1AW1A

Triosephosphate isomerase of vibrio marinus complexed with 2-phosphoglycolate
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
255
structure length
255
Chain Sequence
RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHAESDEFVAKKFAFLKENGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAATAEDAQRIHAQIRAHIAEKSEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALDAKSFAAIAKAAAEAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Triose-phosphate isomerase (TIM) of the psychrophilic bacterium Vibrio marinus. Kinetic and structural properties.
pubmed doi rcsb
source organism Moritella marina
molecule tags Isomerase
total genus 91
structure length 255
sequence length 255
chains with identical sequence B, D, E, G, H, J, K
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1aw1A00
1D3GA 2V8ZA 3EX6A 1W31A 1B3OA 2WV8A 2XN0A 3W7OA 5D2XA 1MSSA 4UMCA 3QEZA 2V2DA 3S1WA 1ZAJA 6TIMA 2CFFA 4GUIA 1WV2A 1C9DA 3NQFA 3QSRA 3SGZA 5KINA 4JTGA 4I9AA 3OEXA 2VEMA 2Y85A 1A5AA 4AAJA 1G4TA 2A7PA 2NXGA 3B0PA 4OV4A 1VQTA 3TK7A 5CPLA 4B5NA 3A9IA 2E6AA 4NX5A 1D9EA 2QCDB 4BK9A 2WNQA 3IRDA 4JN6A 4O18A 4O0ZA 4OHQA 4FX7A 3UWZA 3VCRA 3NOEA 5H2ZA 3L5LA 2R94A 4PH6A 4LOCA 4RZ6A 1IIGA 5EYWA 4AB4A 3MI3A 2A21A 4JTEA 3G8RA 5TBOA 1JULA 4GBUA 3NGJA 3NO5A 4FNUA 1SZGA 1NF0A 5I3JA 3S5YA 4IJBA 1DL3A 2GJLA 3M1ZA 3PG9A 3KVJA 3UZ5A 1QPRA 1GVQA 3ATZA 4C1KA 1EP3A 4WOZA 1F5ZA 4LVFA 1K8ZA 3NDOA 1X1ZA 2DZSA 4S2CA 1FDYA 5DY3A 3TFXA 4FNPA 1WDWA 4X2RA 2JGQA 2FTPA 3HG2A 3CHVA 1AL7A 1PL9A 1JCXA 1IIHA 2GQ9A 4AWUA 4OE7A 4XTIA 5C2XA 1UJPA 3G1YA 1THFD 1WBHA 3O15A 1SW7A 2PRLA 4A2SA 4ZQRA 5FEWA 4O10A 1SFLA 4UMAA 4NNBA 4AVFA 3T78A 4ORIA 1IXQA 2HTMA 3KRSA 1IXOA 1W56A 3MHUA 1DBTA 3W88A 3HMJG 4PEKA 4BFAA 4RZ5A 1H7NA 1KA9F 2C0AA 4AWTA 2R91A 2I9EA 4MUZA 1UASA 1W0MA 3IVSA 4JTKA 2VC6A 5AFDA 1GVOA 2WSQA 3C61A 3HGOA 4FB7A 3C2OA 4O4WA 4JS3A 2ISVA 4TIMA 3TJLA 1J4EA 3P5YA 4EVZA 4JR5A 4E2DA 1FCBA 4XUGA 4UTMA 1VRDA 3LTYA 4DPQA 3ELFA 2IQTA 2E68A 4O8RA 1LM1A 2QEZA 1H51A 5D37A 4BWLC 1ICSA 1TB3A 1L2UA 3AJXA 1X8FA 2Y70A 4UNKA 3U6WA 4IXHA 4CNOA 3SJ3A 4IX0A 2QCHA 3M5YA 4WOQA 4K8EA 3NQAA 1HL2A 1JCYA 1YADA 4AF0A 2BLEA 3GVGA 4LWWA 4NQ1A 3RU6A 1TJRA 3TX9A 2EPHA 4UTWA 3LI1A 2PC4A 5LNSA 5LNWA 5BMXA 3C8FA 4N9EA 1MZHA 1XUUA 4DXVA 3OVRA 2H90A 3SGUA 2Z6JA 1HO4A 4DF2A 5C5YA 3P60A 3T44A 1U5JA 3L68A 1EB3A 4LY8A 1OYCA 3TROA 3BW2A 3TW7A 3DFTA 2ZBTA 1TPEA 3FIGA 5TQLA 5KZMA 2CWNA 1F74A 5F2GA 5CZJA 5IBXA 3W7LA 1JCLA 1R46A 2I14A 3BPWA 3L0KA 1VC4A 4GJ1A 3PUDA 3HO8A 3RFAA 3W86A 1OF6A 2CLKA 3IEBA 1YXYA 3W1XA 2A2IA 3PUEA 4H3DA 1SO5A 2X16A 4HKPA 1KM1A 2A6LA 5U7SA 2CLIA 2QKFA 3I68A 5D2VA 2YZRA 4Z1BA 3STGA 1RD5A 2NZLA 3UQNA 4PTNA 3EWXA 1GYNA 4YCPA 1TJPA 4WZHA 3IV3A 3KVMA 2V5BA 1LTDA 1F76A 2E77A 7TIMA 4IUOA 2YXGA 1L6SA 2NXIA 4HNUA 2H3DA 3RF9A 4OBTA 4NJKA 2QAFA 1ZAIA 1C8VA 1ME8A 3G0UA 4NJGA 1PE1A 4WQ6A 2FLIA 4O0KA 3QM3A 1A5CA 3ANYA 1BEUA 3SZ8A 4AF0B 3W1UA 3M0ZA 2PRMA 1PV8A 1RVGA 3GX9A 3OHIA 2ZRWA 3MW7A 4RX0A 4XTDA 4K7VA 1GTHA 3BG5A 2G95A 4FO4A 2RDWA 2ZQ0A 1TV7A 1PCKA 1YDVA 2WO5A 5F4XA 3KRUA 1R2TA 2BX7A 3MP4A 3DKJA 2B7PA 5EMUA 1K02A 1SW3A 1N8FA 3IIPA 3UWYA 3NQ6A 1RV8A 2BXVA 3MJYA 3MYPA 4GWEA 3ATYA 3CIWA 4R53A 2XN2A 4TU1A 4CCEA 2D73A 3PAJA 3DI0A 4X9SA 4DF0A 4FNTA 3M5XA 3IIZA 1TPUA 1ICPA 2NX9A 4UTHA 4K38A 5LHFA 4CQ9A 3G18A 3TSMA 3TE9A 2NLIA 4KFPA 3EWWA 3MP3A 3L5MA 2C3ZA 3T40A 2FQIA 1OF8A 3P80A 1WXJA 1YTDA 4Y6GA 2Y62A 4ZL1A 3M9YA 3HG4A 4AHOA 2PURA 1H62A 5DBTA 2DZWA 4UTTA 3W07A 2ZA3A 4UCGA 4AXKA 3UWWA 4X3ZA 1JJKA 2ZYFA 4X22A 4DQWA 1TO3A 4H4IA 2A7NA 3E9AA 3AO0A 4LVAA 1WOAA 3KVKA 1H7RA 1VHNA 4U4MA 5AHLA 5DBUA 3G3MA 3B4UA 1LCOA 1I2RA 4O1DA 1TMHA 3P8IA 3YPIA 2Y63A 5HUOA 1LRQA 3P8JA 4XKYA 1ZALA 1QAPA 2X1UA 3E02A 3L65A 2C18A 3HPXA 4LUIA 3F1QA 1P0NA 1ML1A 2ZZ3A 4OGZA 3EEGA 4OQVA 4YWIA 2R8WA 1K7XA 2WKJA 2QUTA 4LV4A 3W9ZA 4K8HA 3MP5A 3PC0A 1EWDA 1PHWA 4EF9A 3N3MA 2NUYA 2RHGA 3FOKA 3LGEA 4ORMA 4AEOA 2YYUA 3UWUA 1FY6A 2E5BA 2Q3RA 1KFJA 5FF3A 3K30A 2J88A 3R8RA 1LLZA 1OFDA 3GNNA 4Y90A 2JKAA 3GDRA 4CNPA 5KTLA 2DORA 5KMYA 1AW5A 2Y7FA 3G1FA 3C2FA 5LNVA 3G3DA 4MVAA 5KITA 3NL5A 5CSSA 2E6YA 1SO3A 2TYSA 3C4UA 4MZYA 2PRHA 2ZDRA 3V1PA 2DJXA 3F4NA 3LCGA 4N9BA 1ZHAA 2NX3A 3ZWSA 4O1BA 5D09A 4O52A 1YDOA 2FB3A 2RFGA 4RKAA 4MY9A 3GXTA 3C2EA 2P10A 4HNNA 4UR7A 4O54A 3BLEA 1OX5A 1VJIA 1H7PA 3G1SA 1PHQA 1OFEA 1YPFA 3HG5A 1RQHA 1FWNA 4Z1CA 2X2GA 4IMGA 4GUGA 1ZY9A 2WOQA 2WSYA 1KTNA 4M6PA 3S1VA 3G22A 2G5WA 4TMCA 1KFCA 2V5LA 4IXXA 4FHAA 1VS1A 5FEZA 2ISWA 2XN1A 3BLIA 1JVNA 3UZJA 2QAPA 3TMQA 5G5IA 1QWGA 3TSBA 3GR8A 4RV8A 2OZ0A 2YX0A 1QNVA 2QDGA 1I2OA 3NM1A 3W83A 1KM2A 2CLEA 5FF2A 3UY7A 3LBMA 3PUOA 4O50A 5BOOA 5KZDA 3W1RA 2R14A 1BKSA 4LT9A 5EBUA 3IIOA 3GNDA 1G4EA 4QAIA 4H6KA 2QF7A 3IVTA 1LLWA 1B57A 3STEA 4UC5A 5AC8A 5T26A 4HSOA 3A5VA 3TCEA 3THQA 2ZA1A 2ATMA 4A22A 2WQPA 3LHUA 4UUIA 3P5ZA 2C14A 3ZWTA 1XM3A 3UYCA 4UTIA 3WJSA 3NQMA 3PULA 5F4SA 3HPSA 5H91A 1DQXA 2DZVA 1G67A 3M47A 5DCDA 2C19A 3B05A 4NXSA 4LTSA 1SSDA 3TIMA 3HQ1A 3N9SA 3UY8A 4Q32A 4R7JA 3P74A 1GJPA 4O1AA 1R2SA 3BW3A 3LRLA 1FX6A 2P1FA 5F2LA 