3V1HA

Structure of the h258y mutant of phosphatidylinositol-specific phospholipase c from staphylococcus aureus
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
306
structure length
306
Chain Sequence
SLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASYINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Structure of the S. aureus PI-Specific Phospholipase C Reveals Modulation of Active Site Access by a Titratable PI-Cation Latched Loop
pubmed doi rcsb
total genus 114
structure length 306
sequence length 306
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3v1hA00
4I8YA 3OHMB 4S3GA 6PTDA 3L12A 4F2BA 4I9MA 4RW3A 1T6MA 1AODA 1QATA 3RLHA 2FJUB 3QR1A 1VD6A 1DJGA 2PLCA 4F2TA 5PTDA 1DJHA 1ZCCA 1DJZA 1QASA 1DJYA 4Q6XA 2F9RA 3H4XA 4GNKB 4I9JA 4F2UA 3CH0A 3NO3A 4QJ3B 4PTDA 5T91A 4R7OA 3V16A 1XX1A 5T9BG 3V1HA 3KS5A 5T9CE 1YDYA 3QVQA 2PZ0A 3QR0A 4RW5A 3EA1A 1PTGA 1DJXA 7PTDA 1V8EA 2P76A 4I9TA 2PTDA 3I10A 1O1ZA 4RV3A 3EA3A 1DJWA 4QJ4B 1DJIA 1PTDA 2OOGA 4QJ5B 3H4WA 2O55A 2OR2A 3EA2A 3PTDA 3V18A 2ISDA 1T8QA 3MZ2A 2OTDA 3KS6A 2ZKMX 4I90A 1GYMA 3RLGA 4OECA
chains in the Genus database with same CATH superfamily
1D2KA 4OTKA 1EGZA 5I3JA 2Z1BA 1WKYA 2A6NA 2CKSA 1YRRA 4Y90A 4OU1A 1ADDA 2L5HA 4R9XA 3IK2A 4JX5A 4YTUA 3C2EA 3W2NA 4UMAA 1ALDA 3B0XA 1C29A 3ZT6A 1BD0A 1REQB 4S3CA 4RDWA 4PMDA 1B3WA 4QDWA 1DHPA 4PMOA 3RCNA 4I9JA 2A3BA 1G0CA 3S1GA 3PTKA 3CZEA 4WXZA 4JTIA 3OQEA 1PZ0A 2RHGA 3A3HA 3CU2A 1ISWA 4RE3A 4PRRA 2PDFA 1TPUA 1XX1A 1H0IA 1QWKA 3SN1A 3WLQA 1YPIA 1H49A 4RE0A 1TV7A 4A8NA 4JFWA 4XWUA 4Y2WA 1JEZA 3EKLA 3TXZA 2OKTA 3FJ4A 4DM2A 4GO8A 2Y7DA 1E0XA 3U2EA 2GVGA 1XC6A 4Z1CA 5HAOA 4BQ3A 4U3CA 4AD2A 1POKA 4YS1A 3WF1A 1EHAA 1JL8A 2FB2A 5CG7A 5A6SA 1FWRA 4ICMA 2O56A 4EXBA 1IGSA 4GACA 1FP9A 3QZAA 1XLAA 2VZVA 1MEIA 2EF9A 1OD8A 1JPDX 4HSHA 5IOBA 4DUVA 1AD1A 4DF1A 1ESWA 2F2HA 4Y8EA 2BS9A 1Q6GA 2PB1A 2YDAA 3IJIA 1R3RA 1R9YA 4WGXA 1AVAA 4EXQA 3ITYA 1UYQA 1FTXA 1PIFA 3DEQA 2DT1A 4LVDA 3WH8A 2ADAA 1WXYA 2YA1A 2XG9A 4IX2A 1E0VA 1AJ2A 1MNSA 4M1BA 3I7SA 1XD0A 1LBMA 4BI6A 1OVDA 2GJXA 4C6IA 1PV8A 3L5AA 1MXSA 2E5DA 4OWGA 4AWEA 4BF5A 2IPJA 2JKPA 1PKMA 3NYDA 4U3AA 2ZDRA 1W9DM 4UTTA 4DVOA 1AK5A 8A3HA 3M0YA 1UWTA 1J0YA 2WSQA 3ZJ8A 2ACRA 3U5UA 3QKEA 3SCPA 1OFDA 4GI9A 1K7XA 1ONRA 1UROA 1BYAA 1SW0A 3EZ4A 4PSRA 2VEKA 3E1F1 3ANVA 3QM3A 1GOWA 4O28A 2AQVA 2EG7A 2HBVA 3E96A 1WA3A 3GH5A 1OYAA 4O8AA 1VEOA 1PHQA 4GINA 2VI0A 3IIZA 1H63A 3ZM8A 4N6EA 4C6LA 3KX6A 5A6JA 1GEQA 4M19A 1VBUA 2QJHA 4C7FA 2GL5A 4L64A 1W1YA 3TW9A 1S5WA 1TSIA 4WOQA 4UFLA 5ENLA 4O1EA 3H2EA 1EPVA 1KXHA 1QPNA 1CGWA 3OLIA 4FS9A 5EKYA 2OB3A 4EPEC 2VEMA 1U30A 4W89A 5E09A 3XIMA 3BSGA 3CT2A 1XSJA 4JQ4A 4YCOA 1YTEA 2V5CA 3I4KA 1X98A 5BRPA 2IQ0A 2G0WA 5EBUA 2PWFA 2O9TA 2GOKA 1QI3A 1I6NA 2I7GA 1B30A 4WXYA 3VCRA 4KWWA 1GONA 5L9FA 1U1UA 2WC3A 1FHUA 1H5YA 1S5TA 1EX5A 1RD6A 3EYPA 3DFHA 2RDXA 1OEPA 2OFJA 3FVMA 4GUJA 3HN3A 3B9EA 2OG9A 3UCCA 4M5PA 3RDKA 1I8JA 1TZ9A 3O6CA 1S2TA 2D2HA 3VK5A 5IHRA 4NI8A 1AQFA 3II1A 4KMQA 4J7RA 4JGDA 4HOWA 1IWPA 4J3SA 1S2WA 4RNHA 4GY7A 4PCTA 5DANA 3GNOA 1VHCA 2OSXA 1EP3A 4UFHA 3ZSSA 2I57A 3TSMA 1HIZA 1EJUC 4TVDA 4QE5A 1NF0A 2ISDA 1O1HA 3E5PA 4P7RA 4BFAA 4MWAD 3WQOA 3AI0A 4LV4A 5IDZA 3QZEA 1PZ1A 1TCMA 3VIMA 2PPGA 2Q02A 3LV5A 3W70A 1US2A 5CZ0A 3NGFA 3LGDA 1VBGA 3GC5A 1ITUA 4XZMX 3ENLA 1YXDA 2BWGA 2H9AA 3TTQA 4B3KA 1RJQA 4LY4A 3ZJKA 4PEKA 3KDOA 3N4AA 3TN4A 3WQ4A 3HQNA 4BI7A 4ZQPA 4J40A 2XIIA 3CUGA 1ONXA 3C0QA 3VOIA 3A4JA 5I7GA 4PTNA 1TTPA 4LV9A 1LROA 5BCAA 5HQMA 1UZHA 4YNGA 3VOFA 1EO7A 3M43A 3QSRA 3FLUA 4RDVA 3SEPA 4S3DA 2B4GA 3N6JA 2WANA 3PJXA 2CZ5A 1SFSA 2CC0A 1OYBA 1UWIA 5EB8A 3G0SA 1DVJA 4K6AA 4JS3A 4GVFA 5IFPA 3IV3A 4ZQCA 3PFMA 3S4TA 3R0KA 5LSMA 2WOQA 4JYEA 1DXFA 1F8IA 1TJ1A 3LHVA 1S5MA 3A5FA 3OVGA 4NZ3A 5KSWA 1C7TA 1MFUA 3AIEA 3WJYA 3S1UA 2FTWA 3PZUA 3QPZA 2JEQA 2E6AA 4KEUA 4BF9A 5AHFA 1BPLB 4DY1A 2ICSA 5EBAA 2YL8A 2TODA 4RNFA 1VFFA 2OCZA 1FHLA 1V93A 3UWZA 3CUIA 3FSUA 3TCSA 1FWCC 4YTTA 1CGVA 3CH9A 3G0XA 4Z1YA 3OBEA 3LCGA 1QW9A 3GB6A 5FCZA 3N04A 1XIEA 3USBA 1YNYA 3U57A 1F07A 3VYLA 1ZNNA 3CYJA 3AFBA 2BTMA 1FOBA 3A21A 3WQ5A 1W9UA 5HNNA 1H1ZA 4GGBA 5ABGA 1UKQA 3B03A 1K8XA 5XIMA 5LIUX 1H7WA 4TO8A 4DAIA 3MMUA 1ZAIA 4R27A 3UYCA 1LCOA 1NAL1 1AW1A 4KERA 4ICCX 4W7WA 4HYVA 2DSWA 3H23A 1GG0A 3T1GA 3T05A 1JRCA 2XH2A 3OG2A 1XF0A 3TJLA 3C3UA 1BWVA 2OZ3A 4X3ZA 2GQAA 1BFNA 3B0UX 3VO0A 4JQ1A 2OO0A 4P8UA 3GKAA 4G5DA 3I65A 4IL2A 3BW4A 4UTHA 2DUAA 4HHPA 1TWIA 2DZVA 5HPCA 2IXVA 1SZFA 4FLRA 3KVJA 4I9TA 2WPGA 3A3XA 3ZT5A 1KKOA 1IT7A 3VX0A 1M7XA 2WMFA 4L80A 4B3LA 2WZEA 1TA3A 1VPQA 2C19A 4K8GA 5A8GA 1I2NA 3GVVA 2W63A 4LEFA 1IXPA 3RLGA 4I6VA 4DBUA 2V81A 5L6UA 3DDMA 2HS8A 3AYRA 3CUJA 3D47A 3CAWA 1CWYA 1FH7A 3M5XA 2EGZA 4IQLA 3W7JA 1SZGA 4GI8A 1GQJA 1XIMA 1VIWA 4M8UA 2VEIA 3ARYA 3XINA 1X8CA 5DN1A 1SMDA 4US5A 5A69A 1L9WA 4NYUA 2BXYA 3GVWA 1DJYA 4GOAA 4LXFA 4UQCA 4JKKA 1XRSA 4ZBCA 2GVJA 3CPRA 2BXZA 1VRDA 2OKOA 1T40A 2ZC1A 2D0GA 5ABFB 1VFTA 3UR5A 1ZJHA 4HBKA 3L9CA 4EIVA 4LVAA 1J96A 3NXLA 2PWDA 4OGZA 4QISA 4QAWA 5H8PA 