDA 3GD6A 2B9BA 2NY0D 4YHZH 2WWOA 1T2QH 4B9PA 3VSQA 2D9CA 4MXVE 4X50A 5DVOA 4MLRA 1G4EA 1YEFH 3RLUA 1OSZA 4QRRD 2VLKB 5HGBA 1AS6A 3LA4A 1HGYA 4O1BA 1QNIA 4HDIB 4HK0A 2V0AA 1NMAH 3WLKX 2DM4A 4KZCA 3TA3D 3AM8C 4CNIA 1D7DA 4ZFQA 1NCDH 3MV9A 5FYLL 1RZJH 4FZEH 5AC7A 4Y2DA 1B9KA 2JKTM 5IMLA 4TX8A 1G6RA 3MX0A 3R0NA 4HJ1A 43CAA 1IC7H 4S3BA 3C60B 2Z26A 1Z1WA 4F0LA 2J7HA 5LBVA 1U8QA 2Z31D 2P5EB 1PY4A 1SGKA 1UZGA 1JYNA 1JCMP 1ETB1 5DRWB 3WMQA 3EWBX 3RMEA 4Q4PA 4JIHA 4XSLA 3RRAA 2YBRA 1WYIA 1BQGA 3SODB 2ADIA 4E8DA 1HINH 5I16A 1I3RA 2YEZA 4G83A 4ZCWA 3UBHA 1A6ZB 3WEMA 5TPWL 1HNGA 3NZ1A 3GTTA 1MLBB 3CH9A 4F2MB 1I0DA 4ZMGA 5T3ZL 4YHLL 4CD4A 1KW1A 2Z7WA 2CO1A 4Q89A 3VWJC 2DQUL 3GD1C 3HCVB 3KYMA 2R7EA 4ZS6C 1UMLA 1S9KC 3CMOH 4AD0A 3CUZA 5AOKA 2PI6A 3TO2B 4LT7A 15C8L 3HC4L 3KLSA 4Z7NB 3B0YA 4PRPD 2XVPA 1DSFH 3GUFA 5AZ0A 2GIYA 1Q0YL 1H3XA 4RGNB 5DUPH 4PWFA 4DO7A 4Y5XB 2VELA 4W7UA 4L3EE 4PJ9D 2HG5A 2FMNA 5K9KA 3DDMA 3ALFA 1BBJA 4LARH 4D0CB 3TV8A 3OVGA 1MZYA 4EMZA 4MKVA 3WEBA 3BQUB 3F64A 3P4OA 1WT5A 5E4IA 1ASPA 2MNJB 1NGWA 3E1ZA 3DFSA 4OGXH 3FT0A 4YSCA 4UBPC 4GUOA 1XBVA 3KPQB 5AHMA 4GMSL 1F1DA 1ZGLP 5C0BB 1YNKL 2CNZA 4HLEA 1WISA 1WBYB 1E4WL 1VFAA 3GMRA 2H6UA 2NTFB 4A68A 5LGZA 1DBJH 2N3JA 4JMXA 1P7KB 3TO4A 3H26A 4MNJA 4WNSA 2D0HA 3AICA 3ZHKA 5IGXL 3P0WA 3WUWG 2XWBB 1VACB 5B7YA 4MS8C 4A04A 1GPOL 2YGVA 2CE6A 1UD3A 3ZXAC 4LCCA 1U8CB 5DA0B 1YNLH 4LCYA 2FL5B 5LN8A 2XXMB 4PI2A 5D8JL 5AG9A 4MG4A 1HJQA 1SDDB 3OZ9H 2YIHA 2FECL 2VRKA 5H2ZA 4XHJD 4G7SB 1A5CA 4LAMA 4GMTL 4HBKA 3DUUA 3P7YA 1BM3L 2AJUL 3VU2A 1PKQE 5EUKB 4G5AA 5HHVH 3TVAA 3MRRA 5J9PA 3RZCB 4ZENA 3B4NA 4PY7B 3FB8A 3KCLA 1LL6A 1ONXA 4KKPA 1W0WB 1B1YA 5A8PA 4UFHA 3ONBA 1UFGA 2J21A 2R0WH 2B1AH 3ABLB 4HKJB 3VRIA 3PXLA 1V5JA 4I13B 1QRNA 3T08A 3MLUL 3QWRD 3DSNB 4MRBA 5I17A 5GZOC 2IWEA 4MVBD 4YQXL 4R26H 4PB9H 1MFCL 3AZUA 3QH3A 3RB7A 2FZNA 5HUOA 4D6JA 3EHBB 4OLWH 5GS0C 2HFGH 2NX3A 3WKMH 3BWUF 1VYPX 2FGBA 3PNZA 5FCZA 1MJUH 4EI5D 4PWGA 4Z7OF 2Y3AA 3FH8A 3R10A 1PF3A 1OPGL 5JXEA 2YDQA 1ZTVA 1EA0A 4LBUA 2EDWA 1XAKA 1I1CA 3E2RA 1XR8A 3G1VA 1QPNA 4Q3MA 1FWRA 4EE2A 3P4LA 1S7RB 4UZUA 4UNVA 2XSAA 4JTUA 5B3JE 2AJZB 1RZPA 2CKRA 4C7FA 3V4VA 2QW5A 1SFTA 3QPEA 4HUUA 1FWCC 3TTOA 2GJ6D 1HSAA 3IN0A 1FWBC 3JWOL 2YWYA 4GZ7A 3BE1H 1KO0A 4MTVA 4N0FA 2VH5H 3D18B 3ZMEA 2F8QA 4F8PA 2CLZB 43C9B 2OPCA 3QQ9D 4R88A 3TYAA 2OTPA 1E6QM 5CAKA 