3D3FA

Crystal structure of yvgn and cofactor nadph from bacillus subtilis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
275
structure length
275
Chain Sequence
PTSLKDTVKLHNGVEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSNFQVHHLEELLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALNKDERVGPNPDELLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords YvgN protein
publication title Structural and biochemical analyses of YvgN and YtbE from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 99
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.1.1.283: Methylglyoxal reductase (NADPH).
pdb deposition date 2008-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3d3fA00
1X97A 1PZ1A 3KRBA 3H4GA 2F2KA 3LUTA 3UP8A 4JQ1A 5JH2A 4AUBA 2IS7A 3ONBA 1PWLA 1YE4A 4L1XA 3LENA 1IEIA 1AFSA 5M2FX 3O3RA 2BGQA 4XVDA 2ACRA 4IGSA 3BUVA 3V0SA 2ALRA 4FA3A 5AZ0A 5KETA 4DBSA 1XJBA 4NKCA 2IPWA 4XO7A 3GHTA 2ISFA 1XGDA 3H7UA 4WDTA 1MI3A 1EKOA 1ZQ5A 3UFYA 4JQ4A 4HBKA 2PD5A 3M4HA 4GACA 2PDGA 5HA7A 4ICCX 3LZ5A 3UZZA 1Z3NA 3WBXA 3CAVA 2I17A 3H7RA 2IKJA 4PR4A 1LWIA 2R9RA 2PEVA 4HMNA 1UR3M 2IKGA 3EB3A 3EAUA 3U2CA 3VXGA 2PDIA 5DANA 4FZIA 4WEVX 2R24A 3UYIA 4WGHA 4G5DA 3GHSA 5LIUX 3N2TA 3Q67A 2HVOA 2FZDA 3R7MA 3V0UA 1RY8A 1YNPA 2A79A 4LB4A 3P2VA 3MC5A 4ASTA 4GQ0A 3WBYA 5LIYX 1LQAA 2PDYA 1HQTA 3LQGA 4DBWA 4FALA 2PDFA 4WDXA 1FRBA 4RPQA 3R6IA 3D3FA 1AH0A 2C91A 3C3UA 1YNQA 1EL3A 3O0KA 3T42A 4R9OA 3MB9A 3LBOA 4YVXA 3S3GA 3RX2A 1T40A 1GVEA 3UG8A 4YS1A 5AZ1A 3LD5A 1PWMA 1S2AA 4XK2A 4FAMA 2I16A 4YVVA 2WZMA 1RALA 2PDJA 1PZ0A 4Q3MA 1ZGDA 4YU1A 4JTAA 3LZ3A 3G1RA 2IPGA 4GIEA 1AZ2A 3R8GA 4IJRA 3RX3A 3FJNA 1A80A 4JQ2A 1AZ1A 3GUGA 1Q13A 2PDPA 3V36A 1ZUAX 3DN5A 1MZRA 3V35A 4JTDA 1R38A 1VP5A 2IPFA 2AGTA 4LAZA 1T41A 3WG6A 1K8CA 4PUUA 2PFHA 3M64A 1Q5MA 4GABA 4PRRA 4H8NA 1MRQA 2HE8A 3UGRA 3BV7A 4H7CA 1QWKA 1X96A 4WDUA 4EXAA 3R94A 1J96A 1XF0A 2PDUA 4LBRA 2BP1A 3FX4A 4XVEA 1Z9AA 2DV0A 4JTRA 2PDMA 4XZLX 2ACQA 1YE6A 2FZBA 4GA8A 5LIXX 2IKHA 1SM9A 1C9WA 2FZ8A 1Z8AA 3N6QA 3CASA 4QXIA 3CV6A 3G5EA 2PF8A 2F38A 2PDCA 4OTKA 1HW6A 1S1RA 3Q65A 3LN3A 4JTQA 4PMJA 3R43A 4XO6A 2INEA 4Q7BA 2DUZA 2NVDA 5JH1A 4LB3A 2PDLA 4XZMX 1RY0A 2NVCA 2PD9A 2VDGA 3V0TA 2FVLA 1IHIA 1Z89A 3LQLA 4I5XA 3WCZA 1M9HA 2IPJA 5LIWX 3NTYA 5HNUA 3GHRA 1ZSXA 2HE5A 1S1PA 4JTCA 4JIIX 2ACUA 2IQDA 5LIKX 2QXWA 3BCJA 4WRHA 3COTA 1EF3A 4L1WA 3F7JA 3CV7A 3CMFA 3DOPA 3RX4A 4XZHA 2HEJA 2PDHA 3M0IA 4QR6A 4XZIA 3UZYA 4ZFCA 2WZTA 1AH3A 4YVPA 4PUWA 4IJCA 3LNMA 1VBJA 4JQ3A 3B3DA 4EXBA 4GCAA 4JQAA 2J8TA 1JEZA 3R8HA 4XAPA 2FZ9A 1AH4A 2PDBA 2HVNA 4WDWA 2P5NA 2BGSA 4GQGA 3GHUA 2PDXA 2PDKA 4PRTA 3QKZA 2FGBA 1OG6A 2HDJA 3ONCA 3UZWA 4QX4A 2PDNA 3BURA 4DBUA 2IKIA 4JIHA 1EXBA 2IQ0A 3ERPA 2ACSA 1S2CA 3LEPA 4QBXA 1PYFA 2DUXA 2PDWA 3UWEA 4MHBA 4F40A 4LBSA 3UZXA 5C7HA 4LAUA 2CLPA 4XZNX 3R58A 4DZ5A 1US0A 3EB4A 4JIRA 2PDQA 2INZA 2PZNA 2HV5A 1ADSA 1X98A 1QRQA 3CAQA 5HNTA 3WBWA
chains in the Genus database with same CATH superfamily
1ZAHA 3LPFA 4A35A 3E0WA 4KCTA 1KM3A 4XX6A 5A69A 5IXEA 3WLIA 3LENA 3LPOA 4RNJA 4QNWA 6TAAA 2VQUA 3SUVA 3O3RA 3N6HA 5BW6A 2ADAA 1ONWA 5XIMA 5D04C 1VYPX 3VIIA 2P53A 1E6QM 2C1IA 1V77A 2JQXA 5AZ0A 1UP0A 3CUIA 4MWAB 4DBSA 2RJGA 3BLIA 5G4HC 3VZZA 3DFSA 2DIEA 4O28A 1BEUA 4XD3A 4IMAA 2YXXA 5AYBA 2Q8XA 3G1XA 3OTRA 3W7JA 3VD3A 2Y7GA 1XXXA 1V51A 3EXSA 3T0BA 1UR2A 2UBPC 2A7RA 2BNJA 4RLIA 4JTHA 1O5QA 3GG8A 1DKWA 3VIMA 2A85A 2ZA3A 3CWNA 5DT7A 4JYEA 3B06A 4HOZA 1JXJA 1Q66A 1E4LA 5BROA 4EKJA 1K4GA 1GT8A 3QMSA 1SMDA 4BCEA 3PJTA 4V33A 3QTPA 3N11A 1OX4A 3B8VA 2IKGA 5AYZA 4W84A 3SFKA 3VXGA 1FWSA 4QE5A 4WR3A 3AFBA 2DZPA 4DN1A 3FW6A 1V03A 1Q4NX 3ABSA 1V3LA 3W4RA 5A8OA 4LB4A 3S6TA 2VDIA 3WQDA 1DHPA 3P2VA 4BK9A 3RN6A 4OGZA 4DXKA 1LQAA 3EWBX 3QRHA 4G8TA 3VA8A 3TE9A 1KXVA 3LI0A 5FKYA 4E6MA 4K68A 1XL9A 1ZTVA 3NL3A 3VC5A 3N2XA 3RCMA 3MA8A 5D2WA 4GQQA 1TJ0A 2OQLA 4FI4A 4WDXA 1AH0A 3N17A 1KRCC 2Q8LA 1ZY9A 1L2QA 5KSWA 2PB1A 3R0KA 1Y8BA 3PTMA 2WCSA 4AIOA 3QXBA 4AFYA 2R94A 3B8UA 3IV8A 2VR4A 3T42A 4HN4A 3EX4A 2Y6ZA 3DI1A 2Q3OA 1M7PA 5EBUA 1N2VA 1Q63A 3ECQA 4EPKA 4LAOA 5EMLA 3VAVA 3PN8A 1BWKA 2P3ZA 5AVNA 1YLVA 4HU8A 2VKZG 2XVLA 2WZMA 4Z2GA 1WV2A 1TKKA 4UCGA 2JE8A 4B16A 1TCMA 1JF5A 1A49A 4KRUA 3R11A 1E73M 2X16A 1POJA 3MHGA 3T8QA 2V5DA 3CU2A 2RHGA 5DBUA 3DECA 1B3OA 1NELA 1R3SA 1F4HA 2INFA 2PDPA 1A5SA 3BLDA 3CAKA 2VVNA 4LVDA 3L65A 1UC4A 4KS0A 3U4FA 1XSKA 3S1GA 3I7QA 1IEXA 1CXHA 1LYXA 4CD4A 3BAXA 3GR7A 3UWVA 1ZBWA 4ZOCA 4UOQA 3NXFA 1RXOB 1R2SA 3CQKA 4XZWA 5K3VA 3OBEA 1MRQA 2VHLA 1VLIA 2BOEX 1DQUA 3H2MA 4L80A 4ERIA 1MFUA 1PL9A 1R3QA 4J3VA 4WDUA 1N7KA 2RGMA 4ZO6A 3QQ0A 4O1DA 3EMCA 3ES7A 1T7LA 2PWGA 1JGIA 4XVEA 5CC3A 3QMTA 3TYCA 3WD0A 1TPEA 1QR7A 1JDCA 2ISVA 2UZ9A 2H8ZA 2IKHA 4M5PA 1SM9A 4GVHA 4AZ7A 1ZFJA 1JAEA 1TUFA 1Z7AA 3VD7A 2PGWA 2R8WA 4FNTA 1REQA 3G1SA 5I00A 1XM3A 3ZR6A 1R8LA 4X22A 1XBYA 1FWDC 1TPC1 4QDWA 3VUSA 3KVJA 3SZ8A 4Q7BA 3PBUA 3R0UA 3SRHA 3STCA 3A24A 5KMYA 3OIXA 4H6QA 5DBTA 3E2QA 1U83A 2G3JA 4DO7A 1SZNA 1R3RA 1VFUA 2FIQA 2FVLA 1KWGA 1BRLB 1A5LC 3P61A 5T26A 