4OZOA 1QNVA 2GQ3A 2IKGA 3S47A 2D24A 1KTNA 4P8VA 2B7OA 4INFA 3GTIA 2C0HA 3KHJA 2ABAA 3ABZA 4P2VA 3T2OA 3PJUA 5KZMA 1VCFA 1BTCA 4ALDA 4DWSA 2CU0A 3H24A 4NVTA 1SM9A 2Y0FA 2HE8A 4XZWA 3SIMA 1XYAA 1GYLA 5A6BA 5LNVA 1OCNA 2NLYA 4Z17A 5FA5A 3DKLA 2GWGA 2WWCA 2RDTA 3O07A 3KM8A 3WQPA 1NEYA 2WJDA 3MKKA 1VQTA 1C8VA 4UCFA 3GHRA 1RV8A 1XLLA 4UIOA 3D3AA 5K9XA 3WJZA 5MKGB 4LALA 1CLKA 3COTA 2OLHA 4H41A 1ZHAA 1ZL1A 4H3DA 4WZHA 4CQCA 1A5KC 4YN5A 5DLCA 3VABA 1SUXA 1ZBCA 3OYXA 4H8VA 4HJWA 3IUIA 1KGWA 2GQ9A 4OBRA 4BQ2A 2V5KA 3N4EA 4KFNA 1EJSC 5BNKA 2PWUA 1AFSA 3M0KA 7ODCA 3BTNA 4LAZA 3L65A 1HTIA 2W5FA 2A7RA 2F2KA 4N0RA 4W4QA 3AS1A 4Q7IA 3E2VA 4CN1A 4U28A 1YPXA 2GFTA 1HJUA 3MCOA 2NSXA 3SSZA 2OR2A 3BLFA 2V3FA 1W2PA 3S83A 5HMDA 2GJLA 3S3GA 3RX2A 3UG3A 3T40A 3EWZA 2G37A 2B81A 1NDZA 1OQFA 8TIMA 4CNTA 3SRHA 2ZUSA 4V27A 2XH7A 4X0VA 4JPGA 3TMQA 2J9ZA 4V2XA 1H1YA 4QIUA 1HX0A 3O06A 3OBAA 1QHOA 3KWSA 3HPAA 2HBXA 3B0VC 3P74A 1UH4A 1FKXA 2WZMA 2WKLA 1CGYA 3LDVA 3T55A 3FKKA 1Z44A 2QMJA 3FXGA 1CGXA 4BA0A 2XSAA 3F2CA 4XZBA 4JN6A 4ZXOA 3R8GA 1TRDA 1W31A 4MADA 3DFTA 3P14A 3GO2A 3DHUA 1I4NA 2ODOA 4LFYA 2C79A 3UCQA 4LUSA 1UBSA 3EPMA 4UWMA 4J3WA 3WD2A 5D09A 4QROA 2XSXA 1IF2A 1GOQA 4V15A 4XAFA 1LL7A 3DFPA 4MG4A 1FWAC 1KM6A 4ZEPA 3SIZA 4H83A 1B5TA 3QV8A 4S3KA 4IPPA 1IWBA 3FOKA 3CNYA 1EXBA 4O11A 1W5OA 2WHMA 2REQA 4PBEA 3VX1A 3PNUA 2QF8A 3H70A 4FXSA 5F1UA 5HNUA 4O8RA 2NLIA 4JTLA 3SQSA 3W7EA 4UOJA 4ZO9A 4KEVA 3BLDA 1OWQA 3SGGA 1NWRA 3NQDA 3KDNA 1Q2RA 3IWPA 4HZMA 3LPGA 1GVIA 3LY0A 3KBWA 3G2GA 2Y8KA 3MU7A 2Z7GA 4KCVA 3GXIA 3HJEA 4BI5A 2Y5JA 3VD9A 3NSNA 1DJHA 5BRQA 5CZKA 1QASA 3WDRA 1MUMA 5CPTA 1TKKA 4UTKA 3OJGA 2R1KA 3CASA 2OXNA 3ZJ7A 1JCTA 3WFZA 3IJ7A 4JIEA 4M81A 3HURA 3TYAA 3L0GA 3DU0A 2HVMA 4V33A 3FJNA 3AHTA 3A4AA 4GYKA 1RQEA 1OFPA 2ZZ1A 4QQ3A 3CHFA 2HVOA 2GSHA 2V2HA 3LXAA 3WMSA 3DENA 3QR0A 1UWSA 1XYCA 3NPUA 4XKYB 3STFA 1A4LA 1WDSA 2V2CA 3DCPA 3SN0A 3FY1A 4K1GA 2VEPA 2XTKA 4BKNA 5I06A 4QS6A 1H3GA 2Y62A 1W32A 3P0XA 4Z1DA 2FHCA 1NU5A 4ADSA 2O55A 1X1ZA 3KOYA 3QQWA 4JY9A 3CZGA 3RK8A 2E6YA 4UUIA 3H26A 1G5AA 3TC6A 1E1CB 1QU4A 4A21A 5HINA 1U2YA 3ZXWA 1QW8A 4NNAA 2VZOA 3DHDA 3EGJA 2PA6A 1YKWA 2HMCA 3W7RA 5D30A 4K1WA 3QTPA 3STCA 3NG3A 2J88A 4JNZA 3T42A 2V3DA 4DAFA 4UR7A 1JGMA 3HFTA 4M3PA 1TB3A 1ENUA 3EB3A 3F5KA 5T26A 3H12A 4FF7A 3CM4A 3HGJA 3P8JA 4A2RA 3OBKA 1EC9A 1SVDA 5DT5A 3HBLA 3ZLGA 3AICA 1V77A 1QJWA 1S38A 1R3TA 1RP8A 4O10A 3AHXA 5AC7A 4H2CA 3ITLA 3ZFHA 1O5RA 5CG0A 4HA4A 4MJ2A 4G2DA 5I79A 1VFLA 1XDLA 4RV8A 2Z2AA 4ZA0A 3GG0A 3DC0A 2CITA 4GX8A 2WSYA 1WDWA 5AY7A 2RGLA 4XBKA 2RGMA 4HA3A 5ABTA 2VEGA 3E0VA 3TR9A 1ME9A 4F66A 2OYLA 3IVUA 1PZ2A 1EOMA 4A4AA 1TCDA 3HF3A 4QLLA 3ONBA 3CLWA 2PSNA 3UXIA 5A6KA 3CTTA 1CPUA 4S39A 3VUSA 4DBDA 4B5NA 5DY2A 1K8CA 5KZDA 3M64A 4LUTB 4O19A 3UEQA 2FTYA 3O05A 3TKFA 1RK5A 4UTIA 4MKVA 3M0ZA 1FXQA 4MJZA 2BSLA 2DQWA 1FHVA 2QCDB 3LCWA 3MC5A 3QGAC 1VIZA 4D6IA 3WSUA 4MHBA 1PKYA 2XH4A 1KB3A 4JHOA 2Z6IA 3M0IA 4UFKA 1GTEA 1TYGA 2C91A 5CAKA 1V4YA 3E02A 2QQ6A 1KM3A 4MKNA 1PL9A 2YA0A 3UETA 3B04A 2OX1A 4JNYA 2GGGA 3MBFA 2QXWA 3GIYA 3LXCA 4Q4OA 2QCHA 2OMAA 5AFDA 3W07A 2Q6ZA 4CCCA 4JN8A 2XGZA 3FFSA 2QT3A 4NYYA 5D9NA 2OLSA 4I7UA 1ZB5A 2W61A 3BH4A 3G6LA 3QHNA 2VR4A 5HNRA 2Z1SA 4K2SA 1LBLA 2YL5A 3CMFA 2BY0A 3VNJA 4U5KA 2YCLA 4ROPA 3FYPA 2XJ7A 3W1XA 3P61A 1V0MA 3BJFA 1TQXA 1Q7ZA 3WDJA 4K38A 4UQEA 2OOGA 2Y5SA 3RRXA 6TAAA 3GW0A 4AHQA 1DEDA 2WSKA 3LM7A 4IICA 1ZAHA 4O13A 2Y8VA 4AMCA 2V5BA 2Z2UA 3AZSA 3WL1A 3V7PA 4NAEB 5EMLA 3KOXA 4UMCA 4G56A 3SQMA 1RQBA 3PTQA 4LAUA 3SECA 4A3HA 2GVYA 1JYXA 1OT1A 1N8IA 1ELSA 3ANUA 3M41A 5BXRA 4WJ8A 1Z69A 4YXGA 2AKZA 1LRQA 2BY1A 2PGFA 4CEUC 5FF3A 4PBGA 4UXDA 3MYPA 3UJSA 1D7FA 3O7UA 3UQNA 4PL2A 3IJLA 3TP4A 3S1XA 3VIHA 1UASA 4Q8MA 1BRLB 5DO8A 1V0LA 4Y9OA 2ONEA 2FHFA 3GC4A 2OWXA 4BS0A 3FS2A 4XZNX 2BOFX 2R1LA 6REQA 1HZYA 3MW7A 3UGVA 5EMYA 4OT7A 2J9XA 3B8VA 4W86A 1FWSA 2WMIB 2AL2B 3GXNA 3QMSA 1YXYA 3W76A 1XBXA 5I3HA 1AMKA 3HGOA 1QUMA 2J7EA 4H9YA 1TO3A 1JJKA 1KCZA 4HD5A 5ABEA 4XAYA 1W3TA 4W7UA 4LBUA 2R1MA 1E70M 4EPDC 3W7LA 3MTWA 2BFGA 1JDEA 5AHEA 2ATSA 1I45A 2QCCA 2DUXA 1NELA 3TLLA 1KM2A 4MFDA 3QW3A 4M7SA 1OFOA 4I5RA 1TIMA 5MF5A 4C91A 1S2VA 4MF4A 2PDYA 1FHDA 1YADA 3HZ3A 5CQ1A 2E09A 3NZGA 1Q6EA 2V3GA 4QHRA 4RL3A 3BG5A 2BX7A 4Q22A 1MNZA 2XN2A 2CZVA 4ENLA 3W1NA 2W4XA 3OG3A 3R8HA 8XIMA 1Q6CA 4D9PA 1B4EA 1O5KA 1O60A 4S3FA 3F4CA 5CGMA 4JTKA 1ZBKA 3SGUA 3WK2A 1N2VA 3U2ZA 1JZ3A 1BF2A 4AAJA 3S2CA 5C2GA 2YYUA 4M24A 2TAAA 1LWJA 5G2WA 4FAMA 5FF7A 4IH3A 2OEKA 4OKDA 3C52A 2VNCA 5C6MA 4GBUA 3WQ6A 4F0HA 3B9OA 1E6PA 3PBUA 4KGJA 2YPIA 2J24A 2EBNA 2AL1A 3UZJA 2Y4SA 1OM0A 2WVVA 2ZCGA 2EPKX 1Q8AA 3T81A 1V79A 3SZ8A 3APTA 4L4MA 1NF7A 5FJJA 2PGEA 1G9HA 3ABOA 1RVGA 5HXMA 1JUKA 1XLEA 3UZ5A 1KXVA 1EYWA 2A7NA 3VOCA 1LOQA 1W0MA 2CZEA 3NQ8A 3URNA 2XHYA 4ZOCA 4GQRA 4DJFA 1HKJA 1HGYA 1WDPA 4Z1BA 2J25A 3LLFA 4WLCA 4LUIA 1P5BA 2D69A 3EDEA 1XH2A 3UBPC 2VJXA 1Y7VA 9CGTA 5A2CA 3B8DA 4EVZA 2V2DA 1R7OA 4GIAA 2QGHA 4DZIA 2X09A 5PTDA 3MMDA 4ATLA 4MZYA 4MUPA 4O1BA 3KBSA 1C92A 2XSBA 5HWMA 3GXPA 4POCA 