1AW1A

Triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHAESDEFVAKKFAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triose-phosphate isomerase (TIM) of the psychrophilic bacterium Vibrio marinus. Kinetic and structural properties.
pubmed doi rcsb
source organism Moritella marina
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
total genus 91
structure length 255
sequence length 255
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1aw1A00
2BSLA 2C13A 3G18A 1UBSA 2HS6A 3QEZA 1PCWA 1XFBA 1XDMA 3B05A 4LVDA 1QPQA 3FJ6A 2I9EA 2FDSA 5DCBA 3A5FA 3MI2A 4JGDA 4UTUA 1AW1A 3C61A 3NPWA 2X1RA 1TPEA 1F73A 1H63A 3FYPA 4CCEA 1N55A 2F84A 3W6YA 3UD6A 3PUOA 4O10A 1TPWA 2AAMA 2WNQA 3FFSA 1JCYA 3G0UA 1Q6OA 2RH9A 5DLCA 1ZENA 3LHWA 4XZ9A 4O0ZA 3UXDA 3W7HA 1PCKA 1KV8A 1QNVA 5DELA 4N9EA 1WXJA 2AGKA 4LVGA 5HJLA 3N2MA 4FO4A 1TPUA 4TR9A 1Z48A 5H91A 1KW1A 1TPC1 1G4PA 5L9FA 1O4UA 3E96A 4PODA 5AHNA 1LBLA 3PG9A 1OX4B 2W79A 2QJIA 3DZ1A 3HBLA 4OV9A 4LY8A 1F6PA 1VHCA 1JCNA 1AG1O 4WUIA 2JGYA 4BK9A 3HGRA 2A6LA 1TSIA 3LX9A 3MP5A 3RFAA 3S1XA 4M19A 1BWKA 3GDMA 1YXYA 3O63A 5D02A 1XBXA 1L6YA 5E1QA 3QPYA 4HKPA 4N9CA 4J9JA 6TIMA 1W37A 2Y7DA 4A21A 1XUZA 4X22A 2ZRYA 4YCOA 1SZNA 4MZ1A 4UTTC 2DZSA 3W83A 1ZCOA 2ALDA 3W75A 1Y0EA 1SFJA 3L67A 4WY0A 3C2OA 1QOQA 3LCWA 4H6KA 1RZMA 2CLFA 5K9CA 1TTQA 1EUAA 1ZAJA 3QRHA 2FJKA 5SWUA 2D73A 2VXNA 2GOUA 1RQBA 2W0UA 5EMUA 4NT0A 1PE1A 1Q3NA 3IIPA 3NQ6A 5CGQA 4YCPA 4K38A 3TSBA 4MY9A 3M5YA 3EXTA 3AO0A 1OF6A 4Q32A 3TNOA 4DO4A 3Q2DA 5FF3A 4UFIA 1W3NA 3W1QA 4JD4A 2ZDRA 3TCEA 1WOBA 2J9YA 3NG3A 3NQ7A 4XBSA 1Z44A 4Z1AA 3EWZA 1GVQA 1RVGA 2YFOA 4OBTA 1WQ5A 3W07A 1A5SA 4ALDA 1SU5A 1GG1A 3W74A 3H54A 1SO3A 3F1QA 4NNCA 3WK1A 3IGSA 5CSSA 4IX0A 4CQ9A 3NGJA 4IPJA 3OVPA 1QWGA 4CCCA 4C1LA 3P5ZA 3QMSA 3R13A 4NJIA 1BKSA 1K7FA 3CPRA 4NNBA 5FEWA 4O4WA 4GRSA 4Z0SA 3LI1A 6ALDA 4JX6A 1FDJA 3SY5A 3P5YA 4NZFA 1LBFA 5C5YA 2Y7FA 4MJZA 2E68A 3UZJA 1GTHA 1TMHA 3SIZA 5HWJA 1IIHA 3EWWA 3MO7A 2NWSA 4QNWA 4Y8FA 5CSRA 1H7NA 3GKFA 4KWVA 3M16A 2ZZ5A 4U4MA 1G4EA 5F2LA 3N73A 3K30A 3MBFA 1KA9F 2FPYA 4GUJA 4L4LA 4N4QA 3BW4A 2V82A 5D33A 1W1ZA 1Z42A 3HOJA 5I3IA 4O0KA 4NJKA 4UFLA 4MYAA 2Z6JA 1L6SA 3TMLA 3STCA 3TK7A 4M6QA 2NUWA 3GDLA 5HUPA 1IXNA 3M6YA 2ABBA 2X1SA 2X1TA 2C6QA 3NVTA 1O5XA 3S8HA 3A24A 4OU1A 3E0IA 1VPXA 2ZRXA 1TRDA 1GJPA 1IIGA 4NJJA 5AFDA 2FLIA 3FJLA 1D3GA 1FWRA 4AB4A 4FF7A 2CU0A 1OFPA 3UYCA 2Y6ZA 2JKEA 1A5AA 1C29A 1YDOA 4POCA 3C4UA 3GDKA 2QCMA 3LLFA 3PR2A 3SR7A 1R47A 3G3MA 1MEIA 4LV9A 1DL3A 2Z2UA 2ZZ4A 3USBA 4OGZA 3GK0A 4QNEA 4WD0A 1JJKA 4MLJA 5CZSA 4D2JA 5HINA 4IXHA 1A50A 2V2HA 1K02A 1TJRA 1CX9A 1I2QA 1R2TA 3LV6A 3P8JA 4LV4A 2JKAA 4ZQCA 5LGZA 3TA6A 4K7VA 2DU2A 2WKJA 3OBKA 1KBJA 4MIMA 4O57A 4HIBA 4EF9A 3MYPA 4HNVA 3TSMA 3RLUA 5I3FA 4E2DA 4JTUA 4K7YA 2VKZG 4RZ4A 5KZDA 4DBEA 5F4XA 2YYTA 2I1OA 1VLWA 2ZBTA 4ZVJA 2QEZA 2ATMA 1G6CA 2NX9A 2J27A 3V1PA 4H4IA 3I7SA 1TV7A 1LM1A 4M6VA 2TSYA 4JNMA 2QF7A 2GQAA 2Y7GA 3MI3A 1NF7A 2ZRUA 3MHFA 1X8FA 1OG0A 4RX0A 5TQLA 3KXQA 5G1TA 1JCLA 3GVGA 5GVJA 2TMDA 1LOSA 1KM2A 2ZTJA 3BG3A 3NEVA 4K37A 2WNNA 1P0KA 2FPTA 3UWUA 4DBDA 2V2CA 2WNZA 2QCCA 3W9ZA 1OVDA 4QAIA 1KM3A 2ZA1A 5DXYA 3DENA 4PTNA 1FUYA 4CQ8A 3NDOA 5AN7A 2NX1A 2QCLA 1KBIA 5AHLA 2V8ZA 2OT0A 1B57A 1FWTA 2WSYA 4A3UA 3NL2A 2E6FA 2VEPA 1I8JA 3R12A 1KM1A 1XDLA 3CT7A 1JRBA 3C56A 1B4KA 1MSSA 4IXXA 1KV5A 1EP3A 2A21A 2EGZA 3UQNA 3P84A 3GZ3A 3SI9A 4WZHA 4JTGA 2WPBA 3QMRA 2DZXA 1VHNA 1H7RA 3W70A 3HMJG 1RPXA 5D2YA 4MPQA 4JR5A 3S1VA 3CQ0A 3QF0A 3OIXA 4AAJA 3M44A 5DY3A 1B3OA 4WQ6A 4TMCA 5I3GA 4O8RA 2C1HA 3SGUA 5KSWA 3BLIA 4LTSA 4KFNA 2A0NA 3LHTA 1A5BA 1EA0A 3LRLA 5C54A 4WX2A 2C3ZA 1Q6LA 4QJ1A 2FIQA 2IQTA 3W72A 5F4WA 4IMEA 3L0GA 2B4GA 1TQXA 3UWQA 5F2GA 5LZLA 1DQWA 2NZLA 4LRTA 4AHQA 4MFDA 1SQ7A 2ZA3A 1W31A 2YZRA 2XN0A 1SR9A 2Y61A 1AMKA 1W56A 1G4SA 1YTDA 5F2MA 2CW6A 1EB3A 1DV7A 1NEYA 2VFFA 1BTMA 4FNRA 1UUOA 3E49A 3C2RA 5KITA 4Q33A 1UJPA 2G5WA 5D03A 1N8FA 4M7SA 4RZ6A 4UR8A 4QIUA 4IPIA 4HNNA 1KM4A 3LOTA 5IBXC 1GPWA 3ABRA 3B06A 3PBVA 2Q8LA 1AW2A 2TRSA 4UCGA 4BWLC 3IIZA 2QCDB 3QSTA 2FPVA 5BRBA 3IIVA 5L6UA 3G1VA 3G24A 3W7CA 1EUNA 1BEUA 1VYRA 3NNTA 4MY1A 4DXVA 5D04C 4RK8A 5LNUA 3DU0A 4CNPA 2A7PA 3WJXA 3SW6A 3IGUA 1QO2A 3TQ0A 4RXGA 2RDUA 3QMTA 3W23A 3L5MA 1FCVA 3W3OA 4FHAA 2GVGA 3GKAA 1XBVA 4PCFA 4LW7A 4W9TA 1TCDA 2YSWA 1G7UA 4FNTA 3W1AA 3KRUA 4AF0A 3EX3A 4UMCA 2NXHA 1M7PA 3NM3A 4O28A 3BGGA 3EWBX 4XKYB 1TTIA 1H7OA 3W85A 3CB8A 5D37A 1T0OA 4BR1A 4HHPA 1JR1A 4K36A 1ZNNA 5BW6A 1XM3A 1GT8A 4UTKA 3NQMA 4JTLA 4M5PA 3AJXA 1UASA 3KHJA 3I68A 3R89A 5HNRA 4WXYA 2NX3A 4UMBA 3KVJA 3DFOA 3QPZA 3S0CA 5T26A 1FXPA 3HGSA 3W1NA 3EXSA 4L4MA 3JRKA 3TUUA 3LHVA 3ABQA 5HMSA 2ZCGA 1H5YA 3BG5A 4NU7A 3L2IA 2YPIA 1QCWA 3RK8A 3W7IA 3LXBA 3EWYA 3BW2A 1VYPX 3QW3A 3O6DA 3OG3A 1A53A 3TW7A 4LNYA 3CIXA 4UXDA 2B7NA 4UTLA 4MZYA 2PE4A 3SFKA 1K03A 3HB9A 4B5NA 3B8DA 3QC3A 4GUGA 3PM6A 1O94A 5CZJA 5CPOA 5FESA 1K8YA 4QSHA 4EWND 1WYIA 3ELFA 1TO3A 3NA8A 4A2SA 4M7TA 3CWOX 4JTIA 5HR7A 2G96A 5BMWA 3EWXA 1SPQA 3JR2A 4TIMA 2C15A 5LNSA 