1IEIA

Crystal structure of human aldose reductase complexed with the inhibitor zenarestat.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALDOSE REDUCTASE
publication title The structure of human recombinant aldose reductase complexed with the potent inhibitor zenarestat.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ieiA00
2INZA 3ERPA 2NVDA 4WDXA 3LQGA 3P2VA 3S3GA 4OTKA 3DOPA 2HVNA 1MRQA 4IJRA 1Z9AA 2HDJA 2IPWA 3H7UA 3WBXA 4DBSA 1AZ1A 4QR6A 4XZIA 4HBKA 4WDUA 1EF3A 1S2AA 3G5EA 4I5XA 4GQGA 5HNTA 3R7MA 1ZQ5A 4PMJA 2CLPA 3CV7A 1T41A 2HE5A 4DZ5A 2J8TA 1EKOA 4L1WA 5LIXX 5AZ1A 1VBJA 3RX4A 2A79A 1HW6A 3H4GA 2FGBA 2C91A 2PDIA 1XJBA 2I17A 4JIRA 2PD5A 3N6QA 4YS1A 4JTRA 4JTCA 3UGRA 1PWLA 1SM9A 2FZ8A 3UZYA 4NKCA 1Z3NA 1UR3M 2FVLA 3QKZA 4JQ2A 4YU1A 3H7RA 3WCZA 3LN3A 2PDCA 3BV7A 2PDNA 3U2CA 2IS7A 3UFYA 4IGSA 1S1PA 4JTQA 4YVPA 1XGDA 3WBWA 2IKJA 2IKHA 3LQLA 2PDGA 3M0IA 2BGQA 4F40A 2FZ9A 2IPGA 3V0UA 3C3UA 2ISFA 5JH1A 3F7JA 2PDFA 4LBSA 1QWKA 1IEIA 3RX2A 3BCJA 4XK2A 2HVOA 3CAQA 1M9HA 4JIHA 4DBUA 4XO7A 3V35A 5LIUX 2INEA 5JH2A 3O3RA 4GQ0A 4XZMX 4ZFCA 1RALA 2BGSA 2HV5A 3LEPA 1ZSXA 4JQ3A 4JQ1A 4WDWA 3CASA 3LENA 4XZNX 4FA3A 5LIYX 1R38A 3DN5A 2F2KA 2PDUA 1YE4A 3LZ5A 3MB9A 4WDTA 1HQTA 3N2TA 5DANA 3Q65A 1Z8AA 3R94A 1PZ0A 4Q7BA 3BURA 3LUTA 3R8GA 3M64A 2F38A 2VDGA 1Q5MA 3UG8A 4RPQA 2I16A 2PDHA 2PDYA 1ZUAX 1PWMA 1YNQA 3GHTA 5HA7A 5M2FX 4GABA 3LZ3A 5AZ0A 2HE8A 4PRRA 2IQDA 4MHBA 4PRTA 2AGTA 2IKGA 4XZLX 3RX3A 2ACRA 2R24A 1MI3A 4LAZA 2ALRA 2WZTA 1T40A 2IPFA 3R6IA 3EB3A 4JTDA 3ONBA 1EXBA 1AH0A 4LBRA 4PUUA 3UP8A 3UYIA 2IPJA 4R9OA 2PEVA 1X97A 1S1RA 5LIWX 4L1XA 2FZBA 3FJNA 4DBWA 4GCAA 2PDLA 2PZNA 3GUGA 3KRBA 4ICCX 3O0KA 4JIIX 2PDPA 3T42A 1PZ1A 1EL3A 5KETA 3V0SA 1AH4A 4WGHA 3UZWA 3UZXA 2FZDA 1Z89A 1YE6A 5HNUA 3LBOA 2PDWA 3CMFA 4PUWA 1ADSA 3EAUA 3BUVA 3FX4A 2R9RA 4LB3A 4XAPA 2PD9A 1RY8A 2QXWA 1AH3A 3M4HA 3NTYA 4QXIA 2ACQA 4XVDA 2NVCA 2PDMA 3B3DA 3Q67A 2PFHA 5LIKX 3R43A 4PR4A 3CV6A 3COTA 4WRHA 3V0TA 1ZGDA 1C9WA 1LWIA 1OG6A 4JQ4A 2WZMA 3WG6A 1LQAA 3LNMA 1PYFA 2DV0A 4FALA 3G1RA 3GHSA 4HMNA 4QX4A 1AZ2A 2PDQA 1K8CA 4G5DA 4FAMA 2HEJA 4YVVA 2BP1A 1IHIA 2DUZA 5C7HA 2IKIA 4ASTA 4XVEA 1VP5A 1AFSA 4YVXA 4EXBA 4IJCA 3GHUA 3EB4A 3UWEA 1GVEA 1QRQA 3WBYA 2PF8A 4EXAA 1XF0A 2PDKA 4H7CA 3CAVA 4LB4A 1YNPA 1JEZA 4Q3MA 2IQ0A 2ACSA 4JQAA 2DUXA 4AUBA 4GIEA 2PDJA 3VXGA 4GA8A 1MZRA 1X96A 3V36A 4H8NA 4JTAA 3R58A 2PDBA 4XO6A 1Q13A 4LAUA 2ACUA 3UZZA 3ONCA 3GHRA 3MC5A 3R8HA 1A80A 2PDXA 4QBXA 4FZIA 4XZHA 1US0A 4WEVX 1J96A 1FRBA 1RY0A 4GACA 3D3FA 3LD5A 1X98A 2P5NA 1S2CA
chains in the Genus database with same CATH superfamily
1ZBCA 4GC3A 2VWSA 3WF3A 1FHDA 4I90A 4J3ZA 1GKPA 2WCAA 1CWYA 3LQGA 1V6XA 3QY8A 1Q6RA 4ZOAA 1UZ4A 1J0HA 2YCLB 2VHLA 3V5CA 1C90A 3HN3A 4RE4A 2QCDA 1CECA 2CLFA 1UR2A 4UFJA 1VRXA 2GVJA 1IYXA 3CTLA 4E2OA 1I45A 5DMYA 2OQLA 3VVGA 4HMCA 1VFHA 3MP5A 3IRSA 2QPSA 3VIFA 4LBUA 4LCQA 1UZHA 4HK5A 3C0QA 1TSIA 1DEDA 1R86A 3FV9A 3WH8A 1Q4WA 3N6HA 2WB5A 3WBAA 2EF9A 4DIAA 4QLLA 4AG0A 4HU8A 4YTUA 3RLHA 3GDTA 5E93A 3TH6A 2C8NA 3NQAA 3E0LA 1NWUA 4FS9A 3DKJA 2FVLA 3Q94A 3MUY1 1RK5A 5CG7A 3RF9A 4Z1AA 3ARQA 5ABHA 4GX9A 1LRNA 3HURA 4ZR8A 4A3RA 1SJDA 1DTUA 3W7LA 3IVTA 4A8RA 4PMUA 3PBUA 3ME3A 4W8BA 1ADDA 2P8CA 1UR0A 1L8NA 2E8YA 2ISFA 1J6PA 4DJDC 2A3BA 5D05A 4WX2A 3ZZ1A 2RJHA 3RX2A 4Z1YA 4LAOA 4EACA 3EA3A 1BPLB 3JZUA 4F0KA 4XK2A 1DKWA 3PBYA 2A5HA 1MQPA 1JZ4A 2PZ0A 2CEQA 1FFQA 4JNMA 3GNDA 1R2RA 3I10A 2X1UA 4I5RA 3OGSA 1V3IA 3BMVA 1FCQA 3QF0A 3LK6A 1XWYA 4E2VA 3ATZA 1WUFA 1PKYA 3LM3A 3ANYA 3CZEA 2GWGA 2W92A 1S2VA 4MKVA 3AYTA 2VFGA 2P3ZA 4L9ZA 2ZBTA 3UU0A 4KEMA 5HDRA 4FA3A 3HIJA 4EF8A 4D6EA 2BFGA 5AC5A 4L5ZA 4NZ1A 3VA8A 2NX1A 1HJVA 2E4TA 4ZQCA 2YCJA 4GXWA 2A7RA 1YE4A 2FDMA 4QS5A 2C1GA 1HZYA 1AW5A 5CZTA 1BXNA 1TG7A 4IMAA 1C8VA 3TCSA 1LT8A 4E3VA 2VDGA 3BLIA 4J7RA 3M5VA 5D03A 4P8WA 2EHHA 4J3TA 2CLIA 3EWBX 3TYBA 4W87A 3URQA 3OHMB 1WDRA 2GOUA 2Z1SA 1EBHA 1HKKA 1UWAA 4DQWA 1V4YA 1QBBA 4US6A 1DJQA 3MV11 2I1OA 4HD5A 2G8ZA 4JFUA 5FF3A 3FJ4A 1K70A 7TIMA 3RX3A 1YQ2A 3GXFA 1G4PA 1T40A 1F4HA 4KS0A 1U5JA 4GY0A 4E4UA 1IEWA 1XLMA 3VFLA 3NL5A 2FJKA 4HCLA 4FEZA 1RPKA 3C52A 4HSHA 1H63A 2PLMA 3WFAA 4YTTA 4JIEA 1TPFA 2ODOA 3UPMA 2WKGA 4H6EA 1GYMA 4ZB2A 4FNTA 4LS0A 3H4XA 2GSJA 4IP4A 4W5UA 1G67A 1JD9A 3E1F1 1OFOA 2Z0IA 5F4SA 2VC6A 5H1WA 5DEZA 2ADAA 2G3JA 4HTYA 3I7RA 1ZY9A 1XPGA 3ZT7A 3BAWA 3K4WA 4H7VA 1GQJA 1EYWA 1UD4A 3GKAA 5M5DA 3K5XA 3WDIA 4A3UA 4NZ5A 1TRDA 3S42A 1JD7A 1Q63A 2E9LA 1UPMB 3GU9A 3ZWSA 4IM4A 3E0FA 3EMZA 3THUA 4MB5A 3PPHA 1VIWA 2C13A 2Z26A 3DHUA 4KFPA 3TN6A 2VZUA 3GK0A 3T4CA 3P74A 5DY2A 3NTYA 4CD4A 1MUCA 2F84A 4S3KA 4DLFA 2DFAA 3W1MA 1XG4A 1DPMA 1BQCA 5AECA 2BVTA 1ALDA 2Z1VA 1KBLA 4KCWA 2CERA 5A2CA 4MJZA 1VHCA 1DIKA 2O92A 4WRHA 4J1OA 3V0TA 3W86A 1H11A 1C9WA 2QNEA 1TMLA 3MSRA 1XW8A 4M6PA 3BPWA 1PKMA 1YTEA 3L65A 3P0WA 3LNMA 3GY1A 4EX4A 4RW5A 4GI4A 1KM5A 1W8GA 2PURA 1YXYA 3KFTA 3LPPA 2QF8A 2EPHA 3H24A 3PZQA 5E70A 3WLRA 1TWWA 3SFKA 1C91A 1NIUA 3OYXA 2W3ZA 5C9UA 4IPIA 4EXBA 4DRSA 1V6YA 