1NDWA 2QUMA 4Q8NA 1AQ0A 3WUFA 3HB9A 4DJFD 2I16A 3WH6A 3LHZA 1RA5A 1J5TA 3I4EA 5AZ1A 3G3MA 4CN4A 2J77A 3KS5A 2G8ZA 5CLWA 1DKWA 1TREA 4GKTA 3FN9A 4RXGA 5I23A 3NEHA 3U9IA 1UZ4A 3LCXA 5A8MA 1VENA 3N9KA 1RK6A 1IV8A 1Q4WA 1R2SA 3E49A 1XGDA 1XCFA 7REQA 3VZZA 3MZNA 4FIRA 3KEHA 3FK4A 2I5QA 4KQNA 4DUXA 3DN5A 1UC4A 2G3FA 4H8UA 1T41A 4N9EA 3AIUA 3DFYA 3ZQ9A 2NUYA 3CK5A 1H61A 2O9RA 3W22A 4I7VA 5FEZA 1CECA 3SCQA 2PEVA 2WZHA 3GNDA 4ZB2A 1L6FA 3ARQA 5CJ5A 4IP5A 2WQPA 1XYFA 4JICA 4UFIA 4WY0F 1S2UA 1SSGA 2C6QA 4WEVX 3DG7A 1ISVA 3WFAA 4HCDA 2C16A 4HU8A 1XCXA 3WJWA 4IQJA 1FDJA 3MY9A 3H22A 2P53A 3WLSA 2IW0A 4JIIX 2BZNA 3G77A 1M65A 4GC4A 3LB0A 4H6EA 1PKLA 1X96A 3MWAA 5JXQA 1XM3A 3TWAA 1DJZA 4Q8TA 5A94A 4HGXA 5JMUA 2WBGA 3AS3A 4PTDA 1J6PA 1KGXA 2QUNA 1OJXA 1KO0A 2YXGA 2W27A 4I8DA 3WQWA 4A3QA 1ADSA 1EJTC 1IZKA 4PH6A 4CQAA 1KC7A 4JDBA 1WKDA 3N9SA 3HV9A 4CQBA 4Q4SA 3WNLA 2PCEA 3N11A 5HQLA 4UFMA 3EMQA 3STEA 3NPVA 1TWZA 3EDKA 3BG9A 2QZRA 3W2LA 2YCKX 3N2MA 1I2QA 3BXWA 4TR9A 1F3XA 1TFVA 5EGRA 3P2VA 5G1YA 3ECQA 3TAOA 3LCLA 3VIKA 5FSDC 3GG7A 2WNNA 5BROA 1V0KA 1FBAA 4RPQA 3PBVA 2GDQA 3WBXA 1XBZA 2FTPA 4OJYA 1EQPA 3GR8A 3BURA 4MNLA 1A5CA 3MVTA 3IARA 3VDCA 1SYTA 1GYMA 2QIWA 2FKPA 4C6NA 1IWAA 3B4YA 3WY1A 1JQVA 3N13A 2IPGA 5DEZA 4S3GA 3LGGA 1GKQA 3IIPA 4O57A 1RBLA 1MW0A 4GHRA 1KD0A 1TVNA 1IT8A 4KIEA 2BODX 3WBAA 1W91A 3LRMA 3W1AA 2FVMA 1VRXA 2OT1A 1JXJA 2QUVA 4Q4RA 1YW1A 4B5UA 1E6RA 3OGVA 5IFTA 4F2UA 3WNMA 1JGIA 2GJRA 4QJ3B 4HHHA 3D0CA 4NJIA 3UP8A 1KWKA 2VL4A 3TLQA 4GBDA 1JD9A 4AIUA 1EP1A 1ME7A 4N4PA 3NQCA 2ZWYA 3GXFA 3H4GA 2O0TA 3MP5A 3UT0A 4UFJA 4UQ9A 3S5YA 3H2AA 1H4PA 4UTMA 2ZOXA 4UTFA 2F6KA 4ZVJA 1AQMA 2FGZA 1UR0A 3QXBA 4FP1A 4CQ8A 1Z8AA 3UR8A 2GGEA 2E1WA 5F2MA 1Q2SA 2UWFA 3CL8A 3PM6A 2POZA 1M7PA 3WH5A 3OA5A 4FNPA 3CB3A 3MPGA 5HWJA 4JQ3A 1O95A 1TPB1 2BVYA 1QI4A 3ZR5A 4NL1A 2TYSA 1TTJA 4A6GA 5CC3A 2EPMX 1E56A 1QAPA 4NSBA 3VZYA 3G24A 5A3HA 1WYIA 1XL9A 3LQGA 3EX6A 1KXTA 4AH7A 1IIGA 1Z3NA 1FWTA 4GQGA 4REQA 4A3UA 1VR6A 2OPJA 1PYMA 1MXGA 1F3EA 2PDMA 2ZXAA 3EX4A 4HZ8A 4QFUA 1J0IA 2E28A 4K7VA 1TZZA 2EG6A 1ZCCA 5C9UA 4O1CA 1TMHA 2OZ8A 5BZAA 3QSTA 4L61A 1K6WA 3EWDA 2WJZA 4MLJA 4LF1A 2GJXB 4OOZA 5DMYA 1VFUA 1X6LA 5AC4A 4V28A 5I5RA 4E0CA 4LS2A 1JCLA 4GUIA 4DO6A 1JCJA 1FWEC 1S1PA 3OODA 4CNNA 1TJ0A 4C6FA 4PMYA 1UZ1A 3SAZA 4ZGYA 4PA8A 4FNQA 3BC9A 3GBDA 1M01A 3RUBL 2CLOA 4ATDA 3HV8A 4Z2IA 1BVZA 3VD5A 3R25A 4GH1A 1UPPA 2I5GA 1C3FA 5K7JA 1R8LA 2ABBA 4HNNA 1EA9C 3Q37A 3JR2A 2GPTA 2J13A 3AMDA 1EFZA 1WBHA 4HNCA 3GG8A 1MXDA 4JKLA 2XN1A 4LEQA 1DQXA 3GXDA 1XQLA 1DWIM 4WRHA 3ABSA 1SQ7A 4H9ZA 4JD4A 2OWCA 1JZ8A 4OFCA 4FIQA 1VB9A 5I03A 3EBVA 3KZSA 4ASTA 2D20A 3T09A 2E68A 3T0DA 1DE6A 1DJQA 1TR1A 1GKPA 3CEPA 2PTYA 4O17A 3Q2DA 2QULA 4IIHA 4GLEA 3W29A 1MVYA 4TTUA 3QC0A 3H7RA 1J0JA 4WKFA 1M7JA 3AS2A 3VUPA 3C0JA 1FCQA 1HJVA 3WK1A 3EKZA 2CWXA 5LIYX 3EOUA 4JTFA 4FZIA 1GZJA 2XFWA 2I9EA 3N2BA 3WCZA 3VTRA 1GJWA 1AH3A 5CZSA 2J6XA 3SQLA 3VDHA 3N2XA 3BG3A 1KTBA 1E0WA 1CXFA 3FX4A 4CQ9A 1L2UA 3G3DA 2INZA 3D3FA 1KBLA 1OG6A 3P60A 3LHTA 3O15A 3S2LA 2X41A 4PEEA 1R5YA 1QK0A 2Z28A 4ADTA 2MNRA 1E72M 3UXAA 1WOAA 4UOZA 4LF2A 4IHCA 1UD5A 2VFIA 4KT2A 2XZ7A 1W1B1 4A3YA 1IXOA 1EKOA 4AVFA 4S38A 2XM2A 4W5UA 3KTSA 3GWQA 4L6OA 2WLZA 3W1UA 1V3HA 3F5LA 4GZIA 2O7SA 2Y24A 3G8RA 4CKQA 4A3RA 4PR4A 5BWAA 3E0WA 1UP0A 2H9AB 4AD5A 1YDVA 3SRFA 4Q6XA 1G6CA 2XFFA 3LU2A 3AUJA 1GW1A 5LA2A 3FEQA 4Z2HA 4LB4A 4DBWA 2X1UA 2WNWA 5EL1A 3EPNA 3G1VA 3TQKA 1FX6A 3L5LA 3QV7A 3FKRA 1NP0A 3DHFA 3KZPA 3UPMA 1AL7A 2YGYA 4E8GA 3K4DA 1W1ZA 2YA2A 4EF9A 4RW5A 3TA6A 3GFXA 4P5UA 1GQLA 3VPLA 3VIOA 4FHAA 3BAKA 4EPKA 1JZ4A 1HVXA 3EWXA 3L2MA 4XIMA 1WDQA 4DYEA 3K13A 3EAUA 3UR7A 3GYEA 3EPOA 5D03A 3TOYA 4JIHA 4E6MA 3NZRA 3VCNA 4QEHA 2ZX6A 1XRTA 3IUHA 1TV4A 1PSCA 2I56A 2UY3A 4C6DA 1IZJA 3KCLA 3OZPA 5M1TA 1TJ2A 2QDGA 3CC1A 3NQGA 4Q3MA 2FHBA 5EMMA 2PMQA 5ECUA 4W8AA 1U1JA 1US0A 4PFMA 2NWSA 1U5JA 3HPFA 2VR5A 3K1DA 5GJPA 2YW3A 3R2GA 3ZVHA 4F2BA 4UTWC 3RCYA 3CZ8A 2E8YA 3ABQA 1OFEA 1FWJC 3P62A 4NF7A 7XIMA 1XISA 3SCRA 2BASA 4PUWA 4B9ZA 1TUFA 1I0DA 2ZZ6A 3FHQA 2YR1A 4O1FA 3LMYA 3MHUA 3BK0A 4NIRA 4U31A 1TX2A 1EZWA 1TE6A 3BW2A 1G01A 3OTRA 3H2NA 2PP0A 1LOLA 4JTHA 3GX9A 1US3A 4EE9A 2E9MA 3PPCA 3IEBA 1EUAA 4LJ3A 4CLMA 3IIVA 1R2RA 2Y7GA 1EXPA 4KCWA 1BXCA 3LA4A 3I7RA 1VBHA 7A3HA 4PB5A 1RPKA 5GNZA 4U4MA 2P76A 4JEQA 2R6OA 1KKRA 1Q8JA 1ZUAX 1DIDA 3GU9A 4IMEA 2PUZA 3WQEA 3K4AA 3EWUA 1X97A 1PWLA 1V6XA 1QNOA 3N2CA 4KCTA 4J3VA 1WOBA 4BQ4A 1TA3B 3TU9A 2BDQA 3S2MA 3LSBA 1SFJA 5AHNA 4QNWA 2ZRXA 4CUCA 4ICNA 1AZ2A 5E0CA 2BGQA 3E0FA 1PS9A 2BY2A 4E8DA 2DGAA 3MUY1 4CD7A 1E6NA 1JYVA 3S5NA 3H53A 3GDTA 1M1BA 1G7UA 3PHAA 1PX3A 4J2PA 3CYVA 2ZUTA 5KINA 2CHRA 1A5SA 5DBUA 1VYRA 3T4CA 2Y89A 4ZO6A 1QNSA 2YLLA 4HOXA 2CXGA 3LBMA 4YTRA 2E0PA 2X1IA 3UVAA 1O68A 1PYFA 4FNSA 5BU9A 2A3CA 2VC6A 1OABA 3NQEA 3W81A 1ITQA 2ZDSA 2FDSA 3WNKA 2ZX5A 2P5NA 2G5WA 4HT3A 3GHTA 1V6VA 2DORA 2WC7A 1Z89A 1JPMA 1MQRA 3CWOX 1VKFA 2QAPA 1AG1O 5CXPA 3POHA 3UZWA 1NJJA 1HKMA 3TZFA 1P0DA 2E7FA 3NR0A 2VEFA 3I10A 1ZY9A 1JFXA 2IQDA 4Z42C 1E9IA 