1AW1A

Triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHAESDEFVAKKFAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Triose-phosphate isomerase (TIM) of the psychrophilic bacterium Vibrio marinus. Kinetic and structural properties.
pubmed doi rcsb
source organism Moritella marina
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
total genus 91
structure length 255
sequence length 255
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1aw1A00
1SR9A 2PCQA 2V0TA 4AMAA 2PURA 4NJIA 4MLRA 3N2XA 5DXYA 3MUXA 3NM3A 3O15A 4WXZA 2YSWA 4LOCA 2ISVA 3DFSA 3LBCA 3B05A 3G3DA 1W0MA 4LVAA 1KBJA 4QNWA 3QW4B 3FOKA 3M16A 5D38A 3L67A 1WV2A 1L6YA 3LCXA 1B3OA 1JUKA 4JR5A 3Q94A 3IGUA 2ZA1A 5K7JA 5C6MA 4IQLA 3W7CA 1K8XA 3TU9A 1R2SA 2BTMA 5F4WA 3MHGA 1ZNNA 1ADOA 3PY2A 1W31A 5CPMA 2CLHA 1XFBA 3EWZA 1KBIA 4K7VA 1IIHA 2JGYA 4E38A 5HINA 1W5QA 4Z08A 2FPVA 3NQAA 4DEFA 3G0XA 4OQVA 1TPH1 1TV8A 4UFJA 2P10A 4A2SA 2EKCA 2VFIA 1YDVA 3M5XA 1KLYA 1A5CA 3ANYA 2QEZA 1L6WA 4S2BA 1ZCOA 1P0NA 2E6YA 2WNQA 4ADSA 4X9SA 3TSBA 1HFBA 3WK3A 3LTSA 2Z6IA 3W2LA 3WJXA 5CGQA 1KTBA 4LVDA 3VNDA 4HNVA 3F1QA 3QQ0A 4HPXA 2P1FA 3WJZA 1YTKA 3TV8A 5D2XA 1OFEA 4ORIA 3R8RA 1LBLA 1PE1A 3E96A 4L4LA 5TIMA 2FB3A 4ZQMA 3UZ5A 3LBMA 2VELA 2QUVA 3GZ3A 4O1BA 3W86A 4HKPA 3LV6A 3M9YA 3NQ8A 3P7YA 4FXSA 4O11A 2ZRZA 2NV1A 2NUYA 1FWSA 2DZTA 2F84A 4NXSA 2V9DA 2QCDA 4MZ1A 3GDRA 4K39A 4MY1A 1KFLA 5KSWA 2TMDA 3ABRA 3LI0A 5HJLA 1JCJA 3G1HA 5D37A 3EWBX 1GVQA 3FFSA 4DF1A 3KOFA 5EY5A 3C0JA 3B0PA 3OG3A 1LRNA 1KV5A 3SY5A 4H4IA 2DZWA 3OHIA 3QF0A 5FESA 2WPBA 5K4ZA 5DBUA 1QNVA 4JYFA 3RNDA 1DQXA 3SZ8A 3CTLA 3IIZA 4RZ4A 3NQDA 2GQ8A 1K7EA 3DU0A 3M41A 4TX9A 3UZJA 2CLIA 3L5MA 3NQ6A 4CCCA 1QMLA 3S5OA 2Z0IA 4CQ9A 1ONRA 1XDMA 3DI1A 4X3ZA 4M6PA 3F4NA 1OYCA 4UTTC 3GXPA 1HO4A 1GG1A 2H3DA 1BKSA 3PS7A 3Q58A 2YDAA 4K7YA 2BSLA 4GNJA 1GJPA 4WY0B 1UJPA 1TRIA 4EIVA 3GNDA 3PUEA 1H7PA 3QFEA 4UCGA 1L9WA 1JCYA 1Q6OA 2ZQ0A 2ZRXA 5EA9A 4YL2A 2VKZG 4M6QA 4XZ9A 2GQ9A 4JTSA 3LXAA 2ZZ6A 2DZUA 3L2IA 1TYGA 3M5YA 3MP5A 4JTLA 4JN6A 2GQAA 4JTFA 2G96A 5IBXC 2H90A 2R8WA 4DELA 2JKAA 1RZMA 2ZRUA 4K6AA 3LHTA 5CZ0A 1VC4A 2YYTA 1GWJA 2GUUA 2VC6A 3MWAA 2JBMA 4NUWA 1VPXA 3GAYA 2Y63A 1FUYA 4DPPA 1TPB1 4FXRA 3PB2A 5ABTA 5CPOA 2XN1A 1JCLA 2E6AA 3PSVA 3BW3A 4XBSA 2RDUA 3W72A 1RQHA 3W7JA 3VI2A 3E02A 3KRZA 5KTLA 3TNOA 3LHYA 2XN0A 4WY0F 1TREA 5AHMA 3HPSA 3DFNA 5D09A 4MPQA 2RH9A 4Z1DA 5L6UA 3TJLA 3F4WA 5F2GA 4MLJA 2CLMA 3W1XA 2UV8G 4QJ1A 1H7OA 3CWOX 4OT7A 1RQBA 3M44A 1VYRA 2ZZ3A 2ATMA 1Q45A 3N19B 1DJNA 3E0IA 4GJ1A 4I9AA 3NDOA 1WAUA 5DBTA 3RLVA 2D73A 5K2ZA 1ZALA 3M5VA 1DHPA 1I2RA 1B4KA 4J9JA 4QM1A 5HNRA 5TQLA 4LC8A 2VFHA 1R2TA 5C2XA 2DZVA 2GVJA 4P2VA 2ZCGA 2A1YA 3PBYA 1Z41A 4BK9A 1FCBA 3O63A 4O10A 2NXGA 2HSAA 3LGEA 4RK8A 1EEPA 5AN7A 3STGA 4A21A 4DPQA 4IUOA 1FY6A 4KKXA 1AW2A 1QPNA 4NJJA 2CZFA 2QCHA 4LS1A 2AQWA 3JR2A 1A50A 1QCWA 2X1RA 4MIMA 3CIWA 5BOOA 4UNLA 5FF7A 1I2OA 3RU6A 4K38A 4O15A 3P62A 4LS0A 1KLZA 3I7SA 4ICNA 1SUXA 4IMGA 4RX0A 2FDSA 2ZZ2A 5D02A 2B4GA 3HB9A 3N3MA 5D2VA 5KZEA 2E6DA 4R34A 2V2DA 1QAPA 5LKYA 5E93A 3LX9A 3B0VC 4MVAA 2Y7GA 3OBKA 1V7YA 3TJXA 4RXFA 5J5DA 2JKPA 1DKWA 4WJEA 3R89A 3TKFA 5A8GA 1F6KA 4KWVA 3L5AA 3NG3A 3I68A 3MBFA 4GRSA 3AJXA 2RDTA 4NX0A 5LZLA 3DKLA 2FQIA 3W7OA 4O18A 1VR6A 3DFQA 1LRTA 4XQ6A 4Z1CA 2PE4A 1MEHA 1R47A 4JYDA 3E49A 4HHPA 1TIMA 1P4CA 1O5KA 1OX5A 3C6CA 4HNNA 1U83A 2V2CA 4X2RA 1VJIA 3FIGA 4N9CA 5AHEA 1KW1A 3RFAA 1MXSA 1K8YA 5AC7A 3SFKA 4QISA 3CEUA 2WSRA 1RD5A 2AGKA 7TIMA 1OYBA 1I2QA 3LCWA 1F2JA 3MI2A 3BLEA 1S3HA 3SR7A 2WSQA 3FS2A 2J27A 3LRKA 4U28A 1WBJA 3L68A 3TE9A 4IX2A 2YFOA 3GNNA 1NF0A 1TPFA 1JCMP 1WBHA 2OT1A 4UMBA 3LHUA 2FIQA 4BWLC 3M1ZA 4EOUA 2LLEA 3OVQA 1XBZA 2I14A 1H7XA 1Q6LA 2EF9A 4RV8A 3C2OA 3WJYA 1Z42A 1A5BA 3LXBA 4IXHA 3O1NA 3R13A 4JS3A 4LW7A 2X16A 3S42A 3IRDA 1EWDA 2GJLA 3P81A 4QAIA 2J88A 1ZAJA 3SIZA 2HTMA 2Q3OA 4KFNA 3G1XA 2ZYFA 1K3UA 5K9XA 3PM6A 4AHPA 4BF9A 3KVJA 1SZEA 3GR8A 1X1OA 1PCWA 3L9CA 3NPUA 3TC6A 3A21A 3FEMA 1OHLA 4C1KA 1J4EA 5FF2A 4EVZA 1N55A 2H6RA 4GBUA 1OYAA 4O57A 4AH7A 2VEKA 3W1UA 3G8EA 1WQ5A 2CZDA 4M6VA 1E51A 5HUOA 2C15A 4LUIA 3DZ1A 3EKLA 3LXCA 1I45A 3M5ZA 3TAOA 4UMCA 4WD0A 1B57A 1X6UA 4KFPA 4UIOA 2WKJA 1LTDA 5FF4A 1LOLA 3P67A 1QR7A 5HWNA 2CLEA 2TPSA 1UB3A 4MFEA 3QPYA 3W7HA 2R14A 2YCEA 4K37A 5D30A 5DCEA 5C55A 4O17A 3O07A 2X1UA 5G5IA 3NPXA 1H1YA 4CNPA 1S5WA 3O6YX 2Y7DA 2O7QA 3NL3A 5AHLA 1OFQA 4Z1BA 1SO5A 3W1TA 3BGGA 4A29A 1TJPA 3P5ZA 1VS1A 3P8JA 3TH6A 3G1AA 3RK8A 3HMJG 1K7FA 5HUPA 1W3TA 3OA3A 2BZNA 2OJPA 3NEVA 3FKRA 3BGJA 1SQ7A 4UTTA 1KFKA 1Z44A 5H91A 1F05A 3D0CA 3NNTA 2ZZ7A 4BI7A 3W2MA 1EPXA 4IMFA 3SI9A 4LRTA 3UXAA 4N9DA 5F1UA 6TIMA 3FYOA 3O06A 1V5XA 3C2VA 4HSNA 3OVRA 2CWNA 5HWJA 5I3HA 4UR8A 3LLDA 3I6RA 4O4WA 2YYUA 1WDWA 3CEPA 4UTWA 3MI3A 1G4EA 4N4QA 3KVKA 3U8GA 4IWWA 4OGZA 5F1VA 3W2KA 2GVLA 4DBDA 2KZHA 5E1QA 1QOQA 1H63A 3NPWA 4S2CA 4QIUA 2FFCA 5E0KA 4PTNA 2ZDRA 3DH7A 2JK2A 5CZJA 1TTJA 3ELFA 1W5MA 1XBYA 1IXPA 1JVNA 3PF3A 4IMDA 3C4UA 3S5ZA 2CW6A 4HPJA 3ZWSA 4KFOA 5I3GA 3S6DA 3C8FA 2X1TA 