3AHXA 4IIBA 1GJUA 4LS2A 4DUWA 2E67A 4QNWA 4UFLA 4PBEA 1OIFA 1MQQA 1XF0A 5AYZA 5G4HC 1QK0A 2E40A 5I3FA 3T1GA 1FWEC 2W6RA 2GJLA 4XQ6A 4BHYA 5C0QA 1ZJHA 1PDYA 1L2UA 3ZVHA 4ATDA 4A21A 4MJ2A 4DM1A 1NTHA 5BRBA 1V0MA 3CUGA 4UOZA 4D6JA 5FCZA 3TOPA 1G4EA 1Q8JA 2BXYA 1WO2A 1F6YA 3WDHA 3EX2A 3NVDA 3GDKA 4J3XA 2AGKA 2GSHA 4NX5A 4KH2A 1US0A 1E6ZA 3VD9A 3EOLA 1B3XA 1RY0A 4HPNA 5C55A 1DWHM 1M01A 3CYJA 4WVXA 4YPJA 4A8LA 1ISYA 1Q66A 3TAKA 2A2IA 4WDXA 2RDUA 2QT3A 3U4AA 3S3GA 4P8UA 3GD6A 2PTZA 3AMKA 3PANA 2WC7A 1S2UA 5LNRA 1XI3A 2A6NA 1S2AA 4GD0A 4GXPA 4R85A 2Y0FA 4JX6A 1XYCA 4X3ZA 4IT1A 1Z32X 3CV7A 4TQTA 1T41A 1H3GA 2QJNA 3L5MA 1OM0A 2J9ZA 1DTNA 2E7FA 1R6WA 1DJNA 4G7EA 1XYMA 2I17A 4O1AA 3V5FA 3SY5A 3UETA 4YTSA 3S1WA 2UY4A 3V5OA 3SCSA 2HQAA 2J7BA 4MWAC 1UP0A 3UZYA 1F2JA 4PRWA 1UA3A 3EWYA 4F8XA 1K6WA 2JALA 5LNSA 4HN8A 1TV4A 3BWWA 3MQTA 3B8WA 1EXPA 1EGMA 2Q02A 4V28A 2IKHA 3HFTA 1IGSA 2XH2A 3HGSA 1R8LA 1B54A 1ZAJA 1NDYA 2OYKA 3VINA 4Y9MA 1JDCA 1HVXA 4IXXA 5KINA 3FA4A 3NM3A 4HA1A 1XRTA 5CEWA 5BZAA 2Y7EA 1L6FA 3LCLA 3OQEA 4FIRA 3V35A 3L4YA 4IMGA 1XLKA 3UXDA 3TVAA 3N4EA 4LVGA 3W4RA 1XLFA 2QVHA 1B3ZA 1TPEA 4UFKA 1GNXA 1X6LA 2VYOA 2WPBA 3OVRA 1XL9A 5A2BA 2IQTA 2AAAA 3AWNA 1G1YA 3LENA 4XZNX 4JS3A 4F2TA 4IL0A 3OLEA 4JYEA 3OZYA 3G0UA 3HTWA 3FA3A 4YWIA 2NT1A 1HQTA 3KL0A 3N2TA 3W88A 1Q7MA 3Q65A 3GU1A 3WMBA 1VBUA 4TIMA 4LNYA 3IK2A 3QV6A 3R11A 5C2CA 1XIJA 4S3GA 3IGXA 4FNQA 4W88A 4DM2A 1VKFA 3KHDA 1A3WA 4UTIA 3W1LA 1FDZA 1PX8A 4N4QA 3VZXA 2BODX 1XSJA 3VO0A 2GGHA 4DWDA 1GKQA 3FYYA 2J8GA 3I65A 3EX1A 1WE5A 3W7JA 4AB4A 1S5WA 1KFJA 2PS2A 1G5AA 3GBDA 1MI3A 3TMQA 2ALRA 3NM1A 4XV0A 3WEMA 2WZTA 4DUXA 2Z28A 4R3UA 1XDMA 2CZ5A 3E5PA 4YMZA 4XZBA 5K9CA 3RILA 1QOXA 3WQPA 3M0ZA 3P6LA 5BU6A 1V8EA 3CQJA 2IPJA 3MVIA 3VNDA 5IHRA 2YXGA 3WEZA 3WYZA 5EBUA 5FAJA 4UOJA 1W9XA 4NJIA 5CC7A 3S8HA 4JTLA 1DV7A 2PDLA 3VC6A 1J79A 3ABZA 3OTRA 4GPNA 1PPIA 2PDPA 3VIPA 3MKCA 1SO3A 4KWUA 4JD4A 4AEOA 4ORMA 5HANA 3F03K 4C6MA 4MADA 1PX4A 3NWRA 4BY3A 3EDDA 5AVHA 4H8VA 3GBEA 1G6CA 2QCNA 3NVTA 1ADSA 3G0SA 2QUTA 3SSZA 4DWSD 3RXZA 2VCBA 1E0UA 1UHVA 1CTNA 4QSHA 2E6AA 1J0ZA 4AW7A 1UR9A 4XAPA 4GQRA 1LTDA 1TRIA 4OBRA 1A5CA 2GDQA 3N2XA 1J8VA 4HB7A 4O17A 4UCFA 4A2RA 2Y8KA 2ZXQA 2B7OA 2B7NA 3W7DA 2E6FA 3PG8A 4EPBC 5CLWA 2V5DA 4GVHA 1HO1A 5EU9A 3RGTA 2HWGA 1V79A 3CV6A 3C0JA 5BXTA 4NYUA 2HMCA 1W9VA 3NZGA 2Y61A 5ABEA 4TXEA 2VC9A 1O1HA 3EXSA 3OQ8A 4S3CA 1PYFA 1C3FA 5CPMA 1TPVA 1OFEA 1B9BA 3WD3A 1Q65A 1OCJA 1KRMA 1EJRC 4RDZA 1PHWA 4NI3A 3L7RA 3CPUA 4NZ4A 1EB3A 3AXIA 2E6DA 3CB8A 4KWVA 5A6JA 4NJKA 1RD5A 3W71A 2VCCA 3L4TA 5DX7A 1SMDA 3CS2A 4N9EA 4FIQA 4RUBA 4URIA 3UWEA 1DQUA 3BLLA 2TRSA 5E0CA 1ICQA 3RNDA 5XIAA 1ISZA 2PP1A 1XRFA 3OU8A 3CAVA 3TC7A 1FKWA 2D23A 3PZIA 3M46A 2Q01A 2CBVA 1K7EA 1MDRA 2ACSA 4JQAA 4JKMA 4BZYA 1VH7A 1KKRA 3S1UA 1OWQA 4PTWA 1MO0A 2YW3A 2Z1KA 3V4BA 3MCNA 4CQCA 2PF0A 1QI5A 1DBTA 2ZZ1A 1QNVA 3IVSA 4H8NA 5FI8A 1EPXA 1REQA 3ANVA 2CBIA 5KZMA 1FWSA 2FB3A 3UZZA 4CNSA 2ONEA 3PJWA 1KFWA 4AAJA 1TZ7A 4L4LA 2A3CA 4TVDA 3UG4A 2Z1WA 1GOKA 3W84A 1X98A 4H6QA 4WOZA 2I9EA 1CGYA 4Z2KA 2O9OA 1IEVA 4PMDA 3CIXA 5I6SA 3STPA 3WBXA 3WUFA 3LGDA 3G3MA 5I77A 3VIIA 1B1YA 2Y7FA 4D2JA 1IT8A 3WQ8A 1GVOA 2OO0A 4C1KA 3W7KA 1TR9A 3N73A 3S5SA 2ABAA 3VMPA 1LBLA 1X1OA 2J25A 5CJNA 1A47A 3A4AA 3AIQA 1H49A 2C71A 3DHFA 3ARTA 4NX0A 1TJ1A 2FGBA 3RK8A 2DZPA 4HPGA 4O0KA 2X7WA 4JTRA 1PWLA 4C65A 5BXSA 1EJXC 3D46A 5CXPA 2YL5A 1MNSA 5BCAA 1EWEA 2JGQA 2NUXA 3POCA 6TAAA 3A4WA 3CMGA 5RUBA 4AZ5A 5G1MA 4XAYA 2PDCA 5CC6A 3P80A 2XJ7A 4YTQA 2CITA 2CWNA 1EO7A 3K46A 2YIHA 1WOBA 3A64A 2QR6A 2DZSA 2PDGA 1KWGA 2IW0A 3BL3A 2YOCA 3CGTA 4JHMA 3OVGA 4L56A 3WF1A 1BYCA 4F40A 9RUBA 1YPIA 3VDHA 4IQDA 2VQTA 3W22A 3P5ZA 1LDCA 3L5LA 1C93A 2YJQA 1WDPA 4WKFA 2VFFA 1EOMA 4LBSA 1EIBA 3IUDA 4FXFA 3VDGA 3SM0A 5I00A 2YFNA 4Q4KA 1RJQA 3BH4A 2NQHA 3FYOA 3R10A 3B9DA 4H04A 1DOSA 4ZOEA 4GJ1A 2DSWA 4MUZA 2YL6A 5LIUX 4K1GA 2ZQ0A 4F9JA 2OZ8A 2WANA 1QOQA 5BOEA 4U3CA 3QJAA 3GXDA 3FSUA 3H7VA 2W91A 1VJZA 4L9YA 1BKHA 5MKGA 1P6WA 1ZB5A 2YYTA 3MANA 1ZSXA 2F6KA 1WXJA 3QC3A 3MDUA 3PM6A 4XD6A 4OWGA 4M82A 4Y9NA 5JU6A 4CCZA 4H41A 5D9OA 1RBOB 1MYRA 5DANA 4DPQA 2QHAA 3W23A 1AUSL 1GJWA 1LP6A 3AIUA 5A69A 1FQ0A 4IFRA 3LU2A 1W5MA 3MBFA 2CHOA 5ECUA 4XG1A 4L61A 4Q8PA 3UG8A 4MFEA 1TPB1 2V8ZA 3OW1A 2CLEA 3O6AA 3H2FA 1J2WA 1GVQA 1UP2A 2D73A 4U5KA 3P14A 4ATLA 2ISSA 4MIMA 4O10A 1ONWA 5A6AA 4WXZA 3L2IA 4ZXLA 5AZ0A 1TR1A 3NQCA 4UOQA 3TW7A 2CPUA 2E9MA 1P7TA 2P53A 4C5YA 3PSWA 3DFSA 1FWBC 2D69A 2X0HA 4O53A 3CUHA 1MVYA 4DZIA 2PP3A 4GNVA 1DWGM 2I7GA 3NFUA 2F61A 4HK6A 1RLDA 1W5OA 3SR7A 1EXBA 4O50A 4M81A 2CXEA 4UXDA 1VFTA 4E2BA 1ME9A 4MNJA 5ABTA 1S1RA 3NDZA 1EO5A 3FK4A 1WCGA 2Q3RA 4GCAA 4GI9A 4QHRA 1E51A 2AL1A 3V7PA 3DGBA 3KOFA 3CWNA 3L4XA 4Z2IA 1H7WA 4KF1A 3C2YA 3GXPA 4AC7C 4NY2A 3TJLA 3W2MA 1PL9A 5HNRA 1O1ZA 1V0NA 2C79A 3CB3A 4DHGA 2PDWA 5GPRA 3VABA 1OK4A 2VVNA 3V16A 1QW7A 2O9PA 4ERAA 3FW6A 2BSLA 1K9EA 5AKQA 3VGDA 3WMLA 3B8VA 1T0OA 3FJLA 4MTVA 3S6DA 2FH6A 5H6HA 1HJUA 1B57A 3AYRA 3N34A 1WYIA 4PTVA 