1P43A 3EJZC 4HBCH 1B3JA 4KQ3L 4LT9A 1NSJA 4JRXE 3GGWB 4X80L 1RUQH 1N8IA 3ARBC 1MFAH 2J6XA 3W5NA 3IJ7A 4GXVL 3N11A 3VFPA 1T8XA 4O2FB 1A7PL 4ACTA 3MPGA 4PMFA 2XG4A 2VDLH 2IWFA 2CETA 4F37K 4FQXC 1L6GA 1YUHA 4UUJA 2VURA 2OTUB 1P6FA 4HC1H 2EJ1A 4KTGA 5D02A 6PAZA 3FTZA 2WBGA 3MDWA 1D3HA 1QFHA 3IFLH 3Q44A 1F9CA 4OI7A 1IBHA 4NWUL 1QX1A 5AOMA 2ADFH 4LKCA 5CGYD 3C2YA 4EI6A 3GXPA 2EIZB 3MOAL 3KD4A 5D1ZA 4PJGB 1XZ0B 5JXQA 3T6VA 1HVQA 3O11B 1QZ1A 2CMRL 2JIXA 3LQZB 1KCSH 3N55A 1CLZH 3CPUA 5DMIH 1F5ZA 4LLDB 4YTUA 1T22B 1KJVA 3S2LA 3AQYA 4ZMOA 4K55A 3M5YA 4Z3EA 3ZLQC 3WZ0E 1RJZB 2BGSA 5CEXA 2GQHA 1X5FA 3D12B 1TSRA 2P42B 2EBNA 5EOCH 1IRAY 2C4XA 3FFDA 1LP9A 4MGXA 1ZGDA 1QFWI 3VFUB 4TMPA 2NY4C 4BQ9A 4M6UA 3M8OL 4HQVA 5CAYB 4W9GC 4LLWB 3TX4A 4PVBA 1Q63A 4RAHA 3VXUD 2VCOA 5C07D 1U1UA 4GG6A 1SUHA 3ZLGA 1N8ZB 1NMCC 3ZWTA 5T9BG 1V27A 2ZX9A 5DEJA 1XMEB 2WLKA 1UZDA 5H2BA 4N8VA 4LHUD 3BXWA 4JIQA 3WMBA 3TXZA 3E9AA 3BSGA 2B7DT 2AEOA 3DX3A 2YKLH 4U1MA 2L4OA 3DDGA 1EDTA 4PP1D 4N9OB 2XZCH 1RZ8A 4WO4A 3QY8A 4OLYH 1KN4L 5LGHH 3VXQA 3FDGA 3U2ZA 2XNAA 1LRQA 2AAVA 4YMZA 3QZEA 4FZ8H 3LEXB 4XZ9A 5ANMB 3K1DA 1PVHA 3T2OA 2H32B 4ESKA 2E3VA 3OIXA 5F96H 1GCFA 2XIJA 4B53A 3BICA 4HYVA 1A7NL 3OHXC 1TWIA 5TQ0H 1OF6A 3MUIA 1VBHA 3X3FH 4LAQH 5CAHA 2HX7A 3D3VB 4NU7A 3RWJA 3MA7B 4DP1X 5SWZE 3S5ZA 5SWUA 4AJWA 1G0XA 5E56A 4I7WA 3H54A 3ALWA 2VFDA 3APFA 4J3VA 3QY6A 3HE6D 1T4KA 2W9EL 2NXYD 1E72M 4WWKC 1LQ2A 4TIMA 4MZ3A 4OLEA 3LBOA 4N1EA 3PGCA 5JMOC 4EXBA 4AJYV 1U8IA 1R3LA 3ZS4A 1SJVA 4QHLA 3NH7H 2POZA 2R39A 3I10A 1QG3A 3KGSA 2XFFA 1RVFL 3K2UH 3NPVA 1IAIH 4HG4K 2Q7YA 2JSFA 4PY8J 4U28A 1GS6X 5ESAB 3TBVB 4XXCC 3BESR 3ANYA 4P06A 4NC0B 1H3VA 1HKLL 4HYWA 4FG2A 4LGXA 3DYPA 4LDEB 3P2TA 3G08A 1OFOA 4WR3A 1H6UA 4Z7UA 4HHMA 5F88B 3C0SA 3P9MA 3BPOC 3HBLA 1BM7A 1BVZA 1HL9A 3HW7A 6REQB 5F1NB 3UPRB 4JXCA 4NC1E 5M03A 3BVNB 3N19B 3E3HA 2XWDA 2PKDA 3B8WA 3TA9A 4N4PA 3NFPA 3GVQA 1H1NA 2GFBA 4O5LH 4LPVA 4WI0B 1ZS2A 2D03L 4C6DA 5CJOH 4JTKA 4NOFA 4P46D 2EDFA 2ZXAA 1T1YA 3N12A 2JJVA 4PBFA 3SGJA 4ICNA 3MTRA 4JPIB 3PE9A 4MUZA 2ZPKL 1V3MA 3U9PL 3W29A 3WGVB 2J6EL 1VPXA 4HS3A 5C0FB 3LBMA 4GKTA 2X6MA 1RMFL 4LCRA 1ZLPA 4ZFMA 2R1WB 3HLAA 4F7TB 4F66A 3AU6A 4FDWA 3T3ME 3WNPA 3MTXA 3AWOA 5D7IF 1N9PA 2VGGA 2X1XR 4BZ1H 4G8GE 2D2CC 1EHAA 1KIPB 3HPJB 1XBYA 3EJQA 5D4IA 1MCLA 3QQXA 1NWSA 1ZLWK 3CXOA 4UCGA 3L3IB 1AH1A 5IB3B 