2ZXBA

Alpha-l-fucosidase complexed with inhibitor, ph-6fnj
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
442
structure length
442
Chain Sequence
RYKPDWESLREHTVPKWFDKAKFGIFIHWGIYSVPGWATPTGELGKVPMDAWFFQNPYAEWYENSLRIKESPTWEYHVKTYGENFEYEKFADLFTAEKWDPQEWADLFKKAGAKYVIPTTKHHDGFCLWGTKYTDFNSVKRGPKRDLVGDLAKAVREAGLRFGVYYSGGLDWRFTTEPIRYPEDLSYIRPNTYEYADYAYKQVMELVDLYLPDVLWNDMGWPEKGKEDLKYLFAYYYNKHPEGSVNDRWGVPHWDFKTAEYHVNYPGDLPGYKWEFTRGIGLSFGYNRNEGPEHMLSVEQLVYTLVDVVSKGGNLLLNVGPKGDGTIPDLQKERLLGLGEWLRKYGDAIYGTSVWERCCAKTEDGTEIRFTRKCNRIFVIFLGIPTGEKIVIEDLNLSAGTVRHFLTGERLSFKNVGKNLEITVPKKLLETDSITLVLEAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase, putative
publication title Structural basis of alpha-fucosidase inhibition by iminocyclitols with K(i) values in the micro- to picomolar range.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 161
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 3.2.1.51: Alpha-L-fucosidase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01120 Alpha_L_fucos Alpha-L-fucosidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2zxbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2zxbA01
5M3WA 4AD1A 2PBGA 2WMFA 5I77A 3EJQA 4BQ3A 3LXCA 4DUXA 5A2BA 1UR8A 3PZGA 3GBDA 2AAAA 1V08A 3D51A 2G3IA 1JF5A 1SFSA 4AZGA 4AZ5A 2QMKA 2XHYA 2AOSA 2XWEA 2BY3A 4BQ5A 1Q6FA 2WNWA 3ARQA 1EHAA 4N0RA 2EABA 1XH1A 1MFUA 4W7VA 3WDQA 4KH2A 1BQCA 2ZXQA 4JL2A 1S46A 1LL7A 2JEPA 3WMSA 3IAPA 5CLTA 3VIHA 1CXFA 4J3VA 3A5VA 3GXIA 5A3HA 3BUQA 2DSZA 4OBRA 3VX1A 3LPPA 1WCGA 4KWUA 1CXHA 2VZSA 5LA0A 4RE3A 4JFWA 3QOMA 4UQAA 1TQSA 4IM4A 2IXUA 1BVNP 1B0IA 3CZLA 2FH8A 3PHAA 3T0BA 5BXPA 2XGIA 3N15A 1WZKA 1UD8A 2EQDA 3S6TA 4HMCA 4C7DA 3EBVA 3VKKA 2CBJA 3WNPA 2X2IA 3CHDA 4CGTA 3GH7A 3ZQ9A 3WEMA 1ITCA 2DSKA 3SCRA 1R46A 3SCQA 1GJWA 2X2YA 1AVAA 3S5YA 1EIBA 3WIJA 2ZUMA 3ARZA 3EMZA 3AHTA 3LPGA 2W67A 2JE8A 2ZE0A 1SR0A 2GSJA 1G0CA 2BY0A 5CLWA 1FP9A 1E55A 2V5CA 4KRTA 3VD4A 2OWWA 1R75A 2F7OA 3VIIA 4OZOA 1KGWA 1ISXA 2EEXA 2F1BA 4HU8A 1TQWA 1QW8A 1H11A 4H8VA 1SZNA 4D6CA 1JL8A 2XIBA 1NP2A 4X9YA 4PUEA 1UG6A 5A6KA 3NDZA 3AHYA 3VSTA 1QPKA 5JBDA 1QNRA 2O9RA 1W9UA 3DYOA 2OWXA 4UFHA 2J74A 3ZIZA 1J0YA 5I23A 3F5KA 3GZAA 1R7OA 4RL3A 4UQEA 5E0FA 4CN1A 2V3DA 1EDQA 3AISA 3E1F1 4IPNB 1HXKA 3BAKA 3VIJA 1M7XA 3PZUA 2D3NA 2W4XA 1KTBA 1XSIA 1JG9A 4GXPA 1QHPA 1E3ZA 4MTVA 1JZ7A 2VCBA 1EO7A 2WZIA 3WH7A 4LX4A 3CHEA 3BH4A 2OW7A 2WCSA 1V6UA 5AYBA 4QFUA 3VDBA 4AD0A 4B16A 2TAAA 5C71A 3B9DA 5LYRA 1UR4A 4FNPA 3SUWA 1GOQA 3CUFA 2WCAA 1W91A 2XVPA 1NARA 4FLOA 3AYSA 3A4WA 5HOSA 4PCSA 1W3JA 3AIUA 1CPUA 4NXKA 4OUEA 2XSAA 4GKLA 2Y8VA 4HOWA 1QNQA 3AMGA 4BQ2A 4PMVA 3JUGA 2Y5EA 3ZT7A 1C93A 3O6AA 4ACYA 1JI2A 1OB0A 2G3NA 1QW9A 1UR1A 3GTNA 4CU7A 2X05A 2CESA 1J10A 4E8DA 1J0HA 4W87A 2NT1A 3K8KA 3BAWA 3L4VA 1H4PA 3BAYA 1VRXA 5D9NA 1ISWA 5E6YA 4OGZA 4MB5A 2X1IA 4S3KA 2IGTA 1NWSA 4MB1A 2WMGA 3BSGA 1NOFA 1QHOA 4C7FA 2VZTA 1QWNA 2WMIA 5A8QA 1V6YA 4ZEPA 3VM5A 1LL4A 1J9YA 2WHMA 5EMYA 1UD4A 1V0LA 5A6LA 3RILA 3PZNA 4MPKA 1GZJA 5A8OA 1BG9A 4AISA 2WMIB 2D2OA 3L4YA 5HDRA 3WKZA 1HKMA 1W9BM 3WQ4A 3OB8A 1HJXA 3BAIA 1HT6A 1DHKA 4S3JA 3L4XA 1E6QM 1FH8A 3WNMA 5DO8A 3D4ZA 3EMCA 5E09A 5ABEA 4K68A 4P7RA 4D6DA 3W29A 3GXDA 7TAAA 2J7GA 5BRQA 2D1ZA 1QHZA 1H0IA 4UTFA 3VIGA 1X6NA 1VAHA 1H0GA 2CNCA 1EOMA 2WXDM 3VIOA 4Q22A 1C7SA 1CZ1A 1ZJBA 2E8ZA 2VX5A 1GQJA 1FA2A 4JHOA 1K9EA 4MAVA 4KMQA 4AIEA 1UWRA 4UQ9A 1XV8A 5HXMA 1A3HA 2IXVA 2D0HA 5CPQA 5DT7A 2WKGA 4XV0A 3NSXA 1SMDA 1NWRA 1WZLA 4CD8A 1W9VA 1MXDA 1CNVA 1BF2A 2J77A 1Y7VA 4B3LA 3RM9A 1OM0A 2XJ7A 4Z2IA 3WUGA 4TTUA 1KTCA 3DDGA 1EO5A 3RPMA 1RP8A 2AMGA 1V6XA 3FAXA 9CGTA 1UD6A 3D50A 4MJ2A 4AWEA 2WZHA 3NSNA 3APGA 1WB0A 2D22A 3EJUA 3NSMA 4DO4A 3S2CA 1PZ3A 6CGTA 3U57A 1R87A 2G3MA 1JXJA 1U30A 3ARXA 2C8NA 4A4AA 2PC8A 3PZIA 4HA3A 1FHLA 4WJXA 2XYLA 3QR3A 2QF8A 2CBIA 3VD7A 4OJYA 1H3GA 3BVXA 2J78A 3LXAA 4CCDA 4H2CA 3W28A 5JUVA 3VGEA 3WF0A 5F7UA 3UERA 2CHNA 1V3KA 2V3EA 2J25A 1OIFA 7CGTA 4Z2JA 4CCEA 5BWFA 3FHAA 1XC6A 2VR5A 1ZBWA 3B9AA 4AD5A 4JCLA 3WD4A 5GNZA 1VEOA 1MQRA 3POHA 3K8MA 1N82A 3QGVA 4FLQA 4Z2GA 2ZIDA 3WSUA 3CLWA 4CN4A 4CUCA 3IK2A 1PZ2A 1JAEA 1G5AA 3OLIA 4J3XA 2XGBA 2VNCA 1KBBA 4JL1A 1CXKA 3WDIA 4LYRA 1BG4A 4ZXLA 2WVTA 2PWGA 3MS8A 8CGTA 3CGTA 1QBAA 1UUQA 4MAZA 4CN6A 1VBUA 3ZMRA 2JF7A 1UH2A 4UFMA 1ISVA 5FL1A 3L4WA 1E43A 3DDFA 1EH9A 1ECEA 3RM4A 3VM7A 1F4AA 1JI1A 4JFVA 1TUXA 1AQ0A 3WF1A 3KLLA 2YDSA 4A3HA 5BCAA 1HJVA 1M01A 1UQYA 4AZHA 1UR9A 2YOCA 1VFMA 3WD2A 3F5JA 4ZXOA 1YHTA 1GUVA 3MUZ1 3F5LA 4MADA 3U7BA 2J7EA 3D5HA 4XUYA 3OZOA 3K4DA 4Z2LA 3WDPP 1HX0A 3N1AA 1O7DC 4TVCA 1MVYA 2E4TA 4PMUA 5D4YA 4J3WA 2F1AA 1NM9A 3QHMA 1MQPA 4UZUA 1XD0A 1J01A 1CLXA 1KQYA 4GQRA 5C8BB 2PWDA 1SMAA 3VNYA 3MV11 3VGFA 5D9MA 3NYDA 1E15A 3RO8A 4A3YA 4U5IA 2VVSA 1GW1A 5BXRA 2DGAA 3ZJ6A 1O7AA 1LG1A 5A6SA 3EMQA 4MNMA 4PMOA 4PTXA 1ESWA 1UYQA 4P8VA 3CMJA 2V3FA 3WY4A 1NOUA 1PEZA 1RH9A 4U2ZA 1UWIA 1LQ0A 1ZU8A 4CKQA 2UY3A 3I3EA 3WEZA 1TMQA 1K9TA 6A3HA 1GOWA 3KEHA 5CSYA 3IJ7A 1E73M 3U5YA 1NOWA 1JZ8A 3RJYA 2DT2A 3IANA 3RCNA 3BGAA 1GOKA 3BCFA 1IV8A 4JIEA 1GQLA 2WHKA 4GPNA 2YIHA 3CUHA 4ATLA 3T2PA 