1AW1A

Triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHAESDEFVAKKFAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Triose-phosphate isomerase (TIM) of the psychrophilic bacterium Vibrio marinus. Kinetic and structural properties.
pubmed doi rcsb
source organism Moritella marina
total genus 91
structure length 255
sequence length 255
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1aw1A00
4RXGA 1XDMA 2C18A 1WOAA 1YTKA 2PURA 4NNAA 3UWQA 2ATSA 2DORA 5J5DA 1N55A 3G3MA 1EUAA 2QCLA 2WPBA 3LHYA 2CZDA 5FEXA 3GDKA 1GVSA 3A23A 2VFIA 1TPB1 4MZYA 3MHGA 3W7NA 4NUWA 1DQWA 2DZPA 4CCEA 3EB2A 4WOQA 1HFBA 4JTHA 2ZRXA 3UZJA 4O0ZA 4WJEA 5C6MA 1W3NA 4R7JA 3DFSA 5AN7A 4L4MA 1B9BA 1GOXA 1XXXA 5F4SA 1TTPA 2CLLA 1F05A 2TSYA 4O16A 4P61A 4CQ8A 5LZLA 3O07A 3NM3A 4BK9A 3NL2A 2X16A 4WXZA 2W6RA 3SIZA 1FCVA 3UXAA 1UCWA 4X2RA 4Q32A 4O1DA 3L0NA 3NQCA 1ME7A 3GK0A 3IVTA 1ME8A 3W6YA 3ZS4A 3E12A 4NXSA 1PV8A 2NWSA 4EWND 2PC4A 3PSVA 2DZSA 3P82A 4KWWA 5K2ZA 3SGZA 1OYBA 1AW5A 3P5YA 1P0NA 3LBCA 1YTEA 3P67A 3N9SA 3W1QA 3TSDA 3N19B 3MWAA 1HL2A 1DV7A 2TRSA 4JDBA 3MYPA 4RCXA 4N9DA 3OVPA 1DORA 2QCHA 1LBFA 1FWWA 2WSRA 3B0PA 3M6YA 4GUGA 1I2NA 1FXQA 2G97A 3R13A 3AO0A 5CZSA 2B7PA 2J27A 3QSRA 4S2BA 4JIQA 3UY8A 3SFKA 5D2YA 1UJPA 1O5KA 3E02A 3TQVA 4JTFA 1OABA 2O7QA 2A1YA 3GXNA 1VH7A 4ML9A 3G22A 4AVFA 4KWVA 3GKAA 3W72A 4MFDA 1E51A 4ZVJA 4K38A 1SW7A 1RQHA 2Y7EA 4LS0A 3OEXA 1OFAA 2EGZA 3TCEA 3AJXA 1SW3A 3PUEA 3IIOA 1B4EA 2X1TA 4AF0A 1FDJA 2YDAA 5AFDA 3S8HA 4O11A 1ZAHA 1ZHAA 1MEHA 1W54A 5J5RA 3NQMA 1KM4A 4GUHA 4XKYA 5BMXA 4JDYA 4IX2A 3UWZA 3S1XA 4Z1BA 2VEKA 1PVNA 4HIBA 3G0SA 3NGJA 3RMJA 3R89A 1WQ5A 2R91A 4QITA 1WA3A 2E5DA 1YXCA 1ZCOA 2GOUA 3ELFA 3HIJA 3R8RA 1PHWA 2J9XA 4NJHA 3T55A 3NM1A 3EXRA 4JX6A 5G1YA 2QJHA 3FOKA 3P7YA 4Z1DA 4O19A 4GRSA 3TA6A 3ZWTA 3W2NA 4YCPA 2VOMA 2B7QA 4RXFA 3TR2A 2QAFA 3PWAA 5LHFA 3NOEA 1W5MA 3KVJA 3DHDA 1GVFA 1JCLA 2JKEA 4IMCA 4ADUA 3EWUA 3W2UA 5A8GA 4E2DA 1RVGA 3C2OA 1O94A 2V30A 2ZZ2A 3G24A 3VNDA 5HWMA 3HQ1A 1I2PA 2ALDA 3M0ZA 4AXKA 1V7YA 4OHQA 4TU1A 1OYCA 1KBJA 2PRMA 1LOQA 3W7CA 1H7XA 2NXGA 2CZ5A 3NQVA 4FB7A 3FKRA 4DBEA 4WQ6A 1FWNA 1OFRA 4DO4A 3LCLA 3S1WA 1SSDA 1Z41A 1AK5A 3NR0A 4AF0B 3C8FA 1YDVA 4FNUA 3TC7A 4QQ3A 4JTGA 1VZWA 4JGDA 1H60A 4XKYB 2GVGA 3VFLA 3S42A 4FIRA 4PA8A 4UTWC 3GIYA 3PULA 5KZEA 3C52A 1T8XA 1FDYA 3W1TA 3TFCA 2X30A 3LRKA 3WJXA 3C6CA 4XQ6A 1GYLA 3W7OA 4Y96A 2QR6A 2HS6A 3RNDA 5D02A 1OF8A 3W87A 2QDGA 1SR9A 1H7WA 2YXGA 4Y90A 3PY2A 1R2SA 2A0NA 5G2WA 2CLKA 2EKCA 3LCGA 3EKZA 3SJ3A 2J24A 3CIWA 3G0UA 2QCFA 3EKLA 3M16A 4JXCA 1H7RA 4O0KA 5EY5A 3TMLA 2C6QA 3DU0A 3W86A 2ZZ5A 4QAIA 4UTIA 1WXJA 5K7JA 3IIPA 4JTTA 1AL7A 4CQAA 3W1PA 2ZZ7A 3LCWA 3T78A 5U7SA 4JTIA 5I3GA 2PRHA 1KV5A 4N2YA 3S1VA 3Q37A 4Z08A 4Y9AA 3MJYA 4AH7A 3W23A 3BPWA 3IIVA 2G5WA 1XBXA 2CLIA 3RLUA 1C29A 1GG1A 2VELA 3IEBA 3HG2A 2B7NA 2OT1A 1AW2A 3C2RA 3A5VA 3N2XA 5D2WA 4CQ9A 3T40A 3P8JA 2ISSA 2XN2A 3NZRA 4MY1A 1LP6A 1MO0A 4O52A 3IIZA 4MPQA 1SZGA 3SGUA 4AWTA 4UTWA 1TB3A 1IXPA 4WXYA 1W3TA 3LRMA 2RH9A 4IWWA 3G3DA 1QOPA 3VI2A 3E9AA 4ICNA 4X22A 1L6YA 2OMAA 5CPLA 3W1MA 3G1YA 1T96A 3EX4A 4YLWA 4O57A 2WSQA 3TIMA 5G4EA 4ZMGA 5CPMA 2AQWA 4HNUA 1MEIA 3A22A 2ABAA 5F2MA 5DELA 4XBKA 4WD0A 2ISWA 3GB6A 5AHFA 2QJIA 1VLIA 1GYNA 4B5NA 5AYXA 1BWKA 3PG8A 5D04C 3W84A 1LRQA 1GQNA 1WX0A 3GR8A 4EF9A 3H53A 3W70A 2JGYA 4O18A 4UR8A 3NQ8A 1TPDA 3OHIA 4PTNA 2RDWA 2X1RA 3UWWA 5G4WA 3CT7A 3GAYA 1SZEA 3G18A 3QM3A 1QMLA 3KHJA 3W75A 1JRCA 5D2VA 5HR6A 4TMBA 1G4EA 4O1BA 1JCNA 3DZ1A 4O1AA 1EPXA 2Q8ZA 2Z2UA 1WOBA 3P84A 4XUGA 5K9XA 3ANYA 1A5CA 1TTIA 3PB0A 4MZ8A 4UFMA 1EP2A 3L67A 4N6FA 2QCCA 1C8VA 3CIXA 3IVUA 4GUFA 1YYAA 4JNMA 3O6DA 1F6PA 4GBUA 4M7TA 4PEKA 4FEZA 4LS2A 3LGEA 5D32A 1R30A 3NQDA 4O53A 2FIQA 3S9YA 1RPXA 4K36A 3EXTA 2ZRWA 3W71A 1R46A 2A5HA 4PC8A 1VCGA 5AC7A 2C0AA 4XBSA 3W2KA 4X3ZA 3UYCA 5T26A 1O4UA 3QPZA 1VYPX 4N02A 4Y6GA 4HNNA 5IBXC 2CLEA 3MI6A 5E93A 3LCXA 5CPOA 2C14A 4QSHA 2JKPA 4LVDA 5LNUA 4AB4A 1OVDA 2E09A 4NJGA 3WJWA 3GDMA 4MVAA 2ZYFA 3W74A 2NUXA 4FNPA 5AYYA 1NF7A 1D3GA 5LNSA 4EIVA 1DQXA 3LHZA 3S5OA 3W1XA 1XM3A 2CLHA 3FYPA 1JCJA 1JUEA 2ZZ6A 3UWVA 1RQBA 4H6KA 4O28A 3B0UX 4HT3A 4NXKA 3DBPA 1F5ZA 1A53A 3A24A 4JTSA 1CW2A 1KM3A 2B4GA 5F2IA 1L6SA 2PCQA 5FF0A 3W7IA 3DFTA 2PRLA 4TO8A 4DF1A 3DFOA 4JR5A 1T99A 4N9BA 1ZNNA 2WOQA 4AEOA 4RK8A 3R12A 3MP5A 2PE4A 2I1OA 3O6YX 3W3OA 3W7LA 3BG5A 5F4XA 1UUMA 1VCFA 2EF9A 3O05A 4IMGA 2GJNA 4IPIA 5AHMA 4RZ4A 1H50A 1KTCA 1LDCA 3U6WA 4ZL1A 2A21A 3PBVA 1FX6A 2ZTJA 1H61A 3TDFA 2J9ZA 3P8IA 3L21A 3M43A 2BSLA 4N4PA 1AMKA 3EWBX 1SQ7A 4UMCA 4ZQNA 1YPIA 2V81A 4EF8A 1QO2A 2OJPA 2J6XA 3TFXA 4BI5A 2NX9A 1LRNA 4HPXA 4LUIA 2QUUA 1THFD 2CU0A 4NVTA 3M1ZA 3DKJA 4MIMA 3BW2A 2HSAA 1J4EA 4Z0JA 1M5WA 2GQ9A 1I2QA 2ZCGA 2NV1A 2YSWA 4LC6A 5DXYA 3UXDA 4W9TA 3Q58A 3W2LA 4GWEA 3NQ7A 1SU5A 1TV7A 2YPIA 4XTDA 5AB3A 1X1OA 4U4MA 2NWRA 3BLEA 3MBFA 3NL6A 2WNNA 3N34A 3NNTA 2J9YA 3U2OA 2NX3A 4D2JA 2YR1A 1W0MA 1GT8A 2CLFA 3VCRA 5LNRA 1P1XA 1H5YA 4DXVA 2XFWA 4ZZ9A 3JS3A 2VEMA 1AW1A 1SO4A 3HO8A 3NL5A 