1SO4A

Crystal structure of k64a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
213
structure length
213
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAAIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
total genus 84
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so4A00
3W7MA 2BSLA 5CZ0A 1EPXA 1SFJA 5LNRA 2HTMA 4Y8FA 4MLRA 4GUGA 4FEZA 1NF0A 4JDBA 3GAKA 3ZR4A 3GKAA 3KVLA 4M6QA 5CZTA 3FS2A 4AF0B 1UCWA 3LBMA 4NUWA 1FY6A 3S1WA 4K6AA 2QJHA 3PBWA 3W1TA 4KWVA 4UTIA 4BF9A 5D05A 1G7VA 1ME7A 2DJLA 2E6DA 4JTHA 5C54A 1L2UA 3HPZA 4KFNA 3B0UX 1UBSA 4JICA 3DH7A 3QPZA 5K9CA 1THFD 3G1SA 3NL6A 2I14A 5HMSA 2A7RA 4RJEA 3P82A 2NV1A 2VFDA 2NZLA 3P60A 1U5JA 2V2HA 2A6LA 3G1VA 5C55A 4UTJA 1GVOA 4YCOA 3O63A 3QH2A 1K02A 3EX2A 4Z0JA 4CCDA 2NX9A 4FNSA 3AJXA 4NQ1A 3A22A 1QDSA 4W9TA 3LI0A 1K8YA 4WY0A 1MSSA 2CU0A 1JR1A 4BFAA 4K7YA 2YPIA 3O05A 1H1ZA 3F1QA 1GVRA 3D0CA 3KAOA 3MBFA 2JKEA 5H91A 1H7OA 3SZ8A 3W1AA 4U4MA 2VEKA 2G96A 4TMBA 1E51A 3NEVA 3V75A 1VR6A 1ZY9A 2DU2A 4JS3A 2C15A 3C61A 3MJYA 4UFHA 4XBKA 1I4NA 5AN7A 3EWWA 5HUPA 3T78A 3UY8A 2P0OA 4LY8A 4Z0SA 3BVJA 3NM1A 2ZQ0A 2H8XA 3W7LA 2V2CA 3C6CA 2JKAA 3L65A 3I7QA 1J4EA 1IIGA 2X2GA 1SZEA 1FX6A 3QFEA 2QUVA 1H1YA 5AC7A 2WSQA 4DXVA 3W2MA 3N9SA 2ZTKA 3IVUA 4ADSA 2B0MA 2ABAA 4LWWA 4N9DA 4FX7A 1PE1A 3HOJA 4CNNA 3MW7A 1KFBA 1V5XA 3O6CA 1LP6A 1VHNA 5K9DA 1N7KA 3W3OA 3TAKA 5FF0A 4ICNA 3C56A 4O8RA 3LXCA 4FX6M 3VCRA 3G1DA 3STEA 4UTLA 4S1FA 4K8HA 3I7SA 4LS1A 1DL3A 5TIMA 3WK1A 1TMHA 1EIXA 1OFDA 4ADTA 1KLYA 5LHFA 3EB2A 1VLIA 4NNBA 3IGSA 4GUHA 1C8VA 3W1UA 1DORA 1LYXA 1F2JA 2CLHA 5DBTA 3TH6A 4C1KA 3NQ2A 3NA8A 4JYEA 1VHCA 1H7XA 3B06A 1VYRA 4IQLA 3FIGA 5G4EA 3UWZA 4JIQA 1PCWA 3T55A 5L9FA 1LBFA 2WNNA 3FYOA 2KZHA 2RHGA 5EMUA 3TV8A 5DCBA 3C3NA 3DFTA 1GTEA 1CI1A 1G4TA 4KFOA 5K7JA 5LNWA 1H51A 3L5LA 2E6AA 4FIRA 5D09A 4O19A 5E0KA 4YCPA 5G4WA 5G2WA 2C1HA 8TIMA 2YGYA 5LGXA 2ZDRA 4OT7A 4AHQA 2X16A 2GPTA 4HNNA 3TA6A 3MWAA 2ZZ6A 5GVJA 2A4AA 2HS8A 2W0UA 1FBAA 2QUUA 1FWTA 3W1MA 2YX0A 3UPBA 3BK0A 4OBTA 4LVBA 4XKYA 4AHPA 4GUFA 1ZJIA 2J27A 4LU0A 3T4CA 1PV8A 4UUIA 2A21A 3JS3A 4JTLA 2V2DA 3GLCA 1HTIA 1RR2A 2JBMA 1HFBA 2J88A 1JQXA 4QJ1A 2E1DA 1DV7A 2PRLA 2YW4A 1K8XA 3DFNA 3DZ1A 5EA9A 3W88A 3TJLA 1YYAA 3B8DA 1K7XA 4FNPA 2EPHA 3KVMA 2C19A 3ZWTA 2C3ZA 1X7FA 3LXBA 3W7CA 4JYDA 4R33A 2WV8A 1S5TA 3WJXA 1OF6A 1QPQA 1KM2A 4WUIA 1XKYA 1AMKA 1DJQA 1P0NA 4OE7A 3W1RA 3RFAA 4E0CA 1KV5A 2GOUA 3IRDA 2PRHA 4NZFA 5D38A 2QEZA 2Q8LA 1YADA 2WNQA 2Y85A 1K3UA 4UTKA 2X1UA 4MJMA 1FCVA 3IVTA 4HSOA 5HQEA 1G67A 3NQ6A 1TV5A 4JY8A 5F2MA 3DFOA 3EKLA 3CPRA 3IEBA 3LCWA 3NQDA 4N4PA 2J9ZA 2VFIA 1Q45A 2GQAA 1KW1A 2ZTJA 1FDYA 2ATSA 3DFQA 1GT8A 1SZGA 3P74A 5F4SA 1H63A 4K8EA 3WJSA 5BMXA 2ISWA 1F7BA 3EXSA 3HB9A 2Y89A 3L0NA 4A3UA 4NJHA 4R53A 4KWWA 3L0KA 3QEZA 3FLUA 1LLWA 3ELFA 3TXVA 3EWBX 1JCXA 1XDMA 1R2SA 3M7WA 5EYWA 4EWND 3EWXA 1TJPA 4E2DA 5BNKA 3TNOA 3NZ1A 1GEQA 1O95A 5K4XA 2AGKA 4UNKA 4NVTA 4IMCA 5AC6A 1F6PA 1GTHA 4LC6A 1A5SA 2QCDB 3GNNA 5BRBA 4U28A 1Q6LA 1D3HA 5AYZA 1W5OA 2RDTA 5F1UA 2ZZ5A 2FIQA 3IGXA 3QPYA 4OV9A 4PCFA 4LVFA 4O17A 4IWWA 3MI6A 3GXTA 2VFFA 4O0ZA 3BPWA 1LOQA 1TPC1 3HPXA 5MHBA 1H5YA 4WD0A 3OBKA 3BO9A 2C0AA 1I45A 1GPWA 3M9YA 4ZZ9A 3ABRA 1SZFA 4GUJA 1Q6QA 3GKFA 3EXTA 4NJIA 4MJZA 2Y70A 4UCGA 1ICPA 2DZUA 3W7IA 3DAQA 2FLIA 4JTEA 5LZLA 3W2LA 3PUDA 1ZAJA 5BW6A 1MZHA 5I3KA 5CZJA 4NX5A 3TW7A 3P61A 1ZHAA 4A2RA 4JX5A 4UTHA 4MLJA 3LX9A 4LOCA 2NX1A 4O14A 2G97A 1NVMA 4N6FA 1XBYA 1KA9F 2ZBTA 2C6QA 1ZALA 3M44A 1EP3A 3VE7A 1ALDA 3M16A 