2CKRA 1UWTA 3PZQA 1G9HA 2WC4A 3VGHA 1QBBA 4LGXA 2WCGA 2EPOA 4LXFA 3SIMA 3A6OA 4UFLA 3TTSA 3WF3A 4QDMA 1K9DA 3K1DA 1OD8A 2UY2A 3TTOA 2V5DA 1W1TA 2W92A 2QPSA 4W5UA 2JF6A 4NF7A 1ISZA 1E70M 5ECUA 2HVMA 2J7BA 1BVZA 2WW5A 3GXMA 5M5DA 1UH4A 4JFTA 1W9DM 2GFTA 1ZBKA 4GO8A 4XZWA 3VU2A 2XN2A 3VNZA 1C8XA 2VMFA 1JZ2A 1E6PA 2GUYA 2E40A 1HKJA 2YL8A 3F4VA 1WO2A 3NUKA 1VFOA 3FAWA 1PX3A 3T08A 1CENA 1EQCA 4JFSA 3PZMA 3TA9A 3THCA 3LRLA 4WKFA 3A4AA 3EDKA 1XH2A 3WH6A 3KLKA 3KL5A 3ARRA 5BXTA 1FH7A 1MQQA 1QWUA 1QNSA 2EXOA 3A3HA 2XN0A 2VL4A 2Z1SA 3RMEA 3VIFA 1XH0A 1BTCA 3VGGA 4H7VA 3VINA 3VDCA 3AICA 1C3FA 2ZUTA 1HP5A 3PN8A 3UR7A 1CGYA 4URIA 3AJ7A 1B1YA 1JYNA 3AYRA 2JFEX 3RIKA 1GPFA 1DWIM 1EQPA 1B3ZA 1OIMA 3W82A 1LL6A 3T0DA 1H49A 3AHZA 3AS2A 1C8QA 2PWFA 1JNEA 1FHDA 1BGAA 3I3DA 4JKMA 2XM1A 4JFUA 4F8XA 2BXZA 1MFVA 2VT0A 1TQTA 4LYQA 2W66A 3IJ9A 3PZVA 2X2HA 4J27A 3OGRA 1E6RA 4HMEA 3H53A 1GVIA 2XFFA 1KWKA 3KL0A 1CDGA 3LRMA 4RE4A 3WY1A 3ARUA 5CZKA 2WSKA 1G01A 5EFDA 4W8BA 1M03A 1GHSA 3WF4A 1PX8A 2WC7A 5LA1A 4AZIA 4QCEA 1CWYA 2VCAA 5ABHA 3VGBA 2HISA 1ODUA 4UZSA 4D1IA 3GNOA 3SCWA 1CGVA 4L4OA 1CGXA 4AYGA 2BS9A 4DUVA 3M07A 3DYMA 4BQ4A 2WLYA 3WH5A 1QI4A 1ZL1A 1R8LA 2E3ZA 3BVTA 4HU0A 3LPOA 4LPCA 3A21A 4F9JA 3OA5A 4PTVA 4D72A 3T0AA 3AXHA 3SCOA 2EAEA 1JYVA 1UWSA 1PIFA 1JZ3A 1W9XA 3WL1A 4ZENA 1GNXA 1WZAA 1ZS2A 1ISYA 3DYPA 3SUTA 2ZUWA 2CYGA 2FHBA 2ZWYA 5C70A 4P7OA 3D4YA 1GORA 3UG3A 3RJXA 2VRQA 2FHFA 1W1VA 1E1EA 2W62A 3OGVA 2O9TA 1KCLA 5KEZA 3AMKA 2XN1A 3J7HA 5A1AA 4ZE4A 5I3DA 1VFFA 4QP0A 1T0OA 2YFNA 4M24A 1Q6GA 5BROA 3HG3A 2FE0A 5A94A 1ITXA 1KB3A 1BLIA 3N04A 3BLBA 1J18A 3MUY1 4HPGA 4C7GA 2E9MA 4GZJA 1DWHM 3M7SA 1B2YA 1KXVA 4MNKA 2WPGA 4AD2A 3HG5A 3WUBA 1QI2A 3CZKA 4PMRA 4PMZA 4J3TA 3BLPX 3QHNA 5JIPA 1H09A 4M82A 3WUFA 1ZJAA 2JALA 4M29A 2CCRA 4WF7A 3ALFA 1FFRA 2VX7A 3N11A 4OOZA 2X09A 2Z1KA 4NXSA 5JBFA 2GJRA 1JAKA 7A3HA 2OYMA 1CIUA 4OKDA 3BUPA 1VFUA 2XFYA 1HJQA 3OIHA 4CCCA 4GZIA 3LX9A 3L4UA 4CU8A 3BSHA 5DMYA 5IFPA 2DEPA 4NRSA 3AHVA 2FGLA 1WDRA 1B3YA 4MDOA 3CV5A 3ZOAA 3NJ3A 3BC9A 1BYCA 1R33A 4QAWA 3SCPA 5I24A 1FH9A 2W63A 1WDQA 1UKSA 2D3LA 3UESA 1B90A 1DWFM 2QHAA 3DX0A 4KGLA 4J7RA 3BXWA 3BCDA 3CUIA 3M46A 3KE0A 3LPFA 1UD2A 4D6EA 2FH6A 3PZTA 1A47A 1B3WA 3M6DA 2CXGA 2W61A 4ATWA 5BRPA 1JXKA 1V0KA 1H2JA 2YLAA 3RDKA 3AIWA 1HJWA 3MU7A 3EJTA 3WDJA 3VD9A 3TONA 1O6IA 4W84A 1B9ZA 3OGSA 1XGZA 3WH9A 4HOZA 3AZTA 5BYWA 4AIOA 1R34A 2DQXA 1E3XA 3HMCA 5FKYA 3ZT6A 3T2QA 2B31A 1DTUA 2ZXAA 1EXPA 4H04A 2OYKA 1C7TA 1HTYA 2CPUA 4PMXA 1VJSA 3OBAA 3HJEA 3ARVA 2QLYA 3CUGA 4QLLA 3W53A 1W3HA 2OWCA 1LJYA 4WIWA 2CKSA 5JBEA 2DSVA 3QHOA 4R27A 4NZFA 4M1RA 1GONA 2VX6A 2PBOA 1PJ9A 4PN2A 1TCMA 2OLHA 1E6NA 1PIGA 2WANA 5E0CA 4GQQA 2ZX9A 2EPKX 4PCTA 5D8ZA 2J79A 2NSXA 1TVNA 1J11A 3II1A 3WY2A 4M80A 1JDDA 3OLGA 4AW7A 1OT2A 3L2MA 2BVTA 5CJ5A 5I2UA 3HU7A 1QNPA 1E1FA 1E56A 4UNIA 4AZCA 1BPLB 4FNQA 1W32A 1HJSA 3CZJA 4AMCA 3BAXA 5I78A 1TE1A 5A6BD 3WQ8A 4D71A 3VVGA 3UCQA 1J12A 2BHZA 4AYSA 5A69A 2GVYA 2WWDA 4CVWA 3AIRA 5I6SA 5CSUA 4AZCB 2OYLA 1UKTA 2VO5A 4MNJA 3PBGA 1J0IA 3AS1A 1B3XA 2J8GA 2ZUSA 4YHGA 1IZKA 2GJPA 3AXIA 1Q6CA 1ZBVA 2CEQA 3BLKA 1OGGA 2YDQA 1BHGA 1W3LA 2Y8KA 4E2OA 1NQ6A 1MW1A 3OZPA 2X2JA 3ZSTA 5DEZA 2Q8XA 2J7DA 1RP9A 1HVQA 3MO4A 2YFOA 4W85A 2J47A 1JD9A 4JZ5A 3VDHA 4CD5A 5IHRA 2G8ZA 3EYPA 1KXQA 1PPIA 1JD7A 2BVYA 3WENA 3WN6A 2OW6A 4XX6A 1WE5A 1V02E 3HN3A 4JKKA 2EBNA 3PTQA 2A3CA 4AEEA 4ATDA 2YL5A 3AXXA 3AZSA 3QOKA 1RD6A 5D9PA 5CGMA 4FLRA 2WWCA 3ARYA 1VEMA 1E71M 3UG5A 3ARTA 3NDYA 4WSJA 1U2YA 2UY4A 1UWUA 4YN5A 1UHVA 5BXSA 5IFTA 4PMNA 1UZ1A 2YKKA 6TAAA 1D7FA 3S5ZA 4U3AA 3GH4A 4W5ZA 5AY7A 4UFIA 3WF2A 4D6JA 2BHUA 2DT1A 1G94A 1XCXA 1OGSA 3L4ZA 3AQUA 3GXNA 4QLJA 1TG7A 4NX0A 1CECA 3WFLA 1P6WA 1US2A 4MB3A 2JIWA 3TTYA 4V28A 1KR0A 4CU6A 2BFGA 1DP0A 1JZ5A 5D9OA 3H54A 5KZ6A 2IUZA 2A3EA 3BVUA 4TOQA 3ARPA 1E0XA 2YDRA 3KWXA 5EFFA 4UR9A 5FCZA 4FF5A 3WELA 1CGUA 1TFVA 1EHNA 1JFHA 5CGTA 3ECQA 3W27A 2DSWA 4P8XA 3AI0A 4HZ7A 1XYFA 2WMKA 4IISA 5A8MA 2YL9A 2PWHA 1J0JA 4BA0A 3PTKA 4P7QA 2D23A 4PMQA 4W89A 4HA4A 4BF7A 1W2PA 1Q6EA 5FIPA 4DM1A 3ARSA 4CD4A 1JZ4A 3K4AA 3EDDA 2VI0A 4PMYA 3AROA 2A3AA 3CPUA 3VOCA 2WYSA 4TUFA 1R47A 1HF6A 1V3IA 1C92A 1HKIA 2PI6A 4J3SA 3AIQA 3TP4A 2F61A 3ZJKA 3VMNA 3W25A 1W3KA 3VMPA 3FHQA 2XFRA 3AMLA 2ZX8A 2X0YA 2F7RA 3BUDA 1TQVA 2DT0A 4U2YA 1V03A 4H8UA 1BGGA 2WSPA 4OBSA 1OSEA 2YA1A 2FGZA 2XSBA 4UFJA 4AD3A 3WUEA 3DHUA 2BY2A 2YA0A 1V6WA 4AC1X 3W24A 4WLCA 4F9DA 4JKLA 2ZXDA 1UQZA 2J62A 3MSDA 1E6ZA 3WD1A 3WD3A 4CD6A 3A22A 1E0VA 1DEDA 1TZ7A 1D2KA 2D73A 1XSKA 3LRKA 1MW3A 3EDFA 1PS3A 2CETA 5D8WA 3DX3A 4V27A 3O2LA 5I0DA 2Y4SA 3GBEA 3U5UA 2J4GA 3WMBA 2F8QA 2GK1A 4UCFA 2BNJA 5TD4A 2VX4A 4XZBA 1QVBA 1VJZA 1ZBCA 4AZ6A 3CC1A 2J7CA 2GK1B 5EB8A 3BVWA 3ZO9A 1DWAM 1AMYA 1HL8A 1MW2A 2XVNA 1IT0A 2YBTA 3CO4A 1CXLA 3WDHA 2FHCA 3VPLA 3W6MA 1E4IA 4U33A 2XWDA 1RPKA 1UR0A 4J28A 4AXNA 2F7PA 2JEQA 3W37A 2FYVA 1KXTA 1R7AA 1GJUA 1J0KA 1L8NA 5A8PA 3L4TA 3SCUA 4TX6A 5E9AA 4Y7EA 5GNYA 2G41A 3D3AA 2E9BA 2W5FA 5A2AA 4D6HA 3DX4A 1QNOA 2WB5A 5A6BA 2WVUA 1PX4A 3EJRA 3K8LA 3KZSA 2CIPA 2X8RA 4KGJA 2DT3A 4TXEA 3BMVA 1CXEA 1V0MA 4BS0A 