5G2HA 4GUJA 2J6XA 4AD1A 3ABRA 4UTUA 1M6JA 4CCEA 4WSHA 4QLJA 4H8UA 1GTHA 3N2BA 4LS1A 4H9UA 1G7UA 4PCTA 2V38A 4M7TA 3THQA 1BXBA 4BF7A 3TCEA 2NWSA 3RCNA 2PTYA 4PC8A 3RMEA 1QI0A 4JTIA 4IFKB 3OYZA 4E8CA 4KKXA 3FEQA 3TZFA 2PWUA 4LSBA 4FLRA 3PR2A 4YVVA 4OUIA 3PNZA 1IHIA 4HU4A 5A8PA 2CZDA 4JICA 1UWSA 3N19B 3LTPA 4NF7A 1U1JA 2WWCA 1VPYA 3BAYA 1X6NA 1RQBA 3WBYA 2Y85A 1RJPA 4MPKA 4UZSA 3MUCA 1JEZA 1YMYA 2IQ0A 3T4WA 4ZOBA 4M56A 1XP3A 3DI1A 3DDMA 3RR4A 2ZRZA 1DXEA 2YR1A 4ACZA 4XBSA 1E71M 1KXVA 2V82A 6CGTA 3O16A 1RBAA 2I5IA 1TYGA 2Y62A 3NAVA 1X96A 3RYSA 2J4GA 1QVBA 3DENA 3CAKA 2G96A 3WY1A 3W6MA 3U9IA 4O16A 2E68A 1I4NA 1FBAA 3AMDA 1VFOA 3CHDA 1JZ8A 2GVLA 1D9EA 4BWLA 4EPDC 4W85A 1FCUA 3R8HA 3PBGA 3DG6A 3EKGA 4GNJA 4J40A 4HYVA 3CHCA 1NFGA 4DWSA 5ABFB 4XB3A 4I6KA 3LCHA 4IL2A 2QULA 1S2CA 4GZIA 3G1FA 3QZEA 3KCLA 4DNMA 2AAMA 4MLJA 1GZ1A 1H09A 2PWHA 4EAMA 4MDPA 3S2LA 4AY8A 1B2YA 3B9EA 1AZ1A 1H7PA 5HMSA 3VYLA 2QS8A 1HKIA 4GQGA 3ECQA 5M1TA 3W1RA 2NSXA 2XFYA 3U48A 1QR7A 3S5NA 4DZ5A 3G1AA 4OV9A 1B0IA 4C6QA 3RLGA 2QJGA 4IIGA 2V2CA 3RX4A 3BGJA 5AHMA 4O4WA 4UTKA 3WMCA 1DJIA 2XM1A 1B90A 3SEPA 1KBIA 4HMDA 2PLCA 4LUSB 1UUMA 3RJYA 2ZZ2A 3ALGA 5EY5A 2WAGA 3J7HA 1UR3M 3CPRA 1E73M 1MQRA 3KCOA 1DIOA 4Z2LA 1JYWA 2QZRA 4LY8A 2YCIX 4RZ6A 3LHYA 4UQCA 4GYJA 3FXYA 3BZJA 3TTSA 4ZE5A 3LTSA 1LRTA 5KZEA 3ES7A 3VD4A 4PMYA 3R25A 2DQXA 2HTMA 1U1UA 2X05A 1Q6GA 1ZAIA 4WQ6A 3AHTA 3L5AA 1UQZA 4FXRA 3HQPA 1OD0A 4W5ZA 2BVWA 4X63A 4Z42C 3MJMA 5FD0A 1E9ZB 3W1AA 5H2ZA 1O4UA 3VZZA 1HL9A 1OABA 1L0PA 1W1PA 2G0WA 4PUKA 5FSEC 1XRVA 2HPIA 8RUCA 2G95A 4EIVA 4NNCA 4IIHA 4HK7A 5KTLA 3AXKA 5EKYA 3EOSA 4CQAA 4ZFCA 3VUPA 3LI0A 3B0PA 3CTTA 5AFDA 4B5WA 4KERA 3TZNA 5DELA 1EIXA 4OZOA 3IJIA 1TTPA 4PFMA 2ZUVA 1EZWA 3BZGA 1OGGA 1KNWA 1EHAA 2NQZA 3O63A 4V27A 5AY7A 4KQNA 1VZWA 1ONEA 5KZ6A 2WSKA 3K4DA 1F74A 1F6PA 5LA0A 4LUYA 1VFLA 5CC5A 2BBFA 4MWAB 5JVLA 1W9DM 5FJOA 3EBVA 2NZLA 3FFSA 3B03A 3P84A 5A6SA 6XIAA 2F9RA 2RJGA 1PWMA 4KRTA 1R87A 3DHPA 4DF2A 1H7XA 3I7SA 5CSYA 4X9SA 3ICJA 1WZLA 3RM9A 3APYA 1KQZA 2V2DA 4RX0A 2XGBA 1FP8A 4PRRA 1TV5A 3N4AA 4N9BA 3DG3A 4RV8A 2AGTA 4N6FA 3T9PA 3BO9A 3A9BA 5MHBA 3WNKA 4PB5A 2GGIA 3W7RA 5I02A 4GQBA 3U5UA 1HL8A 3R6IA 4MNKA 3SCQA 2FHBA 2J13A 4HGXA 1Q85A 3M5ZA 2Y5SA 4WY0F 1HX0A 2HK0A 4E38A 2J9XA 2WVVA 4WCJA 1XLHA 4GWEA 1G9HA 4PL2A 3EDKA 3I6RA 1DQXA 2YDQA 1UZDA 4IFOA 1WP6A 4N02A 4AD0A 4GVIA 1JFHA 4IPLA 3M0JA 3N6JA 2D3LA 4D6CA 3ABXA 3T05A 4FMVA 1M7XA 3LMYA 1Q6OA 4GYKA 2QV5A 2WSRA 5T8GA 3NGFA 1QK2A 3U3HA 3I6TA 1C7TA 5FJIA 5BMWA 1YE6A 1J0KA 3MJYA 4BEQA 4B5TA 1JGMA 3OBAA 3DECA 2GYIA 3QY7A 2D1ZA 3FX4A 3LRLA 5JXQA 3AXMA 3CUIA 4QG8A 2QIWA 3R4IA 4M5PA 4UMAA 3KVJA 2F6UA 1KTBA 4LWWA 3ITYA 5E5CA 1K03A 4QQUA 3TQ0A 4HT3A 4B16A 1PSCA 4RPPA 3LDVA 1HKWA 2DZWA 2GUBA 3N9RA 3TE9A 4LUTB 3COTA 1ZNNA 3U5YA 1LWIA 1BQGA 3HU7A 1QDSA 2X8RA 1JCMP 3WG6A 4UMBA 1K1DA 4C7GA 1TFVA 3P67A 1F61A 4PMXA 2YCLA 3L0NA 1NH6A 2OX4A 3VD3A 2CYGA 2EPNA 4W93A 4XKYB 3K8KA 4L6DA 1QFEA 1ZCCA 3N1AA 1EA9C 3ZXWA 4JNZA 5JMUA 4ZTYA 2IKIA 3HG4A 4QQ3A 4Z08A 3BTNA 4IF2A 1M03A 3H2EA 5CBJA 3IWPA 1A5MC 2VMFA 1V5XA 8TIMA 5ENLA 1BWKA 2PRMA 1TZZA 1JJKA 4G1NA 1MEWA 2PDKA 1U1HA 4LXFA 4GBUA 5TIMA 1KGXA 1DWFM 1XINA 1CIUA 4UR8A 3NXLA 3FIGA 4QG6A 1W9UA 2W4XA 3SGZA 3IIZA 1SJAA 2D2OA 3DXIA 2V63A 1DP0A 2V2HA 2ZRYA 5PTDA 3TU9A 2PBOA 4FF5A 3LCGA 4K39A 5FEWA 3AYSA 2W62A 3R58A 1POKA 1WUEA 2DH3A 3P0XA 4FOUA 3GHRA 3KCJA 1MRAA 2O56A 4YIWA 4ENLA 3G1DA 4AZIA 1XXXA 1X7FA 5L6UA 4PN2A 3HOJA 4M8UA 4J27A 3ID7A 1J96A 1OD8A 3LSBA 1DVJA 2W9MA 4UQDA 2PGEA 1WZAA 1NFPA 2CLOA 5LYRA 1M04A 2OSWA 2O4MA 3EKLA 3ERPA 2VO5A 2DT2A 3CWOX 2WZIA 3G2GA 1E6NA 5I3JA 2BMBA 1XIGA 2WKJA 4A8NA 3AZSA 4DN1A 2CZVA 3HG3A 4AIBA 4DF0A 1YTDA 2QVNA 3A3WA 3DBPA 1E6QM 3FVMA 1UZ1A 2DIKA 4GY1A 1ZQ5A 3Q58A 1XUZA 2FMOA 3AIBA 4JTKA 1BEUA 1JPHA 4PMOA 1QI4A 3WQDA 1AJ0A 1UOZA 2OT0A 4IG2B 1HP4A 1GVRA 5GJNA 3EYPA 1MEHA 1W3KA 3GSMA 3FAWA 3WNNA 2PD5A 2BX7A 2CLHA 2CCRA 2JEQA 4ZOCA 4JTCA 1GOXA 3N9KA 4ZVJA 1HF6A 3W74A 1ZBWA 2ZZ4A 3B9OA 1Z3NA 3E0WA 2DIEA 3FCPA 1HJQA 3BLEA 4DO7A 1BSIA 2I5QA 2OQHA 3VCRA 1A5BA 4L6HA 4AQLA 3KTXA 3BARA 3G1HA 3VGEA 1E9IA 3GG8A 4NUWA 3H8AA 4OQVA 3O8AA 1TZ9A 3RR1A 1LOSA 1UROA 2J79A 2WNZA 1HNYA 3SRDA 3GVGA 5TAOA 3V0UA 3G6LA 2QGHA 4IP5A 2WMIB 5HPCA 1R3TA 1OC5A 5F4WA 2OWCA 3ARUA 5HWJA 2B7PA 2AQVA 5G1TA 2CZEA 2FFIA 3CHFA 3UT0A 4HHLA 3MP4A 1N55A 1MXSA 1VFUA 3TFXA 1CXHA 6ENLA 1UH3A 3KVKA 2XIOA 1GKRA 3MUIA 1FWAC 1RCOB 2E77A 5DT5A 1FX6A 3ZLGA 4S2BA 3FJ6A 2G3IA 3BOFA 5D30A 1JCXA 3DN5A 2YW4A 1RA5A 3DUGA 2X42A 3RPMA 3JW7A 4N2YA 3T0CA 3UJEA 4EE9A 2PU0A 4DLMA 2X41A 1LT7A 1PZ0A 4Q7BA 4EANA 5G4EA 1TB3A 1LL7A 3DERA 1TE6A 1OBAA 1Q7ZA 5JBDA 3R79A 5TD4A 4IMEA 4FLSA 3ABOA 2G3FA 4PODA 3MHGA 4HKPA 1ZPTA 4RPQA 2PDYA 4MYAA 3DFTA 5L9FA 1SFSA 5HA7A 2J7DA 5MF5A 4IQEA 4K36A 1CNVA 4UQEA 2RUSA 3PJUA 3MZNA 2GWNA 4MNMA 1BHGA 2ACRA 4LAZA 2C14A 3F4CA 1NEYA 1RJRA 4UFHA 1IE7C 2QJJA 2OXNA 4GG9A 4LC8A 4MLRA 2HNEA 5GVJA 5AVNA 3GNPA 4QCFA 3K8LA 3G8EA 5XIMA 4XWUA 1SO6A 3QLLA 2WXDM 3FJNA 3QBUA 2W63A 