1FXPA 5A8GA 1ICSA 3QSTA 2A6NA 4M7SA 3MO7A 3P5YA 3G0XA 1GG1A 4WXYA 1LORA 2NWSA 3E96A 2QCLA 3JR2A 2C18A 5KSWA 1JJKA 2TMDA 3O1NA 2PE4A 2YYUA 1TPWA 2DORA 3O06A 1DOSA 1M7OA 4Z1AA 1VZWA 1PHWA 2Y63A 3BW2A 3TX9A 4UTMA 3NR0A 1TPFA 4UR7A 3VE9A 2J9YA 5LKYA 3C2RA 3NPWA 2DZTA 1OFPA 1WAUA 1OJXA 1WBJA 4JD4A 4JX6A 5FEXA 2CWNA 5D2WA 3CTLA 3GZ3A 4MUZA 1O94A 5FF7A 2V8ZA 4UR8A 4E2BA 2XN2A 5D2VA 5EKYA 2NXHA 4OWGA 1VS1A 2CLIA 4LUJA 3C8FA 3UNDA 1LDCA 1Q6OA 3HG3A 3TJXA 3TXZA 3MI2A 4DEFA 4YWIA 5C5YA 3KRZA 3PG9A 4X9SA 4PODA 4NJKA 3SIZA 3CEPA 3W86A 1W5QA 5U7SA 1OFAA 4PH6A 3W23A 3QSRA 1QFEA 2A85A 3QC3A 3GR7A 3MBDA 2H8ZA 4JTJA 1HO4A 4RKAA 3NM3A 4JR5A 5BMWA 1ZAHA 3GVGA 4ALDA 5F4WA 3M41A 2YSWA 1FWNA 4H4IA 1I2PA 2ZZ1A 5AHLA 3ZFHA 1PCKA 3UZ5A 2F7FA 4WQ6A 4AHOA 2R91A 3O8AA 4LVDA 3TIMA 1P4CA 3I65A 3WK3A 3W7KA 2ZZ3A 3O16A 3TC6A 3P62A 1T8XA 3QW3A 1TV7A 3W2JA 3P67A 4HIBA 4I7WA 3LHWA 4JGDA 4ZQOA 3GK0A 4MZ8A 3SSJA 1S5WA 2FPVA 3FJ6A 1V7YA 3W71A 4CNPA 4Q33A 2QCMA 2E68A 3FFSA 3PBVA 2TSYA 3WJYA 4DF1A 5T26A 1HO1A 5LSMA 3INPA 5HJLA 1EUNA 3RLUA 2QAPA 2V0TA 1W3IA 3DKJA 3I68A 2ZYFA 2EGZA 2RKXA 1I8JA 5D30A 4YMZA 4HHPA 3STCA 1L9WA 1PIIA 3B05A 3W74A 4N4QA 4DQWA 1G4PA 2QF7A 4A29A 1H62A 5HR7A 4FB7A 3G3MA 2PURA 3C0JA 3HJZA 1PL9A 1ONRA 4LVAA 2XFWA 3A21A 4G1KA 3W7EA 1BTMA 4O12A 1VH7A 5HWMA 1NSJA 1R2RA 1R46A 2GUUA 5HR6A 4UFLA 3LHTA 3SGZA 2OMAA 4Z1CA 4IMGA 1K03A 1C29A 3TMLA 4ZQCA 3QF0A 2EF9A 2BZNA 5EY5A 3L68A 3LV5A 4JY9A 3NGJA 2Z0IA 3N2XA 2EKCA 3N19B 3MUXA 2Y7DA 4PA8A 4UIOA 3PSVA 1NF7A 1ZNNA 4JDYA 1TJRA 3BGJA 2OCZA 3C4UA 2CZ5A 3B04A 4CQ8A 3G8EA 4P61A 1ICQA 3MP4A 1UUOA 4UXDA 3EWYA 3DFPA 3MYPA 2EAWA 3C2OA 5G5IA 4QISA 1QPRA 4QSHA 1YLVA 4EF8A 1ML1A 2NLIA 3QMRA 2RFGA 3NXFA 1VYPX 1AK5A 4JN6A 3W9ZA 3K30A 1ME9A 1IIHA 4M19A 4ZVJA 5FF4A 3TFCA 1F73A 4DBEA 5AFDA 4ZQRA 1KFJA 1BWLA 1SUXA 1XI3A 2B7NA 4N02A 4MIMA 2X1RA 2ZFAA 4ZQNA 4CQAA 3NQ8A 1UJPA 4GRSA 2R94A 4RXFA 1XC4A 3PUEA 3TROA 1TTJA 2BWGA 3VKJA 2YFNA 3QYQA 2Y61A 3VNDA 2J24A 5F2GA 4R7JA 4FNRA 4O0KA 4Y9AA 3W85A 2W6RA 1J2WA 4IMDA 1WXJA 1XDLA 3FOKA 4K37A 4YL2A 1SU5A 3B0PA 2CW6A 1FUYA 3SY5A 2YFOA 3CIXA 1OHLA 4Q4KA 3SW6A 3CEUA 2ZZ2A 2P10A 3PF3A 3UD6A 2LLEA 3CM4A 1IXQA 4JTKA 4FNQA 1FQ0A 1TRDA 2QAFA 2V81A 3TR2A 4WXZA 1VJIA 1TPB1 2JGQA 2DZVA 2FJKA 3P7YA 3R12A 2D73A 5D03A 3W1NA 1DHPA 4M6PA 4Y96A 5H2ZA 1XCFA 5SWUA 3KFTA 3NQ7A 2WNZA 3S5YA 3S9YA 4AEOA 3LRMA 3W70A 2HMCA 2VXNA 4L4LA 2OJPA 5K2ZA 4O54A 4LTSA 3CU2A 1LOLA 4X3ZA 4NXSA 1GYLA 1OFRA 2WOQA 2UV8G 2R14A 4FHAA 1SQ7A 4XKYB 3ABOA 3W73A 1X6UA 1PS9A 4MFDA 1FXQA 2ZRXA 3QW4B 4O57A 3ZWSA 3ATYA 5I3GA 2WJZA 4GNJA 4CNOA 4JTIA 4O1BA 3LTPA 1DJNA 1AG1O 4IGHA 3MMTA 1VC4A 5C6MA 4LS2A 2CLEA 4MPQA 4AWTA 3DI0A 4CCCA 2ALDA 4QITA 1KM3A 3NPUA 4QM1A 4WX2A 2ISSA 3E9AA 3STGA 3RLVA 5IM51 5FEWA 5CGQA 1F76A 3CIWA 3U2OA 1KBJA 1O4UA 3HBLA 4NJJA 3LV6A 2QCNA 4GXMA 1TYGA 2QCHA 3HMJG 3Q58A 3GNDA 1SO4A 2ZRWA 1YTDA 1EP1A 3TAOA 4FXSA 4TO8A 1DBTA 4H3DA 1TPUA 5AHEA 4RLIA 5D32A 3W76A 3P84A 1SO6A 4OQVA 4RXGA 1G4EA 3PY2A 3TK7A 7TIMA 4AMAA 1NAL1 3HG2A 3M43A 3O07A 3C2VA 3NL2A 1FCUA 1KTBA 1QR7A 3LI1A 4MY8A 3WJWA 4AH7A 1IXNA 3BG3A 3QRHA 1GVFA 4O4VA 3N14A 2Y7GA 4PEKA 4HNTA 4WY0F 1XM3A 3W1QA 4EVZA 3CHVA 5I3JA 5FESA 2E5DA 1W37A 4XQ6A 1CX9A 4LRTA 5IBXC 1YPFA 3MI3A 5CSSA 3TW6A 3R5EA 3PULA 4X2RA 1IGSA 3IVSA 1Z41A 4Q32A 4CCEA 3CLMA 4NX0A 1MEIA 3W2UA 3W7QA 2X30A 2PCQA 4IXXA 1M7PA 1X1ZA 3QMSA 1ZCOA 1JCNA 1KM5A 3KX6A 4FNUA 3SFKA 3BG5A 3R8RA 3L21A 4O50A 1YDNA 4E38A 1TQXA 1T99A 1J5TA 1YTEA 2B7QA 3M5VA 4N6EA 3FEMA 3W1LA 1I2OA 2V5BA 