2W91A 1Q6CA 4ZQRA 3MO7A 1JD7A 3F2BA 5IBXA 2I14A 1UUQA 5HNUA 1SJCA 4US5A 4GYPC 2QCHA 5FACA 3VIPA 1QPRA 4JTCA 3QVQA 3LRMA 1DHKA 2WQDA 1TSIA 3QY6A 3TYUA 3CTTA 2QXWA 4AZCA 2BMBA 1BFNA 1U1UA 3W70A 1XR2A 4HK7A 1VFHA 3LRLA 1VEMA 3SGGA 3TYBA 1BKSA 3G3DA 1CT5A 2HXUA 1H7OA 1I0BA 2GGGA 2VCBA 3I68A 1VJZA 2YYUA 3RIKA 4JCMA 1TPB1 1EGMA 3EDJA 4KGLA 3TV8A 1TO3A 3TTQA 3WQOA 4HNNA 2PZ0A 3OVQA 5FEWA 3GFYA 4KFNA 1H7XA 1UWSA 1HXJA 2J74A 3MV11 4FXJA 1DVJA 4NZ1A 2AQVA 3L9CA 2VZUA 3CXOA 5AC4A 3MVIA 3WQ6A 5K9DA 1XYBA 3TXZA 4OOZA 5JBDA 2CHOA 3ABXA 1E6ZA 4IP5A 3I7RA 1VJIA 2WXDM 3QKZA 1IGWA 3R1ZA 4UMAA 2Y8UA 3EWUA 4JNZA 2QJMA 4IUGA 3F4WA 4E2DA 5CKSA 4JTKA 2D0FA 2P1FA 4JX4A 3KLLA 2VCAA 2Q6ZA 7REQB 1W3HA 3AROA 4A6GA 5BXTA 1LCOA 4AWSA 1S5NA 5H8MA 3T4CA 1XIHA 4UOZA 5LXXA 3HZ3A 4XTIA 1A50A 2WNNA 3TH6A 4RNIA 4RW3A 4A8IA 4QG8A 3R58A 2VX7A 1X38A 3VGDA 4AH7A 4IICA 4XZBA 4MJ4A 3WLJA 3L12A 2J24A 4QGCA 3CPUA 4DWSB 1UW9A 1R7AA 1XIBA 4WJEA 3U0HA 1A5MC 1WQ5A 1IWBA 1XD1A 4AMCA 1A3WA 1E72M 3FJ6A 1KXQA 1B3YA 3AMLA 1X39A 5FD0A 1W5MA 2XFRA 3O2LA 4FA3A 2FFIA 4XB3A 4JGDA 1V08A 2WWCA 3TFXA 3DH7A 3N2OA 3V5CA 5CAHA 7PTDA 1XLMA 3SUUA 2ISFA 2PGRA 3MUIA 3VINA 1FKXA 2WMIA 1TIWA 3GW0A 2BOFX 1EKOA 3CL6A 1L6YA 1XC4A 1WB0A 3PBWA 4OHQA 1JDAA 4UQBA 2D2JA 2X2GA 4UQDA 1RVKA 4CD7A 3MP5A 4ORMA 2GZXA 4IUOA 1EXPA 2GVJA 5EY5A 3D5HA 2HMCA 4ACZA 4YXGA 3HMJG 1EJSC 1HFBA 2HQAA 3P80A 1UR3M 3DKJA 1TV7A 3NQDA 1Q7QA 3DESA 4TOQA 3PNZA 3ZLGA 2VQTA 2UY3A 4C6IA 3GHSA 2JKPA 3HOJA 1GQKA 1DWHM 3PZVA 2VEMA 4G7FA 1BF6A 4ZQPA 3W6LA 3CK5A 1HZYA 3M44A 2Y89A 4MNLA 4K36A 2DH2A 2CU0A 1YDYA 1Q6EA 7TAAA 3MANA 2TODA 2QV4A 3W1XA 4IIEA 1EA9C 4IIBA 5LHEA 3REQB 1SFJA 4JDYA 1ZAJA 3I3BA 3ARXA 5I23A 4TMCA 4Q7IA 2ZRXA 3I6RA 2QNEA 2IXUA 2J78A 5KTLA 4UFHA 2ISSA 2HROA 3VC6A 4HCHA 2XYLA 2X0SA 1B31A 4MY9A 2HBVA 1E6RA 1NDWA 1UZDA 4C5YA 2J7GA 3K13A 4YVXA 4Q4SA 1ALDA 3HA1A 2X40A 2HPMA 1JPHA 4HHPA 1HG3A 3EOEA 1UG6A 2HWGA 1HKMA 3M0KA 2VEKA 4YWSA 3NQ6A 1UYQA 3PJXA 4PTDA 2YB1A 2YR1A 1LOSA 2GWGA 3HF3A 3VKAA 4BF5A 2CERA 1XFCA 1DQXA 1CB2A 1QMLA 3Q2DA 3SCTA 3DFOA 4JFWA 1KBKA 1TIMA 4JL1A 1CTNA 5C55A 2JKEA 4JY9A 2WPGA 1UR0A 3USBA 3KVKA 2J9ZA 3TA6A 4Y9OA 8TIMA 4FXRA 4XBSA 3V35A 2J4GA 2ISDA 4H2CA 2Y70A 3IJ9A 4EAMA 4F9DA 3EOOA 3C8FA 1ITXA 3TFCA 3PZ9A 3WUEA 3AIRA 3BAJA 3GQYA 1SYTA 3F5LA 3OVGA 4LJ3A 3STEA 3RRXA 4UTWA 4GWEA 2J8FA 5HMFA 4WJ8A 5AHEA 4GC3A 4LALA 1NWTA 3FVDA 1UIOA 2ZA1A 3CPGA 4DF1A 4R53A 1GHSA 3WFAA 4F2TA 4TO8A 1XF0A 1CPUA 3TQ0A 2YPIA 3UJEA 3V7PA 2DZVA 1GOIA 4AD2A 2A0NA 4QSFA 5CPQA 1X6LA 5D4YA 3TWBA 5BMXA 3CHCA 1I2NA 3BSGA 2YA1A 3WJSA 4Q8TA 3IIPA 1LRNA 1BSIA 4JTGA 3DC0A 3P3BA 2FZ8A 1M68A 5D8WA 3PAOA 2QUTA 2EG8A 4UFJA 3ICJA 4QIUA 4JTQA 2PP1A 1Q6QA 3TNBA 6ENLA 1G7UA 1W3IA 1GZ1A 4MVAA 4O18A 1V3IA 3II1A 1NAL1 1D2KA 1ZZMA 5H2ZA 3H2AA 1QWGA 1QHOA 1KWKA 4QLJA 3ZIZA 2E67A 3CT7A 4PA8A 3VMOA 3WDRA 3M7WA 2GDUA 1S2WA 3S5ZA 3P5YA 1AK5A 1OK4A 2XIQA 4PMDA 4Y6GA 3VIFA 2OX4A 3K1DA 5A6TC 5EFFA 3WLMA 2G96A 1J4EA 4GXMA 4R7JA 4QM1A 5CC5A 4L1GA 4UTMA 3CC1A 4HMEA 4TX8A 3VZXA 3M0IA 1TWWA 1WKEA 4W7WA 4M7TA 4J3ZA 3MWAA 4NRSA 1C8YA 1YPIA 2BVYA 3XINA 4IJCA 1V6WA 4MB1A 3MV01 1KRAC 5CZSA 5BU6A 3QSRA 2B7PA 4PTVA 1F6KA 2J8TA 3K5XA 3DI0A 3ZQ9A 3WMLA 3DUGA 4KWSA 3OW1A 4DJDC 4PSPA 4Z42C 2CZVA 2DDXA 5J8LA 2YCJA 1W1ZA 1I2QA 2CETA 3EWWA 4HOWA 2F61A 2P8BA 3ARVA 3NZQA 2VFEA 1OG6A 1ZALA 3O1NA 3KOXA 4I3GA 4MWAD 4MSSA 3WD3A 1W9VA 5E93A 5I3JA 4WXZA 3PFRA 4PODA 2WMJA 3W7IA 1H4PA 1XQKA 1J0HA 4GOAA 3S2JA 2J79A 3WLKX 1Q8AA 3OHIA 2XINA 3HV9A 3WJZA 3W74A 4MMWA 4LF2A 2C14A 5D9PA 3ZT5A 4KT2A 2YB4A 4I9JA 4JN7A 3NIYA 2HV5A 3GE7A 1DQWA 1NFPA 3UCCA 2DVTA 1GVOA 3TOPA 4W89A 1M1BA 2VEFA 5I03A 3S9YA 1O5XA 4FPSA 4F0SA 3W86A 3FKRA 3VNZA 3JW7A 3BV4A 1KM4A 3CHVA 1JZ3A 3A4XA 4AIUA 1IWPA 2IS7A 2NZLA 4V2XA 1BGAA 2CZ5A 1ZCOA 2DW6A 2HRWA 1GVQA 5EMYA 4JCLA 3W7MA 2PTZA 3T0DA 1S5WA 2YBTA 4RZBA 2V6AA 1C3FA 1KV8A 5GJPA 2PC8A 4FR1A 5D38A 2F7FA 2H8XA 2NXIA 3KBJA 4GISA 4NRRA 1MNSA 4O0QA 1YEYA 1OT1A 3IVUA 3FOKA 4EANA 2IPWA 6CGTA 4PUJA 5HWMA 2Q3RA 1O95A 4LBUA 1K70A 1JXKA 2ZTKA 1M5WA 4HBKA 4IM4A 4Z1DA 5A2CA 3W1TA 3LNPA 2XWEA 5HUPA 3W1PA 3HPFA 4GQBA 2X2YA 4JTIA 4KRZA 2DU2A 3WBXA 3QV7A 3MUAA 1DP0A 1WP6A 1J2WA 5C54A 2CLHA 4ADUA 5D2XA 4BFAA 2R9RA 4KIEA 2WWDA 1SJDA 3JU2A 4LYRA 4H01A 3I4EA 4UCFA 1GQLA 4LRSA 4UC5A 3PPCA 4RZ4A 4FZIA 1UROA 3NVDA 3HPAA 4A8LA 2D3NA 1T96A 5G2HA 3U9IA 3U2ZA 3LX9A 4FP1A 3RNDA 2JK2A 4TV6A 1F5ZA 1FCVA 1RJPA 4ASTA 4A2SA 5SWUA 1RUSA 4IFRA 3OLIA 3GTNA 3HN3A 2Y62A 3T8LA 1DXIA 2C1GA 3L5MA 3LQGA 2WSPA 1GOXA 3W1NA 1UQYA 5DEZA 2YZRA 3LGGA 3WD2A 2QR6A 3PB2A 1X1OA 1RPKA 4DAFA 3BICA 2OFJA 3AMKA 2C91A 3GLCA 1KTCA 3PSVA 4GRSA 3WNOA 3W7OA 3WNLA 4X9SA 5RUBA 3MTWA 3RPTA 3CMJA 1KC7A 4U4MA 4O53A 1P48A 1WOBA 2G50A 3LBOA 5I3FA 1PX3A 3DFHA 1EC7A 4PL1A 3MW7A 4GGBA 3VDBA 3LHWA 3AZTA 1IE7C 2TPSA 1PZ0A 2G5WA 2CFFA 3CUFA 4JHZA 3NAVA 3IGXA 1DOSA 3LZ3A 5I02A 1E4IA 4DX3A 1XISA 4TVCA 1WZMA 2PRHA 1EO5A 2D69A 3ABZA 1R3VA 1CCWB 2VR5A 3LCHA 4ORIA 1W3TA 2XG9A 1O68A 3I7SA 1RQHA 2CIPA 3C4UA 1XINA 4GUFA 4UUIA 4E4UA 1XX1A 2OCZA 1R3WA 4FR6A 1VP5A 4BI5A 4IG2B 