4UTLA 3WJWA 5IM51 4LW7A 3AMGA 4PTDA 4Q8NA 3FKRA 9CGTA 2VENA 3ITGA 3ZS4A 2ANUA 5HINA 1V0LA 1D3CA 2POZA 1A4MA 2XSBA 2DZXA 4R33A 5HBFA 4FNRA 2VR2A 4JHZA 1PIGA 2WV8A 3FGCB 3S1GA 1X1ZA 2WJZA 3EAUA 4ZXOA 3QGVA 1XBYA 4FB7A 1W3JA 3TIMA 4BQ4A 4NAFB 3W1PA 1UASA 3WJZA 2INFA 2PU1A 2ZXBA 3LCFA 3T44A 1JI2A 4PUDA 1RVGA 4TU1A 5C8BB 5EBAA 3SBFA 4NJJA 3VIOA 3WF4A 1XPYA 1Q45A 3CQ0A 1W5PA 3W2KA 4IMDA 3GTFA 1J5TA 4R9XA 5C2XA 5LIKX 3REQB 5CSUA 5HMEA 3VIGA 2CLLA 5EMLA 1TPUA 4DX3A 1NVMA 1LWJA 4IX0A 3NL2A 2VRKA 3HJZA 4LTSA 1AVAA 3SSJA 4JTEA 3VMOA 1VCVA 1WDDA 2VWTA 4UTTA 3W1QA 3DEQA 4Q8UA 4V15A 3AI0A 3IV8A 4HPJA 4QJ5B 2HEJA 3MV01 3OG2A 3TOYA 4ZSTA 2DUZA 3U7VA 1TPDA 5HWMA 3CUFA 1VP5A 1AFSA 1ITXA 3GHUA 5CC3A 1P43A 4R27A 3TJIA 3EB4A 3IEBA 2EKGA 2PF8A 3WQWA 3UWUA 2BOGX 1PXGA 3LB0A 3PZVA 2KX9A 1NY1A 5M3WA 4KRZA 5GQBA 3M1ZA 2V5BA 1P0EA 1KR1A 3QR0A 4BEUA 1N8FA 4AZ7A 4PBFA 7REQB 3LXBA 2Z2AA 4WY0B 7PTDA 3VKJA 3H53A 4DJDD 4B3ZA 3WBEA 4BCEA 4JCLA 4B9ZA 4Y9OA 3V36A 1UIOA 4XO6A 1MEIA 1V3JA 1XG3A 4KWWA 4H2HA 1DQWA 1JL8A 3IVUA 2WNNA 2RFGA 5D2WA 4D72A 4DVOA 3VNLA 3N29A 3N15A 4NL1A 1T96A 2IUZA 5HQEA 4Y2WA 5CPOA 4GVFA 2XN1A 3UR2A 4Q4SA 2P1FA 4B5XA 2B0MA 2VZOA 1CGTA 5F7UA 4YYCA 2ZWZA 3VOIA 1LG1A 3URAA 1DJWA 4QTGA 4PSPA 3HPSA 4K68A 4P7LA 2V3EA 4IJRA 1MRQA 1Q2SA 3QXBA 4DBSA 2R1PA 3N3MA 1K9TA 2NXGA 4HBKA 1SFTA 3ZWTA 1PIFA 2O7QA 3G5EA 2X1SA 3AOFA 1L9WA 4US5D 3RU6A 1YKWA 1GUVA 2DW7A 4NILA 2PTWA 4UR9A 1JAEA 3BMWA 4LF2A 3UWYA 5AHNA 4IPNB 1UP3A 1TUXA 4B90A 4LVAA 2DY3A 3LERA 3AALA 1X6UA 3NCOA 1AMKA 3IUIA 3W28A 1FKXA 3W82A 5CG0A 3CZ8A 1TPWA 1J4EA 4MKSA 2E1DA 4Y6GA 1VC4A 3BK0A 3AIWA 3EPOA 4Q8VA 4AZGA 1QPNA 4ZENA 4QM1A 2TAAA 3UWWA 2VGIA 5B7ZA 4S2CA 2EG7A 5C9XA 3QKZA 4TMBA 4TTUA 3FHQA 2PDNA 2XZ9A 4ZFMA 1SUXA 1V08A 4GC4A 1XCWA 3IIVA 3JZEA 1QHPA 4ZCWA 3KVMA 4ICMA 1EOKA 3QGAC 2FHFA 1KM0A 3VKDA 3WJXA 2YA2A 2R1LA 2VC5A 3S0CA 1PCKA 2HROA 5H91A 2DZTA 2XIMA 1E9LA 2GQ9A 3S1VA 4I6VA 3UYCA 3N04A 1F76A 5D04C 1GOOA 4KCTA 1QNQA 2VZTA 4DAFA 3URNA 2FDSA 1WA3A 1RALA 1OGBA 4AU0A 4LUJA 4QLKA 4UMCA 4R7JA 5D37A 2HV5A 2BG5A 1DHPA 3LEPA 3FYPA 1S3HA 1YEYA 3II1A 3CASA 1XLEA 3WQFA 4JIPA 2BY0A 1Y5WA 2D24A 4BI5A 5I24A 4GJIA 1R38A 3ZO9A 2I9UA 1NP2A 2DJXA 1SW0A 1EFZA 2E25A 4PCSA 1XGEA 4AVOA 1G01A 1US2A 1LCOA 5I2UA 1IQ8A 2G3MA 1WB0A 1F9CA 3TYEA 4O8RA 4XD4A 4AZCA 4JL1A 5EA9A 4C6EA 2ZRXA 2Y88A 4Q8OA 2JE8A 3B8TA 1GTEA 5AHLA 1X8FA 2QCFA 2Y8UA 2ZRUA 4G2DA 3TC3A 3STEA 5EGRA 5LGXA 4PTXA 2NX9A 1YYAA 3AIEA 2OR2A 2XZ7A 2OYLA 4JTDA 3M6YA 3BVJA 1FFRA 3GR8A 1AH0A 2DUAA 3IUHA 2A6LA 4KBXA 4ZO9A 3KOWA 2H8ZA 1TELA 2GJNA 4M80A 3W7CA 4DBWA 1RP9A 1YIXA 1IXOA 3ITVA 1ZLPA 2WMHA 3LCIA 3GE7A 1KM3A 4RNFA 2VFHA 1ESWA 5LNWA 2XFFA 1XLIA 1UWIA 3UZJA 4OE7A 3LPOA 2ZTJA 5DBUA 2UY5A 3SGUA 1CENA 2FH8A 4MY8A 1KXHA 6REQB 2J6VA 3QR3A 2CXGA 3LPGA 2XU2A 1XLLA 3TWBA 3INPA 1JZ5A 3JVAA 4M1RA 3ARXA 3G22A 3VOFA 1POJA 3QPYA 1RD6A 3KRSA 4QXIA 4ERGA 4O1FA 1NWRA 3THDA 3U2OA 1H7RA 7A3HA 3GFYA 1AMYA 1Z69A 2JEPA 3C2RA 3ITXA 2PFHA 2YKKA 1ISXA 2VEGA 3BOLA 3OLIA 4ZODA 1BRLB 3UESA 1IZJA 3OPSA 3QOMA 4IPJA 1JQVA 3OZMA 3C2OA 2NVAA 1EJUC 2XN2A 1H5VA 1WBHA 2J62A 4PSRA 4XIAA 2XIIA 6TIMA 4H19A 2JFEX 5FA5A 5HPOA 1ZTVA 1EJVC 3RUBL 2VP8A 1L2QA 3UVAA 1GG0A 4HMNA 3UXLA 4NQ1A 1W1VA 2OEMA 4J35A 3P82A 1FCVA 1VEMA 2CKRA 4MWAD 1NOWA 1A3XA 5C7HA 3PFMA 1E72M 2ZUTA 1UG6A 4JTJA 1W0MA 4AHPA 2XPKA 4DEFA 4RZ4A 3GXIA 3GUWA 1XRSA 3WQCA 3ATYA 3Q37A 3MCOA 4RNIA 4HU0A 3UWVA 5CGMA 2OZ0A 1JCLA 4GBDA 3EPMA 2A1YA 3HMCA 3UR8A 5K4ZA 3IJ6A 1PTAA 3IIXA 5CPNA 2CW6A 1M68A 2Z27A 3L12A 3T08A 3NURA 2XINA 3B9NA 3OG3A 1JCNA 4IZGA 4WSKA 5EYWA 2W79A 4G9PA 3MW7A 4QE5A 4J3VA 2GSEA 4XISA 4CLMA 3VIKA 3W70A 3AMLA 5HMDA 3VNJA 4C6PA 4YWSA 1A50A 2OEJA 3G1SA 3BCFA 3O15A 2YPIA 1FP9A 5HQMA 3QKEA 1FWWA 4JIQA 4AIUA 4GVGA 2NUYA 2INZA 1QUMA 2J7EA 1GEHA 4NZ3A 5FJTA 4A2SA 2HVNA 3UJ2A 4DBEA 2IPWA 4GIAA 3E5BA 4WDUA 1EF3A 4LUIA 1W2VA 2J24A 3UPBA 1PIIA 1JFXA 1M7PA 3WJSA 3VGGA 1BF6A 1NOFA 1F3WA 4PMJA 1OSEA 3W85A 4U33A 2VGFA 4W4QA 3T40A 2DSZA 3H55A 3GH4A 4HOXA 4JTTA 2JKEA 3AS3A 2XTKA 3ENLA 4NRSA 2J7FA 3S6OA 1L8PA 1XJBA 1ITQA 3ARPA 3THCA 2XWEA 2X2YA 4H9VA 4Q7IA 1RAKA 2HS6A 1HG3A 2WK2A 3WUBA 3AICA 4A35A 3TLLA 1QPRA 3OVPA 1OX6A 3NQEA 3RM8A 3BV7A 5LXXA 4KETA 4IGSA 4HVXA 2HXTA 5E0FA 3KHJA 1E0WA 3EDJA 1XGDA 4AD5A 1SW3A 2QUMA 3F4DA 2ZXAA 4HZ7A 1UUOA 1ADOA 3UA3A 5KMYA 1CX9A 1W3LA 1KRBC 4WXYA 5EB8A 2XIBA 3AHVA 3OP2A 1GK8A 2RGMA 1J01A 5DFAA 3UY8A 4BQ3A 5D2YA 4DJDA 3PBWA 1VB9A 4NASA 4XSLA 1LLOA 1FVPA 4LU0A 2FZMA 3NNTA 4BWLC 1DWIM 3TP4A 3F2CA 3KBMA 3UWZA 4K7YA 3ABSA 4UIOA 4GJJA 2NW0A 3PF3A 4FNPA 3RIKA 2OOFA 1AJ2A 4LEFA 3U2EA 4NT0A 3W24A 3GDMA 4PBGA 2CZFA 3WL1A 5FESA 4AD2A 4NJGA 5TF0A 1NDVA 5K7JA 1VYRA 1KA9F 1VFFA 1CGXA 4X60A 2CBUA 4B2DD 1AQFA 1KXQA 1O66A 3ITOA 1M3UA 3WH5A 1JULA 1JF5A 1AW1A 4CKQA 2WSYA 4GISA 2VEPA 1IT0A 1B3WA 1ECEA 4PMRA 3AU6A 1P1MA 3HQ1A 2G97A 1GGOA 5DCBA 3W27A 2QDEA 3W75A 1WKYA 1QPQA 4JN8A 4KIRA 3S6TA 3SI9A 4ATWA 2H90A 1EUAA 3C4UA 4LC6A 3ZVHB 4BFAA 4U5IA 4CGTA 3DG7A 4PMQA 1XH2A 4HZ8A 2JBMA 2OMAA 1C8YA 4FNSA 