3R4DA 1SQ2N 1GZGA 4L0YA 1F6PA 2D3VA 1NWOA 1A9EA 1W3TA 4IMGA 3W0WB 4XC1L 1K77A 3M0MA 1YNQA 1KFEA 2BERA 2EYSB 2FVMA 1L8PA 3FT4B 3O3EA 4B60A 5DXYA 1LK2B 1BFSA 2WBJA 1EOKA 1JF1A 4B90A 2F2KA 4AY8A 3ECBA 4YDJA 3HPZA 1N67A 4FG6C 5CKGA 2D9QB 4H25B 5AVWB 3LXCA 2PC4A 4CSZA 3OVQA 3BAWA 5GSVA 3LRLA 3KPMB 1GVRA 5FYKH 4A3QA 3QO1B 3QRBA 4YE0A 4XCEA 3JYBA 4ANUA 3HBQA 3KWSA 1C9DA 1IFHL 3P74A 5IROC 2O9TA 3QUHA 4BH8B 3GI9L 4F48A 4GBXB 1ORQA 8PAZA 3K72A 3FUFA 4PB4A 4AUYA 4KRPC 2H90A 4BS0A 1P84K 2DQJH 3QUYB 1ZBVA 1FH2A 4NP7A 2BJMH 3OMZA 1HHKB 2GPTA 3ES6A 2YPLE 3MI6A 2Q76B 4X0KB 1XBDA 3VWKB 5XIMA 4LS2A 2XV0A 1C90A 3VA8A 5IMKA 4PJBA 2V8LA 3CD4A 4HV8B 4AM0A 3EOOA 2VEMA 5CPQA 2VDQL 5EBLB 4HULB 1AKJB 1R6VA 2OI9B 1PNCA 1AZZC 5GGRB 3N40F 2ZKHL 4I5XA 1XEDA 1LO5A 3RJOA 3NFUA 3FSWA 3GM0A 3E8UH 2VDKB 4FI8A 3LOWA 4OCXH 1W5MA 3AUJA 4UQDA 5CWSB 3ZOAA 3M1OA 3H9SB 2WINA 3GSNA 3OB0K 1KFCA 2OO6A 3STBA 2APVA 3TQ0A 3IWPA 3WK0A 1TPXC 1ZT1A 1RPKA 1D9KB 1QKZL 1PW3A 1FP5A 1TZGH 3T0EA 2ALWA 3I9AA 3RVWD 4HCRH 4QRPB 4JHWH 4XMZA 4LUSB 1F4HA 3EZJB 3HMXA 5EU3B 4JX6A 1MHHB 3URNA 5JNYB 4QE5A 2ADJB 4GIAA 3QM3A 3L3OB 3U6RA 1JJKA 4ONOA 3KMDA 1QTPA 2EZ0C 3W11D 5HPOA 1BDYA 3NG5A 2WMFA 4HTYA 4RA0C 2ZUVA 2Z93A 2OZ4A 3UYIA 4LHUG 4G70B 3DX8A 4XCFH 5C8JA 1XX9C 4K3ZA 3AAZA 3L95A 1F1AA 1GVOA 4QHKJ 3WN5B 2AQ1A 1W8GA 4PJAA 2I5GA 5D30A 5E2TH 3S34H 2WQAA 4W9IC 4LY8A 2QV5A 2XRAH 5ICYB 3C9NA 1KBJA 4GT7A 4JZNA 2CCLA 5AVSB 1DR9A 3EYQC 1NDTA 3QEUB 4K7PH 1HKFA 4OZIA 5FYKU 2DUXA 1YECH 2OYPA 2YGYA 3V6OE 5F7EH 4NZ8A 1PKNA 4B4FA 1DQLL 4LB8A 1PZ1A 3EXRA 4Q9BA 4B5EA 1BKHA 2E5CA 5GS1C 3OKLA 3VH8G 4UDUA 5J11B 2F08A 5I71C 1QK0A 3RMJA 1IC5H 3N1PC 3HQ1A 3GBLA 1GGIH 1OGAE 3MRIA 4LOFA 3OZPA 3T5WA 4PBXA 3QDGB 4OBSA 5DURD 5FSDC 4L5FE 2XSKA 4J3OG 2WHJA 1HIZA 4LESA 5A2LH 3CXDH 1OTUD 2V2TA 1KXVA 1ECYA 1CQYA 1ASOA 1OY3B 3G77A 3WDRA 1JZHA 1UR8A 5GGVY 4BSVA 2L04A 3MPCA 3T0TA 3TTQA 4YHML 2FB2A 2IMMA 2R9HD 5DJ2A 3OU8A 3CM4A 1O1HA 2FT8A 4TNGA 4NGHH 4BEUA 2RH0A 5EOCJ 2R14A 1EXBA 3DOPA 4HIEB 1M65A 4CD6A 3LQMA 1NPNA 4ELMB 2OV0A 2R56H 1H3PL 2MCPH 4R7NB 3IIPA 4NAMA 4F27A 3PZMA 3G1AA 2F5BH 1HYSD 1SFLA 4Q58C 1N64L 5EBMA 4J12A 4UTAL 5I66B 4XVTL 3NABL 4HOMA 2WY3B 4X8GA 3FQWB 2VD9A 5AY7A 2ZRXA 1HQTA 3WDHA 4OSUH 4M4PA 3DARA 5LNRA 3WK2A 3CN2A 3LS4L 4KXBA 3B7YA 1OANA 1ZEAH 5F4WA 2Q7AA 4UQIM 1NC2B 3HHRB 4FFYA 3U46A 4H88L 3ILDA 2YA1A 3MLVH 