1FP8A 1LT7A 1FA2A 3KOWA 4KWVA 3HJEA 3NOEA 1AG1O 1Q5MA 2VC9A 4KIRA 1Z41A 3UWQA 2F6KA 2HE8A 3BJSA 3PSWA 4CEXC 3GXPA 3HGRA 2X1TA 1AD1A 5A2BA 1PZ3A 3GWQA 2XJ7A 2REQA 2FDMA 4DJFD 3UETA 4LUSB 1AQ0A 4OFCA 2GSHA 1IT7A 3KP1A 1D7FA 2PCEA 2TSYA 4OIFA 1TVNA 3IUDA 1K7XA 2X42A 1S46A 2X1UA 3GDMA 4FOKA 2D22A 1LBMA 1JDEA 3OODA 2G8ZA 3CUXA 1JIBA 3QQWA 3IANA 2PF8A 1NJJA 4JY8A 4LFYA 4MNJA 3UZJA 1M7JA 4UFKA 4ZB5A 1EDGA 2OZ8A 4L6DA 4D6HA 2V69A 4KQNA 2EPOA 4O1BA 3W73A 2F9RA 1EWEA 4QJ1A 4F0HA 3DCPA 3P93A 1TCDA 4IPPA 4D72A 1MNZA 1QPKA 4ZZ9A 3EXTA 1KFWA 2BHZA 2NUYA 1XYAA 3QTGA 1Q6FA 2BVTA 1T99A 3UG3A 2YCIX 4K1WA 4C6NA 1NOUA 2F84A 3LDVA 3N2CA 4H1ZA 4ZGYA 3KBSA 2ACUA 4C6PA 5JBEA 5A6SA 4UTHA 2B31A 3GNNA 3JUGA 1X6NA 2XHYA 3P60A 4C6QA 1FWTA 1TYGA 3EYPA 1X1NA 3U3HA 4C1NA 3FAXA 3O05A 1UIPA 1G9HA 3DOPA 1QOPA 4Q8NA 2DVXA 1CXLA 2DZUA 4GHRA 3AYVA 1UHVA 3ZVHA 1DTNA 1GOKA 4Y2WA 1KQYA 4PUWA 4E8CA 2E0PA 1FFQA 4HPXA 1M6JA 1DWIM 4DWSD 4HA0A 2PWDA 1M41A 4LEFA 4XAPA 3N2MA 1LLOA 1M3UA 3ZS4A 3O63A 3HJZA 2B7OA 4LGXA 5C9RA 3I65A 4M80A 3QHMA 3N34A 2PDKA 1K8XA 1TE6A 1NOWA 3S46A 1Q7MA 1ECEA 2V5CA 1GJUA 1ME8A 4D2JA 4FIQA 2O7SA 4S3JA 2IKIA 5M1TA 2NX1A 1P1XA 1XCXA 2ACSA 2PBGA 5HK4A 1OADA 5IDZA 4JN8A 3DEQA 3SAZA 4NASA 3FEMA 1OINA 5FJPA 5BXSA 1U5JA 2CPUA 4MHBA 4LBSA 1E1FA 3NO1A 3UZXA 5C7HA 1NH6A 2DJXA 5EGRA 4LAUA 1KTNA 1R0MA 1KR1A 1KCXA 4WY0A 1HUVA 3U7VA 3GC2A 2DH3A 2PDQA 3W72A 4NHVA 3WBWA 3QF0A 3KHDA 5F2MA 2D1ZA 3QLDA 4PUEA 1SVDA 1EYEA 3NA8A 1OFRA 4WD0A 2VRKA 4L4PA 2AQWA 1RK5A 1OGSA 3VNIA 3MMUA 3R13A 3GG7A 3FXYA 1WO2A 3N19B 4O1CA 3W88A 1J0IA 4E38A 2WNQA 5CPLA 2DW7A 1AW1A 1XJBA 2PC4A 1OYAA 4MJZA 1MSSA 1LQ0A 1DWFM 1QPQA 3A5FA 4V15A 1KRMA 3ZJ7A 2WB5A 1AL7A 5H91A 1RP8A 3GTFA 1I60A 2E09A 1GPWA 5CJ5A 2HJPA 4J3TA 5IFTA 5HINA 3LV5A 4QJ4B 2I17A 2OQYA 1KGWA 1V3MA 2PEVA 4JFTA 1ZJIA 3BANA 4M0XA 6REQA 4QTGA 5LXEA 3EA2A 4G5DA 1YPFA 3V0UA 1GQIA 1ME7A 2V3DA 3W81A 3CGTA 4INFA 4AD4A 4FF5A 2OSYA 3P0WA 2Z00A 3DG3A 4D6JA 3QKEA 1TWSA 3VO0A 4IQEA 3TYDA 3THCA 4DELA 1S5TA 2GOUA 4R27A 1FP9A 4AXKA 3SECA 5CSUA 5AOUA 5DMMA 3L23A 2GGEA 4E4FA 2VL4A 1EA0A 3THQA 1HKJA 3GU1A 1ONRA 3T40A 4DJDD 3OG3A 1XRSA 3S3GA 1EF2A 3E0LA 1MUCA 1A53A 5E6YA 4RW5A 2EO7A 3DG7A 2UV8G 4QQUA 1FXPA 2GUBA 1S2AA 4HYWA 1GOWA 2JGYA 4CQCA 4AHQA 1K03A 1UB3A 1UPPA 4FK9A 3L66A 1ZGDA 4JTAA 5H8UA 2QUUA 3PP7A 1C7TA 5BU9A 3LTPA 2VEGA 4I9AA 2DT2A 1G5AA 4LS1A 2B7QA 5MKGA 3F4NA 3PJWA 3MSYA 1P5BA 4A29A 5HXMA 1F8IA 4KESA 3VX0A 1O5KA 4GNVA 3UA3A 1KA9F 1R7OA 2VWSA 1BTCA 3CZLA 1P4CA 4UNIA 3PY2A 3MO4A 3VIGA 5D8ZA 1P7TA 4PFMA 3P8IA 2EPNA 3W24A 1A5BA 4PTNA 3WO8A 4YTRA 1ZP4A 3ENLA 2PFHA 3UJSA 1VCFA 1VFOA 3L4ZA 1ODUA 2WVUA 2GLKA 5AHIA 4YL2A 2L5HA 3ZSSA 1MFVA 4MG4A 3ZVIA 4B5TA 3NSMA 3U5YA 4RK8A 5LNWA 3EOUA 2CLKA 1N8IA 1YIXA 4AF0B 4ZR8A 1V0NA 1UA3A 4DXXA 3OGSA 1Y0EA 3ZFHA 5DMLA 5A6MA 7TIMA 4PE8A 4IX0A 3AALA 4DBDA 4GY0A 1TWDA 1OABA 3CNYA 3CH0A 4ECLA 5E0FA 3P74A 1Q3NA 4O10A 3CHFA 2F38A 1MVYA 1O94A 3W1MA 1X8CA 1FDYA 5ABHA 4JHMA 4WY0F 4L6HA 3ZT7A 2XH2A 1Q85A 1OF6A 4CNNA 3A3HA 3LG3A 1VS1A 4JTUA 1DIDA 1XH1A 1GWJA 4LB3A 4QCEA 4XZMX 1BD0A 4GXWA 3HPZA 5ABFA 4LF1A 4JHOA 1GPFA 3WQEA 2ESCA 2E5DA 1E9ZB 4RL3A 1E1CB 2RDXA 1HKKA 2G95A 1ZCCA 1ZSXA 4XSLA 4WK9A 3KOYA 2NLIA 2DZTA 2DZAA 3GXMA 1XLDA 4UXDA 1EZWA 1LRQA 1XKJA 3BMVA 3TW7A 4H4IA 4MDOA 3WYZA 2P0IA 4R85A 4QROA 1H5VA 2JALA 3S6DA 1CGXA 4LC8A 5F2IA 1XLLA 5EYWA 4XZIA 1E0TA 4IPJA 1P6CA 3KRSA 4PBGA 4MM1A 3S6OA 3AUOA 1TG7A 2V38A 5D05A 2WKGA 3KXQA 2CWXA 1YPXA 3O8AA 4C6BA 3W84A 2NSOA 1V6XA 4N9CA 1L8NA 4PMNA 1E6NA 4GGHA 1OD8A 5ABGA 2GJXA 1HP4A 1SFSA 2O9RA 1EEPA 1LF1A 4HPHA 1UD2A 2WVTA 4X60A 3KS6A 4LVFA 2DFAA 1JZ5A 2E1WA 2QCGA 1R85A 2POZA 3NQAA 1RBLA 1F3EA 2VOTA 3B97A 3UZWA 2JGQA 5HDRA 4JIHA 3VKCA 1GW9A 1QFEA 1FWHC 1WDQA 1V6VA 2ZDRA 1PTDA 1CGUA 5D30A 3VM5A 4LVAA 1IT0A 4DM2A 4LVGA 3BAWA 1G94A 4TTGA 3C2YA 1BWVA 1LRTA 1J93A 3S1UA 1TJRA 1G4EA 5BCAA 4MKNA 3AHYA 4IMDA 3AYRA 2EG7A 2AL2A 1UOKA 2J77A 3PVFA 4TQTA 5CXPA 3S9IA 2BTMA 5M03A 3VCCA 1XFBA 1TQJA 3RK8A 3L4XA 3H2NA 1JYWA 3NYDA 2GOKA 4GYJA 1IEQA 1HJUA 4NVTA 3TIMA 4TMBA 2H9AB 2J66A 3KL3A 1K7FA 2DT3A 4WKAA 4B5SA 4GY1A 4EXQA 3PZQA 2CBVA 1UJQA 2F6UA 1OSEA 2Y5EA 2HK0A 3AS2A 3O6YX 3DC8A 4DLMA 4GVFA 3P6LA 4F4RA 3GIYA 2AMGA 4Z1CA 2GSJA 3PFMA 1UBSA 1UH4A 3BARA 2E6AA 3M4HA 2G3MA 4ATWA 2ZRVA 3MJMA 4AEFA 4DIAA 5I77A 1FWEC 3B9NA 3NPUA 1JPDX 2V81A 1Y5VA 4UFMA 4CCCA 4KWUA 5J04A 3NQ2A 2EEXA 1XV8A 2OO6A 3WEOA 5B7ZA 5K9XA 4DVOA 1UKSA 3U2CA 3Q58A 1KLZA 4X3ZA 3TUUA 4AB4A 1VJSA 3OZPA 4W4QA 3G8EA 5I5RA 3ALFA 2ZZ2A 3S42A 4NUWA 4XKMA 4GKTA 1GZGA 5AKQA 3KEHA 2HS6A 4FNPA 4U31A 4YTTA 2QEZA 4MPQA 3EB2A 3GYCA 3D3FA 1HL2A 3LSCA 3DYMA 5A6BD 2DQWA 4R7OA 1ONEA 1EL3A 3N1AA 3MUY1 2CHRA 4OV4A 4R9OA 2BV9A 1Q2SA 4O12A 1KFKA 3UR7A 3BLFA 2A7NA 4JEJA 1S5VA 2GWNA 4JKKA 3USZA 4J5NA 4D71A 1W1B1 3W75A 3GDBA 4MNMA 1B90A 4U3CA 5C2CA 4J4KA 4NYUA 1W8SA 3NQMA 5FSEC 2DUAA 4M81A 1J01A 2Q71A 1PV8A 4IJRA 6XIAA 4M3PA 1PS9A 4ZODA 3T0AA 4D6CA 4JQ2A 1QATA 3WIJA 5EBAA 2WHKA 4PUDA 1M7XA 3NYZA 5B7YA 4K6AA 4NX0A 1VPQA 2G3FA 1CGVA 1JRCA 4IIDA 3PZTA 1HKIA 3CM4A 4IIHA 3IWPA 