2WV8A 4LC6A 4WY0A 3P74A 1G4SA 1TPEA 3QZEA 4P61A 2NV2A 3TIMA 3MYPA 1XCFA 2W6RA 4B5NA 1H62A 3NPVA 1PCKA 3NZRA 1A5SA 3GDLA 5FI8A 3PBWA 1XBXA 4O16A 3QJAA 5H2ZA 1GVRA 1TO3A 4NU7A 2O7SA 3EXRA 4MJZA 3DFOA 4QSHA 4IPJA 1VLWA 2A5HA 1MZHA 1H1ZA 1JRCA 3HGOA 5D2WA 3G1YA 2C14A 5G2HA 5SWUA 4FX7A 1SZGA 4AEOA 4JTJA 3T55A 4MFDA 3TSMA 3KX6A 2GJNA 3KRUA 2BX7A 2NZLA 2A4AA 4ZQPA 3CU2A 5MHBA 1NAL1 5AC6A 4XUGA 3LM7A 5HWMA 1LM1A 1TSIA 1PHWA 3MJYA 2W79A 2QJHA 4A2RA 2GPTA 2B7NA 1PVNA 1Z48A 2FJKA 1EIXA 4JD4A 2QKFA 1FCVA 5GVJA 3O8AA 3S1UA 5DLCA 1VGAA 3W74A 3KXQA 3R5EA 4IMCA 3GK0A 4JTIA 3M6YA 1EA0A 1O60A 4M7SA 3VCRA 4PCFA 3W84A 3NL6A 3DFTA 3ZWTA 4D2JA 1VRDA 4FX6M 5BMXA 4PFMA 4GXMA 5D33A 1TPWA 3RMJA 2V8ZA 3I7QA 3O16A 1IIGA 1A53A 5DCDA 1QWGA 3DHFA 4OU1A 4JTTA 3A5FA 4IPIA 5AYZA 5BMWA 3N9RA 3C2RA 4O28A 3W7NA 2Y89A 4DO6A 2ISSA 1XUUA 2A6LA 3QQ1A 2ZBTA 2DP3A 3EB2A 3OIXA 4FF7A 3T44A 5CSRA 2PRLA 2ZZ1A 1C9DA 1THFD 4W9TA 2G97A 1DV7A 2NXHA 3TUUA 3IIOA 1F73A 3NM1A 1W1ZA 2E68A 2VOMA 3NAVA 1LORA 1TV7A 2CZEA 1LCOA 2Y7EA 3SJ3A 4IGHA 4LVFA 1XXXA 4O12A 1P5BA 3EXTA 4LT9A 3SGZA 1AL8A 1H7RA 2V82A 3PB0A 1H51A 3S1WA 2ZTKA 3L0NA 5TBOA 1SSGA 3IEBA 4JDBA 4LV9A 1O95A 2EGZA 1S5VA 5K9DA 3ZR4A 2NWSA 1XL9A 3G1DA 5AC8A 2NUXA 1X8FA 2ZZ4A 5EL1A 1TTIA 1CI1A 3QMTA 2A6NA 1ZHAA 4JTUA 3DFPA 3P80A 3W7GA 2Y88A 4O19A 3T78A 2NX3A 4OWGA 4UC5A 1ME7A 4HSOA 4UUIA 1FQ0A 4JY9A 3WFAA 1W3IA 1J5TA 1SO3A 1R46A 3QH2A 3LERA 3YPIA 2RFGA 1NVMA 1N7KA 2FB2A 4AWUA 3UY7A 5LHFA 1T0OA 3WJSA 3QSTA 1UBSA 2ZRVA 3S8HA 3EXSA 1WX0A 4UNKA 1OK6A 1TTQA 1SW7A 3G0SA 1A5AA 5U7SA 3MMTA 1FDJA 1ICSA 3IV3A 4N4PA 5LGZA 2NLIA 2DORA 4JX4A 3N2MA 1QO5A 1WOBA 3NXFA 1FWNA 3UQNA 3L5LA 4UMAA 1F74A 4QITA 3THQA 5CZSA 5DCBA 1FWWA 3BK0A 1VHNA 5AHFA 3H54A 4WX2A 4O0KA 2Y70A 1YYAA 3IIVA 2AAMA 4NJHA 3B06A 1EUAA 3PC0A 3ABOA 1NEYA 2Y62A 3NQ2A 5F2LA 1ZENA 2QUUA 3W7QA 4R53A 1YXYA 3G1FA 1IXQA 4EF8A 1RV8A 2WJZA 4FNTA 1OJXA 1I2PA 3GX9A 2QCEA 4ZZ9A 2C6QA 3B04A 3EX3A 3TX9A 1HUVA 3BG3A 3NL2A 2VENA 3IGSA 4MYXA 1TB3A 4UTIA 1QFEA 2VFFA 3UPBA 5I3KA 3N9SA 3PR2A 1XM3A 2J9XA 2JKEA 2TSYA 3UY8A 2DJXA 3ABQA 1XBVA 1LOQA 3TW6A 4JIPA 1H60A 1PIIA 2XFWA 1TV5A 1O5XA 4YCOA 2E5CA 3L65A 5I3FA 4WQ6A 3LCGA 1KM6A 3NQEA 3VKJA 2J9YA 4HNTA 1QPQA 4JEQA 2CLKA 1VYPX 1L6SA 1LLZA 1R2RA 3G1VA 4UTJA 3W3OA 1KFEA 1VZWA 1YPIA 3AO0A 3UWWA 4QQ3A 1SO4A 4NT0A 4CNOA 1GQNA 2P0OA 3TDFA 1JJKA 1KFBA 1KM1A 4QNEA 1M7PA 3M43A 1TQXA 1YDNA 3SSJA 4JICA 4AHOA 2VFGA 3NYZA 4RZ6A 3EX6A 2CU0A 2DJLA 3LCFA 3W70A 1FWTA 3TMQA 2A7RA 1LLWA 2A85A 4PL1A 1PV8A 1G4PA 4PC8A 3UWYA 1L2UA 3BV4A 2Z2UA 1VCFA 3W85A 1K8ZA 1AMKA 2VEPA 3BPWA 1EWEA 1GZGA 3LTYA 1ZY9A 2B0MA 3Q2DA 3U6WA 2J24A 1LYXA 1W56A 5CSSA 4RKAA 1KM2A 3W23A 3G0UA 3FA5A 5CG7A 2RKXA 1GOXA 1G69A 2WO5A 3LHVA 2Y85A 1H7WA 3QYQA 1OFAA 1SSDA 2CLLA 2J9ZA 1P0KA 3W7PA 4E2BA 4JDYA 1LRQA 1W54A 1ICQA 2BWGA 2Y6ZA 1G4TA 2TYSA 2X2GA 3UNDA 3OVPA 2QUTA 1FDYA 3S5NA 5EPDA 1LDCA 5EMUA 3A23A 4UFLA 4AHQA 3UPWA 2BXVA 1FCUA 4R33A 3N34A 4DBEA 3BLFA 3RLUA 2ZZ5A 3C2EA 1GG0A 3G18A 3O6DA 4JTKA 1JUBA 2E6FA 1GEQA 3W2JA 4I7VA 4FNRA 1RR2A 1AG1O 3UWZA 3LRLA 4MZYA 4UTUA 1SZNA 1W3NA 2QR6A 1CX9A 1QPRA 5FEXA 2QDGA 4ML9A 4N6FA 3NQMA 1OFOA 3RF9A 2E5DA 1QDSA 4NXKA 3ATYA 4YXGA 4HNUA 4UTWC 1ALDA 4AB4A 3V75A 3IIXA 5G2WA 4LU0A 3STFA 4ZMGA 3CT7A 1KTNA 2W0UA 4UTMA 4N9EA 1WA3A 4K8EA 1VQTA 3WK2A 4E2DA 1XI3A 4KWWA 3CPRA 4JX5A 2C0AA 4JNMA 5D05A 2ABAA 3W87A 8TIMA 1UUMA 5I3IA 2Q3RA 3P60A 1ME8A 4AWTA 3DKJA 5LSMA 4GUIA 3KHJA 1IF2A 4ZQRA 5G1YA 2CLFA 2PRMA 3W07A 1C8VA 3HBLA 4RLIA 3GXTA 3NQCA 4N9BA 1B9BA 3FYPA 5C54A 5LNVA 1W5NA 5EKYA 3GIYA 1UASA 3NR0A 4TMCA 1F7BA 3P82A 4ADUA 3JRKA 3WK1A 3W75A 1XKYA 1GTHA 1OABA 4RCXA 3B8DA 3QMRA 5DELA 4FEZA 3UXDA 3H55A 4ZL1A 1KFCA 4IOTA 3IIPA 5KITA 3W2UA 5CPLA 1J2WA 3UD6A 3ATZA 1VLIA 3PULA 4UTHA 2NXIA 3P84A 1U5JA 1H7NA 5HR7A 3TA6A 4Z0JA 2DZSA 2QCGA 4UFMA 4ZQNA 3USBA 1YTDA 3W7MA 1W37A 1XC4A 5G4EA 4FO4A 1DJQA 3E9AA 5EBUA 5G1TA 3S1VA 4GUGA 4FB7A 1M5WA 3BG9A 3B03A 4WZHA 3GVGA 1MO0A 2ZFAA 1VH7A 3EWWA 1OVDA 3C61A 4O1CA 2A7PA 4NVTA 4Q4KA 4PH6A 4OV4A 4PL2A 1TPUA 4IJBA 3EWXA 2CLOA 4IXXA 4NNCA 4NJKA 1ZJIA 5BRBA 3GB6A 2Q8LA 4ADTA 3QM3A 2FLIA 5LNRA 5KZMA 3TFCA 3DAQA 5AFDA 2V5LA 1JR1A 4AVFA 4DO4A 1OF6A 1X1ZA 4UXDA 1G6CA 4S1FA 4LS2A 1AK5A 4C1LA 4DXVA 3FJ6A 3G24A 1T8XA 4BWLA 4PEKA 4NQ1A 3K30A 1GVFA 5LNSA 2WNZA 1KTCA 3HF3A 1LBMA 5DY3A 1MSSA 3HGJA 1UUOA 2B7PA 1WOAA 5D2YA 3S5YA 2C19A 2V5BA 2WOQA 1JCNA 1VCGA 1N8FA 3G1SA 1F5ZA 1Q3NA 1VYSX 1AL7A 2WSYA 4JYEA 1P1XA 3H53A 3R12A 1EX5A 3Q37A 4FNPA 4Y8FA 4FHAA 1KV8A 1NF7A 1NFBA 3I7RA 2YR1A 3O6CA 4YCPA 1KFJA 2NUWA 2I1OA 4NX5A 4LV4A 3UWQA 4N6EA 3IVSA 1YXCA 4GE8A 4I7WA 3MHFA 2Q8ZA 3W1QA 1D3HA 4ALDA 3TR2A 4NNAA 3L0KA 3HGSA 1I2NA 3G3MA 1EP3A 1FDZA 2X30A 4XTDA 3LOTA 1HG3A 3P5YA 1GPWA 2V30A 5D32A 3DGRA 1FCQA 2VEMA 3V1PA 4O14A 1EP2A 5DN1A 4WXYA 3W73A 5HMSA 1K02A 3A24A 5CKSA 4BI6A 4GWEA 4DQWA 5F2MA 2EPHA 1DL3A 2ZA2A 3CQ0A 4DO5A 4O13A 1S5TA 1GVSA 5D03A 2QCLA 4O4VA 2CZ5A 4MKNA 3EX4A 1C29A 3MYOA 3TW7A 1LP6A 3DHDA 4TO8A 3NZ1A 4A22A 3SW6A 4E0CA 3PVFA 4CQ8A 2QCFA 1BWKA 4JIQA 