3WMCA 4E4PA 3W38A 4HZ8A 4MB4A 2D0GA 1C90A 1DWGM 1E5NA 2NW0A 4W88A 2WC3A 2VZOA 1VENA 2W91A 1UH3A 1V6VA 2Y2WA 1TVPA 3OLEA 1JNDA 3ARWA 1UOKA 1CEOA 1Q6DA 2D24A 4N42A 4V2XA 3UR8A 2D20A 5I5RA 1FFQA 3A47A 1JDAA 3MANA 4FNSA 3DC0A 4WKHA 1HP4A 2G3JA 5CXPA 1QI0A 1GVYA 3GXPA 4KRUA 1E4MM 4AD4A 4J3UA 4AMWA 1HL9A 3EDEA 2ZWZA 2F2HA 3VMOA 3ZR6A 1GOIA 3MKKA 1U33A 4TVUA 3DECA 3SUVA 2J75A 3VDAA 3LXBA 1BYAA 1GQIA 2DIJA 3HG2A 1H41A 4B9YA 2MANA 3IJ8A 3TV8A 1OWQA 3DX2A 3CHCA 2GDVA 2PWEA 1UKQA 1KFWA 5FD0A 1WPCA 1R85A 4DUWA 1NWUA 2CBVA 2XPKA 3K46A 1K6AA 2ZXBA 3ZT5A 3U7VA 5GQBA 4EAMA 1VEPA 1EDGA 4HZ6A 3ZSSA 4DWSC 3PZOA 1E6XM 4CD7A 4AMXA 1XSJA 5HBFA 2V3GA 3N12A 1OD0A 3VIKA 4ML4A 3N13A 1KWGA 4NRRA 2CERA 1VF8A 4GI6A 1LWHA 4X0VA 4PEEA 2NT0A 1BFNA 3BUBA 4X0NA 4TTGA 3N17A 3SUUA 2C0HA 2XTKA 3ZJ8A 3L2LA 3OLDA 1IZJA 3PTMA 3BVVA 4UOQA 1VB9A 1UKOA 5A6JA 1KGUA 5FOOA 3GDBA 4M56A 1LLOA 3T09A 1TR1A 1GQKA 3NIYA 2QV4A 3W26A 1KBKA 3HG4A 5EBAA 1QI3A 3ALGA 4YHEA 3WDRA 3O9NA 1WP6A 1ODZA 4Q7NA 4IPLA 5M17A 1K9FA 3FY1A 1I75A 1NP0A 3CZGA 2WHLA 1JF6A 4MJ4A 1E4NA 2VCCA 2BY1A 3AS0A 4NSBA 3MMUA 4L4PA 1OT1A 1AQHA 2VR4A 4AY1A 4JCMA 4DO6A 2VOTA 2PB1A 3AIEA 4P7NA 4UQDA 5GPRA 3G6LA 2ZX5A 4PSPA 4FNRA 2OSYA 3AIBA 4FNUA 2BHYA 3VTRA 2DSUA 3B9EA 2YA2A 4D6FA 4NI3A 2ZX7A 1E5JA 4UFKA 3BUIA 2WHJA 1W2VA 2V38A 1C8YA 1B31A 2EPNA 3SCTA 4FK9A 2VZVA 4DM2A 3VO0A 3AFBA 1TQUA 4W7UA 3MV01 1EDTA 5A6MA 1Q4NX 1UA7A 4QLKA 3GNPA 2EPMX 1OGBA 1BYBA 2FDMA 1UD3A 2CITA 4F66A 4PRWA 1UKPA 2QPUA 4AIUA 1JZ6A 4HPHA 3B8SA 1OINA 2BVDA 3CBWA 2F7QA 1Z32X 4AZ7A 3VIPA 3VSVA 1KXHA 2VQUA 5HNNA 2XM2A 2DPEA 3MSGA 1AQMA 1DWJM 3WNOA 1EA9C 1GCYA 1QX1A 2ZUVA 1LWJA 1V3MA 1EOKA 4IUGA 1FP8A 4DWSD 4MDPA 1CYGA 1I1WA 4GZEA 2YLLA 1PBGA 3WQWA 4WK9A 1GOMA 3CZEA 1KCKA 1V02A 4PTMA 2WMJA 3AMDA 2VRKA 3WNNA 3TOPA 1VIWA 4ZE5A 4XB3A 4D1JA 2WZEA 2WM0A 3WEOA 1BSIA 3VILA 4CVUA 2WLZA 1HWWA 3VD3A 4W93A 1R86A 2WVSA 4P7LA 3WBEA 4YPJA 2VTFA 5M03A 3POCA 1V3LA 4UOZA 3AIVA 5IDIA 1JYXA 1HJUA 1OCQA 3G6MA 3NCOA 5FL0A 4WSKA 3W6LA 3WL0A 3MUAA 4JHZA 3AOFA 1H1NA 4UOJA 2DH3A 2QMJA 1X6LA 5A95A 2WKLA 1LG2A 4PTWA 2A3HA 3CHFA 4ZFMA 5IXEA 1SYTA 4EANA 3VIMA 1WNOA 1L0PA 2PF0A 3SCSA 3A24A 5LA2A 3TTQA 1CGTA 3MUIA 3UEQA 5A8NA 1G1YA 4JAWA 2EADA 1HIZA 3WQ5A 2Y24A 1MXGA 2VQTA 1EGZA 3DHPA 1GHRA 2GJXA 2VUYA 4HA1A 4OIFA 2OSXA 2UWFA 4E8CA 4BZYA 5E6ZA 1E40A 2ZICA 2VC9A 4F79A 2EACA 2J7FA 4HMDA 4TX8A 2BXYA 3CMGA 3MMWA 4U3CA 2GJXB 3N18A 3SUSA 1XYZA 2VJXA 4QCFA 2XVKA 2VRJA 3THDA 5AC5A 3IAQA 5IHSA 2J8FA 2WVVA 1KR1A 4D6GA 1E9LA 5ABGA 2E8YA 4PYSA 3SURA 1NH6A 2BV9A 5A2CA 5E70A 3AS3A 1B30A 2O92A 4UQBA 2WVVB 4PMDA 1MYRA 4B9ZA 2VURA 2ESCA 4WKAA 1H5VA 5JIWA 5E1QA 4W8LA 3WH8A 2RGMA 4EK7A 3UETA 1GOOA 2ZUNA 3VGDA 3CZNA 2OSWA 1MWOA 4FMVA 2WK2A 1NWTA 1XD1A 1PAMA 2RGLA 4AEFA 1J0ZA 2WMHA 4GIAA 2ZX6A 1CLVA 5HPOA 3MMDA 5DT5A 1CBGA 4GO9A 3BAJA 1E6SM 3VX0A 4AZBA 2E0PA 1US3A 5DF0A 3ZM8A 1X1NA 1E72M 4LYPA 2E9LA 4PBGA 2WBGA 3CZ8A 1UR2A 1JIBA 1HN1A 2DDXA 4EE9A 3BMWA 2YJQA 1W1YA 1XRVA 4H41A 5DFAA 3VSUA 2XUCA 2O9PA 5GNXA 2UY5A 3WNLA 3MI6A 1I1XA 4FNTA 4GINA 2YBUA 3WBAA 1CGWA 3FW6A 2XG9A 3GYCA 2O9OA 1VBRA 4M81A 4ACZA 1W1PA 4NZCA 2ZUUA 3RM8A 3SCVA 3T2OA 4W7WA 3EDJA 4HOXA 3GNRA 1UWQA 8A3HA 5HPCA 4ACZB 3WNKA 4OOUA 4U31A 5CQ1A 4TVDA 4U5KA 4P8UA 2ZOXA 1XHGA 2YL6A 4DO5A 2A3BA 4GI9A 2VZUA 5CPTA 2XVGA 3ZR5A 1V3JA 1MW0A 1KQZA 1E4LA 4RE2A 1M53A 2D0FA 1OBAA 1QOXA 1E0WA 1HKKA 2GDUA 1XCWA 4LQ1A 2XIIA 3CTTA 1WDSA 1UZ4A 4GI8A 5I79A 3A23A 4UQCA 1HVXA 3EJSA 2G4FA 3ZJ7A 1YQ2A 1UASA 2DH2A 1HNYA 4H8HA 1JGIA 3CUJA 3PZ9A 2CBUA 1FOBA 3W0KA 2C7FA 1V3HA 1LF1A 3SEPA 2F18A 4Z2KA 1UA3A 1QI5A 1WKYA 1CXIA 1V0NA 1WAWA 2ALWA 3WD0A 2EO7A 3GXFA 4NZJA 1W9PA 1BYDA 4HP5A 5AC4A 4W8AA 1BAGA 4M8UA 4B3KA 3D52A 3HZ3A 5AYIA 3W4RA 2J7HA 4BCEA 3UG4A 3AMCA 3FNDA 3VD5A 1TA3A 3FN9A 5ABFA 1JDCA 1JYWA 1JFXA 2DIEA 4PSRA 4R5EA 3EJPA 4Z2HA 3KL3A 3CIVA 1M04A 1TA3B 1HXJA 5ABFB 5CG0A 3FXYA 3CZSA 3GM8A 2EPLX 4HTYA 3CH9A 2WAGA 3GH5A 4MNLA 1WDPA 2VVNA 3N9KA 1KGXA 3WFZA 2JIEA 3W81A 3WQ6A 4B15A 4D6IA 1D3CA 2X0HA 5CPSA 3DX1A 2XVLA 1WZMA 4DWSA 1C91A 1B3VA 2CHOA 1UD5A 3OG2A 4FLSA 1F4HA 3H55A 1ZB5A 4P8WA 3GXTA 2EJ1A 4PUDA 5A6AA 3AZRA 3I3BA 3WQVA 3LMYA 4DWSB 1CTNA 3IGUA 3WY3A 3VUPA 4W86A 3AHXA 3SCNA 4EKJA 3A4XA 2WBKA
chains in the Genus database with same CATH superfamily
3GZPA 1VHPA 4MKNA 3M86A 2QUUA 4U1NA 4DUXA 3HIJA 3PL6A 4NNPH 5JH2A 2WXMA 2QMKA 3GTIA 4U1NB 3PL6B 5CSGA 1LL7A 1EBGA 4A2HA 1L4IA 1FE8H 3OL2A 2OMAA 1TPWA 4C6JA 1CLYL 4BD4A 2XGIA 1HZLA 2F53A 1LO3H 3S6TA 3P7YA 4GKSA 3G1RA 3KVLA 5DHMC 3P30L 2P1FA 2F53B 1GJWA 4GKSB 5CUSL 3MKVA 4DN3H 3KBVA 2P46B 4IQEA 4A63A 4QYOA 5KBDA 2WNQA 4Z7QF 4QXUH 5DMNA 2BX7A 5IW3A 4QYOB 4H0IA 4D6CA 2P5WA 4HKBA 4DXXA 4ZRGA 2DKUA 1DUYA 2P5WB 2BM3A 4MXWL 4HKBB 4UFHA 4QTGA 4LCVA 1R7OA 1DUYB 4X7TA 5E0FA 2FECI 4XTRC 2XXFA 1EUAA 4N2HA 3TPKA 4X7TB 4JRXE 2QKIA 4KXCA 2O5XH 1HCYA 3OVUB 1ZAGA 4K3DL 3JTTA 2QKIB 3SGEH 1USZA 1I3VA 3OPZH 3VA2C 1XEUA 3K6DA 3JTTB 3GC5A 1KG0A 1JUBA 4ZAKC 3LVTA 5D1ZD 3SDDA 4MSSA 1KG0B 2Y8VA 2HNHA 4PMVA 3ZN6A 2OMBA 1M3UA 5KSBE 3SDDB 1M7PA 3HE7C 4RPPA 4POZC 2MJWA 3BAWA 4C60A 4OSUH 1EWDA 5AC8A 3ISYA 3UTZA 3N1GC 3FCUB 