3TBSA 1W17A 4PJDF 2Q3XA 1WDAA 1ZANH 3W37A 4DAIA 3E74A 3C08H 4ZMVA 3GX9A 2J1ZA 1LG2A 4Y16D 1A7RL 3T77B 3Q67A 1P0KA 3E0FA 2C9VA 3GSVA 5H8DA 5GRUH 3TQKA 1E5UI 3P81A 2YXFA 5LB1A 4LCUA 2HG0A 3JV0A 3TCXA 2A5HA 3UJTL 2GI0A 1KACB 1XICA 4NUGL 5C8BB 4RESB 3DNKA 1KNOB 4D6EA 5FYKD 1E6JL 3VGEA 1OTSD 3QBTB 4NQTA 5EWIH 3MRPB 4HFUL 4L1SA 4NN6C 3QC0A 5ACZB 2KZWA 1CU4L 5IJVB 1RZIA 3TW6A 3W2DH 3CZ8A 3IFNL 1JR1A 3CX5J 2P26A 1JPDX 2CDEB 1JZJA 1LJYA 5I1LB 4EE9A 4NO5A 1M7DA 1ESWA 4M6NH 3APTA 4GH3A 3FVDA 1TZ7A 1KFWA 3NCXA 2VDRB 3GMMA 3R18A 4UNKA 1C16A 1U8MB 4UM8A 4XBPB 2QJIA 2DAVA 2HVBA 4Q9RH 3STPA 2D4FA 3AIUA 5KTLA 2QAFA 4GYJA 2HXAA 4X42A 1I8IB 4FOJA 3DX6B 2R51A 3LEPA 1XLGA 4ADIA 2EVHA 1T0MB 1ZD6A 5CM1A 4LVNC 3BGFB 4S0SD 2PTZA 3HPLA 3L9EA 2QCDA 4JTEA 3TK7A 4ONVA 1OL0A 3VMPA 3WFBL 4M7LH 3IDXL 1R6WA 3C2AL 4HKXA 3X14A 3NQ7A 1BLNB 3WBXA 2WYIA 1YPZE 1JCVA 2X70B 5J5DA 1X7FA 3PN8A 1JVNA 1KFBA 1MHEB 3QO0B 3GJFH 1MCWW 3ENLA 1CGSH 3BUVA 1H7RA 5A8OA 1J05B 3FUKA 3GIQA 1NY1A 5BS0A 3O3UN 3IGFA 1IEHA 1KBPA 2WYSA 2V63A 4DVBA 3JWNE 2PU1A 1FVPA 1N19A 1AS7A 2PUQT 2Y1ZA 5HGDA 4V2XA 4AF0B 3SKMA 2CESA 4M8UA 3HZKB 3W1XA 4E9LA 5EPMB 4LMQE 5FD0A 1WEJH 4AYDC 2V2CA 4E9YA 4TRPL 4JJ5B 3DYMA 3MJ9A 4TUOA 2QVIA 2FVNA 4HNTA 2ICEB 4M3KB 1GY2A 1K2DA 4LEXL 2YPKB 2VL5B 3U7AA 1TJHH 4J1UB 3AMDA 4L8CA 2VZUA 3UESA 1Y6MR 1AUSL 4L29A 5T91A 4OZFA 1TWDA 2KDYA 1FDLH 4GUQA 5F6IC 4OIFA 3R43A 4DUWA 2H2SD 4GXWA 2J66A 2TODA 4D9PA 4H7ZA 3P84A 5SX4H 3UYRL 2E8YA 2WXQA 4QRSA 2UY6B 4AJ0A 1UQYA 2YOCA 4AG4L 4FKHA 1YMMA 3SE9L 1XGZA 4DGIL 1BVLB 5IHWA 4C1LA 5GGTL 1BMZA 1NEZG 4E41A 4EZMA 5HDWA 2JCCE 3ABXA 3MNVB 4ETQB 2V9TA 3QDJD 1CBGA 3G6LA 1I75A 3NO1A 4EWND 3V5FA 1JRBA 3H7LA 3WH8A 2KH2B 1AGBA 1NTHA 3KPLA 5FM4A 3DRTA 4PJ7F 4GLRI 3MMEB 2CGYA 2OP4L 4TV3A 1CJYA 1AE6H 4XTDA 3X2QB 2O6EA 2EEDA 4R5EA 1GOHA 4FYTA 1WFIA 2MOVA 3FQYA 2NZLA 4GUIA 4Z3FA 3TTEA 2JNZA 2JKWA 1A5FL 1JS4A 4PS4H 3C5SA 4X9SA 5L8JB 4AU0A 1PG7H 3GTIA 5F7KC 4MJ6B 4RUBA 3CVIH 3DESA 1HO4A 2QHAA 2ATSA 4XPHL 2QF8A 1X5XA 5CILH 4Q8VA 3BJ91 5BXTA 2QADC 6FABL 4KDWA 3MUCA 5AN7A 4W6WB 1YBQA 2DWDB 4WI7A 3WMPA 3ZDZF 4MA7L 3BDYL 3PULA 3GRWL 1FVDA 3TJ4A 2NY3C 3GK0A 4GVHA 5DCDA 3M47A 1UENA 3HGJA 4C7GA 1VLWA 3BHBA 5ECGA 5I1DB 3PABA 3R25A 3FEMA 1ACCA 5I6OA 1W8NA 5EOQL 1TE1A 1BD2A 3GAKA 1LEKB 5DHVA 1VEMA 3RWIB 4NJAL 1H15A 4ZT1A 5IR1A 2YDSA 4L56A 1JD7A 4LLVA 2J73A 5DRCA 4URTB 