3LHWA 2A21A 1MEWA 4GUHA 3L21A 3CWNA 2QAPA 1OK4A 3W2NA 3W1LA 2OMAA 2XN2A 3FLUA 3STCA 1SU5A 1OX6A 3W1AA 1TQJA 3GXNA 1SFLA 5K4XA 3QMSA 2JGQA 4Y9AA 5FEPA 2IQTA 2B7QA 3HQ1A 3E12A 1G7VA 3OEXA 3SECA 3NQVA 1B4EA 4RJEA 3W71A 2ISWA 2ABBA 3LLFA 5LGXA 3R2GA 2YFNA 4Y6GA 1JQVA 4RR4A 4N2YA 2OCZA 2EAWA 3W1RA 3PUDA 4EF9A 4POCA 4DF2A 3HIJA 1RQEA 2HS8A 2HS6A 3TQKA 1VHCA 4CCDA 1HO1A 1YLVA 4TU1A 2Z6JA 1LZOA 5CZTA 1RPXA 3KVMA 4K36A 1O4UA 5A5WA 2E5BA 4UTLA 3N73A 1JULA 4ONVA 2E1DA 4WOQA 1FXQA 2GOUA 5IM51 2R91A 5K3VA 2C3ZA 2QJIA 1NSJA 2ZA3A 5BNKA 1ZFJA 2NX1A 1DVJA 2QCCA 3HG4A 3GDKA 5D04C 5G4WA 3CHVA 4AAJA 4GFSA 4MZ8A 4XWUA 1QPOA 2V2HA 3L0GA 1JUEA 1ICPA 5FEWA 4O53A 4CNNA 2YX0A 4LY8A 1ZAHA 3M7WA 1VCVA 3PUOA 3QSRA 3GR7A 1YXDA 2R94A 3BO9A 4WUIA 3GLCA 2I9EA 3DXIA 4FX8A 1DQWA 2H8ZA 4CLMA 1KA9F 3WJWA 5LHEA 1OF8A 5IBXA 2VEIA 3WK0A 4HT3A 2RHGA 4DF0A 2YW4A 3LCIA 3BW2A 1F6PA 3A9IA 1XDLA 3UYCA 1SW0A 2QCNA 3M47A 4LUJA 4MY9A 3M0ZA 3KRSA 2G5WA 3QPZA 3TCEA 2H8XA 3BG5A 4TMBA 4MY8A 4L4MA 1OFPA 4UR7A 1H50A 1T96A 1I8JA 3ZS4A 5AYYA 3W7DA 2HMCA 3W7RA 2ZRYA 3HPZA 1XUZA 4MOZA 1TJRA 4PA8A 3KFTA 2WNNA 3G22A 4ZQCA 1D3GA 4YMZA 1T99A 2YPIA 1YPFA 4O54A 4O1DA 4O50A 1FWRA 3ZFHA 3W7LA 3VE9A 2B7OA 3TMLA 3STEA 1LOSA 4PODA 4N02A 2C13A 5HULA 1HL2A 4UTKA 4HIBA 2DZPA 1FXPA 1TTPA 1AW1A 1R30A 3TFXA 4BFAA 4JGDA 2VFEA 3B4UA 3O05A 3PWAA 4FIQA 4NZJA 3S9YA 1LROA 4ZQOA 1PHQA 3CB8A 2A7NA 2C1HA 4LRSA 5CPNA 4WOZA 3LB0A 2C16A 1FX6A 1O94A 4JTGA 1TMHA 1WYIA 3GAKA 2BLEA 2F7FA 3DENA 3HG3A 4OV9A 6ALDA 4M19A 4ORMA 3LCHA 3IVUA 1MEIA 1OX4A 2DZXA 4OE7A 5DY2A 5FF0A 4O0ZA 3QEZA 2OX1A 2QCMA 3C3NA 4Q32A 3HPXA 1Q6QA 4JY8A 4Q33A 2J6XA 1GYNA 3UWVA 3B0UX 2CFFA 3EWUA 4K8HA 5J5RA 4Z0SA 3LRMA 2C18A 4FNSA 3C2FA 3EX1A 3LI1A 5AB3A 3TXVA 1H5YA 5T26A 4I7UA 3S0CA 5I3JA 1RVGA 1TPVA 2ATSA 2A0NA 3PG8A 4UFKA 3N14A 3S1XA 1EB3A 5K9CA 1DOSA 3L66A 4BR1A 3W9ZA 1PS9A 5DXXA 3T40A 5KINA 1GYLA 4JTHA 4YLWA 2EHHA 1K7XA 1PL9A 2Y61A 3MP4A 1SFJA 4XKYA 3TAKA 2TRSA 3GKFA 3P8IA 3HOJA 4M5PA 4UFIA 5KZDA 1IGSA 1TRDA 1YADA 2YZRA 3QC3A 2H3BA 1I4NA 1W5PA 5FEZA 1W5OA 3W7KA 3FKKA 2VFDA 2QF7A 4IX0A 1G7UA 1SZFA 3CLMA 5D2TA 2Y7FA 3EEGA 3LHZA 3NGJA 4MUZA 4CQAA 3IVTA 4NJGA 3BLIA 1TPC1 4TIMA 1G67A 3W1PA 2ALDA 2YGYA 5F4SA 1UCWA 3GDTA 3NQFA 5L9FA 3KAOA 4XKYB 1GT8A 3G8RA 4A3UA 1KM4A 3VFLA 1YTEA 3DI0A 2FTPA 5FF3A 1BEUA 2VXNA 3F03K 3HO8A 1KM0A 1BTMA 3MO7A 4EWND 4GUJA 3EWYA 4O1AA 5HQEA 2X1SA 4GUFA 4O8RA 5HR6A 5U4NA 4LTSA 3LCLA 5EYWA 4AF0A 2PRHA 3NQ7A 3PBVA 2RDWA 1KM5A 4BI5A 3W76A 1M7OA 3QRHA 4O52A 4JX6A 3NL5A 3TXZA 3PAJA 2YW3A 5C5YA 3TSDA 1OX4B 3A22A 4FNUA 3FJLA 4CCEA 2A2IA 3LDVA 4RZ5A 3NQGA 4IMEA 3THAA 3W6YA 3W1MA 4LWWA 3HG2A 1IXNA 2QAFA 3W83A 1GTEA 4LVGA 1TPDA 2V81A 4MYAA 4FIRA 3VE7A 1DBTA 2Z1BA 3DBPA 1K03A 1SW3A 3GKAA 1EP1A 1W8SA 3MW7A 1QOPA 1OG0A 3SGUA 5BW6A 3CM4A 1F76A 1EUNA 2OZ0A 1SPQA 3HJZA 4R7JA 2WQPA 4OHQA 4X22A 4TR9A 3ABSA 3TK7A 3MBDA 5AOUA 1KM3A 3EX2A 2QCDB 4Y96A 2E77A 3C56A 1FBAA 4JTEA 2ZTJA 4LNYA 1Y0EA 3TQVA 3MHUA 3MI6A 3T4CA 1ML1A 1OFBA 1H61A 1ME9A 4AWSA 3C52A 4ZVJA 4JXCA 2YXGA 2PC4A 1AW5A 4U4MA 2E09A 3BW4A 4XTIA 2GVGA 3INPA 3W88A 2ZRWA 3TC7A 3PSWA 2QDHA 3W1NA 2FPYA 4RXGA 1CW2A 4GC4A 3W7EA 3PG9A 1HTIA 3U2OA 4OBTA 3W22A 4Z1AA 3LV5A 1LBFA 3CIXA 1M6JA 3A5VA 4MJMA 4H6KA 5AHNA 4H3DA 5KMYA 2OT0A 3UWUA 2FPTA 1D9EA 3P61A 1JQXA 5F2IA 3NO5A 1IXOA 1YDOA 4NNBA 1Q6RA 1WXJA 4HN4A 4XBKA 3BARA 3TQ0A 4AF0B 2DU2A 3EKZA 3NVTA 4UFHA 3HG5A 5AYXA 1GVOA 3QW3A 4FNQA 4Y90A 4NZFA 5LNUA 3LTPA 1ZAIA 1OFRA 1BWLA 1JCXA 2NWRA 1TCDA 2G95A 3T7VA 1OFDA 5AHIA 3GDMA 3IGXA 3TROA 3MP3A 3BVJA 3KVLA 1SO6A 3GYEA 1JRBA 5G2IA 4YWIA 3NOEA 3JS3A 4LVBA 3W7IA 2QJGA 4G1KA 4AXKA 2NX9A 1X7FA 3NA8A 5LNWA 3CC1A 3PBUA 3I65A 3HGRA 4M7TA 5F4XA 1QO2A 1DORA
chains in the Genus database with same CATH superfamily
1SR9A 2PCQA 2XSAA 4L4OA 2PURA 4Y9OA 5GQBA 2B81A 3T9PA 2FGLA 2P0IA 1FWDC 1GYMA 4LOCA 4AMCA 4W84A 4MJ4A 5CC5A 3HFYA 3GNPA 4GYKA 2FMNA 3LBCA 3B05A 5TD4A 1E6SM 2P3ZA 2G4JA 2ZIDA 3E0WA 3FOKA 2PBOA 3L67A 1KGWA 5REQA 1WDQA 3ZZ1A 3OQEA 1B3OA 3LSBA 1J8VA 2PGFA 4DJEA 4JR5A 5C6MA 2IXUA 2BY2A 4IQLA 1R2SA 4H8UA 2BTMA 3C5QA 3PY2A 1XFBA 2FHCA 2Z2AA 3QV7A 3SCRA 1CXLA 4E38A 4K8GA 5A1AA 1W5QA 4H2CA 4AC7C 1EJXC 3AU2A 1J0YA 4OUEA 2EKCA 2PDPA 3AMGA 1KLYA 1L6WA 4S2BA 4A35A 4H00A 3TJIA 2QGHA 4X9SA 5HQLA 1C7TA 4WGXA 1JPDX 3LTSA 4R7WA 1V4YA 3WJXA 4H9VA 3JZUA 1I0BA 3HN3A 1BF2A 5FCZA 4GKLA 5D2XA 4X60A 4NILA 2XISA 4WRHA 3A4XA 4ORIA 5HPCA 1GVYA 3WMLA 4L9XA 1W1B1 2PDQA 1LBLA 3WENA 3E96A 1ZJBA 3FJNA 2WZHA 4J3SA 1WZAA 2VELA 3V16A 1NP0A 1UIOA 4HKPA 3M9YA 3P7YA 4FXSA 4JQ4A 1RBLA 2XVPA 5BXSA 2OR2A 1E1FA 1KKOA 2NUYA 3RG6A 1WDDA 4Q8MA 4MY1A 3FSUA 1MUMA 1KFLA 5KSWA 4ACYA 2TMDA 4Q4MA 1XISA 3ABRA 5G4HC 5C9ZA 5D37A 3SM0A 5EY5A 3C0JA 1VFFA 3GC5A 1I9CB 4OFCA 3SCSA 1UD5A 4V15A 2WPBA 3RNDA 1EJTC 4BEQA 3N13A 1E4MM 1K9DA 1NH6A 1BXBA 2Q8XA 1DJHA 1P43A 1DE6A 2E40A 4ATWA 3M41A 4D6CA 4H83A 1XDMA 3DI1A 1LQAA 4QS5A 4A3QA 1HO4A 2OVLA 2H3DA 3N11A 3MDWA 4PB3A 1BKSA 2YDAA 4XZNX 4GNJA 4WY0B 4IFRA 1UJPA 4GVGA 1YE6A 1EHAA 4UCGA 1VRXA 1UROA 2IPFA 1CLKA 