3CZKA 3W27A 4IX0A 1U83A 3UXKA 3W88A 4S1FA 1E5JA 1XFBA 1R86A 4DWSB 1H50A 1TTQA 2CXEA 4XZ9A 2NXGA 5LNWA 1PCWA 2QR6A 3CGTA 5HATA 1P6BA 1V5XA 1MI3A 1UKSA 3IS4A 1VPXA 2W66A 2DJXA 2VP8A 3NM1A 3ZMRA 2YXOA 4IIDA 1UD2A 4KKXA 5DBTA 4S3AA 3VZXA 1H7XA 4Q7NA 4Q4PA 2FGLA 1F05A 2XVGA 1KFBA 1OSEA 1M68A 4FA3A 3NPWA 4PSPA 3L4UA 1GVOA 1BXBA 1HGWA 5CBIA 1XDJA 3G1RA 4IGMA 3CHCA 2XGIA 4XBSA 5EMJA 1MWOA 2CKRA 3C8FA 4E3VA 5LGZA 2PRLA 3M9YA 1EJ7L 4PTMA 4N9BA 2BVTA 3P8IA 4NUWA 4JTSA 1BKHA 2QCNA 2DT0A 3NFUA 4PB4A 4RR4A 4XUYA 1OD0A 2ACSA 1YQ2A 4CU8A 4H2HA 2C1HA 2FZMA 3R89A 4W8BA 4AYGA 4D1IA 5HJLA 3DESA 3SJNA 3THCA 1K70A 3LBCA 1C8QA 1SFTA 2QCDA 4ERAA 1LWIA 3M16A 5JVLA 2XGBA 5DRCA 3R58A 3C5QA 4R34A 1EGVA 4L4LA 3RLUA 8XIAA 3L67A 3FAXA 3VKCA 4D1JA 2BLEA 2HEJA 4UNKA 4ZO7A 1Q45A 2JF6A 4E3TA 4XO6A 4X61A 4PCNA 2LLEA 2ZRYA 2GJNA 4PTWA 1T96A 2OLAA 3OHMB 2ZX7A 2JKAA 2F7FA 5EFFA 3MUZ1 3OPSA 3QF0A 2HTMA 3UCDA 4IQDA 1GOXA 1WZKA 5I3KA 3VFCA 3CO4A 1IR1A 1V7AA 3NQ2A 2IXUA 2J7BA 4DQWA 4QX4A 3H4XA 1NQKA 4RLIA 1RXOB 2OJPA 4PN2A 1KRAC 2X42A 2VURA 4OHQA 2A1YA 2ZX8A 2ZTKA 4B92A 2DH3A 4X2PA 3CV2A 2Z25A 1HKKA 4WIWA 2WM0A 2YB4A 2X16A 2GGHA 2G96A 2QJJA 1E43A 3U6WA 3GZAA 5T9CE 3FJ6A 1BWLA 1XLMA 2X30A 3F7JA 4LUSB 3EA1A 4O16A 4A05A 1I2OA 2Z2BA 4CCEA 2OX4A 1MQQA 3SR7A 4AZ7A 4QE1A 1UPMB 1OX5A 1CXEA 4QAIA 2ASHA 3O6YX 2EQDA 3BSHA 4IMDA 4Y9MA 3UG8A 3GDLA 1RJPA 2P88A 3UWYA 3KL3A 3ABRA 3FJLA 1BSIA 3NM3A 4F0SA 5TNVA 1ZBWA 3D46A 2RJHA 3VDGA 2REQB 3LENA 1RLCL 2J9YA 5IBXA 4O14A 4YYCA 1EP2A 3VD3A 3W83A 2NV2A 5HULA 3LX9A 4KPLA 4Q4QA 3CHVA 1BRLA 5JBFA 3WBYA 3FYYA 3RR1A 1HKVA 5BU6A 1FFRA 2O92A 4JTTA 4ZFMA 1XLIA 4CNUA 1FY6A 1HKWA 1PKNA 3QRHA 2OQHA 2OYMA 5LXEA 2A3LA 3NDYA 2Z00A 3QR1A 2ZRWA 2Z0IA 3S0CA 5JBEA 2CBIA 4U2ZA 5JIPA 3AXMA 2VFGA 4YTSA 1Y5XA 4IJRA 2VX5A 4ZCWA 3QBUA 1V3KA 3SUTA 3QR3A 3UA3A 3DH7A 3ZT7A 3M0HA 2HK0A 1IXNA 3KTCA 4GZ7A 3GRIA 3SUWA 2Z24A 5FIPA 1YYAA 4MWAE 1EEXA 4JTUA 2F61A 3W7IA 3L4TA 1GVSA 1MDLA 2IUZA 3EOSA 3NPXA 1E15A 1GOOA 2QVNA 1JD7A 4CD5A 3W28A 8CGTA 2Q8XA 8RUCA 5A2BA 4O4WA 3T7VA 2PTDA 4O1AA 3EA3A 3E0IA 3ZS4A 1YE4A 5GPRA 2XH0A 1AH0A 4NRRA 1LYXA 2XVNA 1JG9A 3W7MA 5A6LA 1UR9A 1JDDA 2EJAA 1P1MA 3M1ZA 2VZUA 1LM1A 1Q63A 4DBEA 4HYWA 3PJTA 1FP8A 3WENA 3O63A 4TU1A 3AYSA 2OSWA 4LUJA 1P0NA 3IACA 1OGBA 5HBFA 4CCZA 4WJEA 3VC6A 3ARSA 1BXNA 2CLPA 2OEMA 2FZ8A 4QSFA 4HK7A 4J3XA 3DX5A 4YWSA 3HG4A 3R7MA 1JQXA 1DOSA 3DOPA 4BF7A 3NSXA 2PLKA 4XTDA 2XIBA 5E6YA 3M07A 1A3HA 3WLIA 2X1TA 4DBSA 3R0UA 4P8WA 4Z08A 2JIEA 1AUSL 3ITGA 1OINA 2X1SA 3RLVA 4ONVA 5CC6A 1BYCA 3UNTA 2IKJA 4MZ8A 1JAEA 1Z48A 1G4PA 3G8EA 3DZ1A 5DX7A 3CZJA 4DJDC 4HU3A 3ORWA 1GPFA 5G2HA 4YWIA 1EO5A 2RAGA 3O3RA 1H51A 3HG2A 4MVAA 5AYXA 2A7PA 1WQ5A 2DZUA 3IAQA 4YJ5A 4N4QA 1CB7B 4QM1A 4P7LA 4QXIA 2J7GA 4C1NA 1P4CA 1JI2A 4GMEA 4HHLA 4H01A 4DJEC 3P6LA 4S2BA 2PDKA 2IKHA 1BEUA 4R3UA 2A5HA 3CWHA 2BG5A 3PWIA 2DT3A 2X2GA 1OHLA 5DELA 4L5ZA 1RPXA 3CJPA 1HQTA 3VNZA 3UNDA 5D2WA 1MW3A 3C8NA 4FX6M 1QFEA 3BDKA 1ONWA 1JZ7A 3R13A 3M7SA 4Z0SA 5REQA 3PSWA 4ADUA 3G1HA 2UBPC 2JALA 3BICA 4XZHA 4AZ5A 2C18A 1CI1A 3WN6A 3W73A 4QNEA 5I00A 2G3NA 5A5WA 5C70A 2POTA 1R2TA 4LU0A 1X38A 1FH8A 2DZAA 2IMRA 1Y8BA 3BZGA 4HSNA 4MJMA 4AXNA 2PLJA 4FX7A 1PB0A 3KRBA 3MDWA 3WK3A 3LMZA 1NDYA 5BXTA 2CNCA 2J62A 2V5JA 4PCSA 4FPSA 1DJIA 3R1ZA 3LPPA 1UHVA 4MPKA 2YCLB 2QNEA 4M7TA 4EAMA 4Q8PA 2WPBA 5DT7A 1XGEA 2WCAA 1UQZA 1K6AA 4PZVA 4XVEA 4GYPC 4HCHA 2OGJA 3VIGA 3PK7A 3GDKA 5XIAA 3NDOA 5LYRA 2WAGA 1F76A 1L6WA 2PTXA 4MYAA 4IP7A 1J12A 2VDGA 2QJNA 4I9AA 4Z2KA 2W79A 3ZSTA 4GABA 3I3DA 3H55A 3DBPA 1VGAA 3OHIA 5A6TC 3T08A 4IFKA 4PCFA 1DL3A 4IG2A 4GH3A 1CCWB 3GTHA 3RXZA 4Q4MA 1P7TB 3FA4A 3TC7A 1PEZA 2PU1A 2G95A 1VLWA 3M0XA 4KW2A 2PF8A 6REQB 3RMEA 3SCVA 2J4GA 1Q6QA 4QTGA 2HCVA 2EPNA 4RNJA 3URAA 3MI6A 1HP5A 1W1PA 1EX1A 3NSMA 3WH7A 1YTKA 4AISA 2ZRVA 2CLLA 1C91A 3WG6A 1K02A 4X63A 4AY7A 1GCYA 3O16A 1D8CA 3G18A 3M4HA 1FDYA 2ZWZA 4L56A 1EA0A 4JIQA 2A85A 1VFOA 3NDZA 4K8EA 1JRBA 4LW7A 2WHKA 1UD4A 1JF5A 1GEHA 1Q4NX 1EBGA 3R10A 3WKZA 2FZBA 1WUFA 3RG6A 3RIKA 5CBBA 4L9XA 1UA3A 4IGNA 3PUDA 3SO7A 3NQFA 1HP4A 2YJQA 3VNYA 3BGJA 2VGFA 4HIBA 3DGRA 3B8WA 3GU2A 3ABXA 4P7NA 2ZUMA 4A22A 1BLIA 4ZENA 4E5TA 2HNHA 4XX6A 3F2DA 4GFSA 4EF8A 4BWLC 2ZA1A 2ZZ2A 1K7FA 1DWGM 3E12A 3AMKA 3RR4A 4CNPA 3W7DA 4IZGA 4IPNB 3RYSA 2HNEA 1EZ2A 1BQGA 3N15A 2G4FA 4S2CA 1IEVA 4XAZA 2CW6A 4MMWA 3WF3A 5HUOA 2HK1A 3EOOA 2Z4GA 4WQ6A 3A3WA 1Z41A 3TE9A 3NL3A 5FD0A 3QOKA 1DJXA 3Q4DA 2PU0A 2BY3A 3WLOA 2PWVA 5HMEA 2WVVB 4GUGA 9XIMA 1UH3A 1MW1A 5DMMA 1ZRQA 4OIFA 1EWDA 2HPMA 3N12A 5M2FX 2WJFA 4WY0A 4GY1A 4TVCA 4QJ5B 3P67A 1CENA 3LEPA 4GNVA 4HPGA 1MYRA 1UP3A 4FNRA 3NQAA 6ALDA 3TJXA 3R5EA 4ML4A 1KBBA 1QMLA 3HM7A 3KVKA 1PXGA 4S3EA 4MZ1A 5C5YA 1R47A 1XLKA 4O4VA 2GK1B 4JTAA 1D8WA 3B8IA 2PDNA 3C2RA 1SZEA 4NX5A 4JY8A 4AFYA 1C7SA 1ZTVA 2QUUA 2FLIA 4EACA 3PBMA 1O5XA 3L4YA 1K77A 2CZFA 1VBJA 3P84A 3U4FA 4GNKB 3SSJA 4DXXA 1DWJM 1A5NC 3WNPA 4R88A 2NT1A 4W93A 5FJRA 1ISXA 1KRCC 3H6OA 4WDTA 3UWVA 4O54A 2WCSA 4DO5A 3CV1A 3VMOA 3UJ2A 5K2ZA 4Y96A 3NURA 3EWWA 1K3UA 4AIEA 2DZPA 5D8WA 