3LCLA 1JQXA 1PCWA 3W7KA 1JQVA 1CW2A 1XI3A 4PL2A 5A5WA 1K3UA 3BV4A 3W2LA 2OX1A 3LHZA 3BARA 3RLVA 3MMTA 2ABBA 3EX1A 4JX5A 4RLIA 4LVGA 4JTJA 1TPWA 3NQ8A 3PB2A 3CTLA 5AYZA 4Z08A 4AHPA 2QCLA 2DP3A 1OX6A 4EF8A 2G96A 2JBMA 5HMSA 4AWSA 4S1FA 3P62A 3GAKA 1VCGA 4PC8A 4WXYA 5HINA 1KM4A 1F2JA 1LBFA 1OFPA 5F1VA 4HNTA 1VYSX 2YSWA 3IIVA 1I2NA 1GTEA 3G8EA 3GDKA 1HUVA 1KV8A 2BWGA 3TQVA 4QIUA 4HT3A 2Q3OA 3STFA 4NJJA 2A4AA 1GOXA 4HNVA 3RLUA 5EPDA 4N9DA 3W7PA 3TUUA 4K39A 1T0OA 3B06A 2UV8G 2DU2A 1XC4A 4XBKA 2BSLA 2G97A 5AYYA 4UFLA 3MHFA 3DHDA 2OMAA 5A8GA 3B04A 5G2HA 5F2MA 3EXRA 3W71A 3GAYA 3R5EA 5CZSA 3KX6A 1KFKA 1W3IA 5K9DA 4FXSA 3PSWA 1F05A 2CLFA 4M19A 4GFSA 3W1PA 3DFSA 1JUKA 2P0OA 1VGAA 2ZA2A 1SSGA 2V81A 2WSRA 1YXCA 3QQ1A 1W5NA 5HULA 3L9CA 4LS1A 4O1CA 1P0KA 1EIXA 3W6YA 2RDUA 3CQ0A 4ONVA 2VXNA 2Y61A 3TR2A 4Y96A 5K4XA 3O6YX 4HIBA 5CZ0A 2QJIA 2WNNA 5K4ZA 3W1NA 4LW7A 4JX4A 3M41A 2QCGA 1ALDA 3LRKA 2VKZG 4AHQA 3QW4B 4QNWA 1OVDA 2DJLA 4MZ1A 1GVSA 4UNLA 1XXXA 2A5HA 5LKYA 2CLMA 1I45A 3I6RA 2NX1A 4FX8A 2ABAA 4LS0A 1H60A 4UTTC 2H3BA 1OFAA 1XBXA 3F03K 3LCIA 2ZTJA 2RH9A 1G4SA 2V82A 1VYRA 3N73A 4O15A 3W7NA 3W7GA 1KM5A 4FEZA 1TTQA 3LXBA 3MO7A 4HHPA 1Z48A 3SR7A 4RK8A 3LXAA 3T7VA 3UPWA 2A0NA 2Z1BA 1ME7A 3G1HA 1KTCA 3VI2A 3KFTA 5HWMA 4DEFA 4IX2A 1H1YA 3LCXA 3S6DA 4DO5A 1GVFA 1OABA 4HPXA 3GDMA 3M5ZA 1XBZA 3BVJA 4RCXA 3GYEA 4UMBA 1TRDA 3GIYA 4MFDA 4I7WA 4O12A 2ZRVA 3NQ7A 1QPQA 2F7FA 3EXSA 4DO4A 5DCBA 1C29A 1VPXA 4JYFA 2ISSA 4FX6M 4CCDA 4N2YA 4K7YA 2HMCA 4ADSA 4JTIA 3EX2A 3CIXA 2Y89A 2GQAA 4LV9A 4MY1A 3KXQA 4RZ4A 5J5RA 3DXIA 1N55A 3CWNA 3HF3A 4UFHA 4TO8A 4ZQCA 1I4NA 1X6UA 1QO5A 4MKNA 3W1LA 3V75A 3NQCA 1NAL1 5D03A 1UUOA 2VFGA 5IM51 3F4WA 3JS3A 2A7RA 4JYEA 3OVQA 2EF9A 4CQAA 2E1DA 4K6AA 3FJLA 3O16A 2J6XA 4C1LA 3W73A 2A85A 1TPH1 3TQKA 4UR8A 3W7RA 3LHTA 3TU9A 3RNDA 4FXRA 3S5NA 3LCHA 4S2BA 3Q37A 2J9XA 1FCUA 3WJWA 5D32A 3LCFA 1MO0A 4QQ3A 3UXAA 5G1TA 3W2JA 1YYAA 3G0XA 3OVPA 3NZRA 5G4EA 1BWKA 1A53A 2DZUA 1M5WA 1W37A 3TQ0A 3I7SA 1TV8A 5AOUA 3DBPA 1I2QA 1L6YA 3C6CA 1GPWA 2VEIA 1FWRA 3WK3A 1DJNA 1MEWA 1J5TA 1Q45A 1AW1A 1KTBA 5D02A 4JY8A 5AHMA 2JKEA 3LX9A 1SZFA 3G1DA 4Z0SA 2ALDA 2YYTA 3NEVA 1LOLA 3E49A 4JXCA 1F73A 1O94A 4ZQNA 3LRMA 3P7YA 1HG3A 2YW3A 4UFIA 3N2MA 4Y8FA 4TR9A 4GNJA 3CM4A 4A21A 2W79A 1TQXA 5FF7A 3TC7A 1ZENA 3W7MA 2CU0A 1G4PA 4POCA 3BLFA 4O14A 1OJXA 3DFOA 4I7VA 4FF7A 3TKFA 4IOTA 3L0GA 1MEIA 1BTMA 3O8AA 2CZEA 2YW4A 4O53A 1M6JA 4PFMA 1TV5A 1HTIA 1YTEA 3E12A 2B4GA 5I3GA 3OA3A 4QM1A 2V0TA 3O1NA 4W9TA 4Z0JA 3BK0A 4M7TA 2E09A 1Q3NA 3H55A 4FIRA 3W1MA 4N4QA 3QFEA 1ZNNA 1QMLA 4JTHA 2GOUA 5FESA 2C1HA 3W7DA 4JDYA 4FNSA 3S0CA 2GVLA 4JTUA 1DHPA 3JR2A 1Q6QA 4G1KA 2C15A 4NXKA 4MY8A 2CZFA 2BZNA 3UXDA 3MBDA 1WX0A 2CZDA 4IPIA 4QISA 1A50A 1W8SA 1EUAA 4UTJA 5AB3A 3QSTA 1L9WA 4O19A 3N9RA 3KOFA 4Y9AA 3EWBX 1I8JA 1N7KA 1JCJA 3W7HA 2VEPA 1LORA 1GVRA 2VFHA 4MIMA 2HS8A 3NPUA 4ALDA 3ZFHA 3QRHA 3LTSA 4NT0A 1GEQA 3THAA 5FF0A 4MLJA 1MXSA 1K03A 3DFPA 5HWNA 3UWQA 3WJZA 3I7RA 2B7OA 1KV5A 1KW1A 3NL6A 1QCWA 3DAQA 1DJQA 5G4WA 3W7QA 1CX9A 1FDZA 4GE8A 5HR6A 1OK6A 4JYDA 1K7FA 4Q4KA 3QH2A 3LCWA 1T96A 2VFIA 2JKPA 3LM7A 4ZZ9A 3MYOA 2Y7EA 3BW4A 2ATSA 3U8GA 3GDLA 5F1UA 4Q33A 2FIQA 1S5WA 2ZZ4A 4ZQOA 3ABOA 3NZ1A 2ZRUA 2RDTA 4JTSA 2H8ZA 3CLMA 2ZRYA 3DH7A 5K2ZA 2O7SA 2VFEA 1GZGA 1P4CA 5HJLA 1IGSA 3MBFA 4OU1A 4FNRA 5K3VA 3UPBA 4DBEA 3G0SA 3SIZA 3M7WA 1OFRA 3QMRA 5F4WA 3KVLA 1UBSA 1SUXA 3LI0A 8TIMA 4LUJA 1JUBA 3CWOX 4CLMA 5I3FA 5J5DA 4JX6A 3T55A 3M5VA 2WNZA 1GT8A 1G69A 3D0CA 2CZ5A 3PBWA 5D38A 4HSNA 5CSRA 2GJNA 1EX5A 5KSWA 2QCNA 1LRNA 4QITA 3HGRA 1TTPA 1JRCA 2ZCGA 3WJYA 3WJXA 3CPRA 5FI8A 3RMJA 3NYZA 3MHGA 1LZOA 3NA8A 3TFCA 4NJIA 1FCQA 3P61A 4IPJA 2Q8LA 1LROA 3FEMA 4CNNA 3DHFA 1TRIA 5AHFA 4A2RA 2QCMA 3O06A 3R13A 1UCWA 4O57A 3W7EA 3QMTA 4IMDA 3TC6A 4UTLA 2FPTA 2Z6IA 1W5QA 3WK0A 3HG3A 4JTTA 1QFEA 3W75A 3HB9A 5D2TA 1QR7A 3DFNA 4YMZA 2ZTKA 4O4VA 3QZEA 3NR0A 4A3UA 1NEYA 1AW2A 2FPYA 2QDHA 3SY5A 2H8XA 4FNQA 2YPIA 2C16A 2WJZA 1LBLA 4YLWA 1H61A 1OHLA 3DZ1A 3W2NA 1TPDA 3NG3A 4NU7A 5BRBA 4NVTA 4LS2A 3BGJA 5FF4A 3DI1A 1W3NA 4BI7A 4IMFA 4MLRA 1TTJA 1F6PA 3S5ZA 3TMLA 4KWWA 4IMCA 3W2KA 2VELA 3PBYA 2ZZ6A 3IGXA 4M6QA 5EY5A 2Z2UA 5DCEA 2A1YA 1WA3A 1ME9A 1BWLA 3LV6A 5F2IA 2ZZ5A 3WK2A 3LHVA 1YLVA 1GWJA 4DPPA 1OFQA 2W0UA 3EWYA 1U83A 4XWUA 2DZPA 3LV5A 5D2YA 3WK1A 2FPVA 3TJXA 4JIPA 3N14A 4Z1AA 1O5KA 1XKYA 1JUEA 4MYAA 3W3OA 3QQ0A 3NL3A 3Q58A 4R33A 2HS6A 2Y6ZA 3S5OA 3ABRA 4JY9A 1LDCA 2NV2A 1VCVA 3TSDA 3ZS4A 1SFJA 4O16A 3SFKA 3NQGA 4YCOA 1T8XA 4WX2A 4BI6A 3CB8A 5AHEA 3M43A 5DXXA 2ZFAA 3EKZA 1T99A 1YPIA 2X1SA 3FFSA 3BG9A 4J9JA 4LC8A 4YL2A 1JCMP 4QJ1A 2PCQA 3N19B 3QW3A 3MI6A 2HSAA 1S5TA 1Z42A 3KAOA 3L2IA 1Q6OA 4IQLA 5U4NA 4JTLA 1H63A 5AC7A 3W70A 4GUJA 4DBDA 5G2IA 1LP6A 5SWUA 1S5VA 1DVJA 3GXPA 4R34A 1LOSA 4AMAA 3BGGA 3L66A 4P2VA 5GVJA 1GG0A 3ZR4A 1NSJA 2AAMA 3IGUA 2Y7DA 3T4CA 1F7BA 1Q6LA 4DELA 3GB6A 1F6KA 4UTUA 1OX4A 4N4PA 1I2PA 3EX4A 1D3HA 1FDJA 1XBYA 2EAWA 3C52A 3TV8A 5HWJA 3P84A 1KBIA 5C54A 3S1UA 3GKAA 5KZEA 3NNTA 1P1XA 2TSYA 2YFOA 1HO1A 6ALDA 1A5SA 1H5YA 2CLHA 3TNOA 2QJGA 