2CKRA 4DYJA 2GQ9A 3LXAA 4HB7A 2P88A 3L2IA 1HJXA 4GZIA 4JN6A 2NQ9A 2J25A 4W7WA 4DELA 1X97A 1RZMA 5FSEC 4K6AA 5CZ0A 3UYIA 1UA3A 5FAJA 3T6CA 5H8MA 4YTTA 2GUUA 4HVXA 3WH6A 3QZAA 3B3DA 1D8CA 1VPXA 3JZEA 3ORWA 1RAKA 2PDBA 3SSZA 4J4KA 3PZTA 1JCLA 3BW3A 2RDUA 4GH3A 2VGIA 3K1DA 2WC4A 3BSHA 4E2OA 1GZJA 2INZA 3DFYA 1KQZA 3MS8A 4PUUA 4MPQA 2RH9A 3F4WA 2PDWA 3V35A 4QJ1A 2QMJA 5EU9A 1H2JA 1H7OA 1OIFA 4J40A 3M44A 4AW7A 1VYRA 2ZZ3A 3UT0A 2AL2B 1Q45A 3PNZA 3N19B 3A12A 3NDOA 1WAUA 3H70A 4D8AA 3WNNA 1DHPA 1I2RA 4XD6A 3EA1A 2VFHA 1P0EA 4XO6A 5C2XA 2DZVA 3KRBA 2D3LA 1KKRA 2F61A 1R6WA 4EPKA 2DEPA 1P1MA 4JQ2A 2HVNA 4CNUA 2Z26A 1E3ZA 2VUNA 3LGEA 2ZE0A 4DPQA 4A21A 4IUOA 5LA1A 4MDPA 1OGGA 1QRQA 2QCHA 4QRNA 4W93A 1A50A 2OOFA 3T0DA 1AQFA 2I57A 2GK1A 4S23A 4LS0A 3I7SA 4LYQA 1E1CA 1SUXA 1Q6EA 2FDSA 3A3HA 2B4GA 5JBEA 3HB9A 2XIBA 4JTQA 4YTSA 2WM1A 1MQRA 1QAPA 2IMRA 4AZ7A 3B0VC 3BJFA 3VIHA 5A8NA 4BEUA 3TJXA 4DNHA 1GCYA 1MDRA 2XIIA 1TX2A 3WF2A 3R89A 3TKFA 1W8GA 2XTKA 2BGSA 3WLOA 1F6KA 3NG3A 3IANA 4GFIA 3WL1A 2Z2BA 4NIRA 4NX0A 3WDPP 5LZLA 3DKLA 1U5VA 1UR4A 3W7OA 4JHZA 3R58A 1EGVA 4XQ6A 4Z1CA 3UG3A 4JYDA 2OLHA 2CHRA 1CXKA 1DXIA 1N2VA 1TIMA 3GM8A 4W89A 3OJGA 2CLPA 1OX5A 5EFFA 3PUGA 3C6CA 4GIYA 3BLLA 3ZXWA 1VJIA 4J3XA 3UR7A 3AIBA 4N9CA 5AHEA 1MXSA 3K5XA 4DUWA 1QNQA 2AGKA 7TIMA 1MXDA 1OYBA 1IGWA 3MI2A 1QNOA 1PYMA 2BHUA 2WK2A 1RP9A 2J27A 4U28A 1WBJA 2YCLA 3L68A 4P5UA 5D9OA 4IX2A 1C8YA 3CYVA 1VBJA 3NVDA 2OT1A 2GDVA 5AYIA 2PTYA 2Q01A 4BWLC 1UP0A 3F7JA 3OVQA 5HATA 4Q4RA 1Q6LA 2EF9A 1P6CA 2WJDA 3H2OA 1Z42A 1A5BA 4IXHA 3A4WA 3VCNA 5CC7A 2BVTA 3IRDA 2W61A 3P81A 3MPGA 2J88A 3VZZA 3KCLA 1DWGM 3DIPA 2X41A 4PCSA 4CD8A 4AHPA 3CV7A 3ONBA 2IKIA 3L9CA 3TC6A 3QLDA 3MUAA 1TJ2A 1OHLA 4GABA 2IQ0A 4Q6XA 3SJNA 1J4EA 5FF2A 4EVZA 4XKMA 3MO4A 2VEKA 3W1UA 3IJIA 5FOOA 4QAWA 4JNYA 3G8EA 2CZDA 5HUOA 1Z9AA 4PB5A 3TAOA 1B57A 4D6IA 1B9ZA 4A8IA 4AZCA 1N8WA 1UJQA 3QXBA 2JEQA 4W8AA 3ZLHA 2BNJA 4G9PA 1F3TA 1HJVA 5M3WA 4LAKA 3CYJA 3PHAA 4JFTA 3DYMA 5T91A 2FJUB 2IPJA 3CPGA 4MFEA 4TVCA 3QPYA 3W7HA 2PLMA 4QQUA 3KHDA 1V02E 3GU9A 3R79A 5AHLA 4S3AA 2HVMA 3F2DA 2DIEA 4C1NA 3URNA 3U7VA 3PZGA 4HYVA 4DHGA 2OJPA 1EOMA 4U10A 2YCKX 4JFWA 3TCSA 4E6MA 8RUCA 4BI7A 3T09A 4JFSA 2PTZA 4LRTA 1WXZA 3O06A 1P0DA 3C2VA 4J3VA 1BFNA 2WLZA 5HWJA 1TZZA 4H19A 2CESA 4UR9A 5IHSA 4O4WA 4Z2KA 1AH4A 2YYUA 3IGHX 3U5YA 4N4QA 3WUGA 3U8GA 1LF1A 4PCPA 1HX0A 1S46A 1VJSA 3RX4A 3ARQA 1KQYA 4F40A 4W5ZA 7REQA 1DYSA 1IXPA 3B8WA 3C4UA 2VC9A 4PEEA 3R7MA 4KFOA 1XLAA 5DT7A 2X1TA 2XVLA 2WV8A 1KXQA 1V77A 1NELA 1XGZA 3P74A 2I9UA 1GZ1A 1NFGA 2HISA 4C6DA 1XCFA 1FVPA 5HNNA 1SVDA 4WEVX 2VZVA 2YZ5A 2OYLA 4IIEA 2DW7A 2ZUSA 4O16A 2OXNA 2HRWA 1KXVA 2G37A 4NU7A 1QI4A 4IPJA 1JPIA 1VLWA 3S4TA 2CKSA 1MFVA 3TEVA 2NVDA 2PLJA 2V3EA 1FWHC 4FX7A 1DJXA 4AC1X 2I7GA 5XIMA 4QG9A 3SCUA 4RE3A 1Q7QA 2EPLX 2OFJA 3WNLA 1F9CA 5AC6A 4B4FA 2IQDA 1UC5A 2B7NA 4RDZA 3S2MA 1KWGA 3VX0A 2Y1HA 4KGJA 1VGAA 3QKZA 4LAUA 4JTIA 2HZGA 5M17A 1FWFC 3NL6A 1VRDA 3ARPA 4GXMA 2HXTA 2V8ZA 4LEQA 2VX7A 1IIGA 5DCDA 1QWGA 4GIRA 4JTTA 3EBVA 4IPIA 5PTDA 5FIPA 5C9RA 4YU1A 3SGGA 2Z1WA 4IFKA 1E9ZB 1PO9A 1XUUA 5CSRA 2ZZ1A 3KLKA 1THFD 4W9TA 2NXHA 3TUUA 3IIOA 1F73A 4DLMA 2VOMA 2WZIA 3CZEA 4IFOA 2CZEA 4BQ4A 1M53A 4IGHA 1XXXA 3ZLFA 3WZ0E 3OGVA 3H4WA 1H7RA 3PB0A 4LNCA 4JDBA 1HVXA 1O95A 2EGZA 6XIMA 5E6YA 2E9BA 4V1YA 2W63A 4F0MA 3M64A 1A3HA 1A49A 3QMTA 3O9NA 4JTUA 3DFPA 3P80A 3OGSA 2Y88A 3T78A 1NOWA 3WH5A 1X96A 3GFXA 5CJNA 4UUIA 4UQEA 3E38A 3WFAA 1J5TA 1MWOA 4PMNA 3S6TA 3LERA 1RK5A 3YPIA 2RFGA 2FB2A 3VNMA 1EEXA 3WJSA 4ZB5A 3CQIA 2YDQA 3MU7A 2VYOA 1TTQA 1FDJA 3S3GA 5LGZA 3IJ7A 4WLCA 2J77A 4H7VA 2VCAA 2OODA 4I5UA 4QITA 5CZSA 3LG3A 1VHNA 3VGDA 3IIVA 4NJHA 3SCPA 4ZE4A 4IUGA 3MZNA 2EG6A 3NQ2A 1ZENA 2QUUA 3W7QA 4R5EA 1HKKA 1Q6DA 4LAZA 4INFA 2DQWA 2QHAA 2C6QA 3GFYA 3OGRA 3BZGA 3GHUA 4NZ1A 3NL2A 2WMFA 1UR3M 2PZNA 3DC8A 3A3XA 4MWAA 4KIEA 2VFFA 1G94A 1JAKA 4PUWA 1W1IE 1YBQA 3BH4A 3PR2A 3PWGA 2JKEA 3BANA 2YOCA 1XBVA 3ABQA 5CQ1A 4AD2A 4JIPA 2XM2A 1PIIA 3PPCA 1TV5A 3WLRA 4YCOA 3MSYA 7TAAA 5I3FA 4CU6A 4CU7A 1KM6A 3R25A 2J9YA 3P2VA 2WMKA 1R2RA 1B90A 1XW8A 1YPIA 3PANA 4UCFA 1ZCCA 2H9AA 3M0HA 4NT0A 4CNOA 2YL9A 2EG8A 3M43A 2WMIB 2J4GA 1WB0A 4ASTA 1SM9A 1YDNA 1OT1A 2R1MA 3MZ2A 2PDFA 4RZ6A 3VGBA 2QJJA 3EX6A 2CU0A 2DJLA 1U1HA 2A7RA 1LLWA 1PV8A 4J7RA 1G4PA 4PC8A 1L2UA 3THDA 1GOOA 1IWBA 1WUEA 4PMRA 3W37A 1H09A 3BSMA 1AMKA 5HPOA 1GKRA 3BPWA 4RL3A 2XH7A 3GC2A 1MUCA 2B0MA 2ZDSA 3Q2DA 1LYXA 4PSRA 3E2SA 1BVZA 4K3ZA 5CSSA 1KM2A 3F5JA 3FA5A 2RKXA 1GOXA 4OOZA 1G69A 3A47A 3PNUA 2BY1A 1UH3A 1UP3A 2J9ZA 3W7PA 2OSXA 1W32A 4Y9MA 3E2RA 1LRQA 3LS9A 4AIBA 1ICQA 1FP9A 2X2GA 3W24A 4WDTA 2C0HA 3THCA 3S5NA 3BGAA 4OTKA 5EMUA 2WHMA 4REQB 2C7FA 4K2SA 2EO7A 3LZ3A 4AHQA 4DBEA 1GUVA 3C2EA 4C6LA 1WKFA 3O6DA 3PZQA 1GEQA 3W2JA 3T8QA 4F0HA 4FNRA 4BQ2A 4TX8A 1WZLA 2E3ZA 1SZNA 1W3NA 2PA6A 5FEXA 3N25A 1S38A 2BP1A 2DUZA 3RF9A 1NWRA 2ALRA 4YXGA 1FWAC 3P0WA 4P8WA 3BSGA 4F0RA 1W3KA 3GNRA 3V75A 2E9LA 3IUDA 3STFA 3OBAA 1VEOA 1CGTA 4ZMGA 1S5NA 1VQTA 4E2DA 1XI3A 2CBVA 