5A6MA 3SO7A 1LBFA 3B8IA 2X1RA 1KM6A 3BANA 2PLKA 3QSRA 1J6OA 3EOUA 3ARWA 4I7VA 4PUUA 3UP8A 4IFKA 2WCSA 3BAKA 4R9OA 1UBSA 5D9MA 1X97A 1XIFA 4IGMA 1XISA 4AD4A 3EDFA 3SCWA 2G5WA 2OOGA 1J11A 1XBVA 1SQ7A 4LCRA 2JQXA 3KRBA 4RDVA 1LOLA 2Z6JA 5CPTA 1XD0A 3B8SA 2BDQA 1OFAA 1KXTA 4PFHA 4WOQA 5I3GA 4U2ZA 2IXVA 3L21A 5D4YA 1MZHA 1XLAA 3I7QA 1W6TA 1O68A 3UZXA 3MSYA 1Z89A 1QO5A 1T8QA 3N2OA 1ZRQA 5I3IA 3H26A 3PP7A 5HAOA 1XBXA 3BOXA 1F07A 8XIMA 1HXJA 2QPUA 2R9RA 3LYEA 3P60A 2ZICA 1VBRA 1LM1A 4LB3A 2J75A 4IP7A 1FWNA 5KSWA 1AQ0A 4Q8QA 3D3AA 2C19A 2W27A 1DE5A 4W7WA 4ALDA 1RY8A 4Q4QA 2QYGA 3GNOA 4AZBA 2OFJA 4HHPA 2ACQA 2XISA 4B15A 1IR2A 2E8ZA 6ALDA 3MI3A 3TSBA 3U2ZA 2YGYA 4AH7A 2PDMA 3B3DA 3URBA 3OVQA 1XH0A 3VOJA 3WLSA 4AF0B 3H2NA 1KCKA 5ABFA 3BG9A 3OBEA 4OV4A 4ADSA 2XGZA 4PEEA 4HZ6A 1U2YA 1IIHA 1YDVA 2WZMA 5C9ZA 1CXKA 7ODCA 3PN8A 3F1QA 2YZ5A 3THAA 2LLEA 1SU5A 3TNOA 2HBVA 2REQB 4H4IA 4PYSA 2E1WA 2QCCA 4YCOA 2EPLX 3SIZA 4J5NA 3LHUA 3S2JA 3PTMA 2P50A 3H70A 5C70A 3M9YA 3BLFA 3RCMA 5C9WA 4AY1A 4YN5A 4D9PA 3PFRA 3G6MA 1BAGA 1PE1A 5AN7A 2GDVA 4IUGA 1PEZA 3TA9A 3LXCA 1FWCC 1P0BA 3O6CA 1TIMA 3KBWA 3NEHA 4FI4A 3N4FA 4LUSA 1JCJA 1EX1A 1GYNA 3SQSA 1E0VA 5FOOA 3PZTA 1T5AA 1GOWA 3A6OA 3M6DA 3NYDA 3PZUA 3NDOA 4GUGA 1UD8A 1DIDA 4C6IA 4X61A 3NQ2A 3W72A 1D2KA 2VRQA 2E5BA 4HJWA 2YA1A 1JUBA 2ZA2A 1LORA 4BK9A 4DI8A 1OHLA 3ARSA 5BNKA 4TTGA 1YADA 3UR7A 1OZQA 3FDKA 5G2IA 2GUYA 1OC7A 4B5UA 4R7OA 1F3XA 1ISWA 1VF8A 4KGLA 1ZU8A 2E6YA 1JDEA 4RR4A 3VE7A 1W3TA 3H4WA 3DC0A 2WVTA 4CN1A 3GTXA 1NQ6A 3ZR6A 2PA6A 2E3ZA 2VX5A 3DC8A 4FP1A 5BXRA 4R7WA 4I5XA 1SZFA 3R7MA 1OK6A 4QCEA 2ZUWA 2Q6ZA 1Q7QA 3NOYA 4E2DA 5HOSA 3TYZA 1FH8A 4L1WA 4YJ5A 4J2MA 4N6EA 3ZIZA 1XGZA 4Z0SA 4BKNA 3TONA 2CHRA 3VIHA 4M1BA 3MP3A 2P3EA 1ZBKA 2Z2UA 2ZIDA 3QZ6A 1OT1A 5BWAA 1R3WA 4NXKA 2QGYA 4MFDA 1I6NA 2OLSA 1VJIA 1BVWA 1FWJC 4MWAA 2VVSA 2C1IA 4E0CA 1CI1A 3BG5A 4JQ2A 5DMLA 1ITCA 2V6AA 1FHUA 2OCZA 1WOAA 3K13A 3ARVA 4ONVA 2B31A 2IS7A 1EEXA 4JTSA 1XIMA 2ZDRA 2QEZA 3LPFA 4PH6A 3SZ8A 4UC5A 4JFWA 1B5TA 1UWTA 2DT0A 2WOQA 3BJSA 1NU5A 1UYQA 3RAOA 1VJSA 3VNIA 1SR9A 1GHRA 4TO8A 1S39A 5F1VA 4AEFA 1XICA 4AMCA 4I8DA 3FLUA 4H00A 4JY8A 3GU2A 3L67A 4AD3A 1TPC1 1PX3A 4XUYA 4EKJA 2VDIA 4I9MA 3WUEA 2DZVA 3MO4A 5REQB 5JH2A 3QW4B 1RCXB 2X7VA 5K3VA 4XBJA 1K77A 1VPXA 5AHFA 2Z1BA 3TWAA 1Q3NA 3EX4A 5GJPA 3N9SA 5D9PA 5HXMA 1EPVA 2ZX5A 3A4XA 4J2PA 3QYSA 4XBKA 4IGHA 5HUPA 1UW9A 3MO7A 1U22A 4N42A 1XX1A 2ZX7A 3EWUA 3OBKA 2BGNE 1RQEA 2RHGA 1H1ZA 1I1XA 1FDYA 3SN1A 1CXEA 3KX6A 8CGTA 3VKAA 3KBVA 1OYCA 5A6BA 3LCXA 1LL4A 2GGEA 1E4IA 4DYEA 1QXLA 1CDGA 1TPH1 3AO0A 3WLHA 1XIIA 1UKSA 4W8LA 5SWUA 2I16A 3KE0A 2P88A 2PDHA 1V0KA 3QMSA 2E5DA 1V7AA 3GYCA 3O05A 3GHTA 1V3LA 4JR5A 1JCYA 5H8MA 4CD7A 1HVQA 4EP8C 1UMYA 2YZRA 4H6RA 4JFTA 4LUTA 2IKGA 1NWSA 1JGIA 4F0HA 2YBTA 3E9AA 2WM1A 4NZJA 1P1XA 4LEQA 1JUEA 3ONBA 2JKPA 1V03A 3SURA 3M0HA 3TSDA 1SZGA 4XKYA 2WWDA 5DMMA 4S1FA 4HZMA 4HNLA 3VU2A 1XUUA 2DVXA 3O0KA 3CPGA 3MWAA 3L4ZA 4MY9A 2FTWA 1FY6A 4Z2GA 4HJFA 4TOQA 1V6VA 2X40A 3TJXA 3KL3A 3PK7A 3R0DA 4LV4A 4QE1A 2GGJA 1BF2A 3BUVA 1EEPA 4L6OA 5I79A 4D6DA 3P62A 2D2HA 3TSMA 2QLYA 1CGVA 3QPEA 3TXVA 3GWQA 1UC4A 1UWQA 4LOCA 1OX5A 2PD9A 5CJMA 3XINA 2EQDA 4GCXA 4CD6A 1W8SA 5LNVA 4F4RA 3Q67A 4JX4A 2PWEA 4J28A 1D3GA 2VEKA 2WHKA 3R43A 2BVDA 4O19A 3RPTA 1Q6FA 3FXGA 3K1GA 5FEXA 1OG6A 3AC0A 2QCMA 2Y6ZA 2DW6A 3TNBA 4ERIA 4RW3A 1UUQA 1Q2RA 1UC5A 4P61A 2WMKA 1P0DA 1OCQA 3SCPA 3G1RA 1LLZA 1O5KA 1QHZA 2PDQA 3TYAA 1XFBA 1K8CA 1ISVA 2FB2A 4M29A 4YHEA 2YL9A 2FGLA 3IJ9A 2C15A 1N7KA 1E3XA 3MU7A 4GO8A 4IG2A 3DX5A 2V9DA 1DJXA 3QHMA 4AVNA 1KW1A 4QIUA 3AUOA 1VRDA 1ZFJA 1EX5A 2DGAA 1DJYA 2Z29A 2SFPA 3CNYA 3NXFA 3B8UA 3NZ1A 3TK7A 1Z6KA 3H54A 1TA3B 3WH9A 2WQPA 3DFOA 2A7PA 4HTBA 1V6TA 5U7SA 1QI3A 3TMLA 4BS0A 1IXPA 3EXRA 2WQDA 4KIEA 5DT7A 3B0VC 1EH9A 1QNRA 1SFJA 4PCNA 5FF4A 1AG1O 5I0DA 2G41A 2YL8A 3OHIA 4WEVX 1J12A 4I5UA 2D2GA 1VEOA 1XC6A 3QLDA 5HQLA 5EFFA 2WMIA 2ZUSA 4GYPA 4KESA 3VOGA 3VM7A 1J10A 1MMFA 3GVVA 2BHZA 4MF4A 3APGA 4IIEA 4UBPC 3EGJA 4JTGA 1HJXA 4ECLA 1RBLA 1YLVA 1Z9AA 2HDJA 4I9AA 4QR6A 4XZIA 1H41A 1F4AA 7TAAA 3CL7A 4J3SA 5HNTA 2RDTA 3LY0A 1OT2A 2QPXA 2Q8LA 1GG1A 5FSDC 4S3AA 1EP1A 5B7YA 3IV3A 1RXOB 1IXNA 1UR1A 3PTDA 2KAUC 4RDWA 1YBQB 1S5VA 3WK1A 2EJ1A 2PDIA 3GW0A 2HPMA 1CLVA 1LF1A 1SJCA 4GOAA 4QJ4B 3L23A 1BG9A 3BSHA 5I7GA 1AL7A 2WHJA 1DYSA 4YHGA 2OPJA 1G4SA 5LHFA 3OGVA 3ZR4A 1XIEA 3MTWA 4UQ9A 2WMFA 4AXNA 2H9AA 3ZLFA 5BYWA 4JCMA 2E28A 2ZRWA 3LQLA 1JXJA 4IX2A 3AHYA 3ZYZA 1QNOA 2V5LA 5IRPA 1E1CB 3WLTA 4A8IA 1R3VA 1QBAA 5JH1A 4GZJA 3OOQA 3F7JA 2PDFA 4S23A 3WX7A 3QN3A 3R12A 3S2MA 4IXHA 5DY3A 3I3DA 1YNYA 3DFNA 4KEZA 4ZB5A 1MW1A 1P5BA 4W84A 3UZ5A 2X30A 1M7OA 1KC7A 5E6ZA 1W17A 5I06A 4ZQMA 3GG0A 3EOOA 3W2NA 2E5CA 4WIWA 3W73A 1EYEA 3CUZA 3USZA 4ZSUA 1SR0A 3GH7A 3MZ2A 2XIQA 2XN0A 1TX2A 1W1B1 2Z00A 3EPNA 2DSUA 4EWJA 4IJBA 4P7NA 1VFSA 3PY2A 3QHNA 3STGA 4RE3A 1M7JA 3W2JA 4C6CA 1HJSA 4QAWA 1R3QA 1FXQA 4Q22A 3SRHA 2VXNA 1PB0A 3IJDA 3W53A 3I68A 3EWCA 3CUJA 4NXSA 1ZL1A 1R3RA 3FGCA 4JKLA 