1QNVA 3HG5A 3TXVA 2H8XA 4KFOA 3TX9A 3QMRA 4RR4A 1QO5A 3BGGA 3N14A 3PBUA 2IQTA 3KOFA 4FNQA 4LU0A 2I14A 3ZFHA 4CCCA 3F03K 1TQJA 2E5CA 1CX9A 3NL3A 4CNNA 2VFFA 4LS1A 4ZQMA 4DF2A 2BX7A 1KFEA 4O8RA 3M44A 3N3MA 4BFAA 1KLYA 2GQ8A 3GXPA 4DO6A 3LHUA 3HGJA 4I9AA 4NT0A 1VC4A 4ADSA 4UTHA 5G2HA 3FS2A 4DEFA 4NQ1A 1WBHA 4ONVA 4AHQA 2Y62A 1KFBA 3O6CA 1HO1A 5FESA 1XBVA 1SFLA 2E5BA 2OX1A 3NA8A 1A5BA 3Q2DA 3W7QA 3PG9A 4JEQA 3EX1A 1OX4B 6ALDA 2Q8LA 1GJPA 1JULA 3VKJA 1QOQA 1G6CA 5KITA 4H4IA 3W9ZA 1MSSA 1M7OA 5TIMA 3TK7A 1QWGA 1OK6A 3TQ0A 3PBWA 3M47A 5AHIA 2H8ZA 3MYOA 1ADOA 4QISA 4IMDA 1L2UA 1TYGA 2G95A 1F2JA 2O7SA 4QM1A 2Q3RA 3CU2A 3LCHA 1VGAA 1XBYA 1SZNA 4LVBA 3O8AA 2XN0A 3NPUA 3LV6A 3A5FA 4IXHA 1F74A 1FDZA 2VXNA 3MI3A 1MXSA 3N9RA 2CLOA 3PB2A 2Z1BA 1X8FA 1EA0A 3M7WA 4IOTA 3PUDA 1ML1A 1H7OA 1JUKA 5IM51 4A29A 1KTBA 3LTSA 1DHPA 1ICSA 3YPIA 4E38A 1Z42A 1LTDA 1NF0A 2DU2A 4YCOA 3EXSA 3MBDA 3ZR4A 5HUPA 1HTIA 1JR1A 3BO9A 5DBTA 1SO6A 2ATMA 1TPFA 3M9YA 3G1AA 5K4XA 2E6FA 4O13A 3LERA 4OWGA 3UD6A 4JTKA 2DJLA 4UNKA 2YX0A 4NJJA 4TIMA 2R14A 3NO5A 3G1HA 3M5VA 4UFHA 4WX2A 1Q6OA 3GX9A 2VFHA 5CSSA 1IXNA 3P80A 3I7SA 4O50A 3DENA 1PCWA 3OVRA 5EMUA 1S3HA 3EEGA 3W7MA 4N9EA 5HULA 2QCEA 1G7UA 4XTIA 1ZY9A 4HNVA 4FIQA 4OQVA 1BTMA 1NAL1 1QDSA 1G4PA 3QW4B 1KM1A 3BG9A 1FY6A 2Y7DA 2BXVA 3PVFA 5HQEA 4RX0A 3NAVA 2QKFA 3NEVA 1LOLA 2BTMA 5H2ZA 1KFKA 5AOUA 1Q6QA 3QFEA 3RFAA 1PHQA 1IIHA 1WBJA 5D37A 4I7WA 3KAOA 4C1KA 4EOUA 1A50A 1EWDA 3MMTA 3THQA 4NNCA 3B8DA 5C55A 4LVFA 2YFNA 1TPUA 2ZRVA 4UTMA 3BLFA 1RQEA 1XL9A 4DO5A 3STFA 1ZAJA 3CWNA 4LW7A 3PM6A 6TIMA 3NQFA 4A22A 5I3FA 4JD4A 3EWZA 4K8HA 2V2DA 2ZTKA 4A2SA 4DBDA 3SI9A 3TQKA 2FB3A 2DZTA 4MYAA 1K8XA 3S1UA 3L5LA 3FFSA 1GVRA 4WUIA 2W0UA 4IQLA 3W1AA 2A4AA 1R2RA 4J9JA 1W56A 3GVGA 3HG4A 5BNKA 1OFOA 2VFEA 3L0KA 4AMAA 4OGZA 1YXYA 2QDHA 1TO3A 1PL9A 1M6JA 4I7VA 2J88A 3G1VA 4GXMA 3M41A 3O15A 2EHHA 2FFCA 4UC5A 3M5YA 2QJGA 3O16A 1MZHA 2TYSA 1X6UA 4TX9A 4FF7A 1KM5A 4RJEA 1TRIA 3GDTA 1EB3A 1XUUA 2ABBA 1W5QA 4E0CA 1F76A 3MW7A 4IPJA 3MP4A 3C61A 5F2LA 1DL3A 5KTLA 2H3DA 4IGHA 1TTQA 2NV2A 3GAKA 1KM0A 2P0OA 4LT9A 1OYAA 4JTEA 3IGUA 3LOTA 1K02A 5K3VA 4K7VA 1TPEA 3L5AA 3MUXA 4Y8FA 2VEPA 2VKZG 3LBMA 4UFIA 3FJ6A 4OV9A 1K7EA 3TXZA 1JQXA 2D73A 2A7NA 2RDUA 3LI1A 3QYQA 2C3ZA 5CG7A 1YDOA 1U5JA 3IGXA 4WOZA 1FWSA 3QW3A 4NZJA 2DZXA 2G96A 3I68A 1O5XA 2NLIA 2Z6JA 4RLIA 1PS9A 4O14A 3D0CA 3UZ5A 3M5ZA 5G2IA 3HGOA 3W1NA 2QCGA 2VFDA 3W7EA 2F7FA 3DH7A 3O63A 2BLEA 4TMCA 4Z1CA 3A9IA 3LTPA 3QRHA 5D38A 2VEIA 3NQ6A 4EVZA 4YWIA 1KFCA 2FPVA 2ZZ1A 4ADTA 2I9EA 1LORA 2HTMA 1HO4A 2ZRZA 3UQNA 1VLWA 3CLMA 5LNVA 1KA9F 4O12A 4K7YA 3ATYA 3LRLA 3KFTA 3QQ0A 4JYDA 1DKWA 3G0XA 5FI8A 2QCMA 3CHVA 4LWWA 1G4TA 5EYWA 3NVTA 2LLEA 3MHUA 4MFEA 4QNWA 3LHTA 3TJLA 1VHCA 1S5WA 1MEWA 3CQ0A 4Q4KA 1R2TA 4K39A 1ZAIA 4YMZA 1DBTA 3CM4A 3DFNA 1KBIA 1DJNA 4R33A 2X1UA 4NZFA 3NQGA 3DI1A 3O06A 2OZ0A 2Y85A 4X9SA 3W2MA 3SY5A 3UWUA 4O17A 3BVJA 1FUYA 3T4CA 3PAJA 5AC6A 4GUJA 1W5NA 3F4NA 4KFNA 1ICQA 5HJLA 1PCKA 3VE9A 5L9FA 1Y0EA 1XC4A 1X7FA 4ALDA 3QH2A 4UTTC 3RK8A 3IRDA 5D30A 2R8WA 4M6QA 3KVMA 3Q94A 1NEYA 3G8RA 4RZ5A 5DN1A 3EWXA 4UTLA 3VE7A 3C2FA 3R5EA 2NUYA 2YYTA 1K8ZA 3W07A 4FHAA 3MO7A 4U28A 3HF3A 3HJZA 1VS1A 3W85A 2QCDA 3KRUA 5BOOA 3QMSA 3HOJA 1TPVA 4HN4A 1QPQA 4OBTA 2DP3A 1I45A 2ZA2A 3DGRA 1TCDA 4LOCA 2V2CA 3C3NA 1B3OA 1TV8A 3P74A 5I3HA 1Q6RA 2HS8A 3V1PA 5EA9A 5FEZA 5LHEA 2YYUA 1JVNA 2YW3A 1Z44A 3KXQA 3B04A 4M7SA 1TREA 5D2TA 3CPRA 4UFLA 3W83A 5HNRA 4OT7A 3S5NA 4BR1A 3OIXA 4IX0A 3INPA 2B0MA 2GVLA 3TSMA 1ZJIA 4YL2A 3E49A 3W7DA 5DLCA 1I4NA 1SW0A 3L0GA 3JRKA 5DY2A 1LROA 5EL1A 3RF9A 2WO5A 4Z0SA 3G1FA 5EPDA 4NJIA 3S0CA 2Y7GA 3B05A 1I2RA 5EBUA 5H91A 3H55A 2ZA3A 2V0TA 4P2VA 2QF7A 2QUTA 3OG3A 5TBOA 5IBXA 4MY8A 1OFQA 4N4QA 4S1FA 4POCA 5HR7A 1GTHA 4UCGA 4UTUA 5GVJA 1H1ZA 4CCDA 1KFJA 1H7PA 5DCEA 5C54A 3ABRA 3NPVA 3JR2A 1VR6A 1K03A 4LRSA 5FF3A 4DF0A 5AHEA 3H54A 1O60A 5HUOA 3IV3A 3F1QA 3PC0A 1JCYA 2V8ZA 1ICPA 1H62A 3DHFA 2X2GA 3FYOA 4UUIA 5CZJA 5DXXA 1U83A 1O95A 1YLVA 4R34A 4JX4A 3GKFA 4JYFA 4FO4A 3G1SA 2CFFA 3STGA 4OE7A 4AWUA 3E96A 3SECA 1GG0A 5HMSA 2ZZ3A 1TJPA 1YXDA 3W7PA 1RV8A 2ZRUA 2WJZA 3OA3A 3QEZA 3B0VC 1JRBA 3BW3A 3QSTA 1QCWA 4JN6A 2RKXA 3W7GA 4UMAA 4JS3A 4IMEA 5CZ0A 3LV5A 3UNDA 4UFKA 1Q3NA 2FQIA 1OFDA 3C2VA 3WJZA 1KM2A 2A6LA 4HSNA 3GDLA 5FF2A 3HPXA 4FX8A 1LRTA 3ABSA 3GZ3A 4IJBA 2YW4A 1YADA 1RZMA 3NQ2A 2RDTA 5CPNA 5EKYA 5AHLA 3W1UA 3WK1A 4M6VA 5I3IA 4PH6A 5D2XA 3K30A 1M7PA 2QUVA 3S5YA 3NQEA 1LBMA 2CLMA 3KVKA 3C56A 4S2CA 4HKPA 1YPFA 1NSJA 5D09A 1OX6A 3I65A 1V5XA 4JY9A 4UIOA 1EX5A 1SUXA 1VYRA 3IVSA 5BW6A 2OCZA 4CLMA 3ATZA 3G1XA 1AG1O 2ZA1A 2X1SA 3UPBA 1P4CA 3LLFA 3HMJG 2QAPA 4LTSA 1EP1A 1TQXA 2C1HA 5LKYA 1JJKA 1B57A 1IF2A 3LHVA 1FBAA 2AGKA 1P5BA 3PS7A 3USBA 3TMQA 2F84A 5E1QA 3E0IA 4GFSA 2E1DA 2QCNA 2VFGA 3BGJA 2Y88A 2YZRA 3LX9A 2BWGA 1QPRA 4MOZA 1SZFA 3W7KA 4OV4A 2GPTA 4MZ1A 4K37A 2QEZA 5LGZA 5C5YA 1TPC1 4FX7A 2E77A 4DELA 1KV8A 3GLCA 3TUUA 4M19A 2CZFA 1X1ZA 2JBMA 1VYSX 5SWUA 1XFBA 3LCFA 3NDOA 4G1KA 3HPSA 5HWNA 3EWYA 