3NAAL 4PV9B 3Q45A 3DIDA 1BKSA 1BOGB 3UWYA 1NKOA 4G3YH 1Q6CA 1I1WA 1BEXA 4H9UA 4D8LA 2F1AA 3QC6X 4QHMA 4LVFA 3V4PA 4QRRA 1ACZA 4QLWA 1CDCA 3L66A 4JUTA 1DL7L 1TZ9A 1QABA 5IB5B 3TA3A 4PG9A 3TEUA 3NEXA 4HFWA 1TENA 2AK4E 4FF5A 2HLAA 4TVPL 4PS3A 4MNQD 2DJMA 4MZ8A 5L2KD 4A2MA 1TYGA 3CWHA 4DP7X 3MRFB 1LEGB 3GUWA 2JK5A 1A2YB 3T0CA 1MELA 5CNHA 2G97A 3OTTA 3ARDC 4JREB 1UWXK 2B4CL 2G2PA 1MREH 2QT6A 4I1RA 3GJEB 4X99B 2Z31A 3RA7H 1YEDB 3C5ZB 3CHPA 1UATA 2Y9RT 2RBLA 3ZKSD 4C6IA 1UM6L 2YPVH 2YLAA 4YSAA 3R7QA 1M41A 1VAHA 1PYMA 2I7SA 5GXBB 5AYZA 4H6QA 5FCUL 1LO4H 1C5CL 1IL1B 2NY5L 3NCCB 4L8DA 1HNFA 2ZZUT 2Q8AH 3BUPA 4CILA 5C08B 1KXTA 4JHOA 3EWYA 3RXZA 5ERWA 3EDFA 3H2OA 4JG0L 2HKFH 5IQMA 2G4FA 1J48A 3X1EA 1YYCA 3A67L 2A6NA 3B0XA 3KW7A 2SEBA 3R11A 3GMPA 5C0CB 1JZDC 5HR6A 5D5ME 3KH4A 1HIMH 1ADOA 3EGXA 4AEIH 2CKBH 2DJUA 3A12A 4PP2B 2J4WL 2O5YH 1M1BA 4PRPA 4RAUA 3MKCA 1AGFB 4TTDC 4OCRH 4YE4L 3UL4A 3HG4A 1YEEH 4KQ4L 2KZKA 4ZXBD 4GX8A 4ZL1A 3NQ6A 2DMBA 4PJ9A 2Z24A 3BWSA 3ZZ1A 4I9AA 2E56A 2OL3B 3GBML 1S5IL 2OMUA 4Z95H 2XVNA 2GSHA 4XMWA 3NSMA 1WJ3A 2BY0A 4TQ8A 5SX5K 2BX7A 3M16A 4GAFB 4X6DF 4B5VA 1EZSA 4PRTA 3FT3A 4E9WA 3QZWA 2HWGA 3EX1A 4Q6XA 1GGBH 3BEWA 3P2BA 1B0WA 5KVFE 1KTCA 3IACA 1A0QL 2C1IA 4CC1A 2JB6A 2PTVA 5DUJA 2HT3D 2VITB 2Q8BH 3QPXL 1PYWA 3ITVA 3V0FA 3P9LA 1RCOB 4JDZA 4Q7IA 3LOTA 5DHYB 2NQCA 2EQDA 3VE0B 5ABEA 1MQ8A 4TSAH 3L7EB 2FEDD 5DWPA 4XH2A 1AGCB 4X7CC 4P48A 1OD7A 3L1FA 3TFBA 3LXUX 5DD1H 1FL5A 3LG3A 5M2FX 2XTJD 4JHVA 2NW2B 2BSTB 1F8TL 1E27A 3T09A 1D8CA 3VFVB 3SOTA 3L3JA 1EMTH 4QKTA 1DTUA 1KENH 3T3PF 3FW6A 1KN2L 5J0BA 1V0MA 5HJYA 3RHWK 3F4CA 4QYOB 3B06A 5E1GA 4QOKB 3HA0A 5AB2A 2R4SL 1KTLA 4A63A 3N2BA 1BTCA 2J88H 5AEAA 3PTQA 4NSKB 2UV3A 3QWRA 1B6DA 5D6DA 4ZFZB 2MTPA 3KLHD 3IVKA 2FB4L 5HJDA 2VW7A 5HYJA 1FZOA 3VFNA 4ZX6A 1JQXA 4O0KA 1YDNA 3QIWC 3LX9A 2A7BA 4ZFCA 3VGGA 4GXMA 2Z4TA 1JNJA 4FS9A 5BJTB 4EI5A 2HLFD 4MJID 2DORA 3K0YA 4CQ8A 3HV8A 3REWB 3RVUD 3I6TA 1U36A 5LA1A 5BCAA 2FDBP 1OCWH 3C09C 2F53B 3BUTA 4H1LB 2BWQA 1QK2A 2YXGA 1FO0L 4RAVB 1Z6KA 4YZWA 5LIKX 5FA3A 3OKEA 3KLAA 4GZIA 5FOBA 3WNOA 3THDA 5DD6A 5HYSA 4D0BB 2VXQL 1NELA 4TQTA 1A7QL 4KRPB 1Z5LB 4MD4B 2Z25A 2DKMA 3UYPB 1UC6A 4KS0A 3U0PB 1TZHB 4MFDA 5CZJA 3QMTA 4ZYKA 1FOBA 2GJ6A 5C9UA 2A2IA 5E6YA 4TL4A 3GDTA 4AVJA 5E2WH 2WP3T 4KFPA 3PS7A 3B97A 4BA8A 1PXGA 1A3LL 3N06B 1K6QL 5DQPA 3PFUA 1XR9A 