4UFJA 4PL1A 1TSIA 1YXDA 2JK2A 3LLFA 4KFOA 5FEPA 3S8HA 3FJ6A 3EX3A 3TDFA 5CZTA 3I65A 4ZQPA 2E5DA 3TA6A 5DXYA 4UFMA 4QNEA 1EA0A 3LXCA 1RPXA 3DU0A 3W87A 3B8DA 3ABQA 5K9XA 3M16A 3Q2DA 4K36A 4RR4A 1WYIA 2B0MA 1Z41A 1G7UA 5D05A 3A23A 3TW6A 3SECA 2BTMA 5AN7A 3TAOA 3W1QA 4GC4A 3W76A 2EHHA 3HIJA 3RK8A 3W7JA 1VHCA 1M7PA 2TPSA 3VE9A 3G24A 1MEHA 3C0JA 1DV7A 3M6YA 5G2WA 1QOPA 1LBMA 1AL8A 2AQWA 5K9CA 3H53A 5CPOA 3VE7A 3MUXA 3O07A 4L4LA 4RXGA 3HBLA 4QSHA 2J9YA 1TREA 4HPJA 2GQ8A 3U2OA 1V5XA 4FIQA 3LDVA 4ML9A 3W7CA 5BW6A 2V2HA 2VENA 4BF9A 1H7WA 4OWGA 1Z44A 3B0VC 1OX4B 1UUMA 1KFLA 5CPNA 4OT7A 4JIQA 1G6CA 1WOBA 3DKLA 2VOMA 3A22A 3EKLA 3GR7A 3FKRA 4E2BA 3W1AA 5AYXA 3NXFA 5L6UA 3L21A 3NQ2A 2B7NA 1SO6A 4NNCA 3A21A 4NX0A 1FXPA 3C3NA 1O95A 3OG3A 2QJHA 1OYAA 5EKYA 3PWAA 3JRKA 1SR9A 4CQ8A 1ADOA 4LU0A 1SPQA 3LLDA 1LRTA 3O6CA 2YGYA 3QJAA 3L67A 4WY0A 1A5BA 5DN1A 3QF0A 1WAUA 2NWRA 5AC6A 1SO4A 1WQ5A 1M7OA 2DZXA 3O6DA 1EPXA 4UIOA 1W1ZA 1VZWA 1VYPX 2TMDA 3OIXA 3EXTA 2ZRZA 2RKXA 5DY2A 1K8XA 3UNDA 1ZJIA 4WY0F 5TIMA 1XCFA 5E1QA 1AG1O 1TPVA 1L6WA 3PBVA 5BNKA 4AH7A 1XDLA 4LNYA 3WFAA 3E0IA 3W2MA 5D33A 1QOQA 1NVMA 1UB3A 2H6RA 5I3KA 1GG1A 4TX9A 5AHIA 1IF2A 1SZEA 3MWAA 4TMBA 2QCFA 4WXZA 3NQVA 1RQBA 3PG8A 5LNRA 3W72A 1EUNA 2ZZ2A 2FDSA 4D2JA 1KLYA 4MPQA 4UXDA 4XBSA 4BI5A 4M5PA 1QDSA 3PBUA 3EB2A 1KBJA 2C6QA 3CT7A 3H54A 5HUPA 3SW6A 1O5XA 3BO9A 4JDBA 1YTKA 3PB0A 3S1XA 2F84A 2W6RA 1FBAA 1QPNA 3B03A 4E38A 4EIVA 4WD0A 1E51A 3R2GA 4EOUA 1EP2A 3HJZA 1WBJA 1FWTA 1IXPA 5LGXA 1PS9A 2OT1A 2NUXA 1TIMA 3P81A 3PR2A 4MJZA 3PVFA 4ZMGA 4M7SA 1H7XA 3DENA 4WY0B 4ADTA 5I3IA 2NUWA 3W23A 1TTIA 5G1YA 5DELA 1B4KA 3NAVA 4PA8A 1OYBA 2FFCA 1OFBA 3OBKA 4NNAA 1VLIA 1W5MA 3STCA 5LNUA 5DLCA 1TYGA 2B7QA 2QUVA 4L4MA 4XQ6A 1NF7A 1FCVA 3KRZA 3FYOA 1XUZA 3O05A 2GVGA 3A24A 3P67A 3G1AA 1SQ7A 3N2XA 1PVNA 2GPTA 3QPZA 5HQEA 4LRTA 1DKWA 4YXGA 3LBCA 2J9ZA 4PODA 2EKCA 1IXNA 2QUUA 4HN4A 4EWND 5E93A 3DFQA 3QPYA 1JCNA 4BR1A 3C2VA 2VEKA 5CG7A 2O7QA 3SSJA 3CU2A 3G1VA 3C56A 4LVBA 3W2UA 3CEPA 3NQEA 1K8YA 1VR6A 2Y88A 3FYPA 2XFWA 1EWEA 4JNMA 3GXNA 4MOZA 2VFFA 1VCFA 4KWVA 4LC6A 1K7EA 5K7JA 4GUFA 4GRSA 4NZJA 2J24A 2JGYA 1DQWA 4A29A 1GYLA 1FWSA 1X7FA 4UFKA 2C13A 3NVTA 4WJEA 1H7OA 1FUYA 3TH6A 1ICQA 1ONRA 3LB0A 1JR1A 4O11A 2A6NA 1EP1A 5C6MA 3I7QA 4ADUA 3G1XA 1B4EA 3C2RA 3TXZA 1KM0A 4M6VA 4O28A 2NV1A 1Q6RA 3S9YA 2GUUA 5CGQA 3W1TA 4GUHA 4KKXA 3GK0A 5FEXA 1XFBA 3W84A 2QCCA 1VH7A 5CKSA 1RR2A 3B0UX 3EWUA 4JD4A 2DZTA 3GDTA 2Z0IA 3QMSA 5EA9A 3GLCA 3HPZA 4O13A 1W54A 2EGZA 1AMKA 1DOSA 4MYXA 4N6EA 1KM6A 5D2WA 3S42A 3GKFA 2Y7GA 1W5PA 2CLOA 2KZHA 3W85A 3BG3A 1KFEA 2WPBA 1FXQA 2NXHA 3IGSA 4NUWA 1H50A 1OK4A 4IMEA 4P61A 4BWLA 3PM6A 4PCFA 1KLZA 3EWZA 3E96A 3IVUA 5D04C 3KHJA 2YDAA 5C55A 1XBVA 2X30A 5LSMA 2CLLA 4XZ9A 1S3HA 3NPVA 2I1OA 2V30A 3FA5A 3CC1A 1LOQA 2OT0A 3LOTA 4IGHA 2QCEA 4U28A 5L9FA 1J2WA 3PS7A 5ABTA 3IIXA 3ABSA 4KFNA 1RQEA 2ZRXA 2E6DA 3SI9A 5HR7A 1OG0A 3W74A 3LHYA 1O60A 4RJEA 3Q94A 2E5CA 2Q8ZA 3R89A 2ZZ7A 1B9BA 1ZAHA 4LRSA 5LHEA 3QC3A 3LTPA 1V7YA 1H1ZA 1TQJA 4NZFA 4JICA 4DO6A 1W3TA 2GVJA 1KM3A 4IWWA 1TPFA 1EEPA 4XKYB 1CI1A 3NQDA 5AHNA 4O17A 3L5AA 2OJPA 4N6FA 3FLUA 1HFBA 3VNDA 1R30A 1O4UA 3VFLA 5I3HA 1VLWA 2TRSA 4K37A 1GQNA 4Z1DA 4I7UA 1KFBA 1ZFJA 2LLEA 1XL9A 2ZZ1A 1P5BA 1YDNA 3W22A 3NPWA 3NM3A 5E0KA 3HGSA 1SZNA 2V2CA 1QPOA 1SW0A 5LZLA 2CW6A 3NPXA 1W5OA 3FS2A 3TAKA 3UD6A 2PE4A 1R47A 3PY2A 3QYQA 3PSVA 4NJHA 5LGZA 4UTWC 5MHBA 3A5FA 4ZVJA 4GXMA 5EL1A 4OV9A 4JEQA 1TCDA 1TPB1 2FJKA 1NFBA 3PF3A 4LVDA 1QO2A 3LERA 3DGRA 4CCCA 2X1TA 2QCDA 4RXFA 5BMWA 3UWVA 1LYXA 3W7IA 1G7VA 4DF1A 5IBXC 1SU5A 1PIIA 3TXVA 1R2RA 5D30A 2OCZA 3NL2A 4JTFA 3GZ3A 1XDMA 3MI2A 1JRBA 1TPC1 3N34A 4N9CA 1Y0EA 3INPA 2QR6A 5HNRA 1FQ0A 3HOJA 4JGDA 2VFDA 4WUIA 4MZ8A 2AGKA 2YCEA 1ZCOA 3L0NA 1FWWA 2NWSA 3FKKA 2X1RA 2YFNA 4MJMA 1X1OA 4ICNA 1DORA 3O63A 3USBA 3LHWA 4ZQMA 2J27A 3R12A 3VKJA 3P82A 2V9DA 3CEUA 4MFEA 3M44A 4N02A 4E0CA 1RZMA 5CPMA 4UTKA 2E6FA 2YR1A 3HGJA 2FB2A 1AK5A 1OFOA
chains in the Genus database with same CATH superfamily
2Z1XA 1WDPA 3A64A 3EX6A 1Z9AA 3UR7A 4AZCA 6XIMA 4QAWA 5CC7A 2CHOA 3TN5A 3CK5A 3H4WA 3GW3A 4KCVA 2POTA 4DZAA 3OEXA 2REQA 1G4TA 2A7PA 4L56A 3B0PA 5CPLA 2E6AA 1MFVA 3DYMA 1IEWA 1EJ7L 9CGTA 2QCDB 4DX3A 3IRDA 1XD0A 3VCRA 3NOEA 4PUKA 1W1IE 3HZ3A 1O6IA 2OOGA 2O92A 3A3WA 2Z27A 1EA9C 1IIGA 5D9OA 3TN6A 1JULA 4GBUA 4FNUA 3OLEA 3S5YA 1F07A 4MNMA 1XYLA 3PG9A 2VO5A 1X97A 5FJUA 1F5ZA 3AXKA 1XRTA 4S2CA 3PZQA 2VWSA 3H24A 2PBGA 4LNCA 4FNPA 1XYBA 2XFRA 3ZOAA 1ESWA 4X2RA 5G1MA 1MUCA 3VD3A 1AL7A 4ZENA 5C2XA 1R86A 5BYWA 5C9XA 1XRVA 1AQMA 2V38A 2CPUA 4XIAA 3ZM8A 1UR1A 4AZCB 4B5TA 3T78A 5ABHA 3SUUA 1FWAC 5PTDA 4WGXA 1V08A 4KIRA 3GHRA 2QPXA 1ZJHA 3IVSA 3ZO9A 4JTKA 2REQB 2VC6A 3OLIA 5DT7A 3C61A 3HGOA 1XLMA 3KBVA 1BWVA 1IR2A 3TJLA 1HJWA 3BDKA 1CENA 1EPVA 1FCBA 1I1WA 4LCQA 2VP8A 4DPQA 3ELFA 3VCNA 2E68A 3CS2A 2NQLA 3CTTA 5D37A 2GQ3A 1TB3A 2OEMA 3IJ6A 1FWIC 2CETA 3MY9A 1CXHA 4US6A 4CNOA 1FFQA 2PDFA 3ZLFA 4F0LA 4K8EA 3TN4A 1JCYA 1V3IA 5CLTA 1NOFA 3W81A 1JAKA 3GVGA 4LWWA 2EPNA 3TX9A 3QZ6A 3VOCA 3LI1A 2QHAA 5BMXA 