3IACA 3C0LA 4GZIA 4HHHA 1KB3A 4O8AA 4IX2A 4U28A 4G56A 4HIBA 3SUSA 2Y7DA 3W2JA 3W82A 1DPMA 3NWRA 2EHHA 4CNPA 3FKKA 4KERA 2SFPA 3IJ6A 1KFEA 2VELA 4HPJA 4S39A 1TVPA 2C13A 2GQ8A 3ELFA 1EC8A 4HHMA 3RILA 1AQFA 2ABBA 4YYCA 4GA8A 3A4WA 3M46A 3PBVA 4UFIA 4E4PA 3EDFA 3IIVA 3MYPA 4WUIA 2G3IA 5DQPA 1RPXA 1CI1A 4NJJA 4NJIA 2C1HA 3EX6A 2YDQA 3WQGA 2ZADA 1WKFA 3LB0A 2INEA 3SN0A 1LWJA 3MHUA 4G2DA 2J13A 3T44A 3KCOA 2NVDA 4JTLA 1WBJA 1SR9A 2PD9A 1SZEA 1WXYA 3AHXA 5A95A 2OKTA 3NVTA 3FDGA 3T55A 3R79A 1BGGA 3CIWA 4Q6JA 2JEQA 3AXKA 4JIIX 1KXTA 1KFLA 3UERA 1F6YA 4FS9A 3ABQA 4PMQA 1RA5A 7ENLA 4LAMA 4HTBA 3S2MA 3AISA 4L1WA 4E0CA 4HZ6A 3R5EA 4Z2LA 2OWXA 3GNRA 1PIIA 3G18A 4QR6A 3TW6A 4ZFCA 3WDQA 4K7VA 3G6MA 5I78A 4UTLA 4CVWA 2G3NA 4HOXA 5TF0A 1FH9A 2PSNA 4HK5A 5A6LA 4EXBA 3GXFA 3ME3A 3SCUA 1T8XA 4Y7EA 4D6EA 3SIZA 1W9BM 3R8HA 4HP5A 4Z2IA 4GNKB 1XLGA 1H7WA 4N4PA 1E0UA 3W26A 1W91A 5CAKA 4FLOA 2BGSA 2QJHA 4XUGA 1E55A 4KGJA 4UTKA 2Y7FA 1TMLA 4JIQA 3HG3A 4EAYA 3CBWA 1LP6A 1VPYA 3BURA 1V93A 2F8QA 4IIGA 3WBEA 4ZVJA 5CQ1A 4NZFA 4EACA 1H7PA 3CZEA 3VPLA 3K4WA 4PSRA 4E2OA 2OX1A 1RBAA 2ODOA 2QMKA 2C0AA 4N42A 4A4AA 1JZ8A 2CLPA 3V18A 3SFWA 1SO5A 5AYIA 2O7QA 4IGMA 2AGKA 3B8WA 1XLJA 5ECVA 3HQ1A 3TNOA 3EGJA 1OCJA 3CAQA 5AC5A 1S39A 3Q94A 3UWYA 5EMKA 1GCYA 3JVAA 3IAQA 3BK0A 3SB0A 2GVLA 2BXVA 4BEUA 3UR8A 1QAPA 2OU4A 3G0UA 1BG9A 2PF0A 4OKDA 2O4QA 2FPYA 4GY7A 1RR2A 1GJPA 2OR2A 1I4NA 4GUIA 1XKYA 1XDMA 2OG9A 1FCQA 1FWGC 2BBFA 3A9BA 4GINA 1A5NC 4PMZA 3TYZA 4PRWA 5LNVA 1XS2A 4F2BA 3WNNA 3UFYA 3OZOA 2V68A 1IZCA 1OFQA 4JNMA 3TLLA 4F9JA 4DJED 4BA0A 1U5VA 1W2PA 2EXOA 4B9YA 4M1BA 3MU7A 4C1KA 1UWAA 2XDFA 3FFSA 1ITUA 1Z44A 5LKYA 4L61A 4CD6A 2QPXA 3QJAA 1GK8A 1UKQA 2PDIA 3GFZA 6PTDA 4K1GA 2OWCA 3HTWA 3ZOAA 5EMUA 1OWQA 1J0ZA 2Y63A 3Q37A 3B0VC 1OZQA 3EOSA 4X2RA 2A3LA 4YPJA 2XZ9A 4KCWA 2GQAA 3C8NA 1PHWA 2C18A 2NV2A 1LL4A 5G2IA 3KWSA 4UTTA 3UY7A 5C71A 3WD1A 2PDFA 2QCLA 2NVAA 4TX6A 5CJNA 1E9LA 3V1HA 1BWLA 3R6IA 1QW9A 3W1RA 2I9UA 3NQVA 3C3UA 5GNYA 4AAJA 3NQBA 1O1ZA 3V5FA 1RBOB 1QOXA 2CXGA 3G1AA 4E2VA 3GNXA 1RSCA 2ABAA 2Z26A 1B1YA 4H83A 3ZO9A 5L6UA 3MB9A 1IXNA 1BPLB 1ZHAA 1GVEA 4J27A 1JCLA 2D3LA 3B9EA 1GOQA 3AJ7A 5BYWA 1B5TA 1XIEA 3M0MA 4CGTA 3UU0A 1OX5A 4ATLA 1QU4A 4O54A 3GG0A 2Z28A 2YL6A 4Q3MA 4O11A 4Z1AA 3D6NA 4GIEA 1K1DA 1BHGA 4ZXOA 1L9WA 3NM1A 4IP4A 1RK6A 2JIWA 3WQ5A 4PCSA 2FFCA 3EWYA 1TV8A 4GJJA 1XLAA 4C91A 2I57A 4LRTA 3TLQA 2AGTA 1CXIA 4LUTA 5K4XA 1UR1A 2OGJA 1ODZA 2ZZ5A 1TPFA 4GABA 4PRRA 4I7VA 1Y5XA 4EWJA 2V67A 1H0IA 3WK1A 5EU9A 2V8ZA 2WJFA 1X96A 1VGAA 3O07A 1ISVA 4EXAA 1NDZA 4AY8A 3HURA 1XLIA 1KCLA 5H6HA 3VD4A 3AS3A 4CN6A 2B81A 4LAKA 5DY3A 4J7RA 1QW7A 1HKWA 3PUGA 1M7OA 1MEHA 1C9WA 5D37A 1QCWA 2V30A 2ZXAA 3LS9A 4OU1A 3Q65A 5HAOA 4PMRA 2O55A 4BQ5A 1I6NA 3LN3A 3L4WA 1UASA 1NWSA 1SZRA 4PMJA 3NL2A 2OSWA 4HU3A 3R43A 4Y90A 4L9XA 1Y5WA 2UY5A 1M53A 3GZ3A 1HO4A 3MZ2A 2YJQA 2QGYA 1A47A 3TJLA 4F8XA 4ICNA 1SJAA 4EWND 1J0KA 2BLEA 3M7SA 3O6CA 4TTUA 1BKHA 3AHTA 4O8RA 2E1DA 3GXTA 2PBOA 4S3BA 1REQB 1W5QA 4ZBCA 2LLEA 4HU4A 1F05A 5D9OA 4P5UA 1T5AA 3DHDA 1QPNA 4PH6A 4NZJA 5D9NA 1HJXA 3ITLA 5A5WA 2PAJA 5BNKA 4HSNA 2PTYA 1UWUA 4LUYA 3WK3A 1GTEA 1TWIA 3RUBL 2ZE3A 5FEPA 3GXIA 1A0DA 3LHZA 3W76A 1JYVA 1HNYA 5GNZA 3VGBA 2OMAA 1ZLPA 3KCLA 4Q4RA 4N02A 3LNMA 4PCTA 2PGFA 2FKPA 4O0ZA 2V5BA 3BLOA 1PKLA 4JQAA 2XM2A 5AB3A 4AZCB 3CIVA 4WHBA 3BWWA 4NAFA 3MSGA 5I07A 2J7EA 1JEZA 3HQPA 2Z27A 1QNOA 3G22A 1XLCA 4FXSA 3NZGA 2P5NA 4HNTA 1FTXA 2QYGA 3GC5A 2BFGA 2YL5A 2HDJA 1CZ1A 4QX4A 1RD5A 3ZWTA 2GL5A 5CPMA 4ES4A 2VTFA 3BZJA 3RLGA 3N73A 5D2YA 1UP2A 4PMVA 1WDWA 4WSJA 1VEOA 3AIEA 5C2GA 1UP3A 4WSKA 2DUXA 2CBUA 3S5YA 1EP3A 3TCEA 4GX8A 4X0NA 2VMFA 3M0YA 4IIFA 4OT7A 1EUNA 1WZLA 1YW1A 2XFYA 4F40A 2Z7GA 4CD8A 1FCUA 3MJYA 3TMLA 4URIA 3N29A 3KX6A 1PIFA 1NM9A 4L5ZA 4Y9AA 1J5TA 1US0A 1DJWA 5EA9A 4LY4A 3WLPA 1CXEA 3IIOA 4H41A 4DI8A 3TCSA 4REQA 3IIXA 4PB4A 3MI3A 1E1EA 2F2KA 2NWSA 4GZEA 4JQ1A 1OYBA 3ONBA 4AVOA 1OFAA 3WQPA 3B9OA 3T7VA 1CGTA 2QHAA 4JX6A 3RMJA 2XFWA 3ITCA 3M07A 5EMMA 3O7UA 2A3EA 4D8ZA 5KETA 4P7QA 3HGSA 4Z0SA 4F3HA 1F3TA 4M19A 5G4EA 2D2GA 3N6JA 1H62A 1OZMA 4S3CA 4FX8A 3NO3A 2PRLA 1QK2A 1R86A 4Q8UA 2CLMA 1E6SM 2FPTA 1YKWA 3JR2A 9XIAA 4AZ6A 4AIBA 3WENA 3LZ5A 1VYRA 3S8HA 1QI3A 3PHAA 2ZC1A 4D6FA 1MW0A 3H7RA 3O06A 1HO1A 4C65A 3IK2A 1DE6A 1H1ZA 1TMHA 4A21A 4AU0A 4BI7A 2I1OA 3M16A 3U5UA 3W6MA 2WMIB 2D2HA 3AZSA 3G0SA 4GVGA 2CBJA 3MDUA 4GD0A 3WSUA 4ZOBA 4Y9MA 3WUBA 2XIMA 4JICA 2J88A 1K8YA 2ZOXA 3DERA 5LYRA 1VH7A 2XGIA 2VGGA 4I8DA 3WLLA 5TBOA 3MQTA 1CNVA 5CPSA 1XYZA 4HPNA 3HGOA 2AL1A 4NG3A 2Q01A 4ACZB 2OYLA 6ALDA 3NOYA 3SN4A 4IFKB 2J9YA 4J35A 2C19A 4AYSA 3CPRA 4JIPA 4QFUA 1P0DA 4KRTA 2OVLA 3LCFA 2VFDA 2R6OA 2EJAA 1BYAA 1EOMA 1XRTA 4WKFA 2CXEA 2XGZA 4UFLA 1P6BA 4MYAA 3MMDA 3QH2A 3O0KA 3M0JA 4WOZA 2R1MA 2W79A 3I4KA 4K8GA 2YKKA 3CZ8A 3RX2A 2ZTJA 1XCFA 4ZTXA 3VCNA 5E0KA 3TTOA 1LJYA 1RLDA 4KPLA 2FHCA 2WZIA 1NY1A 5I06A 1RH9A 2ZUNA 5AHFA 3BOFA 4ML4A 1P6WA 1UD4A 2DSUA 7A3HA 3PB0A 1DL3A 1PEZA 3LXBA 4FNRA 3FYYA 5JUVA 4NZ3A 3H24A 2WSQA 3AS0A 2VD8A 3TA9A 3STPA 1M04A 1H1YA 