2AQWA 3NZRA 4HN4A 3DFPA 1RQHA 2CZFA 3THAA 3O6CA 3B04A 1VYSX 5I3HA 2ATSA 4JY9A 5E0KA 5A8GA 5EA9A 1ONRA 3IVSA 2H6RA 4UFHA 5EPDA 4FX7A 3QYQA 2ZRZA 4X3ZA 5AB3A 3QZEA 5FI8A 1HL2A 3CHVA 2J9ZA 2C18A 2ZA2A 1JUKA 4IWWA 3GAYA 3DI1A 3FOKA 5D2XA 2QCHA 5G5IA 3EX2A 3C52A 2C19A 2FTPA 3MJYA 1J5TA 1LOQA 3O06A 4UFJA 3TV8A 2LLEA 1I45A 1M5WA 3NYZA 3L21A 4O54A 2E6YA 3WFAA 3NQCA 2E09A 3HGOA 4LRSA 4MUZA 3HG3A 1B9BA 4KFOA 3CEPA 4LVBA 5EBUA 2VFIA 1ICSA 2VFHA 2V0TA 4N2YA 5AHMA 2RHGA 4AXKA 3S1WA 2NV2A 4ZMGA 4UTIA 5BMXA 3MWAA 1H61A 2Q3OA 1QMLA 4MFEA 3G1AA 4MKNA 1NAL1 4O50A 1LZOA 1X1ZA 5D32A 5K7JA 2OX1A 5CZTA 2X30A 3M41A 3I65A 2V30A 2P0OA 3QH2A 2CZDA 5DY2A 4QITA 4TU1A 3TC6A 2ZZ2A 3G8EA 5K4XA 4XUGA 3MYOA 4YMZA 2Y89A 3A21A 3LTYA 3GNNA 2RDTA 3WJSA 4PL1A 5K3VA 3W2LA 3TU9A 5K9XA 3WJYA 4MVAA 4EIVA 5F1VA 2VFGA 5U4NA 4LS1A 3O1NA 2JK2A 3M47A 4YLWA 3W88A 1W5OA 1YTKA 2CZ5A 3EEGA 1JULA 3LXAA 5EL1A 5LNRA 4JICA 3ABOA 3DBPA 3P67A 5IM51 1IXQA 2WQPA 5KMYA 3T78A 1VCVA 1FBAA 3W7JA 5KZEA 4IGHA 3NQDA 3FYOA 3S5ZA 4DF2A 3P62A 1FCQA 2VENA 1FDYA 2C16A 5HQEA 3PULA 3PC0A 4Z0JA 3L66A 1P1XA 3L0NA 2TYSA 3NQ8A 4Q4KA 4FNUA 3W7EA 4BI6A 4JY8A 3WJZA 1VH7A 3SECA 3HIJA 4UMAA 3W1PA 4BFAA 2Q8ZA 3M7WA 4R34A 3OHIA 4GWEA 2J6XA 1DORA 2EF9A 3HG2A 3G8RA 4FIQA 3W2NA 1QPRA 2CLEA 2WSRA 5LNVA 1DJNA 4O18A 1FQ0A 5LSMA 2VELA 4XBKA 2E5CA 3RLVA 3M0ZA 1XUUA 3STEA 3TFXA 4AVFA 1ZFJA 2Z6IA 4N6FA 3ZFHA 1PS9A 2Y85A 3LCFA 3W84A 3NPUA 1JQXA 4R33A 5G2IA 1VCFA 2W6RA 1TTJA 2ZRWA 3NQEA 3TC7A 1W5PA 5DN1A 3DI0A 3PG8A 3NQ2A 3UZ5A 1S5WA 5K9DA 2DORA 2NV1A 4IOTA 4OT7A 4ZQOA 3W2JA 4UTWC 4JEQA 3C0JA 4KFPA 4OE7A 4O15A 4FXSA 1SO6A 5AYZA 1L6WA 4RXFA 1GEQA 2CLHA 2X1UA 3KFTA 3DAQA 4DEFA 3EX4A 4PA8A 4GUFA 5K4ZA 1KTNA 1FY6A 4UTHA 1OFBA 3BVJA 3GR7A 3PB2A 2QAPA 2QDHA 1Q45A 5HWMA 1T96A 4FNSA 1ZAHA 3G1SA 3N3MA 3MMTA 1ZALA 4JXCA 5LKYA 2H3BA 5EY5A 1M7OA 5AHEA 1I2OA 2V2DA 4O52A 1DBTA 4UC5A 3TDFA 5K2ZA 2EKCA 4R7JA 2QR6A 3TX9A 2QCDA 2R14A 3TE9A 3KVLA 1L2UA 3M5VA 3LCXA 3RU6A 1PVNA 3MP4A 4ADTA 3HO8A 4UTJA 3IIXA 5AC8A 3GYEA 4O1BA 2CLLA 3DXIA 1MEHA 3W2MA 3W1TA 2UV8G 2CWNA 4XWUA 1SO5A 2FB3A 3M5XA 3S6DA 3F03K 3LM7A 2BTMA 1H1ZA 4TX9A 1LROA 5AYXA 1EIXA 2NWRA 2CZEA 3L0KA 2ZZ3A 3CM4A 1ICPA 3QQ1A 2GUUA 3G1YA 1IXPA 3IEBA 3VNDA 1BWLA 3LXCA 1DHPA 4RCXA 3GNDA 5FF4A 4RJEA 2Y62A 1AL8A 3W1XA 1OFAA 4JX4A 1VRDA 5DCDA 1HO4A 1IXOA 3C3NA 1ME8A 2ISWA 4K6AA 2TPSA 4DF1A 3Q37A 4HT3A 3ZWTA 4ORMA 3RNDA 4O53A 3TAKA 3GLCA 4BI7A 3P60A 3MW7A 3RMJA 2J24A 2J9XA 4DPPA 4E0CA 3DHFA 1U5JA 1LLWA 4FB7A 4GNJA 3TXZA 3M5ZA 3LGEA 4AF0B 4X2RA 3W73A 3NQGA 3FEMA 3LERA 3UWYA 2DJXA 3IRDA 4MJMA 4AEOA 3CIWA 1EP1A 1ZHAA 1E51A 2ZZ1A 1RQEA 1SZFA 1UUMA 3I7RA 2WO5A 5CG7A 1YADA 1VCGA 3LCLA 4IMCA 2KZHA 2Y63A 1OJXA 1LYXA 2A5HA 2O7QA 1S5VA 4PFMA 5G1YA 5C2XA 4XQ6A 1Q6QA 3HPXA 2DJLA 2ZQ0A 2GVJA 2YR1A 1VC4A 3VE9A 5LNWA 3KVKA 3TSDA 3T4CA 1F6KA 3N19B 2B0MA 5I3KA 2QCFA 4WOQA 2BX7A 5KZMA 2G95A 4G1KA 3NO5A 3DHDA 4NZJA 3R2GA 4LU0A 5D2TA 1PHQA 4WXZA 1PL9A 5IBXA 3BPWA 3STGA 4DQWA 3G0XA 2C0AA 4BWLA 2Z0IA 2OMAA 2PCQA 4LS2A 5ABTA 2ZRVA 4X9SA 2GJNA 4UUIA 2V5LA 2A6NA 2PRMA 1OX4A 3T55A 1WBJA 3MI6A 3W7NA 3DFSA 3L65A 3E9AA 1K8XA 3GXPA 1V7YA 2ZYFA 2CFFA 3HPSA 5G4WA 4DPQA 1TB3A 1KFJA 1GZGA 4JTHA 3KAOA 4GUHA 1GYNA 4WJEA 1CW2A 1GVRA 4ADUA 3QJAA 4XKYA 3W7OA 4Z1BA 1ME9A 3W1LA 1GVFA 1GVOA 1OYBA 4I7WA 3CEUA 1G69A 4RR4A 3RF9A 4O13A 4JDBA 4CLMA 1OYAA 3UWVA 3UWZA 3BLFA 4FEZA 3DFQA 3P80A 3FS2A 2A1YA 2E1DA 2YGYA 1KLZA 5D38A 4FXRA 1OFRA 4JS3A 4RV8A 3PF3A 1OFEA 2X16A 1G7VA 1I2PA 1R30A 4IX2A 3W71A 4IUOA 4S2BA 4ZQMA 2OCZA 3UPBA 3CLMA 4NJHA 1EPXA 1FWWA 1TIMA 1SZGA 1W54A 1FWSA 2GJLA 2GVLA 3NZ1A 5F2IA 4N9BA 2QAFA 4O11A 4NXKA 3I6RA 1G4TA 3H55A 4E38A 1IGSA 5A5WA 3G1DA 1M6JA 2XN1A 1F05A 1K3UA 1V5XA 1PIIA 4NQ1A 4Y9AA 2CLOA 1RV8A 1SO4A 2E6DA 2DZWA 4Z08A 1KFKA 3IV3A 1JVNA 1Z41A 5LHEA 4A22A 3W7DA 4AH7A 3GX9A 3MHUA 2QCEA 3T40A 3BLEA 4JYDA 4LOCA 3UXAA 3QFEA 2QUTA 5G4EA 4NVTA 5F4SA 4MLRA 4HNTA 4NX0A 4ZQRA 1EEPA 1YLVA 3A22A 4K8HA 4OQVA 1TPB1 3OVQA 1EP2A 2JBMA 3NPVA 4UTWA 1SSDA 1SW3A 3IIOA 3N34A 1F76A 1TREA 3CU2A 2NUYA 3VI2A 2B7OA 1H50A 4GXMA 4N6EA 1EWEA 3LCGA 2Z1BA 1K8ZA 4GC4A 1C8VA 3GAKA 4Z1DA 3IVUA 3LTPA 3KOFA 1YDVA 4Z1CA 4HPXA 5HUOA 1RD5A 1EX5A 4EOUA 1H62A 2HS8A 1MEWA 2PRHA 5TIMA 4O1AA 4AWUA 2QJHA 3M43A 1HG3A 2O7SA 1LRNA 1W0MA 3T7VA 4JTJA 3LCHA 3THQA 5HULA 3SGZA 3UPWA 1KM5A 1YXDA 3B4UA 4PC8A 4RKAA 2FFCA 3WK3A 5CKSA 1MO0A 4UNKA 2OJPA 2VEKA 2I14A 4UTTA 3OEXA 4GJ1A 3P8IA 2ABAA 2DZPA 5CPMA 1KLYA 3BW3A 1QOPA 3W86A 3CC1A 4O12A 1LRTA 3VFLA 3L68A 1KTBA 5C55A 3W7MA 3O05A 5HR6A 3JS3A 5DXXA 2WSQA 5HWNA 2VEMA 1MXSA 1SW0A 1JCMP 1DOSA 3I7QA 4AHPA 4UNLA 1F7BA 2DZVA 2NUXA 3DKLA 1LORA 1LCOA 1LLZA 3MP3A 4CCDA 4UIOA 4ICNA 1OX6A 4JDYA 3TH6A 3N9SA 1R2RA 2YFNA 4HNUA 5FF0A 3QM3A 2ZFAA 2CLKA 3LTSA 1QDSA 4FX6M 4LUJA 4AHOA 5I3JA 4IJBA 1X1OA 1DVJA 3NAVA 3WJWA 3NM1A 5AHIA 2YDAA 4GFSA 2GQ9A 2F7FA 4NNAA 1VJIA 3LLDA 1DKWA 2E5BA 3G1XA 1K7EA 2WOQA 3R8RA 3NQFA 1D3HA 1W5QA 1YYAA 3VKJA 3UWWA 1QPNA 4LUIA 3GIYA 4ORIA 3TAOA 1TYGA 5E93A 4MOZA 4UFMA 3T44A 1C9DA 1FXQA 1YTEA 1WV2A 