1E3XA 2IS7A 1T99A 4B3ZA 4QJ4B 1NP2A 7REQB 1BYDA 3J7HA 1WDRA 4W5ZA 5C9RA 4IMAA 4GQBA 2RUSA 5D2XA 6XIAA 3A4WA 5A95A 4O0QA 3N4FA 1GGOA 3NXFA 3NQBA 1HT6A 3AO0A 1Q6LA 1VH7A 2FFCA 1V6YA 3B8TA 5KMYA 1IZCA 2YXXA 1IHIA 1X6NA 4IUOA 3DYMA 3W86A 1GJPA 4LQ1A 3I6TA 1CGTA 2DT2A 3A9IA 2HJPA 4GX9A 4OECA 3WD1A 4ML9A 1EDQA 2QEZA 4MNKA 4TXEA 2E9LA 2V6AA 1SSDA 1OK4A 3DBNA 4GIYA 3RF9A 3TN3A 2Z1VA 5K4ZA 4R9OA 3BL3A 2XINA 4TMCA 3DI0A 4GZJA 1VCGA 4AIBA 1TR9A 1YLVA 3APYA 1A5AA 1ISZA 1POJA 4IIBA 4ROQA 3OVQA 1UUOA 4G8TA 1DIOA 3S9ZA 1IEQA 1P0BA 1RUSA 2QCMA 4QDPA 4BCEA 3CH0A 3BLKA 4HHMA 1LBFA 2I14A 3ZZ1A 1WAWA 2CFFA 5CZTA 2R8WA 4E2BA 3SFWA 3CLMA 4DZAA 3TWBA 3K8LA 5D9MA 4EWND 1U22A 3LS9A 4TQTA 1W5QA 1PWMA 1A53A 2PLMA 2EEXA 2R82A 1ME8A 5A8PA 1JCNA 2HQAA 3JZEA 6TIMA 3JUGA 1XRVA 1P0KA 1VJSA 4NXKA 4F4RA 1LRTA 4DO7A 5FAGA 5M5DA 1TQJA 2PFHA 2CEQA 1A5UA 2QPUA 5CKSA 4HU0A 5C71A 4ZSTA 4Q8UA 2CLEA 4JQAA 4MFEA 4XUGA 4IF2A 1W2VA 4YPJA 3BPWA 5A8OA 3W1PA 1KFWA 4DHGA 5CGQA 3CAVA 1V51A 3ZR6A 3MJMA 4E2VA 2FVLA 1K9FA 2FGBA 1X6UA 3UW6A 5KEZA 4H19A 4FO4A 2JEPA 3PZ9A 1VS1A 3RGTA 3D6NA 1TVLA 4RCXA 3CL7A 4E4UA 4UQBA 1RQHA 2EPLX 2PLCA 2VELA 3CIXA 3AMLA 2WHJA 4L1WA 4M6QA 1SFLA 1XP3A 1XICA 1PPIA 3PWAA 4K3ZA 3S42A 4PUKA 4PMJA 4LYRA 4ORIA 4DNHA 3CV6A 1W3JA 3WL0A 1Z42A 2AQWA 1KGUA 2NV9A 3TROA 1L2QA 3W23A 4L7ZA 2JF7A 3V1HA 4Q32A 2W92A 2D73A 2PODA 2ZFAA 2ZZ5A 2CBVA 2B7QA 2W9MA 2Y1HA 5AYBA 3ZR4A 1LRNA 3MI3A 3NVDA 2ZXQA 4WSHA 3FNDA 3QKZA 4H7ZA 1ML1A 2E4TA 3VGBA 3PBWA 1XC4A 2VX7A 3SUSA 1ZCOA 2PZNA 1HJSA 3UA4A 3VE9A 3FV9A 4KWVA 2QV4A 3OU8A 1KFCA 1GVFA 5I3FA 3VNDA 2VYOA 4KS0A 4LX4A 5CPLA 2QYGA 1G1YA 4NHVA 5LA1A 2XIOA 3KW3A 5F4WA 3BO9A 4LYKA 2QIIA 3VKBA 3TA9A 2VGIA 1DQWA 3LXBA 4FX8A 3WD0A 1M9HA 1P43A 3SCNA 1G4TA 4REQB 1QATA 4CCDA 1W5PA 1A4MA 4X0NA 3VKKA 4WVXA 1S2CA 1GK8A 2YCIX 2CZDA 5C9XA 4GXPA 2F8QA 2VRQA 4JXCA 3GFZA 2UV8G 1VHNA 1E6QM 4UBPC 1JNDA 1GOMA 4W84A 3RU6A 3TR2A 1SMAA 1JULA 4GPNA 4E2DA 2Q8LA 3NL6A 3ARRA 1AA1B 1B54A 1QI2A 2C15A 3BGGA 4MIMA 3IVSA 4YVVA 3W6LA 5LKYA 4LC6A 1F4AA 3GR7A 1W1VA 3UU0A 1OIFA 4ZFCA 1JCXA 1EH9A 5FJIA 2CESA 1B9BA 4HMEA 4IUGA 3DFOA 4DJDA 4AC1X 4UZUA 2EPHA 4J9JA 1OC5A 5FJPA 1MDRA 3QOMA 1XUZA 4F3HA 3C61A 4H8NA 4KEZA 3W2JA 1M04A 4X9YA 4L4OA 3G6MA 3B8SA 2XN0A 5LXXA 3ZVIA 3TAKA 2BOEX 5B7ZA 5FF2A 5DQPA 1F6YA 2NXHA 3BLLA 4DJEA 1V3LA 3MV01 3BANA 3EDJA 1AL8A 4B5VA 1V08A 2CYGA 2G41A 1I1XA 4QBXA 2Y85A 1AH4A 4NP7A 2ISFA 3S5ZA 3CPUA 1OFQA 4OBTA 4LOCA 2H3BA 2G3IA 3BARA 5IHSA 2DSZA 2WWDA 3C3NA 4EWJA 3SY1A 4XZIA 3SUVA 2A0NA 3EB4A 5C7VA 2PWEA 1FH9A 3BE7A 4LBRA 4YMZA 3C2FA 4GFIA 3QYQA 3W4RA 4B5TA 4FNUA 2WO5A 3CQ0A 1RR2A 4HKPA 3VINA 1KR0A 5F2IA 4US5D 4XIAA 4DO4A 3GE7A 5EA9A 3WJXA 2FZNA 2QCGA 2D2GA 5G2IA 3SBFA 1VEPA 3ALGA 3KOZA 4C6EA 4LVFA 1OF8A 1YBQA 2WC4A 1F3TA 1WV2A 1JPKA 1YX1A 4XAGA 4Q8VA 2DIKA 1ODUA 1W9BM 3WF4A 4IIEA 2KAUC 4MWAC 3U7VA 3V36A 2PTWA 1QO2A 1YXCA 4ORMA 1HKIA 5K9CA 5FEXA 5T8GA 5F4XA 3LHUA 1P6WA 1E4LA 4QQUA 3SDOA 2WB5A 3TJ4A 2BP1A 3GDRA 2NSOA 4KGLA 2XZ9A 4DWSD 1LT7A 3IVTA 1C90A 3LLXA 1RSCA 3MMTA 3ARWA 4EK7A 1O4UA 2ALDA 2Z6JA 1MFVA 4BEQA 3PZIA 5A6BD 5H1WA 2DVUA 1VPYA 4WOZA 1FVPA 1GHSA 1RA0A 4G6CA 1J10A 3W2KA 3REQB 2VENA 4C1LA 1W3IA 1ZQ5A 3TONA 5LHFA 4QGCA 4XBJA 2F6UA 4CN6A 3QFEA 3S1VA 4D8ZA 2HROA 3C86A 4JFVA 3VIJA 1XIDA 3EX3A 2D3LA 2CHNA 4AEFA 2YX0A 2NQHA 4AZCA 4XV0A 3RU8X 1UD6A 2O9OA 3L4VA 3ATZA 2YL6A 4DX3A 3RPTA 1KWGA 3RM4A 3UWUA 1DE5A 3WNOA 1UUMA 3QN3A 1SO6A 3TN6A 1XSIA 4PMXA 3VIFA 3IV8A 4QP0A 1J0KA 3RHGA 1NOWA 1VCVA 5D9OA 3UG5A 4ZQOA 3L68A 3AUOA 4KESA 4Z2JA 3S2NA 5AB3A 1BQCA 2DQXA 5E0KA 1H7NA 4B15A 3FSTA 3BJSA 4XD4A 3CUHA 1GORA 4OOUA 1HL2A 2CBUA 3RJXA 3EA2A 3QYSA 4M51A 3RNDA 1IGWA 3R94A 4GZEA 1PDYA 5JIWA 5E93A 2A3AA 1UG6A 2OU4A 1A3WA 4AQLA 3DUGA 3OLGA 3KBJA 3QY6A 2DVXA 4CNSA 2J7DA 1J8VA 5AHMA 4IP4A 2ZVRA 4H9XA 4MB1A 2HISA 1V02E 5CEWA 2GJPA 3B9NA 3G1FA 3ZVHB 3SGZA 1F73A 2VDHA 4JTEA 1QI5A 2Y88A 2Q01A 5HNTA 2ZC8A 4GIEA 1QT1A 2O4MA 2PGWA 3EEGA 1KRBC 2X05A 1TPWA 4CU7A 2ZXBA 3UR2A 2GGJA 1M6JA 3E9AA 1RLDA 1D7KA 3WQVA 2VTFA 1JZ2A 2ESCA 4WSJA 5C7HA 3SN4A 4LS0A 3RFAA 4CD8A 2D1ZA 3QMTA 2OWWA 3QMRA 1C9DA 4RZ4A 1KCLA 3A47A 3TJIA 4PRTA 1GQNA 2ATMA 5M3WA 2QLYA 3WLKX 4LPCA 1NFPA 2J8FA 3TYDA 4GUFA 3N3TA 3P82A 3ARVA 3BGAA 2AQOA 3TNBA 1E51A 1MZRA 1LL6A 5FJOA 3MKCA 3JS3A 1BSLA 4EX4A 4GJJA 4ZMGA 2V9DA 4KRTA 1NY1A 1CXLA 4GQ0A 4GUHA 4O0KA 2C1IA 3LHWA 3C0LA 3W7KA 3HO8A 2NT0A 3VXGA 1S3TC 1VLIA 7ENLA 4EKJA 4D6JA 1ZAJA 1A0CA 4X9SA 1WUEA 3LQLA 1OK6A 1R3QA 3CTLA 1HO1A 1T6MA 3ITVA 1MZHA 1YE6A 1JZ5A 1MW2A 3VU2A 2CBJA 3DERA 3GSMA 2MANA 3P81A 1GVEA 3BQ6A 4DI8A 3WX7A 2ZYFA 2P8CA 1EWEA 3WDHA 1WX0A 4L1GA 3GTXA 3U5YA 1VFMA 4MM1A 4B9YA 3H7UA 1Q13A 3KP0A 2J66A 2WZTA 4N42A 4FOKA 4YVPA 5J5RA 2GWNA 2WYSA 1O12A 2PP1A 3HMCA 2BXVA 4ZODA 3S46A 3T44A 1NWSA 3B05A 1OZMA 3EMZA 4FLSA 4OUEA 2NV1A 3A12A 3DGBA 4FXFA 3E74A 5G1TA 2DH2A 3JRKA 2O7QA 5KZEA 1KXQA 3W82A 4I7WA 4JTDA 3LHYA 1CBGA 1HFBA 1JDCA 1HVQA 2XIQA 3KL0A 1EJWC 2FIQA 1DTUA 1O6IA 4NJGA 2A3EA 2IPWA 1R7AA 3CAQA 3EDDA 3MB9A 4F0LA 4DN1A 4Q8OA 4PMRA 4IXXA 2HS6A 4DXVA 1H11A 