3GDKA 4G80A 4GVGA 3G1VA 3UJJL 3UTZB 4JM2A 4HIEA 3RILA 5A8OA 3NPZB 3MV8E 4JM2B 4HIEB 1W9BM 3WQ4A 5C5YA 1MKFA 4ZS6D 1XLLA 1ELSA 3L9YA 1QHZA 1DJWA 3O6CA 5JW3L 3FSOA 3VIGA 3EYSH 3LQGA 5HDQH 2Z6IA 5D4HA 2Y88A 3GK8L 4LVHB 1GQJA 2XU9A 4HK6A 4LLAA 1KXVC 4UUJA 4FLHA 5E93A 4NJIA 1NIBA 1ZEAH 8TIMA 1Y7VA 4UUJB 4ODTH 2V7NA 1GC1H 2XV2A 2P48B 4XMLL 2R0ZL 3GX9A 1RUPL 1UA6L 2V7NB 1VZHA 2F7IA 4Z7UF 3S2CA 2G3MA 1W1B1 3QQ4A 1Q0XL 3RAJL 1CDCA 3QAZB 3K5SA 1IR1A 5KVFH 5HHVL 5TE7L 1P6AB 3WQFA 3QQ4B 2ALAA 1A6TA 2J5LC 1SY6L 3TFBA 2CHNA 1AUSL 1A6TB 2R0LH 3L45A 4B5NA 1IEQA 5GNZA 3EGDA 4N2BA 5CMAA 1HILA 5BZAA 2PDNA 2FBJH 4FP8L 1JAEA 4PJ5D 2YQGA 5CMAB 1BIIA 1HILB 4A2LA 1Q1JL 2EICA 2PWGA 1A64A 4HIIA 4TV3A 3BVJA 1BIIB 5GGSY 2F5BH 3UXLA 4S2CA 4XP1L 7XIMA 2ZT9C 3UYCA 5I6PA 4HIIB 4LNVA 1WQVT 3KLAA 1AR1C 3MHZA 3KLLA 3M17A 1RZFH 3KLAB 4L1SA 3JR2A 3M17B 3TQPA 1FKWA 4IJBA 3P82A 4TVCA 1XTLA 3F6IA 2I16A 2MCPL 3CMOH 4DNMA 3H2PA 3N1PC 4WXZA 5DZAA 1FORL 2YYUA 3QZEA 3RUBL 3NIDF 1LWIA 1FAIL 1NCCL 3QARA 3UZXA 1ESWA 3JU2A 2GBAA 5B3JF 4N4YB 2FO8A 3S46A 4K94H 1S2UA 3MGAA 4RBPH 2XACC 3NAVA 4PHXA 1W54A 4XNDA 5CSYA 3VCLA 4LNYA 4CSPA 4FQHA 1G1KA 1L7TL 1U3ZA 3HFTA 2A83A 3VCLB 3DBSA 2ZXCA 4LSVL 3DOIA 4FQHB 3ZHNA 3A6BH 5BRBA 3PZQA 4UT7H 2AMXA 3A6OA 1JDFA 3F7QA 2ZUXA 1XLGA 4GVIA 4DHLA 5JXAL 2V5DA 2XICA 4W5UA 5DYFA 3P2TA 2HVMA 3VG0H 1U8CA 3M41A 1YO4A 2QGHA 3RMJA 3M8OL 4IOFC 3LCGA 1U8CB 3NUKA 3CFCH 3T8XA 3PZMA 5G2HA 4Y4HD 5LBSA 4ZZ9A 5T5NG 1KULA 1SVZA 3BPLC 2FEDD 3T8XB 4I8YA 3ARRA 2DWXA 5IBLC 5SWZD 2AEPH 1XIFA 2UVFA 3W2NA 1RFDH 1UM6H 1FNHA 3FS2A 5GXBB 1E4KA 1UC4A 1FUNA 2P43B 3NJFA 3PN8A 3UY8A 4QS6A 1GPFA 4QHUA 2ENYA 3WQGA 4PS4L 1JNEA 4OM0H 2JJUA 2IDSA 4QHUB 1SJMA 3LQAL 3WLJA 1ZXKA 2K8QA 2WLKA 4N0FB 2VQ4A 1R9FA 2XFFA 2E67A 5DC9B 4N24A 1M03A 1O4UA 1R3JA 3ARGA 6REQA 3I2CL 3VOFA 1HW6A 1R3JB 5T33L 5JHDD 2BS9A 4J9JA 1N8IA 4ONGH 3WH5A 2R0WH 3ARGB 4KI5E 2ZZ1A 6REQB 3LPOA 2Y1HA 4MJIA 4DWHA 2CZ5A 4YWGL 1OGPA 3SCOA 1JZ3A 1F41A 4MJIB 4YX2H 1H50A 4JFQA 3ZL2A 3B9KC 4NQSA 1OX4A 4K7VA 5BOFA 5FGSA 4JFQB 1OABA 3NEOA 3AMKA 4NQSB 1OX4B 1B0GA 2DYSB 4DZBA 2KL6A 2DBLH 4Y4FA 5A94A 3WI9A 2EZ0C 1B0GB 1SPDA 4DZBB 1NCNA 1PG7X 4M5YH 4Y4FB 3WFDH 5T1DH 4AQZA 1LORA 3MFGB 4K9JA 4V1DD 5GZOD 3WUFA 1BGXH 4N9CA 2GTQA 1KM0A 3Q9PA 1EF2A 3NP3A 3X3FL 4TLUA 4DO7A 3NJXA 5A16A 4NNBA 3UCDA 2IO5A 1VFUA 1HJQA 4YHLH 4XT1C 4P9HH 5A16B 3A67L 4H8QA 1WDRA 3TJIA 1C8VA 3TAOA 2Z7KA 3OF6D 3B04A 4G72B 3BL3A 5AB1A 4HW6A 4MXQC 3QBUA 1KTRL 5TQ0H 2GEEA 3P60A 3R0NA 3TONA 4LAKA 1UOWA 1HAWA 4DYEA 4MAYD 3L7RA 4ADSA 3P0WA 1U93A 4JTUA 4PMXA 1FYTA 4IP7A 4P5TA 4F92B 7TIMA 1F11A 4JN7A 3FT2A 1U93B 3N4EA 1FYTB 4KWOA 5T26A 4P5TB 3QHOA 1A3LL 5ICYA 1F11B 3FT2B 4BF5A 3MC5A 5FACA 1TCMA 1FDLH 2DLGA 5ICYB 1GJPA 3SYAA 1QRNE 3FK3A 2IAMD 1XWYA 3SY0A 4LVEA 5IB3A 3DOSA 1H8SA 3GHEL 4OJAA 3SY0B 3C6EA 9PCYA 5CJ5A 1JERA 5IB3B 3DOSB 3KS5A 4WWKC 5CKGA 1ET7A 3H21A 3ASNB 4PGLA 1C9WA 3UCQA 4RK8A 4UINH 1TIUA 2QGEA 3U4KA 4E9WA 2E7DA 3PANA 2GJPA 3N42B 1H5YA 1P7QD 3C6CA 4K9EL 3O2DH 3CSYB 3ZSTA 3QIUC 2R2EA 4JM4H 4K3JL 4H0HB 5LLIC 2IDUA 3N40F 2R2EB 3GI9H 4ZO6A 2OK0L 4NJGA 3BKML 3S3DB 1BP3B 3O6KH 4R85A 4ATDA 3QXWA 4RETB 3D85A 3AZSA 1NUFA 4HYVA 3GD1C 2WNNA 3AWOA 3BJLA 4K3EL 4ZFOL 1IAII 4MFDA 4XX5A 4NYLA 2PP0A 1W0WA 2EE6A 4YN5A 2IGFH 4M62L 2YKKA 3PUCA 4NYLB 2EDWA 1QZ1A 1W0WB 3KWUA 2BHUA 1ZENA 4LCCC 3GSOA 3IGAA 1EA0A 3V8OA 3GSOB 3IGAB 4F8LA 3MRBA 3P0XA 2BFGA 4HHAA 1MFAH 1DVFD 1YECH 1B0RA 3U0WH 3SYCA 2TRHA 4HHAB 1CGUA 2HH0H 2EIZA 2A2IA 1B0RB 4J5NA 4OV4A 4IF2A 5DYOA 2D23A 1FGVH 1OPGH 1KBVA 1KBPA 1VLWA 4PP2A 1J9SA 2EIZB 2AQVA 2PLJA 5DYOB 2ZG2A 5F1NA 3ZKSD 2J13A 2VWSA 4PP2B 3V0VA 4BZ1L 3SCMD 2RD0A 1G4RA 5F1NB 4FTVD 3BUDA 5HDBF 1AZNA 5JIQA 3V0VB 3I6EA 4ZQTA 2HKHL 5GSRA 4I1PA 3SB3A 2R82A 1NCWH 1JCNA 5GSRB 1Q9KA 4FFZA 3KPSA 2RMNA 2CETA 3PF3A 1Q9KB 3KPSB 3O2VL 3EB2A 3MUJA 4AZ6A 3SBQA 2CUMA 4QOKE 1HYRC 1HFBA 2XVNA 2DWEA 2BRRL 3G0SA 3PP4L 3O3BA 4QQ3A 2CALA 1EJOH 1IEBA 2DWEB 3W37A 3O3BB 3EX1A 1J0KA 3SKUD 2O61A 4NYUA 1IEBB 1YTDA 4PYGA 2CKBL 3JV5A 3DDMA 1LP9A 5HAOA 2O61B 2V63A 5B7YA 1PX4A 4DP0X 3TXAA 1MHPL 4Y5XA 4XVTH 2CUHA 1LP9B 5CEZL 5FEWA 3ESPA 2DT3A 4ENEC 3W38A 4Y5XB 2W91A 1UH3A 4RWYL 3UBFA 1DIKA 3BMXA 4F48A 3TO4D 4RDQG 3M0VA 3UR8A 2D20A 2UZ9A 5I5RA 1MI5D 3V18A 1IGCH 3QMTA 5IM51 1J8VA 5T91A 1WS7A 3OKLA 2ZCHL 2PN5A 1NFDF 2DVTA 1NBZA 4LPWA 3LXBA 4PFEA 3OKLB 5AD0A 2PGWA 1TQBB 5KSVA 1R17A 5F3BA 3H8NA 5AD0B 5KSVB 4NPJA 5F3BB 3EOBA 4WEBL 4PJFA 4LUJA 5BOZG 4UTJA 4IGBD 3EOBB 3UF9A 5D6DC 2BMBA 4PJFB 1IQWL 4PWIA 3N17A 4JX5A 2IPTL 3SUUA 4LARH 1MHCA 3OLDA 2JB6A 2J4WH 2F53E 1EGMA 1NY1A 1C5CL 1MHCB 1TR1A 4YSTA 3TEXA 1TYEB 4L3FA 4OV9A 2JB6B 5A3ID 3D09A 5DQDH 2WIMA 1WP6A 5DEJA 1P1MA 4Q7NA 2CM6A 5LAPA 3R19A 1XSOA 4MLRA 5AB2A 2EVGA 4O2CA 3RGVD 1ZLUK 4D9LL 2BNRA 2VEMA 1R24A 3G6LA 3D34A 4FNRA 3NIGB 1CD8A 1VC4A 2P5WE 4O2CB 2BNRB 1R24B 5C9XA 4D6FA 2Y62A 4H6KA 25C8L 1EAQA 4L4TA 5T5FA 3VI3A 4HAGA 2LU5A 4Z0XA 3LV6A 1XF1A 4DM2A 1UJTA 4L4TB 4G8GA 2PRHA 3VI3B 1A7QH 4Z0XB 1V6TA 3GTHA 4AIXA 4G8GB 4LSPL 3M7WA 4HBKA 3VD2A 3ABGA 1OX5A 2NY0D 1OINA 7FABH 1TJRA 4J4PC 1FGNH 4IQLA 2HUHA 3CSGA 4GT0A 5IKCA 4LUTA 4G7YH 