4M82A 3GKAA 1I1WA 1A80A 3VIOA 3KW3A 3UPBA 4B3LA 3M0LA 1C29A 1ZL1A 3HU7A 1W1PA 1Q13A 1C8XA 1P43A 2RDTA 4JTDA 4I8YA 4O14A 3ARRA 1QNVA 1R38A 3T78A 4Q4MA 5EL1A 2HZGA 2O9OA 2XPKA 4WCJA 3M64A 5AC6A 3LMYA 3TYAA 3L7RA 4H8NA 3VKKA 4F2UA 1W3JA 2FJKA 5CSRA 2QF8A 2YCLB 4PN2A 3WLHA 3IPWA 3H21A 3P82A 4R88A 3FDKA 3UBPC 2QJGA 3SADA 2QV5A 3FYPA 2BP1A 3FX4A 3SIMA 2Y2WA 2XVNA 2PDMA 1KW1A 1H7NA 2FZBA 4O1AA 3RU8X 3DFTA 5LIXX 2C15A 3GAKA 1V3HA 3BCDA 8A3HA 2G4JA 4RE3A 1NTHA 4H2HA 1ELSA 2EQDA 3XIMA 1TZZA 3MZNA 1Q6GA 3I6EA 2X0YA 1BVWA 4RE0A 2DUZA 4CLMA 3GZAA 5JH1A 4C60A 2A4AA 1RY0A 3MP3A 1YDVA 2CLOA 2GK1A 4W8LA 1H1NA 1M65A 3EKZA 3BTNA 3GB6A 3S5OA 1X7IA 1YDNA 1FHLA 1KKRA 1BSLA 2ALDA 5FF3A 1S1PA 3PANA 1VFLA 4LNYA 2CESA 4CCZA 1K3UA 1OK6A 3UXAA 5A6BA 1MW2A 1JJKA 4DXVA 2NQHA 1G6CA 2X09A 1B3VA 4Q4OA 3WMBA 4P8XA 3TAKA 4W9TA 1JULA 3F7JA 2A1YA 4XAYA 3RYSA 3RPDA 4GBUA 2WBGA 2E68A 3NPVA 5LNUA 1OVDA 2ZVRA 2NQ9A 2A7PA 1UA7A 5EFDA 4GJ1A 3KCJA 2VCCA 1F76A 1UZ4A 2EPKX 4S3KA 2NQJA 1A4MA 3WJXA 3CLMA 1XLKA 1EJUC 4RCXA 4CU6A 3VTRA 3AI0A 1I45A 4LV4A 2OOFA 4MWAE 3TN3A 1VC4A 1AH4A 1RJQA 2NWRA 5EKYA 3L5LA 2W3ZA 3W37A 1QO5A 1KNWA 5FJOA 1CW2A 1P0NA 1PSCA 3H7VA 2OPJA 3WQVA 1E5NA 3W25A 3VK5A 4U3AA 3F4DA 1OF8A 4FLQA 1VZWA 4P7OA 4NZ5A 5KINA 1UWIA 4JX5A 4KF1A 1BYBA 1E56A 3UPMA 3DAQA 4G7EA 4JDBA 4B4FA 3FSUA 1EZ2A 4Y8FA 3UR2A 4S23A 3EEZA 1BTMA 1VLWA 4AHPA 2PWFA 3NPWA 4FMVA 5G1TA 3PTDA 3R10A 3N9RA 4B5NA 1GEQA 4IMEA 1IIHA 1AVAA 1P0BA 3K8KA 1LROA 1BXCA 4XIMA 4MAVA 1G4TA 1OB0A 5FESA 3DGRA 3OP2A 1X97A 2O56A 1ICPA 1W5PA 1EHAA 4PMUA 4AUBA 4ZE4A 2DJLA 4BJHA 3KHJA 3SSZA 5G1YA 2V5LA 3GNPA 5MHBA 4GCXA 2CKSA 4B2DA 1F2JA 3L0KA 4JTSA 5HANA 1YYAA 4HGXA 1J0YA 4KEMA 5I3IA 4MWAC 5DXYA 1XHGA 5EB8A 4CNUA 1EP2A 1DBTA 2VT0A 1TJ1A 2E9LA 5D09A 2V2CA 3ATYA 1CYGA 1SZGA 2XVPA 3LGEA 2FMOA 5LGXA 4LT9A 3TZNA 3MMWA 4K39A 2P8CA 2V63A 1TPDA 3GNDA 5AVHA 3GVGA 4AHOA 4HMNA 1LQ2A 3EPMA 1F73A 3EAUA 3BMXA 3BW2A 2Y7EA 3TTEA 2XU2A 3F5KA 3A4AA 1Z69A 3QN3A 3N2TA 2QT3A 2HVOA 1JUBA 1WDSA 3CYVA 2OT1A 1YNPA 1VRXA 1H0GA 2WJDA 3IK4A 2AQOA 5LIYX 2VEPA 5DO8A 3MCOA 4NI8A 1HQTA 3M0HA 3D3AA 1OIMA 3BL3A 3UA4A 2V2DA 2OZ3A 2QPSA 4GI8A 3C0JA 3GVQA 1DJHA 3SCRA 1N8WA 1QBBA 3TKFA 1GYLA 1KBJA 2E5BA 4HA3A 4Y9NA 3LU2A 3QYQA 4RUBA 1GOOA 3U8GA 2QCDA 2BGNE 3RAOA 5AZ1A 1I2RA 1ZAIA 3BJTA 3IJLA 1FWJC 4UQCA 4FEZA 2NUWA 4L9YA 3G1VA 4DBEA 1Q6LA 2XZ7A 4PCNA 2PDJA 3KWXA 3ZLHA 3TX9A 5LA1A 2XVKA 3TC7A 4NJGA 4C6EA 2IPGA 3MPGA 1GQJA 1R3TA 3IRDA 4L4LA 1WX0A 4EE9A 1OEPA 2QCFA 2R1PA 1SSDA 5C7VA 1KM6A 4QLKA 5C5YA 1PVNA 3W71A 2X7VA 2CHNA 5CSSA 2V5KA 3OQEA 4IMGA 4K7YA 3O16A 2DZWA 2ATMA 1W5NA 3HGJA 3VMNA 3GC4A 2MANA 3ALGA 3OIHA 2GJPA 4RV3A 4V27A 3M6DA 3FN9A 4PB3A 4KWOA 5HQEA 3MBFA 3CWHA 2R82A 3GR4A 2PUZA 2JF6A 1QWKA 1K4HA 3A47A 4EOUA 4DYKA 1RCOB 1XWYA 1WDRA 2ZFAA 3R94A 1ENUA 3LI1A 2V9DA 1JDFA 2GGHA 4XD6A 1F07A 1IWAA 2VRJA 2DVUA 1K6WA 1YE6A 3Q45A 1OHLA 3VOHA 1D3CA 5G1MA 3ITVA 3OO2A 3N6QA 4RNHA 4I7UA 5CCZA 3BG9A 3AIVA 5ABTA 2P10A 4U5IA 5I79A 3BG3A 3QGVA 3C0SA 5JIWA 1BF2A 1T6MA 1XH2A 3AICA 3QLLA 2REQB 1I2PA 3GU9A 3FA4A 4MKSA 2BXYA 1J12A 3T07A 2ZX7A 3W1QA 3VCRA 4NXSA 2J47A 2W63A 3TTYA 4UR9A 1TZ7A 2WVVA 3VIKA 1UH3A 4DLFA 3GK0A 4RR4A 1IHIA 4WKHA 3CB8A 3WQFA 2IPJA 2W92A 3QEZA 3L68A 3THAA 2HE5A 2DSZA 1NQKA 1EJWC 4UR7A 4XIAA 1W3NA 4S1FA 1C90A 3THDA 4HNOA 5H1WA 2WOQA 3EPNA 5HMSA 5BRPA 3QOMA 1GG1A 2W27A 3GRIA 1V7AA 4DJFC 1NDVA 4ZA0A 3WNKA 3CMFA 4WSHA 1WA3A 1BXNA 3IS4A 4AF0A 1V8EA 1BYDA 2WSYA 3PUEA 1PPIA 4CU8A 4M6VA 2V3GA 4YLWA 3SJNA 3N9SA 1PZ2A 1QI0A 4B5VA 3EKGA 3CYJA 1A5OC 5A3HA 3VE9A 3B03A 4ADTA 2PDBA 4C1NB 5HJYA 3LHVA 1P0KA 4W7VA 5CSYA 3ZVHB 4DM1A 3KTCA 1MEIA 4LW7A 2NX9A 3ARTA 1NVMA 2QF7A 1G7VA 3TC3A 3UT0A 2IMRA 4DBUA 4QG9A 1EXBA 3E6EA 1I8JA 1XIIA 2NT1A 4OOUA 4ZO8A 2W66A 4RDWA 1W1VA 3QZEA 3WQWA 3RR4A 4QJ3B 3RHGA 2WZEA 1UPMB 1XRFA 3FIGA 1OC7A 4QRNA 2WMGA 4N9EA 4NNBA 3ZSTA 3URNA 1OFOA 3O6DA 4QAIA 1EEXA 5E1QA 4MOZA 2PTDA 2CYGA 3N9KA 4GK8A 3F4VA 5A8GA 1LTDA 2P50A 1B4KA 4MY1A 2OYMA 1CX9A 2VDHA 3EB4A 5F4XA 4NAEA 2PP0A 1POKA 4C6LA 4DWSC 3EZ4A 2J7FA 3APGA 4MLRA 4JFUA 4B91A 1OT2A 2Y88A 1D7KA 3WJWA 5GNXA 5CZKA 5REQA 2MNRA 1TPH1 3ARQA 2ATSA 1ZRQA 1RCXB 4GE8A 1AA1B 2E9BA 4MY8A 3W2LA 1MO0A 5M2FX 1BLIA 2BGQA 4XVDA 3FAWA 4WY0B 4Q4PA 1TVLA 1M03A 1CDGA 2WJEA 4O15A 2DSKA 4OZOA 4MLJA 4JTTA 1CLVA 1QJWA 4IXXA 3GHTA 4DUXA 2BHYA 4BZYA 4JEQA 2GUYA 4C1LA 1H11A 2ZUTA 3KVMA 4M56A 1S2TA 4JKLA 3QGKC 2ZKMX 5IOBA 1ONXA 1YTDA 4L65A 1W9PA 1UH2A 1X7FA 3T0TA 1R30A 3RCYA 3W22A 2W6RA 3E12A 4AXNA 1GOMA 5DF0A 2OZTA 3DGBA 2YGYA 4E8GA 4GQRA 2ICSA 3A64A 3WY1A 2GJNA 1B30A 2B7NA 3Q4DA 3QY8A 5A6JA 2WMFA 2GQ3A 3WUGA 3PM6A 4J2PA 3VGHA 4FOJA 1QXLA 2PWHA 4D8AA 3B4YA 3NZ1A 3R7MA 1RY8A 2V0TA 3HIJA 2EKGA 1L6SA 3BQ5A 4GZ7A 1PYMA 4UZSA 3EEGA 1ML1A 2YDRA 3WUFA 3EXRA 2H9AA 1XD0A 6REQB 1V0LA 1FRBA 1BQCA 1ADDA 2RFGA 4IP7A 3UXKA 2DP3A 2V3EA 2BY1A 3E96A 3RDKA 1KBIA 2CC0A 3LXAA 1IYXA 1WCGA 3VOCA 3R12A 2GGJA 1YTKA 4MPKA 2Y8VA 4KMQA 4B5UA 1YDOA 1FOBA 2R14A 4Y9PA 3VOFA 3UG8A 4WIWA 3LD5A 3RXZA 1CENA 2ZRYA 4FAMA 4R33A 1VFSA 3ZLFA 2XSBA 2I5GA 1C91A 2D73A 3GXNA 