3UZZA 3MSDA 1ZL1A 3CIVA 3XINA 3CPRA 2ABAA 2GGGA 3W87A 3EPMA 2KAUC 5I3IA 2Q3RA 4Q4QA 1BKHA 3SCNA 4GUIA 5AY7A 3WD2A 4GCXA 3QV8A 3OO2A 3V5OA 2CLFA 1Q2SA 1C8VA 4RLIA 3MVTA 3P0XA 3NWRA 5LNVA 4JN7A 5HANA 3QV9A 3NR0A 3SUUA 3DHPA 3QOMA 3AUJA 1F7BA 4ADUA 1S3TC 6XIAA 3WK1A 2SFPA 4GOAA 1GTHA 3SADA 4MSSA 4RCXA 4MWAD 4YHEA 5CPTA 1Q65A 1QU4A 3GNOA 2X0HA 1EO7A 4GY7A 3DYPA 5E09A 5CPLA 3ATZA 3HV9A 1JI1A 3AYVA 3F2CA 3TA6A 2QCGA 1X6NA 4ZQNA 5GNXA 1YTDA 3W7MA 4FO4A 5EBUA 5G1TA 4G1NA 1KBBA 2GFTA 3BAIA 1M5WA 3BG9A 4WZHA 3ZLGA 3H2EA 3NEHA 3C61A 2A7PA 4NVTA 4Q4KA 1EFZA 1CZ1A 1QW7A 1FH8A 3WO8A 1L6FA 1DXEA 3IACA 3EWXA 2P5NA 2NQHA 3VIOA 4G2DA 1EXPA 3DCPA 5LNRA 5KZMA 2V5LA 1R3SA 3WDHA 4DO4A 2G3NA 1X1ZA 3ITTA 2DSZA 4S1FA 7REQB 1AK5A 1XYAA 4C1LA 2PB1A 5IOBA 3QZ6A 1WDRA 2X2YA 1HL9A 1TIWA 3L2MA 3ARWA 1DIKA 3HF3A 5CPSA 1T5AA 2B7PA 5D2YA 4CD5A 3L4ZA 1OG6A 2V5BA 4PCNA 3WQFA 1DJYA 4XUYA 1N8FA 4CNSA 5A8PA 4JYEA 4UWMA 1P1XA 3H53A 3KDOA 4J3ZA 4FHAA 1J79A 4KETA 1NFBA 2YR1A 1DWAM 2PDYA 1KFJA 2NUWA 4EPBC 4DLFA 1NP2A 1WE5A 3UWQA 2OELA 1HKWA 3CHDA 2YIHA 4XG1A 4ZR8A 1D3HA 2E0PA 4ALDA 4NNAA 4OUIA 4BCEA 2VI0A 4ZOEA 4DJDD 4YTRA 4XAFA 2X30A 1OZMA 4D9PA 1GPWA 3CZKA 1SJCA 3P6LA 3V1PA 2P76A 2R24A 2REQA 1S5MA 3L12A 1V6TA 2DH3A 1KXTA 1DWJM 2PWGA 3A3WA 4HOXA 4DQWA 3WBYA 4CVUA 4O13A 2QCLA 4IQDA 4GYJA 3VA8A 1V8EA 2CZ5A 5XINA 3EYPA 2V5CA 4MKNA 3OIHA 2PDGA 4Q7NA 4TO8A 3SW6A 4E0CA 4CQ8A 1PYFA 1BWKA 4REQA 3LHWA 3AC0A 2A21A 3L21A 4DM2A 1UKPA 2QAPA 3W2NA 3W1LA 5E6ZA 1XPGA 4S3DA 5K4XA 3E2QA 1ISZA 4TX6A 4J28A 4AZHA 3S9ZA 2B7QA 2FMOA 1ITCA 4XAYA 1HJQA 4RJEA 3W71A 2ISWA 3LLFA 5A6JA 3L4XA 3R2GA 1UKTA 3RPMA 4POCA 2NVCA 4Q3MA 1GONA 1QHPA 1E40A 3WF1A 1Q7MA 3TQKA 3VKDA 1HO1A 2Y4SA 3NSNA 4TU1A 2Z6JA 1LZOA 5E9XA 1V79A 1US3A 2FHFA 4B5VA 1BXCA 4HP5A 4IG2B 2YKKA 1TWSA 3HURA 4JNZA 4WOQA 3VAVA 1FXQA 3KEHA 2R91A 5K3VA 3SCVA 1H4PA 2ACSA 4F4RA 2QCCA 3T42A 3HG4A 1CPUA 3GDKA 5G4WA 3CHVA 1HVQA 4AAJA 1KBLA 5A2CA 1QPOA 4XO7A 1C9WA 5A6BD 1JUEA 2I5GA 4CNNA 5ECUA 2YX0A 1ZAHA 4AUBA 3M7WA 4JIIX 3BO9A 4DJDA 1U2YA 3TWAA 3OZMA 1XH0A 2C8NA 2DV0A 2DSWA 1Q2RA 3WJWA 1E0VA 1H11A 4DF0A 4CEXC 3LCIA 1C93A 3BW2A 3UYCA 1RLCL 4U2ZA 2OSWA 4RPQA 4XVEA 2G5WA 2H8XA 1IR1A 4MY8A 1PJ9A 3CT2A 1RY0A 1T96A 1P7TA 1I8JA 3KP1A 4MOZA 3R1ZA 4PA8A 3G22A 2QULA 1VBRA 1D3GA 1T99A 2YPIA 1YPFA 5C71A 3ZFHA 3T1GA 4PODA 5HULA 4HIBA 2DZPA 4IG2A 1Q4WA 3TFXA 3B4UA 2ZKMX 3A4JA 3MSRA 1PHQA 2ZC1A 4LRSA 2C16A 4JTGA 1ZPTA 2VVNA 2F7FA 3IRSA 4B16A 3HG3A 2V67A 1XIHA 1F8IA 2EPNA 3CUZA 4DXKA 1MEIA 3WH7A 2QCMA 3C3NA 4QDMA 4G7EB 1XLLA 1GYNA 4WJ8A 1U33A 5BWFA 4JCLA 1SMDA 4Z0SA 2CPUA 1H49A 3TXVA 5T26A 3P93A 4I7UA 3NFUA 3S46A 1LL6A 3S1XA 1EB3A 1DOSA 5E5CA 3WD4A 4KCTA 3W9ZA 2OKTA 2PTXA 1IEIA 3FDGA 2IKJA 4R85A 3TAKA 4ACZB 3GKFA 4ERGA 4H01A 4M5PA 1ZSXA 2AKZA 3QC3A 1ZBWA 1W5PA 5CZKA 3MV11 3OPSA 3W7KA 4O0QA 5ABFA 3T05A 1ZJHA 4CQAA 4AXNA 6CGTA 4TIMA 1G67A 1ONEA 2W67A 3NDYA 1SR0A 3ONCA 4A3UA 5LA0A 3QGKC 2FTPA 3AMKA 2ZADA 3ZIZA 4Q8UA 4MF4A 1IEWA 3LZ5A 1W9XA 3GW3A 1BTMA 3QLLA 5HQEA 1XG4A 2C1GA 1IEXA 3WLIA 2OKOA 4LTSA 3VFCA 5EYWA 3RUBL 4AF0A 4WDWA 2Y2WA 4I9JA 4KRTA 2RDWA 1KM5A 1POKA 4O52A 1XQLA 4K1GA 3NL5A 4PTDA 3PAJA 3K4AA 3AYRA 3LDVA 3NQGA 2ZE3A 1RCOB 4QJ3B 3W1MA 3BLOA 3W83A 4XV0A 3UR5A 3PPGA 3GG1A 3V0TA 4N7QA 2ZX5A 4KGLA 1K9EA 3UG8A 4H2HA 4LBRA 4KH2A 3IJDA 2HBXA 3SGUA 5I24A 1E72M 3CM4A 3CJPA 4MHBA 4LB3A 2WQPA 3WMSA 1T6MA 3TK7A 4E5TA 3E5PA 2OO0A 3MBDA 5RUBA 1KM3A 4HMNA 5EBAA 3FJ4A 2QDDA 1FH9A 3N2OA 4LNYA 5BOEA 2AKMA 3MMWA 3GVVA 4DYEA 1IQ8A 4AWSA 3C52A 1KXHA 4JXCA 5I06A 1AW5A 2YA2A 2QDHA 1PKYA 3KZPA 2FPYA 3FHQA 3PG9A 2XVGA 3S2CA 2BVDA 3IS4A 4TTGA 1NDVA 2JFEX 3OYZA 3WLQA 5F2IA 4GZEA 4PUEA 2UWFA 5CJ5A 3U3HA 3MY9A 2JIEA 4AZ6A 1WXJA 4PSPA 2HE5A 4DVOA 3REQB 1VFHA 4AF0B 3AMCA 2MUCA 4K1WA 3NVTA 5E0CA 3WQ6A 3TVAA 2ON3A 1LJYA 1W2PA 1OFRA 2WC7A 1BWLA 1T8QA 1OFDA 3IGXA 2D24A 3HU7A 1W9BM 2VDIA 1J0HA 4OVXA 1ISWA 4LVBA 3NZGA 2F6XA 2G41A 3AHYA 2PGRA 2V69A 3AHZA 2VX5A 1JYWA 5LNWA 3ZYZA 2VX4A 4M7TA 3VGGA 1IR2A 1FOBA 1R0MA 3TTSA 5ABFB 1LL4A 5XIAA 2QNEA 4ES4A 4HOZA 1OC5A 3S2JA 4AMAA 1PTDA 5BWAA 4QJ4B 4JPGA 4BZYA 3ZT5A 3O15A 3FGCB 4FPSA 4MWAE 1V0LA 2FTYA 1E3XA 1W0MA 3GD6A 4QNWA 5DRCA 3EKGA 4HJWA 3R43A 1R3YA 3I4EA 4B2DA 1L6YA 1R85A 2VR2A 5TNVA 4Q8VA 3Q94A 5K7JA 3V5CA 4C6QA 4ZOAA 1H3GA 3TU9A 4US5A 1IE7C 5F4WA 2VZSA 3MHGA 1ZNNA 5M1TA 2RJGA 5CPMA 2CLHA 1KBIA 3TR9A 3CS2A 3M46A 4XZIA 4HPHA 3EOSA 1W1YA 3HA1A 5I09A 3Q45A 3AICA 2PWVA 4K68A 3NQAA 3M0VA 5JBFA 4OQVA 3DUGA 2IUZA 3OZOA 3SY8A 2XGBA 3IK4A 2P10A 4A2SA 2VFIA 3LYEA 1V7AA 3C3UA 4GXWA 1TVLA 4HHLA 4ADSA 4LY4A 2VURA 4UQBA 1QI0A 3W2LA 3XISA 1KTBA 1BSLA 2JE8A 4LVDA 3JU2A 3M0MA 3WLNA 1O1ZA 3VNDA 4HNVA 3F1QA 1E1EA 4DJFA 3WH9A 2ACQA 5AECA 5BZAA 4GJIA 1F6YA 4LUSA 4IPLA 2FB3A 4ZQMA 4XISA 3AIUA 4O1BA 2J7FA 4JBRA 3NQ8A 4EXBA 4O11A 4TXEA 2ZRZA 4ERIA 2Z1SA 1XGDA 1FWSA 2DZTA 4NZ4A 3VOGA 2F84A 2I56A 4NXSA 4MZ1A 2QCDA 2OWCA 1JDAA 3CNYA 3W82A 1V6UA 5HJLA 4DF1A 4XVDA 1OD0A 3VKKA 5I0DA 4Q8QA 1XLFA 3RMEA 3SY5A 5FA5A 3T08A 4JQ3A 4D71A 2DZWA 3BLPX 2RDXA 1I1WA 3QF0A 