4LY4A 1PG7L 4XOAA 1FP8A 4AVFA 5MEQA 1NC4A 5IKCB 4LUTB 4FAMA 3LCLA 4J1UA 2EDQA 4BH8A 4G42A 4WFEE 3N6QA 1DQDH 3RVXC 2ZWLT 1NC4B 5MEQB 3TLQA 2G0WA 5F72S 2WZEA 4J1UB 3KG5A 4BH8B 4G42B 2X1WL 4WV1A 4C6QA 1YAIA 4U6VH 3MDJA 3KTXA 3VD3A 5HI5C 3WBEA 2Z34A 2EEBA 4WV1B 1YYLH 5DJ0A 3BZFA 2DH3A 2Q3AA 2HXAA 2ZCLH 3V0WL 2WKLA 3B9NA 5DJ0B 3BZFB 5LA2A 1N64L 4F27A 3MUIA 4A29A 5A8NA 3NJNA 4O02L 5DQ9A 3C4UA 3U1SH 3RZCC 2O6FA 2VEIA 4MLSA 5DQ9B 1TV3A 3LG3A 5FEZA 2YR3A 2DL2A 1B6DA 1AMKA 2WVVA 1YNKH 1X5MA 4PYSA 2BV9A 5A2CA 2BGQA 4UQBA 1A7RL 2WVVB 4YBLC 1CI3M 4N2GA 4B9ZA 1J96A 1CZ8L 1TJ2A 2RGMA 4IKIA 3VGDA 3VXPA 5AYUL 4TUUA 3SDXB 5DDHA 2L7EA 3KW3A 4XAFA 4LCQA 5DT5A 3UP8A 2NYKA 3VXPB 2EDTA 5DDHB 3ZM8A 4ZMXA 2E9LA 4PBGA 4F7MA 1P4LA 3FSTA 4HNVA 4XO6A 6ALDA 4L4LA 4DCQA 3BMWA 2HV5A 4Z1BA 2VYRE 4KCUA 4AT6A 2PGRA 3QJZA 4F7MB 1P4LB 4M3KB 4C47A 3L3JA 1DTNA 3QVQA 4DCQB 3GS0A 4C4KT 4AT6B 1BXXA 1S6NA 3GYCA 4IDJL 4PJIA 1PWMA 5KVEE 3L3JB 5DFVD 1DUZA 2CR6A 4PJIB 5CR8A 5FYLE 4U31A 2JK2A 3ZYZA 2J9YA 3NTYA 3SE9H 1EERB 2DF3A 3BLEA 4TU1A 1DUZB 2VZUA 3B0VC 1ZLVK 3R94A 2CLPA 1G6CA 3NSDA 4UB9A 1QOXA 4Y1AD 2RAGA 3NACH 4JNXA 4J6IA 2NQLA 3PNZA 2I60L 3LDBC 3QKZA 3LMJL 4KKLC 1XLJA 3FDKA 5GGTA 2CBUA 1GKQA 2ZOLA 3FNKA 3TE9A 4I0PD 4B3EA 4GBDA 4NKDA 2ZOLB 3GC2A 3B7TA 1AD9A 1B2WL 4UT9H 4GGBA 4NKDB 3DGBA 1MCIA 3Q13A 5AYIA 4BCEA 2WLJA 1AD9B 2X1RA 1HIMH 1JYWA 4FADA 5DWUL 3DMMC 1BV8A 4R5EA 2P28B 2XWJA 3QUMA 3W72A 2WKOF 1EVTC 4JR9H 3HBLA 2XWJB 1O68A 3QUMB 1DIDA 1WKDA 2AEOA 3DJZA 2OT0A 3HB3B 2OZ3A 4C6IA 2IDTA 1QOPA 2C9SA 3SBFA 3NCYS 5I30H 3LXCA 2B7OA 4PJXA 3DEQA 4HT3A 2H1XA 2VDMB 2VR3A 4PJXB 2KZ1B 5D70L 2WZMA 1EHAA 2J88H 1COBA 2VDKL 3UTTA 5C3TA 3F7JA 1XGYL 1NCBH 3CZLA 2FH8A 3UTTB 4KQ3L 3U7WH 5IFHH 4C56A 4DN4H 4PC8A 2PW1A 3GH7A 1RZIA 4M7LT 2X2YA 1EIBA 1VGEL 4C56B 2JE8A 2OP4L 2PW1B 5JZ7C 2BGNE 1NFAA 1RZIB 3LCWA 4DLFA 1DFBH 2CGZA 2IFFH 4GUOA 3P14A 3JWNG 4BUQA 4JTFA 4QNEA 5AW6B 1KOAA 4L5FE 1H6EA 4Z95H 4X9YA 1W8OA 2HT3C 2VDPB 4XZ4A 2GGGA 1AS6A 4M7LL 5KAQG 2CBOA 3WBXA 3ILEA 4QRPD 3F65A 5GGRY 1T7VA 4XVOA 5LCVA 4N2YA 3NOIA 2K7QA 3WLQA 1KTBA 3V6OA 5I19H 4MTVA 4OF7A 1QTYT 5F7EL 3WH7A 4W9JC 4RFNC 2W80C 5HR7A 2JI1A 2C1HA 4A3UA 1E9OA 2BK8A 5KANG 2QDHA 4P46A 2WCAA 1E9OB 1XCFA 2I17A 2QEZA 4A7QA 4MJHA 3DX7A 4MJIE 4P46B 3QZ6A 3STGA 3ZT7A 1C93A 4GISA 4RLIA 4ODVL 2YPKA 3DX7B 1XLMA 2CO4A 1KCZA 2YGQA 5EMKA 5EWIL 4BCYA 4IZGA 1H4PA 3BAYA 3IS0X 3URAA 2YPKB 2QVNA 1A0DA 2IGTA 4FHAA 3U9PL 2DZXA 3JVGC 1W1IE 3VM5A 3VB8A 4R84A 1VESA 5DR5H 4B5ZA 5K9JL 2D2OA 3WKZA 3V5CA 1GGYA 3SECA 3A3WA 2AQ2A 4LBUA 4NQVA 5J6SA 3UL4A 3GNXA 2NTFA 4GNJA 4P7RA 3EFDL 5F7KC 1NICA 3VKBA 4NQVB 1DZ0A 4Z7NB 3JT2A 2DTSA 2NTFB 4RFOL 4Z42C 1O5RA 4QRQA 5BNKA 1ADOA 4JTDA 4CKVX 3UZYA 4FL4B 2I9LA 2NQDA 4JHOA 4QRQB 2F54A 1F2QA 4ZI8A 2WKGA 2PP9A 1SMDA 2R29L 2I9LB 4P5MA 3RIFF 4LPUA 1KPRA 2F54B 5DWPA 1JVOA 2PXYD 4M0XA 1PD6A 2XJ7A 3VW3L 4P5MB 4Q8WA 1KPRB 4K37A 4I3RH 1HC1A 2AZUA 4MJ2A 3WLMA 1HDMA 1KO0A 4AWEA 1O6VA 2WZHA 4PJHF 4UTIA 4Q7BA 1M71A 3CU7A 1HDMB 1FLTX 3GRWH 4PJBF 4JO1L 4OT1L 1T2QL 1WICA 1M71B 5IFAH 2CBIA 1FBIL 1FYTE 4MBOA 3DGGA 3NM1A 3P9LA 1YW1A 1MAML 3H6OA 3UERA 4O2EA 1JRCA 1YDOA 4XPBL 3EJJX 5FI8A 3DGGB 3KM1A 1XC6A 3DFHA 3K2GA 3P9LB 5LNGA 4O2EB 2OKOA 3PV7A 3LPWA 1UJPA 2SEBA 2OKTA 4G56A 2OV0A 4XN1A 3OLIA 4RNHA 1U6AH 5IESL 2SEBB 2DQJL 4FJZA 2LV4A 1DBMH 3EPMA 2OTPA 3CFKA 4MA1C 4ZT1A 1O12A 3CFKB 1FWSA 4PUMA 3VM7A 2YPVL 2ZSVA 4X6BA 1PBYA 1PKLA 2RHGA 4QG8A 4ZPVB 4O1AA 2ZSVB 4X6BB 5C7ZA 1H5BC 1WYJA 5AW8B 1A6UH 2PPEA 4Q9QL 5SV3A 3D5HA 4JZNA 2R15A 2BDQA 4A2MA 2F1AA 3ERXA 4W9KC 4F8PA 4JZNB 1W5NA 4M7ZB 2X4NA 3MV8D 3VNYA 3BICA 3PGFL 4D8ZA 2X4NB 1EHLH 2PDWA 4RZBA 2RALA 2WQSA 2VERA 2C9AA 5JW4Q 1BQ5A 1EV2E 4M93B 4LNCA 1RH9A 1LQ0A 4PJ7A 8XIAA 2NXZB 3COTA 4HGWA 2D03L 3IMVA 5C0AA 1NDGA 4PQXA 1GY2A 1ADQA 3CG8A 4PJ7B 1HJBC 4MUPA 3AGVA 3TO2A 2I32A 5C0AB 1G7VA 1NDGB 4PFMA 1SJXA 5I0WA 1YNPA 3UD6A 3AGWA 1AK5A 3F6JA 4RNFA 1A14L 1QLEB 1LILA 3TO2B 4C1NA 2R9RA 4DT2A 3NBNA 3RY6C 4OHQA 1XYAA 1UWTA 3NEHA 2NNRA 1JR1A 4C1NB 1A5FH 3BEVA 4DVRL 1Q66A 1MFCL 3CDGA 1TEGA 3BKYL 3KM2A 3BEVB 3CXOA 3DO7A 2OM5A 4ZA0A 4J6RL 3CDGB 3TTOA 3TT3L 3BN9C 3BDKA 3NSYA 4WW2A 3FJLA 1E70M 3DO7B 2DZAA 1BVZA 4NIRA 4GRWB 2Y70A 3N1MC 4IMGA 4X6FA 5IQOA 1QZNA 2GFTA 2INZA 1AY1H 4U0QB 3E49A 4PGCA 4BWLA 1ZPTA 4X6FB 2CR0A 1FJ1A 4JPWH 5E8DH 2I69A 1CYXA 3RRXA 4HHHA 3LRLA 4WKFA 3WJSA 4PGCB 4LHUA 1DQIA 4Y4KB 1CE1L 1SZGA 1FJ1B 4RAUA 5GGSA 3VFMA 1P69B 1MQQA 4LHUB 5LIKX 3HS0C 4RAUB 2Z1SA 3VIFA 5GGSB 1RUKL 1W8GA 4ERGA 3VFMB 3VXNA 4P99A 4N5EC 4ORIA 2RTTA 2X12A 4PWJA 2ZUTA 4R7WA 5EOTA 3VXNB 1ITQA 5FF2A 1L9TA 1GTFA 3UXFA 4Q6KA 5T3XE 5EOTB 1GKEA 4PI0A 3AHZA 1K70A 3N2BA 2PWFA 4YVVA 2P7TA 5LG6A 3KPSE 4J8QA 4H1LG 2OXNA 4I90A 4IM8A 5E95B 3BWSA 2P7TB 4KHTH 2ZRXA 2BSED 4CNTA 3VC6A 5ITBL 2KHAA 3V3WA 2IF7A 1A7PL 3I6LE 5EFDA 4ZFGL 3VGBA 2DPKA 2FB4L 1A5OC 2I5IA 2L0DA 1IGTA 3WU1A 4TIMA 1D5BB 2Q3ZA 5F4XA 4HU4A 1IGTB 1A1NA 2NXYB 3VD0A 1ZCOA 1LP9E 1A1NB 3MW7A 4Y7OC 4L9XA 4X8JA 4PE8A 2Q9OA 1AD0A 4QNPE 4WRHA 2ZWYA 2NY6C 1WFJA 4XZHA 1N2VA 2FHFA 1U8QA 3MGTA 3S96A 2O9TA 3H6AA 3MN8A 4X8JB 2R1XA 4U1GB 2AI0H 1AD0B 2XN1A 4G43A 