2O9TA 2EPLX 5AYYA 1C8VA 2VGBA 4HJFA 1WAUA 4J1OA 3TU9A 2F6XA 3KOZA 1TPWA 4BI6A 1DE5A 5HR7A 2A3CA 4QDPA 3QPEA 1S2VA 3W53A 3TEVA 4EIVA 4ZQOA 3WH7A 1SSGA 2CEQA 4XQ6A 3AIBA 4MFDA 1W2VA 1LBFA 2GFTA 1DJNA 1I9CB 1KBBA 2QDEA 4CN4A 1V0KA 3VOGA 3WH9A 1WYIA 4CQAA 2BASA 4XG1A 1Z48A 4P8WA 1CB7B 1GHRA 3VVGA 2XFFA 2Z1KA 5F4WA 4MFEA 4GFSA 2VUNA 4RE2A 1E43A 1V02E 4H7CA 3BQ6A 5MKGB 3ZR4A 3E1F1 2XTKA 3KAOA 4NT0A 1WZAA 3H2EA 3MUXA 5F4SA 4JTRA 1P7TB 3WELA 2QS8A 4NP7A 3C2VA 4ML9A 4S2CA 4LX4A 2WCGA 1CXFA 2BY3A 3QV6A 2NV1A 3LBCA 3OJGA 4GUJA 1SUXA 5D02A 4IPNB 3L21A 5CGMA 1H2JA 2H3DA 1R46A 2JBMA 1Z42A 2FZNA 1RHCA 3STFA 4Z2HA 4Z1BA 3I3EA 3KDNA 1S3HA 4W93A 4CNTA 3NR0A 5JU6A 2Z4GA 3TN4A 4HNVA 1FHVA 1TTPA 2A2IA 2FYMA 1CECA 4D6IA 4AX6A 4DPQA 5HPOA 1LOLA 3TSMA 3H26A 4MKVA 3ISIX 2YBVA 4MUPA 2D0HA 4PBEA 3TN6A 3HM7A 3IJDA 1MW1A 3VNDA 5A2AA 1MDRA 1FWBC 1K9DA 3A3WA 4M24A 3S1VA 3C6CA 5E5CA 4O4VA 3MHFA 1EF3A 3LM7A 1JZ2A 5HULA 5ABFB 3MSRA 4XSMA 5KZMA 5BOEA 3R2GA 1FH8A 2W0UA 2HEJA 8CGTA 1JCTA 4YYFA 4IPLA 1RP9A 3OLGA 3QV8A 3BGAA 2WZTA 1TV2A 3SRFA 1UR9A 4WF7A 1W8GA 1W9XA 1O66A 3H4XA 2DEPA 4GH1A 5FCZA 1OD0A 2QGHA 1XYCA 3EWZA 4ZTYA 2QZRA 4C6CA 3A5VA 3BW3A 1B3WA 1DIOA 3S5SA 5CZ0A 4ICMA 2ZYFA 4GUHA 4DWDA 2HNEA 4DQWA 4M6PA 2X8RA 3WF2A 4FSAA 4FX6M 4XAZA 3PWIA 1DXEA 3BJFA 3T05A 5F7UA 3TVAA 3W7LA 1L8PA 1E71M 4HZ7A 1WAWA 5TIMA 1X1ZA 3L0NA 5HQMA 1ICSA 3RM8A 4HPGA 3ANUA 4ACYA 4NZCA 3PJUA 4B3ZA 4ZL1A 3MYOA 4RX0A 4TXEA 4BY3A 2GJXB 3VKBA 5FAJA 3BOXA 4AZIA 1GVIA 1UWRA 4IFOA 1H50A 3GO2A 1F8MA 2Z0IA 1QNRA 3M1ZA 4F79A 4L4MA 4XZ9A 1WDDA 4PGLA 3AYSA 3VI2A 1E0WA 5A6KA 4HYVA 2VZTA 1Q4WA 3FGCA 3QR0A 2AKZA 3SQLA 3AC0A 4KEZA 3P14A 1XYMA 2VZVA 4UTIA 2GVGA 1KGXA 4IPIA 3CT2A 4LCSA 1PZ1A 2ZX8A 1S2UA 3QW3A 3H4GA 1OIFA 2WC7A 2CZFA 3UG5A 2ONEA 3B4UA 4ZCWA 2G97A 1XLEA 1LM1A 1IEIA 1NFBA 4FLSA 4A3UA 2WK2A 1AJ0A 3BO9A 3H6OA 5CPTA 1W3KA 2AL2B 4TUFA 2ALRA 3UW6A 3CWOX 4NKCA 4FHAA 4HJWA 3BLPX 1EWDA 5H8PA 3ORWA 1THFD 2PDGA 1EDTA 1GYMA 3A23A 4NNCA 3RLHA 3SUWA 4PEKA 4AIEA 3ITXA 5C8BB 4NU7A 3CAVA 4DHGA 1LLWA 1ZJAA 4X0VA 1LWIA 3WDPP 3KTXA 1HKVA 5IHRA 2EG6A 3EB3A 3TJXA 4O16A 1AQHA 2POTA 5HR6A 2W67A 2XIOA 5XIAA 1JI1A 3AXMA 3BOLA 2QCEA 3V4BA 1JR1A 3VZYA 3UD6A 2J6XA 3MKCA 5TAOA 4DUVA 2X05A 4YJ5A 2KAUC 3PK7A 4H9XA 2VOMA 4AVNA 1TPUA 2BY0A 1UOZA 2FTYA 5CH9A 2J25A 2XUCA 5ECUA 4PL2A 1B3ZA 2AAMA 2QDGA 2WNWA 5LGZA 2PCQA 3NJ3A 2WC4A 1EO7A 1W37A 4US6A 1E0XA 3E74A 1FKWA 3W85A 1H5YA 1Q2RA 5KZEA 4AC1X 4XKYA 4PC8A 2TRSA 2C71A 1GYNA 3WFLA 2PA6A 2YX0A 2FPVA 4B90A 4BHYA 1GGOA 3IJ7A 3W0KA 5JBFA 1XBXA 3IJIA 4GIRA 4IH3A 3PZMA 1VHNA 3AU6A 4FO4A 1EYWA 3T2PA 4D9PA 3HQNA 5C70A 1JYXA 3SY5A 4XK2A 4RE4A 4AD1A 4DYEA 5IFPA 3QZ6A 3N2BA 3E3HA 2VX5A 3G1RA 1TZ9A 3KL5A 3RJXA 2ZUMA 4WLCA 2YDSA 3D46A 3FJNA 3GTHA 4DI9A 4EK7A 3NEVA 1AQMA 4YCOA 1AW5A 2QAPA 1EQPA 4LSBA 3C52A 4F48A 4PCFA 1ZS2A 2BVWA 2ZXQA 1XIGA 2IPFA 4UBPC 1HX0A 3WG6A 1WPCA 4PUUA 1IEWA 4DUOA 2OWWA 5BRQA 3K8MA 3PUDA 4CCDA 2YDAA 3WKZA 4RV8A 1E51A 3GXDA 2MUCA 1TQXA 4UB9A 3RO6A 2EPMX 4PEEA 4Z2KA 4N2YA 4WJXA 3GSMA 2VD9A 4HKPA 1RVGA 1MQQA 3E0VA 1OGBA 2QQ6A 1R9ZA 3HO8A 4XBJA 2KX9A 1C7SA 3G5EA 4QQ3A 2FTPA 1TA3A 1TREA 3STGA 5D9MA 4RNFA 5AHNA 2ZRUA 1R2TA 1VF8A 1KLYA 2VYOA 3R4IA 1NWUA 3EOLA 4QNEA 1LDCA 3CLWA 1W1IE 2J75A 1VD6A 5K2ZA 1TTJA 1HL8A 3LYEA 4BKNA 3EX2A 4DNMA 3L0GA 1EHNA 3W1AA 4H6EA 4GYFA 2NVCA 1EFZA 2G4FA 2C6QA 2QUVA 3WCZA 3DZ1A 1XP3A 2OEJA 1UZ1A 3DU0A 3ZJ6A 4C6DA 2XIIA 1TRIA 4QS5A 3S4TA 1GNXA 4CVUA 2DSVA 3V3WA 4M29A 2GPTA 5IHSA 5BWAA 2WO5A 5D2VA 1K02A 1AD4A 4R34A 3ZT6A 5E0CA 3LCGA 3W1LA 4U33A 4MB4A 3APTA 3VOIA 1VYSX 2QUMA 3E49A 4W85A 1ITQA 2AMXA 1E9YB 1XG4A 2VZSA 3MCMA 5GJNA 5M5DA 1XSIA 2J27A 1B2YA 3W07A 2HTMA 4GLEA 4B5XA 1EJ7L 1DORA 6XIMA 1VBJA 3G3MA 2YCEA 5HWNA 4WOQA 3LLXA 4J2MA 2JKAA 1JCMP 1HVQA 3QHNA 2V5JA 4YWIA 3DBNA 2FZ9A 1OJXA 1BAGA 5CZTA 1H61A 2YXOA 4U5KA 1O5RA 2HVNA 4RKAA 1K8ZA 3FJLA 3T81A 4PB5A 4JYDA 3P7YA 1SZFA 3FNDA 1GVFA 2OSXA 3DXIA 3QR1A 4GQGA 1T0OA 3WEMA 3GHUA 2FMNA 3MDWA 2PDXA 3SR7A 3BLEA 4PRTA 3K4AA 4Z17A 2EKCA 2OELA 1PO9A 4DO6A 3VKDA 1DWJM 2Z1VA 1W6TA 3LLDA 3CJPA 1L0PA 4P7LA 3AMGA 3SGUA 2ZX5A 2R1NA 3R8RA 4ERAA 3LA4A 1QASA 5I2UA 1O60A 4V1YA 4A8RA 3LEPA 4QBXA 3UVIA 2XH0A 3DHUA 3VOJA 1GG0A 4E5TA 1CBGA 3JRKA 4KEUA 3BE7A 1W9UA 2OODA 1E4MM 2PWEA 4K8EA 3UWEA 4JBRA 5FEXA 3NFUA 4U2ZA 3DKLA 4YTQA 1AODA 3OBKA 1UMYA 4FOUA 2W9MA 5DCEA 1KKOA 2J7BA 2PGEA 1QRQA 1FFRA 1QO2A 2PI6A 1TRDA 3NGFA 2P76A 5FJIA 1UR8A 1XDJA 3TC6A 9RUBA 1LZOA 2E25A 4C6JA 4DYJA 4H00A 3LUTA 4C5ZA 5AY7A 3UWUA 2A3BA 4CUCA 1G01A 3CV2A 1RQBA 1PWLA 1SU5A 4L1XA 2P3EA 3J7HA 1S3TC 2D20A 3GVRA 2VO5A 1R9XA 4N9DA 1PX8A 2ACRA 1JFHA 1JCJA 3W00A 3GY1A 3WQ8A 4MYXA 4WXYA 2GVEA 3TQVA 4IMCA 3A13A 2VX6A 1ICQA 5LNRA 4WZHA 3O15A 3RU6A 3FA5A 4Q8MA 2QW5A 3LCIA 3URBA 3GYEA 3T2QA 5EMJA 1YQ2A 5DLCA 1SO3A 3BAIA 3GM8A 4PR4A 3RM9A 3AHVA 2DORA 3UNTA 2PLJA 2KZHA 1A0CA 3WL1A 3ANVA 1JUKA 3MY9A 2PMQA 2ZZ7A 3DX5A 2Z6JA 2W5FA 4K2SA 4V1XA 2VXNA 4LOCA 3CUJA 2E28A 2A79A 3XISA 1W1TA 3GU2A 2A6LA 4ERGA 2D23A 2ZDSA 3VUPA 3EDDA 3K1GA 3M0XA 1H60A 3CQJA 4OVXA 3VIJA 4QG6A 3PPGA 4J3XA 