3INPA 4IMFA 4NJGA 2XFWA 2VC6A 2CLIA 4FNPA 3S9YA 4QM1A 1GOXA 1N7KA 5BOOA 1NSJA 1JCJA 1OFDA 5H2ZA 4QQ3A 3U6WA 4GE8A 5CZ0A 2G97A 3KRZA 2B7PA 3DH7A 3Q58A 1FCBA 3S5NA 3LBMA 2A7RA 3P82A 3IGXA 3CTLA 3NXFA 1FX6A 3WK0A 1ADOA 1ICQA 1RR2A 2H8ZA 1LDCA 2BLEA 2A2IA 2C14A 3TQVA 4Y90A 1ZY9A 3QW4B 3PVFA 2BWGA 4ML9A 4MZ8A 3EX1A 3LRKA 4RLIA 5KTLA 2ISSA 1ME7A 1LP6A 2YW3A 1HFBA 3ATZA 3KX6A 3UNDA 4XTDA 4GUIA 4ZZ9A 2GPTA 2JGQA 4M6PA 1R2SA 1HTIA 3VCRA 1F5ZA 3W7LA 1JRCA 3HPZA 3G22A 1WX0A 4NX5A 5LGXA 2OZ0A 3L5LA 3O16A 4LC8A 3ZS4A 1YPFA 3S42A 3ATYA 3A5VA 3SJ3A 3N9RA 4LC6A 2V9DA 4OWGA 2PURA 4PEKA 3NL5A 1WA3A 3WK2A 3TIMA 4AWTA 1F2JA 1XBYA 1KM6A 4XTIA 5AOUA 5G2WA 3BK0A 1P4CA 2B7QA 1TPVA 3M1ZA 3OVRA 3LHZA 4CNNA 1W3TA 1QR7A 1I2RA 1X6UA 3KRSA 4HSOA 5AC6A 1YDNA 1R46A 3EWUA 3GDRA 1TQJA 4N4PA 1GG0A 4UFKA 2XN2A 1SUXA 5FF7A 3C8FA 1XC4A 4NXSA 1DJQA 3GXTA 3O8AA 1GTEA 3C2EA 4S1FA 1H7XA 2YCEA 3STFA 3W1MA 1S5TA 1W5NA 1W8SA 2PRLA 3L9CA 4JTSA 5F1UA 3ZR4A 5AYYA 3NQAA 3BG9A 4I7UA 2FB2A 3SZ8A 3DKJA 4S2CA 3B0UX 3LDVA 2HMCA 2NLIA 2YX0A 3W7QA 3BGJA 1QAPA 4K39A 3LCIA 2RKXA 4IMGA 4P61A 1H1YA 2P10A 3NL3A 3Q94A 4C1KA 3VE7A 4MYXA 3UY8A 3R5EA 4JYEA 4H3DA 4RZ5A 5KINA 4JTKA 3V75A 1XCFA 3NOEA 4FX8A 5BNKA 3EKZA 5TBOA 1H7PA 2V81A 1L9WA 1OYCA 2QCNA 1ZJIA 3PY2A 5AHFA 3TW6A 1J4EA 1IF2A 1NFBA 1U83A 1SZEA 3HGJA 2FQIA 3LV5A 3U2OA 4JN6A 4I9AA 3LB0A 4TMBA 5DBTA 1AL7A 3LI0A 3CWNA 2QKFA 2VFDA 3D0CA 3G1FA 3SSJA 2X2GA 5FEPA 3S5OA 4Y6GA 1TPH1 3FLUA 5FF2A 3S1UA 4FIRA 4BI5A 5CPNA 3G1HA 3P81A 4Y96A 2E77A 3M9YA 1WAUA 2DZUA 1J2WA 1S3HA 3E02A 2QJGA 5DBUA 4JIPA 2HTMA 1ALDA 2R91A 3W2UA 2VFEA 4PL2A 1VZWA 3TXVA 2H8XA 2Q3RA 1O60A 3EX6A 1XL9A 1ML1A 1OX5A 4WY0F 2A7NA 4O1CA 1PHWA 4CNOA 1T8XA 4PH6A 2QCGA 1UCWA 1LTDA 3PBUA 4YL2A 3E12A 3TKFA 4QISA 1OK6A 3PSWA 3HG4A 4KWWA 2H90A 3QQ0A 1H51A 4O4VA 5G2HA 4LWWA 3LBCA 1P5BA 2YXGA 1HUVA 3BARA 3HQ1A 1OFQA 1TV5A 4DO6A 4O1DA 3PS7A 3NR0A 5FEZA 3W22A 4LVAA 2WV8A 4MY8A 5LHFA 4HPJA 3EXRA 1FDZA 3PBYA 1KFEA 3ZWSA 2A85A 1XXXA 3S5YA 1YPIA 3MHGA 3NQVA 4ONVA 3B03A 1WOAA 4A2RA 3F4WA 3FA5A 1TRIA 3PSVA 1GQNA 2ZZ7A 2Y88A 4WY0B 1I2NA 1KFCA 1MZHA 2ZZ6A 1VQTA 3HG5A 1GYLA 1KFBA 1VGAA 2HSAA 2BXVA 3GR8A 5EYWA 2CLMA 3P61A 4N9DA 1CI1A 3HJZA 2JKPA 3UY7A 3BO9A 2ISVA 4GBUA 2VEIA 3PWAA 3DFTA 2VOMA 3P7YA 3GDTA 3MBDA 1LRQA 4KKXA 3C2FA 1H7WA 4JTTA 1OABA 5D2VA 3W7PA 4ZQNA 3PAJA 2P1FA 1G67A 3TJLA 1A5CA 1AW5A 5FEXA 3TFCA 3PUEA 3IVTA 3N2XA 3G0SA 5D05A 4JYFA 3N14A 3L5AA 1TPFA 4JTFA 3LHUA 3W7KA 2PC4A 3W76A 5AC7A 1SSGA 1X7FA 1JQVA 3W1UA 7TIMA 1F74A 1JUEA 4ADSA 3O07A 2YW4A 2J88A 2BZNA 1KTCA 2RFGA 4LVFA 5U7SA 1DQXA 4EVZA 3F4NA 5D2WA 4HSNA 4UTMA 1D9EA 2QDGA 1GWJA 1FCUA 3DGRA 3H53A 4LS0A 1W5MA 1WBHA 3A9IA 3W7RA 5DCEA 4ZL1A 5MHBA 4TO8A 2NXGA 3W2KA 3O6YX 4UR7A 3KVMA 3TMQA 3TR2A 8TIMA 4LT9A 3QSRA 5CPLA 3B0VC 3NL6A 1XBZA 2NXIA 3G3DA 2DZTA 3W1RA 1TTPA 3MUXA 4A29A 4OV4A 4WOZA 2ZTKA 3HF3A 1VS1A 3A23A 4K8EA 3TJXA 1VLIA 1OFOA 4JTEA 2E5DA 1THFD 4CQAA 4U28A 4P2VA 2QUUA 2EPHA 3FKKA 1AK5A 3TQKA 1I4NA 2Y7EA 1YXCA 2E6AA 1QFEA 3U8GA 5D09A 3C6CA 2V5BA 1LBMA 4I7VA 1O95A 1W3IA 1TV8A 1HO1A 4EF8A 4E2BA 3B0PA 2R94A 1JUBA 3ABSA 3GXNA 1XI3A 4O16A 1OHLA 4YWIA 3YPIA 5J5RA 4DELA 3PB0A 5C6MA 3FIGA 4AMAA 2QUVA 4ZQPA 1TJPA 4N02A 3LHYA 1T99A 4FNQA 4O14A 1KFLA 1QPOA 2A4AA 4O19A 3W7GA 1XKYA 1SW7A 3W87A 4JIQA 1NVMA 1SFLA 1K7XA 1P0NA 1KM0A 3EB2A 2YYUA 3P74A 3GB6A 3EKLA 2R8WA 4OHQA 2DP3A 3DFNA 1OK4A 2EAWA 1VR6A 1GVSA 4IQLA 2GQ8A 1JCXA 5D30A 4BF9A 3O15A 1EWDA 4JX5A 5J5DA 1NF0A 4DF0A 1LOLA 4DO5A 2RDWA 3BV4A 3OA3A 1B4EA 1OF8A 1FWNA 3PBWA 4O17A 2WJZA 2EHHA 2OT1A 4NUWA 3ANYA 1UB3A 1Q6RA 3FKRA 3PUDA 1QO5A 4IMDA 1TPDA 1O5KA 1WDWA 3LRMA 4YXGA 2Y70A 1PV8A 3NPXA 1ZAIA 2H3DA 4R53A 3TROA 1H60A 3C2VA 5EKYA 4AWSA
chains in the Genus database with same CATH superfamily
2F6KA 1FWGC 4Y9OA 3G18A 1XDMA 2GVEA 3VFCA 3FJ6A 3URAA 3KTCA 1KBBA 1HJVA 3PTKA 4IJRA 3WUFA 4UTUA 3C61A 4JN8A 1TPEA 3WNNA 3RX3A 1GONA 3LSBA 3WFZA 4I6VA 1VFHA 2YA2A 4IHCA 5BRQA 4O10A 1UR4A 3AXHA 3FFSA 1JCYA 3ZJKA 2WMIB 2RH9A 5DLCA 3CL7A 4CQBA 3ONBA 4O0ZA 5HDRA 1TKKA 1XP3A 3UXDA 1PCKA 3R58A 1QNVA 2OOGA 4N9EA 4LVGA 4TR9A 3BV7A 3UF9A 1G4PA 1O4UA 4I3GA 4DZIA 1OX4B 5E70A 1U30A 2YXXA 1UWAA 2QJIA 3DZ1A 2WNWA 4AZHA 2PMQA 1JCNA 2JGYA 4G2DA 3HGRA 4R5EA 3RO6A 2EG8A 3IJIA 1P0DA 4U3CA 3RFAA 2ZE3A 4UTFA 4M19A 1BWKA 4PUUA 1YXYA 2XWEA 1XBXA 1L6YA 4DUVA 1JYXA 1UR1A 2WB5A 4KCTA 1NWTA 4J3SA 4M6UA 3A12A 4GQ0A 4HMEA 3MO4A 3WMCA 2H9AA 1W37A 4H01A 2Y7DA 1XUZA 4F9JA 4X22A 1JYWA 1ZCOA 2DQXA 4GGBA 3W75A 3QTPA 1SFJA 3GBDA 3L67A 4TUFA 3HV8A 3WENA 2PZ0A 3H24A 1RZMA 3WUBA 3RILA 2CLFA 1TTQA 1EUAA 5DMNA 1R7AA 2D3LA 3QRHA 4W5ZA 2FJKA 3WDHA 2D73A 4B90A 3PZVA 3VGGA 3M0XA 1RQBA 5FJRA 3EOOA 5EMUA 3SGGA 1Q3NA 5T91A 3BJSA 1MQQA 4IPNB 1V93A 2WLYA 5FF3A 3IS4A 2UY2A 4DJEA 4NZ3A 1V6XA 1WDDA 1VPYA 1WOBA 2J9YA 3NG3A 3WEMA 1Z44A 4CEXC 1GVQA 1HL9A 1US2A 5C2GA 2GLKA 4OBTA 2WJDA 1KRAC 1UR8A 3W07A 1A5SA 5A6TC 4LSBA 1MVYA 3F1QA 4NNCA 3IGSA 5CSSA 1EOKA 4CQ9A 5CC6A 3CZLA 3WX7A 1L6FA 1ISWA 5D9PA 1QWGA 3T0AA 1LG2A 1Q66A 1ITUA 4KRTA 3UYIA 3AC0A 1GQIA 