4H9TA 3TTQA 1UZDA 3E2SA 3SGUA 2FTWA 1HO4A 2Z6JA 1J0JA 3QZAA 4XSMA 4LY8A 5DFAA 2NT0A 3PNUA 4F48A 1TPEA 5TQLA 1HKWA 2D0GA 3PANA 3UYIA 5F2GA 5IBXA 3W7LA 2Q6ZA 2I14A 4GJ1A 3RFAA 1DWIM 1OF6A 4AD4A 1YXYA 4HYWA 3WQEA 3W1XA 2A2IA 4DJDC 3EDDA 5D2VA 4DO7A 3WFLA 5LIKX 2GLKA 3E5BA 3STGA 3UETA 1RD5A 6ENLA 1FA2A 4BY3A 3AIEA 4DXXA 3LA4A 4DIAA 1TJPA 1V6WA 4MB5A 5CZKA 3KVMA 1EHNA 4U2YA 7TIMA 3WUEA 4F40A 4IUOA 4MWAE 2H3DA 3SQSA 4M0XA 3G0UA 4IFRA 2ZIDA 4W7UA 3A9BA 5A6LA 3VIKA 3EDFA 3PWIA 4WLCA 1M41A 2EPKX 5HBFA 3GG8A 3BG5A 5BU9A 1M1BA 1TV7A 1PCKA 3EA3A 1YDVA 3D47A 2WZEA 3KRUA 1R2TA 2GWGA 5BXSA 5LIWX 3RN6A 5EMUA 4JQ1A 3SY8A 3BSGA 1SW3A 3CIVA 3IIPA 3TVAA 4MF4A 4GD0A 3L2LA 4HU4A 4K8GA 4M8UA 2XN2A 3GS6A 2D73A 4DF0A 1A0CA 3M5XA 1ICPA 3CZJA 3SCTA 4JIRA 2XVNA 2BMBA 2J7GA 2PD9A 3EWWA 1E6PA 2GVYA 2JF7A 2OTDA 4TQTA 4WSKA 4B90A 5H8PA 2FQIA 3P80A 4Y6GA 2Y62A 3W28A 3OJGA 4AHOA 2PURA 3VTRA 5DBTA 2NQZA 4I5XA 3W07A 4EWJA 1TMLA 1R3WA 4UCGA 1JJKA 3NVDA 4DQWA 4H4IA 2IS7A 4IQEA 4K3ZA 3AO0A 6XIAA 3DG7A 4JKKA 1WOAA 5AHLA 4URIA 4RNFA 3BZJA 3B4UA 1LCOA 3UWEA 2VZOA 5FD0A 4PCSA 1ONEA 1XH1A 2C18A 1YW1A 4HTYA 2F2HA 3R25A 4XZWA 3E0VA 4WGHA 4OQVA 1DTUA 3W9ZA 2QUTA 1XR2A 5HMFA 3MP5A 3CV2A 4GHRA 2ZX9A 2ZDSA 2FHBA 1C8YA 4ORMA 1XCWA 5AZ0A 4GK8A 1FY6A 3T8LA 3PJXA 2I9UA 4NZ5A 3R8RA 1LLZA 2GGEA 1OFDA 1I60A 3GDRA 5KTLA 3G3DA 4RNJA 3K13A 2J78A 2PDKA 1NDVA 3L4XA 5KITA 2E6YA 1DIEA 1LUCA 4GGBA 3C4UA 2P3EA 2ZDRA 3V1PA 2DJXA 3LCGA 4N9BA 3VIFA 2NX3A 5A6JA 3ZWSA 4O1BA 1XYAA 2AL2A 4O52A 4IT1A 4RKAA 2GJXA 3RPTA 3C2EA 3NZPA 4BZYA 6REQA 4HNNA 4UR7A 1H7PA 1PHQA 2PU0A 3ZJKA 3RDKA 3WLTA 1GKPA 3GTIA 1E4NA 4Z1CA 1AFSA 4IMGA 2WOQA 3ARUA 3S1VA 3G22A 3THDA 1NJJA 4GVHA 3VNIA 3B8IA 2V5LA 3MV01 3XISA 5C7HA 3AHVA 2FKPA 1OEPA 3MSDA 3TMQA 3GR8A 2YX0A 1QNVA 4QG9A 1XDJA 1SFTA 4JTDA 4H7VA 5FOOA 3ARTA 5BOOA 1DWFM 1JNDA 1XSJA 5JXQA 4LT9A 2X0HA 4H6KA 4ZO7A 3IVTA 3Q67A 2PWDA 1B57A 2HEJA 4UC5A 4GYPC 1TZZA 5T26A 3THQA 2ATMA 4QDPA 4A22A 1JEZA 2WQPA 1TZ9A 3LHUA 1LUCB 3SCRA 1XM3A 2CEQA 1NELA 7A3HA 5F4SA 3WD4A 2NQ9A 1DQXA 2DZVA 3KOZA 2WWDA 4QE4A 3B05A 4AVOA 4HHMA 2AL2B 1EGMA 3TIMA 5EMKA 3HQ1A 6REQB 3W38A 1K9FA 3CAVA 1GJPA 2XH0A 1BGAA 3DOPA 3LCLA 1AUSL 1EH9A 3U3HA 4Y9PA 4MSSA 1XI3A 4FOJA 4YYCA 1KQYA 4R85A 2OX1A 3RLVA 3AHZA 4HGXA 4JX5A 3PZNA 3IGHX 4NASA 4JTJA 3NQ8A 5B7YA 4S3EA 1J12A 2E67A 5A94A 3LYEA 1LQ0A 1PZ2A 1OX6A 2G96A 3GTFA 3BOLA 3IUDA 4W4QA 2VNCA 5I3DA 3VU2A 2WKLA 3EOOA 4EPBC 3NQBA 2VZVA 1JZ8A 1LBFA 3R43A 4HNTA 3KP1A 4ICCX 1HUVA 4AEFA 2Q3OA 3STFA 4Z2KA 5EGRA 3GG1A 2PLCA 5EPDA 2Y8KA 3W7PA 2GDVA 3WNMA 3B06A 2DU2A 3CV1A 2WZMA 1XC4A 2G97A 5AYYA 1M68A 3TEVA 1J10A 5A8GA 2ZX6A 4BQ2A 3G2GA 3UJFA 1E43A 3GAYA 3R5EA 5CZSA 1KFKA 2I17A 1UD3A 3W1PA 2X05A 2C79A 2V81A 3AXXA 4IP7A 1VF8A 1QT1A 1AQ0A 2UY3A 1W5NA 3U2CA 2WAGA 3CQ0A 2VXNA 1QVBA 2Z7KA 5K4XA 3UEQA 1S39A 4DJEA 3VOJA 2GSJA 4JX4A 4Q4OA 4XZNX 3W4RA 3LRKA 2W66A 4QNWA 2DJLA 2WVVA 3HPFA 1GVSA 4UNLA 5D9PA 5H6HA 3ES7A 2FGZA 2CLMA 1I45A 4FX8A 4W85A 4PSPA 5CC5A 2ZTJA 3WLQA 1VYRA 3F5KA 3N73A 1GOOA 4O15A 3HURA 2PEVA 3W7GA 1GYMA 3LXBA 4HHPA 3AMGA 4W7WA 1Z48A 4RK8A 3LXAA 1WCGA 3UPWA 2A0NA 3G1HA 3VI2A 2E9BA 4QDWA 1RK5A 2Z2AA 4NF7A 4DO5A 3D3FA 3L4VA 4GISA 4V1YA 1IEIA 4UMBA 4YU1A 4WVXA 3UJEA 1XYMA 3AI0A 1TRDA 3GIYA 1TV4A 4DRSA 3NQ7A 2F7FA 3IWPA 4DO4A 3R6IA 3AIUA 1VPXA 4FX6M 4KW2A 4CCDA 1M53A 3MWCA 1E55A 4LSBA 1QHZA 2GQAA 3H22A 1FH9A 3LNPA 1P6WA 4MY1A 1XIMA 2DZAA 1KRBC 5HA7A 2VX5A 3DXIA 4H8VA 4QE1A 3ITOA 4UFHA 4TO8A 1X6UA 2FZMA 1QO5A 1U30A 4MKNA 3UJSA 4PR4A 5D03A 2WVVB 2QULA 2E1DA 3WZ0E 4BQ3A 5AC5A 1LG2A 3O16A 4C1LA 2HPMA 5DMNA 3VAVA 1TPH1 4MMWA 3TU9A 4FSAA 4WDWA 4QE5A 5FJJA 5LXEA 4S3GA 1Q6GA 1F4AA 4GCXA 3LCFA 1MO0A 1W1VA 1WB0A 2OZ3A 4JCLA 3MU7A 3G0XA 3OVPA 3B9DA 4FA3A 3KCJA 2DZUA 2AKMA 1M5WA 1W37A 3OB8A 3I7SA 4YVPA 5JMUA 4GCAA 5A8PA 1I2QA 3WL0A 1FP9A 3N2CA 1GPWA 2Y8VA 4A3YA 2DIJA 2PWVA 4X60A 1DJWA 3TYUA 1J5TA 1MXGA 1E4IA 1Q45A 4JY8A 4PBEA 3SCSA 1SZFA 2VDGA 1S2TA 2YYTA 2R9RA 2ZVRA 3CLWA 3G6LA 4RUBA 3S2LA 4BJHA 1IZJA 2FZDA 3LRMA 3WBEA 3SSZA 2XVGA 3VOIA 1HG3A 3G5EA 4UFIA 3N2MA 4Y8FA 4DUOA 2Z1VA 4GNJA 3CM4A 1RA5A 4QFUA 4TOQA 1YE6A 3RITA 3CUGA 2EPOA 4LBSA 4POCA 1V6YA 5DRCA 2XTKA 4H8UA 3DFOA 3TLQA 1VPQA 4KBXA 3DUGA 2YW4A 5CBJA 4H9UA 3ONBA 2NVCA 3VOGA 2B4GA 7ODCA 1RBAA 2V0TA 1W1TA 2YZ5A 3ITCA 4M7TA 1YNYA 3UR8A 3KEHA 4HNCA 4CCZA 4CD4A 2PC8A 1JNEA 3VOHA 1IWPA 3DC8A 4IH3A 4S38A 2C1HA 2XIBA 4ASTA 3WQVA 1Q6QA 2ZUUA 4BF5A 3DX5A 4KH2A 1CNVA 4ML4A 4U5KA 1WX0A 4QISA 2YB1A 4UTJA 2J7HA 1ELSA 1L9WA 3GC5A 3KOFA 4Y9AA 3EWBX 1JCJA 5AY7A 1LORA 1XIIA 3UPMA 3C5QA 2VFHA 3BLPX 4QP0A 3NPUA 4HN8A 1ZU8A 3ZFHA 2CBUA 3THAA 4NYYA 1MXSA 3TR9A 5HWNA 8XIAA 5HJYA 3WJZA 1S5NA 3M0IA 5TNVA 1KKOA 2J75A 4RZBA 4J3SA 2B7OA 4J2PA 3WD3A 3M7SA 1UQZA 2OSXA 3NL6A 1XLJA 1CGYA 1DJQA 5HR6A 4DJDD 1OK6A 1UWRA 3BTNA 3WLNA 4Q4KA 4CQBA 3A4WA 3QV6A 3LCWA 3N04A 1QWKA 2VFIA 9RUBA 4ZO9A 3AMCA 3V1HA 4ZZ9A 2WC7A 2Y7EA 3U8GA 3P0WA 4U10A 1WDRA 5D8WA 3VX1A 1TVNA 5EMYA 4C5YA 1US0A 4PB4A 3U4AA 1RBOB 4ZQOA 3ABOA 4IPLA 4JTSA 2KX9A 3SUSA 2PZ0A 3V5CA 1A4MA 3MBFA 4B9YA 3GFXA 4OBRA 3MCNA 2VI0A 