1S3HA 2PC4A 5CPLA 1KFLA 1MEHA 1OK6A 2Y7FA 3NG3A 4M7TA 1ADOA 4EF9A 5AHIA 3GDLA 1UASA 5I3IA 3HPSA 1YXYA 4M6VA 3N73A 3ABQA 2YZRA 4NXKA 3W07A 3W84A 2IQTA 3NNTA 3SGUA 3TQKA 4B5NA 3QQ0A 2A7PA 2I1OA 4LRSA 3UWYA 3TCEA 2HSAA 5AOUA 1T96A 1JRCA 3PS7A 4ORIA 2VENA 4O28A 1LZOA 4POCA 2FTPA 2DZWA 4L4MA 1A53A 1EA0A 1TTQA 4WJEA 3LB0A 1W3NA 3NQAA 2ISVA 4Z1BA 4OV4A 5HWJA 2ABBA 3Q2DA 3FYPA 1R47A 1BEUA 1H60A 4J9JA 3UXAA 5DCDA 1JQVA 2BX7A 4PFMA 2DZPA 3LTYA 5EL1A 2AQWA 2YYTA 1QAPA 3EX3A 1TPVA 4JXCA 4UFKA 3WJZA 3LDVA 1QO2A 3W83A 2HS6A 1OFEA 4IOTA 1Y0EA 3LHYA 2B7OA 3DI1A 4MZYA 4JTTA 2A2IA 2V9DA 2NV2A 4ZMGA 1G6CA 1OX4A 2GJNA 4IJBA 4O1CA 5HWNA 4JNMA 5E1QA 1L6SA 3PVFA 3TMQA 2VKZG 4MFEA 2FFCA 1X1OA 3P81A 2H6RA 4BK9A 4O1DA 3W87A 1TTIA 4C1LA 1O5KA 3LHZA 1O5XA 3NYZA 4HKPA 4NNCA 2GQ9A 2R8WA 1QOPA 2NXGA 1OG0A 3BG9A 1HG3A 2FB3A 3MHFA 1MXSA 1YDVA 1F74A 2O7SA 4K39A 3TDFA 4DBDA 2QDHA 1H7WA 2VFEA 3VFLA 4DO5A 1EWEA 4FF7A 2J9XA 3SECA 2Z6IA 5J5RA 3GDTA 4I7UA 4GWEA 1WQ5A 3OVRA 4JYFA 4LV4A 3F4WA 4RV8A 1VLWA 1LBLA 1JVNA 4K38A 1Q3NA 1W0MA 1G7UA 1C9DA 4O1AA 3C2FA 5U4NA 3C52A 1ME8A 3DBPA 3OIXA 2E6YA 3KOFA 1LCOA 1KV8A 4TR9A 3ABSA 4TMCA 4TX9A 3OG3A 2GVJA 3EX6A 4O10A 3A5FA 1X8FA 4MYAA 1W1ZA 3N2MA 1KFKA 4ZQMA 1B3OA 3CWOX 4ZL1A 1QPOA 5LNVA 3UWWA 3HGSA 1WOBA 3NQGA 4O52A 1MO0A 4LS0A 3CC1A 3GDRA 5LGZA 3NZRA 2ZRUA 3N9RA 2CLLA 4O16A 4AB4A 3TSBA 2GJLA 2YCEA 2Q8ZA 1F05A 2XN1A 1VCGA 3Q37A 3EXRA 4UFMA 3L66A 1RPXA 5I3FA 1HUVA 5AHFA 2NXIA 3FKKA 2V82A 3R2GA 1AW1A 4UMCA 3HG4A 1OYBA 3T7VA 3PUOA 1VQTA 3MP5A 4HT3A 2CLFA 1OX5A 4UTTA 3UQNA 3W7RA 4RZ5A 3M5XA 1JUKA 2C16A 4UTTC 5FF2A 3TUUA 3BV4A 1OYAA 2P1FA 1LRQA 1WYIA 3WFAA 2VEIA 2Y62A 5C2XA 1EP2A 5DN1A 4IMFA 4UFJA 1I2QA 4P2VA 4K36A 3L0GA 3LRLA 3GYEA 3S6DA 2C13A 1I2RA 2TRSA 3PM6A 3LRKA 4MOZA 5CKSA 1M6JA 3HG5A 1GQNA 3H53A 3S0CA 5I3HA 4MVAA 6TIMA 2BLEA 4Z1DA 4N9CA 3LCHA 4IUOA 1D9EA 1XUUA 4IX2A 1YPIA 3QMTA 4QQ3A 1QNVA 3S5OA 4PTNA 3LM7A 1TPH1 3KVKA 4O15A 1G69A 3GIYA 1TO3A 4JEQA 1SW7A 1LRTA 1SZNA 5G1TA 1FDJA 3W6YA 2NUWA 3P80A 1XL9A 3UWQA 3IIZA 2JKPA 4IXHA 1TREA 1YDOA 1KTNA 3NO5A 4FNTA 4IPJA 1TIMA 3BLFA 3EX4A 3W2KA 1KM1A 5TBOA 3FJLA 2H3BA 1MEWA 4CQ9A 4QNEA 3W75A 3M0ZA 4XZ9A 2DP3A 5F4XA 4YLWA 3NQCA 4LV9A 4NZJA 3P8JA 4UNLA 3TSMA 3PR2A 1WBHA 3WK2A 1RVGA 1FCQA 1U83A 4LNYA 5CPMA 3LCLA 3CT7A 3LHUA 3UPWA 1OFQA 1QOQA 1JCMP 1GYNA 3NPXA 3DU0A 3BW4A 3TSDA 3CQ0A 3LGEA 4Y90A 3PAJA 2QKFA 2V5LA 4JTUA 3EX1A 2A5HA 1FWWA 4DO6A 2NX3A 5AYYA 1GOXA 2QUTA 1FWRA 3R13A 5KITA 2Q3OA 1AL7A 1JCJA 3KVJA 2E09A 3BW3A 2E5BA 3EWZA 4BI6A 1EEPA 1HL2A 3G22A 3I6RA 4EOUA 2CZFA 1VPXA 3B03A 5HUOA 1W5MA 5LNSA 1YXDA 3LLDA 3USBA 2A1YA 5D2YA 4ONVA 5AYXA 3NL5A 3GDMA 4UC5A 5FI8A 1GJPA 3I7RA 3E02A 1DQWA 3FKRA 3KXQA 5HNRA 5E93A 4XTDA 3W2NA 3E49A 1TCDA 3GXPA 2QCCA 4GJ1A 3TFXA 2WSRA 5G1YA 2CLMA 5DY2A 4TU1A 5DLCA 1LTDA 3A23A 2VOMA 1WDWA 6ALDA 2Y88A 1P1XA 4XTIA 4GUIA 4MKNA 4N9EA 3S1XA 1R30A 1XBZA 4ORMA 3G0SA 1R2TA 3UZJA 1K7EA 4XBSA 5EBUA 3G24A 1SW3A 1N8FA 5LNUA 3G18A 1EB3A 2G95A 2ZRVA 1YXCA 1RZMA 3NPVA 3W7HA 2C14A 3LCFA 1NEYA 4WY0B 1VCFA 1XFBA 3OVQA 3IIPA 4KFPA 1H50A 4GFSA 3AO0A 2FB2A 3BARA 1SW0A 1I2NA 3F4NA 4RCXA 4NU7A 4QIUA 4RR4A 4NJGA 1OVDA 1OX4B 1BKSA 3LCIA 1W5NA 2BTMA 3L9CA 1A5BA 4DPQA 5J5DA 3MHUA 3C2EA 5L6UA 4JTGA 1OYCA 3DHFA 5AHMA 4OU1A 2QDGA 1TSIA 2FQIA 1JUEA 3SI9A 1WV2A 4NT0A 5G2IA 4ZQPA 3CWNA 1VYSX 2QCFA 3NQMA 4AF0A 3RNDA 1VRDA 4HPJA 1F6KA 3QQ1A 3E12A 3QJAA 4HSNA 1RV8A 1IF2A 1YTKA 3S1UA 1EWDA 1LROA 1OFBA 3W7JA 1A5CA 3BGGA 3LTSA 4RK8A 3O6DA 3KRUA 3HGRA 1SO5A 1A50A 5KZMA 