1PO9A 4E5TA 2WC3A 2FVMA 3R0KA 2VDHA 4JTUA 2BXVA 4NAFA 3MHFA 2GQAA 1S2WA 3M7SA 3IACA 4HNNA 3QQ1A 3LBCA 5M2FX 4B4HA 3LZ3A 3NPWA 4PRTA 4MHBA 3REQA 1TKKA 2IMRA 3OODA 3H22A 1XBZA 4OVXA 4RZBA 1E9YB 4Q8WA 1NF0A 3K4AA 3T0BA 4B9YA 1GOIA 3ZM8A 1JUKA 1ELSA 3A12A 2ZZ3A 3UJRA 3VNZA 1HUVA 1IT7A 3QQ0A 4K37A 1KRCC 4X0VA 3ORWA 1VR6A 1VBGA 2GJXB 2HSAA 3GX9A 1MFUA 4AYGA 2OX1A 3BGGA 4Q6XA 2PAJA 1RR2A 1UWRA 3AUJA 2ZZ7A 1HKJA 4EOUA 2Y8VA 4XIMA 2OWXA 1KFCA 3GXMA 3W29A 3M44A 2ZUNA 4JIIX 1P0NA 5BWFA 3WLJA 1BG4A 1GONA 3W26A 3PSVA 4GKTA 1KBJA 2VOMA 2EKCA 5HJXA 3FVDA 5LGZA 2AKZA 5E9AA 1V93A 3LBOA 3WLOA 1S38A 5LA2A 1R9XA 4IIFA 3SQLA 3MMTA 1RP8A 7REQA 1FOBA 4WY0A 1ODZA 4LNCA 3DU0A 3ARZA 3H2AA 3ITCA 1K8YA 2OLAA 2ZDSA 2PTXA 3KS6A 2WBGA 3HMJG 2PMQA 1DL3A 1UWUA 3R89A 1SZEA 1CXIA 2XH4A 3CIVA 4XSMA 4UWMA 4GFSA 1KR0A 3M4HA 1AH3A 5A8GA 3LLXA 5EMUA 1UH2A 5T9CE 3PJXA 3IARA 2NVCA 5ABGA 3MYOA 3GNRA 3KBJA 4KWOA 3JS3A 2GJRA 1K9DA 2JIEA 4KFOA 2GK1B 2Y2WA 3ZQ9A 1IEXA 2EAWA 1NELA 3G1VA 4JL2A 1MUMA 3VNYA 5E0KA 3LHWA 1QNPA 3WQEA 3CV2A 3SCVA 5G2WA 2BLEA 3W3OA 5C7VA 2OTDA 1RQHA 3C6CA 1PTDA 2GVEA 2HXUA 3SN0A 2NQLA 4AHOA 3RRXA 1EDGA 1JYXA 2R1MA 2Z4GA 1QCWA 4B91A 1SW7A 4S39A 2BHYA 4L4PA 4H6KA 3DYPA 3BDKA 4QX4A 1Y5VA 3QFWA 3OEXA 1BWLA 3BC9A 4UNKA 1E15A 2MANA 3RM4A 3O0FA 3B9AA 8A3HA 1BVNP 4Z1BA 2FTYA 2ZZ6A 3W2LA 3ZOAA 4GZ7A 3SJNA 4EXAA 1NWTA 1E0TA 2CBJA 3AIRA 1NSJA 4F2BA 1A5NC 1OCBA 4PL1A 3BXWA 5GNXA 5HR6A 2VL4A 2BB0A 2GL5A 3WK0A 3RPDA 1OX4B 1FTXA 1THFD 4DO5A 3L0GA 3HPXA 4QJ1A 3T81A 3UCDA 5H8UA 2PDJA 2XYLA 1K8XA 5A8NA 2R14A 3GDBA 2GVYA 1EQCA 1P6BA 4PTMA 1C8QA 1Q6QA 3WNLA 1NOUA 4X2RA 6PTDA 1KFBA 1E4MM 4JYDA 4A3YA 3T2OA 1EP3A 4XTIA 1AK5A 4B3LA 3CV1A 4I7UA 1P4CA 2I5GA 5G5IA 1AD1A 3AS1A 1RUSA 3W7GA 1K3UA 4M6QA 1IZCA 4H1ZA 3LGEA 1JPMA 1YXDA 1UJPA 4GH3A 1JG9A 4E3TA 1I8JA 5B80A 1Q8AA 4DAIA 1C8XA 2YB1A 3FAXA 2HBXA 3V18A 1FHLA 2QV4A 3UR5A 4Y8EA 4O8AA 1U30A 1JAKA 2VD8A 3PPGA 4R53A 1LL6A 2WJEA 1LBMA 3WQVA 3E2SA 3VDBA 3EA1A 4Q32A 2PWVA 1B4KA 3PS7A 3CEPA 5FACA 4B5SA 3GIYA 1KD0A 3EX3A 3C8FA 1V51A 5CBIA 4HPXA 3S4TA 1VBJA 5I78A 5DLCA 5CPLA 1O5XA 3W1TA 4XX6A 1SMAA 3LS9A 3MCMA 4L4MA 3C56A 4OKDA 5F2MA 2A3LA 2CIPA 2MNRA 3IAPA 3V75A 1ZP3A 5DCDA 1TQJA 3KEHA 3KDOA 3M07A 4A6GA 3GZ3A 3W02A 3WLPA 2XFWA 2BXZA 3F2BA 2VFIA 4MAVA 3MMDA 2VTFA 4RCXA 3MUXA 1SGJA 3U2CA 1R2TA 1S1PA 2OQYA 1RZMA 1H7NA 5D02A 3STFA 4WKAA 4DBDA 4K7VA 4IICA 3S46A 1YDYA 4WSJA 4B4FA 4XAFA 1EUNA 4D1IA 3K8MA 3W0KA 3WELA 2BOEX 3UA4A 2YBVA 4KFNA 4B3KA 5D38A 2VEMA 2R82A 1R7OA 4LYQA 2QDDA 4M7SA 3C2EA 2NQJA 2XVLA 3W7EA 1YXCA 4L80A 4PMZA 1W37A 4N9CA 1A49A 4D1JA 2RGLA 5HULA 3ZJ6A 4XZMX 4HNVA 2CWXA 5IFTA 2JKAA 4A05A 2B7QA 5KZDA 1JRCA 3C86A 2JIWA 4I9JA 3PWGA 3AQUA 1BLIA 1UB3A 5LIYX 5E09A 3GW3A 3L68A 2J9YA 3FN9A 2QQ6A 6REQA 4WDTA 1DWJM 1Z8AA 1LRQA 3E3HA 2A85A 3BURA 2H3BA 3SADA 3WH7A 1LJYA 1RCQA 4W9TA 1V3MA 1JPDX 2AKMA 1QWGA 2EBNA 2WNQA 5GJMA 4BQ2A 1E1EA 3WIJA 1Z44A 5C54A 2NLYA 4MZYA 1BRLA 1KTCA 2YDAA 3ANUA 3PZGA 2OODA 3LTYA 1TJRA 4BF9A 3L4VA 1GQKA 3DIPA 2G37A 4MZ8A 1BYAA 1JPIA 2HK1A 2XG9A 3LCWA 3W7PA 3E38A 1TVNA 4RL3A 3GAYA 3F5JA 1EGVA 1J0JA 3CL6A 1GW9A 3HGJA 1PV8A 3NL6A 4DJEC 5CGQA 4PTNA 1E70M 2V69A 2O55A 3E6EA 4E6MA 4JX5A 2AMGA 5KETA 2A3AA 1BXCA 4NAEB 1QPKA 4OHQA 4MWAE 4GQQA 5HNUA 3NQGA 4K8EA 2HVMA 4OBTA 1W5NA 4LVBA 5F1UA 4MB1A 1IXQA 3GXTA 4DI9A 4QDMA 5C5YA 2V30A 2XVGA 2C3ZA 3PPCA 3WMSA 2J66A 2FKPA 3K2GA 3UVIA 4CN4A 4XVDA 4EWND 3A3XA 4GIYA 5EFDA 2VOTA 3IAQA 4LY4A 1HKMA 3GDRA 4REQB 2J78A 1JF6A 4ZMGA 2Q8ZA 1WBJA 1HGYA 3AMCA 2WHMA 4QP0A 1XS2A 4R34A 2YCKX 2VURA 1RA0A 4NZFA 3LRMA 3NSNA 4HOWA 2PBGA 4AISA 4FR6A 1KTNA 1LQ0A 1NJJA 4QS6A 4Y9PA 2Z25A 1BYBA 2QCEA 3HPZA 2V5KA 3CT7A 3VGFA 4FAMA 3A21A 4QEHA 4F48A 3DGRA 3M0MA 4GUHA 3AWOA 3WLKX 1GYLA 2AL2B 4NG3A 4AWTA 3ZT5A 5J8LA 3KOZA 1ZALA 2DT1A 1ZZMA 1CCWB 1OC6A 4QEEA 3GG1A 1K6AA 3KRUA 3NEVA 4Q4MA 2PUZA 3GR4A 4MM1A 1R5YA 4Q3MA 4GGHA 3T0TA 1T6MA 5F4XA 3F4WA 2ZVIA 5IFPA 3E0IA 1PS9A 1VAHA 1PYMA 1WAUA 4GIEA 4HQVA 1RV8A 2FPVA 4C90A 5IBXA 4C91A 5CZSA 3EWXA 4C5ZA 1XQLA 2ACUA 3MI6A 5A8MA 2BTMA 2ALDA 2VNCA 4I3GA 1FWGC 2PRHA 1K7FA 4O0ZA 3OA5A 3AXHA 2JF7A 4PGLA 2FTPA 1P0KA 1FWRA 4MB3A 3UWQA 4RZ5A 3D3FA 2P5NA 1JZ6A 3NUKA 1GORA 3DBNA 1JXKA 1W1IE 1WAWA 3AZRA 2PODA 1AQMA 1X8CA 4L7ZA 1A3HA 3P7YA 4HHMA 2VUYA 3WQ6A 1ZENA 4TX8A 3ZT6A 3NZRA 3GNNA 3BE7A 3PUGA 1A5LC 1NDZA 3PUDA 3PTQA 2CLPA 2QUUA 1UKOA 2HE5A 3P93A 4E8DA 1EKOA 3M7WA 1KFEA 3GDLA 4M24A 3CLMA 3E2RA 4BA0A 4K2SA 4V33A 5CZ0A 3H4GA 1J18A 3VKCA 3O07A 3WD1A 5FEPA 2HRWA 1DE6A 1R30A 4UFIA 1AA1B 2O9RA 5M17A 3UD6A 1PKLA 4X0NA 2WNWA 4RK8A 2A3EA 3AZTA 3RG6A 3MMWA 3S5OA 4ES4A 1S5MA 4CCCA 2XFRA 3OB8A 7ENLA 4DYJA 4YU1A 5AC7A 5FF2A 4U2YA 3VIJA 4CQ9A 1NARA 5CPSA 3QQWA 1KV5A 3IJLA 1Q6DA 1ZP4A 1VFMA 1AL8A 3GZAA 2VI0A 4GUFA 4HNCA 4ZB0A 1VS1A 2GPTA 3RFAA 3I4KA 4KWSA 1IIGA 2BGQA 3WL0A 2IPGA 2YFOA 3NQ7A 1F05A 2ZXDA 1QWKA 1IEIA 3M0KA 3AFBA 3LHTA 3IIOA 3BCJA 1V7YA 1R2SA 4IPPA 4K6AA 2VGGA 4JN7A 1V02E 5BU9A 1EJWC 1UR4A 3W7NA 1E1FA 3CMJA 1M9HA 1TMHA 3N17A 2OJPA 3TQVA 3UY7A 