3VILA 3TZFA 5FESA 5DBUA 1QNVA 1X1NA 4DBSA 2Z27A 3U4AA 2UBPC 3IIZA 4PTVA 4KCWA 4AFYA 1K7EA 4MUPA 8XIMA 2G3JA 3L5MA 2FVLA 1QMLA 3OG2A 2Z0IA 2J8GA 1ONRA 1T40A 2AGTA 3EDJA 4M6PA 3VGEA 1E1CB 3WY1A 4UTTC 3GXPA 2Z4GA 4ZFCA 4ZO8A 3OLGA 1ADSA 1FA2A 1J0ZA 1VBHA 1TRIA 3PUEA 1YQ2A 3QFEA 5LIWX 1MW2A 1JCYA 1IEVA 3AFBA 3RGTA 3WEMA 1XIMA 1QATA 3N2CA 4XZ9A 3AIQA 4JTSA 2ZZ6A 2DZUA 3M5YA 4J3UA 4F0KA 5IBXC 1CEOA 1NWUA 3NSXA 1O68A 9XIAA 3A64A 2R8WA 2JKAA 5F7UA 2PDNA 3ANUA 1VC4A 1EJUC 2WC3A 4E3TA 1YHTA 5DRIA 4LB4A 4MM1A 1TA3B 2XFYA 3B40A 3KOYA 2Y63A 1FUYA 1FWGC 2FZ8A 3VX1A 3PB2A 2ZUNA 2AL2A 3B0XA 1X38A 1A47A 3PSVA 3W7JA 3VI2A 2NQJA 1WZKA 5CJMA 3WQGA 3AXKA 4WY0F 4F0LA 1QPKA 3HPSA 3D3AA 4Z1DA 3VPLA 1NM9A 3TJLA 5F2GA 4MLJA 2CLMA 2UV8G 3UZWA 4OT7A 5A69A 1JIBA 2WHKA 4W7VA 4AG0A 5BU9A 3SQSA 4DBUA 1U22A 4NAFA 4GJ1A 4IGSA 4I9AA 4KEZA 4XX6A 5DBTA 5CH9A 3WQ5A 1ZALA 4Z2GA 3LPFA 1B4KA 4J9JA 3CBWA 4LC8A 4KW2A 3W25A 3OTRA 4AZCB 4IFKB 1E70M 3PBYA 3QHNA 4DUOA 3PBMA 3I6EA 2CZVA 2O92A 1FCBA 3O63A 5A95A 3QR3A 1JNEA 2VRQA 3CHCA 3STGA 4KRZA 3KOXA 3VK5A 4C5YA 2OYKA 1EDTA 2CZFA 4LS1A 4PMDA 3JR2A 1UG6A 1QW8A 2X1RA 2NT1A 4EE9A 4MIMA 3CIWA 5BOOA 1MNZA 2PZ0A 3TW9A 1FP8A 6REQA 1A5NC 1R3WA 2ZZ2A 4Z17A 5KZEA 2W91A 2OB3A 3H23A 3OBKA 4A8LA 3XIMA 2V6AA 1V7YA 5J5DA 2RJHA 2JKPA 3BQ6A 4WJEA 4CVWA 3O0FA 1WAWA 1XF0A 4KWVA 2GSEA 3WQ4A 1NIUA 8A3HA 5LIYX 1UR1A 4C60A 1BQCA 3EA2A 1VR6A 4R9OA 3VDGA 3WLTA 3AWOA 3UBPC 1R47A 1LUCA 3E49A 3TTQA 3IUHA 2D2HA 1K1DA 1BLIA 3CXOA 2V2CA 4HNNA 2XPKA 3GZAA 1M65A 4Q8PA 5I6SA 4C90A 4GNKB 1A3XA 1UP2A 3CEUA 2C79A 1I2QA 3LCWA 4IISA 3W81A 1S3HA 3SR7A 2VCCA 3AWNA 3CZGA 3GNNA 1NF0A 2W92A 4X9YA 1JCMP 5IFTA 3SBFA 4ZCWA 1XBZA 2I14A 3W4RA 4UB9A 3WJYA 3GBDA 4GYPA 4LW7A 5FAGA 3H7VA 3TTEA 3KBSA 1GORA 3OVGA 1WNOA 4BQ5A 3VIGA 1RJRA 4JTAA 3B9NA 1EWDA 1CB7B 3RR1A 4KFNA 3G1XA 2FZNA 5K9XA 3KVJA 3BAKA 4RUBA 1TV4A 3A21A 3FEMA 1BTCA 2Z29A 4C7GA 3PTKA 4C1KA 3U5UA 1N55A 2H6RA 3LPGA 1XIEA 1YNPA 1XLJA 4M6VA 1WQ5A 2C15A 1M7XA 3LXCA 1I45A 3UEQA 1O12A 5IDIA 4C7FA 7A3HA 4AIUA 1F8MA 5LXEA 3K4WA 3H4GA 3GFZA 2JEPA 3LA4A 5HWNA 3TTYA 2CLEA 2TPSA 3CHEA 5C55A 4JEJA 4O17A 3M4HA 2ZICA 3NPXA 1RA0A 2UY3A 4G6CA 5E70A 3PZIA 4DN1A 1E15A 1SO5A 1O66A 4JAWA 3WEZA 3UFYA 3P5ZA 3P8JA 2XVNA 3RK8A 5HUPA 4QG6A 3FKRA 3R10A 3BGJA 3VGHA 1KFKA 2BHZA 3NNTA 1Q6CA 4IMFA 3VCCA 2ONEA 4NYYA 2QZRA 4N9DA 5F1UA 2D69A 3FYOA 4W8BA 4S3KA 4QE5A 3VUPA 4UR8A 4C6MA 2FH8A 4LCQA 3GTIA 3LLDA 2OGYA 3HFTA 2F9RA 3AS3A 3WQOA 1GJWA 4UTWA 2YBUA 2BXYA 4IWWA 1PAMA 5F1VA 2GVLA 2W5FA 4AX7A 2KZHA 1XLIA 3D6NA 1QOQA 1H63A 3NPWA 4ATLA 4QIUA 1NQKA 2FFCA 3UG5A 3Q67A 4PTNA 1ZZMA 5CZJA 1TTJA 1VBUA 3ELFA 1W5MA 3PF3A 2ESCA 3EZ4A 4IMDA 4PMZA 3CV1A 3S5ZA 4C6JA 2MNRA 1V3HA 1R7AA 4U3CA 3TNBA 3S2LA 5JIPA 4NZ3A 2BY0A 3RCNA 3N6JA 2NV2A 1RALA 3TIMA 1L8NA 2W6RA 4Q6JA 4B5NA 1H62A 2CBIA 4H7ZA 2XH2A 1PCKA 3GDLA 5FI8A 1XBXA 4ZO9A 5H2ZA 1TO3A 1AJZA 3VC5A 2O7SA 3DFOA 1V6WA 3T0AA 2A5HA 1JRCA 4QEEA 1XYBA 1O5RA 5G2HA 3GRIA 3AZTA 2OQYA 1Y65A 3W53A 5SWUA 1SZGA 3OA5A 4AEOA 1VFOA 2JF7A 3ZSSA 3B0YA 3KRUA 1E9LA 2DT0A 2A4AA 4ZQPA 3ZJ6A 3IJQA 1PZ2A 1NAL1 3MDUA 1B54A 5HWMA 1LM1A 1PHWA 1QI5A 1UHVA 2W79A 3UZXA 4A2RA 3CO8A 1FHLA 2AMXA 2FJKA 3CK5A 2QVHA 2POTA 3J7HA 5GVJA 3S1UA 3W74A 3R5EA 1EA0A 1O60A 4PCFA 3G2GA 4Q8NA 4XD5A 4FX6M 5BMXA 4U5IA 5D33A 3ZM8A 3O16A 3DHFA 1CB2A 2VT0A 2J8FA 4B2DD 2FVMA 4KS0A 2GJXA 5BMWA 3N9RA 5EB8A 1E4LA 3W7NA 1S2UA 3Q65A 4GGBA 3GNXA 2ZBTA 2DP3A 3FSTA 3TP4A 1MRAA 2PRLA 1C9DA 1HKVA 1DV7A 2RAGA 2E68A 3NM1A 3NAVA 1PWLA 1TV7A 5A2BA 3SJ3A 4ICMA 2CYGA 3EXTA 3DFHA 3WUEA 5IXEA 2X7WA 2ZTKA 3SAZA 1BSIA 5TBOA 3PWIA 4IJCA 3IEBA 2QPSA 1XPYA 4FK9A 3WBXA 5K9DA 3QN3A 2VEGA 1US0A 1K9FA 3RLGA 3KLLA 2VD9A 1FWIC 3G1DA 5AC8A 3CAWA 5FKYA 2NUXA 2CCRA 2DGAA 4L9ZA 1X8FA 1JDEA 1TTIA 3W7GA 4OWGA 3MCOA 1US2A 3S6OA 1ME7A 4HSOA 1HKMA 4IGNA 1FQ0A 4OIFA 1W3IA 4LJ3A 4L1XA 3QH2A 1JF5A 5CEWA 1LWHA 1XIDA 1Q13A 4AWUA 1RA5A 4GBDA 1VFTA 3QSTA 1UBSA 5DANA 1JPKA 1SW7A 1A5AA 1ICSA 3W27A 4YVXA 1R9XA 4EXAA 4AZGA 1KFWA 4DJED 1Y8BA 4PTMA 4WKFA 3THQA 2WJEA 1SFTA 5DCBA 1FWWA 2XG9A 3BK0A 4UZUA 3H54A 1GNXA 1ZBKA 3AJ7A 3THUA 3SFWA 1VF8A 1EUAA 2WVVB 1SZRA 1CCWB 3G1FA 1IXQA 1RV8A 4FNTA 3TYDA 1OJXA 4ZTYA 1I2PA 4C6OA 3LGGA 2QCEA 4AYSA 3BG3A 4PMJA 1QXLA 1TB3A 3O7UA 1XC6A 3UPBA 2EEXA 3N9SA 5AVNA 1XM3A 3IJ6A 2PPGA 3UGRA 2TSYA 1TKKA 3QGAC 4F66A 2GSJA 2DJXA 1LOQA 3GG7A 3TW6A 3AYSA 2XFWA 3L65A 1X7IA 4WQ6A 1V03A 4GQ0A 1S39A 2V3DA 3NQEA 4TTUA 1QPQA 3PP7A 2CLKA 3UA4A 1XS2A 1MZRA 2J7GA 3G1VA 3R8HA 3W3OA 3TTOA 3Q4DA 3JW7A 1VZWA 3AO0A 2X0SA 3NUKA 4QQ3A 3WUFA 1Y5WA 2I5IA 4HYWA 2ACRA 2P0OA 1BG4A 1UD4A 1L0PA 1JJKA 4Z2JA 3U0HA 1M7PA 2HK0A 1B3VA 2ZUVA 2QMKA 4JICA 4HSHA 3NYZA 3VXGA 1J6PA 2HWGA 3U48A 1UMLA 3T2QA 4IICA 1H1NA 3SN0A 1GHRA 3HTWA 3PPHA 3WFLA 3BTNA 2A85A 2QS8A 4PL1A 1W9UA 2PODA 3H2CA 3BV4A 1VCFA 3W85A 2VEPA 1EWEA 1GZGA 1UIPA 3LTYA 4BF5A 3DGBA 1WKDA 4DRSA 4MWAB 3AHVA 3VNKA 3SCOA 4PTWA 3CO4A 4H6EA 1UKQA 2WO5A 3LHVA 1A0EA 1WPCA 4HYRA 1OFAA 5KEZA 2OTDA 2ZX8A 1PX3A 4QS6A 4JDYA 1OGBA 1PUDA 1W54A 5DEZA 2V3GA 3UPMA 