3WXWH 5I3DA 3TW9A 5GISL 1U8QB 3MGTB 3S96B 1Q6GA 2R1XB 1IC0A 3K4ZA 3IUHA 3OHMB 4G43B 3VQLA 3W9ZA 2R59A 2VXUH 5FDWA 4AD2A 1BIHA 3U9UA 1VF5C 3L1GA 4O12A 3BV4A 3ANUA 5FDWB 4LB3A 5IJCC 3VWKD 3U9UB 1KV3A 5DHVH 1A50A 1TPXB 2DKMA 5HSFA 1SM9A 2OYPA 4K3HA 1MG2C 2VE6A 1E7VA 4JE4B 4PJFE 3JZUA 4E9VA 2OR8A 5I24A 2W8CA 1FWJC 2VE6B 4OF8A 3Q1EA 3DX0A 3BXWA 1OF2A 3CUIA 1LO0L 4WDUA 4D6EA 3HJZA 5GS0H 3SRHA 4D0CB 3QEQA 4RDZA 2W61A 1OF2B 5HMDA 4AWUA 2ZA3A 3FLUA 2P5EA 4IRJD 2YCJA 3QEQB 3ZS4A 3JYBA 3U9WA 2Z1VA 4LESA 2P5EB 1R34A 2N7BA 1CD1A 3FF8A 5ALBH 5AW0B 4WI6A 1UMYA 3KVKA 1CD1B 3VFWA 3ARVA 1TR9A 5JPMA 1BMZA 2OL3L 3ZL1A 5AYXA 3P11H 5LAXA 4NAMA 4I5RA 3W22A 4ODHH 3RPTA 1T4WA 3VFWB 4HAFA 5JPMB 4RV3A 5AHLA 3NIGE 1ASOA 5LAXB 5H91A 5BMXA 2BNRE 5AQ0A 4AG4L 3C5ZD 3DETC 1Z9SA 2WANA 4FXJA 3PPSA 3NGFA 4KKZA 4BFOA 4KI5D 1HEHC 1Z9SB 2ZTJA 4L4TE 3OKEA 3VI3E 2R94A 2BP0A 1WFMA 4R3SA 1KM6A 1G87A 4UNLA 4GXVL 1XX1A 4HWUA 1GW6A 4G8GE 3OKEB 3CZJA 5KUKA 2BP0B 4HWEL 1ZTVA 3NCCB 5AFDA 2I25N 2IWGA 2WNXA 3MT1A 1YEHL 5F1KC 4B9IA 2ZYFA 1NCDH 4FALA 2Y7DA 4E2OA 2XYBA 3CQQA 4AGLA 2B0MA 2L7JA 3MODH 4JZ5A 3QNZA 2YCLA 5PTDA 4KZCA 2VKZG 3DJTA 3KNBA 3X14A 4UWMA 1JQXA 3QNZB 3QPYA 3R25A 2YCLB 2VELA 2QS8A 3KNBB 1H3PL 3ARBC 3BW9A 1OO2A 5I3IA 1JMXA 5D7HA 1BECA 3WTYA 3ANYA 3BW9B 3M1BA 3CZFA 2FYMA 1UWUA 3L1OH 1OV8A 3F62A 3M1BB 3STEA 3CXHK 3CZFB 4PW3A 4N26A 5HI4D 3PJXA 1PYMA 3RGHA 3LK6A 5TBOA 4UT6H 5K5YA 3WFLA 5KYXA 2JIWA 2PCFA 2HT2C 1F86A 4BFRA 1A4AA 4V28A 5KYXB 1I1AA 2HXTA 2PCFB 1Q7ZA 1X9UA 4HB7A 4ZMTA 1QFWL 1I1AB 1YJDL 1OWWA 1UGNA 4O1DA 2WXGA 3WLWC 1U83A 4OIIL 2WBJA 4Y9PA 3SDXE 1AMXA 3MQIA 4JX6A 1GCFA 1JZ4A 4HJIA 3MNMA 2WBJB 1QRND 3OYZA 2EE9A 2F15A 4MUZA 4FOKA 3C2FA 1WTGT 1RAMA 3ATEA 1J1PH 1ENUA 5REQA 4UFJA 1SMOA 1GMIA 4F9DA 4A2FA 5REQB 4PBDA 3L5WA 2E5BA 1HEJC 4LF1A 4YVUA 2UX6A 3IRZA 3L5WB 1HE7A 4PJIE 1HWGB 4FMKA 2PLTA 4GSRA 3KEDA 1T66D 1OAKH 3SI9A 5EU7C 2XXGA 4EX4A 1J86A 1AHMA 1ZQ5A 1N7ML 2JWYA 5EGRA 4XZBA 2I9UA 1N67A 1LRQA 2PTXA 1H0DA 1LYQA 4PVNA 4YDVA 1A7NH 4AL8L 1CXLA 2AQQA 3F2LA 1H0DB 5GGQL 3H6JA 4ICWA 4YDVB 3U79A 1RK1A 3FC8A 1GJUA 1BWKA 3RAOA 1J88A 3NOYA 2PGFA 1M6OA 2BVEA 3FMGH 5DHYA 3VKAA 1RK1B 2W5FA 1QNOA 3ULVC 4LUIA 1M6OB 2HRGA 5DHYB 3WFBL 1SXZA 1X1OA 5EY5A 4LSTL 1KJ2A 1V6VA 1RPUA 2PWUA 1KJ2B 4FQPA 3IDUA 4XD4A 1NCAH 4YS1A 4PMEA 2PYFA 3DC0A 3BX7C 5EA0H 2PYFB 5C0IA 4KRUA 5LNVA 2CJSA 5C0IB 4B9YA 3W7PA 2J72A 2ABAA 2CBVA 3CEUA 4PJXE 3BLLA 1PF3A 1VEPA 5H35A 3TYUA 1CB4A 4DWSC 5KS9A 3HC4L 3HHMA 2FZ3A 2O0TA 3MLXH 5H35B 3MI2A 5KS9B 3UTTE 2FZ3B 3LH2L 5DU7A 2BWDA 4TSCL 1CLYH 1QFOA 1A3RH 1G69A 4N87A 4OCSH 3TN0D 1LLOA 3HPAA 4C56E 3VUSA 1SHMA 1KBKA 4MKVA 5EBAA 3P30H 1H3UA 1W72H 1MUWA 1ODZA 1XF0A 3KAAA 3ZGHA 2X0SA 1JUEA 1AG0A 4GYBA 4QOKD 5LGKA 1JQVA 5CEYA 4KWSA 4FJ6A 2VOTA 2APBA 1GZQA 2ZX5A 5CEYB 1LEGB 5D7KE 4A55A 4GAGH 4Z1AA 1GZQB 4LL1A 2A9DA 5FW7A 4I4WA 4L56A 3U2EA 5DFWH 3GUFA 3P3BA 4GLEA 3J07A 4Y9BA 4FK9A 3QORA 3CAKA 3FUNA 4I4WB 1C29A 1TQUA 5B80A 2QQNH 3MUUA 3VKCA 3QORB 1XYCA 3V6OE 1BYBA 1A5CA 1D9KD 1LK2A 4MHHG 3H1ZA 5EEYA 1Z7JA 1LK2B 9XIAA 1IIHA 4HF5L 3WTSA 5GGVH 1AR2A 3ULUF 5DMLA 1V3MA 4UTAL 1X7IA 1MPAL 1S38A 4GZEA 3UW6A 2YLLA 5EO1A 3RDTD 3Q4DA 1KELH 3CZEA 3CWHA 2QBWA 4O4WA 5EO1B 3W01A 3W7JA 1EKOA 2Q20A 3PL6D 2WVSA 4YPJA 3PPCA 3PDGA 4ZUUA 3G6MA 3GSQA 2GC7C 4XMKL 3HR6A 2R4SH 4ZUUB 2XIQA 4FQ1H 4GBXD 3GSQB 1JWUA 3WQPA 4HWBA 4Z7OF 4B95C 5SV4A 4Z7NE 4C8XA 1JWUB 4R90L 4MYPA 1NAMH 5JW3H 1YNLL 1JNLL 1ED3A 1MXGA 3FTZA 5DXYA 2F53D 5D1QA 2ZICA 1ED3B 2XFWA 3GK8H 1YEDA 3GKWH 3IN2A 1JHLH 4X42A 3N18A 2F54E 5AC5A 3LOTA 5D1QB 5JHLA 1YEDB 2EKGA 2O92A 3QNXA 1WDAA 4M61A 3QNXB 1AIFA 4YXGA 2FVMA 4M61B 3TBTA 2WMHA 4E41A 1AIFB 1KCBA 5HPOA 1GMEA 3LV5A 1WA3A 1L6XA 3TBTB 4E41B 5F7LB 1NJJA 1UR2A 3U6XS 5DELA 1WGVA 1SY6H 2P9RA 1MRDH 2XUCA 4FKHA 2BG5A 4K1WA 4GKOA 3TXVA 3VYNA 1NL0L 2EG8A 2BIHA 1CGWA 3FXIC 3TFKD 1W2KT 1AKPA 2BERA 2Z8RA 4Y2DC 3SCVA 3BFQG 1R3KA 1RK5A 3RFZA 4FP8H 3AUOA 4ZQPA 1AAJA 4YTRA 4L1BA 3QI9A 2NUYA 4IH3A 1R3KB 3RFZB 4PCYA 3QI9B 4UR7A 1I8KA 4ERIA 1FWCC 1HKKA 3W1AA 5K4ZA 4WFED 2PLMA 2WCPA 2ZNWA 1I8KB 4H9ZA 2G4FA 7PAZA 2W9MA 3KM8A 2HG5A 2JGYA 2JH2A 3TZFA 4R7OA 4H9XA 1EZVY 3PWUA 3SEPA 1QMUA 2HG5B 1UYWL 4NZJA 1BYDA 4PUNA 4E2DA 3PWUB 3L3DA 4QR7A 1BAGA 2MCPH 3L3DB 4LKXA 4PLJD 1FAIH 1NCCH 2WN3A 3MGOA 3N9KA 2XPZA 4LKXB 3WIHL 3SGKA 3ABKB 2XT1B 3DX1A 4PJ7E 4MASA 4HDIA 5C0AE 3MGOB 3H55A 3G3MA 2WUCL 4A6YA 1Q13A 4HDIB 2VYOA 1U8PA 4KV5E 3SCNA 5DK2A 1L7TH 4S3AA 4X5WA 4A6YB 2WOBA 3QH3A 4QJ4B 2GTWA 1U8PB 5D1XC 5DK2B 4LCWA 4X5WB 2HJPA 3QH3B 3W3BA 5CPMA 2GTWB 2QPXA 4LCWB 2EDNA 2UVEA 4N1CA 1UT9A 2V17L 4GRWE 5JXAH 2RQ8A 4H8WL 4YO0A 4XB8A 4OBRA 1JCXA 3FB7A 3TK7A 4N0FA 3S9IA 1I8LA 4YO0B 3C09C 2MQ3A 3FB7B 3I65A 4YVNA 3PRZA 4HMCA 4RISL 2ESVA 4GNVA 4PJDA 1KMGA 1R46A 4FE9A 5IROC 5B1BB 1OE3A 4R7LA 2ESVB 3NGBB 3CDYA 4PJDB 1SR0A 2VFFA 2V5CA 1WWWX 5EF1A 1MEXL 5AYTA 1ICSA 2HTMA 3M4HA 1IGFH 2YHGA 1KFGA 1SF3A 3CQ0A 2ICSA 2O6DA 3EG9A 3NJHA 4DWDA 3RKDC 1PDZA 5DMIL 1AODA 3EG9B 4RXGA 2CG9X 5EOCL 3GD6A 1EDQA 3LQAH 3D1MC 4DGIH 4L1DA 1AD4A 4N2EA 1S5IL 1KFLA 4WTZA 1J8HA 2IPUG 2IADA 3KPOA 1JV2A 3S2AA 3DJRA 5EEUA 5AYBA 5AKVA 