4WJEA 5DXYA 4M51A 1XFCA 4XKMA 3U8GA 2INEA 1F5ZA 4OIFA 2YSWA 3GNXA 5HATA 3E96A 4G8TA 2J7CA 1QI2A 5AC6A 4PB3A 1B9ZA 1Q6CA 2BS9A 4FF7A 2I56A 1OFQA 3S9YA 4FOJA 3QTGA 5J5DA 4Q4PA 3RCYA 5E1QA 5AHEA 4QFUA 3WF2A 4CNOA 4HSNA 3WFLA 4UQBA 1CXFA 1EC8A 2QUVA 4LJ3A 5A8OA 3EEGA 3BQ6A 2VX4A 1F3EA 3FOKA 1P6CA 4F3HA 1YPFA 3VDCA 1CZ1A 1FWDC 4UTWA 4GYFA 4JTHA 1XLDA 1N8WA 1W9BM 4XD5A 1QATA 4C1NB 2ZOXA 4J9JA 2VEIA 1FWIC 5I5RA 4FX8A 2C0AA 2OT1A 3AAMA 3E2QA 3KAOA 1SZRA 4FSAA 5A3HA 3SDOA 3CJPA 1IF2A 5BOFA 3W9ZA 1W56A 3CL8A 3QYQA 1QMLA 4JKKA 1CEOA 1EDQA 2ISWA 4AF0A 2C1HA 3L4UA 4C6KA 1H61A 4INFA 1A0DA 4KEUA 2YCEA 4FXSA 3O7UA 4DXVA 3HV8A 1O5QA 4CCDA 1GOQA 2JF6A 1EBGA 2GJPA 1OG0A 4TR9A 3VK5A 2REQA 5LA1A 1KM1A 1UD2A 1YW1A 3MKKA 2B81A 1NQKA 3GTHA 3UYIA 1IR1A 1OADA 1I1WA 3BW4A 2NV1A 5LIWX 5D32A 4WK9A 5IDIA 4J4KA 2OEKA 2QF7A 3HV9A 3TYDA 1XLCA 1YDNA 4PEKA 4TV6A 3POHA 1W2PA 4AIOA 2JGYA 2PC4A 4O4VA 3T8LA 1BWVA 1PZ1A 2XM2A 2E9BA 3SUSA 3F2DA 3WK2A 3H6OA 3Q45A 5CKSA 5K9DA 5D2VA 1KV8A 3UBPC 3SUWA 3UF9A 4LRSA 2DVUA 1OCNA 4Z17A 3KLLA 2AQWA 1U33A 1R0MA 1E4LA 2W66A 4FO4A 2EPOA 5I03A 1E5JA 1UOKA 2IXUA 1XYFA 1US3A 1WPCA 3CQKA 4Q33A 2FMNA 3N3TA 1EC7A 1Z42A 3D47A 3EMCA 4AXKA 1VIZA 3WQ5A 2OVLA 3M0YA 2EJAA 2X2GA 4S3BA 3B0UX 1OFRA 2O7SA 3FY1A 5T91A 4XZ9A 3WD2A 2J7HA 4PR4A 2PP0A 1PKNA 5I09A 5FJJA 5IDZA 1HFBA 1XCXA 2J88A 3FSTA 3LV5A 2D0FA 4HYRA 5CJ5A 1BVZA 3HGRA 3QRHA 4JYFA 5TQLA 1SPQA 2NLIA 3TTEA 1LQAA 1V3HA 2ZUUA 3LMZA 2OO6A 4PMNA 1T7LA 4DJFD 4GGBA 2RAGA 4K1WA 3GHSA 1AZ2A 5F2GA 5FEZA 2ZE0A 3KRZA 3VI2A 4Y90A 2BZNA 2UWFA 3MPGA 3NIYA 4E4PA 4U4MA 1XIHA 1GW1A 4S3EA 3FNDA 1QT1A 1D3HA 4ZA0A 1L6YA 1TWIA 2CHNA 3TYUA 2QAFA 1TV3A 3CIWA 2A21A 2WZEA 4C6FA 1YNPA 2D0HA 1ITUA 4IQLA 3EDEA 3WSUA 3ZSTA 4N9DA 1VLIA 4KGJA 2PI6A 1PUDA 3NA8A 4AUBA 2GQ3A 2VZVA 4EPEC 4FOKA 1XYBA 2EG6A 1H51A 1LQ2A 3VXGA 4DXXA 1G69A 4GA8A 2WMGA 3PB2A 3LHZA 4O1DA 3VAVA 1GVFA 2ATSA 1LROA 4JTAA 4ML9A 1B3VA 1KO0A 3N11A 2G3NA 3U57A 1G94A 4ZO7A 3KDNA 1V6WA 2F8QA 3A9IA 3NPXA 1E6SM 4ICNA 4POCA 1K8ZA 4QBXA 4FZIA 5DF0A 1F73A 3ITTA 1L6SA 1A0CA 4AZCB 4ZZ9A 3B8DA 4HP5A 2C0HA 3NQ8A 2PTDA 5A6LA 3CH9A 1Y5XA 3G1XA 3Q4DA 4GXMA 1ODUA 2QUNA 3JUGA 3WDPP 6XIMA 2PRLA 1OIMA 3AXXA 4CNPA 4F0LA 1XV8A 1E40A 2X16A 3LA4A 1GT8A 4LYKA 1KKOA 1R46A 3T07A 1FH9A 3H7UA 5REQA 1S5TA 4P8XA 4QE4A 2WLYA 3W25A 1HTIA 1N2VA 5D2XA 2QIIA 4HNTA 1MFVA 1DWAM 2HCVA 4DF1A 2J8TA 4Q6JA 1HJWA 3CO4A 5AZ1A 1I2RA 1W91A 1MUWA 4OT7A 4UNLA 3SUVA 4FLOA 3F5LA 2D3NA 3RO8A 4AIEA 3TXZA 3NQMA 2FPYA 3TYCA 4AVFA 4O52A 1MW2A 5E9XA 3W37A 2Y5EA 4YS1A 1ZJBA 1B30A 3U7BA 4PUMA 3M43A 2OGYA 9XIAA 1JZ3A 4YL2A 2X09A 1HT6A 4K3ZA 2Q8XA 3CQHA 1U5HA 4D6GA 1B3OA 2QDGA 3P81A 4JN6A 1Y0EA 1HN1A 3ISIX 4NZCA 3WQGA 5DRCA 5HR7A 4MGGA 4YYFA 1QAPA 4W7VA 4DPPA 3FA5A 2ISVA 1YDOA 4DZHA 2Q09A 3VDAA 1KGUA 1JZ2A 3PWAA 4FX6M 1SSDA 2C16A 3PULA 4ZBCA 4JEJA 2OYMA 2V67A 3T2QA 2ZA1A 3B4UA 3HPAA 3O9NA 2P76A 1EJSC 3LV6A 2VGBA 3CZGA 3NJ3A 1TIWA 4GYPC 4AC1X 1GZGA 2ON3A 3VCCA 1K4GA 4A3QA 4UNIA 1E6RA 1GWJA 4GMEA 4UTHA 1EGZA 4IIDA 2PE4A 4UCGA 1DXFA 5T26A 1R9ZA 4JQ1A 1K9FA 2CLMA 4NHVA 3BLOA 3DFHA 1W32A 3LHVA 4QDWA 1G4TA 4IHCA 4FX7A 4ROPA 1FUYA 1TTIA 4O1CA 2V3GA 2X1IA 3KP0A 1J5SA 3B40A 3MB9A 2ZADA 4JDBA 1LUCB 1R85A 3R94A 1E6XM 4TX9A 5BRQA 3WK3A 5IXEA 1TJ0A 4W8AA 1JYVA 1UBPC 2NWRA 1UPPA 1ENUA 3PPFA 5JIPA 4AHQA 5C9RA 3UJFA 1XSKA 4HSOA 4AMAA 4OGZA 1M1BA 3DZ1A 4JBRA 1H2JA 4PUNA 3VD7A 2YDRA 1FCBA 3OIXA 3QTPA 1BFNA 4X2PA 4ROQA 4XZLX 2BNJA 5A1AA 2R24A 1O7AA 3QMRA 3TEVA 1V6UA 3SECA 4X9YA 3EB3A 4X22A 3CWHA 3RRAA 3RJXA 3ALFA 3GR7A 2DPEA 4LBRA 2XIJA 1A4LA 4O12A 2I14A 1PZ3A 2P8BA 4D8AA 5BMXA 1HP5A 1OVDA 2PEVA 1E5NA 2F6XA 2VX7A 4L1XA 1X38A 1KCXA 3TR2A 3NG3A 2PZNA 2DU2A 3CLWA 4CQBA 4A22A 4PUJA 4ADUA 2YBUA 5TBOA 2ICSA 5AYBA 3QH2A 2NT0A 2YYUA 3L9CA 1GVIA 3KM8A 4V1YA 1A0EA 2DJLA 3H23A 3CMFA 5C71A 1UIPA 1TA3A 4KCVA 3T78A 3GVWA 3WNOA 4MMWA 4IWWA 2WVSA 4H9ZA 3WH6A 4HMEA 1E4NA 1Y8BA 2QJIA 2VKZG 4EK7A 2G50A 1WZKA 1ICPA 3SUUA 4MYXA 4UUIA 3WD0A 3N13A 1OFDA 3VM5A 4Q7NA 5BXPA 3CBWA 2DEPA 1ME7A 1DHKA 4JTFA 3DH7A 4RKAA 3VKBA 2OG9A 3ZLHA 4JDYA 1EA0A 3SFWA 4MAZA 4ACYA 4TUFA 4HN4A 2CLKA 2ZKMX 4DNHA 4AX6A 1O6IA 3LSCA 1H5YA 3WLMA 3IGSA 1JZ7A 3H2MA 3W7HA 4G5DA 2BP1A 1PCWA 5AYIA 5FKYA 3SUTA 3PZMA 1NDWA 1KCLA 3C0SA 5LNUA 4M19A 1JNDA 3WLIA 2UY3A 1AJZA 2VD9A 1CXLA 1YBQA 2QMJA 3NZQA 1QO2A 1RLCL 3BW3A 4O1BA 1X7IA 5JBFA 1SFLA 2R8WA 1E3ZA 1VCFA 2ZRVA 3S5ZA 2PGRA 1VBHA 3W2UA 4OJYA 3DHDA 2O9TA 3MY9A 3MKVA 5H8PA 4P7RA 3T8QA 1VLWA 3N2MA 4WLCA 2ZWYA 1R3SA 4YCPA 4Z1DA 3ONCA 4ZEPA 2P10A 2DSKA 3UXKA 1GJPA 2YXOA 1CW2A 2Q3OA 1E1CA 3GFZA 3CT2A 4EXQA 3BAJA 1FA2A 1W3IA 4HOZA 4W86A 2FIQA 1U83A 1X39A 4FXJA 1A5OC 2NVDA 1HIZA 3R8RA 3DYMA 3GIPA 4KCUA 3M5XA 3ZJ7A 1XM3A 3VPLA 3C5QA 3BG3A 1I2PA 3VE9A 2P0OA 2Z6IA 5EPDA 3LX9A 3PUEA 2CETA 5AYXA 1KFLA 3RN6A 4FLQA 1FWTA 1S46A 5G1YA 3PVFA 1ICSA 3E02A 1CT5A 3GQYA 1XYLA 1YRRA 5FF7A 2XSXA 1R7AA 3AIVA 1PAMA 3LGGA 1W54A 4L9XA 4O14A 4DJFA 1Q6EA 2BWGA 4IOTA 1I75A 3PAJA 3VC5A 2PWFA 3A24A 1ECQA 2FZ8A 3UG5A 3C3NA 3QFEA 3TFCA 4OECA 4NKCA 