2OKTA 3M7WA 5CH9A 4ACZA 2NV9A 1Z8AA 3CWOX 4CLMA 3S2JA 3T55A 3M5VA 2YKKA 4JTAA 1QW9A 5D38A 2D2JA 4W84A 1YNQA 1TTPA 4HPHA 1JRCA 4J27A 1P43A 1R3RA 5FI8A 4ENLA 1UR0A 4IPJA 1E0UA 1ISVA 3DN5A 2ON3A 4A2RA 4Z17A 2VEGA 4DZ5A 3VMOA 4PTDA 1C91A 2JALA 4MKVA 2ONEA 3QXBA 1CT5A 1O1HA 1Y7VA 2JF6A 4DJFA 4UTLA 2FPTA 7ENLA 2XJ7A 3WLRA 2BHUA 1QFEA 2PU1A 2BVYA 3HB9A 5D2TA 1Y5WA 2V5CA 3OZYA 1D2KA 4M1RA 1E4LA 1Q4WA 4PZVA 1YPXA 1DE6A 1UWIA 4A3UA 1UZ4A 4YN5A 1AW2A 3VIOA 5KETA 4FNQA 4ACZB 2PDMA 4YLWA 2E0PA 3FDGA 4R9OA 2GWNA 3KWXA 2F61A 4LS2A 1YEYA 3KLKA 1PJ9A 4BI7A 3M6DA 4JIEA 1TTJA 3RO8A 1GPFA 1V6XA 4KWWA 3W2KA 2O9RA 4R7WA 2PLKA 4UBPC 2Z2UA 1H5VA 1D8CA 3L7RA 1ISWA 4MDPA 1PWMA 4XWUA 1UC4A 2BVWA 3TZFA 3VX0A 2OLSA 1EZWA 2AMXA 2P50A 2F6XA 1W9XA 2YCKX 4EK7A 2VD8A 3QQ0A 1UD4A 1Q6CA 3SJNA 1JIBA 4YHEA 3ABRA 4C7DA 1IZCA 1SFJA 3NQGA 1T8XA 4BI6A 1EC7A 2X1SA 2PCQA 2NT1A 5CG0A 3WDJA 2XIJA 4UQ9A 2DH2A 3N19B 3QW3A 5CPQA 2D2OA 3KDNA 1R3TA 4ZOAA 1OT1A 3W70A 4GUJA 4DBDA 5SWUA 1LP6A 4MG4A 4YJ5A 4R34A 2PA6A 1LOSA 3BGGA 3PTKA 4S3CA 1DTNA 3ZR4A 1F3XA 2AAMA 1Q6LA 4DELA 1F6KA 4UTUA 5ABEA 1XBYA 4ZOCA 3WN6A 4J3XA 3T0DA 4BHYA 1LT7A 1P1XA 2TSYA 6ALDA 1FWJC 3K4WA 3TNOA 4RDYA 1YXDA 2JK2A 3BLKA 4KCUA 3TDFA 5BWAA 1ADDA 4QG8A 5JBDA 3M0KA 3VD9A 2ZUNA 1TWSA 4BKNA 3THUA 2UBPC 4QNEA 3V18A 2RAGA 3R58A 3W87A 3BSHA 1LLOA 1Z41A 1KWKA 3A23A 4PTVA 3SECA 4IM4A 2WMKA 1EYWA 1AJ0A 4EPKA 4I9TA 3HIJA 3W7JA 2PWHA 2XHYA 3KL3A 1SM9A 3PTMA 4WSHA 3IJDA 4L6DA 3WF1A 1J18A 1DXFA 5G2WA 2ISFA 4NRSA 5FSEC 4M80A 3H53A 4Y9NA 3VE7A 1UD2A 2J9YA 2WANA 2PDHA 2XGIA 5ECUA 4L1WA 4HPJA 2NQJA 1V5XA 3LDVA 1V4YA 2HXTA 4ML9A 3W7CA 5HJXA 1AH0A 2V2HA 2VENA 5I77A 4OWGA 1ZJBA 3NZQA 4QROA 3MUAA 5CPNA 3E0FA 2PP0A 3EMQA 3M0VA 1Q2SA 1EC9A 1O68A 3A22A 3EKLA 3FKRA 1JFXA 3W1AA 3NQ2A 4U33A 3QKZA 5GNZA 1FXPA 3ZMRA 4RNIA 3B9EA 3PWAA 4Q3MA 5DT5A 2QJJA 1QI0A 4CQ8A 3PZTA 4W7VA 4HOWA 1SPQA 1WUFA 4FXFA 4AY1A 4HPNA 1AJZA 2IQDA 1O1ZA 1UA3A 1JDEA 2CIPA 2NWRA 5AC6A 1M7OA 2DZXA 2HE8A 3O6DA 1W1ZA 1VYPX 3OIXA 3EXTA 3WFZA 3UNDA 4J3TA 1UH2A 4KRUA 4MJ2A 4NAFA 2GFTA 3OQEA 3V3WA 5BNKA 3NSMA 4LNYA 3BLDA 5D33A 1XIEA 1NVMA 1MQPA 3QC0A 5CC6A 4E8GA 1EJRC 4IJRA 4TX9A 5H1WA 1IF2A 4D6GA 5DMYA 3AIWA 3O0KA 4DJFC 1ZGDA 3VYLA 4BQ4A 1UD6A 1ONWA 1V6UA 3ZVIA 3EB2A 1KBJA 2P53A 3CT7A 1IEVA 3FSUA 2DW6A 3H54A 1EFZA 3F5JA 3FX4A 3H2MA 1CPUA 1PZ0A 1YTKA 3S1XA 2F6KA 4HMEA 4E38A 2YXOA 4DYKA 3WD1A 3TOPA 3R2GA 5CXPA 1C7SA 1IXPA 1K77A 4QEEA 3UR5A 1EJUC 1XCXA 2QZRA 2WMGA 4E4PA 3WKZA 4YTUA 4DAFA 3UCQA 3PR2A 2TODA 3RX4A 5FSDC 1PTDA 3WO8A 1PTGA 2VWTA 4IFOA 8XIMA 4M24A 1K9EA 1V02E 2PDBA 4H9ZA 2PF0A 4E4UA 1OYBA 4GO9A 4NNAA 1OFBA 5DRIA 4ZSTA 3O3RA 4NAFB 3T09A 2B7QA 2QUVA 5DMLA 1C93A 4XQ6A 3KRZA 3FYOA 1SQ7A 3BOFA 1PVNA 4F0KA 3WD0A 3QPZA 4IP5A 1FHLA 4LRTA 2W91A 3I4EA 2IMRA 3VGBA 1IXNA 4HN4A 1ZTVA 3QPYA 3AC0A 1JCNA 4BR1A 2Y0FA 3APTA 5CG7A 4AX7A 1GCYA 2QJMA 4E8CA 3NQEA 2HK0A 2Y88A 3FYPA 6TAAA 1EWEA 2GGJA 3NUKA 4FR1A 4LC6A 1K7EA 5MF5A 1R9XA 1D7KA 1L0PA 4OZOA 1X7FA 3TW9A 4CNSA 3AROA 4J5NA 3LNMA 3FXYA 3TH6A 3OHMB 3SIMA 2A6NA 1B3WA 3AZTA 3I7QA 1GZJA 3G1XA 1OC5A 2R1LA 1B4EA 4Y9OA 4UCFA 4D72A 4JHZA 4GUHA 4KKXA 5LA1A 3CT2A 2NSXA 3W84A 3WLMA 1RR2A 3FAWA 4JD4A 3LD5A 3HQNA 4ZE5A 1W54A 3H70A 1AMKA 4MYXA 4RDVA 4N6EA 1KM6A 3S42A 2HXUA 4QDMA 3GVVA 4NUWA 1OK4A 1H50A 4P61A 4PCFA 1E9IA 1KLZA 5FJPA 3HFYA 1NP0A 4LPCA 3SRHA 1Q2RA 3E96A 1X98A 4DNHA 3TA9A 1GGOA 3N3TA 1Q85A 4E8DA 2G8ZA 4XZ9A 1S3HA 3FA5A 1CIUA 1LOQA 2OT0A 3LOTA 4IGHA 2O4QA 3S5SA 2QCEA 3QHMA 4U28A 1PKLA 4QG6A 2QMKA 2OZTA 1RQEA 2EG8A 2ZRXA 2E6DA 1A5MC 1OG0A 2E8ZA 4RJEA 3IUHA 2ZZ7A 3DGBA 1ZAHA 4LRSA 5EU9A 3ORWA 1TPFA 4FZIA 1R3VA 1EEPA 2FZ9A 1E70M 3ITVA 1CI1A 4X9YA 1UMYA 4M3PA 2OJPA 3VNDA 2YBVA 1R30A 5DO8A 3VDAA 3QN3A 3BOXA 4ZODA 3APYA 4NIRA 3WLPA 5E9XA 2QVNA 4W8BA 4I7UA 2LLEA 1XL9A 1MW1A 4R5EA 1S2WA 2YL9A 4W93A 1QPOA 1UBPC 1V93A 3NPXA 1W5OA 2W27A 3TYDA 5BRPA 4IQDA 1PAMA 4HVXA 2ZUWA 4UTWC 5MHBA 4OV9A 4JEQA 3ID7A 2ACUA 2YBTA 1TPB1 3ZQ9A 2DSVA 2WCAA 2QDDA 3R0DA 1DWGM 1CXLA 2O56A 3R10A 4ZR8A 3IJIA 2OGYA 2QQ6A 4GVGA 4LBRA 4GQQA 1J0ZA 4ZBCA 1FKXA 4GYFA 4EANA 2OU4A 4V1XA 4C1NA 1UKQA 4DF1A 4TUFA 5M1TA 5D30A 4JTFA 5BXTA 1WNOA 4DJED 4AXNA 4N9CA 3VIMA 3VIJA 1NWUA 2OODA 3HOJA 1E71M 4WUIA 2Z2BA 2AGKA 1XGZA 2YCEA 3AUJA 1VENA 2X1RA 1PSCA 2YFNA 4MJMA 3MDWA 3BH4A 4FMVA 4B5WA 2WNWA 1AH3A 3IK2A 2D3LA 4RE4A 3QBUA 3M44A 5CPMA 3CL6A 3E5PA 3RYSA 1V0KA 4XVEA 3CGTA 1OFOA 1E1EA 1W31A 1CXEA 4JBRA 4UMCA 2ACQA 2VZTA 2V2DA 4AU0A 1ZAJA 3S1WA 4GUIA 3FDKA 2FVLA 2J8TA 3TN3A 4GMEA 3QSRA 5KINA 5BRQA 2Y85A 4AAJA 2FMOA 3TK7A 3VGFA 1ECEA 4B5NA 4DB7A 4NX5A 4NKCA 4BK9A 1MUWA 4GQ0A 4OHQA 4B15A 1B3VA 3M0JA 4C1NB 1QK0A 4PH6A 3KOXA 3DYOA 4OKDA 3T0TA 4AB4A 2V68A 3QGVA 3G8RA 1TKKA 2PWFA 4TTGA 3B3DA 1NF0A 4BQ5A 1P6BA 2QNEA 2GJLA 4WDUA 3UZ5A 1C7TA 3PPFA 1GVQA 3ATZA 1POJA 4HK6A 4GX9A 1K8ZA 1X1ZA 5DY3A 3NDZA 2UY5A 4H9YA 3TFXA 1C8XA 1WDWA 5E0CA 4E2VA 4CEXC 3HG2A 3CHVA 4AZHA 2EKGA 3N6QA 4XTIA 3RCYA 3WQ6A 4I5UA 1THFD 1WBHA 4ICMA 3CYVA 1FFRA 5DX7A 2PRLA 1SFLA 3PZVA 3PTDA 4NNBA 4AVFA 3AYSA 2WBKA 3M0XA 1IXQA 5DF0A 2IKHA 3KRSA 1W56A 4IQJA 