4EF9A 2DT1A 2VENA 3TQKA 1OCBA 1UUMA 4L56A 1HF6A 3H53A 1TTQA 3ABRA 2FHBA 1MRAA 1SO6A 4NX5A 4H9YA 2J6VA 2XIBA 3IEBA 1ZBVA 4E2BA 3SURA 4QHRA 2RDUA 4DJEC 4IISA 4HMDA 2GDVA 2Q02A 1QDSA 3QHOA 5FJUA 3L5AA 1RLCL 2G41A 3OLEA 3PBMA 5DCBA 1VPXA 3F5JA 3SQMA 3OQ8A 3W7CA 3WH5A 4HD5A 3NEHA 4AEOA 2VJXA 4YVVA 3DHPA 4Z1YA 3B0XA 1B0IA 5C9ZA 4ZOEA 1H51A 2IXVA 1QK0A 2FJUB 4RZ6A 2HISA 4OWGA 3EDKA 2BG5A 3G6LA 2FQIA 3ARYA 2WW5A 4JN6A 1HTIA 1DYSA 3SEPA 3W2NA 4QJ5B 1TMQA 4KETA 4K3ZA 4MAZA 1W9DM 1AZ1A 2BODX 4ZQNA 2ZWYA 1FWAC 3OYZA 4MZYA 2HXTA 4LYKA 2CLIA 3H23A 2NV9A 3U4AA 3B9AA 1JCYA 4IQLA 5CLTA 1ECQA 3HV8A 1CLXA 1Z6KA 4LPCA 1T41A 4IHCA 1J10A 1DEDA 1HIZA 4IFKA 3GBEA 3ARSA 1J0JA 3EX1A 4GX9A 5B80A 1VBGA 4GVIA 4ZB2A 2NXGA 3RLUA 3UGRA 3C2RA 4MF4A 2E8YA 4HU0A 1KO0A 2A3HA 1D3GA 1VCVA 3WJYA 1I75A 2JFEX 3GIQA 5FEZA 3RCNA 1E5JA 2RAGA 3KRZA 1U1HA 4LBRA 3URAA 3FVMA 4N6FA 1Z9AA 1EPVA 4LUTB 3BGJA 8XIMA 4HMCA 1VFFA 4P61A 4DF2A 2O9PA 1YBQA 2CWNA 1VENA 2E8ZA 1DJQA 2ZZ3A 1JD9A 3TSBA 4HTYA 3ITTA 4YNGA 3D47A 3OLDA 5J5RA 3TROA 2VWTA 1F3XA 2BB0A 2QVHA 1VKFA 3K8LA 3UWWA 2IW0A 1LUCA 1W32A 4O1FA 3UG4A 1VBRA 3WN6A 1N82A 4ZXLA 1NEYA 2VNCA 3KTSA 1AW2A 3KS5A 3FV9A 2BSLA 5HJXA 4MZ1A 4YHEA 3QC0A 4L64A 3VMPA 4UTTC 3W7DA 4GPNA 3VE7A 1PCKA 4BS0A 1V4YA 2WMKA 1JF6A 5U4NA 1JPMA 1Z89A 3FK4A 5FSDC 3NTYA 3KBWA 1DIKA 3P8JA 4RXGA 1UBPC 2FVKA 4YHGA 1EPXA 2ZX9A 3ABOA 3HG4A 3SDOA 5AC8A 3NQGA 4LUIA 1ZBCA 1L2UA 1XUZA 1ADOA 1R87A 4UWMA 3LCLA 2YCLA 3C5QA 5T8GA 4TVUA 3ITYA 3IIZA 2ANUA 3UF9A 2OTDA 3SW6A 1J79A 2V82A 3LXCA 3ZJKA 5EPDA 1JG9A 5LA2A 3TAOA 3K2GA 3ANYA 2CITA 3R25A 8XIAA 4H9TA 2TMDA 1E3ZA 3WDHA 3PPFA 2ZUUA 3M0VA 5F1UA 2CLLA 1CGWA 4DB7A 5I3HA 4D6GA 4NJHA 1D3HA 2A3AA 2E6YA 3SJ3A 2B0MA 1NFGA 2E77A 2XWDA 3UR5A 2JEPA 1EX1A 2X1RA 4P7NA 1EUAA 2PDNA 4GI9A 1IR2A 4ROQA 5CBBA 2IQ0A 5I09A 4NAFB 3YPIA 3N25A 1EH9A 2YLAA 2D24A 3L2IA 2HS8A 2Y5SA 3WBAA 4I9TA 3QFWA 1RJRA 1XIJA 2BHUA 4D8LA 3TONA 3M43A 3E38A 4AG0A 3N4EA 2NW0A 3EDEA 1E6PA 4E3TA 3BCFA 1A5UA 3U6WA 3W2KA 2HCVA 4Z2JA 4XZNX 4PTMA 4U2YA 3SN1A 2A21A 2FDSA 1DV7A 2PZNA 3PZUA 4MWAA 4MB5A 3O0FA 1Q45A 4DAIA 1WBHA 5HNTA 1HGWA 3NGJA 3HFYA 4GI6A 2Z1BA 1UD8A 3DFYA 3UP8A 2EAWA 1XW8A 3B0YA 2FZMA 2HK1A 3W27A 1H3GA 1AFSA 1GTHA 3IV3A 3PUOA 4HB7A 3UPWA 1QPOA 1J5SA 3E2SA 3O6AA 4I5UA 1NARA 1O1HA 1TV3A 1KM5A 2E4TA 5CZJA 1LWHA 3VFCA 2J8GA 5DN1A 4CN1A 3RGTA 4DF0A 4QEEA 2DIJA 3R89A 2WHJA 1EBHA 2A5HA 3UVAA 4REQB 3TOYA 4EPDC 4P8UA 3H7UA 3IGSA 1MI3A 2Z1WA 4HYRA 3BSHA 2PPGA 1IXQA 3SSJA 4EX4A 3W7NA 4GACA 5C9UA 5A94A 4ICCX 2QCNA 2VVSA 3WQCA 5C2XA 2WC3A 3AIQA 2FVMA 4OV9A 3NSXA 4AQLA 3PTKA 3NPXA 4RXFA 5HJLA 1NOFA 1MXSA 3S2LA 3FXGA 1MYRA 1WUEA 4RJEA 4AZGA 2F2HA 4KW2A 2FZDA 2QULA 3WF0A 3TDFA 1GUVA 3WNPA 4YMZA 2DQXA 1O7AA 3QPZA 1EBGA 1IZKA 2DIKA 1RQEA 1GQNA 2YFOA 1OFBA 1XRVA 1HL9A 3WK0A 4H8HA 1HT6A 3TJ4A 3VDCA 2OGYA 3N13A 3WK2A 2ZA2A 2G0WA 4EPBC 3BLLA 3TYEA 2WSRA 4DPPA 3NM3A 3A21A 4W7UA 3ZXWA 1C92A 1PX4A 4NY2A 1FWCC 4GYPA 3CIXA 2GVYA 1JRBA 1PTAA 5BRBA 3M47A 5F1VA 5E09A 2WHMA 4LCQA 1F3WA 4GC4A 1HJWA 4GO8A 1ZBKA 3NQEA 4H19A 3IVSA 3LMZA 2UY2A 4OQVA 1VR6A 3A12A 4BWLC 5LZLA 3W7QA 2HPIA 3AXHA 3FHQA 1VB9A 1XGZA 5CG0A 1Y65A 1SGJA 4X2PA 4O17A 2VM8A 4QLLA 4AWTA 1LBLA 3ZJ8A 3RX3A 3AWNA 5DT5A 3PS7A 2RGLA 1Q6RA 1ZENA 2C7FA 3DBPA 5CGQA 3G0XA 1R3YA 3KE0A 3SI9A 3GIPA 2JF7A 1CLKA 2D0GA 4P8VA 3W7PA 2TYSA 4LAZA 3AIUA 3BAYA 1FWFC 1EGZA 1SPQA 3AO0A 3N3MA 2DY3A 1WUFA 4RPPA 2C0HA 4Q8PA 3GD6A 3LHTA 4PTXA 3U57A 3MVTA 4ONVA 4YTSA 4LYQA 1DTUA 5FI8A 3H2CA 3RLVA 4JR5A 5A6AA 2O0TA 4Q8WA 1KGUA 5AN7A 2ZUSA 3WF3A 4B9ZA 4CCEA 5A8NA 4H7ZA 3CUZA 2Z2UA 4DZIA 2QIWA 3T6CA 4A3QA 5MF5A 1QHPA 2GQ9A 1BRLA 1HGYA 4H3DA 1ZJHA 1FHDA 2HNHA 2X1IA 3CV6A 3U48A 4ZB0A 3M5VA 1HW6A 1I2OA 3OG2A 3HPXA 1KFCA 2C3ZA 4D6DA 4S3GA 1EJTC 4HSOA 1VAHA 3LK6A 1B9BA 5CBJA 1R5YA 7XIMA 1JZ4A 5CPNA 4DJFA 3N12A 4D1JA 2BVDA 1XC6A 2VURA 5DMYA 3CZGA 4Q32A 4IL0A 3L4TA 1M9HA 3AYTA 3PC0A 5LIWX 2PTWA 2Z24A 3E0IA 1ZB5A 4M6UA 3OOQA 5E70A 3T08A 2OLSA 1P0EA 2Z2BA 1UJPA 4O50A 4MIMA 4S38A 3V1PA 2OT0A 4XD4A 2X1SA 3OGVA 1TV5A 3INPA 2E5CA 3ITOA 4A3RA 1KCZA 3MWCA 4QCFA 3GDLA 2Y24A 2GK1B 4JNYA 4UMCA 1OBAA 2H3BA 1SO4A 2QCCA 1TE1A 2C8NA 2OQHA 2FGLA 5C0QA 3QFEA 1QW8A 4FNSA 4YVPA 4H04A 2EJ1A 4W8BA 3HPSA 1LLZA 2X7WA 3C86A 3CO4A 1XG3A 5I0DA 2ZXDA 3H8AA 7REQA 3IVTA 2FHFA 4W8AA 3EA3A 1DIEA 5G4WA 1SQ7A 3F1QA 5JQ9A 1A3XA 4B92A 3GG1A 2WNZA 3RR1A 1Q6OA 4FNUA 1U22A 1KM0A 3DIPA 4QISA 4AC7C 5K4ZA 2WVSA 1CXKA 1DJYA 2VGFA 3NQ8A 2BX7A 5C6MA 1FDJA 3OGRA 5AC7A 1UWQA 3UESA 3TWAA 4U10A 3VGFA 1QNQA 1PHQA 1UMLA 1Q6DA 4NYYA 4DWSA 5BXRA 3BXWA 3NNTA 4ZO9A 4AZBA 3A22A 3GFXA 1WNOA 5HMEA 1OX4B 1PXGA 1D8WA 4O4WA 4L4OA 2C16A 4HNCA 4LV9A 1JAKA 3LSBA 3ZYZA 5CJMA 4RDVA 2INZA 3FCPA 1C8QA 2XVGA 4LWWA 4IF2A 4DEFA 3DDMA 5I3DA 5L9FA 4G7EB 1YXDA 5JMUA 3UCQA 3OVPA 1KFBA 1RAKA 2YW3A 4Y96A 4I6VA 4YN5A 2PRMA 3UNDA 3GNOA 4R7WA 3C2EA 2OEMA 4Q6XA 1RCQA 4DZHA 1SJBA 4W5UA 2NQZA 5BOFA 2W62A 2XN1A 3T1GA 4CEUC 3WLOA 5DELA 5CC7A 4HVXA 1FUYA 1FCBA 3OA3A 1OX6A 3C61A 3DYOA 1DJXA 4XV0A 4WDTA 3N4FA 2PP3A 4JQ4A 3RJYA 4JFVA 3UQNA 4EF8A 1A0EA 3KBNA 4I6KA 