3IETA 3C52A 2V7NB 3QDMD 2QGCA 5JDSB 3SYAA 1R3IL 3EWZA 1IC4H 4UR9A 3AQUA 4ODUA 1GT8A 4ATTA 4DKAA 2EDEA 1A66A 5M1TA 1PLGH 1KIQB 2LU5A 5D2LF 4M61A 5B80A 3JVGC 2QUNA 4HPYH 4TLSA 1L8NA 3FCGA 4LW7A 5K33A 3RU8X 3ISRA 3STGA 2ZTKA 1U3NA 4NERA 1ZFJA 2NYKA 1DLHB 4YDMA 1E90A 4NM8L 1DJXA 2WXHA 3JV4A 4QT5A 1QVBA 1JHLL 3A3YB 1MY5A 1WC7B 2FGWL 2XIBA 3PZNA 4UF7C 3KYOB 4Z78B 3D6GA 2E27H 5LNSA 4F7EB 3BTNA 4F9PA 2NUPB 2E1DA 1U33A 1MCJA 2WIMA 3MCMA 4AEFA 4M5TA 2WW8A 1NGYA 1OX6A 1DFBL 4MX7A 3L5JA 3ZTNH 3QIUD 2WZHA 3L81A 4RGMC 4X4ME 3ENEA 4XBGA 5GS2H 3HS0B 4IJCA 3NRFA 4R6UA 4NJKA 3E0IA 3T7VA 1MRCL 3UETA 3W70A 1OEPA 4Z7VB 4FP8H 5EEWA 2Q02A 3N1QC 1OOWA 2OXGB 4YPGA 1IIKA 4XUGA 2DT3A 3F00A 3ZYZA 1LE9B 4KH9A 1AMXA 5EU5A 2VE6B 4WDUA 1TO4A 3B2PA 3OAWA 1YY9D 1LLOA 1H8SA 2WO4A 2VXSH 1F73A 3P54A 5LZLA 3K6SB 5TDNB 4X9GA 4Q8BA 4TQHA 3HZVB 4LSUH 5AD0A 3GMOA 4CNSA 2EDKA 5DK2B 4M9OA 1RZGA 4QWWD 3RK8A 4QEGA 1TWZA 3QIBB 1TQUA 3VXUA 1Z9PA 2X28A 5C07A 1NEUA 1TU2A 1VIZA 5KVDL 2FX7L 1JK9A 4W9DC 4YVNA 4AH2B 3C2FA 1J9RA 3D05A 4MDRA 5I2UA 1RZMA 3O2VL 4N2MA 3UXDA 1ZHBA 4XNMA 4LHUA 3U9UB 3EBHA 2IBBA 1XG3A 4LCWD 3IEAA 2C13A 1KIRA 2YLKA 3NSCA 4KPHH 1P9MA 1L9PA 1VD6A 2VUYA 3SO5A 3RLVA 2Z1PA 4DW2H 4AZBA 3UWUA 3KBNA 3RM9A 1JNNH 3S8WA 1E8ZA 4UFIA 1OF0A 3FNKA 5C92A 4YR6A 4OZGE 2BGNE 2H6OA 4UAOC 2X4UA 2H9AA 1XIJA 4Q8OA 3FTXA 5I6MA 5LBSH 1ADQH 2GK1A 4IMFA 1IT0A 2HCZX 1HOEA 4TM9A 4EANA 2C9QA 4ABUA 4WQOA 5M94B 3VH8A 5C0GB 1UP2A 4J27A 3B2UD 4MD0A 5IQLA 1NGZB 1QO3B 3BQ6A 3MROB 5ISZE 2O7SA 3PQYE 1T1XA 2Q87A 3K4WA 3ZTEA 4DKFH 3N73A 8TIMA 1EK3A 3HE6A 4HIBA 1RHHA 3VXNA 2K3TA 1IGCH 4M4RA 3ZBMA 2Z29A 5IV2B 4NQED 1ZLUK 4GACA 2P0OA 4F15B 4IEFA 2ESVB 3EFDH 4JFTA 2ZXQA 1FVCA 3BVVA 3UBGA 5DANA 1PSKH 4OAWA 1O6SB 1B3IA 4APQC 4XD5A 3SCVA 1H3WM 1JPSH 5LIWX 3CVBA 1D2KA 1ZKAA 2DWEA 1A5SA 2WQDA 1H5YA 1XYLA 1U21A 2XWJA 3G5YB 4A7GF 2N7AA 3O2LA 2WVVB 4ZR8A 4N85A 3CUPA 3TBTB 1F74A 4G9DA 5ADPH 1F3XA 2PLKA 1FGNH 1VRXA 3U1QA 1BVNT 3QUXC 2PR4L 1AJ7H 5J04A 2A1YA 1JDCA 1JDFA 4LVEA 3VCNA 4MD5B 1RBLA 3TCSA 4FXTA 3ALXA 3RR4A 4O1AA 4XO8A 2UBPC 2FKPA 4D6HA 3O6FC 2H3NA 5AOUA 3L23A 1UA6L 1CBJA 3OR7B 4N2HA 2JF7A 4F58L 4ZTOL 3FVMA 4KV5E 5DA4A 4KI5F 4G71B 1EJWC 1C8PA 4IQEA 4NQXA 1OP4A 3VFRA 3D0AA 5FI8A 4GQZA 1DQVA 4FQQA 4MWFB 4S1SL 3L1OL 2NY6D 5LHEA 4YVPA 1ZSDB 1V77A 3U48A 1G9HA 3ZYJA 1E0UA 1UD2A 1JHTA 4B27A 3RJXA 4KUCD 2XG9A 