3S9ZA 4HA0A 3ZXWA 1J0ZA 1POJA 3R11A 4Z0SA 2YDRA 3E0FA 3I10A 6ALDA 3ZJ8A 1FDJA 3P5YA 1L0PA 1J6OA 1CNVA 1EH9A 5C5YA 4HNLA 3S2CA 1XLCA 2W9MA 3FGCB 3N17A 2NSOA 3CYVA 5DFAA 1Q5MA 2DQWA 2GYIA 2PDPA 2NWSA 3OIHA 3WLPA 1G4EA 3MBFA 2FPYA 1O1ZA 3GVVA 2V82A 3CL8A 1EDGA 3W01A 1UWTA 1W1ZA 2BY3A 3VKAA 3VKKA 5A2BA 1JPMA 1U2YA 4NJKA 1DHKA 5LYRA 1R3VA 3ARWA 4WKAA 5KEZA 3UZXA 3LY0A 3M6YA 1CXEA 2C6QA 3NVTA 1O5XA 5C9ZA 3A24A 3N11A 1KCXA 2D69A 1NP0A 4ROQA 1W1B1 5HMEA 4Y9MA 4ZEPA 5AFDA 1K9FA 2TODA 2BV9A 4HZMA 4L4PA 4FF7A 3K13A 3UYCA 3T4WA 3CJPA 2PDYA 1NQ6A 2ZVIA 3PJUA 3DHPA 3G6LA 1TWIA 1ELSA 2PDHA 2Z2UA 3USBA 4OGZA 1P6CA 3GK0A 4WD0A 2QJNA 4LUSA 4B15A 4MLJA 1J5SA 2P0IA 4KERA 3GSMA 1K02A 1CX9A 2J47A 2IKIA 4PB3A 4DJFA 4LV4A 1XLDA 3H2EA 2BNJA 2JKAA 1HN1A 3VM5A 4E2DA 4GI4A 2RGMA 4RZ4A 5D8WA 3V1PA 4H4IA 1E9IA 3I7SA 1MMFA 1LM1A 2UY3A 2QF7A 1NF7A 2ZRUA 3AHXA 3ISIX 4JFUA 4ROPA 3OBAA 4RX0A 5GVJA 2OEKA 2TMDA 3GH7A 5ENLA 3BG3A 1ZBVA 1P0KA 2WNNA 3UWUA 1JZ2A 2QCCA 4QEEA 4QAIA 1KM3A 3CV7A 3O3RA 1QK2A 2V5KA 5C0QA 1FUYA 3NDOA 1LG1A 5AN7A 2V5JA 1KBIA 3KLKA 3EDFA 1FOBA 1KGWA 1FWAC 4G8TA 4H7VA 4INFA 1B57A 3AS3A 2XGBA 2VEPA 3AAMA 3BAIA 1GVYA 5EFDA 2XSBA 3VIHA 5HJYA 1JRBA 2XDFA 4ACZA 2EGZA 1FWEC 4F0MA 3SI9A 3QMRA 1NDVA 3KS5A 4AWEA 3HMJG 3PUGA 2D2HA 5G1MA 1RPXA 1HKJA 4LYPA 1RLDA 1E6SM 4W86A 3GXDA 1JDAA 3SGUA 3RX2A 3M0LA 4LTSA 4C6OA 1C92A 3AXMA 1A5BA 1YE4A 4JPGA 1EA0A 1MRAA 4B5TA 4QJ1A 2FIQA 2IQTA 4PULA 1RALA 4JQ4A 1V6WA 1GUVA 1QW7A 1PAMA 1AQHA 2ZA3A 2R1NA 5H1WA 2XN0A 1LJYA 5ABFB 1R3WA 4FF5A 5F2MA 3UFYA 4DNHA 1DV7A 4B4FA 2VFFA 1UUOA 3A3XA 4Q33A 5CLTA 1N8FA 3KDNA 2PWUA 3CUZA 4ZO7A 1RH9A 1CB7B 1TX2A 4ZE4A 3AIBA 3GG7A 5A6LA 1KM4A 4F0HA 3ABXA 3ABRA 3ABZA 4QE5A 1MQRA 2Q8LA 1XYAA 1FHUA 4BWLC 3IIZA 2OYLA 1DWJM 3CUXA 3GS6A 2GJPA 5BRBA 3UR7A 4DAFA 4D1JA 3G1VA 4NF7A 3G24A 3W7CA 1JIBA 2ZX5A 3FCPA 3REQA 4MDOA 2CHOA 1ONEA 3TTEA 5LNUA 2UBPC 3WQWA 1NFGA 2XH7A 1IQ8A 3IGUA 3NXLA 2PTZA 1PX4A 3GHTA 3TQ0A 3LK6A 3W3OA 3H4GA 3T09A 4ACYA 3Q4DA 4W9TA 1TCDA 1G7UA 1P6BA 4PTXA 4UMCA 4RPQA 3RG6A 4ZODA 1AD4A 4DJEC 1SM9A 1H7OA 3VOCA 3W85A 3CB8A 3EMZA 4Y7EA 3VCCA 3FDGA 2AL2B 1GW9A 1JR1A 5I3DA 4K36A 3CL6A 4BY3A 5CGMA 5AZ1A 1R9XA 2P50A 1GT8A 4YYCA 4UTKA 4IL2A 1VKFA 4JTLA 3FJNA 3R94A 3XISA 3R89A 4OBSA 4TTUA 3WF0A 2O56A 1EF2A 4UMBA 1S1PA 3KVJA 3DFOA 1E5NA 3QPZA 3M0IA 4ZOAA 3N15A 5T26A 3HGSA 3L12A 3BG5A 4NU7A 2YA1A 3L2IA 3HTWA 3NQBA 3P0XA 4GNVA 3LXBA 3RN6A 3O6DA 1KWGA 1A53A 3TW7A 4LNYA 1DJIA 4DWSD 4UTLA 4B5NA 3BUVA 4RNJA 4A3HA 3LMZA 3PBGA 3ENLA 3TOYA 5CAKA 5AZ0A 1VIZA 3ELFA 4H00A 2GGJA 4ACZB 2NSXA 3TTSA 1D8CA 1B30A 4JTIA 2BVYA 4LFYA 5BMWA 4F9DA 3NO1A 1I0DA 1RK6A 1TZZA 3VGDA 4L6OA 3AHZA 4HN4A 1I0BA 2I56A 1M03A 4AD3A 4H1ZA 1XGEA 2FMNA 1ONRA 2GGHA 4LEFA 4UFHA 1PYFA 5IFTA 5EPDA 1E6PA 2GFTA 2HISA 5AB3A 5FI8A 1HL2A 4AXNA 3ZYZA 2ZA2A 4E3VA 5HMFA 2PS2A 5G5IA 5C71A 2XU2A 3AS2A 3SN1A 1LOQA 3TV8A 1CYGA 3VIFA 2E6YA 1MI3A 2D2OA 3GNPA 3SCSA 3HG3A 4KFOA 3LQLA 4DB7A 1XYCA 4LVBA 1MXGA 1Q6EA 4PMOA 2VFHA 4UQCA 2RHGA 4WDTA 3HQPA 4YU1A 4S3JA 5CBJA 4MNMA 3MA8A 1QI4A 3MWAA 1RVKA 3U2CA 1HGYA 1EDQA 2VX5A 5M17A 1OD8A 3G1AA 1NAL1 1X1ZA 5D32A 4X0NA 3D46A 3M41A 1AMYA 2EJ1A 2PDJA 1OBAA 4U2ZA 5F7UA 2ZX8A 1HJUA 2FHBA 2QS8A 4HHHA 2Y89A 2J7GA 1Y5WA 3A21A 1Z32X 5E0CA 1GOIA 2RDTA 2NT1A 3WJSA 4PL1A 1H0IA 1KQZA 4MVAA 3GUGA 3SUTA 4IISA 5U4NA 3SRHA 4LS1A 2JK2A 1O6IA 4PE8A 2CZ5A 3EEGA 3SQMA 1Q4WA 2VEGA 5LNRA 4RNIA 1FHDA 3NURA 2FZNA 5CC3A 3E0WA 3W7JA 1JZ6A 3S5ZA 5I06A 4AY1A 2C16A 5HQEA 3HMCA 4Z0JA 4EWJA 3L0NA 4HK5A 3WMSA 2TYSA 3NEHA 3NQ8A 4EXQA 5BYWA 4Q4KA 4CGTA 4IFRA 3BLPX 3WJZA 2WM1A 4HU8A 3SECA 3GUWA 2QDEA 3M7WA 2OSYA 3OHIA 2J6XA 3WLMA 2DVXA 1OCQA 3W2NA 5IRPA 2QVHA 2WSRA 1FQ0A 3ITLA 1JNEA 4B9ZA 4IP7A 2E5CA 1DTUA 3RLVA 1XUUA 2VD9A 4AVFA 1ZFJA 3WLNA 4N6FA 3ZFHA 3UXLA 1JPHA 4KMQA 5IDIA 5G2IA 1VCFA 3LD5A 3APGA 2W63A 2O55A 3DOPA 5CH9A 2Z1XA 3F2BA 1W5PA 4QXIA 5DN1A 1V0LA 3NQ2A 4OFCA 1TG7A 1Z6KA 3ARTA 3AHYA 2DORA 2W67A 1R3SA 3ARYA 1WUFA 3WF4A 3HA1A 4DAIA 4JTQA 4LUSB 2OU4A 1L6WA 1GEQA 2J13A 1I60A 3KFTA 2WSPA 4PA8A 3SUVA 1KTNA 3GR7A 3PB2A 3TN3A 1T96A 3N3MA 1ZALA 3KWSA 3QY7A 3EA3A 5IHRA 3V36A 5EY5A 4IGNA 3TVAA 1BXBA 2V2DA 3AMCA 2HPMA 3L4YA 3ARQA 4R3UA 3TX9A 3VDAA 4JFSA 3RU6A 3HO8A 1WDRA 1UQYA 1PZ3A 2CWNA 1WE5A 3M5XA 2J62A 3LM7A 4EE9A 2BTMA 1MYRA 1QHPA 1UROA 3K46A 3CM4A 1ICPA 2Z25A 4NRSA 4ECLA 2F6XA 4A4AA 1AJ0A 1CECA 1G1YA 1AL8A 2O4QA 3DIPA 2AGTA 3KWXA 3BSMA 3C3NA 2DFAA 3BWWA 1ME8A 2TPSA 1IV8A 4DF1A 3VD9A 4NKCA 1E3ZA 4NAEA 2NQHA 3Q37A 1A4LA 1K6WA 1MQPA 4AY7A 4BI7A 2ZX6A 3MW7A 2WANA 2J24A 3BQ5A 2NVDA 4DPPA 4E0CA 3DHFA 1C7SA 2VD8A 1U5JA 4L6HA 2W27A 2ON3A 4GNJA 1E70M 3MZNA 1RXOB 3M5ZA 3ES7A 4AF0B 1WZMA 3PN8A 3ITOA 2D23A 3CUJA 1E4MM 1AQMA 2ZZ1A 1RQEA 2QPUA 3G77A 3AI0A 2WO5A 4WJ8A 5CG7A 3U57A 3XINA 4IICA 4AZ5A 1IR2A 3VKDA 3VZYA 1K9TA 1E4IA 1LYXA 1SJBA 4MGGA 3BMXA 4LBRA 4P7RA 1OCNA 2WW5A 2PDMA 3W6MA 3W81A 2ZQ0A 2GVJA 2YR1A 1K1DA 2L5HA 2VOTA 1UWRA 3WZ0E 1ZB5A 1K8CA 4OUEA 3N19B 4GH1A 4E6MA 2X0HA 2DDXA 1KXHA 5KZMA 1BRLA 4RW3A 1UUQA 2ZUUA 1YBQA 3WQCA 1E0TA 