3WCZA 4L1GA 4LALA 1VEPA 2GVGA 1XHGA 2WZHA 3NQ6A 1JIBA 3UJSA 4H83A 3SY1A 1XSIA 2ZYFA 1H0IA 3WBWA 3W00A 3WNMA 5M03A 3NPUA 1W3HA 2FZ9A 2H3DA 2D2JA 3F4NA 3IJ7A 5DMNA 1RPXA 4GRSA 4F66A 3SCTA 2RH9A 4H3DA 1SO4A 1K02A 4A4AA 2NXIA 4MPQA 3SCOA 4UR7A 3TQPA 1XLJA 3IS4A 4NU7A 4NYYA 3NPVA 2HVOA 1B4EA 4OU1A 4DO4A 2GJXA 3WJYA 5KITA 1OZMA 3PUOA 1C92A 3BLDA 4GINA 2XGIA 3A5FA 2QCDB 3GB6A 4YTRA 4LYRA 4GQ0A 3TW6A 3ZFHA 2FVKA 2FHCA 4AWUA 3VGHA 1J0IA 2ZFAA 1B31A 4MUPA 3PBVA 3T09A 2ZA3A 2CC0A 3CZJA 3G77A 3G18A 3D0CA 3QOKA 3NGJA 3EEZA 3PBMA 3LRKA 2TMDA 1N82A 5DO8A 2BASA 2QCHA 3LBMA 4NP7A 3QV9A 1I0BA 2VUNA 3CXOA 1LYXA 1NFBA 3A4JA 3LOTA 3W1NA 3LG3A 3T7VA 1TCDA 2EPMX 3QC0A 4RXFA 5CSSA 3QVQA 4D6FA 4JNYA 3PHAA 3W87A 4UB9A 5ECVA 1H50A 3VMNA 4JFVA 2H8XA 4NI8A 1ZUAX 2FGZA 1X1NA 2WMJA 2V68A 2WCGA 4ADTA 5CCZA 4M3PA 3MDWA 4BJHA 1CBGA 3IGUA 2A3HA 3OLGA 2GK1A 4LQ1A 1R9YA 1S3TC 1OYBA 2IQDA 4LYPA 3WUGA 1M53A 3WF0A 1JPKA 2PWGA 4DY1A 3DI0A 2QJHA 3SY8A 3VFCA 3CU2A 3RLUA 4ORIA 2QCGA 1AQHA 5CH9A 4LAMA 1OQFA 3RMJA 4L4OA 2WO5A 2NQ9A 1TVLA 3QV8A 1ZJIA 2NV9A 3UCQA 3IGHX 1KLYA 3SCRA 2C6QA 4Z0JA 2OSYA 3HQOA 3QGKC 3M47A 3DFYA 2QAPA 4IH3A 3A5VA 3W1UA 1SYTA 4O18A 4DYKA 2QKFA 3JR2A 1DORA 3P61A 1ZBVA 3PWIA 1KCZA 3KWSA 1NM9A 1EL3A 5AC4A 3QMTA 3N25A 5IHSA 3ZSSA 4OFCA 2OKTA 3HQNA 3CZKA 1OX4A 4S3FA 4LX4A 3NQBA 1O12A 4UTFA 4MZ1A 1KWKA 1DJGA 4O57A 3OLDA 4H7ZA 2X0YA 4NNAA 2KZHA 2A0NA 1SO5A 9XIMA 3I3EA 2Z2BA 2J47A 4FPSA 5D8ZA 4RNJA 2DDXA 5E6YA 4AFYA 1RK6A 3KP1A 3DKLA 3NSMA 2BY2A 3BAIA 1OB0A 5DRIA 4IISA 4G7FA 4JQ4A 4HCDA 2FQIA 5JUVA 4V1XA 2TODA 1KBBA 5FIPA 4QSFA 5CSRA 1TX0A 5DQPA 3WDJA 1OY0A 5LKYA 3AROA 4XTDA 2Q71A 1MW0A 4RE2A 1EDTA 3GIQA 1E56A 3H21A 1BD0A 2DZAA 3R1ZA 2AQOA 3OZOA 4AZ6A 1CB7B 4DUOA 3BLPX 1IWPA 2J7GA 3M0LA 4U10A 3BSMA 2ZZ5A 3KZPA 2VJXA 4S3DA 4ZQPA 3VOCA 3TAOA 3PZ9A 3PB0A 1XC4A 4LB4A 4P5UA 1LLWA 4WF7A 7XIMA 3LM7A 1VPQA 1WV2A 2DUXA 2Z1XA 1VHNA 5A5WA 3TROA 5FAGA 5AB3A 3BW2A 2DP3A 5G4WA 3MUAA 3RO6A 1J0YA 1BSLA 1XDJA 5FL1A 4PCFA 3S2NA 1F3TA 2XDFA 1XD1A 4KEVA 4TMCA 1VYPX 3KL5A 3E74A 1DXIA 3WO8A 2PDXA 4DWSC 4Y7EA 3R2GA 4F79A 1ZAHA 4Z2JA 1NAL1 4BR1A 3TTQA 4F9DA 3TUUA 2EG8A 3T2PA 4DELA 3BMXA 4H9TA 3L66A 3RITA 4KMQA 1F6KA 2XHYA 4RDYA 1OF6A 4LT9A 1FDJA 5D9NA 1ME8A 1F8IA 4R5EA 3UQNA 5DBTA 4O0QA 2WVUA 1TMQA 1UD3A 2OGJA 3G0XA 4CD5A 1CYGA 4MJ4A 1W1A1 4MVAA 3G1YA 1OFPA 3IRDA 4US5A 2I57A 4GZEA 1ZCOA 5LSMA 3MT1A 2GGGA 2QMKA 1SJBA 1UCWA 3WN6A 3M0VA 2W0UA 3JU2A 3GC2A 5AOUA 1TV8A 2C91A 4XAGA 4AY7A 3HZ3A 3SN4A 3BCDA 1O60A 2MUCA 1O5RA 3VCNA 3N6QA 3UGRA 1EJ7L 1SM9A 4IUOA 1TREA 4ZO6A 5CGTA 4O15A 2TYSA 2R1NA 2E09A 3R0UA 1UA7A 4PB4A 1WNOA 3MA8A 4BI6A 3ZR5A 4CNNA 4JOMA 3QY6A 1DJZA 1MSSA 3R13A 3FDGA 3WDRA 1RSCA 1WX0A 2FJUB 3AHZA 1Z7AA 2NSOA 4RXGA 1VYSX 3VNKA 4GO9A 4KRUA 3M0IA 2OU4A 4MG4A 3TKFA 2YXXA 3TW9A 3KOXA 3GH5A 3P5YA 3AISA 2Y5JA 1FH7A 1R3YA 5IBXC 2WBKA 2Y4SA 5HNNA 2Z7GA 2XVPA 1OEPA 3B06A 1PZ2A 1FWHC 3IIPA 1BGGA 2WJFA 2DVTA 3NQVA 4EVZA 4J3UA 8XIAA 3GXNA 2FYMA 1RHCA 3EZ4A 4JPGA 4P8VA 2V3FA 2YDSA 4XO7A 2VR5A 2NUWA 2GOKA 3S9IA 1OFBA 3N18A 4AZHA 3V3WA 3AJXA 3WKZA 1FXPA 1UQYA 1MXGA 2BGSA 1OF8A 1XIBA 2ZC8A 4NSBA 3BAXA 2HJPA 4NAEA 2VFEA 2EGZA 2R6OA 3CC1A 1IV8A 2F2KA 3LI1A 4EF9A 4P7QA 4G7EB 5DXXA 3HO8A 1UJQA 2ZX8A 3XISA 4C6BA 4M0XA 3U4FA 1C9DA 3LUTA 4MOZA 5AHIA 4CU7A 1H62A 3M64A 1H60A 2V0TA 3M5YA 3KXQA 2CKSA 4HA4A 4S3JA 1Q5MA 3BV4A 3TJ4A 2BHUA 1J93A 3H12A 4UZUA 3MUZ1 2X0SA 1WKDA 5I3HA 4QITA 4TV5A 4M6VA 2WPGA 1FWFC 3QHOA 4REQA 4WZHA 2FPTA 3R5EA 4H9YA 1TTJA 1VGAA 5EMJA 5GNYA 3P8JA 1W3NA 3MSGA 3HPFA 3MSDA 2DZBA 3FHAA 1MNZA 4R88A 1DJHA 2PPGA 2WLZA 3OZPA 4QROA 5FL0A 4AEEA 3GO2A 5CAHA 3C2FA 3OIHA 3B97A 2A4AA 5HWNA 2HISA 4E4FA 1TQXA 2VEFA 4NIRA 4PZVA 4FNUA 1KLZA 2ZCGA 1CLKA 1M65A 3B0XA 1EP2A 3W83A 5EL1A 1UKTA 2XVKA 4GUIA 4CQDA 3SW6A 5I3DA 1AD4A 3G8RA 4GHRA 2RKXA 4O1EA 3F4VA 3GYEA 3EB2A 1QU4A 2GLKA 3UCCA 4GH1A 3GUGA 1GPFA 4P7OA 3G3DA 2AL2A 4JY9A 3I6EA 3M16A 1DIEA 2ZE3A 3KOYA 1CLXA 2R91A 3T42A 2BVYA 1PJ9A 3OA3A 2D22A 3DFPA 3GS6A 3V0SA 3N14A 3UXIA 2GFTA 3CM4A 4B92A 1TTQA 4H9XA 1KQYA 2XWDA 1CGUA 4HU3A 2XVNA 3KTSA 4NNBA 2D20A 1OINA 1NF7A 4ZTXA 1BTMA 3GC5A 2X1TA 1VCGA 3APTA 3SCUA 3TTYA 3IJ8A 2VFDA 2VM8A 1H7OA 1TUFA 4UTWC 4Z1CA 4QGCA 2OSXA 3MVTA 4DO6A 1XYAA 4FHAA 3QM3A 1IEQA 2XH7A 3HJEA 1OYAA 2ATMA 1ZGDA 3VX0A 3TQKA 3H2OA 4CEUC 4ZL1A 2DH2A 5KEZA 2HZGA 4JEQA 3DFQA 1XDLA 2H9AB 2Y70A 1W1YA 1F7BA 1Z41A 1JNEA 2NQ5A 2QJMA 2ZVRA 3O6YX 4XZWA 3K30A 2Z7KA 3RU8X 1NP0A 3W01A 3NZPA 4RV3A 5A8QA 3USBA 3HGOA 1XLBA 2WW5A 3B05A 2W5FA 4OBSA 2WSPA 2GDUA 2DSVA 2WJDA 3BJFA 3MS8A 1QRQA 1MWOA 1MW3A 3YPIA 1TWZA 3KUMA 2PCQA 3SCNA 2RDWA 5EMMA 1PHQA 3NR0A 3VD5A 3B04A 3CHVA 1T8XA 3WLNA 4N7QA 4YXGA 5AYYA 2VCAA 4LAKA 4JHOA 3NYZA 4CVWA 3RHGA 5K9XA 2GUUA 5T9BG 4LF1A 2V81A 3C0LA 4FK9A 3W38A 3RLVA 2BY3A 5I3KA 3VUSA 2PDBA 2J8FA 1Q13A 3IPWA 4G56A 1IWBA 2OELA 3W07A 3NSXA 1J9YA 1GEQA 1KGWA 2H6RA 3W76A 1MXDA 2O4QA 4IMCA 3NQDA 4HA3A 3I4EA 1W9PA 1EZ2A 2O0TA 3VIMA 5EMKA 4C7FA 4OOUA 3QPZA 3PNUA 1C29A 3PTKA 4HA0A 5A95A 1P48A 3UGVA 1E6PA 3DOPA