1B4EA 5F2IA 2VFGA 4DELA 3S5ZA 2GVGA 3NQEA 5FEZA 4A2SA 5G2HA 1OABA 3EWUA 1KM4A 4IPIA 4ADUA 2ZZ7A 4DPPA 3PC0A 4BI5A 5AC8A 2FDSA 3L5AA 4UMAA 4HPXA 4DF2A 2H90A 5TQLA 1TTPA 3PBUA 1P0KA 4FIQA 2VELA 5D37A 3OHIA 4A22A 4O4WA 4DO4A 4WOZA 2WPBA 4MZ1A 1KFEA 2ZA3A 3MP3A 2WQPA 1TPEA 2BXVA 3KHJA 3UYCA 3BLIA 3ZS4A 4BR1A 3M6YA 1N55A 2TPSA 3HQ1A 1OF8A 1KTCA 1WOAA 4UFIA 1G4SA 5HULA 2VEPA 2NUXA 3EEGA 2NWRA 1KM0A 1Z48A 3SJ3A 4O11A 1H7PA 4UMBA 5D02A 1UB3A 5CPOA 3NVTA 4AXKA 3IV3A 3JRKA 1FCBA 1UUMA 4JX4A 3RU6A 4LC8A 1GG0A 1QCWA 2QCEA 3M5ZA 1QPNA 3PB0A 2W79A 4MY9A 2VC6A 3NOEA 3S8HA 4DF0A 3OA3A 3A9IA 2CZDA 3MYOA 1DQXA 1LRNA 3LLFA 5K9XA 1EUAA 1SSDA 1W5PA 3V1PA 2E77A 1O60A 1Z44A 2OX1A 2A7NA 4ML9A 4AWSA 3TU9A 5D2TA 5DY3A 5DELA 4D2JA 5EPDA 3LBCA 3TE9A 1B9BA 1KLZA 2YW3A 3GX9A 4QAIA 2Z1BA 2V30A 3M1ZA 2ZA1A 1D3GA 3NQVA 4CLMA 4M5PA 1B57A 1RQHA 2QJGA 1GVQA 2TYSA 4WOQA 1QWGA 3NAVA 5DXXA 3EKZA 4I9AA 4LW7A 4N2YA 4A21A 2QJIA 1OK4A 2WKJA 1XBXA 4XWUA 5D2XA 3NDOA 4IMEA 1ZAIA 2DJXA 4WZHA 3T44A 2F84A 1LBMA 3RMJA 2RDUA 3L5MA 4YXGA 1K8ZA 2PRMA 3GXNA 1L6WA 3DHDA 4JTFA 3ANYA 2J6XA 5KTLA 4LVGA 1Q6RA 4GC4A 2CZEA 5DBUA 1JUBA 2CLOA 1TPDA 4OGZA 5ABTA 2OT1A 3G1XA 1AW2A 1ZENA 3DFSA 3BLEA 1BWKA 4FXRA 1KM6A 1WA3A 2H3DA 3A24A 1JCYA 1H7NA 3GAYA 2X1TA 2X1SA 3B0VC 2OT0A 3RF9A 4MY1A 2XN0A 3M47A 4HNUA 3L2IA 5IBXA 3CB8A 4Z08A 2RH9A 4JIPA 2DZXA 1QO5A 1M5WA 3HGOA 4R34A 4Y6GA 4JTSA 4AWUA 1DKWA 2YDAA 2ZA2A 1LOSA 4O53A 5KZEA 1Z42A 2Q3RA 3GR8A 2QCDA 4BWLC 4N9BA 3G0UA 1SSGA 3MHGA 2CLKA 2AAMA 3RK8A 3TQVA 3UWVA 3Q94A 4X22A 5D33A 1L6YA 2B7PA 3VI2A 4S2BA 1RQEA 4AAJA 1W31A 1H61A 3TQ0A 3STFA 3N34A 4QNWA 5HINA 1CW2A 1IXOA 1VCVA 5LHEA 1P5BA 3E0IA 3T40A 1XUZA 3U6WA 1GVSA 1A5AA 1OFOA 5CPNA 3DENA 4EIVA 2OZ0A 3PBYA 2YXGA 2QR6A 3G8RA 3W1PA 5KMYA 5CSRA 3W22A 3LCGA 1JRBA 3W7GA 4LUIA 3W7DA 3HIJA 1WX0A 2O7QA 2Z6JA 1FDZA 4S2CA 1KBIA 5DXYA 2CFFA 4O13A 3PWAA 1KFCA 3IGUA 3UXDA 4FO4A 4FX8A 4HNVA 1SO3A 3WK0A 1OX6A 1SR9A 2Y6ZA 4RX0A 3GDKA 2E6FA 4HN4A 4GE8A 3H55A 4K7VA 4BI7A 3LCXA 3W7OA 3HO8A 4LT9A 3OEXA 3P5ZA 3QZEA 3FA5A 1PHQA 5DCEA 1JULA 2B4GA 1W3TA 2WSYA 3N3MA 2EHHA 1T0OA 1TQJA 3HGJA 3QM3A 2ZCGA 2FPTA 2ZRYA 3DKLA 4PL1A 5BOOA 1H7RA 1K7FA 3ATZA 3S5NA 4XUGA 4RZ4A 3H54A 3LOTA 4KKXA 3DXIA 1LLZA 3THQA 2E5CA 5FF3A 3NQFA 2ZZ4A 1XBVA 3YPIA 1GZGA 3LXAA 3TKFA 3W72A 2FPYA 4PL2A 5A5WA 3S42A 4OHQA 1IXPA 4AVFA 1SPQA 1TRIA 4IX0A 1PVNA 3UY7A 3A5VA 2ATMA 5CG7A 3W7NA 3S1VA 1AW5A 3P8IA 5F2LA 4UTWA 1RD5A 3DGRA 5KINA 4TIMA 4PC8A 5CZSA 1W56A 3OVPA 4UTWC 1FWSA 5AB3A 1W8SA 4O18A 2GVLA 3F03K 5AHNA 1XXXA 2Y7EA 2VEMA 3L67A 3O15A 1ZFJA 5K3VA 3G1AA 3O6YX 1LM1A 1DVJA 3G1FA 2RDWA 1EX5A 3G3DA 1RQBA 1TB3A 4H6KA 4MYXA 1VGAA 2WO5A 2DZSA 2NUYA 3G1HA 4BWLA 1AL8A 2JGYA 3UWUA 2G5WA 5FEPA 5KZDA 2VFHA 3HF3A 3R89A 3M5YA 3IIXA 1SFLA 1B4KA 3PB2A 2I9EA 4NNAA 1NFBA 4I7VA 1GWJA 2ZRZA 4UTUA 3PG8A 1TV8A 3KRSA 4RZ6A 2A0NA 1QMLA 3W1XA 1JCLA 3GB6A 1F5ZA 1S5VA 3G1YA 3TC7A 4GBUA 3IIOA 2GQ8A 3LHVA 5K4ZA 3PSWA 2JK2A 3SR7A 5D04C 2Z2UA 3IIVA 1W54A 2YR1A 3LERA 2QCGA 3U8GA 3W7PA 3THAA 3B4UA 5F1VA 3NL3A
chains in the Genus database with same CATH superfamily