4PEKA 4QBXA 1KA9F 4RZ5A 1HT6A 4MUZA 1W0MA 4E3VA 2VDIA 1EO5A 2V5KA 1ZBKA 1XPYA 5CBBA 3C2OA 4JS3A 1XIHA 4BEQA 4TIMA 3WH8A 2PDCA 3P5YA 3QV8A 1LQAA 2YCIX 1AQHA 1T6MA 1HP5A 3O6AA 4F0HA 2I16A 3S47A 1LM1A 1UZHA 4C6PA 1DIDA 2E4TA 2GSHA 4N42A 3EOEA 3JVAA 4UNKA 3SJ3A 2HDJA 3NQAA 4JKLA 4CGTA 1CEOA 3NDYA 2BLEA 1TJRA 3VOFA 5LNSA 2PC4A 1W2PA 1U22A 3T4WA 3C8FA 4DXVA 3WLOA 2VCCA 4DWDA 2BGNE 3UG5A 3T44A 1U5JA 3L68A 2G3JA 1EB3A 1OYCA 3TROA 3TW7A 3F4DA 4J1OA 1F74A 5CZJA 1GORA 2XIOA 4TVCA 1S2AA 3L0KA 4B5SA 4LB3A 1ISYA 3HO8A 4D9PA 3WLHA 3W86A 1HW6A 4H2HA 5LIYX 4LF1A 3PUEA 4H3DA 2PDIA 4HKPA 3QY8A 2ASHA 3A3HA 3D3AA 5JIWA 3H12A 1QNQA 2CLIA 2QKFA 2XVLA 3UJ2A 2YZRA 1HGYA 3EDEA 1K6AA 1XLHA 2BY2A 2G3IA 1ODZA 2GGIA 4PTNA 2HK1A 2VGFA 1GYNA 4L7ZA 1M7XA 3DDMA 3IV3A 2ZX5A 1LTDA 2E77A 2DVXA 2Q02A 1DE5A 4NJKA 2QAFA 1ZAIA 1ME8A 2VYOA 1JFHA 1PE1A 1I75A 4O0KA 3ANYA 1UKPA 4GXPA 3M0ZA 3HPAA 3GX9A 2D23A 2OXNA 2P5NA 2GJPA 4RX0A 1GTHA 2G95A 3WBWA 2YL5A 2RDWA 2QGHA 9XIAA 2WO5A 2E9LA 2ADAA 5E70A 4PMXA 1K02A 1N8FA 3NQ6A 4GWEA 3SM0A 1ITXA 4EPDC 1XG4A 3QOMA 3PAJA 2PSNA 4L5ZA 2F6UA 3IIZA 2NX9A 1HIZA 2Z1SA 1JDAA 1XIBA 3G18A 3TE9A 1DJIA 4KFPA 3MS8A 2QJNA 3MP3A 3SCPA 3L5MA 1MDRA 2C3ZA 3T40A 1W9VA 1B5TA 4GG9A 1VP5A 4ZCWA 1TFVA 4ZL1A 1V3JA 1A4LA 2OPJA 3WLJA 3VDBA 1H62A 4PSRA 4L64A 1V7AA 2GVEA 1KXQA 5JBEA 2ZICA 4AXKA 1BYDA 2WM1A 4X3ZA 1QW7A 4FLQA 4D6DA 1JPDX 3N6HA 1JZ5A 2J13A 1F61A 1VHNA 2OO0A 5DBUA 4J3UA 3BCDA 3PZGA 3B0YA 3GNXA 4O1DA 3GH5A 4YHGA 1HVQA 3GTXA 3ZSSA 1ZALA 4WSJA 3GU2A 4IGMA 3E02A 3L65A 3CUZA 3AXIA 4LUIA 4RPQA 3BICA 4OGZA 1VAHA 3EEGA 2R8WA 1K7XA 4GZIA 2CERA 4DJFD 4Q7NA 1EWDA 3VK5A 1N8WA 3N3MA 1PYFA 3FOKA 2YYUA 3UWUA 3MSGA 3UCDA 4BCEA 1YKWA 5JU6A 2E5BA 2Q3RA 1KFJA 3WDHA 2GDQA 4TV6A 2JKAA 5KMYA 4DWSA 2XG9A 2Y7FA 3G1FA 4MVAA 3N1AA 1PIFA 3WMSA 1GVIA 1KRAC 4AZGA 2TYSA 4MZYA 4QJ4B 1VD6A 3MUY1 4NHVA 2BV9A 4W88A 2FB3A 4MY9A 4HYVA 4H2CA 2NW0A 1OGGA 3R8GA 1VJIA 3MCMA 1W91A 2P3ZA 4QCEA 1RQHA 3ZLGA 2WXDM 2DVTA 1KTNA 4M6PA 2G5WA 4TMCA 1KFCA 3IK4A 1GQKA 4FHAA 2WMHA 3B8SA 2ISWA 2XN1A 3BLIA 3BC9A 3MC5A 1QWGA 3SFWA 4HCDA 4PCPA 4EXBA 4RV8A 4UWMA 1HL9A 4G5DA 1KM2A 3U0HA 3UY7A 2QUMA 2I5IA 4O50A 1EO7A 1ONXA 1UPPA 2I57A 3IIOA 3GNDA 1G4EA 1UROA 3NZGA 3STEA 5AC8A 3ZIZA 4C90A 3A5VA 2XVPA 4DWSB 3MPGA 3QY7A 2C14A 3CHDA 3UYCA 3NQMA 3PULA 4KIEA 3N29A 4Y2WA 3M47A 5DCDA 2JIWA 4A35A 4WF7A 3QLLA 1TELA 5CAKA 4A05A 4YTSA 4GY0A 3N9SA 3UY8A 4Q32A 4R7JA 3BW3A 3N15A 2P1FA 5F2LA 4YTQA 3GBDA 1BPLB 2A3EA 3R1ZA 3RJYA 4PL2A 1K3UA 2HBXA 1J5SA 4JFUA 2HRWA 2PS2A 3L4WA 4RLIA 3EZ4A 2XSXA 4X0NA 3OA5A 3PB2A 3CTLA 4Z08A 4AHPA 2QCLA 2DP3A 4JN8A 3EMCA 3VNJA 3VKBA 3IACA 3PJTA 4S1FA 3P62A 3VIPA 2VZSA 3ZVHA 4ZB0A 3T8QA 5F1VA 1P6CA 4AIOA 3GW0A 3IIVA 1CB7B 1GTEA 2G3FA 3G8EA 4C91A 2BWGA 4MNKA 4QIUA 1A5OC 4HT3A 2ALRA 3N12A 2A4AA 1U1UA 3PFRA 3AIVA 3OVGA 3BANA 4P7RA 4LB4A 2BNJA 4OFCA 4XBKA 2BSLA 1Q63A 3VDHA 4UFLA 3T08A 3MHFA 4HNLA 3UGVA 1VFOA 3B04A 1J11A 1CB2A 1BGGA 4Q8NA 3KX6A 4FPSA 1V77A 1W3IA 4J28A 1IWAA 3XINA 4JL2A 3PSWA 1F05A 3CUJA 1IWBA 2P0OA 4M82A 4LYRA 4PMOA 3OG2A 1SSGA 1T41A 3E2RA 3GM8A 3L9CA 4LS1A 1P0KA 3W6YA 4ONVA 3O6YX 2NQHA 4HIBA 5CZ0A 5A3HA 1WZMA 4HOXA 4LW7A 4YIWA 3WH7A 1Q8AA 1UWAA 1A3WA 1P7TA 2QCGA 4EP8C 2VKZG 4AHQA 2ZKMX 3P3BA 4GYJA 1ITCA 1XXXA 3ZVHB 4JHMA 2ABAA 1PZ1A 2QT3A 4GI6A 3WNKA 5M5DA 1E6XM 3LCIA 1AJ2A 3I4KA 2RH9A 4FEZA 1TTQA 2OEJA 1V8EA 4Y8EA 4C65A 3GFYA 5A2CA 2EEXA 4M6UA 3KFTA 5E5CA 5HWMA 3V36A 4DEFA 4GQGA 1H1YA 3GRIA 4G7EA 1X38A 1U2YA 3BVJA 1XWYA 3N17A 1KCKA 1W8GA 2VX6A 3AHTA 4KESA 2OQYA 1LL6A 4HCHA 4XZBA 4I7WA 4O12A 1P0DA 1QPQA 2HJPA 5DCBA 1C29A 1VBHA 3RRAA 4N2YA 4RNHA 2WLYA 4PEEA 2Y89A 4ATLA 2BY1A 3KXQA 3AALA 4A8IA 4XG1A 4NP7A 4AX6A 5J5RA 3CZLA 3QOKA 4DWSC 3SY1A 1P7TB 5MKGA 7REQA 3W1LA 3V75A 3UA4A 3HV9A 2HCVA 3JS3A 2A7RA 2PODA 3OVQA 2EF9A 2ZXBA 1JF5A 4K6AA 5C70A 4ZA0A 1R5YA 3VABA 4MUPA 3W6LA 3TQKA 3W7RA 3S2MA 2AL1A 4FXRA 2Y5SA 3LCHA 4DUWA 1OGBA 4S2BA 5BCAA 1CGWA 3WF4A 1PDYA 1GW9A 4OECA 3EA1A 1CGTA 4S3BA 1N82A 5D32A 5M3WA 3UXAA 1OGSA 3V0TA 2QV4A 4G7EB 4E5TA 3C86A 1YYAA 2FVKA 1XICA 2EJAA 3WCZA 3BLOA 3P14A 3LM3A 3GVQA 2F9RA 1HZYA 1A53A 3DBPA 3E6EA 2VEIA 2WMIA 4AD0A 2WCGA 1TJ0A 5FJIA 4HK7A 1EBGA 2WMFA 1AW1A 5AHMA 2YOCA 1KGXA 5AVNA 1T7LA 3ERPA 1HKVA 1GQIA 2AQVA 4Z0SA 4DBSA 1W1B1 3S9ZA 3EPOA 2X1IA 1KD0A 2DH3A 1LOLA 7REQB 3NTYA 3M46A 4H9VA 4TR9A 3WF2A 4L6OA 1NFPA 4LYPA 1TV3A 3LSBA 1TQXA 1ZJAA 1ZENA 3ALGA 1E5NA 3M07A 1RP8A 3TKFA 4FF7A 1QNSA 3L0GA 2Z25A 4W5UA 4ERIA 3K5XA 4B3KA 4IPPA 4PFMA 3C3UA 2FGBA 3E12A 4Z0JA 4W9TA 3C8NA 4PRTA 1A5KC 1Q3NA 3IAPA 3AXHA 3PBMA 4FIRA 3QFEA 3RILA 2ZUVA 5FESA 4FNSA 4JTUA 3URNA 1H11A 1NDZA 2WMIB 4NXKA 2D0FA 4WR3A 3JZEA 4HCLA 4MY8A 3ES8A 1DHKA 2BZNA 1XIFA 2CZDA 1GJUA 3E0WA 4G8TA 5AB3A 3H2FA 2VMFA 3W7HA 1N7KA 4XZMX 1JZ6A 4FOUA 1ZBVA 4TX8A 2Q01A 1WKEA 4MIMA 4Q8TA 4KRTA 4ALDA 4PYSA 3QRHA 3LTSA 4F2TA 4NT0A 4P8UA 3WG6A 5T9BG 3H23A 1MYRA 1YQ2A 1U5HA 3DAQA 3W7QA 1CX9A 4D6JA 4GE8A 3O7UA 1BHGA 1K7FA 4P7QA 4FAMA 4KWUA 3QH2A 1IEXA 1M3UA 2BY3A 1T96A 5FAGA 2JKPA 3SCVA 5A1AA 3LM7A 1HL8A 5A8OA 2YDRA 2FGLA 3S3GA 4P7NA 2HV5A 5F1UA 3R8HA 