1GJUA 3KTXA 2VCAA 3K2GA 4F48A 5CPSA 2CLIA 4O50A 4ZOEA 1E5NA 3EXTA 3I68A 3CIVA 4XISA 3LN3A 3VNIA 3HPXA 1TPEA 5E0FA 2VRKA 4YTQA 1L8PA 1TRIA 3LOTA 4ECLA 1RH9A 4F0RA 1HUVA 2DSUA 4AZBA 1K9DA 3UWQA 3NZ1A 2Y2WA 3L0KA 1D3HA 2JK2A 4O12A 4NU7A 1MRQA 2VC9A 4PTXA 3BLPX 3B8UA 3BOFA 4HA1A 2NVAA 1ZPTA 5RUBA 4C60A 3LD5A 3TN5A 3DFQA 2CLHA 1M03A 4B5XA 4RZ6A 2OZ0A 3WBEA 2XUCA 4MAVA 2BGSA 2DIEA 3L7RA 1V3JA 4XQ6A 3N25A 1TTIA 1KLYA 1KV5A 1I2PA 1DQUA 2GVLA 3O6DA 2VFDA 1F5ZA 1K7EA 3ARPA 4MUZA 2ZADA 4NX0A 4KFOA 2KX9A 2X7WA 4N9CA 2H6RA 3CS2A 2INFA 3CL6A 3UWWA 2Z26A 1FWIC 3GD6A 3N29A 2WQDA 3GNPA 4GY0A 4RW3A 5AYIA 1AODA 3S8HA 2E8ZA 1CXHA 4P7QA 1SJAA 3MJYA 1XH1A 3NJ3A 1OX4A 3WF0A 1PAMA 2AKMA 2WVUA 1FWGC 1T7LA 1TX0A 4N2YA 3AQUA 2PD5A 4WD0A 3DYOA 3PTMA 3URQA 2WVTA 4C65A 3N1AA 3NA8A 4L1XA 1DXIA 1JUEA 3PB0A 1SJCA 4WKHA 1PX8A 3HA1A 5F2GA 1LZOA 2JE8A 1XG4A 5A2AA 1TV3A 3IRSA 2W6RA 1G4EA 4PMUA 1TMQA 3SW6A 4PUMA 1V3IA 3UFYA 3A24A 1W1A1 5TF0A 1NFGA 1ZP4A 3RJYA 1ONEA 1E73M 3FW6A 3IK4A 4NZ4A 4DPPA 1G7VA 2X7VA 4UZSA 3PANA 1LLZA 1KBKA 3VM7A 1JYNA 1KCKA 3RX3A 1WZAA 1CNVA 3V18A 3HQOA 2PC8A 3GY1A 4IFOA 3WIJA 4AEOA 3NWRA 4ILSA 4JTRA 5D8ZA 3V35A 4LCSA 2H3DA 1WCGA 5EMUA 1P7TA 1MEWA 3HQ1A 5HQEA 5EMKA 4B5WA 1W6TA 3Q45A 5B80A 1J0HA 3MI2A 4RE4A 3VDBA 1GVQA 3AXXA 4AX7A 5LZLA 3NIYA 3MP4A 5HJYA 1SPQA 2ZUVA 3TFXA 4H9MA 1PHWA 3TW7A 3EDFA 3B0YA 5A6MA 3TTOA 1B1YA 3KXQA 2QDDA 3NO3A 1TIWA 3BMXA 1N82A 2YCEA 5IXEA 3OYZA 1Q6FA 5D9PA 4PGLA 2E6DA 4JOMA 4J3UA 3E2SA 4D6DA 1M3UA 4IMGA 5G4EA 5BMXA 1TWWA 3NUKA 4TOQA 5B7YA 4RJEA 1J11A 4LAOA 3UPWA 1FWHC 3TYEA 1XLJA 3AS0A 3O9NA 5DXYA 3LZ3A 1O1ZA 3E38A 3K30A 1EPXA 4CU6A 2C7FA 4FNTA 4DUOA 2Z1WA 3OP2A 4A2SA 1QBAA 1JYWA 3KBMA 1TUXA 3IJ6A 1R9ZA 4UNLA 3QQ0A 3NQVA 1VJIA 1K9TA 4XD5A 2J8TA 3WQGA 4WK9A 2ACUA 3AYTA 2QKFA 1UUQA 3GK0A 3PFRA 3E0LA 5IDIA 4QJ1A 4DZ5A 2R24A 2PDCA 4XZLX 5BWFA 1SO3A 3F2BA 4I6KA 3O8AA 3ZO9A 3MUCA 3PB2A 4CVUA 3GLCA 1EHNA 3NL5A 2B7NA 4KFPA 3FXYA 4UTLA 3MMWA 3M46A 2DW7A 1OCQA 1WZLA 3GH7A 4ACZA 3ITTA 1Q3NA 1EL3A 3QTGA 3F4WA 4Z2LA 2ISSA 1R3YA 4M6VA 5I77A 4WGHA 1KA9F 2EHHA 1WB0A 2TRSA 5JH2A 2YFOA 3M0LA 1E6SM 5FJTA 4MB3A 3W24A 4ZOBA 1VYPX 4PL1A 5I2UA 3GG1A 3TH6A 2PRHA 2FH8A 3ES7A 2Z27A 4J4KA 4GO9A 4KRZA 1XCWA 1DTNA 4XD3A 2XVPA 3M0JA 5FEPA 4RV3A 2DJLA 3MYOA 1U5HA 1TJPA 4MWAA 5E9AA 1FUYA 5D32A 3STPA 1UD8A 3EX1A 3MWCA 1JCMP 3U2OA 2GK1A 3H4WA 3CUFA 4C1NB 5LGXA 1IR2A 3OW1A 4AWTA 1HJQA 1V0NA 3VOJA 2DZBA 1JF6A 2FMNA 4J28A 3AAMA 3E5BA 3KRUA 3NYZA 3PAOA 1GHRA 1T8QA 3LYEA 2OSYA 3UZXA 1X8FA 1QRQA 3AMCA 3C4UA 3DXIA 3VD7A 1BG9A 4CEXC 1B4KA 4RE2A 5H91A 3VA8A 3BV7A 1XXXA 1S46A 2EPOA 3JZUA 1A80A 2DEPA 3TYBA 1J5SA 2VGBA 2FFIA 2VFHA 1S5NA 2YFNA 4PC8A 2R14A 3OEXA 2G97A 4MY8A 3W85A 5D04C 1SO4A 3FIGA 4C6CA 2BOGX 2R91A 5REQB 4E8CA 4ES4A 1QDSA 3FVDA 1N7KA 3MANA 3L4ZA 3NQ7A 3LK6A 1X7IA 1GTHA 2YBUA 3UY7A 1EC7A 4A8RA 3PZMA 4D6HA 3RPDA 3KOFA 2AOSA 1XSKA 3WMLA 1K9EA 3FAWA 1UKTA 3PVFA 4HMNA 4JTGA 3UESA 1JVNA 4GD0A 2GYIA 4P7OA 4PMZA 2Z7KA 2FH6A 1N8FA 1TJRA 3V1PA 4DPQA 3TUUA 3W3OA 3B9DA 4JKMA 4FMVA 3ONCA 4GQQA 5CZJA 1MUWA 4AD3A 3KBNA 1MMFA 4H6QA 3LPFA 1XS2A 3W72A 3UXLA 3H2FA 4L6HA 3VMPA 4BK9A 5AHLA 3G5EA 5AZ0A 1ZJAA 3QGKC 3G1DA 3WNNA 1CB2A 4V1XA 4J27A 1RAKA 3O1NA 5DCDA 2OEJA 4JNMA 2J74A 4R85A 3WMBA 2A79A 3Q67A 2J78A 4L9ZA 2I17A 4GG9A 2QCFA 2QJIA 5DXXA 3AZRA 1KV8A 3R0DA 4D6EA 1RBOB 2B0MA 2V38A 4FSAA 1XKJA 4IPIA 2DZXA 1RCOB 4IFKB 4ZB5A 1KFEA 4IG2B 5HWNA 3AHVA 2W3ZA 5BXSA 1TPFA 4GKLA 3PZQA 2WMJA 1AW2A 1T5AA 5C9WA 2WKGA 4NZ1A 5T91A 3VCCA 3EWCA 1B9ZA 3F1QA 2BNJA 2OT0A 4MNMA 4CD6A 3KFTA 4U10A 1ZENA 2WMKA 3VKDA 4IM4A 1XIIA 2WHLA 4M0XA 1V6TA 1XV8A 5I6SA 2HSAA 1LG1A 1H09A 3N6HA 4MB4A 4W9TA 1H2JA 3MDUA 1ZZMA 3I6RA 4KEMA 5FESA 1RALA 2VFFA 4F9DA 3FEMA 4M1RA 3N17A 3WEOA 4KBXA 1FWWA 3THDA 2ZIDA 4HMCA 3TQPA 2VXNA 3C0SA 2YW4A 3TK7A 2VT0A 3VGHA 3EB2A 1ITXA 5D02A 1S3HA 2H8XA 4B2DA 2VMFA 3JU2A 4Y7EA 3WDIA 4DIAA 3GW3A 4AEEA 4C6OA 3K5XA 4NZCA 3UZZA 5J04A 5U7SA 1U33A 2G50A 4QS5A 4IPJA 4ZE4A 1M53A 1NOFA 5AVNA 3LRKA 5TD4A 4TTGA 1OFRA 5FL0A 1SW3A 5D2TA 1ZFJA 3U48A 2FQIA 4CGTA 1LG2A 3G22A 1A47A 3KLLA 5I07A 3W7CA 3WLPA 3CPGA 1JPHA 1CEOA 4PE8A 4YYFA 4M6UA 3KCJA 3UERA 4B91A 4JHZA 1CIUA 4ZSUA 3KRZA 1EF3A 3BWWA 1FWNA 4JDYA 3G1XA 3L21A 4B2DD 1XYBA 4KWOA 1TV5A 2YB1A 1E9ZB 4TMBA 2YYTA 1L6SA 3QHMA 4AZHA 3TYCA 1U1HA 2F84A 2FPVA 2CLMA 3WZ0E 2PE4A 3RILA 3SB0A 2P50A 1Q65A 4MDPA 3FGCA 1LUCA 1PDZA 3ZWTA 1F61A 3TEVA 4LYQA 4FI4A 4KF1A 3PN8A 1XLHA 4DZHA 4LBSA 3PY2A 4J35A 2OZTA 3TX9A 3U0HA 4WY0B 1PO9A 1J2BA 1QBBA 2J7FA 2ZBTA 3AWOA 1S39A 3AIWA 5TBOA 2VUNA 3ZYZA 3BAXA 2DUZA 1EEPA 1UR8A 1JUBA 3KHDA 4H7VA 3OB8A 5D2YA 3CHDA 3VIIA 3CWNA 3TYZA 4JL2A 3PUEA 1B2YA 1XKYA 3KP1A 4AD4A 1HF6A 4R7WA 2YIHA 3W9ZA 5FACA 2V69A 4DJFC 1WNOA 1KBIA 1F7BA 1H62A 1JI1A 3F4VA 2DV0A 1I60A 3POCA 3GDMA 4QCFA 5AHIA 1PIGA 3W26A 4J5NA 5BYWA 3MSGA 4G7EA 4F8XA 3PZGA 4GGHA 4LYPA 1VEMA 1C8XA 3LNPA 3GNXA 3FDKA 3K8KA 4LRSA 2PI6A 4O53A 3M5YA 2XWEA 1GZ1A 1QOXA 1DIEA 4HZ7A 2HZGA 4HVXA 5CC5A 4GNJA 4RPPA 2PS2A 3NTYA 2CWNA 5LIKX 1W3KA 1P1XA 4M56A 3UD6A 4Q8WA 1GOKA 1QOQA 