3LLDA 1KFLA 2WSYA 1D3HA 4NNBA 2CZEA 4LNYA 1F7BA 1OHLA 4K6AA 4WY0A 3HPZA 3TJXA 1LCOA 3T7VA 2P10A 2NUWA 2B7OA 1K8YA 3NG3A 3GNDA 2YGYA 4JICA 2Z6IA 3FIGA 1W31A 4XWUA 5KZDA 1KLZA 3DFQA 5KINA 3CTLA 1OG0A 5K9CA 4HHPA 4RV8A 3NXFA 4UMBA 3QC3A 5I3KA 2WNZA 2V5LA 3ZWSA 3A21A 5FEWA 2A2IA 2GVJA 1G4SA 1TTJA 3V75A 3LDVA 4UTKA 2E6AA 2C16A 3FJLA 4TR9A 4MKNA 3W1LA 3GR7A 4LRTA 4FXRA 4PL2A 1EP3A 2WQPA 1ONRA 3BLIA 4XZ9A 4KFPA 2DJXA 4QJ1A 3W2JA 4JYEA 1Q6LA 5FF7A 3TU9A 2FPYA 3W76A 1ME9A 4O15A 1FQ0A 3EX3A 3DI0A 3DFPA 4C1LA 3WK3A 1QAPA 3PBYA 4N9CA 1PE1A 5DBUA 2TMDA 1VJIA 3BK0A 2C13A 1QR7A 1UASA 4NX5A 3HG3A 1EWEA 8TIMA 4AWSA 1OFEA 3QZEA 1KTNA 1H63A 4GNJA 2YCEA 2DZUA 1XCFA 1SO3A 1QPOA 4OU1A 1LM1A 2ZFAA 3QMTA 1SPQA 4MY9A 4BI6A 4JX5A 2ZBTA 5D05A 3UWYA 3PSWA 1IXQA 1AL8A 3G1DA 3IIXA 3I6RA 3W1RA 3HB9A 1FCQA 3CWOX 4WY0B 5HINA 2ZZ4A 1WV2A 4Q33A 1TPWA 5F1UA 1K3UA 3L65A 3MP3A 3TROA 3W7JA 1TRDA 1JQVA 4LC8A 4PODA 2EAWA 4ORMA 4GC4A 2NX1A 4R53A 3WJSA 1B4KA 1W8SA 1XUZA 3S5ZA 1BEUA 4M5PA 1W5OA 3DAQA 4UTJA 1TV5A 4UR7A 5G5IA 2E68A 2FJKA 4K8EA 1FWTA 4KKXA 4ORIA 1W5PA 1W1ZA 3QQ1A 4JY8A 1JCXA 3GYEA 3OBKA 5DY3A 3WK0A 1XDLA 2JK2A 4GJ1A 3WK2A 3TAOA 2CWNA 3CEPA 1UBSA 1RR2A 1OK4A 1TIMA 2FTPA 1LYXA 3MI2A 7TIMA 1XKYA 1D9EA 3SR7A 2BZNA 3L66A 5ABTA 1L6WA 5U4NA 3GXTA 5G1TA 2V2HA 1NVMA 3C4UA 2YFOA 2Y63A 1Z48A 3LM7A 1ZENA 1ZFJA 4MJMA 3TV8A 3LXBA 5KMYA 2OT0A 3TH6A 5F1VA 1DJQA 2CW6A 3F4WA 1LLZA 3FKKA 4UFJA 3BV4A 3QJAA 3M5XA 4FXSA 3LXAA 2KZHA 3NZ1A 1W37A 2RFGA 3C0JA 4AAJA 5K9DA 3KVLA 1CI1A 1GVOA 1LLWA 1SSGA 3DXIA 5BMWA 1KM6A 3C2EA 1TSIA 1IIGA 3TAKA 1VPXA 2ISVA 1ALDA 1SFJA 3O1NA 4FNSA 3U8GA 2NZLA 5C2XA 4NJKA 1BKSA 2RHGA 3TKFA 5D33A 3CC1A 4GUIA 2Y7FA 1IGSA 5I3JA 2AAMA 1GPWA 3L68A 1YDNA 3I7QA 3RLVA 4NU7A 4LVGA 3P5ZA 3P62A 2Y61A 4BWLC 3SSJA 5LNWA 1F73A 2NXHA 4PCFA 4O1CA 3I7RA 2ZRYA 3P60A 1GEQA 2P1FA 1LBLA 2V82A 2WV8A 2EPHA 3FEMA 4LVAA 2E6DA 3NYZA 4BF9A 3LI0A 4BI7A 3DKLA 1VRDA 4O54A 3PF3A 5CKSA 2JGQA 4A2RA 3WJYA 1TJRA 1TPH1 2A85A 3N73A 4DPQA 4FX6M 4IXXA 2W79A 3W22A 1PIIA 3SW6A 3ABQA 1ZALA 4Z1AA 2C19A 2VC6A 1TMHA 3TC6A 1A5AA 1EEPA 3L5MA 3P81A 4JTJA 1OJXA 2Z0IA 5AHNA 3IGSA 1OFBA 3QPYA 4RZ6A 5MHBA 2WNQA 4IMFA 4NX0A 1T0OA 3KX6A 4MLRA 1IXOA 2GQAA 4JTUA 1YTDA 2DZVA 3FLUA 1G67A 1Q45A 4BWLA 5KSWA 2ZQ0A 1FCBA 3L2IA 4I7UA 4O10A 1R47A 1LOSA 4CNPA 3KRZA 3UY7A 3W88A 3W7RA 4M6PA 5FEPA 1LZOA 1H1YA 3LHWA 3OVQA 1DVJA 3EX6A 2HMCA 3BARA 3FA5A 3EX2A 4FNTA 3LCIA 3S6DA 5CSRA 3L9CA 4RKAA 3BW4A 5LGXA 1H51A 3MHFA 1I8JA 1OF6A 4QIUA 4AHPA 3RU6A 2FLIA 4FNRA 4PFMA 1C9DA 3KRSA 4MLJA 4PL1A 1DOSA 5E0KA 1VCVA 1P0KA 2H90A 3HBLA 1K7FA 1QFEA 3BG3A 4JTLA 1QPNA 1G7VA 1I2OA 5CGQA 1VQTA 3NPXA 3PR2A 3TW6A 3CB8A 5AC8A 3TE9A 2E6YA 3STCA 1G69A 3STEA 1N8FA 1WYIA 5D03A 1GVQA 4MUZA 3W73A 5KZMA 4ZQOA 1RD5A 1NFBA 4HPJA 4L4LA 5DCBA 2GJLA 3LB0A 4UTTA 4AHOA 3B03A 2WKJA 5LSMA 1A5SA 4N6EA 3P61A 4HNTA 1GZGA 3B06A 3WFAA 4CNOA 1J2WA 4LV4A 3EWWA 4MYXA 1WDWA 5F4WA 5CZTA 1OX5A 2A7RA 4DPPA 1HG3A 2C15A 3LTYA 3G8EA 5DCDA 3TSBA 3TNOA 1F6KA 3B4UA 5L6UA 4ZQCA 3PUOA 2V5BA 1GTEA 1N7KA 4HSOA 1FXPA 1XBZA 1WAUA 3HGSA 4UXDA 4YXGA 3NQAA 1H7NA 2FDSA 4A3UA 2Y6ZA 3SZ8A 1VHNA 3QF0A 1W3IA 1FWRA 4H3DA 3ABOA 2TPSA 1XI3A 1S5TA 3NPWA 3GNNA 1FCUA 5AYZA 1JUBA 4WZHA 3UPWA 1K7XA 4O4VA 1JCMP 4LV9A 2JKAA 1UB3A 2R94A 2Q3OA 5HWJA 2FPTA 4QNEA 4LUJA 4O4WA 1EIXA 2ZDRA 2NXIA 5FF4A 3GDRA 5TQLA 2V9DA 3LXCA 4WY0F 2QCDB 2A7PA 3R2GA 4ZQPA 4E2BA 5F2GA 4MJZA 4IUOA 2H3BA 4ZQRA 1BWLA 1L9WA 3T44A 1OFPA 2Y89A 3W7HA 1EUNA 4GE8A 3CEUA 4LY8A 3THAA 4DQWA 1KW1A 2XN1A 2DZWA 2GUUA 1OX4A 2FB2A 5K4ZA 1HUVA 3N2MA 2Y70A 5A5WA 4A21A 4UNLA 1SO5A 2UV8G 2H6RA 1J5TA 2A6NA 5BRBA 3TW7A 2VENA 1S5VA 1GWJA 1UUOA 3HGRA 4JIPA
chains in the Genus database with same CATH superfamily
4CGTA 1XDMA 4MB3A 1YTKA 5J5DA 1N55A 3WNPA 1EUAA 4GABA 3QHNA 3P0XA 2CZDA 2QIWA 3ARUA 1J0YA 3ZVHA 1FHVA 3RRXA 2BASA 4ZB5A 3KBJA 1DQWA 2DZPA 2PWDA 3NVDA 3CYVA 1BVWA 4JTCA 3CHEA 1UR1A 1HFBA 1XIIA 4JTHA 3GW0A 2ZRXA 4WJEA 1TA3B 4JIEA 4C6MA 3IUIA 1TVLA 4U2ZA 5AZ1A 2D24A 4E6MA 2HEJA 2DY3A 4CQ8A 1BAGA 1LF1A 3VD3A 3O07A 2BOFX 4BK9A 1KXTA 2PDQA 3QBUA 3CQJA 3WUGA 3N3TA 2W6RA 4X60A 2R1PA 3V0SA 1XLJA 4KF1A 1CXFA 1FCVA 4X2RA 4Q32A 1IZJA 4PTMA 1UH2A 1ITCA 5HMDA 4B3ZA 5A6LA 3QY7A 4OUIA 5CGMA 1PV8A 1X7IA 1K9TA 4KWWA 4LNCA 1S38A 3VIIA 1OYBA 2H9AB 1R0MA 3P67A 4XK2A 3MWAA 3D3FA 2QDEA 2PAJA 4KS0A 1JZ5A 3MYPA 3NDZA 1V6TA 3OVPA 2QCHA 1FWWA 3DHPA 5HAOA 1IWBA 3M6YA 3LK6A 3VMPA 3R13A 4L1WA 2C7FA 3K8KA 1EKOA 4IIDA 2W61A 2J27A 1OIFA 4I5UA 2Y4SA 4S2BA 3EMQA 3VIOA 3CK5A 3E02A 4L65A 2DW6A 1OABA 2O7QA 3KBVA 2A1YA 2PTZA 4AVFA 3WQ4A 4L80A 3TN4A 1PIFA 2GK1A 1IR2A 4K38A 4AXNA 2XWEA 4YJ5A 1Y5XA 4LS0A 2EGZA 3UFYA 2D22A 4MB1A 1SW3A 3PUEA 1Y8BA 1M9HA 1KKRA 1YNQA 1NFPA 2WZTA 4UNIA 4P8VA 4CD4A 2P8BA 3S8HA 1RBAA 1PPIA 4NZ1A 5BMXA 1PEZA 4JDYA 1JYWA 4IX2A 1DHKA 1WP6A 2CBIA 3UWZA 1S5MA 3MMWA 2GJXB 1JPKA 2CNCA 3KM8A 1XRFA 3TYCA 3AS1A 3ARPA 3CT2A 2GOUA 7A3HA 1C8YA 1Q85A 5I23A 3NCOA 4NF7A 4QSFA 1FWBC 4JKLA 3TA6A 3B40A 3W2NA 4YCPA 5HMFA 4KBXA 4RXFA 5EMKA 3TR2A 4RDZA 3I6EA 