1IEIA

Crystal structure of human aldose reductase complexed with the inhibitor zenarestat.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
315
structure length
315
Chain Sequence
b'ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALDOSE REDUCTASE
publication title The structure of human recombinant aldose reductase complexed with the potent inhibitor zenarestat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 85
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2001-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ieiA00
3D3FA 1YE4A 2IQ0A 2FZDA 2HVOA 3UZXA 3CAVA 4Q3MA 3GHRA 3CASA 1AH0A 2HDJA 4LBSA 1FRBA 1MI3A 4XAPA 5LIKX 3EB3A 3CV7A 2F38A 2PDYA 2R24A 2PDMA 3N6QA 2IPWA 2HE8A 3V0SA 4GABA 1MRQA 2PDUA 4QX4A 1X97A 1YNPA 2IPFA 1EXBA 3M64A 2HVNA 4LAUA 1ZGDA 1XGDA 4YS1A 4PMJA 1LWIA 3EAUA 4GACA 3U2CA 4MHBA 1RY0A 3H4GA 3ONCA 4PRRA 4WDUA 3LEPA 4JQ4A 4XZNX 4JIHA 5M2FX 3R58A 1RALA 3BCJA 3N2TA 1X96A 2I16A 2AGTA 3M4HA 1XJBA 4JTDA 4WGHA 2PD9A 1S2AA 3WCZA 4I5XA 3V35A 1ADSA 4L1WA 1ZSXA 2INZA 3MB9A 1YNQA 2DV0A 2J8TA 2A79A 3UWEA 2PDWA 5LIUX 3CAQA 5DANA 4DZ5A 1ZUAX 1Z3NA 4FZIA 3KRBA 4IJCA 4F40A 2BGSA 4PRTA 4WRHA 2P5NA 4JTCA 2NVDA 4JIIX 5LIXX 1LQAA 3T42A 2IKJA 1PWLA 3VXGA 1PWMA 1T41A 3GHSA 3QKZA 4GQGA 1X98A 4GA8A 4IJRA 1UR3M 3R94A 4GQ0A 3UYIA 3Q65A 2HE5A 4GIEA 2IKHA 5JH2A 2ALRA 1AZ2A 1VP5A 1Z89A 4HMNA 3RX4A 1RY8A 3COTA 2IPJA 2PF8A 3BURA 2PDHA 4JTAA 4LAZA 2PDJA 2PDXA 3UP8A 5HNUA 3RX2A 1HW6A 1Z9AA 1MZRA 3WBWA 3R8GA 4QR6A 2BP1A 4DBSA 4WDWA 4FAMA 2IS7A 3G1RA 3LENA 3LD5A 3GUGA 4AUBA 4XVDA 4XO6A 1PZ1A 3H7UA 4ASTA 2FZ8A 2PD5A 1YE6A 2PDQA 4XZHA 2NVCA 3BUVA 3LUTA 4XO7A 3G5EA 4JQ3A 4G5DA 4FALA 1Z8AA 4H8NA 4OTKA 2IKGA 3O3RA 3Q67A 3S3GA 2ISFA 3V36A 4NKCA 2PDKA 4XVEA 2INEA 3DN5A 2C91A 2FZBA 3LZ3A 4R9OA 3WBYA 3LQGA 2HEJA 4JQ2A 1EKOA 3LQLA 3GHTA 4EXAA 2IPGA 3UZWA 4YVXA 3WG6A 1QRQA 2R9RA 3FX4A 1AZ1A 4ICCX 4PUWA 1K8CA 4XZIA 4L1XA 4LBRA 2I17A 2WZMA 1PZ0A 4PUUA 3CV6A 3B3DA 4Q7BA 2ACRA 3R7MA 1S1PA 2PDCA 4YVVA 1J96A 1C9WA 3LZ5A 4FA3A 1Q5MA 5KETA 2CLPA 2ACSA 2PZNA 2ACUA 4XZMX 2PDIA 2PFHA 4QXIA 3GHUA 3RX3A 3ONBA 4HBKA 4XK2A 3CMFA 2ACQA 2WZTA 1IEIA 4PR4A 1VBJA 2VDGA 3R43A 1EF3A 3LNMA 1US0A 2F2KA 1SM9A 4JTQA 1S1RA 1HQTA 2DUXA 5JH1A 2PDLA 1AFSA 1A80A 1AH4A 4YU1A 2PEVA 3UG8A 4XZLX 4IGSA 3WBXA 4JQ1A 3LN3A 3UZYA 1EL3A 3P2VA 3H7RA 2IQDA 4GCAA 3BV7A 1PYFA 4ZFCA 4JTRA 5C7HA 1M9HA 2PDFA 3V0UA 5HNTA 3UZZA 4LB3A 1XF0A 3R8HA 4H7CA 5AZ1A 3O0KA 1S2CA 3FJNA 3C3UA 4LB4A 2BGQA 2QXWA 3LBOA 4WDTA 1ZQ5A 3ERPA 1GVEA 3V0TA 2FZ9A 1Q13A 2FVLA 3R6IA 4JIRA 4JQAA 5LIYX 3M0IA 5HA7A 2PDGA 4DBUA 4WDXA 3MC5A 2PDPA 4QBXA 2DUZA 4DBWA 3UGRA 1T40A 1IHIA 5LIWX 1OG6A 3UFYA 1JEZA 2PDBA 3F7JA 2FGBA 3DOPA 4WEVX 2HV5A 1AH3A 2PDNA 4RPQA 5AZ0A 2IKIA 1R38A 1QWKA 4EXBA 4YVPA 3EB4A 3NTYA
chains in the Genus database with same CATH superfamily
1LWHA 2JEPA 5KZDA 4WOZA 2EBNA 4F8XA 3QVQA 1AD1A 2QNEA 4JTTA 4LBSA 1TYGA 3SN1A 1YTDA 1ZP3A 3PJTA 4KWVA 1FDJA 5LIKX 2Z25A 1SU5A 5A2BA 2YCJA 4Q4PA 1WDSA 1GOXA 3FOKA 3G24A 3G1XA 2E9BA 2FFIA 1NWRA 2NSOA 1XL9A 2Y5JA 1XKYA 4H3DA 1E1CA 2BB0A 1SJBA 2A4AA 2VC7A 1EDTA 4PMOA 4Q4KA 1SZGA 1NJJA 2HVNA 1HVQA 1YW1A 4LWWA 2QUTA 3W23A 3GK0A 3M0XA 2YZRA 3RILA 4K68A 1REQB 6REQB 3DBNA 4S3GA 4AF0A 1H61A 2ZE0A 1NFPA 5E0KA 2GJXB 3A13A 4UFLA 3W7IA 3S6DA 3T78A 1F3TA 2EPKX 2VTFA 1B3VA 4PRRA 5HPCA 2FHBA 1N7KA 1F5ZA 4W9TA 4JQ4A 4QJ3B 2C0AA 1UR8A 3A64A 3CC1A 5M2FX 1KM4A 2VT0A 3C2OA 3WQ6A 3EX6A 3T7VA 2E0PA 2XFWA 4IGMA 2ZX7A 5I3GA 4JL2A 1QNOA 3V35A 2OELA 2WW5A 2YB1A 3M5ZA 3NQ7A 3EX3A 4B3LA 1YLVA 4K2SA 2HVMA 2YDQA 2G3NA 2VO5A 6XIMA 1L6SA 4TQTA 3KBNA 3AIUA 4B5TA 4O17A 1IXQA 3TH6A 3AI0A 3KRBA 2OZ8A 4MADA 1UH2A 2VURA 1KFWA 4OUEA 5DF0A 3POCA 1KR1A 3W1AA 3NFUA 4HTYA 3THAA 3CZGA 4DX3A 5LIXX 3J7HA 3VXGA 1XD0A 4G2DA 3CO4A 2PCEA 2RHGA 3BOXA 1PS9A 5HQMA 1M7XA 1A5SA 2A2IA 1XH2A 2YCIX 3WUBA 4GIEA 3WL1A 4EP8C 2XSBA 1TRDA 4C6JA 2XH0A 3MP3A 1HF6A 4LRTA 1JPIA 4DVOA 1OX4B 1W32A 4Y90A 2PP0A 2W62A 4JTAA 3CJPA 1M5WA 4NYUA 4C1NA 2DIJA 1E0UA 4XAYA 2PA6A 4WXYA 4M0XA 2YCEA 3WBEA 4Q4OA 5A2AA 4GNKB 4QISA 1V3MA 4FAMA 1JZ3A 1OFPA 3LD5A 5FEXA 3SDOA 4GKTA 1K9EA 2OOGA 3WJYA 4ASTA 3EA2A 4H83A 5AC7A 4PMNA 3AXIA 2VOMA 1OIMA 3FKKA 2V5CA 2GWNA 5GNZA 3ZYZA 3S9YA 1KQZA 1E6XM 4JIPA 6A3HA 3LHZA 5L9FA 3CV1A 4B92A 1YBQA 1C7SA 2JFEX 3BW2A 1QBAA 3I3EA 4TVUA 5M17A 5ABEA 2V9DA 3NEHA 1KXTA 3EOOA 2OR2A 3G3DA 1XQLA 1O5QA 2CZEA 5D04C 2C91A 4UZSA 3CEUA 1Y0EA 3TCEA 1BPLB 1W9PA 3BXWA 4NXKA 3HG5A 2UV8G 2WO5A 4AZ6A 4QGCA 1L2QA 4DUVA 2Q8LA 4PCFA 3WLTA 2VELA 3B9DA 3U5UA 2J4GA 4AD2A 4QRNA 4PMZA 3AICA 4AVOA 1W2PA 1EX5A 4FP1A 4ADSA 4H2HA 2ATSA 3FDKA 5BW6A 6ALDA 4JKKA 3DI1A 2G5WA 2WKLA 1GVOA 1UQYA 3D47A 3NQ8A 3AHVA 5HULA 2CLPA 3HB9A 4CNSA 4L6HA 4NQ1A 3N29A 1TJ0A 3L4TA 2PFHA 1OADA 1XPGA 3QR0A 3PNUA 5CSRA 4O16A 1K70A 5I00A 3WBAA 3U48A 4CN4A 1NFGA 3G2GA 3M0JA 3CM4A 2PDLA 2X1TA 3UVAA 2VRQA 1B9ZA 4EF8A 4IGSA 2D0FA 1XYZA 3STPA 3VNZA 2OVLA 2PWVA 4D6CA 3I6RA 2OSWA 1Q4NX 1JF5A 2RDTA 4IFKB 3BSMA 3QMRA 1CECA 3EBVA 3IK2A 3GTFA 4F9JA 1TUFA 1W1YA 2REQB 1HJWA 3QGAC 