1J8HB 5B22A 4AD0A 2IADB 3TEZA 3KPOB 1CT5A 1JV2B 4IKNA 1UR4A 1DVZA 2H1LM 2DJUA 3A4WA 1G7LA 1BFTA 2QAPA 2A6IA 4I85A 2DM3A 4OD3L 1MCRA 1G7LB 1J8KA 4OECA 4YWGH 3N43F 2A6IB 1XBZA 4P48A 2QQLL 3C2AH 4DEFA 2KDYA 1ISWA 4OGZA 4EVNA 2VC2B 3BSGA 4K8RH 4F7PA 2WXRA 1TPEA 5AAWA 4EVNB 4F7PB 3UAJA 4UNUA 3QXVA 3DUUA 3SYOA 3T71A 1FRBA 1X5XA 3QLLA 5C0QA 3DUUB 4Q9RH 2C9UA 4UTFA 3X3GH 4AMAA 1H0GA 4OFPA 1VLXA 3UYRL 4BIKA 3C2VA 3V6BR 1EBPA 2QV5A 4MBRA 1GGTA 5J8OA 3V7PA 3DFOA 5HXMA 1CE6A 2CLZA 4XNYH 1UR3M 4Y9AA 1SO5A 2PDMA 3FH5A 1CNVA 2DV0A 1BF2A 1CE6B 2CLZB 5BZXA 4TTUA 1YDPA 2A3TA 4YHYC 5IK3A 3QEQE 1YDPB 3NPSB 3NSNA 3TIDA 4H8PA 5IK3B 1WB0A 5GGRA 1EWHA 2P5EE 1FY6A 2AQWA 2IQAA 4DO4A 1R87A 3ARXA 1U30A 2JKAA 3QMRA 3TIDB 1TTJA 5GGRB 3M0MA 4U3XA 3W86A 2IQAB 1KCSL 2UUDH 5GS3A 3FVMA 3VD7A 2ITCA 3ZHDA 3CSYA 3W28A 4LP4A 2H45A 2HJKA 3OAZK 3S2JA 2ITCB 2VMEA 1PGRB 4YLQT 5HYFA 1ZBWA 1IT9L 1SU5A 2HJKB 3F84A 5IVZA 3WKYA 3ARGD 5IBTL 4NJKA 5IVZB 1TT6A 4YZFE 4MY1A 3NH7L 1ME8A 3IRSA 3DVGA 4MJID 4O52A 3KPMA 4R2GD 3GR8A 3DVGB 3KPMB 2AQNA 5I8CA 4KZEL 4QWWC 1UQYA 1GAFL 4AZHA 3AY4A 3P74A 5I8CB 2W5PA 2H4EA 4L65A 2ZNXA 1RI8A 3H7LA 2B9AA 4HCGA 5D2VA 3WDPP 3WN5C 4DKTA 5AW5B 1MJ8H 1FKXA 5D38A 4K3JH 1SMAA 4L9DA 2VLKD 2VVSA 3KJ6L 5T3ZD 2NYYC 3CMJA 1FNSH 3BKMH 2CIIA 5AL8A 2ITFA 3PAOA 4F37K 2CIIB 2P8LA 1GOWA 3QISA 1UCWA 1BWMA 4LVGA 1M7IA 4DERA 2P8LB 5HBBA 2E9GA 1EZ2A 4DZIA 1UCBH 1M7IB 3L5XL 1KB9K 3MCG1 1NKGA 2W95A 3ALWA 1F6FB 4WEEA 3LAFA 1IVLA 4BFKA 1AKJA 1UEMA 3VI4A 5ANHA 3K1DA 3BPOB 4HVBA 4ORGA 1C5DA 3PXHA 1AKJB 4M7TA 4QSFA 5DY2A 3VI4B 2YD9A 4AW4A 2JF6A 1H6TA 3AO0A 4ORGB 1C5DB 5M2FX 4LLUA 2GL5A 1ZBKA 3TJHC 5B1CA 3FRPG 2R83A 3MUGA 4P5TD 4LLUB 3MUGB 3KBHE 2WXKA 2F5AL 1I60A 4IBLT 2YZRA 1CDIA 1PHQA 3SYPA 4HCIA 1GVEA 4FDWA 4AQ1C 1JCKA 3LS4L 2HPIA 2KLSA 2YAQA 1C12A 4XMZA 1OFDA 1Q7MA 3GINA 1GGOA 3Q45A 2X42A 1FV1A 5F8QC 4O0QA 1B3OA 1F13A 4RCXA 1C12B 3SDAC 3A4DA 1HP5A 1FV1B 3AYRA 2JFEX 3NQDA 5CP3A 3FTGA 1DLFL 4Z7WA 4YYCA 3CFEA 1FHDA 4UAOC 2W0LA 4YLWA 4L0YA 3FTGB 4Z7WB 3CFEB 4RV8A 1E6RA 3O2VH 1JZIA 1DDTA 3OQ3B 2Q7AA 1L6YA 4GACA 3GSWA 3WKML 3QUXA 5LA1A 1VYSX 1VZWA 1A9VA 3S5NA 4E0CA 3WK2A 3GSWB 4K7YA 3QUXB 3MRLA 4B91A 3LZRA 2RFGA 3WJYA 3D85D 1DQUA 5IGXH 3MRLB 3F01A 5KUMA 2DM4A 4ROQA 3KLHD 3R4IA 2BOGX 1S2WA 3VOJA 1JYVA 1XLKA 3ETBJ 3ZTCC 1KYDA 2GB2A 2CYGA 5CEZH 1GORA 2F9RA 3ORJA 4K5NA 2X0WA 3T1WA 1TRIA 2PD9A 3V7AE 1ZKAA 4RWYH 4HFUL 2BZNA 4IJCA 3HG3A 3QE5A 1FNGA 2WXLA 1RAKA 3IS4A 4JZJC 1FNGB 2O55A 1O9VA 4BI5A 1OWRM 1XB6A 5HYEA 1A02N 4HUKB 1ZGLA 1G9NL 1DBJH 3RX5A 5FJUA 2ZCHH 3MO7A 4I3GA 1F7BA 2Z1KA 3D2UA 1ZGLB 1ZE3C 4ZB5A 3OIHA 3L4UA 3D2UB 1RJRA 3CVBA 2GHZA 3QC6X 3R13A 1K7XA 1AXSA 3HA0A 1HHJA 1C9SA 3E12A 3VK5A 4O8RA 2DP3A 3A4EA 5KS9E 3O8AA 3RA7L 5CAYB 1AXSB 3FSAA 1HHJB 2EUVA 1IQWH 1D5MA 4MMZA 2LU3A 4U05A 3GAYA 4WZHA 1H2JA 1D5MB 4MMZB 5T3XD 4FX8A 1B9ZA 1C5CH 4Y5VA 3RWCA 3KPSD 3V0UA 1ZIBA 4Y5VB 3IPEA 3RWCB 2VEKA 1DQXA 4QLLA 4JQ1A 3I6LD 4Q6XA 3U4EA 4X8XA 2AJXH 1BZDA 2K7PA 2PBOA 1OYCA 3MY9A 3U4EB 4HEPG 1E6NA 4FXFA 1TJPA 2O5YH 3DURA 2GVLA 1J11A 1F73A 2KZKA 3DURB 3CVHH 4AW7A 25C8H 5CN2A 3B56A 1SW0A 1E56A 3MACH 5JH1A 2PRLA 3QQNA 5HDWA 1MIMH 3F58L 5EEXA 5I6SA 3EYQD 4LCYA 2MCMA 1R3HA 4Z77A 5H1WA 4DAIA 3ZQXA 1PZ1A 4XNXH 4Y8AA 4LCYB 1R3HB 4UTKA 5F93C 4Z77B 1M9HA 2YDQA 4OUIA 4Y9NA 5CJOL 2DEWX 1FWGC 1Q65A 5GGUA 5J11B 5E23A 4NCC1 3MFFA 4FJYA 1PG7H 3N2CA 1R2TA 4MWFA 5GGUB 2ISDA 2HWZL 1WFIA 3FZUC 2IH9A 3MFFB 4O10A 3RVUC 4GK8A 5AHEA 3RHGA 3HA1A 4MWFB 3PTQA 4AEEA 3QOKA 4XNUH 5CLYA 2FPVA 1OGAA 3UP6A 3TAKA 2YRPA 1JPFA 3SDXA 1WHPA 3EKZA 1D5IH 1OGAB 2G5UA 2YZ8A 3F7RA 1JPFB 3QFJA 2CGRH 4E0RA 3MJGX 2WSQA 4B2DA 2X44D 1N64H 1ZVHA 3QFJB 3KS0J 4QG6A 4WEUD 3L2IA 4E0RB 1W3TA 2X1OA 5ADOH 1ORSA 1QP1A 5D1QE 2OMZA 1JXGA 1O5XA 1ORSB 4FYTA 3GRGA 2OMZB 5EFFA 5T1JA 4DIXA 1Z44A 5AAMA 1JTOA 4HZ7A 1R5VA 2PWHA 4P7QA 1UVQA 3OZLA 3BAEL 5HUPA 1CZ8H 1CK0H 5I1DA 2BNRD 4EIUA 5I5IA 1R5VB 4I5XA 4LAQL 1TELA 1F3DJ 1UVQB 4FXGA 3RRQA 4P23C 5I1DB 4E41E 3FYEB 3HW7A 4L4TD 1I9RL 4FXGB 2ZX8A 3DX9A 3CUXA 2VM3A 1KJMA 3UBHA 4US6A 1K1DA 4PUKA 4G8GD 2YA0A 3DX9B 5GRUL 4WLCA 1KJMB 4DP6X 1UQZA 3QQWA 1OX6A 2A73A 1TZ7A 2ADIA 1F1GA 4LDEB 4FHJA 1BVLA 2WJ5A 4M48H 2PTUA 4DSYA 4ILDA 2A73B 3VXUA 1EANA 2AXGA 2ADIB 1BVLB 3MLYL 4Y2NA 4OVUA 3LHZA 5E03A 1XINA 2CHXA 3VXUB 4BZ2A 2Z3FA 2AXGB 3BZDA 2DLFL 5EB8A 4YMPA 5KW9L 1AMYA 2YDAA 4M4PA 4NP4L 3I74A 3VTAA 1NC4D 3RY5A 2F8XC 3VPLA 3TIMA 2X10A 3LMJH 3TV3L 4F57H 3C60A 4BQ8A 1GIGH 2E9BA 3C60B 2GBVA 3EZJB 3KZSA 2OQLA 3FA4A 4PS7A 3CWOX 3WMCA 1S2TA 1C90A 1AZZC 1FQ0A 4BSJA 1EF3A 5K3VA 2D3VA 2OCJA 5DWUH 4MYXA 1NBYA 4PIRF 3S9DB 2UZXA 2D24A 3BXNA 3TN5A 4XZMX 3F2BA 4P5KA 1NBYB 2UZXB 3BXNB 3O4LD 5C55A 2G3JA 3LNIA 5CXPA 4P5KB 1GTEA 3EKGA 4N6EA 4J3UA 1UWAA 4ASTA 3LTYA 4A04A 4F2BA 5JNYA 4O13A 4U4IA 2XZAL 5JNYB 3EOTH 2X7WA 4LCWE 2ZZ4A 1HINL 3IFNL 1OP3H 4MLJA 2V3GA 1OD0A 4HX1A 4YGAB 3W3OA 4WUKL 1WAAA 3I6GA 3R8BB 2VDKH 5AUMA 4KK5C 4HX1B 4PB9H 3I6GB 3TYDA 1E4XH 5AUMB 4QXIA 5DC4B 4ZTOL 4J35A 5A6JA 4IMDA 1KGUA 1Z8AA 2ESVE 3QS3A 3W26A 4PJDE 3IVKA 2AKMA 4NPYA 3WNJA 4QQUA 1VGEH 3GNML 5T9BG 4P9ML 2OP4H 1XKJA 3L7EA 1HZKA 1E4NA 3IVKB 2WZ0A 