3EOEA 3SCPA 4LU0A 4EANA 3STGA 1PL9A 4M24A 1CZ1A 3MANA 4DQWA 3N04A 1H09A 1RAKA 1EEXA 2C0AA 3RCYA 1AFSA 1HF6A 2Z0IA 1PXGA 3TYEA 5ABTA 3KE0A 2GJNA 3ITYA 4UUIA 2V5LA 3MI6A 3E9AA 1HX0A 2E8YA 2CFFA 4K2SA 4IM4A 1TB3A 1KFJA 1UWIA 4XVEA 4ZE5A 3QKZA 2R9RA 3SDOA 3UERA 4EXBA 3W7OA 1ME9A 4Z2LA 4I7WA 3CEUA 2GUYA 4RR4A 3UWZA 3A9BA 2ZC8A 3P80A 1DWFM 5AY7A 3M0YA 3FA4A 2QJJA 1KLZA 1QW9A 1LL7A 2FZ8A 3VGBA 4O0QA 5CBBA 1OFEA 4XX6A 4F2BA 1FP8A 1G7VA 2MANA 5CGTA 3VMPA 1TIMA 1SZGA 3O9NA 2GOKA 1J12A 1H2JA 2QAFA 4C6KA 4PUEA 4XSMA 1IGSA 4XO6A 2BG5A 1M6JA 1OG6A 2XN1A 1K3UA 3DHUA 2E6DA 1NDYA 3SN0A 4C6CA 5A6SA 1TVNA 1U33A 1SGJA 3T40A 2J25A 3BLEA 4JYDA 3MUIA 3RM8A 1SYTA 1M41A 3C5QA 3EA2A 4HJWA 5F4SA 3UT0A 4MLRA 5H8MA 4NX0A 3OQ8A 2BOFX 1EEPA 4MB4A 2A3BA 5LIXX 2EPMX 2WVVA 1F3XA 3I4KA 1SW3A 2VZOA 3IIOA 1OIFA 1TREA 3FYYA 3CU2A 3KS6A 2JIWA 3IUDA 2B7OA 4N6EA 2PF0A 1EKOA 4U5IA 3ITGA 3MSDA 4Z1DA 1JF5A 2DSWA 1CGWA 1CTNA 3VKCA 3KOFA 3WQ5A 1MXDA 4OVXA 4CN6A 3OZPA 4BHYA 2HS8A 3BC9A 4JHOA 2EG6A 2QJHA 2O7SA 4GCXA 4JTJA 4LCRA 4DI9A 4P7NA 2I17A 3SGZA 1CLKA 1KM5A 4PC8A 2BP1A 1EJVC 2J7DA 1WDSA 5CKSA 2VEKA 2HRWA 2I14A 3P8IA 4JKKA 2DZPA 1IE7C 1G5AA 2VDIA 5CPMA 1KLYA 3CHFA 3AZSA 4GIYA 1EQPA 1XLJA 2YL5A 1QOPA 5HA7A 4AX7A 5A95A 3H2FA 3H22A 4O12A 5C55A 3KP0A 4U31A 3OZYA 1TV3A 3BMWA 1SW0A 1DE5A 3I7QA 4UNLA 3BAJA 1LCOA 1LLZA 3MP3A 4CCDA 3SAZA 1EDTA 4Q3MA 2WC3A 1V8EA 2IKHA 4GC3A 3ARUA 1PBGA 4H9VA 4AZ7A 1E43A 4QS5A 2VWTA 2WJEA 1X1OA 3CGTA 4LANA 4LB4A 3URQA 2YDAA 3M7SA 1DKWA 3M6DA 3G1XA 5HPCA 2WOQA 3UPMA 1X1NA 3ZLGA 5HOSA 1PIFA 3M64A 2VI0A 1O5QA 1TYGA 2Y5JA 1JD7A 1YTEA 1N8WA 4CEUC 2VR4A 4FNPA 3RMEA 1OFDA 3TP4A 9XIAA 1MUWA 4ICMA 4GJJA 2VVNA 3LBMA 3P82A 3IGXA 3S2JA 1A4MA 1BYBA 5MKGB 1PEZA 4DUOA 3H4XA 3K4AA 3LGGA 2E25A 3LA4A 4LYRA 1JD9A 3GW0A 2X1IA 1NP2A 1W9XA 3GG8A 3JU2A 1T8QA 4IFOA 4G56A 4M56A 1LDCA 4UQEA 2BLEA 2A2IA 2C14A 2X0SA 1U5HA 1ZSXA 3LRKA 3GVQA 1ME7A 3SY1A 3KX6A 4Q8VA 1MUMA 3MCMA 2YIHA 4NZ5A 1CENA 3ZJ7A 1F5ZA 3W7LA 3ZMRA 3HPZA 4W88A 3G22A 1YMYA 1JGIA 1TIWA 3L5LA 3O16A 3ZS4A 1XH2A 2XM1A 3S42A 4CD6A 1W3LA 3ATYA 3N9RA 3QBUA 4OWGA 1R7OA 4IIFA 1XLLA 5M3WA 2Z1WA 3WLQA 1JL8A 5A94A 5A8NA 3KEHA 1PUDA 4XISA 3BK0A 1P4CA 3BAYA 1US3A 1TPVA 1J0YA 3M1ZA 1ONXA 3VXGA 3CZJA 1D7FA 1I2RA 1X6UA 5AC6A 3VIOA 1R46A 1PDZA 2D20A 4B4HA 6TAAA 4UFKA 3E6EA 1CXFA 3A4JA 4JCLA 3C8FA 1XC4A 2CNCA 3GXTA 1BVNP 4YNGA 4S1FA 1H7XA 3SCOA 4JTSA 4F0LA 4WHBA 4XZHA 2R6OA 2FB2A 3SZ8A 3DKJA 4YS1A 4PMYA 2QVNA 1VRXA 3LCIA 1NU5A 1LUCB 2P10A 3NL3A 3PPGA 4C1KA 2BHUA 1UD5A 3UY8A 5KINA 4JTKA 1LWJA 5BNKA 4FX8A 3EKZA 5TBOA 4CVUA 2V81A 3DX5A 1L9WA 1OYCA 2QCNA 3N2BA 4HU3A 5AHFA 3TW6A 1J4EA 4BQ2A 1IF2A 1SZEA 3HGJA 3IK2A 1V02E 2RUSA 3CWNA 4Q8PA 3UW6A 5IHSA 1TE1A 1U22A 4MB1A 2I5IA 3S5OA 2OO0A 5CPNA 4AQLA 2DZUA 5FJJA 1J2WA 1S3HA 5JVLA 1E40A 2QDDA 4PRRA 3PNZA 4PL2A 3TXVA 3ZSTA 1J01A 3OG2A 3GU2A 4KCUA 4P7LA 3VIKA 2D22A 1XL9A 3KBSA 3VX1A 1P1MA 2VX6A 2QCGA 4J3WA 1OK6A 1UR3M 2YBVA 2PA6A 3CO4A 1BPLB 3QQ0A 3CV6A 3HQ1A 4DO6A 3OGSA 3UEQA 5LHFA 4JHZA 3DGBA 5DQPA 4IPPA 3PZGA 1IHIA 4LX4A 2H9AB 3PBYA 3MDWA 2A85A 1XXXA 3MHGA 2WMKA 1MUCA 3ME3A 5EMKA 3E74A 3S6TA 4B3LA 3WQ8A 2GK1B 1R86A 1WB0A 2EO7A 2QQ6A 3AXXA 3HG5A 1J18A 2ZXQA 3B8WA 1KFBA 3PFMA 3EKGA 1HXJA 2BXVA 3GR8A 5EYWA 4N9DA 2JKPA 3K1DA 5GNYA 3UY7A 1PZ1A 2YL9A 2VEIA 2A3CA 4AIBA 3VUPA 2VOMA 3GDTA 3VOHA 3CV2A 3C2FA 1H7WA 3GC4A 1EIBA 2Q09A 3USZA 5BOEA 4DLFA 1JPDX 1A5CA 1AW5A 1UH2A 1M9HA 3N2XA 3G0SA 1ZS2A 2FDMA 1POKA 3W82A 3N14A 3LENA 3NYDA 2OG9A 4UZUA 1SSGA 4NZCA 3Q45A 4F3HA 1V6VA 1OIMA 4DZ5A 3T2OA 1JUEA 2G0WA 4H9YA 3I3BA 5IOBA 2PLJA 1DQXA 5I02A 4DYKA 4Z1YA 4H9TA 1FCUA 3DGRA 1J0HA 3VNZA 1W3KA 3H53A 3U3HA 3LMYA 2Z7KA 3KBVA 2PWFA 2NXGA 5DRCA 3W2KA 2PGFA 4UR7A 3B9DA 4AW7A 2W4XA 3TMQA 8TIMA 2ZVRA 4R9XA 5A8OA 4QLKA 1F4HA 3NDZA 2QIIA 3N6QA 1GKPA 1TTPA 4OV4A 2CWXA 2ZTKA 3HF3A 4WOZA 3WLOA 4CD5A 2DT2A 4JTEA 2E5DA 3OP2A 4KWSA 2QUUA 4ZO8A 3GC2A 3TQKA 3R79A 5D09A 2ZOXA 3THCA 4I7VA 3GFXA 1CXKA 2R94A 4YYFA 1IZJA 1B54A 3OZMA 1OHLA 4KH2A 4YWIA 3QLDA 5CJNA 1FWDC 2EG7A 1BQCA 1KXTA 1Q2SA 1QOXA 1VENA 2QUVA 1XW8A 1T99A 4FNQA 1KFLA 1C7TA 2A4AA 3W7GA 1XKYA 4CQDA 3ZJ6A 3CAQA 2DP3A 4DWSC 4FI4A 2Y8UA 1DQUA 2JE8A 2GQ8A 2FH6A 1K6AA 4BF9A 4K1GA 3O15A 4JX5A 5J5DA 3LS9A 5FSEC 4DO5A 3LQGA 1B4EA 1OF8A 2DVUA 1FWNA 3NUKA 1VBUA 2WJZA 4JFTA 4AD5A 5DRIA 1UB3A 3OTRA 2JQXA 4C6IA 4IMDA 1XH0A 4ENLA 4R88A 2GWNA 3ZT5A 1XFCA 2CZVA 2JF6A 4V2XA 1LL4A 1FRBA 3NPXA 4XD4A 1H60A 5JH2A 4PTWA 2C13A 4H6EA 4H9MA 2IKJA 4YTUA 3B05A 4LVDA 1TA3B 1QPQA 2I9EA 5GJMA 3A5FA 4DO7A 1T5AA 3KZPA 3WCZA 4NP7A 1R9ZA 1XD1A 1N55A 5GNXA 4Q4QA 1FHLA 3DCPA 4D8AA 4I5RA 4LQ1A 2UWFA 3GG0A 3VA8A 3LHWA 4XZ9A 3W7HA 3H7RA 1KV8A 1J11A 2OODA 1RJRA 3N2MA 4FO4A 1TPUA 3TN6A 5H91A 1Z48A 1VFFA 4AD2A 1PX3A 5FJTA 5AHNA 4PODA 1LBLA 3GY1A 3UA4A 3PG9A 2WCAA 4OV9A 3RJYA 1W1YA 1F6PA 4UQ9A 1CLXA 1VFSA 1VHCA 5DF0A 1AG1O 4WUIA 4H19A 2A6LA 1TSIA 3S46A 3CMGA 3MP5A 1HZYA 2PD9A 2C8NA 4ZA0A 5D02A 3QLLA 5E1QA 2Y8KA 3VKBA 4HKPA 4N9CA 2YBUA 4J9JA 2PDXA 2NQ9A 3HFYA 3U7VA 2HV5A 4GK8A 4FMVA 5LXEA 2ZRYA 