5HJLA 3W81A 1K8YA 1TFVA 3Q58A 2PGFA 2C16A 3KBMA 7XIMA 1Q13A 3B0XA 1W0MA 3WJWA 1EDQA 2CITA 2WZEA 4V15A 5I09A 1KM0A 1DBTA 1DV7A 3NPXA 1FFQA 2CLLA 2POTA 4RDWA 1TMLA 2P10A 2F61A 3IUDA 3PS7A 4KRZA 3WUGA 2H3BA 3T40A 4DYKA 3MTWA 1SZEA 5D9OA 1WOAA 3ZVHB 3E96A 1FY6A 3UG4A 4ZGYA 3HN3A 1R38A 4FNQA 2VL4A 4FXRA 3GNPA 2PU0A 1ZENA 3N14A 5A6BA 3LGDA 1QDSA 3B9EA 3CH0A 4R33A 2H8ZA 3P7YA 2AL1A 2QUUA 3STCA 3AC0A 3UZXA 4IGNA 2UY4A 2YGYA 5MKGA 3LPFA 1W1A1 1K9TA 4XAPA 3QLLA 4E5TA 2E1WA 1GTHA 3R0KA 2R24A 4D8ZA 3D0CA 3OLEA 1FXPA 2Z2UA 2PDMA 3LCXA 2XVNA 1QW9A 2CERA 2PTYA 1RZMA 5IDZA 4O1CA 4DJDA 2FJUB 4QX4A 2A3HA 1ISVA 3PWGA 2J8FA 1US2A 3H12A 2YYUA 4H9TA 5D9NA 1TQXA 2I1OA 4FXSA 4CN1A 4DJEC 4ERGA 1W3NA 3SCVA 1RA5A 5HAOA 3CZEA 4GVGA 1OM0A 4GCXA 3WFAA 5KMYA 3CHVA 3DERA 1JZ2A 1Q6CA 4LFYA 4XD4A 3G1FA 4IF2A 3H4GA 3DFOA 5DO8A 4GO8A 4K1WA 5CPTA 4HZMA 1EHAA 1V3JA 1R3TA 4JFSA 4OGZA 1TWSA 4I9JA 3PPGA 4DZIA 2J74A 4P8XA 3QGKC 4UFIA 1OFEA 4CNOA 3MI2A 4GI8A 2CLMA 2Y63A 1AW5A 3T0BA 3BWWA 4LXFA 1GZGA 1XIMA 3GZAA 1H1ZA 1J0KA 4N4QA 4Y9MA 2EF9A 4A3QA 3MQTA 1Q66A 4M1RA 1BQGA 1NF7A 1OX5A 3EX1A 1J01A 5FKYA 3L68A 2FDSA 2ZRZA 3TW9A 3U2EA 5I7GA 4R7OA 3TAKA 3XIMA 1EJTC 3B04A 1LLZA 3C8FA 2XGZA 4IJCA 4L1GA 5BU9A 3GFYA 4XSMA 2BGSA 4LANA 3CV2A 1M1BA 3A9BA 4IPPA 2ZA3A 3L65A 4OKDA 4JIIX 3T42A 4MJ4A 1BYCA 3G18A 4F66A 3AOFA 2OKOA 3WENA 4EPBC 3QKZA 2QLYA 1C92A 1GHSA 5F2IA 1IXOA 4O0ZA 4X0VA 3I3DA 5IFPA 4BZYA 2R82A 3PZ9A 5K9DA 5C9WA 1V6VA 3GB6A 4ZL1A 3AU6A 3ZXWA 1DTNA 3KEHA 1Q6FA 5BZAA 1GG0A 1TV2A 1Q6EA 4AVFA 2BGNE 5G1MA 4O8RA 1YDNA 3FHAA 5KINA 4QHRA 2GZXA 4KCTA 2XIMA 4LAZA 1X6NA 3BZJA 5EB8A 3EWUA 1S5WA 1NEYA 2A3AA 2PI6A 2FH8A 2X0HA 3GFZA 4YWIA 4BWLA 5XIAA 2P0IA 4H01A 4OECA 4F2BA 3G1RA 3F2BA 1JPHA 1G4SA 2ZVRA 4RNIA 4Z42C 1LBLA 1A5BA 4ES4A 3UXIA 3GH4A 2Q6ZA 1ECQA 3MA8A 4A05A 4JTJA 2OEJA 2VD8A 4LNYA 2P8BA 2H9AA 1OCNA 3P61A 3NDOA 3S5ZA 3WSUA 3TQKA 1OCBA 3S3GA 3AUOA 1UWTA 1I6NA 1VEPA 2FKPA 3OQEA 4LTSA 2X7VA 3I65A 2XIJA 4MYAA 4R9OA 4EF9A 1R2RA 2CETA 4ZOEA 4JHMA 4V1YA 4JQ2A 3UR5A 1NY1A 4A8NA 3GHTA 4H9XA 4XUGA 4EXAA 3RM9A 4CLMA 2PRLA 3BDKA 5I3HA 1VFUA 2R9RA 3M5XA 4EAMA 3TYBA 1KFKA 3OB8A 4HU8A 5AC4A 3VTRA 1HVXA 2PSNA 4JAWA 3B3DA 4U31A 4HZ7A 5AHMA 4D1JA 5CBBA 4ACZA 1OD8A 3DAQA 1JZ8A 1DJGA 1W1IE 2BVDA 4N9DA 1CGUA 4ALDA 1DPMA 4L80A 2X1IA 2CZDA 2E6AA 4ML9A 3LBMA 4JD4A 4D6HA 5C55A 2XWDA 3WLSA 3OLGA 1V79A 2BTMA 4MWAE 3RX3A 2VDHA 5IDIA 1H5YA 4GPNA 4KT2A 1ITQA 1KTCA 1E9YB 3PJWA 3TU9A 4GI6A 2V8ZA 4KH2A 4EPEC 1OC5A 3IANA 1YDVA 3MJYA 4JTQA 1LL4A 5H8UA 2YB4A 1RXOB 1KGXA 3RHGA 4X22A 3PPFA 4W86A 2G4FA 4JCLA 3KS6A 4M51A 1WOBA 4AY8A 1D7KA 4R3UA 4O0KA 4JQ1A 5DN1A 1K6AA 3AHXA 1E3ZA 5M1TA 3E12A 4C6IA 4C7FA 3BV7A 4GY7A 1XWYA 3TMQA 1F7BA 3F03K 1TR9A 3VI2A 3CQHA 3VK5A 1XF0A 4MVAA 4NJHA 4AWTA 4HSNA 3G1HA 1QNRA 3DGRA 4MWAB 1M6JA 3FDGA 1J93A 4M5PA 1BGGA 3ABOA 1XLCA 5HJYA 1FDYA 2VC6A 2V5DA 4JIRA 4KGLA 4S3EA 1FWEC 1RP9A 3T55A 4O1BA 2E4TA 1GONA 4MNKA 3ATYA 4LUYA 3FXYA 2BOFX 5FACA 1XLFA 3O7UA 1DJHA 1VH7A 1IWBA 3GXPA 2VC5A 5EBUA 1VFHA 2OYKA 2Y5SA 3FEMA 5ECVA 5MF5A 1E1EA 4GXPA 1GEQA 4QE5A 4ZQOA 1JUEA 2RJGA 4L9ZA 1V77A 1GG1A 1BG4A 4BCEA 1PX4A 1EB3A 2E3ZA 4DJED 1G4PA 4WCJA 5DELA 4XBKA 4M3PA 4WXZA 2ZXBA 3NZRA 1D9EA 5D2TA 4ZSTA 1P0KA 3INPA 1VJZA 2A7NA 3BAJA 2Z1VA 4QG6A 3VGFA 3H7VA 4BHYA 2PGEA 4GG9A 2IPFA 3C0JA 5I0DA 3TOYA 3LHUA 1SYTA 9RUBA 3RF9A 1JPDX 4LT9A 2W91A 1MUCA 3BLPX 2NXIA 1IV8A 3E1F1 1DE6A 1XRTA 2TAAA 4KIRA 3GTNA 4D8AA 3PNZA 1ME7A 1QCWA 4CQ9A 2SFPA 3ARRA 3UXDA 1UKPA 3VIKA 1W17A 4A21A 4CD5A 3NPVA 3VX1A 4IG2A 5AKQA 2X1UA 5LGZA 4OZOA 1AW2A 2FMOA 4B15A 1SJCA 1YRRA 1QK2A 3MPGA 3U2OA 3V5CA 5D33A 3TKFA 2PRHA 4NHVA 3KCLA 3T2PA 3NQBA 1LOQA 3WK1A 4L1WA 2WCGA 1YDYA 1OCJA 5IFTA 3R4IA 5I06A 3A4WA 3GZ3A 1VS1A 3VO0A 3ARVA 2PDWA 3NPWA 1XIEA 4QG8A 4ZMGA 1WV2A 4KERA 5DANA 3GNXA 2ZZ7A 3MVIA 4FZIA 1GYMA 4US5A 2Z2AA 4K36A 4V33A 4PRTA 3JVAA 4G1NA 3UW6A 5K7JA 5F7UA 3OVGA 5CZKA 3TCSA 3POHA 3AJ7A 4B90A 2X09A 4WZHA 4RK8A 3TYCA 1X98A 1FQ0A 1JUBA 3VD9A 1PTAA 4F0SA 1UP0A 1TVLA 3QQ0A 2GVLA 4O4WA 1IT7A 4PCNA 1XDJA 4K8HA 3PUEA 3NVDA 4D72A 4O1FA 1JXKA 3QZAA 3CMJA 1QW7A 4QAIA 4PB3A 4HMNA 1M04A 3VPLA 2E09A 3URNA 3G77A 1WBHA 1UD3A 3I6EA 4JTUA 4OJYA 4RV8A 1MW3A 5FESA 1T96A 4H2CA 3GM8A 4XZBA 4F0RA 3PZNA 3O1NA 4HPGA 5CKSA 3SR7A 3LENA 1SFLA 4U28A 3HPZA 3H7UA 3SAZA 2G95A 1L6WA 1ZS2A 3REQB 3M16A 2P50A 2O7QA 1NQKA 1DJIA 2QDHA 2ONEA 4UCGA 3B8IA 1YADA 2GK1B 4Y7EA 4O4VA 4KKXA 1TCDA 1ZNNA 4RE2A 2UY2A 1EC8A 3FV9A 1H4PA 4H8NA 1QPKA 3W1XA 4ZFMA 4JTHA 1H7RA 5B7ZA 4PH6A 4PRWA 5BROA 1GHRA 4FLQA 2NV9A 4JDYA 3WD0A 1R3QA 2QAPA 3N19B 1OBAA 2JKPA 2FZBA 2POZA 4FX6M 3K2GA 5HANA 4Q8NA 1F76A 2YXXA 4LVDA 3O6CA 3OYXA 1QRQA 4CNPA 4GH3A 1AZ1A 1E1CB 1O66A 3WZ0E 3MKCA 3KP1A 4YLWA 5DCDA 5C9XA 4I90A 2PWUA 3HF3A 4R9XA 3BE7A 3DHFA 4YVVA 5FD0A 1LLWA 3S2JA 4FB7A 2ZUTA 3Q4DA 5CZSA 1UZHA 4PUJA 5FJOA 5HMFA 2HQAA 4AF0B 1AL7A 2PZNA 4KBXA 4PMQA 1TMHA 2JBMA 1ITCA 3CUZA 5KSWA 5K2ZA 4R7WA 3HFYA 4LEQA 3MMDA 1PTGA 3LNMA 1US0A 3PZOA 2AMXA 5FIPA 4AZCA 3VCRA 4AZ5A 4INFA 1F6YA 4MUPA 4YU1A 4UNIA 1P5BA 2ZRUA 3K8KA 