4ZB5A 2FUQA 1W3HA 2PDBA 5D2YA 4TV5A 5DMJB 2XTLA 1IKFH 5JPMA 4S0HA 5DUBA 2J8UE 1LM1A 4R33A 5A2FA 5FKAA 3BZ4B 2B59B 1U1HA 3HV9A 1EZVY 1PZSA 2YARA 5ABZA 3BT2L 5AC8A 2CLHA 3ZLFA 4EVNB 5IIEB 4V15A 2IF7A 2LTQC 2FFCA 5CEYA 2COQA 3L3DA 1ZT7A 2IO5A 3OAZK 3LKSA 4IQHA 3BP4A 2CUHA 3HJEA 1NLBL 2RJHA 4OBTA 3N9GH 3KP1A 1JPIA 1UZ8B 4DWSD 1KB5B 5KVEE 2XWZA 3KPRA 4RIRB 5B1AB 4MDIB 1DE4A 3I02A 2Y5EA 5F89A 3TC3A 4DZHA 3G04B 4L3ED 2FJUB 3MGOB 4CGUB 3NIFE 1MY7A 3PWJB 2J43A 4YTSA 4WKHA 2HUHA 5JW4R 3M0VA 4NKIH 4J3OH 5LGKA 1YEKH 4TUJA 2HK0A 3O2DH 3MOBH 3L08A 4MB1A 2Q10A 2BOCA 5HDOA 1MDRA 3EA3A 2PXYB 3WO3B 3WL0A 5CINL 4P5TD 1CZ1A 5GS2D 2QQ6A 5FUZH 2FJGA 4RZ6A 2ZSWB 1NANI 4AOFA 4HZ6A 4LVHC 3OJMB 3B9KB 4IUGA 3W22A 2EEXA 2DQFB 1FHVA 3NQ8A 4IKJA 3ZQ9A 5I1JL 1PCSA 4NNPL 1X5ZA 5JPNA 3BZDA 3N04A 4D8PB 1MCBA 3PP3K 5AKRA 4GEJA 5D1QE 2UX7A 3F2LA 3QEHA 3GKWH 2PF0A 1WTGT 4NCC2 2YD9A 2JKLA 1H51A 3PUOA 1RUKL 3ZL4L 1WUFA 4DP0X 2ID5A 2BSSA 3U3HA 3WNIA 1OT4A 2CLVA 3C6LC 2HMCA 3L6FB 3OF6D 4R96B 1YLVA 4MAZA 3M4HA 2BVPB 1Q9OA 1FLTX 3F85A 5IDIA 3UZ5A 1YPFA 5IVXF 3BWWA 1NDGB 3R6IA 4BJHA 4J9JA 4PJHB 3ATBA 5K9JH 2WQUA 2DICA 1XLMA 2FEEL 3SE8L 1SEBA 1F6FB 1WUZA 4MBOA 3GS7A 4QLJA 2DTMH 1A6PA 1X5JA 3ZUCA 1NEZA 3O4OC 4XO3A 4KTYA 5IQ9A 3P93A 1RY8A 1SSGA 2DZEA 3ARFB 5FDYA 4KJPC 4ILSA 5LXGH 1FRGH 1AK5A 2YJLA 2CGRH 3EJYC 4QSHA 1KJMB 5KSBF 2AZUA 4BZ2H 1FWHC 4E4FA 4ZQRA 3DGCR 3KZPA 3PWLA 1TVBA 4AHPA 3MBXH 1NAKH 2IDQA 4IOFD 2R2BB 1C91A 3MUXA 3ULSA 3W7GA 2YD7A 1PNDA 3T2NL 3T05A 3ZKMD 5CC3A 1RH8A 4QKXB 1NUGA 4K9EH 3KNBB 5DJ6B 1LGVA 2IVFC 5FHBL 6TAAA 2DQHL 4PBDA 5DMLA 4UR8A 3TMQA 3HPAA 4UC5A 1MWAL 3D47A 3P60A 1UZ1A 1SOQA 3GF8A 2OQLA 4BIKA 2WYZA 1OYCA 2BP3A 5TFSL 3KRBA 5C9JB 7PAZA 4IIQC 3CFCH 3LNHA 4U1JB 1M7PA 1ECEA 2O6FA 2ICWJ 2BHUA 1XYCA 1AI1L 5LAPA 1ICSA 4I18B 2GK0A 5K59F 4PJ8D 4JRXD 3DROB 4YTRA 1D5IH 2OXNA 1H3UA 4P2QE 1H9VA 3M43A 1YEHH 3INUH 2YUXA 3QORC 2MQGA 5KW9L 3FO0H 3CAVA 1T3FA 3V0DA 2BNRE 2NX5A 4DJEC 3QOKA 3FB5B 4C58B 3KLQA 4ODSL 2IADA 4J3UA 1XTLA 1M53A 4JQIL 4DF0A 2A85A 5J6HB 1F13A 4C5YA 2ITFA 3LEVH 2WN3A 1DJNA 1EGJL 2WQRA 4M7TA 2WHVA 4A6YH 4DNMA 5IMMA 1AFVL 1Q1PA 3VA6A 2QCEA 3WJZA 4GFSA 4MZRA 3B9VA 1TJGH 4HUWB 1H5BB 4NAFB 4M3HA 1MRDL 1CICA 3DX9A 2APSA 2JQAA 4HJJH 3BRDA 5EEUA 4QP0A 3D39B 4RWYL 4JN2B 1EVTC 2XKNA 4U6XA 3FULA 2NV9A 3MRNB 4JRYD 1YEJH 2E75C 3VFGH 4AT6A 2WMIA 3UIYA 4OZOA 1SOKA 