3UGVA 5CEWA 1DXFA 5LNSA 4O52A 4EPEC 1K6AA 3KBVA 2WV8A 3REQA 4LANA 1C93A 4OBTA 2NT0A 1V0MA 4MUZA 1VIWA 1VBHA 3TTSA 3UYIA 1A5CA 1YX1A 5DY2A 1XPGA 3AIWA 3VD9A 3OVRA 5T9BG 2VFIA 3BH4A 2YXGA 1OFPA 2VP8A 1HJVA 3WBYA 1MXGA 1G0CA 3FEQA 4RDZA 1XICA 3VDAA 4HN8A 2PDYA 3UYCA 4TVDA 3AMDA 4JTJA 3EPOA 2QVNA 3GH4A 2VR2A 3RO8A 3V16A 4FALA 4F0RA 4O1EA 4HK6A 1PAMA 1OM0A 3LRKA 4RPQA 1V6UA 1EGVA 5GPRA 3VFLA 3RM4A 4OECA 4NF7A 4O13A 1TWZA 3KRUA 4MDPA 2XM1A 5DRIA 3EWXA 4IL2A 4E3VA 2NUXA 4A8NA 1J18A 3E2RA 2RH9A 3KLKA 2O92A 2YA0A 3W1UA 1K9TA 1VQTA 3B9DA 1JCXA 1TELA 4QDMA 3B8SA 3NL5A 3QY7A 4BF9A 4PMYA 3PWGA 1R2RA 4HT3A 1Q8JA 6A3HA 3B0UX 2GDQA 1VIZA 3UY8A 5HOSA 1TUXA 4UZUA 4QSHA 3C3NA 3KVLA 2YSWA 2YA2A 2FB2A 2PODA 1EP1A 1YADA 4X9YA 4C6OA 3R8GA 5E6ZA 5FJTA 3FJ4A 3SCWA 2AKMA 1YTEA 5AHMA 2NQ5A 1G67A 2QCDB 3NCOA 2VX4A 1DJIA 4WQ6A 1XYLA 4OUIA 4DJDA 5D33A 3LHYA 4ZO7A 5HQLA 1LORA 4Q8QA 1XIFA 4S2BA 1SFTA 1FWWA 2Z6IA 3DN5A 1E70M 4RDYA 2E6FA 2FTWA 1TR9A 3ZR5A 1B4EA 4FX7A 4HA1A 4K37A 1QI5A 4PYSA 4AY1A 4UIOA 3T9PA 4AMAA 2R91A 1K8CA 3QQ1A 2I9EA 5JXQA 2A6NA 4UOJA 4ATDA 2DT0A 2OOGA 2CW6A 5AECA 2QIIA 3G1YA 3W87A 1EJRC 3NL6A 3BV7A 1OCQA 3C0QA 1UR4A 2W4XA 3LERA 3EWCA 1H7RA 2WLZA 1E40A 3T09A 4IWWA 3G24A 3TMQA 3BGGA 5E9XA 2ZZ4A 1EQCA 3GDTA 1PKNA 3W7KA 1ISYA 1FH7A 1IT8A 3ATZA 2QUNA 1VFTA 3FY1A 3CMGA 9CGTA 3W29A 3MSDA 3G77A 4OTKA 1ZU8A 1KTBA 4MGGA 3CZJA 4GG9A 4PUNA 4C6KA 1KQZA 5FF0A 3CEPA 4OJYA 2ISWA 3VABA 4R9XA 4FIRA 3NQFA 1XIDA 3QV9A 3UJ2A 4AVFA 5HWJA 2E3ZA 5HNRA 4I9MA 2PDLA 2CCRA 2ON3A 2I5IA 5J5DA 3NG3A 3UXDA 4A3YA 2HSAA 1ME9A 4BF7A 2YBUA 2GYIA 1V02A 3GH5A 4GXPA 5M3WA 4R5EA 1W1YA 3PF3A 4H8UA 3W9ZA 3WD4A 4CU7A 3VNYA 3G1FA 3HG5A 1PDYA 3A9IA 5CLWA 1US3A 5CC6A 3B8DA 2WVVB 1XI3A 3WLQA 2HBXA 3SUTA 3NDOA 4Y8EA 5IBXC 3C2FA 2Z25A 3RX4A 2Q09A 5BOOA 3GX9A 1FXQA 2PDHA 3THUA 1JFXA 4J9JA 3TSDA 2XN0A 4AY7A 4M1RA 2P0OA 4UNKA 3W23A 3K30A 3M0ZA 3WX7A 1JPKA 2ZIDA 3EX3A 4IQDA 3DENA 3PULA 1OGGA 4C7GA 1VBUA 2CKRA 3PZNA 1KM1A 4H6KA 2Y1HA 2AAAA 1G4SA 4Q8VA 4J40A 1PKYA 1IR1A 2C79A 2VEIA 1R6WA 5DCDA 3OYXA 1FVPA 3B05A 2TAAA 1PKMA 4CQ8A 1ISXA 4L9ZA 5E9AA 1T8QA 1VHCA 1IEVA 2D2OA 3KZSA 4IJBA 1XIMA 1B57A 3UEQA 4TU1A 2FGZA 2PE4A 5A8QA 1XPYA 1W5OA 3LHUA 1G4PA 1DWAM 5PTDA 1KXHA 4LS2A 3U2EA 1I0DA 4A05A 4CNOA 5K7JA 3UZ5A 2WYSA 4MZ8A 2Y8KA 3V75A 4X63A 1UD3A 3OHMB 1X98A 3BG5A 2QJNA 2EBNA 4LY8A 5BMWA 3QBUA 1GW1A 3W7EA 2WKJA 1E9IA 3QM3A 3W7GA 4CNSA 1OQFA 4YTUA 2Y85A 4BQ4A 5JH2A 3WLRA 1Q65A 5FAGA 2WJZA 4ZQMA 4FB7A 2X0HA 1H49A 4UQ9A 1BVZA 4GMEA 5AYXA 1KBLA 3NSNA 1V6YA 3PZOA 3T4WA 3KBMA 3SCNA 2WMHA 1TJ2A 4ADSA 4IGHA 4NAEB 1F6PA 3WF4A 2ZXBA 1JGMA 3CQ0A 4BQ2A 1UC5A 3IJ8A 3PG8A 1XGDA 2OLHA 3AMCA 1ZQ5A 4QE4A 4B5WA 5AFDA 5REQB 2I7GA 3VILA 5I3GA 4HCLA 1N8FA 1SW7A 5G5IA 4MJMA 1GKPA 4UQAA 4H9VA 4S3DA 3OEXA 2BS9A 3UZZA 1Z3NA 1YMYA 4IGNA 1JZ6A 3GR8A 4JZ5A 1V5XA 3KP0A 1PDZA 3RPMA 4QP0A 3MP4A 3I6TA 2VFFA 1SW0A 3LY0A 4WEVX 1LL6A 5FL0A 1P1MA 3KDOA 3G1DA 3D0CA 4AD0A 1GZJA 3Q67A 2NSXA 1KFJA 5A8MA 3W28A 3NDZA 3U7BA 4Q4KA 1A3HA 5I7GA 1UD6A 3MMTA 1XQLA 4JXCA 1BYCA 2Z7KA 1IIGA 4F0MA 2HVMA 2WLYA 3VYLA 2J7CA 1HN1A 1RV8A 3FYOA 2ZUVA 4H9UA 3AS1A 2Z29A 3BC9A 3MUZ1 3TZFA 4MB3A 1WZKA 3MUCA 5D32A 4ENLA 3N15A 1OY0A 4POCA 4DUWA 4OBSA 3SRDA 5IRPA 3ARPA 5G2WA 1PWMA 3DFPA 1QTWA 2AOSA 1SR0A 2ZZ6A 3ZWSA 1RALA 3POHA 3AQUA 4LTSA 4IG2A 1J11A 4JS3A 4N7QA 4YU1A 3TR9A 4XAGA 5FF4A 2O4MA 1IXOA 2NLYA 4BEQA 3ARZA 4CQDA 4NILA 2PURA 4GBDA 3CS2A 4NIRA 1US2A 1EB3A 3L2MA 4TX9A 3LCWA 3EMQA 2XSAA 2I5QA 1LT8A 3AZRA 4NSBA 4PUMA 2J62A 4LUSA 1J9YA 3PZGA 3N3TA 4KH2A 4K38A 2YL9A 3GDKA 1QUMA 3AUJA 3KOFA 2UWFA 5LSMA 3VDGA 3GUWA 3NQCA 1U5HA 4Q33A 1MDLA 3AXIA 1KRBC 3VKJA 3IARA 4B3KA 4Z0JA 5HUOA 5KZDA 1ZP3A 1W1A1 3WEZA 4NJKA 1C9DA 4GH3A 3UJFA 5FOOA 1A5KC 1FY6A 4DZAA 2IUZA 1J96A 2PLKA 2VRQA 3GAYA 3SO7A 2PDUA 3B8TA 3CQHA 5KZ6A 4UTUA 4AWEA 3T0CA 3FA3A 1H09A 1H41A 3BW4A 4XZLX 1W56A 4XBKA 4UTFA 1TJPA 1B54A 1G69A 1UZHA 3BPWA 3RG6A 3POCA 4UTWC 2EF9A 4DNHA 2QJJA 4CQ9A 3H70A 3ES8A 2CZEA 4ZENA 3B8IA 3TR2A 4JFSA 4V28A 4ZE5A 3PTQA 3CHEA 2YIHA 4JTFA 1L6WA 2XH7A 4H9MA 1GVSA 3UXLA 5K9CA 2VFGA 3I3DA 5LA0A 2DSWA 1ISWA 4DO4A 1OC5A 2XIJA 1O12A 4MADA 1LL7A 1KCKA 3W7HA 4M51A 4C6MA 3LLFA 4HHLA 4ROPA 3QGAC 3M41A 1GVYA 1QBAA 3HMCA 3NUKA 3S2NA 2VDGA 7CGTA 3V0TA 4I5XA 3CUHA 4GO9A 1XSJA 3MCNA 3N14A 3BAKA 3QSTA 1SW3A 2YFNA 5DXXA 2J7DA 4PUKA 1QI4A 2J9XA 4C6FA 2IQDA 3CO8A 5LIKX 2WAGA 4WRHA 3TJIA 1L6FA 2NQLA 1AJZA 3UCDA 1BXBA 1KD0A 2V3FA 3HG2A 3SCPA 1KV5A 1MW3A 2BZNA 3PAJA 4PMOA 3WL0A 2FLIA 3S5NA 2XGBA 5ENLA 1VEPA 4GCAA 1UCWA 3FLUA 2CLFA 3IUHA 4AYGA 3LOTA 4H7VA 4QE1A 1FWRA 5TNVA 2ZWZA 3WNMA 1E3XA 2WM0A 1IF2A 4N4QA 3FSTA 3W01A 1S38A 1UUOA 4M6QA 1MQRA 2QMJA 3P81A 4A22A 1JNDA 4FF7A 2E9MA 3LPGA 3VIHA 1TTIA 1EJXC 2E7FA 4O57A 1TV4A 3WH6A 1PTGA 5HPCA 1DJGA 4PFHA 2EGZA 3ARWA 2JIEA 3G8RA 5CPOA 3P67A 5ABEA 1QNPA 1ZNNA 2OKOA 3RITA 1OC6A 3LPPA 2PDWA 4B2DD 2H6RA 5F2LA 2DZXA 1UKTA 3CUGA 1L6GA 1UQZA 1QT1A 1E6XM 3QZAA 1ZPTA 4N9BA 4XTDA 3VDHA 5IDIA 3WQ4A 2YL8A 5C9XA 1XH0A 1F61A 5A8PA 3EA1A 3PZIA 4HCDA 4Q8OA 2PWUA 2DPEA 4XWUA 2PS2A 4ZFMA 1YE4A </