1TELA 5L6UA 2E5BA 1OGBA 4TVCA 5J04A 4DXKA 2YW3A 3RIKA 4ZFCA 1XLAA 4IH3A 5HNTA 3A4XA 3ZLFA 3HA1A 2I57A 1ONRA 4H7CA 2D1ZA 3WNKA 4V1XA 4MPQA 3L4ZA 1GKPA 3TYEA 1LBMA 2Y5EA 4XKMA 4LQ1A 4Y2WA 3W1NA 2BSLA 1IT8A 2QXWA 4O10A 1CXIA 1BXBA 3HV9A 4WK9A 2Y24A 1DIOA 3AXKA 3PBUA 3ZWTA 4PA8A 3O0FA 1B0IA 5IXEA 4XG1A 3W37A 1R2SA 1AODA 1JULA 1XISA 2DY3A 2OO6A 2VVSA 2ZICA 3AROA 1EYEA 1FCUA 5FSDC 3DI0A 4XSLA 4JX4A 3TMLA 1KA9F 5KEZA 1FWCC 2XGBA 4X9SA 2VGBA 3R5EA 4HK6A 4UQDA 3KDNA 2QEZA 5G4HC 1KRCC 3O6DA 4PTDA 2GQ3A 2DZBA 1M3UA 4PBFA 5C0QA 4C1NB 1G6CA 3WH5A 2NW0A 3MV11 2O7SA 2YLLA 3BH4A 4HU0A 3RFAA 1V8EA 3LCIA 2ZX9A 2HDJA 1SR0A 1E5NA 2PTWA 2CPUA 1DQWA 2VEGA 1L9WA 4FX8A 4ZB0A 1Z41A 4FHAA 2CESA 2A3CA 3IVTA 4ICNA 3MV01 1BYAA 3F4VA 4TV6A 4DEFA 3W4RA 3CIVA 1ZFJA 2XVPA 1J0YA 1B5TA 2HE8A 2I56A 3KWSA 4KEVA 5M5DA 1YBQB 1XLHA 2O0TA 2IXUA 1LTDA 1H1NA 3I4EA 1ZJBA 4GOAA 1IEWA 2QGYA 1Q6QA 5DQPA 3H4WA 2XIQA 4Y6GA 3ABZA 2V5LA 3CEPA 1RCQA 3FAXA 4JX6A 3W7QA 3AMKA 2PTDA 1VHNA 3HZ3A 3NQ6A 5LXXA 5E70A 4S3AA 1UR9A 2X0SA 4PEKA 4DHGA 3ZZ1A 4O18A 1M7JA 4QNEA 3K1DA 3S46A 4U3AA 1AK5A 1WKDA 2C1IA 3N2TA 3FVDA 3BK0A 3EDEA 2I16A 5FF7A 5IRPA 3TIMA 4GJ1A 3NQAA 5FOOA 2C7FA 2VOTA 2MANA 3T8LA 3DHDA 4UR8A 1R3VA 4NASA 2WVVA 2DZWA 1ZY9A 2GQ8A 1TX0A 1EPVA 1EGMA 1S2WA 3AWNA 1IQ8A 3NXLA 2WSPA 4PMXA 1L8PA 4LS1A 2J9XA 4JNMA 5BXPA 1XUUA 2GQAA 4GC4A 3HPFA 2EHHA 3IPWA 4G7FA 4F40A 2QCCA 1JQXA 4WRHA 3L5LA 4S3KA 2GOKA 5H8PA 4IM4A 3F1QA 1NH6A 1KD0A 2WCSA 4ZTYA 2IKJA 7TAAA 3SN4A 5TAOA 1B3OA 3ZR6A 1XIGA 3K4AA 3O07A 1R9ZA 1JJKA 3SBFA 2V38A 2CHRA 4Q4SA 3MCMA 2WC7A 3VNLA 3XISA 1BD0A 2BHYA 2QMJA 1GVQA 1XH1A 3RCMA 3IIPA 4F0HA 1MQQA 1LRTA 3GW3A 3TN3A 3C2FA 2VFDA 1FCBA 1FWJC 4KRUA 1M01A 1I1WA 2C19A 5FF3A 5HUPA 2GGGA 3W27A 1EYWA 3W0KA 3IACA 4XTIA 2PF8A 1YIXA 3BURA 4DLMA 5HDRA 2QW5A 3W1RA 3ARQA 4J40A 2CW6A 1UJPA 2OO0A 2VXNA 1ISYA 2PDJA 3TTOA 3KS5A 4MKNA 1FWAC 1VFMA 5JBFA 3S83A 1WXYA 5AN7A 3RX2A 4DWDA 3R8GA 3RRXA 1A5OC 2BY1A 4IIEA 4Z1BA 2DH2A 1D7FA 2V30A 2D73A 2AGKA 1ZCCA 4FO4A 5FI8A 2VGGA 2DH3A 5T9CE 4AD0A 4HMDA 5A6SA 3E0WA 3THQA 5FCZA 3LUTA 2G4JA 4NRSA 2YBVA 3VGEA 3M0VA 4M7SA 3TJXA 2Y7DA 1GJUA 2WM1A 3N2XA 1PKLA 1SW0A 3S1UA 4J2MA 4O19A 1UYQA 5MKGB 1BVZA 4NY2A 4IX0A 4ZB5A 3SUWA 4U5IA 5CZJA 1ML1A 3STFA 2DVTA 2OWXA 3S1XA 2ATMA 3BV4A 2QKFA 2WNWA 1CT5A 1ZAHA 5JIPA 1W37A 1JRCA 4DWSD 7ODCA 1E0TA 3B05A 3SCUA 2V82A 3ABQA 3RCNA 1CW2A 2GJLA 5BOOA 3BLFA 3E0IA 4EXQA 4OQVA 5FEZA 2AKMA 5CQ1A 4B3ZA 3BOFA 3QH2A 2O9TA 4HP5A 1GW1A 4X9YA 5KETA 2ICSA 3QJAA 4RDVA 1AL8A 3WLJA 3VGGA 2YIHA 2OGYA 3ONBA 1WDDA 2JIWA 4QAWA 3N2CA 2BBFA 2OT0A 1A5LC 2WJZA 4XKYA 2PLKA 1XI3A 4UXDA 4D2JA 4UTUA 4UQEA 3TSMA 3QY7A 4KCVA 3PTDA 3PF3A 4J3TA 4YCOA 1HKWA 4RCXA 2Z24A 3C5QA 2WC4A 3DYMA 4UNKA 2EG7A 1G67A 2KZHA 4IUOA 4YNGA 3N17A 4LVFA 3O16A 3G3MA 3H7RA 2XSAA 3WQOA 1B57A 3H21A 4PCTA 4Z1AA 3NL2A 2CEQA 2EEXA 1IEQA 2Y6ZA 3OQ8A 2OKTA 2QR6A 2NQHA 1R3YA 1B3XA 1GJPA 4MM1A 2RDXA 5E6YA 3RN6A 4UTHA 2X16A 3VC5A 1XS2A 3E2RA 3WQEA 3C3UA 3W86A 1VYPX 3GDBA 2PGRA 3DYOA 3M1ZA 3ERPA 2Y2WA 4FOJA 4S23A 1CXKA 1VIZA 4UOJA 3PZVA 1EO7A 3R6IA 4LCRA 5CH9A 4Z2GA 1VGAA 4H41A 1SSGA 4J3ZA 4CU7A 4GKLA 1PE1A 2WHLA 1J0ZA 4BJHA 3KRUA 1KC7A 4RZ6A 1KGUA 2WNZA 3TLQA 1MXDA 4HNVA 2WAGA 4DBWA 5FJUA 3C2VA 3VINA 3ITXA 5EKYA 2NLIA 4HGXA 1PX8A 2PDBA 1CGVA 3EOSA 2XHYA 3FFSA 4FK9A 4JN6A 3TXZA 2AAAA 3AJXA 3P93A 5CJNA 3TQPA 4MZYA 3IIVA 4X3ZA 1DJXA 4ORMA 1O5KA 1XLIA 3NNTA 1E43A 1FFRA 2C71A 3QYQA 2OT1A 1EGZA 3GVGA 1JYXA 1R9XA 2UY5A 1I9CB 3GHRA 3CASA 4LU0A 4P7LA 3RNDA 5LXEA 3O8AA 4KRTA 4CEXC 6CGTA 3T1GA 1TPB1 5CAKA 3W2LA 4DF0A 3QXBA 3KOXA 2BOGX 1WZLA 2J6VA 4BY3A 2IPWA 4S3BA 3W7HA 2NQJA 1D2KA 4D6JA 4B4FA 4BR1A 2PWEA 2H9AB 2XN2A 3SCRA 4LS0A 3A4JA 1RCOB 1TTIA 4J3UA 5LYRA 5FF2A 1S3TC 2PC8A 1RA0A 4A3RA 3ZT5A 1CIUA 4GACA 5GNXA 4MHBA 2HBVA 3SCSA 3ANYA 1HJXA 3LCLA 2YSWA 1IR2A 2QCEA 1JGMA 5LHEA 1V08A 2DQXA 4FNPA 3GDRA 3NEVA 2AQVA 3LEPA 3EA1A 3UWUA 4XD6A 3AZSA 4AWEA 9XIAA 4DJFC 1HO1A 2AQWA 4LW7A 1O1HA 1Q3NA 4BQ2A 2XSXA 5H2ZA 4ZR8A 3VOHA 1LRQA 4ACZB 3DXIA 4EWJA 3WK0A 3WCZA 1KLZA 1XFCA 2INZA 3H23A 4HPXA 5CXPA 2OYLA 3FLUA 2W61A 3RPDA 4X63A 3VZXA 1QI4A 1W9XA 5CG7A 3GAKA 4YXGA 1WQ5A 3KCJA 1BKSA 3IIXA 3F5JA 4DZ5A 3K8MA 2J75A 4JTEA 2YDAA 2GJRA 3UVIA 2V0TA 2NVDA 1DJNA 2QJNA 1LCOA 1SSDA 3E2SA 1PWLA 3DFSA 3WQPA 3QBUA 3ENLA 3WDPP 2CFFA 1UUOA 2QUVA 2QCFA 2XH4A 2UBPC 3OGVA 1A0DA 3UYIA 3Q65A 4HPHA 2ALRA 5D4YA 3BAYA 4ATWA 4GE8A 1TTQA 1J4EA 1P6BA 3GXMA 1QO5A 1W3TA 3I4KA 4ADUA 3CHFA 3M0KA 1D8WA 5DCEA 2VZOA 3WH9A 3VD3A 4JL1A 1QK0A 5TQLA 2F6XA 3SY5A 1V6YA 3HMCA 4AD3A 1RPXA 1XG4A 2CWXA 4PYSA 4QR6A 1TA3A 3EWYA 4LUSA 3BL3A 5LKYA 1UP3A 1TTPA 1A4MA 3NO1A 2W79A 4B2DD 3TTYA 1JCXA 2BNJA 3GY1A 4PL2A 3TNOA 1JNDA 1V6WA 4NJIA 1GEHA 2J6XA 2E67A 1BXNA 4XZHA 1EF2A 4ZBCA 4C6LA 1CENA 2FHCA 3GFXA 4HA4A 3EX2A 5CLTA 4WKHA 3L4WA 1Q8JA 2IKGA 3O3RA 3C61A 1JI1A 4N02A 2EJ1A 1M7PA 1Q63A 3QKEA 4NKCA 1DWFM 3M07A 5LNRA 2VX4A 3IUIA 3LLDA 3LPGA 2X41A 1VF8A 1EP2A 1OIFA 1E4LA 3G6LA 4JTLA 2H90A 3KDOA 1KBIA 2VKZG 2QJIA 4WSJA 3L9CA 1UP2A 2P76A 5LHFA 3B4YA 3UZWA 3UCCA 2X2YA 4JTGA 