1G4TA 2J78A 2TYSA 4UBPC 2QUTA 1FDYA 4GHRA 3TLQA 1QWKA 1FCUA 3BLFA 3RLUA 4PRRA 2CXEA 3NURA 2O0TA 1JUBA 3WQWA 1ELSA 4Q8TA 1RR2A 2F6KA 3UJEA 4FLSA 1WO2A 1AG1O 4MKSA 2DW6A 4V27A 3VM5A 1CX9A 4GNVA 4U31A 1JI2A 2E28A 3NQMA 3FVDA 2Z28A 2E5DA 2WWDA 3WQ8A 4NXKA 4UTWC 4HNUA 2Z00A 1EDQA 4AB4A 1JZ5A 4AD0A 2XFFA 4H8HA 1KTNA 2X09A 1ECQA 4J3WA 3HM7A 4PRTA 4WKHA 4JTCA 4JX5A 2WHJA 5D05A 1JDFA 1UUMA 4QE4A 3EAUA 4B5TA 1ME8A 2V5DA 1QBBA 3KHJA 1P6WA 1U30A 3UXIA 3UW6A 3WEOA 3NQCA 1B9BA 3UWEA 3TN6A 3GVWA 1I1XA 1P6BA 4FLQA 1G0CA 1R3VA 3GBEA 3WMBA 3B9AA 1RY8A 4OOUA 3W75A 1XKYA 4I3GA 2E7FA 4GQGA 2A3BA 2TAAA 4IPPA 3QMRA 5DELA 1JZ8A 4QDWA 3KBNA 4QCEA 3UXDA 1Q6GA 2OX4A 1JZ2A 1LWIA 1K8CA 1KFCA 3IIPA 3W2UA 4R7OA 1J2WA 1VLIA 2F2HA 2NXIA 3P84A 2DZSA 5HMDA 3CPUA 4PB4A 4UFMA 4MAZA 3AIRA 5HK4A 4EPEC 4QGCA 1W37A 1XC4A 5A6BA 3E9AA 1K77A 4GUGA 1B2YA 1AD4A 1RBAA 4FB7A 2G8ZA 3I10A 3GVGA 2CITA 1DIDA 1D3CA 1VH7A 3EWWA 1OVDA 4E8GA 4O1CA 1W3LA 2YL5A 4L4PA 3URAA 3DX5A 1MDLA 2CLOA 3W02A 1W17A 4NNCA 3GB6A 3QM3A 3CL7A 4LALA 3TFCA 3C0QA 3DAQA 4AVFA 3NO3A 4DXVA 4F2TA 4NQ1A 2DSKA 3WNMA 4ZENA 2Y8KA 2WNZA 2QT3A 3K13A 5E0FA 5DY3A 1VEPA 2QF8A 3AQUA 1UUOA 4JL2A 9CGTA 1GOIA 1E6QM 1CDGA 4QBXA 3BLDA 4PTXA 3AROA 2E1WA 2WSYA 1ZRQA 4ZFMA 4I5XA 3Q37A 1EJVC 4OBSA 1KV8A 1NF7A 3O6CA 4YCPA 1NDWA 3WSUA 2I17A 1W9VA 4HMDA 2QYGA 4QLLA 4N6EA 1AQ0A 3R0UA 4Q4OA 4FR6A 3G3MA 4B3KA 3VD9A 1OQFA 4XTDA 1HG3A 3L7RA 1RJPA 1TJ0A 4TOQA 3VIIA 2V30A 4U5KA 3KL3A 2VEMA 3OHMB 1XLBA 4O14A 1DQUA 1DE5A 1XLHA 3WQDA 1I75A 3MSGA 3BMWA 1J01A 4DB7A 2ODOA 3W73A 4PMYA 3A24A 3GTXA 4GZ7A 5CKSA 4CNTA 4BI6A 4IIHA 2BOFX 2DFAA 4OKDA 4YHGA 4AD4A 1DL3A 4LH8A 4DO5A 5AZ1A 2VR4A 3DG7A 4DAIA 1NTHA 2J7EA 3VD4A 3EDKA 4L6HA 3MKCA 3NZ1A 4A22A 4OECA 1KR0A 3KL5A 3N2TA 2AOSA 3CWNA 3H2FA 2PDXA 3FLUA 3STCA 2KX9A 1OX6A 3G1RA 4F0SA 3CUJA 3GXNA 4GPNA 4KBXA 1JDCA 3HPAA 1DJZA 3E12A 3ZR6A 1G7VA 4FZIA 4H8VA 3NQVA 1D2KA 1B4EA 1UW9A 2YLLA 2ABBA 3AMDA 4P8VA 2YFNA 4RR4A 1TR9A 3W1RA 1UD3A 4EF9A 2Q71A 4DF2A 2XH0A 3KE0A 4M3PA 3UVAA 2HS6A 4CCDA 4Y7EA 5DMYA 1YLVA 3GIPA 3K2GA 3CASA 3TYUA 1RPXA 1UYQA 1R3RA 4HNLA 4K36A 1O4UA 5A5WA 3U7BA 4LF2A 4UTLA 4F9DA 1UQZA 4ONVA 4LFYA 3TYBA 2E1DA 1LQ2A 1VFSA 5I00A 2C3ZA 1NSJA 2ZA3A 1ZFJA 3PFRA 1GQJA 1QK0A 5EGRA 4US5D 1AMYA 1DIOA 3FEQA 4ZO7A 3MUZ1 3MJMA 5GNZA 4AVNA 1NFPA 3L0GA 2NQ5A 1XV8A 1ICPA 1FWCC 3LD5A 4O53A 1UH2A 5DMNA 1VCVA 3PUOA 3QSRA 5JBDA 4WUIA 2PD9A 2I9EA 1DIEA 3DXIA 2CHOA 1EF3A 4S3BA 2WSKA 5LHEA 1OF8A 5IBXA 4JN8A 1V6VA 2YA0A 4JTRA 1F6PA 4B92A 2PWUA 1S2CA 2UY5A 3SCQA 2QCNA 3DG6A 4LUJA 4B3ZA 3M0ZA 2F2KA 3KRSA 3QPZA 3TCEA 2QUMA 3T8LA 4H9YA 5FACA 4TMBA 3GU2A 3SUSA 1H50A 1V3LA 4IMAA 4DUVA 4Z2IA 3LM3A 3ZS4A 5AYYA 3ES8A 1NDZA 2HMCA 3W7RA 3VIMA 2ZRYA 4WSJA 2DT3A 4U2YA 3E1F1 3KFTA 3L23A 5A6TC 3VNZA 2EQDA 3L4UA 4RZBA 2R1KA 3VE9A 3CZLA 2C13A 4LX4A 2ZX6A 4U33A 2Y24A 4PN2A 1ITXA 1TTPA 1E73M 4DZ5A 2P8CA 3N4FA 3PWAA 3CUGA 3P3BA 3CUXA 3CB8A 1M03A 1NOFA 4PMUA 3LB0A 1TMHA 1ONXA 2FGBA 3FA4A 2YA1A 4OV9A 4M19A 4NI3A 1MVYA 4ORMA 3LCHA 2DZXA 3DC0A 4OE7A 5DY2A 3VABA 3WKZA 4O0ZA 3QEZA 2CETA 4Q32A 3SUVA 1UA7A 3ANVA 3HPXA 1EQPA 3UWVA 1ZS2A 1ECEA 4GCAA 2CFFA 3EWUA 4K8HA 1XH2A 3LRMA 3C2FA 3EX1A 3SCTA 1H5YA 4RNJA 4C91A 1EZWA 3TONA 1R86A 2DT1A 1TPVA 3PG8A 2PP0A 1V93A 3PJUA 4KEVA 5MKGA 1GYLA 4LAOA 1EJ7L 1DTUA 3RM4A 1S2AA 1Y7VA 2V5KA 4B91A 1PL9A 2AMGA 4E2VA 4GIEA 2GL5A 3G5EA 2VM8A 3TWBA 1G1YA 1TE6A 5KZDA 3B9DA 3N4EA 2YZRA 4MB4A 4FOUA 5FEZA 1XHGA 1XRSA 2QF7A 1NOUA 3CLMA 5D2TA 1TA3A 5FJTA 2Y7FA 3EEGA 4F79A 5GJNA 4MUZA 5C9WA 2PDIA 3IVTA 1J18A 3N29A 4B4HA 3WX7A 2ALDA 2YGYA 3F4DA 2FH6A 2XIMA 1UCWA 3GDTA 3FAXA 3UA3A 9RUBA 4F2BA 2ZX9A 3RDKA 1KM4A 4BQ3A 1YTEA 5JH2A 3DI0A 2QQ6A 5MKGB 3HV8A 1VEMA 4PUMA 5JVLA 3S1GA 2PP1A 5IHRA 4YVPA 2OWWA 4EWND 1D7KA 1PSCA 2X1SA 3N2BA 2PSNA 4D8ZA 1FH7A 3NQ7A 3PBVA 4MADA 4BI5A 1AJ2A 1M7OA 5I03A 2YW3A 2D2GA 4F9JA 5C5YA 2JIWA 3TSDA 2BHYA 4FNUA 3FJLA 4YVVA 4CCEA 4CQBA 1HP4A 2E8ZA 3BZJA 4IMEA 3W6YA 4EAYA 4EAMA 2UY4A 4HD5A 4ZA0A 3HG2A 2QAFA 3OU8A 4LVGA 1TPDA 2V81A 4MYAA 4FIRA 3VE7A 4GKTA 1EP1A 1W8SA 4DWSC 1EBGA 1J2BA 1EUNA 2V38A 2OZ0A 2WZTA 4B5UA 5FD0A 3VMPA 3ABZA 1CNVA 4WGHA 5C8BB 2PWFA 4C6EA 4KEMA 3WQEA 3R94A 4TR9A 3U2ZA 3RYSA 3EX2A 4Y96A 4HQVA 3MTWA 4W4QA 4V1XA 4LBSA 1TVPA 1JPHA 3TQVA 3MHUA 4N0RA 2NLYA 3T0BA 1H61A 1C7SA 1ME9A 1UD2A 1BHGA 4ZVJA 3W0KA 3L4YA 3WF3A 4P8XA 3V18A 3W88A 4Z42C 3PSWA 3VOHA 4ICCX 3W1NA 1K4HA 4A3YA 1E56A 3N15A 1W1VA 1XICA 4GC4A 3EPOA 5BU6A 3CUHA 4LXFA 4WJXA 4OBTA 2OYMA 4Z1AA 3CIXA 4XAPA 1UZHA 4E4FA 1K6WA 4H04A 3NIYA 4JKKA 3RO6A 5KMYA 2WANA 1JQXA 3R4IA 2PTDA 1YDOA 4H8NA 3VGFA 1EH9A 3WBEA 4HN4A 4XBKA 1QUMA 1K4GA 3TQ0A 3VZXA 4J1OA 4RDWA 3PFMA 3EKZA 2OQHA 3GR4A 3SN1A 1AH0A 3AXHA 3QW3A 4Y90A 3E0LA 1E4IA 2D3NA 3UVIA 1JCXA 1TCDA 1UWSA 1BD0A 2J7HA 4TV6A 5AHIA 3GDMA 1XX1A 3B8UA 4M51A 4C6PA 3MP3A 3BVJA 1UR8A 3PJWA 3CAQA 1JRBA 4HN8A 2VJXA 5G2IA 2Z1VA 3JS3A 3NOEA 5FJOA 4S3CA 2QJGA 4G1KA 1YEYA 1X7FA 3H7RA 3NA8A 2P3EA 1AJ0A 2HQAA 5F4XA 1AD1A 3LMZA 1MQPA 1TUXA 3KM8A 3GIQA 3RPTA 1ZP3A 4QG8A 4Q8OA 5EMKA 2YDSA 2V0TA 