2EKGA 4DJEA 1VFTA 5LHFA 3K4AA 4QEEA 4HSHA 4KEUA 3VGBA 4IM4A 5FJTA 2ZUSA 4MGGA 3KVJA 2HV5A 3O7UA 4LUTB 4YIWA 2ZZ2A 4C6NA 4KIRA 4M1BA 2GFTA 4AD1A 1I2PA 4AUBA 3S2LA 1AH4A 1C7SA 1V7YA 4OHQA 2CITA 1Y7VA 3W7CA 2OO0A 4GZIA 3DYPA 4WQ6A 1AK5A 3SM0A 2JEPA 4NL1A 4G7EA 4H1ZA 4PA8A 4Q8UA 4AC7C 2Q09A 1HVQA 1QWKA 3C6CA 3B8UA 4Y96A 4B9ZA 3RNDA 1OF8A 3VXGA 1H7WA 1F3WA 4H6EA 1R2SA 2QMKA 2EKCA 1W1PA 3SRKA 2IPGA 2AMXA 2V5DA 4W5UA 3M16A 3VPLA 3TMLA 3W86A 1MZRA 4UTIA 1WXJA 3SCQA 5K7JA 3Q4DA 3UG5A 2PGRA 3SIMA 1AL7A 4CQAA 1R9YA 5U7SA 2PRHA 4H7VA 1UR3M 4N2YA 3S1VA 4AH7A 3MU7A 4LAZA 4Z2LA 1EHNA 2B7NA 5BRQA 4C6FA 4S3CA 5D2WA 1XRVA 2PGWA 3NZRA 4MY1A 4C7DA 1MO0A 3IIZA 2WHLA 2OKTA 3I6TA 3GNXA 3R11A 3MMUA 2I56A 1S2TA 5CAKA 1BKHA 3QR0A 4O0QA 3VI2A 4OKDA 1W1A1 3SCUA 4X22A 1NQ6A 4PSPA 3W1MA 3G1YA 1KC7A 1T96A 4WKHA 4MPKA 2WSQA 4HMDA 4DIAA 4IGMA 1RA5A 5A6KA 1MEIA 1HJVA 5GPRA 5ENLA 2QJIA 3ECQA 3VIMA 1QW9A 2UY3A 1BWKA 1DE6A 1GKPA 5D04C 3QY6A 3BQ5A 1WX0A 4XAZA 3H53A 3W70A 2JGYA 4JQAA 2ASHA 2KX9A 3NQ8A 3DHUA 4PRTA 1B30A 2R9RA 3QHOA 4GHRA 3O0KA 3RDKA 3EB3A 3CT7A 1DIDA 1W6TA 1ISXA 3W75A 5FJJA 5HR6A 2DPEA 4KWOA 1Z89A 5ABGA 3PJTA 5EFDA 4KETA 3GQYA 2Q8ZA 3P84A 2HK0A 1XH2A 1A5CA 3PB0A 4ERAA 3T4WA 4UQBA 1QK2A 5I02A 3OODA 2POZA 1MQPA 1QUMA 4TVUA 1HGWA 1F6PA 4MMWA 4LS2A 4PUJA 5H6HA 4JQ3A 2YLAA 4PB5A 3UXLA 1FVPA 4K36A 3ZXWA 4PGLA 1K8CA 3SN4A 2A5HA 4PC8A 1GEHA 1GQJA 2AQVA 4C6QA 4XBSA 3W81A 3W2KA 1CGUA 7REQA 3QPZA 4DNMA 2A79A 4K1WA 2IW0A 3B8TA 2CLEA 1XHGA 3LCXA 5E93A 4WDTA 2Z1SA 2ZYFA 3AYVA 3W74A 4CEXC 4CNSA 4QE4A 5HOSA 4PYSA 5LNSA 4EIVA 1JXKA 3S5OA 1KCZA 2CLHA 1K77A 3KTSA 5DEZA 4HT3A 2P8CA 2FYMA 4E4FA 3P93A 3CUXA 4GNVA 4FLRA 4UOJA 1O6IA 1CW2A 1KM3A 3QLDA 5FF0A 3C3UA 1GCYA 5C70A 1GKRA 3ZM8A 4DF1A 1WXYA 3K8MA 1RP9A 1ZNNA 4GQBA 1HT6A 2WMIB 4L1GA 4AEOA 2ZX9A 3MP5A 2PE4A 4S3AA 3W3OA 2D0HA 3CZ8A 5F4XA 4BA0A 1UUMA 2EF9A 4JFWA 5J8LA 4QBXA 5AHMA 4RZ4A 1H50A 1S2CA 2ZWZA 1RY0A 4ZL1A 2QS8A 3ZLFA 3TDFA 4D71A 1JDAA 1SQ7A 1YPIA 3L12A 1QO2A 1RH9A 4BI5A 3ZVIA 3AMDA 1UR0A 3M1ZA 3OO2A 3BW2A 4US5A 4MM1A 2GQ9A 4C6OA 4LC6A 5DXYA 4AIEA 3GG1A 5AB3A 2UY5A 4U4MA 3WFZA 3V1HA 3QXBA 3NNTA 1ZU8A 3MMDA 2BVDA 2CLFA 3VCRA 1H5YA 4K2SA 4GX9A 4ZZ9A 5I2UA 1AW1A 5EU9A 3NL5A 1QNVA 2HBXA 1EQPA 1H5VA 4RR4A 2WMHA 4MG4A 2I14A 2XDFA 1TQJA 2E5CA 4PUUA 3NL3A 1AFSA 2O9TA 3KCLA 2BX7A 1JPIA 3UG8A 1KLYA 3LQGA 3HGJA 3AIWA 4I9AA 3WQEA 3VGDA 4F0MA 4ADSA 2EPKX 4DEFA 4NQ1A 7ENLA 4IIBA 5FESA 3NA8A 1E0UA 1A5BA 4PRWA 3MUY1 2Q8LA 1BYBA 4CKQA 1G6CA 4AVNA 1AZ2A 3MQTA 3FK4A 2PDGA 1RAKA 4K68A 3ITXA 3GY1A 2H8ZA 4W86A 4BS0A 3M46A 2V3GA 4XUYA 3SRFA 2BFGA 1L2UA 3DECA 3TQPA 2Q3RA 3IACA 1HZYA 2V3EA 4WGXA 5HJXA 3O8AA 2XN0A 1BG9A 4JNZA 3T0DA 4YS1A 4ICCX 4XAPA 4E8GA 4XB3A 2CLOA 2J7BA 3PB2A 2OWXA 1YPXA 4QCEA 1EA0A 4IOTA 1KTBA 1CXHA 3YPIA 1LTDA 1NF0A 1V02E 3R10A 3V3WA 4CD6A 4QS6A 4O1EA 1A5LC 1HTIA 1FH8A 2XVLA 5GJPA 2HNEA 5A6BA 1HJUA 3R0UA 1TKKA 2CIPA 1IQ8A 1KB3A 2E6FA 1O7AA 1EDGA 2XIBA 1NDWA 3B8SA 2QPSA 4HD5A 1A5UA 2E9MA 1TV4A 3M5VA 5JQ9A 1Q6OA 4HHMA 3HPFA 1VEOA 3I7SA 4O50A 4MDOA 1XLFA 3EEGA 3MSDA 3W7MA 4I5RA 4HOWA 2CLPA 2PC8A 3AFBA 2DT0A 4FPSA 2I7GA 2V6AA 1NAL1 3D5HA 3QW4B 4XAYA 1KM1A 3BG9A 4IJCA 1FY6A 2BXVA 2ZOXA 3PVFA 8XIMA 1ECEA 2R82A 4RX0A 3CMFA 2I17A 2BTMA 5CPTA 5AOUA 4J3UA 1H41A 1C3FA 4I7WA 1AZ1A 3GHUA 3CNYA 1A3XA 2IS7A 3PWGA 3VNJA 5FL0A 2YFNA 3FGCB 3BLFA 3HTWA 4LFYA 5BOEA 3A47A 4D6CA 3TR9A 3PM6A 2BGNE 2VZOA 3EWZA 2ZTKA 4A2SA 4DBDA 3SI9A 2DIJA 3QC0A 2DZTA 1K8XA 3L5LA 1CENA 1GVRA 5HDRA 3W1AA 3NZPA 4NI8A 3DUGA 4Y9MA 4DYJA 5ABEA 1OFOA 1I75A 4WJ8A 1W9UA 1TX2A 4HNOA 3WF1A 1TO3A 1M6JA 4J40A 1FFRA 3M41A 1EQCA 1XCWA 2TYSA 1KM5A 1B3WA 1ESWA 1XUUA 5KEZA 3GW3A 3AS3A 4JZ5A 3BJFA 4AZCA 3LPGA 2P0IA 4IPJA 1W2PA 3MP4A 3C61A 4GIEA 3TTSA 3E3HA 4HP5A 2Z27A 3GAKA 3SCWA 4JTEA 3IGUA 3LOTA 4WRHA 1TPEA 3SDOA 2OWWA 3CO4A 2VKZG 3LBMA 3QQWA 4UFIA 2X40A 4JCLA 4B5UA 2RDUA 1UZHA 1HX0A 4U10A 3QW3A 1ADDA 2DZXA 2VX5A 1JYNA 2G96A 3HJEA 4O14A 3UZ5A 3GYCA 3HGOA 4IG2A 2VUNA 2QCGA 2VFDA 2WVVB 3KCJA 1WZAA 3QRHA 1UMYA 1KFCA 2O4QA 1ZBCA 2I9EA 1BHGA 2HTMA 2QV4A 1RCXB 5LNVA 4R7OA 3CMGA 4O12A 2YL8A 3ATYA 4GO8A 3MCNA 1EXBA 5CLWA 2QCMA 5DMNA 2NLYA 3TJLA 3MHUA 4RNIA 2Q8XA 3CQ0A 4K39A 4AZIA 1W1IE 1PAMA 4YMZA 1RCQA 1UZDA 3B0YA 3KCOA 2VUYA 2C8NA 1BG4A 2GQ3A 2X1UA 2OZTA 1WAWA 3R8GA 1EHAA 3ZMRA 2OLSA 3SY5A 3UWUA 3U7VA 4DI8A 3U5YA 1FUYA 3OLGA 4LBSA 1WDRA 3MSRA 3IRSA 4BEUA 4XISA 1ICQA 4GVHA 3IGHX 1J93A 4ZFMA 3AXXA 1D7FA 3GVWA 4AIUA 4Q8TA 5I78A 1NWTA 1QJWA 5FAJA 2R8WA 4CU8A 5GQBA 5DN1A 3EWXA 3DBNA 1GOIA 3LUTA 4FHAA 3Q45A 4QE5A 1KRBC 4U28A 3HJZA 1VS1A 3W85A 3VOCA 2QCDA 1XIFA 4US5D 2QVHA 1EFZA 2XH4A 4JAWA 4GK8A 3P0WA 3EB4A 3RG6A 3STPA 2V2CA 1B3OA 3CHCA 4V1YA 2VMFA 1ZZMA 3O3RA 4PTVA 2IUZA 2O9PA 4D6GA 3T0BA 3V1PA 1Q6CA 1H2JA 2OEKA 4IPLA 3PZVA 1F4AA 4ENLA 2ZC1A 2J7CA 1T40A 2XIQA 4IP7A 5HNRA 1CWYA 3CB3A 3AMCA 3EDJA 1BXCA 3INPA 5B80A 3TSMA 2GVLA 3GVVA 1ZJIA 5FA5A 3W7DA 3QOMA 1I4NA 1SW0A 4DB7A 3DYMA 3WQWA 3JRKA 1LROA 2X2YA 5C9WA 2WO5A 1L0PA 2ZUTA 3H7RA 5EPDA 3ZR6A 3R7MA 1TA3A 4I9MA 1I2RA 