2CHOA 4PMUA 4A3YA 2C8NA 1XBXA 2QPUA 4ZOCA 1EUAA 2YA2A 1V6TA 4IPIA 3KL5A 2FTPA 3HTWA 3LXBA 5TF0A 2F2HA 5KTLA 2DZUA 4QDWA 1JYVA 3EKZA 5AFDA 3TP4A 3BLLA 1K77A 4LVBA 1FWTA 4QXIA 2Z00A 4ATLA 2WHJA 4IG2B 4XD5A 5A8NA 4FI4A 1JDAA 1V51A 1EBGA 4DXXA 2ZVIA 1QPQA 4AIUA 3CL8A 5CC6A 3ITCA 3AFBA 3VU2A 1AFSA 3C8NA 1DJQA 1L6YA 4I8DA 1QI0A 2FJKA 2BHZA 2VGFA 2V2DA 1MXSA 1KR0A 4UCFA 3FYOA 4S38A 1XLLA 3H2NA 2J88A 4MG4A 5BRBA 3ABSA 2KAUC 3APTA 3UZZA 4IMFA 4LB3A 3WD1A 4GFSA 3VIOA 2BY3A 1AMYA 2W4XA 5EY5A 2UWFA 1MFVA 2F6KA 4C5ZA 2WQDA 4OHQA 1ZHAA 1J11A 1J18A 2HSAA 2BVWA 3GX9A 1TREA 3SCNA 3EOLA 3GO2A 2O55A 1H7OA 4YPJA 2EAWA 1UMYA 3B9OA 1BF2A 5LIYX 1IGSA 4J3SA 4WHBA 1BVNP 3D5HA 1VFOA 4O12A 5D9MA 4LS2A 4XZWA 5CGTA 3W82A 3TLLA 1KFCA 5CBJA 1E6QM 3JU2A 1WKFA 1SFTA 2XVLA 3P62A 1XIFA 3AS1A 4Y8EA 2FPVA 1SMAA 3RPTA 3QTPA 3GRIA 2IKIA 1ONEA 1QI5A 5BYWA 3VUPA 4Z17A 4LJ3A 3NA8A 3LERA 4FLRA 1EPXA 1YE4A 4WX2A 3WLQA 4GY1A 3Q37A 5C2GA 4B5VA 3B8UA 1UPPA 2DT0A 3KLKA 4CQ8A 2ZUNA 3UJSA 5I6SA 3WH6A 1K7EA 1E40A 3VM7A 4N6FA 4LUJA 5AYXA 5EMJA 1VPYA 4GBUA 3EWWA 2F6UA 2XFFA 5I3KA 3WQCA 1JCNA 4YL2A 5I78A 4LF2A 3IGHX 3R1ZA 2PDUA 4DJFD 2WJFA 2V2HA 4DZHA 3PBWA 3QSRA 3FAWA 2ZBTA 2GSHA 3U0HA 4EOUA 3BLKA 5A8QA 3NGJA 1FWWA 1YDOA 3DKLA 3NQVA 1YXYA 4YS1A 1GZJA 3HU7A 4CCCA 4TU1A 3MZNA 4L4LA 3QZ6A 2DSUA 5I2UA 1WNOA 3WY1A 3TXVA 3ONCA 4TTGA 4JN7A 2JK2A 2BDQA 3EDKA 1EUNA 2QULA 1H3GA 1R8LA 1KRAC 4H1ZA 4IFOA 3R58A 2XFRA 2EGZA 3C52A 1H1YA 3R10A 1NOUA 1VBGA 1BFNA 3RMJA 3BJSA 4M6UA 4JYEA 1OFOA 1HJVA 1WKEA 1B4EA 2OFJA 3LGEA 1HKKA 1ZTVA 5CSSA 2JIEA 3C0LA 4GJIA 3MB9A 4C6KA 1HP4A 1ZJHA 2J8TA 3S2NA 3HGOA 2A79A 3BG3A 1AJ2A 1XYBA 2VI0A 5LIUX 3AXHA 2TSYA 3KFTA 1NM9A 4R85A 3W7LA 4PMVA 1KFJA 2Q02A 2FDMA 4C60A 3B40A 1R5YA 3LYEA 1FBAA 2AMGA 2P5NA 2R1MA 4AZCB 2MNRA 4P7OA 1YPFA 4QJ4B 3OLIA 1VFTA 3QEZA 3M5YA 2OQLA 1V3HA 3GBDA 2QDEA 2A7PA 5FAGA 2OX4A 3UY7A 2VX6A 1V3IA 4NYYA 1JDEA 3T4CA 4KF1A 3H22A 2RH9A 2JF7A 3CAKA 3SSJA 1XBVA 4KWUA 1TPC1 1EJ7L 4OV4A 4E8DA 5LNWA 3EEGA 4TX8A 3RX4A 3CL7A 5REQA 1UBPC 3EMCA 1FHVA 4LVAA 1TE1A 4C1LA 3COTA 2ZZ5A 1BWKA 1TRIA 3VKDA 4O1EA 4LALA 2PTXA 3DU0A 1LUCA 1OK6A 2NX3A 1TMQA 5H6HA 1WB0A 1T7LA 1H60A 1CB7B 3DC8A 3M7SA 3E3HA 3IVUA 2CC0A 1SR9A 1TE6A 4WDWA 4MJ2A 3W07A 2R14A 2VQTA 3VKKA 4TTUA 5HQEA 5FJJA 2VMFA 4Q8WA 4GH1A 2NVCA 3QV9A 3ARSA 3PUDA 3TYDA 3WF0A 1TV7A 2VUYA 1E1FA 3UD6A 4S39A 4A6GA 4MSSA 2JGYA 2OU4A 3P0WA 3MKVA 3LV5A 3ZT6A 3EMZA 2J7CA 3U6WA 3WFLA 1TPVA 1ONWA 4N9BA 3CPRA 3LG3A 1R46A 3GLCA 4Z0JA 3NURA 1W3LA 1E4MM 2WWCA 3QV8A 4RXGA 4S3FA 1FP8A 4AB4A 4IMGA 3LZ3A 3CTTA 5JQ9A 3KZSA 1DVJA 2VC9A 3WEZA 3RO8A 1SPQA 3UNTA 4IP4A 1I2NA 1YPXA 1UWSA 1OFBA 3W70A 2VRJA 3F2CA 3F4NA 3RXZA 3ECQA 3OBKA 4IL2A 3V18A 3P6LA 1H7XA 1PVNA 2OGJA 2B7QA 1XC4A 3T0DA 4U5KA 4Q7BA 4GINA 3OVPA 3PM6A 2J62A 3IJ6A 1IIGA 3PBYA 1IZCA 1J96A 1ADOA 3W22A 2G50A 1UWIA 1Q5MA 3P67A 3GQYA 5CG0A 3UWYA 3VA8A 3BAKA 1HN1A 4XZMX 3QY8A 3UXAA 2BVYA 5EGRA 3L0KA 4HMEA 3GBEA 4KFNA 1R7OA 3L4UA 2WANA 3AIVA 2ZUMA 3A6OA 3MP4A 1A4LA 2EJAA 1A5KC 4K8EA 4QJ5B 2A0NA 1SVDA 2YA1A 2BZNA 2PP1A 4Z2LA 4UTMA 1UA3A 5I5RA 2QT3A 2XM2A 2DJXA 1Q7QA 3MSGA 1ELSA 1JQVA 2ZRWA 1F4AA 3P2VA 1JD7A 2RKXA 1FKWA 4KWOA 3W01A 2WVVB 1O68A 1JAKA 1PYFA 4JTRA 4QG9A 2CLEA 2VEKA 2WB5A 1FCQA 1I75A 2YA0A 3WLHA 3WQDA 4Q6JA 1LP6A 2CXGA 3KRZA 3FNDA 4EVZA 8XIMA 3C2YA 3BQ5A 4REQA 3T07A 1G94A 3T9PA 1O60A 2HK0A 4H00A 5FJPA 1JI2A 1JGIA 3KOFA 1E72M 3W25A 1BAGA 1F05A 2G3IA 2CBUA 3FA3A 2ZTJA 4LYKA 1DQUA 2FYMA 2VX7A 3L4VA 4C6PA 3STEA 2QV5A 1EJWC 3VE7A 3GTIA 4Y9AA 3FYYA 5HMDA 2VVNA 3KAOA 2OODA 1G0CA 1LLOA 3DOPA 4J5NA 4WOQA 2H8XA 1UOKA 1T0OA 3M9YA 3UEQA 4BS0A 1PXGA 5J8LA 3W1QA 3QHMA 3P80A 3PZIA 1LOSA 1QPRA 2X30A 2RDUA 4XD3A 1Y5WA 1UZ4A 3L66A 1OINA 4W89A 4Q3MA 3KVLA 1BQCA 4UZUA 4OUIA 5HR6A 2VYOA 2GGHA 3VDHA 1KBJA 1TWWA 3TV8A 4NZFA 3MUAA 5DXXA 3CIWA 3W53A 2CLFA 3FJLA 1EIBA 2NLYA 1LL6A 3FJ4A 4AD4A 1OF8A 1C8XA 3U7VA 2PWHA 2ABAA 2E9LA 1S5VA 4IQLA 1QAPA 3WMLA 4PE8A 3HPXA 4JIQA 1Y5VA 3LTPA 3AYVA 1R2TA 1RQEA 1Y8BA 3A5FA 1K03A 3W7EA 1EXBA 3VVGA 3OLDA 4UTTA 3KVJA 1XG3A 4H8HA 4EANA 4GUGA 4HOZA 2A85A 3CHEA 3ITVA 3PN8A 1WA3A 1ICPA 1TVPA 5HK4A 1RY0A 1CI1A 4JDBA 3S1WA 2PLCA 2BASA 3OEXA 5D2XA 4GD0A 1TIMA 4ZO8A 3UWWA 2F7FA 4QLJA 5IBXA 1F73A 3BCJA 3CGTA 4M6QA 3OVRA 2FLIA 4RE0A 1S46A 2AGTA 4ROQA 1XJBA 4UTLA 4Q4QA 2XN0A 1CXFA 3AMGA 1ADSA 1KV8A 1ZSXA 1NOFA 3QRHA 3AIQA 1V6XA 2VEIA 2CKRA 2CZVA 1A5MC 2O56A 5DEZA 3E49A 1GW9A 1XLBA 3ISIX 2HISA 3OZPA 1FOBA 1AG1O 2JF6A 1NSJA 1MWOA 4ZENA 4DO6A 1XPYA 5EMYA 1MUWA 1TV5A 4XKYB 4UTWC 2WOQA 4P8WA 4I7WA 4C90A 3OG2A 3LCGA 4PSRA 3ZFHA 1T99A 1LQAA 4D6DA 2C79A 4PTMA 5E1QA 4W88A 5CEWA 1B3YA 3DESA 4KMQA 1XYMA 1IE7C 2CIPA 4NSBA 3LMZA 4K6AA 1E71M 5DMNA 2HXTA 3QQWA 3ZR5A 5BXTA 2WMKA 4O15A 4LVGA 2OMAA 3QR1A 3SY8A 3V4BA 3N4FA 3LHWA 3S6TA 1XLJA 3APGA 1O94A 2GUUA 5XIMA 4CQAA 3IJIA 1A0CA 2OPJA 1EZWA 6TIMA 4IJBA 2IPJA 3NWRA 4O14A 4PMYA 1Z32X 2NWRA 2D69A 1BYDA 5DBTA 3DFNA 3OBAA 1UC4A 4D6FA 2PDXA 3TJLA 5I3FA 4PB4A 3W88A 4C6FA 1XDMA 1AQ0A 4ROPA 2FFCA 4D9PA 4O52A 2XINA 5CSYA 3GUGA 4K39A 1GVYA 4HHLA 