2GSJA 4W8LA 1ZJBA 4UR9A 1YMYA 2PDPA 2TSYA 4L65A 1W1IE 2VM8A 3QPYA 5CJMA 5BRBA 1P0EA 5AVHA 1RCQA 3EMCA 3W2UA 1GNXA 1UR3M 4Q4KA 3HIJA 2DZTA 4XSMA 5HJXA 7CGTA 4FEZA 1BAGA 1KLZA 1TV8A 2O4QA 3XISA 2GUYA 2ZZ4A 5EY5A 2PDIA 2J6VA 1XLGA 3LCIA 5CSUA 4QLKA 3CZLA 4RZ5A 1YNQA 3TNOA 1KBJA 2DP3A 2PDLA 4P61A 1GQKA 4FOJA 4YIWA 3GXMA 1T8XA 2R9RA 4M80A 2BHZA 4N7QA 1RD5A 4IOTA 2NUWA 3PR2A 1HN1A 1QVBA 3FHAA 3R11A 3S6DA 1WXJA 3GU1A 3T0CA 3UZYA 3KAOA 1MUCA 3AIVA 1E71M 1THFD 3AU2A 3LCFA 4Q7BA 1QTWA 4AY1A 3VILA 4FLOA 4GJIA 4K37A 4Z2GA 1E6ZA 1EUNA 1G94A 4OQVA 1Y5WA 3WH9A 2GUBA 2RDWA 3L2IA 2A2IA 3JVAA 4M82A 4TX8A 1UP2A 4MNJA 3LBOA 1I0BA 3LI1A 4JR5A 4ZR8A 1PCKA 3PBGA 2XDFA 4H8HA 3CT7A 2W62A 4H9VA 3T2QA 3LUTA 3VAVA 1XIJA 3WD3A 4AHPA 4W7VA 4C6KA 3W7QA 1UZDA 3LNMA 2YL9A 4NQ1A 2QAFA 3REQA 2PDUA 5KZ6A 5DY3A 2R1PA 4YVXA 1W54A 4KETA 3V5CA 4Z0JA 3TQ0A 4G1NA 4EPBC 3ZOAA 3ATYA 4WSKA 3TOPA 3C56A 3MO7A 3DG6A 3HGSA 4HN8A 2ISVA 4IJBA 1IEWA 2YDRA 1XLBA 3JW7A 4IPLA 4AWUA 3TV8A 1WPCA 4JX6A 5C54A 3T6CA 2YOCA 1A0DA 3ARXA 2IKIA 4US6A 1OZQA 4TX9A 1WZMA 2X0YA 3KL5A 3VKAA 5LA0A 3S6OA 2GOUA 1A49A 1E0UA 2C13A 5D4YA 4NZFA 1I9CB 2QW5A 4WJXA 2EO7A 5HK4A 5HOSA 2TPSA 3KWXA 4B4HA 1KNWA 1GOIA 3QFWA 3I6EA 1F6PA 2FB3A 3C2VA 2VUYA 4IJCA 3VC5A 3S6TA 2XM1A 3NQMA 5C0QA 4F0KA 1P6CA 4UNIA 1AQHA 3T0BA 5EFDA 2Y5EA 2GSEA 2BMBA 3ARUA 3T4WA 1OADA 1XHGA 2XPKA 4I8YA 4RDZA 3GKFA 3QV9A 1YDOA 1H41A 3NNTA 3BAJA 4HP5A 3B0PA 1OG0A 1DWAM 1DP0A 5AOUA 3PBYA 3BLIA 3WK0A 2EJ1A 1J01A 1LTDA 3GHSA 2VKZG 3CQKA 5E70A 2VZTA 2D23A 4C5YA 1NWTA 1SR9A 2AAAA 2WXDM 4JHMA 2EG8A 3Q94A 1KFJA 4HPXA 5KTLA 3PWGA 1O94A 1U5VA 3IPWA 4NZJA 4M6PA 4UR8A 1VC4A 2ZE3A 3NAVA 1OB0A 1LQ2A 2J27A 1H60A 3SM0A 3WLJA 2ZUUA 4Q6JA 2P3EA 5BOEA 3OZOA 3FA5A 1N55A 3V0UA 1C93A 3RCMA 1A5LC 3WF2A 3K4WA 4N02A 3C2OA 1JDFA 1V8EA 1W8GA 4IMCA 2VD8A 4PUEA 1KM1A 1EYEA 5FF0A 3PUGA 3OGRA 3DAQA 4NAFA 4UOQA 5I3IA 3EXSA 3LTPA 5I0DA 4WDUA 2W91A 3QHOA 5MHBA 4ZXLA 3B4UA 2OELA 1OCBA 2VC7A 4AW7A 3IJ9A 2BHYA 1XDMA 2WSRA 4O52A 3WQCA 4AUBA 4H7CA 2ZUWA 5I09A 2Q3RA 3T0AA 1M7OA 3HJZA 1LLWA 3HTWA 4RDYA 3VNKA 5HR7A 1KFLA 3NZPA 1X1OA 1PUDA 3BLOA 3KVMA 5CGTA 3BSMA 5U4NA 2VO5A 5HANA 4FR1A 1FCVA 3KRSA 4XO7A 1DWFM 1R3WA 1VD6A 1DJGA 3UJRA 3SCOA 1CDGA 1Z7AA 2B7PA 4JYDA 4HJFA 3WQDA 2R1NA 3O0FA 3GVQA 4HNOA 3I7QA 4NJKA 4C6JA 1EDTA 1XYMA 2QCLA 2YDSA 2QDHA 4AZ6A 2PC4A 4ATWA 4JFTA 2Y7EA 1QPOA 2UY2A 5D33A 2UZ9A 4TX6A 3PZOA 1LQAA 3GIQA 3AXIA 2ZZ3A 3WBWA 4F40A 4O15A 1B3VA 1YBQB 4J1OA 5HPOA 3W74A 7TAAA 1QR7A 3S1WA 3IJ8A 3GYCA 2PWGA 4WF7A 5KETA 4AZGA 3I3EA 3HQPA 1PIIA 1QO5A 1OT2A 4MLRA 2VRJA 5D38A 3WMCA 5AKQA 3MZ2A 2VOMA 4DRSA 1R46A 3WLTA 2PGRA 3WD4A 3VIPA 4AC7C 1QXLA 3LZ5A 4L6DA 2AAMA 4H4IA 2VQUA 2QHAA 3AJXA 3L0NA 2PD9A 1QPKA 3USZA 3GC2A 5CLTA 4BQ5A 4LCRA 3RM9A 1W3NA 3N19B 5F2LA 3ITOA 1JNEA 4IL0A 2Q71A 1Q66A 4MKSA 1W5NA 2AMXA 4AB4A 1TWSA 1V03A 3WEMA 6CGTA 1TE1A 2J8GA 1XINA 3WLHA 3GNRA 4J3TA 1AJZA 1Z6KA 3CMJA 1EGMA 4LVGA 3T78A 3SRDA 4IQEA 1CT5A 4O0ZA 4JTJA 4CD4A 4LAMA 4NJJA 3MQTA 5FAJA 1EOKA 1UWUA 2FPYA 3EOLA 3HFYA 3AOFA 3IANA 1UC5A 3O2LA 5D37A 4AZCB 3AHYA 2RFGA 4X60A 1YDYA 1O5QA 2OOFA 1LWHA 1A5BA 4ERIA 1A3XA 4ZO8A 1VYSX 5IRPA 2C14A 4IGSA 2ZUNA 4IXHA 1W37A 5J5DA 3GTNA 4GXMA 3GXTA 1KM0A 5I3GA 2DU2A 1UB3A 1E1FA 1Y65A 3C2YA 4AF0A 1O66A 1UIPA 2ALRA 3IUDA 3UVIA 2D0HA 4JX4A 1E9LA 3LSCA 3AC0A 1I1WA 3GNNA 2AMGA 3A22A 4I90A 2XWDA 5CAHA 4NNBA 4UQDA 1UD3A 5JUVA 1J93A 4B4FA 3B9AA 3V0SA 3NCOA 4Y9AA 5E6ZA 4AU0A 4NXSA 1F8MA 1RJRA 4LUYA 2HE5A 3VKJA 2VHLA 2XU2A 5AC6A 1REQA 3H8AA 4EAYA 1UKOA 3W01A 3VGDA 3IIXA 2G4JA 3T0TA 2Z1KA 3U4AA 2E5BA 3WJSA 2PTZA 3ITCA 2V5LA 4RKAA 3THAA 2G3MA 5FSEC 3PC0A 5T9BG 3BLEA 4AD0A 2X1RA 1FCBA 3SURA 3QC3A 3T07A 1HG3A 2ZICA 4DELA 3SCTA 3G1YA 1QI0A 4TV5A 4HNTA 1NSJA 3WELA 1Y5VA 4PMVA 1ZSXA 2NQLA 3AU6A 3KCOA 1FQ0A 3PG9A 4GVIA 4HPHA 3N14A 4XAPA 5C2XA 1KQZA 1QNPA 3UGRA 1UR4A 1XLDA 5BOFA 4URIA 2GZXA 3RMJA 2GQ8A 3NGJA 1UWQA 4MY1A 3QLDA 3OLDA 2V82A 1UJPA 3K46A 3NL2A 3M5VA 4R33A 2Z29A 4GCAA 2Y7FA 1VP5A 4LSBA 1F74A 2RDUA 4O1DA 1OBAA 1TPC1 3M6DA 1JFHA 4I9MA 1LDCA 3LTSA 2YLAA 4DYJA 3V75A 3OZMA 1GT8A 4W85A 4G9PA 2VVSA 1YIXA 5AYYA 3M47A 3W7GA 3AIQA 1GWJA 1TPH1 1ZLPA 2F9RA 4HN4A 2QPXA 4JL1A 2E9BA 1UQYA 1AW5A 1V02A 3BVJA 4XG1A 2HWGA 1FWDC 4MY9A 1XYZA 1W9XA 2Y70A 3A13A 1JXKA 1XIBA 1EB3A 4Y9PA 5H8MA 4HTYA 4D2JA 5KITA 5F4SA 6A3HA 4DM1A 1VFSA 3ELFA 4ZQNA 2V68A 3SUUA 4CNOA 2QUTA 4JBRA 4LT9A 4E4FA 1DXEA 1E4MM 3S5OA 2X0HA 1EJXC 3CBWA 4XB3A 3E2QA 1TWDA 3P80A 2VR2A 3FA3A 4DLMA 3CIWA 1GQIA 3PPGA 1ZJIA 2UY5A 4BHYA 4Z1AA 3PTDA 4YLWA 4NILA 1Q7QA 5C9ZA 3E2RA 3PZTA 4UTUA 3MS8A 1BGGA 4WKAA 2RKXA 3W7HA 3S9IA 1T0OA 1LT8A 3GUGA 3P93A 1LF1A 2DY3A 4JCLA 3CQJA 4AG0A 3RAOA 2WVSA 2NVDA 3MVIA 2JQXA 2A3HA 3H2MA 1S1RA 2OGYA 1GUVA 5SWUA 1O7AA 2J7CA 1KFKA 1Q5MA 4HNUA 1XFCA 4HNLA 4MGGA 3ISIX 2OO6A 1IQ8A 2VX6A 3N6QA 1LQ0A 4H00A 1WO2A 3N73A 4IT1A 3WEZA 4GC3A 1UH2A 3A9BA 3VFLA 5H6HA 3SY5A 3HMJG 1LJYA 1ZGDA 2SFPA 3ICJA 4H6KA 4Q33A 2VZSA 1UOKA 3LG3A 2E40A 4U5IA 4WX2A 2V67A 1NWUA 9RUBA 2WZIA 1V7YA 3EXRA 4LGXA 2P0IA 5J8LA 4JYFA 1TVPA 5DMNA 4C90A 1KW1A 