4MLRA 3N2XA 2J62A 4IQJA 1J93A 2YSWA 1UWQA 3SIMA 3DFSA 2WB5A 1OWQA 4FLRA 4LVAA 1XDJA 1KBJA 3ZSTA 3A6OA 3H21A 1BVWA 5D38A 4HU3A 1WV2A 3ARRA 3LCXA 1O7AA 2GJRA 1JUKA 1EPVA 3IGUA 5LIKX 4XZMX 4UOJA 2OEJA 1X98A 3PZ9A 2CIPA 1ADOA 3SEPA 4YTUA 1E71M 1W31A 1KWKA 3EWZA 4K7VA 1IIHA 2JGYA 5FJIA 1QHOA 5T9CE 3N1AA 5HINA 5A2AA 2QV5A 1EO5A 3G0XA 1RXOB 1TPH1 1TV8A 4UFJA 2YB4A 1QNPA 2FZMA 3M5XA 2PD5A 1A5CA 1YIXA 2QEZA 4ROPA 1ZCOA 3EMQA 2NSXA 1P0NA 4NZCA 3FN9A 1XLGA 3TSBA 2R6OA 4GVFA 3QGVA 4M82A 4GYFA 3MMUA 1Z32X 1DXFA 2EKGA 3WJZA 1YTKA 3TV8A 1VFLA 3AMLA 3K4DA 3R8RA 2PTWA 1GOMA 4L4LA 5TIMA 3UZ5A 3LBMA 1KCLA 1DWHM 1FHDA 3KBMA 3NYDA 2QJNA 1B5TA 3ALFA 2NV1A 3WDRA 4JFVA 2UY2A 4D6FA 1OY0A 3E2VA 2V9DA 3EA3A 4K39A 3VKAA 1WXYA 3WLKX 4C6BA 4Q7BA 4L64A 4KQNA 1JCJA 4ZB2A 1GVQA 3FFSA 3KOFA 2WVUA 3F4CA 3OG3A 1LRNA 1WDSA 1X6LA 2HNEA 4H4IA 3OHIA 2Z25A 4NZ5A 5K4ZA 4JYFA 1DQXA 1TMLA 4KERA 3CTLA 2NW0A 3NQDA 3H4XA 1BWVA 3DU0A 3FK4A 1NY1A 4TX9A 1TMQA 5BOFA 3NQ6A 4CQ9A 2XINA 3IJ8A 2WVSA 3LNPA 3F4NA 4UQCA 1BXNA 3UJRA 1Z7AA 1GG1A 3Q58A 3PS7A 1XYMA 2HXUA 4K7YA 4XAZA 2BSLA 3OOQA 4GJJA 3GNDA 1H7PA 1L9WA 1Q6OA 2ZRXA 4IP4A 2VKZG 4M6QA 1HL8A 2J79A 3V7PA 4HK7A 1TYGA 3MP5A 4JTLA 2VDGA 4XZLX 4E4PA 1QT1A 3NCOA 2H90A 3AZRA 4IZGA 4J27A 3LHTA 2XM1A 3MC5A 3ZR5A 4NUWA 2Z7GA 4H9UA 1UZDA 3GAYA 1UPMB 4GK8A 1PEZA 1XLMA 4DPPA 4Z1YA 1W1TA 1TPB1 2ZXDA 4NAFB 5A94A 1VP5A 3SCWA 5LIXX 1ZLPA 4XBSA 3W72A 1RQHA 2DUAA 1T7LA 2XN0A 4YYCA 5AHMA 1RVKA 1PKMA 1RCQA 1QK2A 5D09A 3OW1A 4YN5A 2OLAA 5EMMA 5DF0A 4RNFA 3UP8A 3CWOX 1RQBA 1NDYA 3VYLA 2GGJA 3EMZA 1EHNA 1DJNA 2GDQA 1QBAA 1L6GA 3QQWA 1J5SA 3RLVA 5K2ZA 4GVHA 3QBUA 5BXTA 1G5AA 3M5VA 1RPKA 5HNRA 1R2TA 2GVJA 8CGTA 1LG2A 4P2VA 3TYZA 1AFSA 2A1YA 3SQLA 3GH5A 2XIJA 4BK9A 2YBVA 2NXGA 1EEPA 3BV7A 3H6OA 1FY6A 4KKXA 3KOWA 4G7FA 5GNYA 9XIMA 1QCWA 3IJ9A 4KCUA 5FF7A 3SB0A 4K38A 1ODUA 2QIWA 3CUFA 1HGYA 1UWRA 2WQDA 1Q5MA 4UOQA 2DVXA 3N3MA 5D2VA 1P7TB 2E6DA 5LKYA 5JU6A 3LX9A 3RJXA 5BROA 2GDUA 2BDQA 4NI8A 4RXFA 4O8AA 1DKWA 4GI6A 3CH9A 5CBIA 4CCZA 1V08A 1E6XM 3BAJA 4UZSA 2D22A 4YPJA 2PI6A 3L5AA 3CV6A 1G9HA 4GRSA 1JZ4A 4S3GA 2FQIA 1DJIA 3EMCA 1XWYA 2PE4A 2HCVA 4EKJA 4HHPA 1HN1A 4FSAA 2ASHA 3ITCA 1O5KA 5BXPA 4O1EA 1U83A 1RK6A 4ERAA 1SJBA 1KW1A 1XD1A 3BLKA 2VEFA 6A3HA 5AC7A 3SFKA 4QISA 2WSRA 1RD5A 4CN4A 3BLEA 4BKNA 2WSQA 3H2AA 3U4FA 3BJTA 3GU1A 3FS2A 3PJTA 1KRAC 2WKGA 3LRKA 3TE9A 1KB3A 4I9TA 4D8LA 3NJ3A 1IHIA 2VGGA 5D8WA 5FL0A 1B30A 3RILA 4A8RA 1WBHA 2WMGA 4UMBA 1M68A 3LPPA 4L1WA 3UGVA 3LHUA 1JZ3A 4YS1A 1REQB 1H7XA 4RV8A 3C2OA 3KP0A 3EOOA 1C3FA 3LXBA 4PZVA 4EK7A 1QW9A 3IJLA 4JS3A 4AYGA 2O9RA 4WDXA 2VVSA 1VFUA 3AAMA 4GACA 4EANA 3SIZA 2ZYFA 1K3UA 3GY1A 4S38A 3PM6A 3LPOA 4BF9A 1HNYA 2L5HA 1JDDA 3ZQ9A 1ITQA 1SZEA 2WVVA 1PCWA 3NPUA 3H12A 5D4YA 2W9MA 1UR2A 2GJPA 3ITYA 1BAGA 2IPGA 3E0VA 3N18A 1OYAA 4AH7A 3UU0A 2D1ZA 1JYVA 5EMYA 4GI9A 3T4WA 4O1FA 3DZ1A 2OO6A 3EKLA 1GHSA 3GTFA 4UMCA 3KUMA 4KFPA 4UIOA 5C7VA 4HMCA 2WKJA 1LTDA 5FF4A 1LOLA 3LU2A 3P67A 1ZUAX 2PFHA 2R14A 5D30A 4URIA 3AS1A 4H9XA 1H1YA 4TVDA 3KOZA 3O6YX 5BYWA 3VMNA 1W91A 1OFQA 4IP5A 3BGGA 1TJPA 1O6IA 3TH6A 1KGUA 4KCVA 1K7FA 3TN5A 1W3TA 4L7ZA 1M41A 3OA3A 2BZNA 1PX8A 3WNKA 1SQ7A 3BL3A 1LLOA 3PPFA 1A4MA 1F05A 3D0CA 2VGBA 3W2MA 1EPXA 3BJSA 1R3TA 1HKJA 1ISYA 1VPQA 1H0IA 2WZEA 5I3HA 4MPKA 1M04A 3II1A 1XIIA 1X8CA 5T8GA 3WLSA 1EC7A 4M0XA 3CEPA 3AS2A 3MI3A 2GLKA 3TYCA 4OGZA 2G3IA 4H6RA 3W2KA 5E1QA 3CTTA 4J2PA 1V6YA 4I8YA 2ZDRA 2JK2A 1FTXA 3WG6A 3ZWSA 3EWDA 1O5QA 3VTRA 2R1PA 2X8RA 5I3GA 4MAVA 2ZXBA 3S6DA 2F6UA 3C8FA 3M7SA 4LC6A 1XD0A 5A6MA 5HJYA 3QOKA 4ZB0A 4P61A 4FS9A 3MYPA 2Y8VA 3GHTA 4QTGA 3W29A 1OGSA 1XCWA 2E9MA 4E4UA 3NPVA 3NZRA 1XRFA 2CBUA 3W6MA 2HJPA 1GVRA 5CSYA 2VRKA 1ODZA 3EXRA 4QSHA 3RRAA 5CCZA 1MZHA 5D2WA 2XIQA 3V1HA 4CUCA 5DMLA 2WKLA 2V63A 3B9EA 2QPUA 2INEA 4JTJA 3EOUA 1POJA 4S3EA 2GJNA 3KCOA 1E43A 2BX7A 2NZLA 2PAJA 4ZBCA 4WVXA 4LGXA 5MHBA 4LEFA 2POZA 3B8IA 4QP0A 5JUVA 3AU6A 4NRSA 4XUGA 3D46A 4QE1A 4XK2A 1TSIA 4HMEA 1YPXA 2QJHA 3COTA 3VZYA 4B3LA 2GPTA 1PVNA 1Z48A 4JD4A 1EIXA 4IL0A 2QKFA 1FCVA 3QC0A 4L9YA 3ZT7A 4P8UA 1XKJA 4AQLA 3O8AA 1J0KA 3KXQA 2Y5SA 3MUY1 4IMCA 3GK0A 3S83A 4R3UA 4M7SA 1X39A 1XLEA 4RE2A 3W84A 2ZXQA 3DFTA 2GSHA 4W88A 2CC0A 2PEVA 4LYPA 1TPWA 2OG9A 3I7QA 1A53A 1JGIA 3C0LA 4OU1A 4QDPA 7ENLA 1IZKA 1W3HA 5AYZA 3ID7A 3C2RA 4O28A 1F61A 4DO6A 2ISSA 2A6LA 4Y8EA 1EJWC 3EB2A 4FF7A 4ZOBA 4MNMA 2BOEX 3BWWA 1YX1A 3DOPA 1W1ZA 1LORA 4QLKA 2Y7EA 1FWJC 4IF2A 1A5UA 4MWAC 4LT9A 3WLPA 1AL8A 3GVRA 3I4KA 3S1WA 3L0NA 4G56A 4RDYA 2YXOA 4LV9A 3WYZA 4M6UA 1S5VA 3I3BA 3N04A 5A6SA 1CGYA 5BRPA 2VL4A 2WM0A 3GDBA 1TJ1A 4AD1A 2NWSA 2RUSA 1JZ7A 2VMFA 3U57A 3USZA 2UZ9A 5EL1A 1CI1A 3T2PA 1ZHAA 2PLCA 2QW5A 4O19A 2NX3A 2R1NA 1IWAA 4AIOA 1EGMA 2WYSA 4EX4A 1JEZA 3QHMA 1SO3A 1R46A 3URQA 4G7EA 3KZSA 4D6DA 1C90A 1NVMA 1N7KA 5LHFA 1T0OA 2D2OA 2NQLA 4GO9A 3W6LA 3GXFA 2ZRVA 1TZ7A 3EXSA 4IHCA 3ZJ7A 1YMYA 4UNKA 4XIMA 2YDRA 3RHGA 3G0SA 5U7SA 4L6DA 2OEKA 4IGMA 1YNYA 3FAWA 1SYTA 3IV3A 1OINA 2DORA 3PZOA 4JX4A 1WOBA 3NXFA 3UQNA 3L5LA 4UMAA 4PR4A