3TSDA 3NQMA 2VFGA 3VGBA 4AEEA 5C9ZA 3N15A 3UJFA 3UGVA 2QV4A 1E9LA 4ENLA 2DPEA 1H7NA 1QPNA 1XH0A 1RJPA 3TW7A 3GD6A 3ID7A 3Q67A 1XBYA 2D3NA 2VEMA 5E0FA 4B3KA 3RU8X 3QW4B 4JIEA 3FA4A 4IIDA 3W85A 3W2JA 3W6MA 1XFBA 1J0JA 4RLIA 5E93A 4L65A 4MAVA 4GZEA 4X2PA 4JCMA 1S2TA 3KUMA 3RUBL 3NQGA 4W87A 5HOSA 3R79A 1TWZA 2C3ZA 4PTWA 3BVJA 3KCOA 1LL7A 3VIGA 5D8WA 2OZ3A 1Q2SA 1JPKA 3P82A 3RMEA 3R12A 3GXIA 4ICCX 3E0VA 2I17A 1XBZA 1PV8A 1PZ0A 3V7PA 4JTKA 2ACRA 1UCWA 1CXHA 3FGCA 4YJ5A 2YDRA 2DIEA 3HGRA 5A6JA 1ZBVA 3M6DA 4IX2A 1UWAA 1P48A 1JF6A 1K02A 1WDRA 3ELFA 2V67A 2GSEA 4M7TA 4E8CA 3H55A 5J5RA 3QW3A 2PAJA 4HBKA 1A47A 1OC6A 3PPCA 3CMFA 3IAQA 4ZQMA 3TYUA 4IP7A 3GXTA 3W73A 4PR4A 4LV4A 2W66A 4AAJA 4I3GA 2IMRA 3BC9A 2H3DA 3SM0A 5AYBA 2HTMA 2XH2A 2CWNA 4FNUA 1S1RA 4MWAD 4UFJA 5BRQA 3MDUA 1S3HA 3N13A 1TVNA 1O12A 5C71A 1EWDA 2B7PA 4AZGA 4PC8A 3QZEA 3PUOA 4E4UA 3GG8A 2ZZ3A 3B9NA 3AAMA 1Y5XA 2VCBA 5TD4A 1NWSA 1N82A 3DFHA 2WSKA 2PDFA 4GIYA 1V3LA 3L7RA 1F3XA 4HZ6A 3PAOA 1JYNA 1KKRA 2J7BA 1S2CA 1H63A 3V3WA 3FJNA 2R1PA 3HJZA 2QZRA 4MIMA 1W8SA 3G0XA 1YYAA 4HVXA 1K6WA 1K1DA 1Q6RA 2J24A 2PWGA 4JGDA 4ZXOA 1KXHA 4OE7A 1E15A 2V3DA 1V5XA 1VFFA 1HJSA 1V4YA 4PZVA 3AMDA 5HWNA 3NVTA 1W1B1 1CPUA 3GU9A 3TC6A 1JCJA 3DFTA 4PMRA 3O9NA 3LV6A 3VIFA 1TCMA 3F7JA 1P4CA 1KFEA 1QHOA 2FGBA 4H7ZA 4Y96A 1R30A 4RPQA 3C2EA 3VAVA 4JFVA 2OXNA 1QWKA 3VKCA 1XRFA 3NQCA 2CLIA 3GWQA 3EB4A 3FSUA 1U5JA 3D3FA 5JU6A 5HMEA 3E2QA 1TA3B 4LUSB 1B1YA 3BAIA 1N8WA 3WNPA 3VC6A 2ZZ2A 1FRBA 3CUIA 4JFTA 3CV7A 3NZPA 3SGGA 1TWIA 1UWQA 2E8YA 1O1ZA 2YL6A 1ODZA 3GU2A 3MY9A 4PUEA 2E6DA 4MNJA 3C2RA 3WD3A 2HXUA 1TJRA 4Q8MA 2EO7A 1N8IA 2WJEA 2NZLA 4IPJA 3WQFA 4MLRA 5CAHA 2H6RA 3OYZA 4KEMA 4MNLA 4F48A 1J79A 1B3WA 4E4FA 3U2CA 1GQLA 1Y7VA 3GNDA 2WXDM 3T2QA 2BV9A 3S5SA 2PTZA 2YBUA 2R6OA 2J8GA 1ZB5A 4KEZA 1ISXA 3TC7A 1GKRA 4MB3A 4A8IA 3MW7A 1DKWA 1MW2A 4Q22A 5JBEA 5LA1A 1MMFA 4BEUA 4HT3A 4M1BA 4YTTA 4HQVA 4HA1A 4C7GA 5DMLA 1X39A 1S38A 1EJUC 4AC1X 1GCYA 5B80A 1G1YA 4J3WA 5M3WA 4WGHA 4AMAA 1TZ9A 3W2UA 3CT2A 4PMDA 3ABXA 4K38A 1GOOA 4IMDA 2DV0A 4NIRA 4F9DA 2OYMA 5H91A 1VJIA 3WDRA 3VIJA 2O9RA 3RR1A 2P1FA 2WPGA 3EDDA 3CQIA 3TAOA 1ZZMA 2X1SA 3LHVA 4CVUA 5H8MA 2EPNA 1HL9A 1VBHA 2E28A 4B5UA 4LCQA 4L9XA 5AHNA 3VNIA 3P81A 3L67A 1XGZA 1EHNA 3VOGA 2QPSA 2XVKA 1OQFA 1LORA 2I5IA 1HT6A 4DYEA 3RITA 1JIBA 3ARYA 3BJTA 3UU0A 2NT1A 5EMLA 3VCCA 3R8RA 4B16A 1ISWA 4FLOA 5BOFA 1UOZA 3H2OA 4U33A 3RGTA 5F2GA 4Y9OA 2VR5A 1V3KA 2YYTA 3SUUA 3DC0A 5MHBA 1AZ2A 2D2OA 3A9IA 1Q7ZA 2BODX 5E09A 3DH7A 4W8BA 2A3LA 4F4RA 5E5CA 4GUFA 3TA9A 3U2ZA 2C13A 2PDHA 2G0WA 3KBSA 2PPGA 3UP8A 4Y9PA 3TROA 4O53A 5BMXA 2BY0A 2VCCA 3BAWA 1DIEA 3WBWA 5KITA 1TX2A 1PHQA 1XIHA 2E25A 2GJNA 3IJQA 4H6EA 1NFBA 3PFMA 4Q33A 1BXCA 1WZAA 3W7OA 2RUSA 3PB2A 1UKOA 4FXFA 1JR1A 1OC7A 1QW8A 2PBOA 4PUKA 3WDHA 3W7RA 3KVKA 2C1GA 2OSXA 3OIHA 1FX6A 4FNTA 2R1NA 1U1JA 3G5EA 3KW3A 1TPUA 4GMEA 1Z8AA 2FGLA 3BSGA 5A5WA 1SGJA 3LHTA 4UFHA 2WZHA 3BCDA 3G1SA 1B31A 4RW5A 1HL2A 1RBAA 2XVGA 1BSIA 1LM1A 1JZ7A 1DHPA 3CNYA 5FL0A 4BQ3A 5G2WA 2XU2A 2G3FA 3C0QA 1X38A 9XIMA 5I3JA 3NJ3A 3GXDA 1A53A 1HXJA 4GYPA 3GU1A 4N7QA 1EEXA 1OFDA 1EX1A 2HWGA 3KBJA 3APYA 3IIOA 3NSMA 2OQYA 3R13A 4FOUA 3S42A 2W67A 1OYCA 2FZMA 1BRLA 4J3XA 1QUMA 2O9OA 4QEHA 4ZB2A 2X0YA 4XTDA 3AIRA 4GFIA 4WJEA 1A5NC 4PUNA 3GH7A 3NYDA 3TWAA 3RM4A 3UPBA 2B81A 1GT8A 1NAL1 3WO8A 3OIXA 4GISA 4ZO9A 1IWPA 3MYPA 3TNBA 2DZVA 2OWWA 4BF9A 2ZX5A 4O8AA 3VDBA 4MY9A 4Y9NA 2WSYA 3CUGA 5DXYA 3NSNA 3AIBA 4HNCA 5JUVA 3PBMA 3JW7A 1I1XA 3C3NA 4NVTA 4IWWA 4AD5A 5HPOA 1NWUA 1DXEA 2DUXA 2J47A 5T26A 3ZLHA 4ZODA 1GYLA 3ZO9A 1VYRA 4PGLA 2F84A 1UIOA 2FMNA 3MDWA 1TWDA 4KFOA 4IMCA 4ICMA 3UCQA 1VPQA 3DX5A 2WLYA 4M29A 3TUUA 1HNYA 5F4SA 3B97A 4E2OA 5CC7A 1I4NA 1IIHA 3W24A 2ZUSA 1A5CA 3CYVA 1CGWA 1QPOA 8XIAA 1M68A 2J9ZA 3CUFA 3BMVA 1MO0A 3W74A 3KLLA 1XCFA 4YYCA 1ZAIA 1EBHA 4GWEA 4JTIA 5FL1A 5I02A 4W5UA 1GVEA 1Z69A 1HFBA 4TO8A 2BVTA 4JQAA 1Q6GA 2PC4A 5HWJA 5RUBA 1W3HA 2GGEA 3WL0A 5HA7A 3NG3A 1WUFA 1XUZA 2WNQA 4UB9A 1UJQA 1E55A 4RE4A 4UFMA 2BHUA 2VFIA 1U33A 4QBXA 3IRSA 2ZUWA 5CPLA 3DG3A 2OLSA 1T40A 2ZFAA 1NARA 4FMVA 1XICA 2PZ0A 3B8SA 1I60A 2ODOA 4EIVA 1EEPA 3PB0A 5REQB 5AZ0A 1SZRA 3QF0A 2YFOA 3GNOA 4R34A 1LUCB 3L21A 3H6OA 4EXBA 2YZ5A 1YNQA 3ATZA 3LCHA 5G5IA 5A6TC 1TPFA 4WJXA 3N3TA 3S5YA 4K37A 2ZRYA 3EZ4A 2WMIA 2GUYA 2XDFA 2GL5A 4W8LA 2ZYFA 5I3DA 3SCPA 1VCFA 1LT7A 1ME9A 1TB3A 2XYLA 1KRBC 4N4PA 2X8RA 3DDMA 4L7ZA 4HCHA 3TOPA 3BG5A 3F2DA 1IYXA 5JBDA 1E4IA 3TONA 2MUCA 2WC3A 5PTDA 1M53A 3DUGA 4WLCA 3VCNA 1XGDA 4YTUA 1WXJA 1TIWA 4HOWA 1LWIA 2Y61A 4KWSA 3TDFA 4NP7A 3BW3A 3Q2DA 5F4XA 5HNRA 2AQOA 2DU2A 4WDUA 4IPNB 3U7BA 3CU2A 1ADDA 1J9YA 2OEKA 1UIPA 5DBUA 4GK8A 4A8RA 1T8XA 1YQ2A 3LX9A 3NR0A 4RPPA 3OA5A 3MZ2A 3M4HA 4KESA 3HOJA 2BXYA 5F4WA 4MDOA 4W5ZA 4OBTA 4I5XA 4J2PA 4TMBA 4PULA 2YXGA 1I0DA 1UZ1A 5LZLA 4GRSA 4GVIA 1ZP4A 3TN6A 4AQLA 1YX1A 1MYRA 4DO7A 1SFSA 5F1VA 3QHOA 2TRSA 4GQQA 5C2CA 1H09A 3M7WA 2BXZA 1K4HA 3IJLA 1Z42A 3USBA 2JALA 4JFWA 4XIAA 2QDGA 4JTCA 4ZOBA 2WMHA 4C7DA 4MF4A 3N1AA 2Z26A 4BA0A 4FS9A 