2BSLA 1X8CA 1BHGA 2HTMA 4AW7A 4X63A 4RUBA 1J96A 4FEZA 3ZR4A 3GKAA 4RZBA 2XHYA 3FS2A 4H9TA 1FY6A 3S1WA 1WXYA 3WYZA 1JD7A 2J7FA 2WK2A 3WQCA 4AUBA 4UTIA 4O8AA 4LAOA 5D05A 3SCSA 1OGBA 3KHDA 3IACA 2DJLA 4S39A 1NDWA 3VMOA 3BUVA 4NIRA 1L2UA 4JICA 2WYSA 2J62A 4S3EA 3DH7A 5K9CA 2J78A 3WNNA 4YIWA 2DUXA 4RDZA 1JZ3A 3GO2A 4RJEA 4DN1A 4DXKA 2NZLA 3DOPA 3P60A 1OZMA 4HU8A 3P0XA 2A6LA 2GFTA 4UTJA 1GVOA 3W82A 4CEXC 4U5IA 3QH2A 3TYAA 3TW9A 1SJDA 4NQ1A 2WVSA 3GBEA 3WLIA 1PBGA 1OY0A 4WY0A 1MSSA 1MQPA 4Q8PA 1GKPA 4J35A 5AY7A 3O05A 2CXEA 3D0CA 3KAOA 1J0KA 5H91A 1H7OA 1US0A 4DWSD 3TTEA 5CC3A 2WJDA 2G96A 2VO5A 4FSAA 2ON3A 2HCVA 3UG3A 3NEVA 3V75A 1VR6A 1ZY9A 1QASA 4XBKA 2FTWA 1I4NA 5AN7A 1HVXA 2E25A 3J7HA 5HUPA 4C6FA 1OC7A 4Z0SA 1DXIA 3N2OA 3NM1A 1GHSA 4S3BA 3W7LA 1IIGA 3F5JA 4QFUA 2R9RA 1FX6A 4Q8WA 2QUVA 4XZIA 1EJSC 2VR4A 4IPPA 3W2MA 1GQJA 2CBUA 5DMMA 4FX7A 2OSWA 3HOJA 2XFYA 4GG9A 3BURA 3DBNA 3BE7A 1K9TA 2NLYA 2WMJA 2I16A 2CBJA 3IRSA 4O8RA 3AU6A 4UTLA 1H49A 1LUCA 4R27A 1IT8A 4NHVA 4RV3A 4HK6A 3I3EA 5EU9A 1EIXA 1XLAA 1OFDA 4ADTA 2CESA 3KM8A 4NNBA 1LYXA 2OELA 3TH6A 1UZ1A 3NQ2A 3MV11 4JYEA 4XIAA 3B06A 1QI5A 5G4EA 2C8NA 1KQYA 3UWZA 3WQVA 4L9YA 4PCNA 3UWEA 2PGEA 2OSYA 3SUTA 2KZHA 3V16A 2WB5A 2HK1A 3DFTA 3TP4A 1GTEA 5K7JA 4HMCA 3L5LA 5LNWA 4ZXOA 4GVIA 4O19A 1MW3A 4JQ1A 4XAPA 3UJSA 5G2WA 5I3DA 1U1JA 2D69A 4M0XA 4OT7A 3T0TA 3RRAA 4XD3A 2V63A 2P88A 4J3SA 1FBAA 1R85A 3AI0A 4C1NB 1J11A 1FWTA 3W1MA 4X61A 4HP5A 4LVBA 1MNSA 3MZNA 1EGVA 3DG3A 2J27A 4LU0A 1NP2A 3T4CA 3JW7A 3EAUA 2XWEA 3U5UA 1VJSA 3TN4A 4JTLA 5LIYX 4R9OA 2OB3A 4WSHA 1HFBA 4B9ZA 1JQXA 1CEOA 1DV7A 2PRLA 2E9MA 3S1GA 3TJLA 1YYAA 3B8DA 1TA3B 1JPDX 4JYDA 2WV8A 2X42A 1HL9A 1QPQA 3O0FA 3WJXA 1J0HA 2WQDA 4WUIA 4IQJA 3GH5A 1P0NA 3RFAA 4DNHA 3WQEA 3QV6A 4E8CA 2PRHA 5D38A 2Q8LA 1GJUA 4DLMA 1XCXA 3R4IA 3R79A 5HMEA 2OOFA 5T9CE 2WNQA 2Y85A 3VKBA 2HXTA 1NOFA 4UTKA 5HQEA 1G67A 3NQ6A 1WPCA 4JY8A 5F2MA 3UA4A 3KTSA 1A5MC 5CC5A 1S2WA 2Z1VA 2JEPA 3U5YA 3IEBA 1MUWA 3WEZA 4D6FA 1XLCA 2VFIA 1KW1A 2OO0A 2PBGA 1GT8A 1WZMA 1SZGA 4URIA 3P74A 5F4SA 4K8EA 4Z2LA 2Y89A 4YTQA 1WNOA 1ZJHA 4AIBA 3PNUA 4ASTA 1IEQA 3SRFA 1HJSA 4H7ZA 4LAKA 1LLWA 3ELFA 3CUIA 3AMGA 3BAYA 1CGWA 5EYWA 4EWND 3VNZA 3EWXA 3VD7A 2BOFX 2NT1A 1JZ4A 4DWSB 1NARA 1QNSA 3TNOA 4GH3A 1O95A 1KWGA 5K4XA 3BTNA 4UNKA 3WQ8A 3W01A 2WXDM 5JIWA 2QCDB 5BRBA 3E0VA 5REQB 3UF9A 1J10A 1Q6LA 1K4GA 3QN3A 5AYZA 3AU2A 2RDTA 1HP4A 4L1XA 3L4TA 2NQZA 1IGWA 2QS8A 3VOIA 3UZXA 2FIQA 2Z7GA 4O17A 2YL5A 1TUXA 4M56A 3CNYA 2VFFA 4Q8OA 2PU1A 5CJ5A 1UH2A 3THDA 1S3TC 3AFBA 1H5YA 2C0AA 4ZZ9A 2ZDSA 3QR1A 4EXAA 3OTRA 4HMNA 4E2OA 1V6WA 3EXTA 4NJIA 4JQ2A 3USZA 3ZLFA 2BODX 1LF1A 3VIGA 1ZAJA 3MCOA 5I3KA 3UZZA 3WQDA 2L5HA 4A2RA 3ITTA 3AXMA 4LOCA 2WZEA 1Z32X 3PJWA 1ZALA 1NWTA 4HOXA 4F0LA 2HBXA 7REQB 3VE7A 1FXPA 2WC4A 2C18A 3E96A 3EDFA 4L4PA 3O1NA 3EBVA 4JQAA 4Z1AA 5H1WA 1VZWA 1CLVA 3BW2A 5BROA 2VC5A 3NR0A 1TPFA 3VIOA 1CPUA 3C2RA 1OFPA 3LMYA 3PUGA 1ISXA 4WKAA 4HN8A 1HJQA 2PI6A 3GZ3A 5FF7A 2PLJA 1F3XA 3T0BA 5EKYA 1VS1A 2D20A 1XCWA 3C8FA 1RUSA 4G6CA 3TJXA 3BCJA 1ONEA 5C5YA 4F0SA 2GVYA 5FD0A 3PG9A 4PSRA 4PODA 2VZTA 2Y4SA 2ZUVA 2WC7A 3CEPA 5I77A 5FJPA 3W86A 1UZHA 1W5QA 3W23A 3GIPA 4KEMA 3VPLA 3AUJA 1NQ6A 1ADSA 1QFEA 1TJ2A 2NSOA 3B9OA 3SGGA 1Q7ZA 3NM3A 4PBGA 5F4WA 3KOXA 4B5XA 4ZOAA 3BLLA 3E5BA 2DT2A 2FH6A 2O4MA 4C6DA 4KWOA 4AZIA 3VGFA 4YTTA 1PCKA 3MWCA 3O8AA 1P4CA 3W7KA 3GS6A 4ATDA 3O16A 3GG0A 3MS8A 4BEUA 1KGWA 4BCEA 4HIBA 1ZCCA 1X38A 3SSJA 3KBSA 1B31A 4Q33A 1Q2RA 3FFSA 2PTWA 2IQDA 3WJYA 1B0IA 1GW1A 2IKGA 4BF5A 1HO1A 5HJLA 1EUNA 3RLUA 2V0TA 4E3TA 3IUDA 4YMZA 3OJGA 1NTHA 4AC1X 1L9WA 1PIIA 1XGZA 3MSDA 3G2GA 1BPLB 2E8YA 2WZHA 1ONXA 3EB4A 3MCMA 2OVLA 3A21A 5HBFA 1JDEA 4AD4A 2WKGA 2GZXA 4PUUA 1VH7A 1B2YA 1RCQA 2C7FA 3CS2A 4RE2A 1R2RA 2E67A 2PLKA 2GUUA 3LHTA 5M1TA 1K03A 1C29A 4ZQCA 1RPKA 3VCCA 1OG6A 2EF9A 2Z7KA 1RLCL 1HXJA 3H4WA 3B9DA 4QROA 3NWRA 4CNTA 3L4YA 2Z0IA 2RJHA 3N19B 2XWDA 5BRPA 