4MB4A 4Q33A 1FWHC 2BDQA 1S5WA 1OCQA 1RY0A 1E0XA 4H41A 3NZ1A 2ZRUA 2RDTA 2OEKA 2DGAA 2ZRYA 5K2ZA 2VFEA 1GZGA 5XINA 5HJLA 3SCQA 2PGRA 1A5UA 4Q4SA 6A3HA 3B9OA 5K3VA 4DBEA 3SIZA 3AU6A 5F4WA 1F3WA 3LI0A 1UG6A 1OQFA 1R87A 3IJLA 4LUJA 1JUBA 2ZXDA 1XISA 1Z7AA 1LL7A 4WDTA 1PYMA 4LGXA 2DY3A 3OZMA 1KGUA 2P8CA 4E6MA 5CSRA 2GGHA 5KSWA 3Q4DA 4GNKB 4R27A 2J6VA 2YA1A 1BVZA 1GKRA 1RJRA 3CPRA 3U7VA 3U2ZA 3MHGA 1LZOA 4CD6A 1I0BA 2V67A 2PDLA 1WXZA 2HROA 1XSIA 3P61A 4I5RA 2ZUMA 5CLWA 5JBFA 1HJXA 4KQNA 4REQA 1TRIA 4IMAA 3LU2A 5JH2A 4S3KA 4HNOA 4PMZA 4IIFA 3DYPA 3PUGA 1OADA 3QMTA 4GH1A 4CN1A 3TC6A 1W5QA 3HG3A 4XZHA 3MB9A 2E9MA 3W75A 3R0UA 1LF1A 3UZZA 4AWEA 3DFNA 4YMZA 2ZTKA 4O4VA 3QZEA 1RUSA 1W1YA 1X7IA 2R1KA 3UZXA 2INFA 1NEYA 1FTXA 1BXCA 1OWQA 2WJZA 3CQJA 2E8YA 5LA2A 3RX2A 1OHLA 3NG3A 2X40A 2OQLA 1BQGA 3BGJA 5FF4A 2YB4A 2VGGA 5BU6A 2BGQA 1F6PA 1F3TA 3I6TA 2VELA 3IGXA 2X42A 2G3MA 5DCEA 3GNRA 4AMCA 4XD3A 1IGWA 1WA3A 1HJSA 1BWLA 3WK2A 3N18A 5C9RA 1MDLA 4REQB 2O55A 3T0CA 1OCJA 5D2YA 5A8QA 1HKMA 2R24A 4OBSA 2FPVA 3N14A 4Z1AA 1O5KA 5I2UA 3PTQA 4JQAA 4UZSA 4MYAA 4Y9MA 3NL3A 3Q58A 3ANVA 5GNXA 5CAHA 3FJ4A 3S5OA 2WMJA 2D2HA 3VUPA 4YCOA 1MXDA 4WX2A 5AHEA 3M43A 5T9CE 2ZFAA 4QQUA 5DEZA 3FFSA 4D6EA 4AD3A 4EAYA 4JQ4A 3URAA 5TF0A 4DBUA 3MI6A 2HSAA 1S5TA 1ZS2A 1Z42A 3KAOA 2E7FA 3GUWA 1DJXA 3OLGA 1RA0A 3AQUA 1RAKA 4AMAA 3L66A 3R0KA 3STPA 1W9BM 1PX3A 3IGUA 3KDOA 3VDCA 2Y7DA 1AD1A 1E1CA 3UU0A 3GB6A 1KCZA 4WHBA 1I2PA 3EX4A 4IISA 1D3HA 1FDJA 2R82A 2JFEX 3DECA 5C54A 3S1UA 3GKAA 4L6HA 3CB3A 3NNTA 1HO1A 1GNXA 3G77A 2FH6A 5EMMA 3MZNA 3ITTA 1US3A 3LLFA 3S8HA 4ZB5A 1F6YA 3EX3A 1HKJA 5A6KA 4CQCA 2J74A 3POHA 1H41A 5CZTA 1WKDA 3I65A 4ZQPA 4H83A 5DXYA 1EA0A 1RPXA 1JPMA 3ABQA 1VFTA 3Q2DA 4NAEA 3FN9A 3EOUA 4OIFA 4RR4A 1DYSA 2B0MA 3DFHA 5D05A 2WZHA 4GZ7A 1YMYA 1J01A 4KGLA 3TAOA 3W1QA 5HQMA 1J8VA 3UGRA 2PI6A 2O0TA 3RK8A 5B7ZA 1KKRA 2TPSA 3VM7A 4GYKA 3G24A 2FHFA 1DV7A 5A2AA 1QOPA 3VINA 3C0LA 1LBMA 1AL8A 1F4HA 2G50A 4XAPA 2AQWA 5CPOA 2VR4A 3MUXA 3VIIA 3BAKA 3O07A 4Q4MA 3ZJ7A 4IPNB 4PMNA 1TREA 2HISA 4HPGA 3U2OA 2DUZA 3CMGA 2I56A 3CHCA 1E1CB 4BF9A 1H7WA 1R0MA 1QOXA 3ICJA 1UUMA 1KFLA 1N8IA 4DM1A 5BOFA 4JIQA 1WOBA 4WJ8A 3DKLA 4ZO8A 5I5RA 2XFYA 1XC6A 3GR7A 3NEHA 4E2BA 2ZXQA 3AS1A 3AIBA 4AZIA 1BYCA 1CECA 3U48A 2YLAA 3C3NA 4GI9A 2C71A 3JRKA 3WLKX 3GBEA 1ADOA 4NAEB 4C6EA 1WDQA 3LLDA 4UOZA 5IRPA 4KGJA 1A5BA 2QS8A 1UIPA 4J2MA 3W53A 1WAUA 4BS0A 2TMDA 1CGXA 4PCNA 1RH9A 3UZYA 1K8XA 1V3MA 4S3DA 3MV11 4PMVA 1BQCA 1XCFA 2G3NA 1C90A 1L6WA 3AS0A 4Z2GA 4XAYA 3GVWA 3T05A 4H9MA 4B91A 3E0IA 4G7FA 1OB0A 2QV5A 1SZEA 1LWJA 4TMBA 3D6NA 1RQBA 3II1A 1JZ4A 3V5OA 3EDKA 1N2VA 4L65A 3F2BA 3AISA 3W72A 4IIHA 2ZZ2A 4MPQA 3L12A 4BI5A 4O1EA 4M5PA 3UP8A 3PBUA 3COTA 3WQPA 5HUPA 3SW6A 1O5XA 3BO9A 2V6AA 1FBAA 3B03A 2XZ9A 1TX2A 1R3QA 2ESCA 4EOUA 1Y8BA 3LS9A 5LGXA 2OT1A 2PZNA 4GKLA 4DZHA 2O4MA 4ZMGA 4M7SA 3DENA 3TLLA 3OYZA 2DDXA 5I3IA 2NUWA 3T1GA 1L2QA 3DBNA 1Q7MA 2IKJA 3H4GA 5G1YA 5EFDA 5T8GA 3DG3A 3T2OA 3WDQA 2PTWA 1XH0A 3NAVA 4KEZA 4C6NA 2XIMA 2W3ZA 1W5MA 2BVTA 1Z32X 4D6FA 1MWOA 4L4MA 1QI5A 4QLKA 4C6IA 2OO6A 4X2PA 3MO4A 1XD1A 2GZXA 3WMLA 4DWSD 2ZADA 1PB0A 5ENLA 2NVAA 5TD4A 5HQEA 1E9ZB 1BG4A 1DKWA 4YXGA 3LBCA 1LT8A 2J9ZA 1IEQA 3PZ9A 3KM8A 3VNYA 1XLDA 1G5AA 3DHPA 3G1VA 3DEQA 1QI4A 3IPWA 4GGHA 2FH8A 4Q8MA 4Q8PA 1BRLA 2XFWA 1R9ZA 3NIYA 2VFFA 4F0RA 4KWVA 4DI8A 5K7JA 2PGEA 4GRSA 3RXZA 1DXEA 2J24A 4A29A 4U2ZA 3WQOA 4Q6XA 4UFKA 3EA2A 1EC8A 4GI4A 4JEJA 1ONRA 3LB0A 3AMKA 1EP1A 5C6MA 3HFTA 1QNOA 4ADUA 5A6SA 1KM0A 4M6VA 2NV1A 5I07A 3GC2A 5FEXA 2QCCA 1VH7A 5CKSA 5C8BB 2FZNA 3B0UX 4ZTYA 2HBVA 3EWUA 4AC1X 4RE0A 2WHJA 5EA9A 1XQLA 4O13A 5F7UA 4AQLA 1DOSA 3SUWA 2HNEA 2KZHA 1KO0A 4DN1A 3LENA 5EMLA 5I02A 2VRKA 3S46A 1QI3A 2OVLA 1NFGA 2YDQA 3BLLA 3BMWA 3PM6A 4ZFCA 2XIIA 1ENUA 4F9JA 3WMCA 3WELA 3GWQA 4MADA 4PTMA 3KHJA 5C55A 1KFWA 3DHUA 1XQKA 4HZ8A 2CLLA 1BG9A 3NPVA 3CC1A 1BRLB 3CL7A 3ZT5A 2Z29A 4JNYA 5L9FA 1W2VA 3RLGA 5ABTA 4KFNA 3W74A 3LHYA 2CCRA 3EBVA 1VJSA 1TVLA 3Q94A 3CUHA 1B9BA 3NCOA 5LHEA 1HN1A 4NZFA 4HB7A 4JICA 4DO6A 4XVDA 3BUVA 4F4RA 3NQDA 3L5AA 4N6FA 3V7PA 4H19A 1S46A 2YBUA 3QTPA 2ACRA 3VFLA 4D1JA 1FOBA 1CZ1A 2CNCA 2TRSA 1MI3A 2IKGA 3W6MA 4Z1DA 4P8WA 1KFBA 3BQ6A 1IT0A 1P5BA 2FYMA 3W22A 3NPWA 3NM3A 5E0KA 3W26A 1SW0A 5LZLA 4GABA 4IG2A 2QPSA 5ABFA 3AZSA 5ABGA 3PY2A 3QYQA 4HZ6A 3PSVA 1XFCA 1K8CA 4ZVJA 4GXMA 5EL1A 1B3ZA 3TTYA 2CHRA 3BAXA 4W86A 1TUFA 3K2GA 2X1TA 5BMWA 5KZ6A 3UWVA 2GJXB 1BTCA 5LIUX 1G7VA 1A3XA 4I90A 5IBXC 1PIIA 3TXVA 1GOQA 1IHIA 2QXWA 5CPSA 1W1PA 3GZ3A 3VILA 1UHVA 3MI2A 3PJUA 1TPC1 3LMZA 3INPA 3I6EA 1FQ0A 1VFLA 2VFDA 3L4UA 4MZ8A 3VCCA 3L0NA 4QEHA 2GSEA 3FKKA 1E6NA 5C9UA 1EIBA 1X1OA 4YNGA 1DORA 2WJDA 3USBA 2C7FA 3UVAA 3LHWA 4EXAA 4O0QA 4CN4A 5CGTA 3R12A 3VKJA 2RGLA 2CKSA 5LXXA 5HATA 2V9DA 3CEUA 4PUMA 3KZPA 4UTKA 1HQTA 3HGJA 2FB2A 3WLSA 4TV5A 1M03A 4BFAA 3A13A 1D3GA 2V8ZA 3RG6A 4AY7A 3W7OA 3A6OA 4TX6A 3S6TA 2XGZA 4U31A 4IG2B 6TIMA 2CFFA 5ABFB 4S39A 2OR2A 4I9AA 5H8MA 1A5AA 3UG4A 3A4AA 4OV4A 1VQTA 5JQ9A 3WNLA 1K70A 1WPCA 2WNQA 2MNRA 4JN6A 4FX7A 1Q65A 3AZRA 5GJPA 