4FLSA 3TFCA 3L4XA 4G6CA 3I6TA 1ENUA 1CTNA 1UPMB 2X7WA 1XSJA 2GJPA 1YXDA 3D3AA 2QUNA 6ENLA 3GNRA 2I9UA 3R94A 2V81A 1S39A 3SGZA 3RLGA 1F3EA 3G6MA 1KRMA 3ME3A 1V93A 4AXKA 1VCGA 1I2OA 5G2IA 2ZXAA 4JXCA 4QP0A 1M7OA 4NT0A 3ANUA 3VIIA 1PKNA 1UUMA 3FYPA 3UPWA 4UOZA 4GZJA 4IIFA 1G5AA 1C8YA 2EPHA 4REQB 3K8LA 4KFPA 5A6BD 3AIWA 4K8GA 1Z9AA 4FX7A 3TX9A 4DIAA 1Y65A 4NXSA 3KM8A 1E4NA 3CT7A 1IGWA 1PZ1A 4HJFA 2DQWA 1VQTA 2PRMA 3B0UX 3OGSA 4PBEA 1GQKA 4RKAA 2KX9A 3LK6A 2YOCA 3PK7A 5A2CA 1J0HA 4MJZA 3H2CA 4DJDD 1TV4A 4ZQCA 1FTXA 2O4MA 1PIIA 4TX9A 3KP0A 3P8JA 1PKMA 5FF4A 2BY2A 2DZAA 4L9YA 3M0YA 3V36A 1IR1A 4IISA 2J79A 4G9PA 3LBCA 5HINA 3ZJKA 1KBLA 3U4AA 4MLJA 4WY0F 1ME8A 1HKMA 1MZHA 3I7SA 4JEQA 4JX5A 4JHZA 4JNZA 4KEUA 1QI3A 1S2VA 3G8EA 3LRKA 4AW7A 4UMBA 5FEWA 4HK5A 2FVMA 4WD0A 2Q3OA 3FX4A 3UR2A 3T44A 1F8MA 2VM8A 1BTMA 4JEJA 4RNHA 5BRPA 2WZMA 3U9IA 3KOYA 1TPEA 4OVXA 4CD6A 1EJRC 4NJGA 2QPXA 3NZ1A 3E5PA 1YKWA 3V5FA 3ZS4A 5CSUA 1WO2A 3HMJG 1W1TA 4NNBA 5T9BG 4X60A 2ACUA 3RK8A 4ZEPA 2Y8UA 2PDIA 4Q32A 4IFRA 4WVXA 3E74A 3NIYA 5FF0A 3EX4A 1EJSC 3QOMA 4XK2A 4AZIA 2QVNA 4M56A 4LBUA 1FHDA 5CPMA 2CLHA 3PSWA 1CBGA 1VBJA 5EFDA 1GPWA 5JH1A 1QASA 4JPGA 1R47A 3AMLA 1VD6A 4MPKA 1THFD 1RV8A 1I0BA 3URBA 1VC4A 1EL3A 2Z6IA 1C7TA 1DEDA 3VGHA 4AIBA 5D2WA 4LOCA 4YMZA 4QCEA 2ZUVA 3NCOA 2OLHA 4QIUA 1P0BA 1F3WA 3VKBA 4QJ1A 5AZ1A 1XIIA 2ZZ6A 2DT1A 3GXFA 1DORA 1XXXA 3GYEA 3RAOA 2GDVA 1UASA 4KIEA 4EE9A 1WP6A 3R11A 2HNEA 3R2GA 2ZZ4A 5BU6A 3K4WA 4WDTA 4F2TA 1KV5A 5D30A 2Y89A 1B4KA 2B31A 2CU0A 3GIYA 3VE9A 3VZYA 4YTRA 3LTYA 4Z2JA 3KL3A 3NDZA 3MC5A 1TZZA 3MP5A 1DIDA 3WN6A 3EKLA 4XV0A 4H9YA 3W38A 2J13A 3C4UA 2QAFA 1DXFA 5AHEA 1QI2A 3TSBA 1I2PA 3FN9A 1ZRQA 4WEVX 2HV5A 1HUVA 2FGZA 3U8GA 1KCKA 4RE3A 2I7GA 4NG3A 2A21A 4YTQA 3RU6A 2V63A 2FZDA 7PTDA 1FUYA 1V0KA 4MYXA 3WD4A 1NTHA 5FJTA 3JZUA 1MI3A 1A50A 4S3CA 4UTWA 3WEMA 1EOMA 3H54A 1UR2A 1E5JA 3F4WA 1TUXA 4GIRA 3S1VA 4CNUA 1XINA 1YNPA 2R8WA 1VRXA 3PUGA 2CLOA 1UHVA 1DWIM 1CGXA 1OFAA 4M6PA 1EJVC 2Q09A 4LAUA 2VX5A 1BYBA 4QE1A 2JE8A 3EWZA 2WZIA 4H9UA 1EH9A 2Y8KA 5HBFA 1EFZA 4CKQA 1PDYA 3PZTA 1J5TA 3MWCA 3L2IA 4XZNX 4EWND 1FXQA 3NO5A 2O92A 3KXQA 4JIHA 3VDAA 3THUA 2G3MA 3VFLA 3VABA 4YWSA 2NWSA 3BTNA 1OZMA 2PB1A 4DBEA 3LI1A 1OYBA 3GG7A 1W3IA 2YPIA 3K30A 1B30A 2E6YA 1X7FA 3A3XA 3FGCB 2GSJA 1P1MA 1V6UA 4L6DA 1W2VA 3PANA 4JTDA 1CCWB 2PD9A 4NZ1A 1PIFA 4NZ3A 4YIWA 2OTDA 3P0XA 2PBGA 4JZ5A 4W7VA 3TYZA 2HJPA 3LRMA 4PODA 3TJ4A 1XRSA 4HU3A 3CWHA 4KPLA 4CN6A 3CH9A 3CK5A 3F4CA 3ZR4A 3LRLA 3KZPA 3KE0A 2Q8XA 4DNHA 3RLHA 3IVSA 1ZUAX 5XINA 3H2MA 3W6LA 5FJIA 3SW6A 1O7AA 5G1TA 3LXCA 5D2VA 2XPKA 4U2ZA 4HZ8A 3NOEA 1S5MA 3MBDA 1WKYA 3AU2A 3N4EA 2DDXA 4QDMA 1QNSA 4HNNA 3A23A 3BAXA 1XM3A 1R0MA 5JMUA 3T08A 2ON3A 3GIQA 2PURA 1UR3M 3ALFA 2BXVA 1DWAM 3HFTA 4GQ0A 4FNRA 4RXFA 4ML4A 1I8JA 3IJ8A 4H9ZA 1N55A 3V1PA 1VP5A 1HGYA 2AL2A 4DY1A 1UR4A 3HPAA 5LNVA 4DWSC 3UJRA 3B8VA 1UKQA 4QLKA 2WMJA 1NDWA 2PGWA 3II1A 1WCGA 3WLMA 3G22A 4QQUA 4DBSA 1KFLA 4GUHA 3AYSA 1XC6A 4EPKA 2QJJA 3IEBA 4NI8A 2R91A 1DXIA 1K9FA 3PG8A 3VZZA 1FWRA 1XRVA 3MMTA 2HS6A 5E9XA 1JYWA 1JL8A 5J5DA 4OBSA 3WEOA 3H2EA 4IP5A 1LBFA 3WNNA 3W72A 2QDDA 3T05A 4FALA 2P53A 1CEOA 4OTKA 3U5YA 4ZO7A 1U5HA 2NV1A 3VFCA 2A6NA 3EB2A 1ODUA 4GYKA 2PDKA 4GY0A 2WKJA 3DGBA 2YL8A 3E0FA 3IGUA 1TZ7A 4LYPA 4RZBA 3PTQA 3QFWA 3WBYA 4HN4A 4UOQA 3RDKA 3WNLA 1VB9A 3LQLA 7A3HA 3QQ1A 1U2YA 2DZPA 3N9RA 3WF1A 4FF5A 3M46A 4TOQA 4P7RA 3FJ6A 1OF6A 5HNNA 4AFYA 1D3HA 4PUUA 3WKZA 1J5SA 4DN1A 3GTXA 3CZKA 1VAHA 2QQ6A 5FEPA 1E56A 3BLDA 3GG1A 2OB3A 2QHAA 4IPLA 3TFXA 1KKOA 1ZJAA 1AVAA 1CXLA 5GPRA 2WCAA 4I8YA 3KBWA 4GO9A 5ABGA 4AZHA 5A8OA 4K1GA 3NPUA 3R43A 4Z1CA 5G2HA 1ECEA 3PG9A 4WKAA 1CLVA 4US5D 1ALDA 3ABRA 5G4EA 3H53A 1G4EA 3UZ5A 4NJKA 2ISWA 3ZLGA 3OODA 1VLWA 3FKRA 2PEVA 2QCGA 3UETA 1RP8A 4QQ3A 5I79A 1CLXA 3UERA 3LN3A 4CQDA 3ITOA 2IQDA 4U4MA 1RJQA 1GNXA 4UQCA 3VILA 2ZWZA 3PULA 1X1OA 2ZZ1A 1E0WA 4QSFA 4LX4A 1X6UA 2YXOA 4BI7A 1GJWA 2YL9A 5GQBA 1RVGA 5AHLA 3W76A 1XYFA 1VFLA 1UWUA 3A3WA 4ECLA 5CGQA 3QHNA 2WK2A 5EU9A 2QGHA 3DFYA 3LBOA 4M6VA 1W5NA 3S0CA 2RJHA 5C7VA 2W0UA 1JZ5A 1GUVA 2DVXA 3UXLA 3SZ8A 1RR2A 2J25A 2YJQA 1UZDA 1H2JA 1XYCA 5BNKA 3SURA 3RR4A 3N2MA 1FWNA 3LCFA 3SIMA 1XR2A 4KCUA 4K7YA 3AQUA 3H24A 1QXLA 3HBLA 2TMDA 3MANA 1OG6A 3DG7A 2J7FA 3WH8A 4Q6XA 4J27A 1R87A 1KM5A 1W1PA 2VZUA 4Z2IA 2R1KA 4QM1A 3DENA 1FWFC 4K3ZA 4QTGA 5CGMA 3SECA 3JZEA 2GFTA 2E68A 1JCLA 3LGGA 2W9MA 3OOQA 3N11A 2IQ0A 4GGHA 4H6QA 1V02A 4XIMA 2R1LA 4AXNA 1HIZA 1AW1A 3WIJA 1KCZA 4B9ZA 4ZSUA 1GWJA 2HCVA 3N3MA 1F6KA 3EB3A 1FHLA 1OHLA 2OZ0A 3BGJA 2CHNA 3M0LA 1UD2A 3FA5A 3HM7A 4UWMA 2C18A 4BQ5A 1LWJA 3QSTA 3TQVA 3UF9A 3CAWA 1OG0A 3GC4A 3NQEA 3AYRA 5E9AA 1CXEA 3FSTA 1EOKA 5TNVA 4PMJA 4C6BA 1F4HA 4UTIA 5TIMA 2G97A 2Z1KA 4L4OA 5BOEA 5AY7A 4DRSA 5EMUA 4CCDA 2YCLA 2PF0A 4NU7A 2BX7A 3FIGA 2RGLA 1VEMA 4DQWA 1DWGM 4FPSA 3RG6A 4H9MA 4UMCA 5F2LA 4UTJA 1BRLB 3CQ0A 5EPDA 1BSLA 3PY2A 4JOMA 1UUQA 1AA1B 3F5LA 2ZKMX 5EYWA 1G01A 3L0GA 5LNUA 3URAA 3N4AA 3IS4A 1P1XA 4XWUA 3U57A 4W7UA 1UD4A 4AZBA 2CBJA 3LU2A 4PTNA 