2O9PA 5G4HC 5I03A 3UFYA 4JDYA 1UPPA 2UY3A 1DJZA 2XVPA 3C4UA 2CZ5A 2IXUA 2QW5A 5DMLA 4UXDA 1P0EA 2DIEA 1W1IE 3N13A 2EAWA 1XSJA 5G5IA 2Z00A 3IV8A 1YLVA 1D7FA 4EF8A 1GZJA 2XH2A 1ML1A 2NLIA 1QPKA 5C2GA 3CWHA 1AK5A 4U31A 2FZMA 4JFUA 3DECA 1IIHA 4TVCA 2YLAA 4S3AA 3KOWA 4DBEA 1XRSA 4M3PA 1KFJA 1PWLA 4M24A 5E9XA 1IZKA 1XI3A 3EMZA 4N02A 4MIMA 2ZFAA 4CQAA 3NQ8A 1XIHA 2ZWZA 5FACA 3ITCA 3FYYA 4QE1A 3WY1A 4PRWA 3CUFA 5F2GA 3LNPA 2CIPA 4W4QA 1X7IA 1B54A 2W6RA 1SU5A 3B0PA 2CW6A 1L8NA 2C91A 3LMZA 4KPLA 3UXKA 5FKYA 1WUFA 1MFVA 4Q4KA 2ZUNA 4KS0A 2LLEA 3BWWA 3NDYA 3OA5A 4EPKA 2E3ZA 2QAFA 4HK7A 2V81A 4PMQA 2DDXA 3TR2A 1E56A 2JGQA 1Q7QA 3P7YA 1P0DA 3R12A 4HPHA 4RPQA 1PUDA 3AS2A 2ZKMX 4O0QA 3S5YA 5DT7A 2ZUTA 5A8OA 2OJPA 4O54A 1RJQA 4X3ZA 2UV8G 3PPGA 4FHAA 1SQ7A 4ZTXA 4PB3A 1X6UA 1FXQA 2ZRXA 3QW4B 3R6IA 4KMQA 2YDQA 4ZFMA 4RNFA 1XLBA 3L2MA 3M07A 1YPXA 3CGTA 1QI0A 2J7GA 3C3UA 4MPQA 5M03A 1K9EA 4CCCA 4F0KA 4QITA 2PFHA 1AVAA 4WX2A 1T8QA 1ZP3A 3E9AA 3STGA 4RE3A 3UCDA 3VIIA 2W67A 4U5KA 1B3ZA 4D9PA 4LB4A 1TFVA 3U2OA 1EXBA 1KBJA 1O4UA 2HRWA 3LV6A 3K4DA 2ZVRA 1P6BA 3OO2A 1M03A 4FXSA 5A95A 4RLIA 4Y9MA 2PDIA 4Z42C 1PDYA 3SN1A 4RXGA 1XYCA 5BWAA 3PY2A 3TK7A 4IPLA 1NAL1 2PDJA 1C7TA 3HV9A 4ZBCA 1US3A 2QLYA 3WL0A 4OUEA 3MV01 1E1EA 2EEXA 3BG3A 5CC7A 2FVLA 3S46A 5I79A 4PEKA 3VIJA 1OGSA 3W1QA 4EVZA 5I3JA 2PTZA 2E5DA 3WD4A 2E9LA 1PAMA 3ARSA 1S5MA 1C92A 4QEHA 4ZSTA 2P8BA 4AVOA 4Q8UA 2VQUA 4IICA 1AH4A 4JHZA 4GO8A 1IEIA 2W9MA 2X30A 1QATA 4W89A 5GJPA 3KX6A 3ZR6A 1PB0A 4MKVA 1GOQA 1M9HA 1DXEA 4E38A 3CYVA 3FEMA 3W1LA 1I2OA 5CPLA 3L4WA 2Y7FA 3T8QA 3H2AA 4C91A 3W53A 4EF9A 1D8WA 5AHIA 3LPOA 1RD6A 3LBOA 5I3IA 3ABQA 2IQTA 3OQ8A 3TQKA 3VC5A 3R8GA 3QQ0A 3MKKA 3TZFA 2X41A 1Q8AA 5E9AA 1XIBA 2POTA 4FPSA 3VMNA 1TWIA 4MJ2A 2XSXA 3KTXA 1LZOA 4GZIA 2FTPA 1N82A 2DZWA 3WF0A 1YW1A 1K70A 4KRUA 3E74A 3LK6A 2WKLA 1A5UA 2ABBA 2QULA 3FYPA 2NQJA 1YDYA 3CAWA 3LTYA 3WDRA 1V6TA 3APTA 5EL1A 2GJPA 1QAPA 1J5SA 3MMUA 5A8MA 1DJIA 3ARQA 3ITGA 1PZ0A 3WJZA 4JTAA 1OFEA 3LHYA 1DQUA 4FZIA 4JNZA 4JTTA 3S3GA 1XRTA 3AICA 1G6CA 4C6BA 3EYPA 4O1CA 3EEZA 3TMQA 4X0NA 3P2VA 3MDUA 4MFEA 1PTAA 3P81A 3WLSA 3W87A 1TTIA 1O5XA 4TX6A 4NNCA 4MNJA 1GNXA 1NWUA 3BG9A 7PTDA 4KETA 1MXSA 4MB5A 2BV9A 1UA7A 3KLKA 1F74A 1PWMA 4ZB5A 2BP1A 1UA3A 3BLPX 1UG6A 4FF7A 4B4FA 3CUXA 1TVLA 5J5RA 3E0LA 2DVXA 1MFUA 2UBPC 3H8AA 2G4JA 4JYFA 1O6IA 1W0MA 1G7UA 3C2FA 2HJPA 3OODA 3C52A 3RMEA 3DBPA 3OIXA 1MZRA 1KV8A 1PKNA 4TX9A 3VGEA 3BXWA 3A5FA 4AZBA 3JZUA 4ZQMA 3CWOX 3N4EA 3KBVA 1QPOA 1WOBA 4O52A 4AG0A 4YWSA 2BHZA 3NZRA 1PTDA 3BICA 4OUIA 5A6MA 4YVXA 3CIVA 2CLLA 1TR1A 2VQTA 2YCEA 2Q8ZA 3W6LA 1OBAA 1XPGA 1F05A 2BY2A 1O1HA 3F5KA 3L66A 1KRAC 1UD5A 5KEZA 2NXIA 5E0FA 2V82A 2BBFA 4HTBA 4W8BA 3WLTA 4UMCA 3WLRA 2GJXA 2QPSA 1OYBA 3ISIX 1B90A 4HT3A 2Y5SA 3UQNA 3B0XA 4RZ5A 4GMEA 4GPNA 5FF2A 3TUUA 3HTWA 1OYAA 2C71A 2P1FA 1LL6A 1X6LA 1X1NA 4Q8VA 1BQCA 4YNGA 2I17A 3QY7A 2Y62A 5C2XA 4XSMA 2GDVA 3LRLA 3GYEA 3DDMA 2C13A 3S6DA 1I2RA 3C8NA 3PTDA 3MY9A 1PXGA 4Z1DA 4N9CA 4IUOA 1D9EA 3QMTA 4BY3A 3U57A 4W85A 4QQ3A 1KBKA 4DNMA 2XGIA 1TO3A 2O9RA 3W6YA 1XL9A 2JKPA 1R9ZA 1TREA 4HU4A 1KTNA 3LPGA 4FNTA 1E6XM 1EBHA 5A69A 3MT1A 1A3WA 5A8QA 4IIEA 4NZ1A 1HKIA 5F4XA 4PMVA 4ZOBA 3L2LA 3WX7A 2OODA 4NZJA 3P8JA 1FWFC 3TSMA 5C9XA 3BLDA 3FN9A 1HJVA 1IE7C 3VX1A 1CLXA 1VFHA 2WJFA 3LHUA 1OFQA 3VC6A 2YBUA 1GYNA 4AZ6A 3DU0A 1E9ZB 3TSDA 4Y90A 1PTGA 4PMDA 1OADA 6A3HA 3NO1A 3R0KA 4J7RA 3RRXA 1Z69A 1FWWA 4L4OA 2J6VA 2QUTA 2AGTA 5I06A 4FA3A 1B5TA 3RUBL 3L12A 3OBEA 2VRQA 4G1NA 