4NPYB 3QYSA 1OLZA 1YPXA 3TU6A 1BM3H 4LSSL 4ZOCA 1MF2L 3G3LA 3MMUA 3L7EB 1E4WL 5FS5A 1UM5H 2GSMB 3EXTA 1DQWA 5I1JL 1AXTL 1TLMA 4PSPA 4W9CC 4FULA 4RR4A 2GOUA 1ZLSL 4GH1A 1E5JA 4H3DA 4KUCD 5E1GA 4M7LH 2W9EL 3AFBA 1YEGL 5HI3C 5LGYA 1EDYA 3FQYA 1ZAJA 5EU3A 3HVNA 3GO2A 2CITA 4PS8A 4QRNA 1X5LA 1J8HE 3CN3A 5KVEL 2HMID 5M94B 5I1KH 5EU3B 4PCFA 3I6SA 4YDIH 3P5YA 3ONBA 1W80A 1L2UA 1DWJM 2TSBA 4OJFL 4EWND 3HB3D 4S1QH 1RHCA 2VR7A 4IUGA 1N19A 1T5XA 1IFRA 1CYGA 4F7TA 5CIPA 1T5XB 4NZTL 2B08A 4ODVH 1BVOA 4F7TB 3WJZA 2WM0A 1IC4L 5HMEA 1A4LA 1PL9A 5CIPB 3K6FA 2VH5L 4TULH 4DB7A 3OSVA 4TSBL 3OP2A 3POCA 1IBDA 5E2TL 4EIVA 3U9PH 4BQBA 4FYQA 1XFBA 3VRJA 4ZX5A 3AAZA 3LN3A 1SN0A 1U5HA 4PTWA 3UTTD 1KBIA 1EZSA 3VRJB 2PF0A 3AT8A 3AAZB 4N90E 2NY3C 2HBXA 3H24A 1V8HA 2JMRA 2VQTA 4RFOH 4JRXD 4JYEA 2QKFA 4JE0A 4C56D 3CU2A 2EEDA 4HMDA 4R33A 2WO3B 2DZPA 4KWVA 4QT5A 5IHSA 4KTEH 5ACLA 3WCYA 2R29H 1CICD 2Y07L 2J6XA 4QT5B 5EZIL 5DUBA 3VW3H 1JRHL 1SO4A 4FS9A 2WOQA 4JQIA 3SADA 3HE6C 3B3BA 5DUBB 5D7KD 2QSVA 1J2WA 4D9RE 2VWEE 2OELA 3QT2A 4ZPVA 3B43A 3QG6A 3BAJA 4RNRA 4JO1H 1US3A 4DJDD 4OT1H 1N4XL 4Z7IA 2VM4A 3QG6B 4RNRB 4OAWB 5CZXC 1MAMH 5LBSL 4XPBH 5B3NA 4ZUSA 1NF0A 3KRBA 3NZ1A 1GS6X 4XMPL 3KH4A 5F1VA 4NM4H 3NJJA 2BPBA 4ZUSB 2ZWKA 3MRFA 4WNJA 3GJFB 4P46D 4TM9A 2ZOXA 3KBJA 2HDJA 3MRFB 5E9XA 2OR7A 4L5FL 4FNLL 1S9XA 3UPAA 2E28A 2NW2A 3FH8A 3LZPA 3ITTA 1S9XB 5CSSA 2GW5A 5I9QB 2YPVH 2GABA 2NW2B 3IUDA 4H8HA 5MKGA 1HU8A 4NC1E 1HGWA 4NYYA 4LLVA 3SGEI 1NWOA 2DB8A 4Q9QH 1UA3A 1QI5A 1I7RA 5TQ2H 3PJNA 1WKYA 5MKGB 1S5NA 4LLVB 5HD8D 2UWEF 1K85A 2QR0A 3EO1A 3JWOC 1I7RB 3D52A 1KJVA 4B6ZA 2OQYA 3VXRA 2YAHA 2OBGA 1YMHA 3AMCA 2XQ0A 2QR0B 3LZNA 3EO1B 1FHNA 4M03A 4NIKB 3TA3C 3L5AA 1KJVB 2ZAIA 3VXRB 1XM3A 4GW1A 3EWCA 1YMHB 2DY3A 3EKCA 4GW1B 3LVEA 2YUZA 4Y4KA 2D03H 1MCPL 3HMXA 5I1GL 2F54D 4M4RA 5AENA 3LENA 5U7SA 2A6DA 4ZFFA 1KACB 4EKJA 4JDTH 4M4RB 3LUTA 5I76A 4AD1A 2AV7A 5TPWH 2A6DB 2OSLA 4D7PA 4ZFFB 4BQ3A 1P4IH 4ABUA 5I76B 2AV7B 4AZ5A 4DVRH 2OSLB 4ML9A 3DV6A 1MFCH 2BY3A 3VI4E 4HUMB 5MHBA 3BKYH 4KK9D 4RH4A 1GVFA 1FIGL 3DV6B 1ZSHA 2D2JA 5IWLA 4B5UA 5EL1A 2J6EH 5T3ZL 3B06A 2FLRT 2DQGL 1GGIH 2H2SC 4KW2A 1H51A 3NZPA 2LGNA 4UC5A 1DORA 3WLPA 4C7DA 2CRIA 3EH2A 2VKWA 1RZKL 2X2IA 3M0KA 4GXUN 4QS5A 4WO4A 5ISZA 2P5NA 4RAVA 2ZUMA 3B8WA 3QJAA 1D5BA 3CN1A 4WO4B 5ISZB 4LAZA 4RAVB 3RVTC 3VD4A 4AK2A 4E5XG 2F7OA 1YXYA 3DJ9A 3T77A 5CZRA 1PYFA 2Y7LA 3G3DA 3PTDA 1IAOA 3T77B 1VBJA 2B1OA 2Q3XA 1EX5A 2V30A 4Z7WE 4JFZL 3GR4A 4JRFA 2OJPA 1IAOB 3ES6A 5LNWA 1BZ7B 3UPBA 4HXBL 2X41A 3S83A 4LL4A 3ES6B 4KO7A 4YDLB 3G8EA 4FB7A 1KM5A 5KYUA 3OBEA 4OI9A 5LSMA 4ZFGH 2Q5BA 5D2XA 3QTGA 5KYUB 2PURA 5D2NA 3VTMA 3APCA 3ALPA 5D2NB 3PBYA 4GKLA 1AXIB 4CJ1A 3AMGA 3PDDA 4MVAA 5TQLA 1GW9A 2I85A 1S2CA 1SXBA 1FFOA 3GNDA 4DKEH 4N8VG 3SE8L 2NLYA 2FZDA 1VZIA 1FFOB 4A7TA 4D0CA 1NWSA 3ZRFC 4AUYA 4LS0A 4XODA 3TSMA 5A8QA 5E56A 2ZP8A 1UP0A 4FEMA 4WK2B 3UJIL 3LY0A 3ITLA 3B37A 4LB8A 2UY6A 1ECZA 5HYIA 1RCYA 2YXXA 2UY6B 1FA4A 4KQNA 5MI0C 3SY8A 1H0IA 2YGNA 4OGAD 2XWCA 1CZ1A 1TV5A 1IL1B 3HQOA 2GI7A 1LL1A 2VXTL 2ZXWB 2G9HA 4I6KA 5JO5A 3K74B 4Z2IA 3QRBA 3DDGA 2G9HB 2PDIA 4QSHA 5EB9A 4ZTPH 5JO5B 1UD6A 3GDRA 3ITOA 1LO0H 3AQZA 3VFPA 3OKKA 3APGA 3T4AA 3MCKB 2Y7QA 4G8EA 3C0LA 3MCLH 4XE0A 1GOGA 4RGMB 4Y16C 3VFPB 3OKKB 1XG3A 3T4AB 3P0VL 2A4AA 2Y7QB 2PC8A 4G8EB 1FCVA 4PCPA 2XYLA 1QRKA 3MLVL 3WD5L 3SQOH 3LXAA 5CZSA 2A9BA 1PDYA 4NNXA 2DMKA 4BK5A 3OJGA 3CIWA 2J25A 3QUYA 2PTZA 4K36A 5J0BA 4NNXB 2W94A 5CBEA 4JFEA 3QUYB 2Q76A 1V93A 3WSUA 3CLWA 4MF4A 4QRTB 3ESVF 1ILUA 4AG4H 5CBEB 4JFEB 2NY7L 4QR6A 1N26A 2NXYD 2Q76B 2GDQA 1KLUA 3QXTA 3CD4A 43C9B 4GXVH 1KLUB 3V0SA 3VOHA 4G7VL 1KN4L 5T3XL 4HWEH 3DDFA 1ECEA 1OCRB 1XR8A 3BTNA 4FFZL 5BCAA 4WHYG 1Q0YH 2HVBA 4KKXA 2PCXA 3ZXAC 1YEHH 1O7SA 3JWNH 1XR8B 1UM4L 3WFAA 4LFHD 4BFIA 3K4DA 2XIDA 2HT4D 1QRQA 4JBRA 5D4YA 4BFIB 1N10A 4UZUA 3B5TA 1XD0A 1WV2A 1KB5A 3MV11 2F74A 3J8F7 5J12B 3GMLA 1KB5B 2JELL 2VFDA 2F74B 4P8VA 3GMLB 1JUKA 4O50A 3PB0A 3SE4C 3NCBB 1OG0A 2XBZA 2QJNA 1SGKA 5JXEC 3UAFA 2E4FA 2NZLA 2ISSA 1RZJH 1OGAE 1E73M 3SIKA 1JZ8A 2JK5A 4XCFL 2JQZA 4BRVA 1IV8A 3OMNB 4AHPA 3P0YH 5EU6A 3CUHA 2JK5B 4MCZA 1KTLB 2VLJA 4GE8A 5KVDL 3T2PA 3QFJE 5EEVA 1XR2A 1LCOA 2KAUC 5EU6B 2KUTA 3GQYA 3NQ7A 4MCZB 2A6JA 2VLJB 1V54B 3QEQD 4JTGA 1T96A 4XZIA 3WK3A 5GRXG 3A9IA 2P5ED 2A6JB 3TTSA 3LEXA 2J8UF 4LK4A 4W4QA 2XOTA 1BXAA 3LEXB 4M6MH 2J7BA 2G4JA 2OPCA 1OTSD 2VQ1A 2V5LA 3HHRB 2LLEA 3KCJA 1YJDH 4S23A 3FB8A 4IJ3B 2D7MA 3FAWA 2VQ1B 2D31A 1PX3A 4U49A 1CENA 4NG3A 4Y5YC 3FB8B 4MJ6A 5F3HA 1HCVA 1R6VA 1WV7T 2D31B 2R2BA 3AYTA 5FCUL 2G37A 3ZR4A 4WNSA 4MJ6B 5F3HB 3NQMA 4AY7A 3SBWA 3ZVHA 2R2BB 4IGMA 3UY7A 3HPSA 1C16A 3ZVHB 3HFML 3QEGL 1YUKB 4PLKC 4XHQA 3R1ZA 4HZ1A 4HA0A 1Q72L 1C16B 2FQEA 1GPOL 1UW9A 2FJKA 1YQVL 3QCTL 3P54A 1K4HA 3ELAT 3HB9A 1DYZA 1WVZA 3NZRA 4LF2A 3VXUE 3ZIMA 2K3TA 5CR1A 4LT9A 2VN3A 3CSBA 3OC5A 1N7MH 7PCYA 3TCXA 3LN9A 1T04A 1PX8A 3OXRA 4M1DL 3K2UL 5LDUA 3RR1A 4AL8H 2EDHA 1T04B 4IPIA 1RHHA 3O6FA 3OXRB 3DYMA 3OR6A 1ZGLM 1SZEA 3N41B 5T5FL 4XN2A 3SJ3A 1RHHB 3O6FB 3BVTA 3GMPA 3OR6B 3JZEA 1MWAA 3GMPB 3MLUL 3WL1A 1GNXA 4XKYA 1ISYA 1MWAB