1ONXA 5H91A 3H24A 5M5DA 2V0TA 4P2VA 1KFWA 1NU5A 3OG3A 3CV1A 5BXPA 3BLOA 3S9ZA 3N15A 3D46A 3DG7A 3NJ3A 4POCA 5HR7A 2G4FA 3PZTA 3VZXA 2P5NA 5GVJA 1H1ZA 5DCEA 1H7PA 1V6YA 4LRSA 3GTXA 1EL3A 4I9JA 5FSDC 1R7AA 2WM0A 1S2UA 3ES7A 4Q6XA 5ABFB 4B3LA 3UR7A 3RM4A 1A5KC 2FH8A 1ICPA 3DHFA 1J2BA 3FYOA 5CZJA 5DXXA 4MNKA 1O95A 2O56A 4E2VA 4JX4A 2HWGA 3GKFA 1E0VA 4S3FA 1A4LA 2CFFA 3STGA 4OE7A 4AWUA 4KGLA 3SECA 2W62A 3W7PA 1TJPA 4GYPC 1OM0A 4S39A 3OA3A 4QAWA 4NP7A 3B0VC 4ASTA 3UT0A 3WQPA 3OTRA 4DXXA 3QSTA 3W7GA 3TYEA 3M0IA 2WMJA 4DJFA 5CZ0A 4UFKA 1N82A 1Q3NA 2JEQA 2FQIA 3RHGA 3PAOA 4B5XA 4ACZB 5FF2A 1GOWA 1T8QA 3GZ3A 4W87A 3QVQA 2ZWYA 2NT0A 1PYMA 1YADA 3QZ6A 4U5IA 2RDTA 1RBLA 3R0KA 3WK1A 4M6VA 2PF0A 4RE2A 4PH6A 2QUVA 3NQEA 3L4ZA 2WCAA 4S2CA 1YPFA 7ODCA 1EX5A 1SUXA 3IVSA 4AX7A 2J4GA 3SUUA 3ATZA 4F66A 5JXQA 1EZWA 3I3DA 3TTEA 1A47A 3TA9A 2DIKA 3LLFA 2QAPA 3GIQA 1EP1A 4JL1A 4W7UA 4UOQA 5LKYA 1W2VA 1JJKA 1TE6A 2XZ9A 3MS8A 2F84A 3KRBA 5D9MA 3E0IA 4ZEPA 2PDYA 4GGHA 2QCNA 1XRSA 3G2GA 3QY8A 2YZRA 5DX7A 2YDQA 4WKFA 3F2BA 3K46A 3B97A 2GPTA 5I00A 1OT2A 1HP4A 2DSWA 1IEQA 3LU2A 3NSNA 2BOGX 3T0TA 4P7QA 4FX7A 4W93A 4DWSB 3UCCA 1VFOA 4M19A 3EPNA 4X63A 1X96A 4PCPA 4G1KA 3HPSA 3EWYA 1KFLA 2WSYA 4IJRA 4NNBA 1P0BA 1F7BA 3RJYA 3HPZA 1EJSC 1K8YA 3NG3A 1QNPA 3GNDA 2YGYA 4UZUA 5A2BA 1Q6DA 5KZDA 4ZO8A 3LLXA 4ZO7A 4PUWA 1OG0A 3NXFA 5TNVA 4UMBA 4AISA 5I3KA 3ZWSA 3WNMA 5FEWA 1G4SA 3AHYA 1AODA 2C16A 2QJMA 5A2CA 3HM7A 1ZJAA 1E9LA 3CXOA 2PTWA 4PL2A 4AD3A 1M04A 4BQ5A 1ONRA 3BL3A 4L6HA 1XLKA 2DJXA 3L2LA 3W2JA 1B5TA 1QNQA 4O15A 1JDDA 4IQDA 4D1IA 1J12A 2E9LA 3DFPA 1FTXA 4GFIA 2C91A 3GNPA 4HCDA 3DFHA 1PE1A 4AX6A 2B81A 3AIVA 2IKGA 3BK0A 2C13A 1K9FA 4NX5A 4AWSA 1X39A 3AALA 2YCEA 2DZUA 1LT7A 2OEJA 4NSBA 2PDKA 1SO3A 3GO2A 1QPOA 1UPMB 4R27A 1SPQA 3NURA 2ZBTA 3LD5A 3UWYA 1IXQA 1AL8A 3I6RA 4S3DA 3W1RA 3HB9A 3CZKA 3CWOX 4DZAA 4G2DA 4D8ZA 1N2VA 5E5CA 5F1UA 3WH7A 3KBSA 3TROA 1TRDA 4LC8A 3KE0A 2OFJA 2F6XA 2NSXA 5I24A 1N8IA 3VMNA 1KGUA 1W5OA 1TV5A 4UR7A 3L4UA 5E09A 2E68A 1G1YA 4H6QA 1UPPA 1E3XA 1JCXA 9RUBA 2QPXA 3PNZA 3GH7A 4E4PA 3WK0A 4GJ1A 3WK2A 2ESCA 5I6SA 2R6OA 3VK5A 3W0KA 3CEPA 1UBSA 1TIMA 2PB1A 2HVMA 1Q8JA 3MI2A 1FWEC 5FJIA 3LMZA 3LA4A 1NIUA 5ABTA 5G1TA 5CC7A 1KXHA 4H2HA 1Z48A 1ZFJA 3TV8A 1MUMA 3PBGA 3PZQA 5F1VA 1DJQA 3LNPA 1XGZA 3V4BA 2CW6A 4UFJA 4HN8A 2WC4A 1XSIA 1EYEA 4DJDA 3KVLA 1CI1A 1LLWA 1Q7ZA 2PP0A 3VC5A 3BURA 2QZRA 4OJYA 4LUSA 1SFJA 4FNSA 2NZLA 2G4JA 1KBBA 3AHTA 4QRNA 1E40A 3NZQA 2XSBA 1IEXA 4P8WA 2IKIA 3UEQA 1BKSA 4GUIA 3A3WA 1G9HA 2AAMA 1YDNA 1SMAA 4PBEA 1DXEA 4LVGA 3P5ZA 3OQEA 2ISDA 3A9BA 1CZ1A 2JF6A 3I7RA 3WBEA 1LBLA 2J66A 2WV8A 1FP8A 3FEMA 4BF9A 3EDFA 4PMJA 3QYSA 3PF3A 1SZRA 3SURA 4MTVA 4A2RA 2FMOA 4IIGA 1XIGA 2QQ6A 1TPH1 1I0DA 4L5ZA 4DPQA 2PGEA 4FX6M 2HROA 2DT2A 4WEVX 2PDWA 2YA2A 1GPFA 2PPGA 1ZALA 4Z1AA 2C19A 1OSEA 1RPKA 2YCJA 1A5AA 4HQVA 1OJXA 2V63A 3GC5A 1OFBA 4ZSUA 3QPYA 4IP5A 4H9TA 5FSEC 1LWHA 1E5JA 4LH8A 2WNQA 4DHGA 1UOKA 3SCOA 4WVXA 1G67A 1ONEA 4W88A 1H0GA 2XISA 2ZQ0A 2BG5A 3V16A 1XDJA 2A3AA 3FAWA 2WLYA 4I7UA 4QS5A 1S2VA 2PWUA 3RAOA 3AMLA 1LWIA 3UY7A 3ABXA 1WB0A 3WD1A 1XLBA 1LZOA 4GO9A 3AXHA 3V5OA 4B91A 2HMCA 2NQLA 1G0CA 4AFYA 4FNTA 3LCIA 1V03A 1H51A 3MHFA 5GJMA 3S1GA 4AHPA 3EEZA 4FNRA 4PFMA 3QR3A 3GTIA 3KRSA 3GXIA 4H9ZA 3N12A 1VCVA 2H90A 1K7FA 1QFEA 4JTLA 1G7VA 2PDPA 4WSKA 1I2OA 2FZ8A 2JQXA 5CGQA 2C1GA 4OOZA 4C65A 2DZBA 3TE9A 2E6YA 1G69A 3BMXA 4TTGA 1O1ZA 1MI3A 3N2OA 4KRTA 5DCBA 1NFBA 4L4LA 2X0HA 5FKYA 4AHOA 4F9JA 3NUKA 2XVNA 2G3MA 3C0SA 5ABHA 5H8MA 1NY1A 3P61A 4MJ2A 1HGYA 3KEHA 4CNOA 1UR8A 3LGDA 4MYXA 5ECUA 1VEPA 4FLQA 1J0JA 1OX5A 2CXGA 4DPPA 1HG3A 3LTYA 4MWAC 3TSBA 3TNOA 2REQA 1SJDA 3UVAA 4L61A 4CN4A 4HSOA 1XBZA 3HGSA 1NP2A 1REQB 3SZ8A 2GGIA 1W3IA 3VKKA 5BXTA 3W37A 1JUBA 1X97A 1KWKA 3LSCA 4O4VA 5EBAA 2O92A 5HWJA 4LUJA 1OEPA 3TZFA 3JZUA 3BSGA 5TQLA 2FVKA 3T8QA 2WBKA 3GFZA 6ENLA 4MJZA 3DC0A 2H3BA 4ZQRA 3GRIA 3I4KA 2Y89A 4A6GA 4DQWA 3VINA 2FB2A 1HUVA 2D3LA 2E7FA 4IL0A 1EXPA 4W84A 2UV8G 5LA1A 3URAA 3W4RA 1GW9A 1KNWA 2PURA 3N4AA 2OLHA 2DORA 2NVCA 1E0TA 3G3MA 3WNKA 3AI0A 5A6SA 1I9CB 2RGLA 2J47A 3GDKA 2MANA 4PUEA 1UWIA 1TPB1 2VFIA 2WM1A 4JEJA 4AZ5A 3L2MA 4D6DA 2YXXA 2V68A 4ZBCA 1KXQA 3M0JA 3M7SA 2CZVA 1EF2A 2AAAA 4ZE4A 4EACA 3UZJA 1R3TA 5AVHA 4KCTA 4GY1A 3AZTA 3U57A 1IWAA 3DFSA 5AN7A 3CUGA 4L4MA 2FMNA 1GOXA 1ADSA 2BXYA 5F4SA 4XZIA 4L9XA 3DGBA 5M17A 3GG0A 3CHFA 2DFAA 3NIYA 4WXZA 2IKHA 1OC5A 2WSPA 4EX4A 1V8EA 3KS5A 4O1DA 3GBDA 3HU7A 4UR9A 4HMNA 4MAVA 2WXDM 1ZGDA 3E12A 1TR9A 3C86A 2GOKA 1VBHA 3BOLA 2NWSA 2OOFA 2PC4A 2WC3A 3WY1A 1PDZA 3P82A 3QGVA 3DN5A 5DQPA 5K2ZA 3EKGA 1AW5A 3P5YA 1I1XA 2C1IA 3MANA 1P0NA 3LBCA 4OVXA 4Z42C 1DV7A 2TRSA 4JDBA 3LY0A 1BSIA 1LBFA 3AU6A 2ZDSA 3VKCA 1I2NA 5CZSA 1CGVA 1XLAA 3GBEA 4JIQA 4DAFA 6REQA 4HMCA 5E0CA 3AUOA 2YCKX 4ML9A 3CUJA 2VDIA 2FDMA 5DMYA 2OX4A 1JF5A 5LIUX 4KEMA 3EDEA 2Z1XA 4HJFA 4DM2A 3HV8A 3WL0A 4PTXA 2WKGA 3EZ4A 3AXIA 3FVDA 4Q4MA 1QHOA 4A35A 3RMEA 4CD5A 1M03A 5EMYA 1WXZA 1FDJA 2YDAA 1UWAA 4L7ZA 4O11A 1ZHAA 3FYYA 1KM4A 