2HPIA 3EWZA 5D9MA 5EMJA 1HL2A 3I6RA 1KXVA 1RK6A 1QW7A 5HUOA 5LNSA 3LLDA 3HZ3A 2REQB 2GOKA 4TOQA 4QRNA 3E02A 8XIAA 5E93A 1YNYA 4L7ZA 3E49A 1TUFA 2HQAA 4LX4A 1KKRA 1WKFA 1UQYA 5FJUA 4CN6A 4I9TA 3COTA 3UJFA 3ZJ8A 3U0HA 4N9EA 3S1XA 1R30A 1CGYA 3QQWA 3G0SA 2BMBA 3N6QA 4XBSA 5EBUA 3G24A 4MMWA 2HV5A 5LNUA 3NPVA 1RZMA 2E8ZA 3LCFA 3K1DA 4Q4PA 4BQ4A 2VDHA 2ZOXA 3OVQA 3CV2A 3VNLA 3AO0A 2BASA 3BARA 1I2NA 4C65A 4P7QA 4QIUA 4NJGA 1VP5A 1BKSA 4AX6A 1KXTA 4GLEA 1W5NA 3MMWA 2BTMA 3QKZA 3WBYA 3VGDA 3FAXA 3UYIA 3U48A 3DHFA 3AROA 3OZOA 5AHMA 1EC9A 2EPKX 1HGWA 2FQIA 4AIUA 1EYWA 4JHOA 1SVDA 1JUEA 4QDPA 1PZ2A 3SI9A 4L6DA 1WV2A 4NT0A 1E9LA 3B8TA 3A9BA 2VRKA 3KDOA 1VRDA 4HPJA 2G8ZA 1Q7MA 3I4EA 3VIFA 3ZT7A 1JZ6A 1KGUA 3MUY1 3GG8A 1XIMA 3LTSA 3TLQA 5ABEA 3D47A 3HGRA 1A50A 4DLFA 1B4EA 1LQAA 4J3WA 5F2IA 4DELA 4Y7EA 2PDFA 4P8VA 1U1UA 2R1PA 5HQMA 2WVTA 2OLHA 1KM4A 1QW9A 3RPMA 2ZZ7A 4DPPA 5AC8A 3RHGA 3E2QA 4FR1A 3GTHA 1OIMA 3FXGA 1TTPA 2PF0A 1DJGA 4C6LA 3AZRA 2WPBA 3BL3A 3OP2A 3WF3A 4MZ1A 3U4FA 1XRVA 2D22A 2WQPA 3N17A 4LUYA 4A8LA 3UYCA 4PSPA 3M6YA 2TPSA 3QFWA 3VNKA 1XH1A 3DC0A 5HULA 4DWSA 1WZLA 4DM1A 2NWRA 3GRIA 1FP9A 4XZWA 4O11A 1H7PA 2PDHA 4H9VA 1IZCA 3RX2A 3IV3A 2VJXA 4LC8A 1QPNA 3WLPA 3PB0A 3SUUA 3II1A 1TJ0A 1NP0A 4B2DA 3PZNA 1Q63A 5LA0A 1DQXA 5I02A 2Z1KA 1HX0A 4GVGA 4A35A 5LXEA 3BV7A 1CXFA 3RXZA 2ACRA 3TYEA 5EPDA 3TE9A 1B9BA 1KLZA 2Z1BA 2V30A 3OOQA 1XQLA 4J3TA 3KLLA 2WHMA 3BJTA 4WOQA 4MNKA 4M6UA 3T2QA 1OINA 2P53A 1ZS2A 2G0WA 1M1BA 3WLOA 4I9AA 5HNUA 1LUCB 1OK4A 2JIEA 2WKJA 3UR5A 4WCJA 4IMEA 1ZAIA 3CZ8A 4WZHA 1E5NA 2G3IA 4CUCA 5FAJA 3OZMA 1K8ZA 2PRMA 2DGAA 4LYRA 3LGDA 4JTFA 5PTDA 3N4FA 1MQRA 1UJQA 4WEVX 2CZEA 4LEQA 1JUBA 2Y2WA 2JQXA 3GU2A 3A4WA 1XGDA 4OGZA 5ABTA 4MWAA 3GXDA 1M68A 3MUZ1 1KM6A 2H3DA 9RUBA 4R5EA 2OT0A 3RF9A 4MY1A 2XH0A 1PDZA 3NCOA 1M5WA 1FA2A 2XM1A 4R34A 4AWUA 5IOBA 3NQBA 3OBAA 1WDPA 3ME3A 1E4LA 4OTKA 3KBWA 4IZGA 1IHIA 4XUYA 4U3CA 2UZ9A 5IXEA 3Q94A 4NF7A 2X09A 2B7PA 3VI2A 1RQEA 1CNVA 2PB1A 3URQA 1AJZA 2IKJA 3TQ0A 5LHEA 2PDBA 3QZAA 1OC5A 1GVSA 1TX0A 3DENA 4JEJA 2YXGA 2QR6A 5CSRA 4KCVA 2VEGA 3BOLA 3AIVA 4NG3A 4LUIA 3W7DA 3HIJA 4S2CA 2Z6JA 5A6AA 1FDZA 2WM0A 2F9RA 2R24A 5DXYA 4O13A 1UH3A 3BLOA 4B5SA 4FO4A 1JNDA 4FX8A 1SMAA 1BWVA 4HNVA 1SJBA 1Q2SA 3SUWA 1H11A 1UWAA 3A4JA 3GDKA 3W27A 3H55A 4K7VA 4EAMA 4BI7A 3LCXA 3P5ZA 3WL1A 3SBFA 1TCMA 1UR0A 1H2JA 9XIAA 1T0OA 4L6OA 3EOUA 3WIJA 3QM3A 2ZCGA 4A8RA 3URAA 2WWCA 5HK4A 3QOKA 5BOOA 2WBKA 4M29A 4H41A 3ZXWA 1K7FA 4MB4A 4RZ4A 1AODA 4REQB 4G7EB 2WVVB 2HVOA 3U2ZA 1EJ7L 3YPIA 5ABFA 1DWHM 4OHQA 1O7AA 3KCOA 3AZTA 4FI4A 3A3WA 5A2AA 1FWBC 2ATMA 1MYRA 1ZJBA 4IJCA 1Q13A 2PGWA 3S1VA 2GJXB 1K6WA 2ZUSA 1KR1A 2QGYA 3NZQA 4H8VA 4PC8A 4TIMA 4CNSA 3OVPA 4X60A 2GDQA 1XH2A 1PYFA 3V3WA 1UD8A 3F03K 2V5KA 3M7SA 2VEMA 3LZ5A 2QZRA 4AZCA 2WCAA 3WQWA 5IFTA 2DUAA 1RQBA 4H6KA 3VM7A 4MYXA 1VGAA 3G1HA 4BWLA 3ZJ7A 2G5WA 4KGLA 3N1AA 5FEPA 2HZGA 1AQMA 3HF3A 3M5YA 3IIXA 2V3FA 3K4WA 4NNAA 2IKHA 1NFBA 4H8HA 1GWJA 1YBQA 3QPEA 3ECQA 4ZENA 2ACUA 3KRSA 3RIKA 1QMLA 3WH8A 1JCLA 3GB6A 1F5ZA 3WLMA 1QRQA 1XIDA 1G94A 2JK2A 3SR7A 1VIZA 4ZOCA 3IIVA 1W54A 2YR1A 7TAAA 2QCGA 2VZUA 1E0VA 5A6KA 3W7MA 1UD3A 5LNRA 2PDCA 1PKMA 1SYTA 1ZP4A 2ZE3A 4Y8FA 4GUGA 4MLRA 1LJYA 1W3HA 4LYKA 4AX7A 2XVKA 4JDBA 3VYLA 3K8MA 3FSUA 2WHJA 4NZCA 1R38A 2FZBA 1G7VA 3UJEA 1ME7A 3GYCA 1VAHA 2Z27A 2XVGA 4KRZA 1XISA 4KFNA 3QPZA 4DBSA 1THFD 1UPMB 3ORWA 2BOGX 4JTCA 4C6CA 5BOFA 3S6OA 4DUXA 3P82A 4F9JA 4KRTA 3OLDA 2MNRA 1CLKA 2QDEA 1DPMA 1EOMA 3UT0A 1GCYA 4UB9A 