4YCOA 4MZ1A 4ZSTA 1CBGA 2DZSA 3W83A 2ALDA 1Y0EA 4JEJA 3BCJA 2DSUA 3LCWA 3E2RA 1ONWA 2PDUA 5K9CA 4HZ8A 1PZ0A 2AOSA 3EDEA 3OO2A 2EEXA 5MKGA 3S9IA 1W1TA 2CPUA 3ZLHA 4F79A 2W0UA 4GD0A 4NT0A 4MWAD 5CGQA 1XRSA 3OBEA 4FXJA 4RNHA 4Q6JA 3AO0A 4WR3A 3WO8A 3VDHA 1V6YA 2DT0A 2Z2BA 3Q2DA 4EAYA 2PFHA 3O7UA 4A3RA 3TCEA 4XBSA 4G9PA 4Z1AA 3EWZA 4LH8A 3FAWA 3VIJA 2PB1A 2YFOA 4QRNA 4ZOBA 4MHBA 4ALDA 1R3QA 1SU5A 3W74A 4PCTA 2PBOA 1AJZA 4IX0A 2DGAA 3LBOA 3OVPA 2OWCA 3H8AA 1H11A 4C1LA 4W93A 3QMSA 3N2TA 3R13A 1BKSA 4C1NA 3SJNA 3EWCA 4CQCA 1ZU8A 1LT7A 5FEWA 2ZIDA 2V3EA 3LI1A 4Q4RA 1TVPA 5ECUA 1LBFA 3NDYA 5A8MA 3CZKA 3QR1A 2AL2A 2I5GA 1GTHA 5A8QA 3EWWA 3QVQA 5CSYA 3IGHX 1PKMA 4QNWA 4Y8FA 2AAAA 3GKFA 4KWVA 4DI8A 5I79A 3K30A 4GUJA 4N4QA 3BW4A 3ZVIA 3U4AA 5I3IA 4LBUA 3HV9A 2J77A 3FX4A 2CBJA 2Z6JA 3UZYA 1EHAA 3TMLA 3STCA 4Z2IA 1J2BA 2X1SA 2PP1A 4AZ6A 5FL1A 1XYZA 4ZB0A 1S2VA 1XGDA 1Q7QA 1XRVA 2CKSA 2JEQA 4D9PA 3FJLA 3P3BA 3RR1A 1FWRA 2CU0A 1BVWA 1A5LC 3PWIA 3REQB 1C29A 1YDOA 1FWCC 4S38A 4L1XA 1KRMA 3GDKA 2QCMA 3LLFA 3M46A 3PR2A 3XIMA 3G3MA 4LV9A 4AX6A 1DL3A 2QULA 1OCJA 2G4JA 4DZHA 4MJ4A 1JJKA 3O0KA 5JMUA 2PU1A 2V2HA 1JI2A 1I2QA 1YNYA 5I6SA 3JW7A 2DU2A 3KL0A 4E8DA 1B90A 1E6ZA 1D7KA 3RLUA 5A69A 5KZDA 4ZVJA 5F4XA 2I1OA 1VLWA 2QEZA 3WF3A 3L7RA 4L7ZA 4K8GA 1CCWB 1OGSA 1Z3NA 2GQAA 3MHFA 3DECA 3UG4A 1X8FA 4BF7A 4XZIA 1OG0A 4MWAA 4A3QA 2IPJA 4GX9A 5G1TA 3UA3A 1LOSA 1VFLA 3NEVA 4GA8A 1VEOA 3BOLA 4Z2KA 2V2CA 1PDYA 3W9ZA 4E4UA 3PZ9A 3N6HA 1HJWA 3DENA 4PTNA 3EYPA 4B92A 1R3RA 2W91A 4BCEA 1OGBA 5J04A 2OT0A 4A3UA 3NL2A 1I8JA 1JDEA 3R12A 1KM1A 1H3GA 4NZ4A 3C56A 1MSSA 1RA0A 4CN1A 1KV5A 4U3AA 4HMCA 5CZKA 2A21A 3UQNA 4WZHA 4JTGA 4RDWA 1ECQA 4R7OA 2PDWA 1H7RA 4KF1A 4DM2A 3OA5A 3MU7A 3S1VA 3QF0A 1B3OA 2XH4A 3A3WA 5CAHA 2NLYA 3EEZA 1HKMA 3ANUA 5KSWA 1B3WA 2J78A 3IANA 3VNYA 5D4YA 4YHGA 1TWWA 1RPKA 3AJ7A 5CQ1A 1Q6LA 5F4WA 4IMEA 3L0GA 5LZLA 3P6LA 1T41A 2NZLA 3NCOA 5T9CE 1VEPA 4AHQA 4J27A 2C1IA 3N4AA 3LEPA 2YZRA 3WELA 4KGJA 1IWPA 2ZWZA 2Z00A 1YTDA 3QOKA 1WKDA 1FFRA 4FNRA 1RCXB 3BE7A 4QP0A 1RP9A 3AYTA 4X60A 2ESCA 2R1PA 3ARSA 1KKRA 1VJSA 4ZR8A 4M7SA 4RZ6A 4IPIA 4WGXA 3H26A 4W89A 3PBVA 1L2QA 3FJ4A 3VNMA 3T1GA 4AUBA 2TRSA 1H1NA 3EB4A 3OPSA 4CU7A 1Q7ZA 3DG3A 3CUGA 4GQGA 3C0LA 4Q4MA 3KW3A 3TJ4A 5L6UA 3I6EA 1EGZA 4HJFA 1BEUA 2Y4SA 4DXVA 2VCAA 4CNPA 2A7PA 2E40A 1PIGA 1QO2A 3W23A 4FR1A 3ITVA 3FV9A 2G3IA 1K9DA 3QFWA 2XZ7A 4UNIA 3GKAA 3H6OA 2HDJA 1J9YA 4FNTA 2OPJA 3W1AA 4S23A 4PEEA 4AF0A 5I03A 4F48A 4O28A 1QNSA 2J7EA 3UCDA 3EWBX 1TTIA 3U48A 5D37A 1T0OA 4F66A 1JEZA 2OWXA 4UOQA 9XIMA 1IR1A 1ZNNA 1ZP4A 3ALGA 4XD3A 1XIFA 3IJDA 1ECEA 1UASA 1EQCA 3KHJA 4HU0A 3I68A 3G2GA 1UOZA 4WXYA 2YB4A 1FXPA 1G01A 3UXKA 3JRKA 3TUUA 3WNOA 3LHVA 5HMSA 3CT2A 3R25A 2YPIA 1V08A 1YX1A 3W7IA 3PPCA 1MNSA 4YIWA 2XSXA 3QW3A 5FJIA 5HQMA 2G50A 1XWYA 2OX4A 3CIXA 4MZYA 3HB9A 4XB3A 1O94A 3ARRA 2X7WA 5DT5A 3VDCA 2IKGA 2XVGA 5FCZA 4OJYA 3VMNA 1K8YA 2BVDA 1Q6CA 3A4WA 3N18A 2E9BA 4GKTA 3SCTA 2YLLA 1QBBA 1UWUA 3KOXA 4W7VA 3EWXA 2VO5A 1SPQA 2Y5EA 3JR2A 2C15A 2AQWA 3AXKA 1JYVA 3AISA 3DFPA 1H41A 1WPCA 3WLRA 3O6CA 5HPOA 3VPLA 3SB0A 4BS0A 5JBDA 4MTVA 3WDPP 3CUFA 5A8GA 3R0DA 1E6XM 3IVSA 3TOPA 2QIWA 2ZRZA 4ZTXA 1ENUA 4WDUA 2OTDA 3QOMA 2J9ZA 1JUKA 2DIEA 1PTGA 1L6GA 3GAYA 3FOKA 3C52A 4W84A 3MJYA 4V33A 3O06A 2NV9A 5I78A 1I45A 1WDPA 2V69A 4HGXA 1B0IA 3WFAA 4DWSA 1W9BM 2ZUTA 3CNYA 2E09A 4B91A 1M7JA 2PWHA 2YKKA 4MUZA 3U5YA 2W3ZA 3SRFA 2V0TA 4DZAA 3NO3A 4TXEA 1JNDA 3GHRA 4AXKA 3GTIA 1XLKA 3EDDA 3FHQA 1JZ3A 4O1FA 1B3YA 4ATLA 3EOUA 1H61A 3WH7A 1DTNA 2BY2A 2PAJA 4H04A 4O50A 5HMDA 3V4BA 3W6LA 2OX1A 1R3TA 3SO7A 3GH5A 1VFMA 2IXUA 3QH2A 3CMFA 1U1HA 1KCKA 3N2OA 5M2FX 1Z69A 3TC6A 3G8EA 5A6JA 3KOZA 2PDIA 4XUGA 6ENLA 5B80A 4C6FA 3LTYA 2ANUA 3DBNA 3E5PA 3GNNA 4PMNA 4LPCA 5BWAA 4R27A 4AEFA 3GDBA 2ACRA 4EIVA 2VFGA 3OYZA 4XK2A 3GQYA 3ITTA 1W5OA 1YTKA 3SIMA 3ABOA 5AVHA 4GJIA 2YLAA 3M0MA 2WQPA 3I3EA 4BF5A 3T78A 3ZT7A 4AIOA 1VBRA 1DEDA 4IGHA 4DF2A 3FYOA 4FLRA 1FCQA 3KHDA 3WLLA 1V3KA 1FDYA 3L2MA 2QW5A 3PC0A 2PZNA 2WWCA 1P1XA 3W7EA 1T6MA 1UC5A 4BI6A 2X42A 4S3DA 1VH7A 3W1PA 1IEIA 1TWSA 2Q8ZA 4GXWA 3A4AA 1NARA 1P0EA 3G8RA 2CLEA 5LNVA 2VRQA 4U5KA 3A6OA 1XG4A 1GKQA 4XBKA 2DY3A 2A3AA 3IRSA 4YWSA 1VFUA 2YJQA 1TE6A 3NPUA 1JQXA 4MM1A 3WQPA 1TTJA 5A8PA 1EO5A 3E2QA 1GHRA 2VRJA 1J93A 4HMDA 4JHMA 3NQEA 1ISYA 1ITXA 3TC7A 1Q65A 3DI0A 5HQLA 2ONEA 2X8RA 2WC4A 1S5WA 4PRWA 2CESA 4R7WA 1BSLA 3TYUA 4IOTA 3ZVHA 1W17A 1X98A 4UTWC 3WQFA 1ZJHA 1UP3A 4O15A 4FXSA 2BVTA 5AYZA 4RXFA 2X1UA 2VYOA 4YJ5A 3S6OA 4JIIX 4GUFA 4UTHA 5T9BG 2QDHA 5HWMA 1UH4A 1V3HA 4MUPA 3WD4A 4PFHA 3G1SA 3FA3A 6XIMA 4E2VA 5AHEA 1I2OA 4B5UA 4WGHA 4O52A 1DBTA 2DSKA 3MMWA 1V3IA 1SR0A 4R7JA 3FSUA 2XIQA 3QV6A 2QCDA 4LUTA 1L2UA 3M5VA 2C91A 3LCXA 2I7GA 1ODZA 4UTJA 3IIXA 1R38A 2P53A 2PTWA 4J1OA 3DXIA 2WHMA 3W1TA 3BLLA 1SO5A 2QZRA 2FB3A 4CNSA 3S6DA 3F03K 3AALA 3EOSA 4E4FA 5E09A 1H1ZA 1LROA 3WKZA 2VQUA 4C91A 3G1YA 1IXPA 2E3ZA 3IEBA 3WLKX 4QG6A 1DHPA 3GNDA 4US5A 5FF4A 2GL5A 4HB7A 2Y8VA 3CLWA 1XR2A 4RJEA 3GXMA 1OFAA 4NYUA 