2R94A 3PZOA 1W3HA 1UH4A 3W37A 4RZ6A 2XH2A 2OYKA 1YIXA 3MI3A 2A21A 4IJCA 5I6SA 1YE4A 3NGJA 1SZGA 5I3JA 1HKKA 4FLOA 2INZA 4IJBA 1DL3A 3RO6A 3M1ZA 3M0HA 3SN1A 3KVJA 1KQZA 1QPRA 4LVFA 3S2NA 4IP4A 4LY4A 2DZSA 1FDYA 2DSWA 1R7OA 1D3CA 3BV7A 1QJWA 3KHDA 4OOZA 5I03A 2JGQA 4MTVA 3K46A 2FTPA 4P7LA 1PL9A 1IIHA 4F0SA 4AWUA 3G1YA 2GJRA 3O15A 4PRWA 2AAAA 1SW7A 1WUEA 5FEWA 4O10A 1CCWB 1XRSA 4ORIA 1JGIA 5I06A 1HF6A 1J0IA 2HTMA 2W92A 3W88A 5HNNA 5G4HC 1Q7QA 5D9MA 3KS5A 3SEPA 3UG8A 2FJUB 2O9PA 2WSQA 3LZ5A 4O4WA 2ZVIA 3KS6A 4B2DA 4JR5A 3BAYA 4OTKA 4KERA 4PBFA 3URQA 1VRDA 2IQTA 1VPYA 2QEZA 4Q6JA 1H51A 1NIUA 4V15A 1ICSA 3AJXA 1L2UA 2A3CA 1O12A 1GOIA 4IX0A 1QASA 2QCHA 3EGJA 2ZX8A 3K1DA 2CKRA 3GVRA 1YADA 4AF0A 1RALA 2EQDA 3SUTA 2I5QA 4CVUA 2EXOA 5LNWA 4N9EA 5C2CA 3OVRA 2PTDA 5CSYA 3G6MA 2H90A 4IL0A 4DF2A 2OELA 4V2XA 3BW2A 3DFTA 2ZBTA 4V33A 3R94A 3NURA 2MUCA 4AD1A 3LPPA 1DWAM 3EPNA 2CLKA 4MJ4A 3IEBA 2W4XA 4XAFA 3SQMA 3SN0A 1KXTA 1KM1A 2NQ5A 3ENLA 1RHCA 3I68A 2WHMA 1KB3A 3OZPA 2Y1HA 1F3EA 4LXFA 2NZLA 4B9ZA 3UQNA 5FKYA 4HSHA 2PAJA 4YCPA 3TYEA 1V02A 1UD5A 2EG6A 2V5BA 2VVNA 1F76A 3MKVA 2B81A 4AW7A 2YXGA 2NXIA 4HNUA 4TVUA 1JYVA 4L9YA 3SGGA 1D8WA 4NJGA 1BVNP 4WQ6A 3CAWA 1XF0A 1A5CA 1BEUA 2QGYA 1XSKA 2CESA 4AF0B 1PV8A 3JUGA 2DQXA 2YJQA 4QJ3B 5CSUA 2ZRWA 3MW7A 1E40A 2BB0A 3M0MA 3TWBA 4OUIA 4HA4A 2ZQ0A 1SMDA 1E9LA 2OLAA 2D20A 5F4XA 3MP4A 1EJXC 3GIQA 4QCFA 3S4TA 2Q8XA 4F8XA 3URBA 3UWYA 2J8FA 3VM5A 1RV8A 3MYPA 3ATYA 4R88A 5E9AA 3CIWA 4C6DA 4R53A 3BE7A 3UERA 1EJSC 4HOZA 3BJFA 4TU1A 4CCEA 4X9SA 4FNTA 1TPUA 4H8NA 4UTHA 2DFAA 3C0SA 2OYLA 4UQCA 3GU1A 5FL1A 2XDFA 1J9YA 5LHFA 3TSMA 2PDYA 2PDWA 2NLIA 3MKCA 1VB9A 5C0QA 3ANUA 4AFYA 1OF8A 1IT7A 1B90A 1XIGA 1GONA 1EJVC 1TWZA 1YTDA 4W8AA 2G41A 3M9YA 2VR2A 3HG4A 2JE8A 2PPGA 2DZWA 4PMDA 2VQUA 1R38A 1KRMA 3QYSA 2A7NA 3H2NA 4H7CA 3UNTA 4LVAA 3L4TA 5A6MA 4B16A 3KVKA 1H7RA 4U4MA 3ARYA 5A95A 3UXLA 3G3MA 3BMVA 1TMHA 3WD2A 4DM2A 1KBLA 3CO8A 2FFIA 3YPIA 2Y63A 5HUOA 4L4PA 1LRQA 4XKYA 3NJ3A 6PTDA 3NOYA 2X1UA 3HPXA 1ZSXA 1P0NA 3KOWA 2J77A 1ML1A 3PPHA 4GVIA 1BSLA 4I3GA 1M01A 3NO3A 4LV4A 2WJEA 3PC0A 4DUXA 1PHWA 1RBLA 2VD9A 4EF9A 2NUYA 2RHGA 3B0XA 4F79A 1AVAA 1A0DA 1RLDA 3I3EA 4F2BA 4C6CA 4DJEC 5FF3A 3K30A 2J88A 2VURA 2VJXA 3GNNA 4Y90A 2DORA 1VFSA 3WQDA 1AW5A 1G0CA 1OD8A 3C2FA 5LNVA 3NL5A 2SFPA 4TTUA 4ATDA 3CAQA 3FYYA 2J7EA 4MKSA 3F2DA 2PRHA 1C9WA 3AICA 3F4NA 1F8MA 3AWNA 1XW8A 5D09A 4J40A 2WVUA 3ZJ6A 3GXTA 3QHNA 1XPGA 5A6BA 5CPTA 3T2QA 3MMWA 4GQRA 4PB5A 2FDMA 3G1SA 1YPFA 2B31A 1FWNA 1SJBA 2C8NA 2X2GA 4GUGA 2WSYA 2CWXA 5GQBA 2PP1A 3K4DA 1J0KA 1WDSA 5FEZA 4FK9A 3UZJA 2V69A 5G5IA 3TSBA 2OZ0A 3NM1A 3SCOA 1G94A 2CLEA 2V5JA 4EACA 3LBMA 3PUOA 3U2EA 2R14A 1BKSA 2VL4A 1KR0A 5EBUA 1TIWA 3REQA 1LJYA 2QF7A 1LLWA 2PWEA 3EOLA 3W0KA 4Z42C 2EPMX 4HSOA 1JPKA 3P0XA 3P5ZA 4S3FA 1Y5XA 4UTIA 5A8NA 1L6GA 1S3TC 3N4EA 3HPSA 4I6VA 1WO2A 1VIWA 1G67A 1R3YA 4P8XA 4HJFA 3WNOA 3CYJA 2YCJA 2C19A 4NXSA 1L6FA 1CXIA 1SSDA 3GTNA 4AYSA 4U3AA 1VFFA 2Y8UA 1KXVA 4O1AA 4FLSA 1VBRA 3WLIA 1JQXA 1JQVA 1FHDA 3LHZA 3E3HA 3EYPA 1GEHA 4LVGA 5HMEA 3GD6A 1TPWA 3WH9A 3AYVA 5AYZA 5XIMA 1EJTC 2F2KA 1TG7A 2JBMA 5HMSA 1TR9A 3A12A 2ZXAA 3GAKA 4G6CA 2G4JA 4PC8A 4KF1A 4WXYA 5HINA 4MAVA 2XH4A 1OFPA 1VYSX 2YSWA 1I2NA 3MT1A 1PBGA 4LEQA 1V0LA 3REQB 1QW8A 3GDKA 4IGNA 2Z24A 3OODA 2P8BA 4H01A 4E3TA 4NJJA 4IIBA 1SR0A 4HNVA 3JW7A 3RLUA 4XX6A 3ITXA 1U33A 1QHOA 3TUUA 1T0OA 4HD5A 2UV8G 1G9HA 2XVKA 3VNZA 1GK8A 4XO6A 3I3DA 2OMAA 5BROA 2D2GA 5F2MA 3PNZA 3D46A 5K9DA 2AMGA 4NI3A 2CLFA 4GFSA 2ZA2A 2WSRA 1J2BA 3QHOA 3LY0A 3R11A 3QQ1A 4O1CA 1EIXA 4H00A 2RDUA 2VRJA 4IIEA 2Y61A 1OC6A 2QJIA 2WNNA 1JI2A 2EJ1A 3N2OA 2OB3A 5K4ZA 1DEDA 3W1NA 3H4XA 5JVLA 1OSEA 3FW6A 1J79A 1PKNA 1EQPA 1OVDA 2A5HA 3OW1A 3I6RA 2NX1A 4DLFA 1J93A 3PZIA 1OFAA 1XBXA 4HMNA 2V82A 4HJWA 1E6RA 3QR0A 4RW5A 4JIHA 3W7NA 4N7QA 5REQA 2W5FA 3H7VA 4EE9A 3GYCA 4GZJA 4XKMA 1Y5VA 4HHHA 2ISDA 1KTCA 3QLDA 4IX2A 3WH5A 3FCPA 1OBAA 3LCXA 1GVFA 3E0LA 3M5ZA 1XBZA 4JN7A 3UT0A 2FTYA 3T0AA 3GYEA 3AHYA 1OD0A 2R1NA 1BXNA 4YYFA 4MFDA 2A3AA 2DT3A 4FF5A 4IUGA 3T07A 2UY4A 4JYFA 2ISSA 1DXIA 2JEQA 4K7YA 2RJHA 4JTIA 3EX2A 4ZEPA 1AH4A 1NH6A 1S2VA 4LV9A 1UWTA 4XV0A 1UPMB 3IRSA 5FIPA 2DIEA 1ODUA 1EYEA 1N55A 3CWNA 3H6OA 3VZXA 4GYPA 3PAOA 2DSZA 3CV7A 3NQCA 2VFGA 3ITYA 5A8MA 2GUYA 4A8NA 3SN4A 5HPOA 2A85A 2FZBA 4AYGA 4RL3A 1PWLA 4XD4A 3CQHA 3WQ8A 3RNDA 5REQB 1WZLA 3S5NA 3IS4A 1V6TA 3HM7A 4O8AA 3Q37A 3WIJA 4AEEA 1EZ2A 2PFHA 2WLZA 3SCWA 2J9XA 3CL8A 1FCUA 4QQ3A 1XRFA 5G1TA 3W2JA 3QQWA 4ERGA 3NWRA 3UW6A 1NP2A 2Q71A 2EO7A 1TV8A 5AOUA 3DC0A 1HGWA 3SRKA 3DCPA 1L6YA 5FA5A 3FHAA 5ECVA 4M29A 1GQJA 3AJ7A 3CQKA 4A3QA 3KRBA 5CGMA 2XPKA 3A47A 1KTBA 5D02A 2XZ7A 4AD5A 5AC4A 5I00A 2ALDA 3ABXA 3NEVA 1S1PA 3GDBA 3ARVA 3E49A 4JXCA 3CH0A 1ZUAX 3R79A 3PBGA 4IIGA 3RHGA 3SO7A 1GJWA 4QRNA 2W79A 1QNRA 3TC7A 1TJ2A 2R6OA 3LN3A 2VC7A 4GJIA 3TYCA 4CN6A 3EDJA 4M81A 2J8GA 2GUBA 4FS9A 1M65A 2GOKA 4NSBA 6CGTA 4IOTA 1E0WA 1MEIA 1BTMA 2QW5A 2CZEA 4DAIA 4IZGA 4O53A 1FWFC 4YVVA 1HTIA 1YTEA 2QDEA 5I3GA 4QM1A 2IUZA 5BXRA 3BK0A 2PDPA 2X7WA 3ARWA 1QMLA 2GOUA <