4XKYA 3V7PA 2A3EA 4M80A 3S1XA 4Z1BA 4HIBA 1WQ5A 2R91A 3DEQA 3BC9A 2GZXA 1UC5A 1HP5A 1ZCOA 4RUBA 1TCMA 3BWWA 4A4AA 1JIBA 3W6LA 3HIJA 3TW9A 4PEEA 1PHWA 3R8RA 4HYWA 1RD6A 1PXGA 4BQ4A 5CEWA 1J01A 3FOKA 3AHVA 4GRSA 4OUEA 2WKLA 1HJSA 2VOMA 2A3LA 1F4HA 2B7QA 1XIJA 1NP0A 1GOQA 3UVIA 4B9YA 5JIPA 1FH9A 2Y2WA 9CGTA 3NOEA 1W5MA 2XVGA 3DHDA 4IMCA 3EWUA 2HRWA 4HA3A 1L6FA 1JZ4A 4CUCA 4QFUA 1AJZA 1RVGA 1NH6A 3HQ1A 4I9TA 4QJ3B 3XISA 3G6LA 2VYOA 2Y5JA 4CN1A 4HPHA 5I79A 2XTKA 5M1TA 1OYCA 2PRMA 2CZ5A 2VGBA 4E4UA 2QHAA 3FKRA 4DO4A 2DQXA 4TX6A 1Z41A 1JEZA 3N6HA 1E9IA 3NR0A 1YDVA 1XICA 3RRAA 4NY2A 1AQFA 4FNUA 4JTGA 2GVGA 3VFLA 1O68A 3GIYA 3PULA 1T8XA 3LRKA 2QVNA 4Q8VA 4LF1A 3WJXA 3W7OA 2V67A 1JZ8A 1K1DA 2HS6A 2PCEA 1B3XA 6A3HA 4GCAA 4Y90A 1GGOA 2CLKA 4US6A 1JL8A 1ZS2A 1FA2A 1TG7A 2QCFA 1XYZA 4O0KA 5EY5A 2EJ1A 2ZZ5A 4QAIA 4L6OA 4UCFA 2J7EA 4KWSA 2NQJA 1BWVA 4JTTA 3W1PA 2XIIA 1IV8A 4JTIA 4R3UA 4Y9AA 4DUOA 3MJYA 1Q65A 3PZUA 3BPWA 3IIVA 2G5WA 1XBXA 4OBRA 3R79A 1J0KA 2CETA 2OT1A 3C2RA 4CQ9A 3T40A 2XN2A 1VJZA 4I6VA 4O52A 4MPQA 2Z4GA 2CESA 1IXPA 4WXYA 2GVEA 2OU4A 3E1F1 1W3TA 3AC0A 3LRMA 3CPGA 4YU1A 4IWWA 1QOPA 3M0KA 1DP0A 3E9AA 2DT3A 2OMAA 5CPLA 3WBYA 3EX4A 4YLWA 4O57A 1U5HA 3PPCA 2XPKA 4LPCA 5G4EA 4G7EB 5CPMA 1HVXA 1MXDA 3FVMA 3A22A 2ABAA 5F2MA 5DELA 3N9KA 4XBKA 3ALGA 3V5CA 4WD0A 1V51A 1EJWC 1IEVA 1YHTA 2VURA 2ZUWA 2TODA 4RE4A 1CLVA 4NAFA 1GQNA 3H7VA 4EF9A 3II1A 2PDHA 4DBUA 3OHIA 3MDWA 3H2EA 3IJ9A 4PTNA 4MAZA 1QMLA 2VCBA 3ERPA 3ZJKA 4JKMA 3GTFA 4YNGA 2FTWA 3DZ1A 4O1AA 1EPXA 4NIRA 4Z17A 1TTIA 5TD4A 4QX4A 3L67A 1ZBKA 4EANA 1FWFC 4N6FA 3ICJA 3BLLA 4FEZA 2BY2A 1R30A 3NQDA 4H7ZA 2J7GA 4O53A 3TYZA 3W53A 3TONA 1AA1B 4XO7A 1XD0A 5G4HC 3LZ5A 2ZRWA 3B9NA 3W71A 3WLNA 1Y5VA 1ZCCA 3HPAA 2C0AA 1Z3NA 4MWAD 2OTDA 2FKPA 4EPEC 4JTDA 1V79A 4NZ4A 2XZ7A 1CBGA 4N02A 4Y6GA 3BAWA 1KGXA 3MKKA 5IBXC 2AL2A 3SEPA 3MI6A 3S6TA 1RHCA 3E2QA 1OVDA 3POHA 3ONCA 2WLZA 2NUXA 3F5KA 1D3GA 3VGHA 3A3XA 1KBLA 4NZ3A 3U2CA 3E2RA 4AIBA 5CXPA 1VAHA 5I03A 3FYPA 1JUEA 4GXWA 3UWVA 1NOFA 4FR1A 1F5ZA 1VD6A 1GOKA 4Q4QA 1QT1A 2PFHA 1L6SA 3KWXA 2PCQA 3E0LA 1A5MC 3DFOA 1T99A 3QGAC 1UWSA 4FA3A 1V3MA 1E6SM 1WCGA 4DWSC 1V0KA 2I1OA 3O6YX 1VCFA 2R1MA 5CJ5A 2HCVA 4DLFA 3T9PA 1WPCA 3U6WA 2YBUA 5T91A 4M51A 1U2YA 5CPQA 2ZTJA 3L21A 4U33A 2BSLA 4N4PA 4F0LA 3EWBX 3RM8A 4ZQNA 1R38A 2EG7A 4HTBA 1LRNA 7REQB 4WJXA 1H1NA 4H6RA 3WO8A 3OLDA 4LY4A 3FDGA 1J4EA 2W91A 5JMUA 5E6ZA 4DUWA 3VU2A 1I2QA 2VR5A 2AGTA 4QP0A 4W9TA 3NQ7A 3KWSA 1SU5A 1TV7A 4WLCA 2NWRA 3BLEA 1C8QA 3CLWA 2OLAA 4LF2A 2BY1A 3BANA 1XLLA 4ZB0A 5PTDA 2L5HA 1GT8A 5LNRA 1P1XA 4XZBA 4DXVA 3ZQ9A 2VC9A 1S2AA 4L6DA 3SN1A 2BHYA 1SO4A 4TOQA 2QIIA 1UKPA 3HG5A 4DY1A 1R3SA 4HU4A 9XIAA 2IQTA 4X2PA 2I5GA 5C9RA 1XV8A 4ZO9A 3V36A 4CCCA 3GU2A 5FJPA 4BQ2A 1DJIA 4GVIA 5REQA 5BXRA 1KFEA 1SM9A 1O5RA 2GQ8A 1Q6GA 1H11A 3BJSA 4MNLA 3KDNA 4UTHA 4QJ4B 1POKA 4HU3A 2GL5A 4MUPA 4URIA 2CHNA 3BSMA 1ZP3A 1XJBA 3BUVA 4IT1A 4B2DD 3RM9A 2G8ZA 3N4EA 4JEQA 5DRCA 1OX4B 3WL1A 1QOQA 1YNYA 3N6JA 2W9MA 4PMRA 3M4HA 1MSSA 1M7OA 4Q3MA 4QTGA 1OK6A 2VGGA 3PBWA 4LYQA 1AJ2A 5AHIA 2VZUA 3S2JA 5JBDA 1EJUC 2J75A 3MYOA 4IMDA 5C0QA 1F2JA 3CV7A 4B4HA 3ZZ1A 4AU0A 3CU2A 3LCHA 3WF0A 4OZOA 3EPMA 1G5AA 3LV6A 3A5FA 4IXHA 1FDZA 4PMDA 2VXNA 4JQ4A 1MW0A 1MXSA 3N9RA 4AY7A 3K4WA 2DVUA 2PZNA 4Q4OA 1V93A 4L4PA 4A8RA 1H7OA 4F2TA 5I09A 4A29A 4P8XA 1IZCA 3HURA 3LTSA 1DHPA 1R6WA 1V08A 5HBFA 1E6RA 4C90A 2PUZA 3E2VA 1JFHA 1V4YA 2ATMA 1TPFA 3M0HA 1R3QA 2VEFA 1KRCC 3LERA 4OWGA 1M53A 4JTKA 4G7FA 2YL6A 2YX0A 4NJJA 3SQMA 2R14A 3NO5A 4UFHA 1CGWA 4WX2A 1U22A 3GX9A 2CXEA 1IXNA 3ZSSA 2NQHA 1H49A 2FTYA 4ZE5A 5EMUA 3LGGA 4XZNX 3NSMA 4TVDA 4HNVA 4FIQA 1XC6A 1K70A 2W66A 4LYKA 1G4PA 4DUXA 3SQSA 2PF8A 2YB4A 5HQEA 4YYFA 3NAVA 1LOLA 2W5FA 5H2ZA 3S3GA 3S4TA 1WBJA 1ZLPA 4AZGA 1UROA 4UBPC 3MV11 3RIKA 4XZWA 1HKVA 2HPIA 3GUWA 3SUSA 1OC6A 3KAOA 2EBNA 1EWDA 3VA8A 1ITUA 5HQLA 3K2GA 4NNCA 3B8DA 5C55A 1XKJA 1J0ZA 5DRIA 4DRSA 1RQEA 3GTHA 3H2FA 2BXZA 4DO5A 2O9RA 2OOGA 2R1KA 4JD4A 2V2DA 2WYSA 1HJXA 1CXEA 3VGFA 4NG3A 4C6JA 1R86A 2V3DA 4H8VA 4J9JA 1W56A 3GVGA 4ZOCA 1XYFA 5JVLA 4IHCA 1V0MA 3A4AA 3H8AA 2ACRA 1PL9A 4EE9A 1OY0A 3G1VA 3O15A 1YIXA 3T42A 3SCNA 3OOQA 4A8LA 1O5QA 4TX9A 1X6UA 4FF7A 4RJEA 3BH4A 1BTCA 4FOJA 1W5QA 3PNUA 1US0A 4PUDA 1F76A 1VBUA 1DL3A 1W9XA 1R3RA 2H3DA 4NZCA 1O12A 4IGHA 3RR4A 2G50A 5A6AA 1JI2A 2P0OA 5AECA 1OG6A 3OQ8A 3VNMA 4HA1A 4REQA 4K7VA 5HPOA 3MUXA 2ACUA 3VZYA 4Y8FA 2VEPA 3TXZA 1XWYA 1TE1A 2C3ZA 5CG7A 1FWSA 4L9ZA 3I68A 5G2IA 2PDFA 1DJXA 4G1NA 3W02A 2C79A 3W7EA 3WH5A 1O66A 4U31A 2XUCA 4C6DA 3K1DA 5A94A 5E9XA 2VEIA 3NQ6A 4EVZA 1EC7A 1GZ1A 4ADTA 2BY0A 2Y5SA 4GY7A 1QBAA 4C1NA 3MSYA 1VLWA 3CLMA 1KA9F 4K7YA 2CWXA 2X1IA 1FHUA 3O6AA 2WMGA 3KFTA 3H22A 4FLSA 1I60A 4L64A 5FI8A 3WEOA 4V2XA 1UBPC 2P3EA 5EYWA 2LLEA 4GI9A 3VVGA 5HJYA 4LALA 2ZUNA 1VENA 4KGJA 1DEDA 2Q01A 1DJNA 4R33A 2UY2A 4NZFA 3NQGA 1TZZA 2OZ0A 5CZKA 4D9PA 3J7HA 5IOBA 1XS2A 4PMZA 3BVJA 2FGLA 1E3ZA 5I3DA 1D8WA 1GVEA 3FJNA 2QPUA 2VCAA 1W5NA 3F4NA 3MO4A 1QATA 5E9AA 3OU8A 2GWGA 3GVQA 