5DCDA 4E4PA 4EKJA 1IT8A 3DYMA 2ISWA 4K6AA 2XM2A 3DC8A 4O53A 3TAKA 3VUSA 3P60A 1M1BA 2VL4A 4FB7A 1V4YA 3WNKA 3MV01 3KCOA 4U10A 5C9UA 3UWYA 3IRDA 4OOZA 3GRIA 1EP1A 1ZHAA 3LPOA 1NDZA 3ZIZA 4NI8A 1UUMA 4GGHA 4LAUA 4IG2A 1QASA 1TZ7A 1A5OC 4IMCA 2KZHA 3RU8X 1G0CA 4QHRA 1V51A 1YPXA 2A5HA 2MUCA 1ZZMA 2O7QA 1FTXA 3AS1A 5BXSA 1S5VA 5C2XA 5B7YA 3GG1A 3CAKA 1BXNA 5LNWA 3ES8A 2WJFA 3KVKA 3E2VA 4XD6A 1CEOA 1F6KA 2ZUMA 3N29A 2AKMA 2VQTA 5D8ZA 4G1KA 1QK0A 2YL8A 4AYSA 2XH2A 3LPFA 5A6MA 3V7PA 4BWLA 1RBLA 3WLSA 2D0FA 4ES4A 3E3HA 2A6NA 1GQJA 2P88A 2WCGA 1UKSA 1OX4A 3H4WA 4O1EA 3L65A 4NASA 1K8XA 3WDRA 4ZFMA 2ZYFA 2QJMA 1BGGA 3GIPA 2G3NA 1GZGA 4L9YA 4HHMA 1GYNA 4QDMA 1BYDA 3H7VA 1S39A 4J3VA 3RRAA 4QDWA 1CW2A 1GVRA 3OLDA 4XKYA 2B31A 1E56A 1GVFA 1DJYA 1OD0A 3HU7A 4C90A 3UWVA 1UOKA 4RDZA 3VIGA 4DNMA 4IIGA 3AWOA 1OC5A 3C86A 2XFYA 1WXZA 2X16A 3NWRA 2FZ9A 3UPBA 3CLMA 4NJHA 1FWSA 2GVLA 1ZJBA 4N9BA 4O11A 2GJXA 4NXKA 3H55A 4H8HA 3UG5A 3W26A 4E38A 2QXWA 5A5WA 3G1DA 1F05A 1TWZA 1PIIA 4GNKB 1SO4A 1RV8A 4DBWA 3VVGA 2DZWA 4GMEA 1JVNA 1Z41A 5LHEA 4AH7A 3MHUA 3CV1A 2QCEA 2OOFA 3WQGA 4G6CA 1J0KA 1R5YA 2HXTA 4HNTA 4HZ7A 4OQVA 2ZX7A 3CQJA 1BRLB 4QCFA 4G1NA 1GK8A 2JBMA 3KP1A 4UTWA 3MY9A 3DERA 3T2PA 2J8GA 1S46A 4NSBA 5RUBA 4NIRA 2W92A 2NUYA 5FSDC 2Z1BA 4GC4A 4BJHA 3BCFA 2AL1A 4PSRA 5JBEA 4Z1CA 5HUOA 1RD5A 4EOUA 3ITCA 2PRHA 5TIMA 4Q4SA 4O1AA 1UZHA 3M43A 3L4ZA 1LRNA 1W0MA 1KQYA 1XYBA 1YXDA 1HQTA 3HQNA 4ZBCA 1P43A 4AFYA 4UNKA 3QV7A 1A3HA 2OJPA 3W29A 4UTTA 1VPQA 4XO7A 2OYMA 2ABAA 4D6DA 4GYPC 4TOQA 1EYWA 3BW3A 2GK1A 3GM8A 3W86A 2Q6ZA 2XISA 3OGRA 1AZ1A 3VFLA 5BXPA 1KTBA 3W7MA 1TMQA 5HR6A 2GSHA 1KBKA 4PUNA 4LYQA 5TD4A 4J3ZA 5FD0A 2VT0A 4Q8UA 2VX4A 3DYPA 4WRHA 1LORA 3M0VA 4ICCX 1OX6A 4JDYA 1ISZA 1UR0A 2V3FA 2OQLA 4PMXA 1MW0A 1W3HA 2YFNA 1KC7A 2FKPA 2Y2WA 4PMZA 2ZFAA 2V6AA 1XD0A 3R0KA 4FX6M 3LTSA 1FKXA 1QDSA 4AHOA 3WBAA 2E1WA 1IZKA 1DVJA 3S2NA 4MPKA 1LT8A 4GFSA 4XKMA 4NNAA 3LLDA 3FN9A 3WH8A 1WKYA 1W5QA 4O8AA 4ORIA 5E93A 4UFMA 3T44A 2XJ7A 1FXQA 1WV2A 1JPKA 1UP2A 2Z7GA 3S9YA 1GOXA 5DEZA 1N7KA 5BROA 1JCJA 5XINA 3BLOA 4QQ3A 4GE8A 5CZ0A 1FCBA 3L4WA 2J6VA 2A7RA 1A5MC 1EZ2A 4B2DA 1W1A1 3CTLA 4DXXA 3AIWA 1FX6A 4D6GA 2GDUA 4F2TA 1ADOA 2QYGA 4AVNA 4I9TA 2YCLA 4DUWA 1DWAM 1RR2A 4DIAA 3R43A 2J8FA 4X61A 3R0UA 3F4CA 1Y5VA 1UH3A 1NWRA 3QW4B 3EDJA 1GOQA 2BWGA 4ML9A 5E6ZA 4DJDC 4FSAA 4MZ8A 2XUCA 5FL0A 1Z89A 3AZRA 4MB5A 1LP6A 2FVMA 3ATZA 3ZR5A 1TZ9A 4GUIA 4IP4A 4M6PA 1PKNA 3VZXA 2NVCA 5AVNA 2D2GA 1WX0A 6REQB 1DIEA 2VX7A 1US0A 2PLMA 2OZ0A 5JIPA 2ZXBA 1UMYA 3LSCA 3SJ3A 3RXZA 4LC6A 4PEKA 4JQAA 3CTTA 3U0HA 2A3EA 1YKWA 4AYGA 3TIMA 4GZEA 3TN4A 1F2JA 1ITCA 4XV0A 1XBYA 4XTIA 5AOUA 5G2WA 1E0VA 1S2TA 3OVRA 3LHZA 3ZO9A 1XH1A 4PMVA 1FVPA 1QR7A 4RDYA 4U33A 2ZXDA 1TJ2A 3U4FA 3PTMA 4N4PA 1GG0A 5CJMA 2PCEA 3ERPA 4ZO6A 1E72M 3D47A 3U7BA 2ACQA 2AQVA 1GTEA 2YCEA 1JGMA 1S5TA 1W5NA 2PRLA 5AYYA 3SSZA 4IMAA 2VUYA 4AY8A 3WBXA 2GGGA 1GCYA 3TJIA 5I23A 1SJAA 2RKXA 1LLOA 3H12A 1B2YA 3VE7A 3F4DA 5LA0A 2EXOA 4H3DA 2VGIA 3WF1A 1TA3A 4YPJA 1XQKA 1XCFA 1FKWA 1H7PA 1DYSA 5A6KA 4IP5A 1K4GA 3MCOA 3IWPA 4TTGA 3UJFA 1U83A 5DANA 3U2OA 5A1AA 4MKVA 4TMBA 4C6LA 3HQOA 3WD3A 1OT1A 3DUGA 3G1HA 4Y96A 4TX8A 1WAUA 4F0RA 1LF1A 3E02A 4I9JA 2ISDA 2I16A 4JIPA 3MTWA 1ALDA 4XZLX 2OLAA 1IEVA 1IWAA 2R91A 2Q3RA 1TCMA 3DFYA 2A7NA 1PHWA 4CNOA 1T8XA 4PH6A 4TVUA 3E12A 4QISA 1XYLA 4GACA 3PSWA 5BWFA 3HG4A 3MMDA 4O4VA 1B3ZA 4E2OA 1RA5A 2YXGA 4Q8OA 3NR0A 5FEZA 3W22A 4LVAA 3WN6A 1N82A 2YCIX 1ZLPA 1VB9A 1R6WA 4UR9A 3ZWSA 3NQVA 1IWBA 4A2RA 2Q01A 2ADAA 2VDGA 3F4WA 3FA5A 1TRIA 3PSVA 1GQNA 2ZZ7A 4XZBA 1I2NA 1J8VA 1KFCA 1MZHA 3NIYA 3WL0A 3FVMA 1KGUA 1VQTA 2E4TA 1S5MA 4US5D 1WNOA 3QGVA 4QLLA 4FLSA 3UCQA 3ZQ9A 3UWEA 3BO9A 2NQ5A 3EB3A 3OHMB 1LRQA 1P48A 4B9YA 1OABA 1W91A 3AZTA 3BAWA 4ZQNA 2DT3A 4LBSA 2E28A 5DX7A 6CGTA 3UVAA 4RW5A 3TFCA 5GJPA 4JFVA 1EJWC 5D05A 3B8IA 1EJXC 4JYFA 1RUSA 4JTFA 3S1GA 2DT1A 2CHNA 3DFHA 4RUBA 1X7FA 4DRSA 3W1UA 4HNCA 4M1BA 2WXDM 1YW1A 4ADSA 1E73M 3OQEA 2YW4A 4JQ3A 2BZNA 4LVFA 3CWHA 5U7SA 1V3MA 4A8RA 3SM0A 2HJPA 1RSCA 4MF4A 1EBGA 1UPPA 2XINA 3UZWA 5HJXA 4ATWA 4HSHA 3A9IA 4J5NA 3W7RA 4ZL1A 2OSWA 3O6YX 2WMGA 3F5KA 1ISVA 5M03A 2V38A 4H8NA 3UXIA 4I6KA 4LT9A 4GI9A 3B0VC 3CUHA 3QR0A 4UQBA 1E3XA 1VBJA 2DZTA 4A3YA 1DJGA 5I0DA 4DVOA 3RLHA 1V6UA 1RBAA 3S47A 3CS2A 4K8EA 3TJXA 1OFOA 4W7UA 4MWAC 1JXJA 3FGCA 3FKKA 2GSJA 3BH4A 3ZT6A 2D24A 1V0KA 5EFFA 2E6AA 1QFEA 3BAXA 3U8GA 2PBGA 5CEWA 3VNIA 1MZRA 2V5BA 3WBWA 1LBMA 3L4UA 1EC7A 5HNUA 1E1EA 1HO1A 4EF8A 1C8QA 3B0PA 2AKZA 3ALFA 3FK4A 4ZCWA 2DSZA 3ABSA 3D5HA 4MWAE 3AICA 4B2DD 3SUSA 5J5RA 4M3PA 4AMAA 4ZQPA 1AH3A 4N02A 3LHYA 2CXGA 4XAYA 3V1HA 1SJCA 5CJ5A 3RITA 3K8KA 3WH6A 1UA3A 1J0IA 1P0NA 1XRTA 3R6IA 3P74A 3ARVA 3CHDA 4A8NA 3EKLA 2R8WA 3DFNA 1VR6A 4A05A 3WH5A 4GQQA 1YRRA 1NF0A 1AVAA 3E0LA 4IIHA 5H8UA 2BY1A 3ID7A 1NTHA 4C1NB 3R10A 4S3KA 4QFUA 2EHHA 3BOXA 3E1F1 4LAOA 3V5CA 4MG4A 3PZQA 4NUWA 3OVGA 3K4WA 4WLCA 5LIWX 3BL3A 1TPDA 1PV8A 2BS9A 2ZUWA 2WZEA 3UBPC 1UD2A 4OKDA 1ZAIA 2H3DA 4Q7BA 5EKYA 4AWSA 3AIEA 3TEVA 