1U1UA 1OD0A 4A8LA 3PBVA 1F9CA 4GQRA 4TUFA 4W85A 2VUNA 4AMCA 4CNNA 1NF0A 3B0PA 2D20A 1XD1A 3PZMA 1HO4A 4TXEA 2QCMA 3CUJA 1G7UA 1HL8A 3ZJ8A 3T4WA 1OFRA 3RO6A 3QPYA 1G4TA 3TN5A 3UPMA 1W1VA 4GA8A 4Q7IA 3LI0A 5DY3A 2Z0IA 4UQ9A 2OWCA 2G96A 3BARA 2YFNA 1RAKA 5ABHA 1L6GA 1YNYA 5AYIA 1H62A 4BI5A 4HCDA 3W3OA 1PKYA 5D8ZA 2GDUA 3UG5A 3IAPA 3B4UA 5TBOA 3KHJA 1J2BA 5FA5A 1JVNA 4MFEA 1UR1A 1CLKA 1FH9A 4H4IA 5A69A 1JUKA 2V3EA 2VENA 2E1DA 1PCWA 1N8FA 2YKKA 3R0DA 3AS2A 1IZJA 3EWCA 2V3GA 1GK8A 2ABBA 5I3IA 5AVHA 1R7AA 3TR2A 1G9HA 1XLDA 1UH3A 3MO4A 4UR9A 4EX4A 1JXJA 2E77A 1MZRA 4J9JA 3HG4A 2NQ9A 3A24A 3WQ4A 2ZA1A 2ZWYA 3PVFA 1SQ7A 3THDA 1KM6A 3BMXA 4AHPA 4GYJA 8A3HA 4S1FA 4PL1A 2INFA 4XBJA 3ZT7A 4IT1A 3MHUA 3SN0A 1EA0A 2BS9A 1LG1A 2WJDA 2V6AA 4TVDA 4ORIA 4HU4A 3MWAA 4RR4A 1QOQA 3EKGA 2FTYA 1K3UA 3QC0A 4XX6A 4DJEA 1VEOA 3TVAA 4IXHA 1E6SM 1CZ1A 4XVEA 4CU8A 1SO4A 4ZXLA 1KM2A 2WMIB 4XBSA 3PPHA 3W2KA 1XV8A 3QTGA 2J27A 2P3ZA 3QN3A 3ZOAA 4BI6A 1AJ0A 5HMSA 2Q3RA 3W28A 1X8CA 4MGGA 4R7JA 4O13A 1KM3A 3N12A 4FIRA 4WF7A 1BF6A 2X1RA 1K8CA 3GDMA 3NYZA 4LBRA 4I9MA 1IXPA 5K4XA 2QCDA 3TZFA 4JNYA 3LZ5A 3B8WA 5HXMA 3WLLA 2PE4A 1UW9A 2ACSA 3ARPA 1X7IA 1UD5A 3CXOA 1QR7A 3QY6A 1WUEA 5DRCA 3W7MA 5KZEA 4ZOAA 1RHCA 4GX8A 3LM7A 3LM3A 2C14A 8CGTA 5KZ6A 3G1VA 2QF8A 2RDWA 3HURA 3M6YA 2OG9A 4UQAA 4DM1A 1SZFA 4U2YA 3VGDA 4CCEA 2ZRVA 2VDIA 2DT3A 4CD7A 3KBVA 1EJXC 1AH4A 2QVHA 3UG8A 1QNVA 3CB3A 3TTQA 2ZC1A 3TEVA 4JY9A 1PB0A 4U3CA 4H7VA 3CZJA 4HNTA 5D32A 2J9YA 1ZALA 1PX3A 1W9DM 4IXXA 3ZMRA 4JR5A 1ZPTA 1HTIA 1EXPA 1X1NA 4P5UA 1GYNA 1FKXA 1Q7MA 1QO2A 5ECUA 2WBGA 4OFCA 2HNHA 2BGQA 2OX1A 3VNMA 2Z7KA 4GI9A 2CLKA 3QC3A 2Q71A 1N2VA 4LYQA 1PO9A 3DG6A 3LDVA 4P7NA 4V2XA 1J6PA 1QOXA 2OLAA 2PMQA 4O54A 3E02A 3W7NA 4A29A 3VX0A 4LAMA 1E6ZA 4DUOA 1LJYA 4P8VA 3UGRA 2NT0A 2A7RA 1H41A 1IHIA 3CQJA 3IJDA 3AHTA 2GVYA 1ZBCA 3SRHA 1Q85A 2PDNA 4UC5A 3UY8A 2DIKA 2Y88A 4QROA 3L5AA 1OT2A 3UZJA 4MB5A 3BMWA 3SFWA 5LA0A 4JKLA 1K8XA 4QE4A 4B5SA 1V0NA 2Z7GA 3OA3A 4Q8UA 3KWXA 1SO5A 1TTJA 5EL1A 3EEZA 3UYCA 4HYWA 4HKPA 4HOXA 3P5ZA 4LC6A 2EPOA 3EXRA 1JZ6A 2NSXA 4WY0A 5D02A 4XAGA 1P7TA 2OSYA 2JEQA 3VNDA 2GLKA 3E5BA 5DCBA 1GZ1A 2XN1A 2ZX8A 4F0KA 1WE5A 2DEPA 1FWIC 1RK6A 1BLIA 3E6EA 4NL1A 2VR2A 4GZ7A 1X1ZA 4DF1A 4JN8A 3AZRA 4C5YA 1ZBKA 3WK3A 2HS8A 3KTCA 2VFEA 3I7RA 4HSHA 1PAMA 1PDZA 3SCWA 4CUCA 6TAAA 3VOCA 2XH7A 1A3HA 3GKAA 2WMGA 3BOLA 3EA3A 3PTMA 1DIKA 2ZQ0A 2HPMA 3EXTA 3E0LA 3OZYA 3H2AA 2WBKA 3G1DA 3GUWA 4Z2KA 1A0EA 1SW7A 4DI9A 5G1YA 5HJXA 3GDKA 3DECA 3HG3A 1GVSA 3BW4A 1FCVA 5DT5A 3IGXA 3MHGA 2Z27A 1RQHA 4NZJA 4LAKA 2J7HA 1S2AA 1JNEA 1LG2A 1DE5A 2NXHA 3M0ZA 3UQNA 4MFDA 2DZTA 2PP3A 4X2RA 1PZ3A 1RPKA 1L2UA 4FNSA 2VNCA 1MXGA 1VCVA 1FWHC 2JGQA 1QT1A 3A3HA 3BG9A 4NAEA 1PHWA 3THCA 3ITGA 3GYCA 4Q8TA 4L5ZA 3C0SA 1P6CA 3NGFA 4ZE4A 3GG0A 4HMCA 4LUTA 1Q6LA 3W26A 2YDSA 4LH8A 3GHSA 3GSMA 5CBIA 1DWJM 1JCMP 2DSWA 1F07A 1P6WA 2NV2A 3D46A 2ESCA 2PS2A 1MUMA 1I45A 1UQZA 4O1AA 4WIWA 1K8ZA 2VCAA 3RJXA 3RJYA 2HE5A 5JIWA 1MSSA 1S2UA 3NOYA 1VRDA 3NZQA 5JH2A 1OGGA 2FH6A 5A6KA 2VR4A 3EDFA 4NF7A 3B0VC 3HQPA 2EKCA 4O1DA 3W71A 4EPDC 3SEPA 1I2RA 1AMKA 2O4QA 2QIWA 2QF7A 2RAGA 3F5KA 5CC5A 3CTLA 2ZIDA 3MU7A 4E2VA 4J28A 1UR0A 2PWFA 3WDQA 2IS7A 4JFUA 3T81A 1BG9A 1G7VA 3A47A 4DAFA 3WLKX 1LQ0A 3T8QA 3WJXA 4WQ6A 2WV8A 3BO9A 4XB3A 1E73M 4L4MA 3MUZ1 2XFYA 3KRSA 2Y85A 2DORA 3TYAA 4Q8PA 1FP9A 3GC5A 3MUXA 3SCTA 1LRNA 2Z2BA 3R89A 2ISFA 2GVGA 1F6PA 2QMKA 3MI6A 2INEA 2VZVA 5CC3A 2B7OA 4I5RA 2B7NA 3IRDA 4P2VA 1EDGA 1OX6A 3NSXA 3MUIA 4F3HA 1EKOA 4ZO6A 2VJXA 1QWGA 3GR7A 1POKA 3AHYA 2ZRXA 4BFAA 2JKAA 1R85A 4C6DA 1H7PA 5D03A 4ILSA 1W3JA 1OJXA 4EAYA 4PUWA 2VEFA 4XZIA 4HYVA 4PUMA 4WSHA 1C29A 4YYFA 4X61A 1UKSA 1S1PA 4B5NA 3RPMA 4OU1A 4IIHA 2V69A 1QHZA 3VNJA 4O0QA 1QVBA 5A3HA 1MFUA 3WYZA 5JXQA 5T8GA 3AZTA 1UMLA 2Y7FA 5BXSA 2ACQA 2WZTA 3SB0A 1T6MA 2NX9A 4O28A 4HCLA 1SJAA 1SM9A 1B54A 2D22A 4IUGA 2ZUUA 4MUZA 1IT0A 3LXAA 3MMUA 2ZXDA 4RUBA 2ANUA 3CL6A 3WMBA 1SJDA 1J2WA 3FHQA 3N6HA 2ZDRA 1E0XA 2Y7GA 1KFBA 4GCAA 2CBIA 3K4DA 4Z2HA 1MW0A 1M03A 2VFHA 4C6CA 3DIPA 4HNOA 4LEFA 4UIOA 3LPPA 1IWAA 1V0LA 2EQDA 3JRKA 5ABFA 3O15A 1H49A 1FHUA 4AX7A 2QIIA 1W6TA 3CHCA 4R88A 3NO3A 2VRKA 4AHQA 3UA4A 2X42A 4DPQA 3EXSA 2P88A 2YBTA 4C6MA 4DB7A 1V7YA 4X0NA 1TJ1A 2FVKA 3LB0A 1XIDA 3S5NA 2VGIA 1GQJA 4CQBA 4DPPA 3GE7A 3L12A 3Q94A 4AC7C 3EWXA 4ZCWA 4LV9A 2WHKA 2Z1WA 5D05A 1OWQA 3VUSA 4ZQPA 1W5OA 3WUFA 3QMSA 2DUZA 1JAEA 3B06A 3W75A 2V3FA 1M41A 2AL2B 5D09A 2I14A 3MHFA 2FQIA 4I6KA 2PLMA 4S3DA 3C56A 4NI3A 4Q8VA 2IUZA 5BCAA 3N9KA 2CNCA 4DUXA 1KWGA 3NTYA 1D3CA 2W27A 2EPLX 4H19A 5IOBA 5C54A 3PHAA 1UWRA 4O11A 5C9RA 5B7YA 1H0IA 3OHIA 3VYLA 3WQVA 5A6MA 1E6PA 4PCPA 3SQLA 1AD4A 4QS6A 3TK7A 2Z1BA 5EBAA 3GS6A 4H8VA 2F38A 5I24A 4M80A 3EDJA 1YEYA 4HPNA 1US3A 5H1WA 3RCYA 1VFSA 2HBXA 4LUIA 5FSEC 3N6QA 3AS0A 5AECA 1D8CA 4GABA 1GQNA 3G1YA 1R3RA 1PEZA 1CNVA 3XINA 4RNJA 1AQMA 4W93A 3TJIA 2BMBA 2Q01A 5AYYA 5E0CA 3M5VA 2DGAA 2ZADA 2W63A 1OCQA 4IICA 1I2QA 3MCNA 4AH7A 2YLAA 3WMSA 1GORA 3CHDA 4GGBA 2XG9A 1XP3A 2A1YA 4R27A 4M19A 4QEEA 