5TAOA 1XC4A 1OADA 2VO5A 1GJUA 4H8NA 3VGGA 1OB0A 1REQA 3RK8A 1E15A 3S47A 4KEVA 3VILA 3ZT6A 1XYMA 3CL7A 1MDRA 3WMCA 3Q94A 3VZZA 4CU6A 3F5JA 4D8LA 3WD4A 2J7FA 4RZ5A 4GNKB 4UTLA 3VE7A 3D6NA 3OZYA 2UWFA 1P43A 4YVPA 3WDRA 1VIZA 1W91A 3MJMA 1S1RA 3GU9A 1ZBVA 3KRUA 3HQPA 5BOOA 1VFHA 4AMCA 2G3JA 1LUCA 4DZHA 1XH1A 1TCDA 1OD8A 2HISA 4LOCA 3C3NA 2V38A 1TV8A 2PD5A 3P74A 1PZ3A 9XIMA 5FD0A 3DOPA 1Q6RA 5EA9A 5LHEA 2OEMA 1JVNA 2YW3A 1DWAM 3TZNA 1CYGA 4HOXA 4DWSD 3CPRA 4UFLA 4ZENA 3S83A 2WQDA 3PTQA 4IX0A 4E8DA 4HB7A 3M0XA 1TWZA 4YL2A 1VP5A 3E49A 2BVTA 5IHRA 2QGYA 3OJGA 2VT0A 3L0GA 2AOSA 1VEMA 1US2A 3G1FA 4NJIA 1E72M 1WKFA 3S2CA 3KLKA 3OYXA 2AL1A 3SJNA 2QUTA 1XQLA 7TAAA 4MY8A 4GIAA 1OFQA 3BOFA 2J8GA 3D3AA 4UTUA 3F4CA 1EZ2A 4L1XA 3PFMA 3JR2A 2IMRA 5FF3A 1QPKA 4FS9A 1B3YA 3H54A 3R0DA 1RJRA 5H8PA 3IV3A 3PC0A 2A3HA 2KAUC 4KERA 4Z1YA 1YLVA 4R34A 1CTNA 1HKMA 3E96A 3ITGA 3BQ6A 2IXUA 4ERGA 2ZZ3A 1YXDA 2ZRUA 3WF2A 1E4LA 3QEZA 4DXKA 3MVTA 3BW3A 1QCWA 2RKXA 4JS3A 3RGTA 4Z2HA 3LV5A 1FKXA 4B15A 3WQVA 3WJZA 3UW6A 1KM2A 4HSNA 2J8FA 2GGGA 1VFUA 3VC6A 1N8WA 4GYKA 2FFIA 3ABSA 2J7DA 1VFMA 3ZT7A 4G5DA 3VKBA 2YW4A 4XX6A 3GVRA 3NQ2A 5CPNA 5AHLA 2IQ0A 4WR3A 5I3IA 3D47A 2BV9A 1ITXA 1R9ZA 5GNZA 1LBMA 3KVKA 3V35A 2UY4A 5C2GA 1DJGA 5D09A 2WCSA 2ZICA 3I65A 1V5XA 4JY9A 1F07A 2I9UA 4UIOA 1I1WA 2OCZA 3AYSA 2WZIA 2C0HA 1JGIA 2D69A 3G1XA 2JE8A 1AG1O 2ZA1A 2X1SA 1P4CA 2XVPA 4LTSA 3CQKA 4PMNA 5M03A 3USBA 1Y5WA 4RPPA 2VFGA 3SRDA 2F8QA 3ZLGA 4OECA 3LX9A 5BU9A 1QPRA 4PB4A 2F38A 3OLIA 4P7NA 4D1JA 3NXLA 3ARWA 3XINA 4MZ1A 4AZ6A 3E6EA 4XAGA 2B31A 4K37A 5BROA 2Y8VA 3PZIA 3WDIA 3WLTA 1TPC1 3O9NA 4QJ5B 4R9XA 3RPMA 1VYSX 5SWUA 1XFBA 3KP1A 2J79A 1BF2A 3FN9A 1OHLA 4K6AA 4WY0A 4DJEC 3WUBA 3TJXA 2Y24A 1XISA 5A8QA 2NUWA 2B7OA 1MUWA 2ZXBA 1Z6KA 1W31A 4LAKA 3M0VA 4XWUA 3CQIA 1OGBA 4HK7A 1UOZA 4RV8A 2CCRA 5A8PA 2G37A 3QC3A 1VF8A 3IK4A 1DWJM 4WF7A 2OXNA 4JQ1A 2P53A 4C6CA 3T1GA 4AWEA 3SCSA 2PDLA 4H9YA 3GR7A 2UZ9A 1XH0A 3PTDA 3GFXA 2ZUVA 1UH4A 5A8OA 3BLIA 4KIEA 4GLEA 4GI6A 3LSBA 1D2KA 3WQ5A 3FJ4A 3ENLA 5FF7A 1CLXA 3S2NA 3PHAA 5A8NA 3H2AA 3EX3A 4C1LA 4GIYA 4M24A 3W82A 4IIFA 2TMDA 2TAAA 4TV5A 3S5SA 1VJIA 3EOUA 1UASA 1EWEA 3E74A 1R7OA 1OFEA 1RVKA 1KTNA 3GZAA 1Q63A 3M0MA 1XCFA 1CNVA 1RA0A 1B2YA 4BI6A 4JX5A 5D05A 3WKZA 3IIXA 1FCQA 3GHTA 3C0QA 2HZGA 1WV2A 2XIOA 3QOKA 1K3UA 3L65A 3W7JA 3VNYA 5JH2A 4K3ZA 2EAWA 3OBEA 4PSRA 2AKMA 4GC4A 3KW3A 5DANA 3GHSA 1XP3A 4R53A 4D6EA 1B4KA 4M5PA 1FWJC 1XLEA 5FACA 1FWTA 4KMQA 3W27A 1TMLA 3WDPP 3MV01 4EXQA 1J6PA 1XDLA 1DJYA 3R43A 4JHOA 4O1FA 3AIUA 4IGNA 3QR1A 4PR4A 3KZPA 3Q67A 7TIMA 1XKYA 3GXFA 4J27A 2BZNA 2QUMA 5E70A 4BJHA 5U4NA 1HQTA 3GXTA 2JIEA 1YE4A 1BXBA 1TV2A 1UJQA 2ZUUA 1RBOB 3LM7A 2VR4A 3AWNA 3ZT5A 3ARSA 1LL6A 4I8YA 1EDTA 1H09A 5I07A 3LQLA 3V18A 4KW2A 3F4WA 3QJAA 3M5XA 1JXJA 4ATDA 4AAJA 5K9DA 2ZC8A 4DX3A 1GVOA 1HL8A 1TSIA 1VPXA 3CBWA 1W3HA 4B92A 5BCAA 1ALDA 3O1NA 4NRSA 3U8GA 1LT8A 3K5XA 1WZKA 4NJKA 2RHGA 3TKFA 3R58A 3CC1A 2Y7FA 5I3JA 1JF6A 2PLJA 1GPWA 1SYTA 3I7QA 4EPBC 4XG1A 1F73A 3EYPA 4O1CA 3P60A 2EPMX 4M3PA 1GEQA 2P1FA 5EB8A 2D23A 2D0FA 2V82A 1P0EA 2J62A 2A3BA 2E67A 3DKLA 2ZVIA 3URBA 1RSCA 1VRDA 5B7ZA 6XIMA 3B8WA 3V0UA 3AHZA 1XG3A 2BHZA 1X38A 4HZ6A 4EKJA 3W25A 4JHZA 3ABQA 2WMKA 4HJWA 3NOYA 4AIOA 1TMHA 1XGDA 1EEPA 3P81A 3E0VA 2Z0IA 3IGSA 1PBGA 3FV9A 5MHBA 4IMFA 4GA8A 4NX0A 4MLRA 3KX6A 2GQAA 4JTUA 1YX1A 3UZYA 1V3LA 1YTDA 2DZVA 1PWLA 1J11A 3VOGA 5KSWA 3TJ4A 1ZTVA 4Y9PA 4O10A 1M68A 1PDYA 1LOSA 1R47A 4C6PA 3KRZA 3RR1A 4LUSB 2BGSA 3W88A 1V6VA 5FEPA 3EX6A 1F3XA 1CGXA 3FA5A 3EX2A 4EAYA 3COTA 1VIWA 3BW4A 4WDXA 1XINA 1KR1A 4D6HA 1OF6A 3AYTA 3GG7A 3RU6A 2FLIA 1Y65A 2OGJA 2YLLA 3KP0A 3WLSA 4W8AA 4MLJA 2QULA 3R25A 2D20A 5CSYA 1JNDA 3HBLA 2GDVA 3BG3A 3RO8A 2DSVA 4S3GA 3NPXA 1Q4NX 4PCNA 3CV2A 2GGEA 3STCA 3ANVA 3RUBL 3STEA 5D03A 4MUZA 3W73A 5KZMA 4F3HA 4ZQOA 1K6AA 4HPJA 2XFRA 2YCLB 3LB0A 4UTTA 3WH6A 3CIVA 4C6BA 2P76A 3BMWA 4TQTA 5A6MA 1GZGA 4QG8A 3FCPA 3VTRA 5F4WA 5CZTA 4H04A 3KL3A 3B4UA 3TP4A 2V5BA 1HIZA 3P14A 3OZOA 3PANA 3C0LA 5J04A 2X7WA 4UXDA 3WD0A 4YXGA 3PJUA 1ZJHA 3MKCA 4FXJA 2XH2A 1OGSA 3IWPA 1FWRA 3U48A 3ABOA 1XI3A 1BF6A 5CQ1A 3QKEA 3UPWA 1R87A 1JCMP 4LV9A 2R94A 2IPWA 2FPTA 4O4WA 2NXIA 5FF4A 5D8ZA 4HNLA 4JKKA 1C91A 2A7PA 3UESA 4LUYA 3R2GA 4ZQPA 5HA7A 4IUOA 2DIEA 3T2QA 1X1NA 4BY3A 1L9WA 1EIBA 3T44A 4OIFA 3ITYA 4H19A 3MZNA 7CGTA 4LY8A 4LCSA 2XN1A 3UZXA 2GUUA 1OX4A 1XIEA 3N2MA 1A49A 5A5WA 1UZ1A 3L4YA 3SAZA 4XIMA 4IP4A 1J5TA 4B90A 5HXMA 2A6NA 1UUOA 3HGRA 4JIPA 1XPGA 3WNOA 4AYGA 2NQZA 4ZB2A 1WOAA 4FI4A 4NNAA 3UWQA 3WBWA 1KRAC 3LHYA 1L6GA 2VTFA 4JIRA 2Z1VA 3T0CA 5MKGA 2Q71A 3P2VA 4MZYA 2XVKA 3MHGA 3W7NA 4NUWA 2E4TA 3NO3A 2J13A 4WOQA 1UUQA 2GGJA 1W9PA 1MNSA 2WC7A 2REQB 4C60A 5C6MA 1X6LA 3VAVA 5M3WA 3EMZA 4N42A 1SGJA 1TTPA 2TSYA 2XGBA 4XD6A 4HU8A 3NM3A 1UD6A 1ONWA 5A2AA 3UETA 3NL2A 3WLJA 2X16A 4I6KA 1UWUA 1VPQA 5BZAA 3SIZA 1ITQA 5A95A 2XGIA 3UXAA 3N1AA 1MYRA 3BLKA 1NTHA 3NQCA 3PN8A 3IS4A 1AMYA 3IVTA 3WQFA 3W6YA 4NXSA 1E43A 3UP8A 2DZSA 4R9OA 3SGZA 4UQCA 3QN3A 1C92A 