3JUGA 1R24B 2HKHL 4BZ1A 4H8PA 3P62A 2D31B 1LQAA 1NIDA 5IEHA 1I9JH 1LCOA 1WHOA 4UB9A 4GWEA 3BN9C 1UR0A 5FO9B 4IL2A 2FK9A 3MRLB 1EXUB 5DJYA 1O5DT 5D38A 1F05A 4NQVB 3G5ZB 3TZVC 5E2UH 4Z7WB 4NKCA 2GJZB 2AQSA 2JGYA 3OZYA 3TXVA 3PP4H 5EULV 1LROA 1EC9A 4UTBH 3VXOB 2Y36L 4XMKH 3IRZA 2ZC8A 3Q2DA 5C3LD 2CBTA 3C87A 5F71A 4OJDH 2IOOA 3GIYA 4AY0A 3D7PA 1BF2A 1N12A 4JM2C 4F24A 7TIMA 3RDKA 5A2IH 1EGVA 5E6IC 4J3OD 1PD6A 3MS8A 1I8UA 4OZHB 3MLWL 1CVSC 4MDOA 2NXGA 3QK0A 1M56B 4I4WB 4IBSA 3CFDA 4ZUVB 1ZB5A 2BCKB 4QMEA 3MYPA 4YSPA 3Q37A 2DQDH 7PTDA 2AEWA 1UWEL 4PRIB 4XO4A 2Y7OA 4ZUUB 5FWRA 4BSWB 5JHMA 4F8TA 3S0CA 2CJSA 3OWRA 4JDEB 3UY7A 1N2VA 4G7VL 4N8UA 4PTVA 1ISZA 1T7ZA 3RNQA 3SQLA 4E42B 3FHAA 1DJSA 4UIKH 2BZNA 4L23A 2WNKA 3EWWA 4N24A 4WJ8A 3N1MC 2C0HA 3DV6A 1NL0L 3SQOH 1KIUA 3WIIH 1V0NA 1U6AH 4B95C 4J2QA 4NQQA 5EG6C 5DBTA 3ARWA 3RIAK 3PUUA 2ZYFA 1QPKA 2UZYB 1FQ9C 4KEMA 3GFZA 4ZAKD 5DLML 5HVHB 3UO1L 2FVKA 3RF9A 2Y63A 2WQVA 5J06A 4JFQB 2RQ8A 2OMYA 3SCMD 4B7LA 2NDGA 3QZMA 4WUIA 4DM1A 1KCWA 1QFEA 1JTPA 1GJIA 3F84A 3U7WL 3I3EA 4X7SH 4MJMA 1AZBA 2IXUA 2VDOL 3RDTB 2J12B 4RNHA 3CHXA 3FQXB 3VW3H 3X12A 3U4BL 2R1YB 1S9YB 4NQCE 3GMLB 4GP5B 2E8ZA 4Y4KB 3LZPA 4BRJA 5LIYX 5IB4B 2YRBA 1P5VB 2VAAB 3SDXF 4TNWF 1TUPA 1ZTXL 4QTIL 1IAOA 4HCRA 2IEPA 2G2RB 3RNKA 3EMQA 3GSWA 4JRLA 4OFVA 1NAMB 4L5FH 3DN5A 4UV7L 1J8HB 3BH9A 4AW4A 3EYOA 4ZX4A 4KHTL 1H8LA 3H3BC 3OKKB 5EUOF 3ZYOA 5IF0B 2A3AA 4NX0A 1YW1A 2HDJA 1R33A 4B5UA 4P59H 3GVWA 3AB0B 3V7MA 4QTGA 1LE5B 1PIGA 3BK0A 4AYEC 1ED3B 3VJ6A 1V3LA 3TYGH 1IEBB 1AO7E 1X1NA 2J7GA 4RZCA 4P23D 1NM9A 1FWTA 1EZVX 5C7VA 5BUGA 2WWDA 3DX7B 2F1BA 4C6QA 4CL7A 2ZZ7A 3P77B 5IK3A 4QY8B 25C8H 2P5PA 4OM0H 4JM4L 5T1KD 3ITOA 3ATDA 3MJ7B 1SVZA 4PAZA 4DYEA 1Q38A 4OD3H 5TE7H 5DQDH 3HUJE 4C6OA 1WIUA 2W6RA 1T6VN 2WWNA 1SBSH 3I6LE 4RDQF 3L7RA 4K36A 3QDJA 3MODL 5BV7B 4G8GD 3FONB 1MCWM 4NIKB 2V17H 3U0WH 2UZXB 3T42A 3P0VL 4AMAA 2ZP8A 4XXWC 5K9OB 3MSRA 4YL2A 5B8CC 2GC4C 2A74B 2OT1A 4MNKA 1PCXA 4PG2A 3QYNA 4QXUL 1U8LA 1SQMA 4TX9A 1T0OA 3PHSA 4HZLA 1NFKA 1EAPB 4QCIB 3F7PC 2I9EA 4DJFC 5C5YA 5CP7A 1K5NB 2QKIC 1WOAA 1CXLA 1XT5A 3UDWC 1YNYA 1J2WA 2J7CA 3D69B 3RWCB 4UBDD 2ZZ6A 5I1CL 4Z7AA 4WTQA 4WUUB 2HVNA 5E7BA 4J5NA 1JPTL 1A0EA 5C7XL 5AW6B 5HHOB 2F58H 3RU6A 2H5UA 4MXWH 2YD1A 4Z0SA 4X6EA 3W1TA 1W0MA 4IL0A 3D51A 3HRZB 1A6WH 3UYCA 5DMKA 2WJZA 2E6JA 4Q4MA 1BAWA 3FFCB