4HHPA 1MEIA 4DWSA 1HKJA 3PBGA 2DW6A 3PFRA 1WXZA 1XKJA 1M65A 1EWEA 3QPZA 4IGHA 2XM1A 3ARTA 1KM1A 4E38A 2CYGA 4K7VA 3HGSA 3VNKA 1EP1A 1DWHM 4GHRA 2TODA 1GQIA 4MDPA 4Q8QA 2ZX6A 3FS2A 1F2JA 1DJZA 4CQCA 1JZ4A 4UFKA 3PZQA 4GC3A 1JG9A 2FTWA 3ARUA 1QOPA 3URQA 1EQCA 2D24A 1VBRA 1MQPA 3W7GA 4E3VA 5AB3A 4A35A 1TPWA 3BLIA 4F79A 2E5DA 2XISA 4W84A 2FZNA 4E3TA 3N2OA 3GDLA 1MEHA 3S2LA 7REQA 4WKFA 3YPIA 2V5BA 1H51A 2WNNA 3TQ0A 2ZA2A 4NILA 4UNLA 2VHLA 1U5VA 1GTEA 2WSRA 1QATA 3E9AA 4ACYA 4E8GA 3M47A 4LC8A 4GQGA 1CDGA 1E6RA 3FVMA 5DLCA 1PZ2A 3CWNA 4E2DA 2ZTKA 5LSMA 1UA7A 1GGOA 3SSZA 3UCDA 1O6IA 1WDQA 4RDZA 1DQXA 3LHYA 3NDYA 4C6QA 5GJPA 1ZLPA 3I10A 5CJ5A 4OV9A 1FH8A 5FAJA 2GDQA 3P5YA 3VKAA 4WR3A 1CGYA 2Z1XA 3S9IA 1FWSA 1V02E 2OJPA 4AZ7A 1BEUA 3OO2A 2AAMA 3MI3A 2Y1HA 4HYRA 5E6ZA 5ABTA 1VZWA 5F2MA 3UWVA 4PUDA 5G4WA 2CBVA 2XGIA 2DUAA 4XVDA 4UBPC 1V7AA 2V2CA 3SADA 2GQ9A 3FCPA 1QFEA 1YE6A 2PDQA 4C91A 3BUVA 2HPIA 4Q4RA 1E0VA 4XO7A 3AYTA 4NX0A 1TPH1 4ZVJA 3VDGA 3IARA 4MWAC 1NU5A 3N34A 1PYMA 4WUIA 3VNYA 3K1GA 3VMOA 3A21A 2C1HA 2NQLA 1FWDC 3VD4A 5GJMA 5A8PA 4QITA 2WVSA 4DF2A 1UC5A 4AWUA 3DBPA 4GUJA 2HEJA 2IQTA 1ITXA 1RSCA 3WMCA 5IM51 2IPGA 5C70A 4TR9A 4G7EA 4YVXA 4OOUA 4ERAA 4WJ8A 4NX5A 1A49A 2BLEA 2D0GA 2B0MA 2Y7EA 4L1XA 2D2GA 3NL5A 2I5GA 2XZ7A 1XCXA 3DCPA 4PN2A 3CS2A 4UTTC 1RVKA 3SQMA 5CPQA 1PPIA 1V03A 2CCRA 1KTNA 2EPMX 4MKVA 3H2FA 3WQWA 3B8DA 3N25A 1C8VA 1PJ9A 3TC3A 4D1IA 2QJHA 3UNDA 3OG3A 4H6RA 2X05A 2D0HA 2YCLB 2ALDA 1YXCA 1KCLA 4JYFA 2GYIA 5LA2A 2ISVA 3QR3A 3W87A 3AMCA 5DY2A 4LY4A 1C93A 1U1HA 5U4NA 1IEIA 1RK5A 3WH7A 2Q8ZA 3CZ8A 2R94A 5IBXC 1XLGA 3SCQA 1QNPA 2CZ5A 3EMQA 1Q4WA 3MS8A 2QJGA 1OEPA 1RLDA 3UG3A 4DZAA 4KQNA 1DL3A 4C65A 3OGRA 4KWWA 2QCLA 1TG7A 2FHFA 4HIBA 2Y70A 3ICJA 2QJMA 3PZGA 4V28A 3UR7A 1M9HA 5C7HA 4MY1A 3BJFA 1CGTA 5HWMA 3B8TA 3GH5A 4EK7A 6XIAA 3TTEA 5HUOA 3W7CA 1XYAA 1NDYA 3S47A 2GOUA 4ERIA 4GBDA 5JVLA 4AX6A 1H0GA 4N42A 3CQKA 5AYZA 3GVQA 2D3LA 3AXXA 3TZNA 2DSZA 2ZC8A 1KO0A 4M8UA 3CMGA 1O95A 1YTKA 1UD8A 2PDGA 4GZIA 4WDXA 4E0CA 4BF5A 4IQDA 3HV8A 1VKFA 1OVDA 3OPSA 1KWKA 3T09A 3GXNA 3BZGA 2GVEA 2FPTA 1Q65A 3DEQA 4QFUA 4IIGA 2B4GA 3B03A 1PL9A 3N18A 2DSKA 4FOKA 5AHIA 1D3GA 1RD5A 2WVUA 1A3WA 5DMYA 4CGTA 3OBEA 1GVFA 3TW6A 3O05A 3NAVA 3OU8A 3PAJA 3W29A 3V16A 4XQ6A 3AUJA 3LA4A 7TIMA 3G8RA 3GKFA 4D6IA 1OB0A 2HVOA 1IEXA 5IHRA 4HA0A 4GJJA 1C9DA 3HJEA 1BWLA 3VIPA 3B0YA 4B2DA 4KGJA 1L0PA 4IQJA 4Z0SA 1W5MA 2A3EA 3TTSA 2ISDA 1Q8AA 3K13A 1MNZA 4LSBA 3W9ZA 5A8MA 4MNMA 4M82A 2E6FA 4PBGA 4JICA 1RH9A 3L2LA 4IQEA 1OY0A 4ZA0A 2GUBA 3ANVA 4I7UA 1MRQA 4ZZ9A 5I07A 3TWBA 3WLOA 2WWDA 3W1UA 1WZKA 1LZOA 2Z29A 1OK4A 1RQBA 4Q8OA 1UH4A 4RV3A 5C9UA 6PTDA 4GIAA 4BK9A 4J1OA 1KLYA 2HK1A 3W83A 1F8IA 2VZSA 3AS3A 4JYDA 1TPDA 4QNWA 2DT2A 3SRDA 3LTSA 1QMLA 5AC5A 1WDPA 4AU0A 3R0UA 1JDCA 3N9SA 4A3HA 3GAYA 3HPSA 1JPMA 3DHUA 2QCDB 1VYSX 5BWFA 3T0CA 4QCFA 4LNCA 2YL5A 4OIFA 3RLUA 3OP2A 2XWEA 5EMKA 4DNMA 3W6YA 1RCXB 3JR2A 4GXWA 3WNMA 4I6VA 1U22A 3S4TA 4ZE5A 3DKJA 4Z1YA 3K46A 4ONVA 2Z6JA 2CXEA 3KOWA 3DFPA 4NAFA 5F1UA 3LLXA 3KX6A 2UZ9A 3W1MA 1XIBA 4UTFA 1KNWA 1LF1A 3S8HA 4HSOA 5A94A 3W1TA 1GPFA 4RX0A 3U3HA 3KTXA 2G37A 3GR8A 3S5OA 3UA3A 1TSIA 2NXGA 4H6KA 4M81A 3LNPA 2OZTA 4DM2A 4NNAA 3WFZA 3HQOA 4QLLA 2V68A 1A5AA 4NUWA 5DRIA 4KETA 3WUEA 2WPBA 1Z89A 3MMWA 3ES7A 1KW1A 1EQPA 4N9CA 2C15A 1WAUA 4QDPA 1EC9A 2NVAA 4HA3A 1SO3A 3TN4A 4E4PA 4UTKA 1R3SA 3FW6A 1TKKA 3V1HA 4NNCA 3L0NA 1EO5A 3LMYA 1FVPA 1B90A 3VD5A 2WLZA 1K4GA 5HNUA 4S3JA 3PR2A 2BP1A 2E7FA 3VOFA 2OCZA 3MKKA 3ZQ9A 3I68A 3ITLA 3BANA 3T0TA 2D2JA 1FWGC 3MUCA 4AUBA 1XLEA 4BKNA 4XO6A 1HKIA 3W02A 3IWPA 5AVNA 3L2MA 4FSAA 1HZYA 1K7XA 1UD6A 2A3BA 3EGJA 5AC6A 3CZLA 2JQXA 3SUVA 3BLEA 1C3FA 3GR4A 1WAWA 1W1ZA 2NUXA 1HG3A 1QU4A 4MB1A 1XCWA 1HP5A 4IOTA 4YTSA 1J8VA 3SIZA 3QPEA 4DO5A 1XSIA 3QYSA 3AXMA 4JBRA 3SO7A 2V5KA 2OEMA 1HKVA 3WLNA 1REQA 6REQA 2GGIA 4B9YA 1MW1A 3WD2A 1NQ6A 1J12A 2GJXA 2A5HA 4JY8A 4WY0B 7ENLA 1P7TB 3FK4A 3LQGA 3IGSA 3QFEA 3UXKA 4HN8A 2E8ZA 4JKMA 4DELA 4V27A 3WG6A 3WQ8A 1UB3A 1SFJA 5EA9A 4DJFA 4LCSA 3A22A 4W4QA 4EKJA 4L61A 4POCA 4IMEA 3CV6A 1Q6DA 4A22A 3R7MA 2PDCA 3RYSA 2YCKX 1O4UA 4M24A 3PJUA 4BF7A 3OVQA 3P84A 1R3WA 3ZJ6A 3O6YX 1MDRA 2DZXA 1UBSA 2PWDA 4JTFA 4PB5A 4C6OA 5CZTA 4P7QA 4L4PA 1KXVA 1EGVA 1QNQA 3IV8A 3KL0A 4LGXA 1P0EA 3NQ2A 1JCYA 3G1AA 3VDCA 4TV5A 3NM1A 5EFFA 4LRSA 1TO3A 3MYOA 1HJQA 1HQTA 4I9TA 4AY7A 1VBUA 3W7KA 3FEQA 3W7DA 3EOEA 4QS5A 4AVNA 4XZLX 2W5FA 5HQLA 4HPJA 4TMCA 1HX0A 3ALGA 3VIMA 3AIEA 3SJNA 3ZSTA 4C6EA 2VZTA 3EWBX 1QJWA 4F0LA 2WKGA 2WVTA 1GOKA 4NRRA 3AWOA 4MAZA 2Y8VA 1TR1A 4NAEB 3EYPA 4F2UA 2ZCGA 2W3ZA 3O0KA 1Z6KA 1ZAJA 2Z4GA 4GLEA 1XW8A 4CCZA 1OX4A 4XISA 3QM3A 3V5OA 1U83A 4FR6A 4LUTB 3SUSA 1NWTA 3LPOA 4Q4MA 4D8LA 3OJGA 3M0IA 3W7PA 1A5UA 4N6EA 4QSHA 1E6NA 4DBUA 1QTWA 1MVYA 2PDPA 1MEWA 3KTSA 5LNSA 4D71A 1Z7AA 4J4KA 3BSHA 3BGGA 4XAFA 3IJ9A 5LIWX 3UFYA 1R9YA 3GTHA 1W3KA 4AIOA 1GVRA 3OZOA 3NUKA 1KBBA 1WDWA 1S5TA 4RDYA 1WZMA 2OOFA 1GOWA 3O63A 2C6QA 2FPYA 4LPCA 4S2CA 4E2BA 4AG0A 3CLWA 3G0SA 3MCOA 3H70A 5K9XA 3DFQA 2E40A