2CERA 3UG3A 3CS2A 5FJRA 3N9SA 4QDMA 3W1QA 3TSDA 1Q8AA 1R85A 3EWDA 4DJED 3R1ZA 3SFWA 4N9DA 3UGVA 4ZSTA 2WSRA 1TX0A 3B0PA 4RL3A 2Y0FA 1FXQA 2G97A 3ZLHA 5H8UA 3AO0A 4ZFCA 2B7PA 1E71M 1BFNA 3CAVA 4GACA 3QSRA 3EPOA 5D2YA 1JZ3A 1UJPA 1XRTA 1W1TA 4QDWA 2FVLA 4OFCA 3G22A 1EJRC 3ITOA 3GKAA 3W72A 4MFDA 1E51A 1V77A 1BPLB 3W01A 1VB9A 3PPFA 2IQDA 1OFAA 3MUAA 3AJXA 3IIOA 3LM3A 3MUIA 4EWJA 4AF0A 5ECVA 2D2GA 3THDA 1JAKA 1VPYA 1CXLA 2PS2A 3OB8A 5J5RA 1Q4WA 4GUHA 3QZAA 4W5ZA 2FHFA 3VDGA 4MADA 5LXXA 5D9OA 4AC1X 2DUAA 1PVNA 4NZ5A 3G0SA 3NGJA 3R89A 4QITA 1WA3A 5E6YA 2E5DA 1DTNA 1UP3A 3Q65A 3S2MA 3OYZA 2J9XA 4ZODA 3T55A 4FOKA 3NM1A 5HMEA 5G1YA 4JIHA 3WQCA 3P7YA 3VCNA 4W8LA 4O19A 3KLLA 3USZA 3UR8A 3WNLA 4EXAA 1GVFA 2JKEA 1WE5A 4ADUA 3B8IA 6REQB 4CVWA 3CUIA 2CYGA 5A8GA 1NOWA 4E2DA 1TUXA 2V30A 3G24A 3VNDA 2DDXA 1U1JA 2VNCA 3ARQA 2Z25A 2WB5A 2I5IA 4TU1A 1M7XA 1IE7C 1UIOA 3B9AA 1B0IA 5KZ6A 1ZUAX 1H7XA 1W1B1 2NXGA 4L4OA 4DBEA 1FWNA 1OFRA 1F8MA 3LCLA 1SSDA 1KCXA 2PDCA 1PKYA 3BTNA 2OVLA 4GZEA 4QQ3A 2GVYA 3GC2A 4A8NA 1GK8A 4XKYB 5HPCA 3S42A 4FIRA 5KZEA 2WZEA 3C52A 1FDYA 3W1TA 3TFCA 2X30A 1QI2A 3ZJ8A 1EX1A 4XQ6A 1GYLA 2QR6A 5D02A 2WWDA 3W87A 2QDGA 4J3WA 4NAEA 1VFLA 4WDUA 3K8LA 3PY2A 4X0VA 4QDPA 3UGRA 3WUFA 3EKZA 3WX7A 1XGEA 3SJ3A 2J24A 3CIWA 2DH2A 3ZJ7A 3G0UA 4IICA 4S3BA 3EKLA 4JXCA 3T09A 1P7TB 2C6QA 3DU0A 3L4XA 4C6EA 1TWIA 3IIPA 2XM2A 3VUPA 1UZ4A 2ZZ7A 3LCWA 5CBJA 1KV5A 1W9VA 2CPUA 4Z08A 4C6LA 3I10A 4KPLA 3H2MA 4DZ5A 2VELA 4J3VA 1TWSA 3HG2A 4XKMA 1AW2A 4C6KA 3WH9A 3ZR5A 5FAGA 1YRRA 3AOFA 2PGFA 3GR4A 2HXTA 3VX1A 4AWTA 4J3SA 2E25A 3T07A 1B54A 2QT3A 3G3DA 1DE5A 1IEIA 1L6YA 1XW8A 1H0IA 4Q8QA 4MNJA 2PTDA 3AUJA 1P48A 1JG9A 4ZMGA 4AQLA 1MRAA 1MVYA 4H41A 2F9RA 3WH8A 4C7FA 4GPNA 1W32A 5AC5A 5AHFA 1VLIA 3G5EA 2WMFA 4B5NA 4DBSA 3UJRA 1MWOA 1UHVA 3PG8A 5A1AA 1BYAA 3GR8A 4GD0A 1FWCC 4J7RA 4AZBA 1UKQA 2PP3A 4O18A 1RK6A 5XINA 3DG3A 1PKLA 2GGHA 3APYA 4F0SA 1C93A 2PDNA 2ZIDA 5A8MA 3QV9A 4F0HA 4PMXA 4FZIA 3UWWA 5G4WA 1SZEA 3CAWA 1XFCA 3CV6A 1JRCA 5D2VA 3TEVA 4NRRA 1G4EA 4O1BA 1JCNA 5BYWA 4GINA 2WPGA 2Z2UA 3BAKA 2POTA 1WOBA 3F2CA 5K9XA 3ABZA 3U3HA 4JHMA 4NYUA 1EJVC 1AQMA 4UFMA 2IXVA 2PBOA 3QGKC 1PZ1A 5GNYA 2QCCA 1C8VA 4PEKA 4GBUA 3A3HA 2Q02A 1UIPA 2VX6A 3OZPA 5JIWA 3UA3A 1RPXA 1E1CB 2EJAA 4GZJA 1HKIA 4PN2A 4ROQA 4Q8PA 3WLMA 2PP1A 1R46A 2YBVA 4X3ZA 1O4UA 4LANA 1W17A 4HNNA 1EBGA 4I5XA 4E8CA 1RP8A 1YQ2A 3WD3A 5CPOA 2C14A 3A12A 1UQYA 3TTYA 3PZMA 4NJGA 3WJWA 3GDMA 4KRUA 4FNPA 4NAFB 1NF7A 1E0WA 4UZSA 3WLLA 3LHZA 3KBWA 5IDZA 1QK0A 4X0NA 3W1XA 1DJWA 3LZ3A 1XM3A 4GI8A 2E0PA 4KRZA 2ZZ6A 3UWEA 1RQBA 4H6KA 4O28A 3B0UX 1US3A 1EPVA 3N2BA 4RE3A 1ZL1A 3A4JA 2GDQA 2HK1A 2B4GA 5F2IA 3UCQA 3W7IA 1NELA 1MQQA 2PRLA 4IIEA 3GU1A 1JZ2A 4M82A 1UH3A 4JR5A 3UPMA 4LB4A 1JPHA 4N9BA 5I06A 4C5ZA 1UP0A 1GUVA 2X0SA 5T9BG 1S1PA 2QLYA 3WD2A 4M56A 2J77A 1BYDA 4RK8A 3R12A 4QGCA 4DJFC 3N25A 2PODA 1JDEA 4IMGA 2GJNA 4IPIA 1KTCA 2RJGA 3H23A 3PBVA 1HKKA 1H61A 2OPJA 3P8IA 1PJ9A 3RPDA 1AMKA 4LAOA 2ZX7A 4EF8A 5JBEA 3K4DA 4Z2IA 2NX9A 8RUCA 4HPXA 4LUIA 4R85A 2CU0A 3VNZA 1F61A 4MIMA 2HSAA 2AL2B 2VD8A 4BEQA 1M5WA 2NV1A 3W2LA 3UXDA 3Q58A 2NVDA 4PUNA 2YPIA 1XIHA 3VUSA 5DF0A 1EGZA 2WNNA 1XIMA 4YWSA 2YA1A 2X41A 4D2JA 2NX3A 5HNUA 3EA3A 1W0MA 1BQGA 2WZMA 4XVDA 3HMCA 4PCTA 3JS3A 2QYGA 1AQHA 1QNRA 1DIEA 2ZXQA 2H8XA 4KFOA 3TX9A 4AG0A 1LL4A 1FHDA 1MUCA 5IRPA 2GSJA 1QO5A 3TOYA 3N14A 3PBUA 2GWNA 2GUBA 3B4YA 3IANA 4FNQA 4MSSA 4FMVA 1I0BA 4R7WA 1PSCA 5A6BD 4DYEA 2VWTA 2VFFA 4LS1A 4ZQMA 1V0NA 1Q6EA 3FAXA 2PWGA 4JBRA 1WKDA 4DO6A 3LHUA 3GG8A 4NT0A 2D2JA 1VC4A 1TJ0A 3FS2A 4AHQA 2Y62A 4CU7A 4LAUA 1KFBA 3O6CA 1HO1A 3U5UA 4BF5A 1SFLA 3W7QA 5KETA 3PG9A 4NASA 1GJPA 2J25A 1JULA 3VKJA 2BVWA 5A3HA 1UW9A 4U2YA 4H4IA 2VCCA 3W9ZA 5TIMA 1QWGA 2OR2A 1XYAA 3TQ0A 3AU2A 2NVAA 5IFPA 2BNJA 4QISA 2G95A 1RY8A 4QM1A 5T9CE 4H2CA 1NDYA 1GOOA 5JH1A 2OGYA 1XBYA 4QLKA 1OBAA 4LVBA 2F6UA 1QNOA 1BVZA 1GJWA 5TF0A 3VOHA 3WUEA 1T7LA 3SO7A 1R3WA 3RYSA 4JQ2A 1X8FA 1M41A 1QI3A 4LSBA 1NJJA 1JUKA 3RITA 5CJMA 3QV8A 1QW8A 1ICSA 3IPWA 1F8IA 2F6KA 2DU2A 3MBDA 5HUPA 1K4GA 1JR1A 3BO9A 5REQB 3VCCA 5AVNA 1GOMA 4KCUA 3KUMA 3W24A 5K4XA 4O13A 3DIPA 3UD6A 2DJLA 5I7GA 4UNKA 2Q6ZA 4DLMA 4YHGA 1CECA 5LA2A 4R5EA 4DUVA 3AXMA 2VFHA 5CSSA 4JIIX 3H7UA 3GC4A 3OVRA 3VYLA 3G6MA 2WVUA 3O0FA 1EO7A 2E3ZA 4N9EA 5HULA 3CUZA 2OB3A 5IDIA 4RV3A 4XTIA 1ZY9A 1BTMA 4FP1A 3SY8A 4PMOA 3IUDA 4WIWA 1B90A 2OELA 4Y8EA 1C9WA 1MMFA 1JAEA 2P3ZA 3NEVA 1KFKA 4O8AA 3TTOA 1Q6QA 5A69A 2DSKA 5D37A 2PI6A 2WBGA 1LJYA 2ZX8A 4AD4A 3PUGA 4C1KA 4EOUA 1A50A 3KL5A 1UWTA 3THQA 2J6VA 4DM1A 3ID7A 1TPUA 2ZRVA 3B9OA 5RUBA 3RLGA 4IPNB 4UTMA 1XL9A 1ZAJA 3CWNA 4LW7A 4ZTXA 1UKTA 6TIMA 3NQFA 1KRMA 4LBUA 4K8HA 1LQ0A 5IXEA 1ZPTA 3TQKA 4MYAA 2RAGA 4PBFA 5C9ZA 2W0UA 4IQLA 1S39A 1MQRA 1KKOA 1R2RA 3ARZA 3WLPA 3L0KA 3C2YA 4V28A 1YDYA 1YXYA 4DJDC 2FVMA 2QDHA 4EAMA 1EGMA 3KTCA 1IR1A 4I7VA 3ZJ6A 5C7HA 1EOMA 3M5YA 2QJGA 4H9UA 3O16A 5D9NA 1MZHA 3H70A 5LIWX 3PTMA 1WDDA 1UD4A 1TRIA 3GDTA 4KESA 2ISFA 4AW7A 4RNJA 6XIAA 4ZXOA 5CC5A 4HOZA 5F2LA