2BSLA 4HCDA 3W4RA 1UBSA 3QEZA 1PCWA 1Q8AA 4GYJA 3JUGA 4HK6A 5DCBA 2OLSA 3MI2A 4JGDA 1QBAA 1RP8A 3LYEA 1NWUA 2X1RA 5D9MA 1F73A 3FYPA 4G7FA 1D2KA 1KCLA 4LUYA 4I5UA 3W6YA 3PUOA 3GU9A 1CB2A 4ATDA 3G0UA 3AFBA 3THUA 5I00A 4TVDA 1ZENA 3SN4A 4AG0A 1AQ0A 3AIUA 4KEUA 3OODA 5BZAA 2BHZA 1CIUA 5HJLA 4D6IA 4AIEA 1TPC1 3F5LA 4V15A 3E96A 5XIAA 3STPA 2PODA 1RBOB 4R85A 1VFOA 4PTVA 4LALA 1BHGA 3VILA 3IJLA 4BK9A 4B5WA 3SCQA 3LX9A 1GVIA 3GDMA 4JIEA 2BFGA 2W61A 3K5XA 3O63A 3GZAA 2INEA 3H7UA 3T07A 4BQ3A 3QPYA 2FVLA 5B7ZA 4KRUA 4A21A 3CQHA 2Z2AA 1E15A 1M53A 1XICA 4CKQA 4GHRA 3CYJA 4ZOCA 4WY0A 3C2OA 1OZQA 2YB1A 1NDWA 3TTOA 3VZZA 1ZAJA 2HVOA 5TNVA 4K1WA 2GOUA 1E1CB 1PE1A 3IIPA 3MWCA 3NQ6A 4A8LA 4MY9A 1OF6A 1B9ZA 4Q32A 4DO4A 4IQDA 1EL3A 1E1CA 2BASA 5I24A 2ZDRA 1RJQA 3NQ7A 4KWUA 2O92A 1W1VA 5FOOA 3M07A 3UZZA 1WQ5A 3TNBA 3U9IA 1DPMA 1GJUA 2POZA 2VR2A 4GQBA 3CMJA 1UD3A 3NGJA 3ZZ1A 3SBFA 1NWSA 4NJIA 3WQ6A 2XIMA 3MUY1 1K7FA 4NNBA 4WK9A 2OXNA 4O4WA 3B9EA 4GRSA 3S2MA 2E7FA 2WK2A 4DJFC 4XG1A 1CGYA 3UNTA 1EF3A 3V16A 1R87A 2E68A 1BF2A 1TMHA 2QMKA 1MNZA 3SIZA 5HWJA 5JXQA 4PMJA 4IL0A 4Z17A 1DXIA 1C90A 1XLBA 1UZ1A 3CHCA 5CSRA 1H7NA 4F0KA 4HD5A 5CCZA 2ZZ5A 3NTYA 4U4MA 5F2LA 2DW7A 1KA9F 3WH9A 4LUTB 3TZFA 3A3HA 1D3CA 1KR0A 2OB3A 3HOJA 4C6DA 4O0KA 1OQFA 1R8LA 3SQLA 2WQDA 1QI2A 3TK7A 4M6QA 2NUWA 3GDLA 2F2HA 1RLCL 2X1TA 4E8CA 4Q7IA 4JTCA 3E0IA 4BEQA 4J4KA 2ZRXA 5G4HC 1GJPA 4NJJA 3CQKA 2FLIA 3VNLA 4V1XA 2WVVB 2Y6ZA 4PUDA 2JKEA 4PUWA 1A5AA 2Z1SA 3WQ4A 4POCA 5M1TA 5IFPA 4XAFA 2ZZ4A 4QNEA 1AH4A 4ZXOA 5C9WA 1DJWA 3GFYA 4D2JA 5HINA 2QUNA 4IXHA 1TJRA 2VGGA 1R2TA 3LV6A 1DE6A 2NQJA 1EC9A 4QS6A 3TA6A 1D8WA 1ODUA 3T81A 3QC0A 1KBJA 4MIMA 4O57A 3B3DA 4N42A 4HIBA 2WPGA 4S3AA 4EF9A 3EA1A 5I3FA 4JTUA 4K7YA 2VKZG 4DBEA 2ZBTA 4TX6A 2ATMA 1G6CA 1TMLA 2J27A 4KIRA 1TV7A 4M82A 4M6VA 3QGKC 4B3ZA 2DZBA 4DWDA 1NJJA 1HW6A 3MI3A 3B0YA 1DIOA 3AYRA 1JCLA 1EYEA 5EMJA 3KL3A 1O68A 3VMOA 3AMGA 4F0SA 1NOFA 1QVBA 4P7OA 3RX4A 4CQ8A 4E8GA 1GKRA 4IF2A 4J7RA 4OZOA 2NX1A 5AHLA 3TR9A 2UY4A 2HK0A 2IQ0A 1S5NA 4WJXA 3CT7A 3TA9A 3TYBA 4IXXA 1EP3A 3WFLA 2CIPA 3VD4A 4KT2A 2HVNA 4K68A 1ZP3A 2WPBA 2DZXA 1VHNA 1Y8BA 3CASA 3PZMA 2P76A 3TTYA 4MSSA 3OIXA 4AAJA 3M44A 4DBUA 4WQ6A 3C3UA 4TMCA 1E9ZB 2C1HA 3N25A 3BLIA 4JKMA 4AZBA 3LHTA 5CPSA 1QUMA 3LRLA 3QHMA 3LM3A 1CDGA 4JTDA 3URBA 4PMRA 3W72A 3UWQA 1X39A 1TQXA 2B4GA 5F2GA 3ONCA 1EJUC 2DV0A 4LRTA 4MFDA 3AYSA 1SQ7A 1W31A 3AU2A 4FOJA 1Y5XA 3WBEA 1W56A 1G4SA 2CW6A 1EB3A 3EAUA 4UQAA 3E49A 2PDLA 2ZX9A 5KITA 3GNRA 1UJPA 8XIAA 4QX4A 1EJRC 3MS8A 3GTXA 4UR8A 1AUSL 2PDQA 4OECA 3V0SA 5IBXC 3B06A 4F8XA 2FGZA 1AW2A 4PMQA 3KCJA 3TW9A 2QCDB 3BZJA 2R1MA 1UWQA 1YBQB 1OC7A 4YVPA 4Z42C 3VIPA 3NNTA 3GVRA 1ADSA 5D04C 3UJRA 2ZXAA 3HPAA 3WJXA 3C0QA 2V63A 2D0HA 4HMNA 4HP5A 2RDUA 2DUXA 2F2KA 4RXGA 2WVUA 4H2CA 4GO9A 1TFVA 4Y8EA 2I5QA 4PCFA 4LW7A 2Z29A 2YSWA 4J3UA 5A3HA 4LGXA 4KPLA 3OU8A 2VP8A 1M7PA 3B4YA 3BGGA 5JU6A 1EXPA 4BR1A 3A47A 3BQ6A 4MJ2A 3ARPA 3WDQA 2PDNA 4NZ1A 2RJHA 1XM3A 1BVZA 3UR2A 4M5PA 4XZMX 4L5ZA 4LCSA 3WLHA 5HNRA 1A5NC 2NX3A 2VTFA 2XVKA 4EK7A 4QAWA 4HPGA 2FZBA 2PGWA 2CKRA 1Y7VA 3ABQA 1IYXA 3O0FA 2ZCGA 1H5YA 2CEQA 2O0TA 2PEVA 3IAPA 4BQ4A 3EWYA 3BW2A 1VYPX 1NY1A 3JZUA 1ESWA 3OG3A 4UXDA 2B7NA 2OYKA 5IDZA 3B8DA 5TF0A 5CZJA 5CPOA 3APYA 3AROA 1E0UA 1UD8A 5E6YA 3QHOA 5I7GA 1TO3A 2A3HA 3GD6A 4A2SA 1XLFA 2DH2A 2OELA 4M7TA 4URIA 3E2SA 4H6RA 1XINA 4TIMA 5LNSA 1YNPA 4XAGA 1DJZA 1RQHA 3THAA 2D2JA 3H2NA 3TWBA 3K2GA 1RY0A 4L9ZA 3MSYA 3UR5A 2ATSA 1E6NA 5E0KA 2HZGA 5BOFA 2IPWA 4YVXA 3GH4A 4QJ4B 4FX7A 1JZ5A 4M8UA 1OADA 5GJNA 2XH0A 2C18A 4QG9A 4IWWA 3DI1A 2QCHA 3EX2A 2NT0A 1PPIA 3NFUA 4KQNA 2PU0A 4GQRA 2LLEA 1M5WA 4O54A 5REQA 1BD0A 4QG8A 3GXIA 3NQCA 4BKNA 5HBFA 3HGOA 4LRSA 4NILA 3RLGA 3TYDA 3TYZA 1B9BA 3GBEA 4IG2B 1ZCCA 5EBUA 2GJXB 5CPTA 2VFIA 3FDKA 1ZRQA 2Z4GA 4N2YA 2WZMA 1S1RA 2G37A 1XV8A 3S1WA 3BSGA 1OCBA 5AYBA 4ZMGA 1BGAA 2X7VA 4GI8A 5BMXA 1PYMA 2RAGA 4PYSA 3CK5A 4EP8C 2Q3OA 1K70A 3PANA 4IGMA 4IUGA 3O2LA 4HPHA 1VF8A 1E0WA 2HBXA 3VU2A 2VC9A 5CZTA 3I65A 2P0OA 2CZDA 2WZIA 2CETA 4I5XA 1UZDA 5FACA 5CG0A 5BU9A 4NYYA 3CAWA 4HOXA 3QN3A 4YMZA 4AC1X 4FAMA 1QPKA 4AD1A 3R8GA 1XG3A 5K3VA 1E9LA 3TU9A 5FAJA 3KZSA 5K9XA 3VNJA 3WJYA 4HOWA 1HP5A 5F1VA 4YLWA 2JEPA 2WHJA 4PB5A 1JULA 3HPFA 3BANA 1GYMA 2F9RA 3DBPA 5IM51 1IXQA 3IJ9A 5KMYA 2G41A 1VCVA 4W8BA 1FBAA 2XIJA 2CBUA 1NOWA 3NQDA 3P62A 1HJXA 3E38A 3SCVA 3PULA 4V28A 1OGGA 5DMMA 3L66A 4WEVX 5CXPA 1WZLA 2J7HA 4FNUA 7A3HA 1EHNA 3WL1A 4ERAA 2X09A 4UMAA 3RCMA 2CBVA 3VC6A 3DG7A 4GLEA 1DORA 1PJ9A 1QPRA 4JZ5A 4MB3A 4JQ1A 2OLHA 2VDHA 2VELA 3QYSA 3M0ZA 3PJTA 1AJ2A 1XLMA 3STEA 3TFXA 2YOCA 4NG3A 2W5FA 2WBKA 2Z6IA 1OWQA 4XIMA 3R1ZA 1PS9A 3V0TA 1EJSC 4BA0A 3GVWA 2W6RA 1XIMA 1Y65A 3ITXA 4A8IA 2ZRWA 1BAGA 1UP0A 1A3WA 4HZ6A 3GHUA 3LUTA 2FH8A 4J3XA 4D71A 1DJXA 4NL1A 2OZ8A 1YHTA 5K9DA 2EPOA 4OT7A 1CGTA 4ZQOA 3W2JA 4D8LA 3C0JA 2XSAA 2ISFA 4KFPA 4ZTYA 1XSIA 3EMQA 3G5EA 1SO6A 4H83A 1EA9C 2CERA 4L1GA 3IUHA 4DEFA 1B5TA 2WSKA 4HBKA 3BJTA 5K4ZA 4C6JA 2INFA 7CGTA 1FY6A 4RE2A 1XLAA 1OFBA