3HPZA 1DPMA 3W00A 4QDMA 5TAOA 3O0KA 2Q3OA 4QR6A 4Y8FA 4PRWA 2WCGA 5JBDA 3M0VA 4H1ZA 3GH4A 4L9YA 1PJ9A 4S23A 3TSBA 1B3OA 2I9UA 2FMOA 1CX9A 3BJTA 3PG8A 1J2WA 1ZU8A 1HL9A 2VCCA 3W87A 1Q6RA 2NVCA 1OIMA 1B57A 5GVJA 1OYCA 2E77A 3IRDA 3V3WA 1HO4A 1UIOA 2D2JA 1RCXB 3P0WA 4PMNA 1MQPA 3W02A 3LTYA 1XW8A 3VNMA 2VCBA 5GQBA 3WO8A 4KCUA 3H7VA 2EKCA 2J47A 1JZ6A 1SJDA 5GNYA 2WMGA 4AIOA 3CQIA 4LNYA 1JIBA 4UMBA 1NFBA 3DKJA 3LV6A 5D05A 1UJQA 3VM5A 3SJ3A 4PBFA 1XR2A 3VGFA 4IFRA 3ITXA 4JCMA 3UPBA 5JH1A 4E2OA 3HU7A 2XIMA 3MSRA 5G1MA 2XFRA 1B31A 1XIHA 1OX4B 2VX4A 2ZA3A 3B40A 2UY4A 5E5CA 5DFAA 1H0GA 3BW3A 3ARTA 3UJFA 4WDXA 5A8NA 3GBEA 1B3ZA 3U7BA 2R94A 4LH8A 4GYFA 3L23A 3THUA 1LORA 4IMFA 1SW7A 1J4EA 1XG3A 2O9PA 1OC6A 3AROA 5H2ZA 1B3XA 1PTGA 2PBGA 3R4IA 1OX6A 3VVGA 5GJNA 3WDQA 3UG4A 5I3DA 4OBSA 3WQFA 1OY0A 2A21A 4I5UA 5LIWX 2J75A 3MUIA 2CLFA 1W9VA 4YL2A 1DV7A 4JTCA 1WXZA 1E4NA 1QPRA 4K39A 2GDUA 3L66A 1SZNA 3U8GA 4KRUA 5E1QA 2XVLA 2PWHA 4A8IA 1UA7A 4UTWA 3W6MA 3SI9A 3G1SA 1ADOA 4XD6A 5CPQA 3W37A 2OTDA 5F7UA 3LLDA 3SCWA 4GJ1A 3WLRA 1QNQA 2QCEA 3AXHA 3BZJA 3CAKA 1XIFA 3QQ1A 3MO4A 4DI9A 4DWDA 3HGRA 4PUUA 4IWWA 5IBXC 4C1KA 2Q8ZA 1QHPA 3MHFA 5HDRA 3MKVA 5CPNA 4LB3A 4EP8C 4GI6A 5CPOA 4DUWA 3HG3A 1XLFA 1M41A 4AWSA 1IT0A 2ZXDA 4JFUA 3SRKA 4RNIA 4RK8A 3W1TA 3GHUA 5DF0A 3S5SA 4NKCA 1UWAA 3GAKA 5C2CA 1PVNA 4I5XA 4LCQA 1HJWA 3AIRA 4C7DA 4U2YA 1BHGA 1BWKA 3ZWSA 1YPFA 1IEIA 3W7OA 1Q6DA 3W75A 2CCRA 1LL4A 3NEVA 4E38A 4RX0A 1RBAA 3E3HA 1ODZA 3PZNA 2C0AA 3KBVA 1CLVA 3A23A 2D0FA 3LGEA 1QPQA 1A5OC 1B0IA 1CYGA 3MSYA 3CHEA 2DW6A 2P10A 1EC8A 4NNCA 3MA8A 3KUMA 3THQA 1VJZA 3DIPA 2PDQA 1XUUA 3W1RA 5DMLA 4J2MA 5K9DA 2WKJA 2B31A 3RPMA 2JFEX 1SU5A 1KQYA 1UCWA 1Y0EA 4QCEA 5I78A 2YDQA 3P7YA 4ZTYA 3PZVA 1J18A 1RVKA 3CB8A 1PTAA 3V5FA 4KIRA 3MUAA 1BTMA 2W0UA 4G7FA 4WR3A 2V30A 2YZRA 5GJMA 2PCQA 5BXPA 4CVWA 5DCEA 3G1AA 1WKEA 2WK2A 4OVXA 4AD1A 2VDIA 3IJQA 4PUJA 3W53A 1MRAA 2KZHA 1UR1A 2HV5A 1Q85A 3NOEA 4ACZB 5M17A 1WE5A 3R6IA 3A6OA 1UOZA 3VD4A 2CERA 5M03A 2C3ZA 1QW7A 3PS7A 4MB5A 4L4PA 2DZSA 4BY3A 2QPSA 1FA2A 3IAPA 3EEZA 5ABFA 1VBRA 4W87A 4TUFA 5FF4A 4RUBA 3VOHA 2FZDA 2XIJA 4NZ5A 5LNRA 4FXRA 1NDVA 2Y61A 9XIAA 4GIRA 4LRTA 3OGSA 3STGA 4MJ4A 1R30A 4QSHA 1W17A 1BVWA 5CH9A 1UMYA 4YHEA 4K8HA 4ACYA 1E6XM 4JN7A 4MWAB 1V6UA 3PP7A 2PDHA 2E25A 1OC7A 2NX1A 2ZZ7A 4LWWA 4OUIA 5FI8A 1QK2A 3QPEA 1YDNA 4PUNA 3W25A 1ZP3A 3CV7A 1W3LA 4F0MA 4PODA 1A0EA 1AMYA 1EJRC 2IQTA 2WMHA 3QGVA 1A50A 1NIUA 4NG3A 3L2LA 4UQAA 1ICQA 3DI1A 3AISA 4WDWA 2QVHA 5MKGA 3BAYA 2GLKA 2DVTA 3PUOA 1IEXA 1XLCA 4C5ZA 1XPYA 4F2TA 1TPDA 4D71A 2G3JA 3VNLA 4DF2A 4IIFA 1KM4A 3VI2A 1KRMA 1JDAA 2F6XA 1QWGA 3IGHX 3SADA 3QW4B 1P48A 1FDZA 1DYSA 1ECQA 3N18A 1H7RA 2XYLA 3BMWA 3AWNA 3ARZA 3OIXA 2BVDA 3MCNA 1WKFA 2WSPA 1W1TA 3P3BA 1VAHA 3ZJ6A 3DFSA 1JR1A 3BOXA 4KWSA 4PCPA 1AJ0A 2HDJA 2A4AA 4GE8A 1XGZA 1ZS2A 4PTVA 1FWBC 2D3NA 1XIGA 5TIMA 4QE4A 4QEEA 1E4IA 4QG8A 5HMFA 3CO8A 3GZ3A 2NW0A 3U3HA 1R85A 4DEFA 1B90A 4C6BA 5C55A 5LIXX 2QF7A 1Z32X 2ZKMX 4DXKA 1PZ3A 1F9CA 4XKMA 3GR4A 5FKYA 2X0SA 1E0TA 4PULA 4B5SA 4EANA 4Y9NA 3PULA 1BKSA 4H6RA 2QGYA 1A5MC 4QRNA 4DNMA 4NRSA 1QNRA 3DC8A 3MP3A 3CUXA 3TC3A 3R12A 2NWRA 1CLXA 3M7WA 4GCXA 2J79A 1KCXA 5EPDA 4X2RA 3BCDA 1V3MA 3TTYA 5ECVA 3TCEA 3BCJA 2BGNE 1OFBA 5BMWA 1E40A 3PPHA 3FYOA 4PYSA 4G1KA 3ZLHA 6XIMA 4W88A 4YCPA 3W2MA 5K4XA 4JQ2A 3F4NA 3ZIZA 1RY8A 3F5JA 3T2PA 5A8QA 1GVYA 1CZ1A 4N6FA 1K8ZA 3FDGA 1WAUA 3AYVA 4K68A 4LS1A 7PTDA 3GVGA 3ME3A 3UY8A 1MO0A 1HW6A 1K03A 1YHTA 2XISA 3CEUA 1UKPA 3BUVA 1TG7A 3U2CA 3DHPA 4HTBA 4DLFA 3IIOA 2GUUA 2ISWA 4PFHA 3MSDA 3P5ZA 2V3EA 3WDPP 1UMLA 4KWUA 5FJUA 4GWEA 3BQ5A 3ES8A 2VQTA 5GNXA 7TIMA 2CHOA 4Y6GA 4QLJA 3DG3A 5AN7A 4O18A 2WM1A 3SCUA 2YCJA 4FALA 1GG1A 3IJDA 1S2AA 3WLLA 3VE7A 4D6GA 1BF6A 1R0MA 4YHGA 2ON3A 3TSDA 4QG6A 4AHOA 3IGXA 2NQJA 4P8XA 3NOYA 4HK5A 1IXQA 2I1OA 2E5CA 3V5OA 2QS8A 1DIKA 2ZRZA 3H54A 2BHUA 3VGEA 4FK9A 4FF5A 3RLHA 4EOUA 3TDFA 2HRWA 2VD9A 4R53A 3B3DA 4DYKA 3ANYA 3OQ8A 6ENLA 3URBA 5HR6A 4NT0A 3Q65A 1SR0A 4WCJA 4M29A 1ZBVA 3S2JA 3KE0A 5A6AA 1L6GA 2PDJA 3GFYA 2QJMA 1F3WA 3V16A 3W1LA 3INPA 2FZ9A 3WLMA 1E9YB 4B90A 2ZX9A 1PBGA 1BG4A 2ZQ0A 4XKYA 1E3ZA 1UW9A 4D6CA 1SGJA 2A6LA 2J7HA 1EIXA 2P3ZA 1IIHA 2VWSA 1XQKA 3AMGA 2WW5A 3EWBX 5AECA 3RN6A 3BV4A 3FGCB 1PE1A 1LUCB 1KR1A 1DBTA 3WUEA 2FVKA 3PPFA 1D9EA 4XK2A 2JBMA 4AYSA 4AXKA 5AC5A 4UCGA 1X39A 3TQVA 3ALFA 2ZVIA 1E1CA 1OGSA 3KS6A 2Y8UA 3LRLA 4LTSA 3D5HA 3H2CA 3TXVA 4PMQA 1EIBA 3BCFA 4HCLA 2YSWA 1Z9AA 2H90A 4NY2A 2QDEA 3DYPA 1LOSA 1F2JA 4CQDA 3BMVA 2CPUA 4JTQA 5D2VA 2ZE0A 4C6QA 1EQCA 4F79A 1H7OA 1C8YA 1XYLA 4G7EB 1GKRA 2NQ5A 1K4GA 1ITCA 4HMDA 1JCYA 2D22A 3LCHA 2CETA 4D6FA 3LPOA 2DPEA 3EOEA 1XWYA 1OCJA 5HUPA 1PX4A 1D3CA 4GXWA 2NUXA 4K7YA 1ISYA 2P8BA 3C6CA 3OOQA 4UTTC 1J9YA 1AZ1A 1NH6A 3EKGA 5G4HC 2BVWA 1I2RA 4H04A 4DB7A 2NX9A 1V6WA 3VGGA 3GTFA 4AVNA 1CW2A 1HXJA 3R79A 4YU1A 1H1NA 1RP9A 1W3HA 3VOGA 1WDDA 4RXFA 5FEWA 2PDXA 3W1QA 2ZRUA 3WUBA 3N2TA 3L5MA 2I5IA 4MOZA 4OV9A 3N3MA 3MUXA 3RRAA 3W84A 1ICPA 2JGYA 3MBDA 4QITA 4DJDD 2DFAA 2C8NA 3V4BA 4FB7A