5C55A 3VK5A 4FK9A 4YCOA 2ZXQA 1S1PA 2NX9A 4FNSA 1W9XA 3AJXA 1YX1A 1WKEA 4V2XA 4S3FA 4GIYA 3QV7A 4B5WA 4K7YA 2YPIA 5BXRA 2IPJA 1E0XA 2RGLA 4AEEA 5CAHA 4JQ4A 1KB3A 2J7EA 4GKLA 3W1AA 4U4MA 2XFRA 4MUPA 1UIOA 3BOFA 1RCOB 4MNMA 1G9HA 2FTYA 4JS3A 1MUCA 1WB0A 2WNWA 4C60A 3EWWA 3T78A 4XBJA 4PUKA 4GCXA 4W5ZA 1EPVA 3BVJA 4UCFA 1KCKA 3I7QA 3B3DA 1E6NA 3DHPA 3WMBA 3QFEA 1DWAM 3AUOA 4H7CA 4UQBA 3CHCA 2JF7A 3N9SA 2DT3A 2ZTKA 2YIHA 3IVUA 1E6RA 2ABAA 3K13A 5CGMA 2FZ9A 4PUJA 3KL0A 1XIFA 4CNNA 3ZMRA 3MW7A 4DWSC 2YBVA 1LP6A 1QWKA 5EFFA 3LXCA 4FX6M 3BAWA 1UW9A 2WVUA 1MW2A 4LYPA 2ICSA 1P0BA 4ACYA 5HANA 2PWFA 5H8MA 5TIMA 5HNTA 1DIOA 1TMHA 6TAAA 4QSFA 4EWJA 3UPMA 1V4YA 3T0AA 3NZGA 1KXHA 4KBXA 3CHDA 2ALRA 4C1KA 1F2JA 4MPKA 2CEQA 3NA8A 3NSMA 4JHMA 1VHCA 3EA1A 3SCPA 4I6VA 4M1BA 1PCWA 1JYWA 1QT1A 4IF2A 1EHNA 5DCBA 3IPWA 1CI1A 2VGBA 2E6AA 3HU7A 2GDUA 1EJTC 5G4WA 4QR6A 4PN2A 4DVOA 2YGYA 1QNQA 3GNPA 3ARXA 4AHQA 2O92A 4HNNA 3TLLA 3PK7A 5GVJA 3VD3A 2HS8A 2W0UA 2RJGA 3IAPA 1IZJA 1X39A 2QUUA 3EA3A 1I0DA 4QLKA 3CV7A 2FYMA 3UPBA 1GEHA 2QJMA 3H2CA 2XISA 1ZJIA 4UUIA 3JS3A 1EIBA 1QJWA 1XYMA 3NIYA 4NP7A 2V2DA 3GLCA 1O5RA 1YNQA 1HTIA 3QR3A 4PCSA 1SM9A 5DF0A 3UXLA 5EA9A 3W88A 1GUVA 4I90A 4Z2KA 3ZWTA 2DZBA 2C3ZA 1X7FA 4GIAA 4R33A 1AUSL 1S5TA 2A79A 1OF6A 1CZ1A 3K8KA 1E70M 2GOUA 3H21A 2D0FA 4NZFA 5M5DA 1CCWB 2QEZA 5C7HA 4KIRA 2ZUUA 1XX1A 1VEOA 3T81A 2PWUA 3DFOA 3EKLA 2V6AA 3TYDA 1HKVA 2VL4A 2OFJA 1EX1A 1FDYA 2ATSA 4Q8MA 4YN5A 1H63A 3WDIA 3WJSA 5BMXA 1VBHA 4E6MA 3EXSA 4R53A 3L0KA 4ATWA 4HJFA 4OECA 2VX7A 3SAZA 2GYIA 4US6A 3FLUA 3V0TA 2P76A 3VZXA 1QI4A 2QUMA 3GU9A 3CLWA 3GC2A 3P93A 4C5ZA 2Y5JA 1TJPA 4DM2A 4E2DA 5BNKA 3GHRA 3HFTA 4AXNA 3NZ1A 1EXPA 2PWGA 3WH6A 4Z2JA 5C9WA 1A5KC 4AZ7A 4U28A 4AFYA 3ARRA 1A5NC 1BVZA 2TAAA 1W5OA 1AQ0A 2V5JA 4HHHA 5FSDC 1PIGA 4R88A 3QV8A 3IGXA 4UQCA 4OV9A 3FA3A 4UBPC 3ITVA 4C6IA 1EJWC 1R86A 5FCZA 4XAGA 5MHBA 3CO8A 4DYKA 2QDDA 3BO9A 3HMCA 3M9YA 3ABRA 1JPIA 2UWFA 4AZ5A 1Q6QA 1RP9A 2QT3A 2Y70A 2PTDA 1MI3A 4F40A 4UCGA 2DZUA 3DAQA 2FLIA 5LZLA 3W2LA 3TNBA 4XISA 4NX5A 3P61A 1M53A 1ZHAA 4B92A 4HA0A 3UG8A 4MLJA 5CG0A 3WD0A 2NX1A 3R43A 1T40A 4O14A 1VB9A 5GJNA 4H6QA 2EKGA 1S2AA 3KWSA 1J6OA 4BS0A 3WBXA 1ICSA 4TQTA 3QSTA 3P5YA 3OGVA 1GG1A 4WXYA 2Y1HA 2ISDA 2QCLA 5KSWA 1JJKA 3VCNA 2TMDA 4EX4A 2YYUA 1TPWA 2DORA 3O06A 2XH7A 3WF2A 3ZLHA 2XIQA 3B9EA 3TX9A 2IPFA 1KO0A 3S9IA 5GPRA 3VE9A 4G56A 3PZVA 2D0HA 3FEQA 4GHRA 3ES8A 1PZ3A 1Y5XA 4O1EA 2I5IA 1OJXA 4JX6A 4HCLA 1ZTVA 1GVIA 3CTLA 4MUZA 3GY1A 4QCFA 2JFEX 5D2VA 2AQOA 4WDTA 3WBAA 3XIMA 4MB1A 3UNDA 3ZJ6A 1Q6OA 3HG3A 4D6HA 3TXZA 3MI2A 1IEVA 4YWIA 1PX4A 1EGZA 4X9SA 4IGSA 4NJKA 1U22A 3W6MA 5E6ZA 2XVNA 4IG2A 5EGRA 3L23A 1Q6CA 5HNNA 4PH6A 1FFQA 1AZ1A 1DWIM 2A85A 4Q8TA 4IQEA 3M0JA 4PUDA 2HNEA 3RO6A 4DJEA 4JR5A 4NZ5A 2OZTA 3BQ5A 4ALDA 4IIFA 3M41A 3LN3A 4DX3A 1E0UA 5EB8A 4WDXA 4H8NA 2OTDA 1NWRA 1Q6EA 3SQMA 5AHLA 4DO7A 3WMCA 4FAMA 4LANA 3RILA 4IHCA 1FP8A 3UZ5A 2F7FA 3PZIA 2PTYA 4WQ6A 1AD1A 2GGGA 3TIMA 3KBMA 4QG8A 4JL1A 3TC6A 3O6AA 2W4XA 1GPFA 3QW3A 3P67A 4A3RA 4E4FA 3QGVA 4KW2A 3QY8A 4W7UA 5IHSA 1V7YA 4LAZA 4CNPA 2ZXDA 3LM3A 2QCMA 2E68A 2E4TA 2VZVA 2TSYA 4DF1A 2GSJA 3W29A 2P50A 2OQLA 3VO0A 5T26A 2OEKA 2Z2AA 5LSMA 1AJ0A 2QAPA 3I68A 1W3IA 1I8JA 3CZGA 4A29A 1FH9A 1FWIC 1FWEC 3H23A 5B7ZA 1PL9A 3O0KA 3PJXA 3FNDA 1BTMA 5CBJA 2ZX9A 5A8NA 3MUIA 4U2ZA 3WZ0E 2A3BA 3K2GA 3SCRA 5CPSA 2OMAA 1CXKA 4IMGA 3TMLA 2R6OA 1DWFM 1FH7A 3WSUA 2Z24A 1DIKA 2QVHA 4B5UA 1EOKA 3IJ8A 5EY5A 3L68A 4JY9A 3N2XA 4HB7A 5E09A 4JFTA 2Y7DA 2Y8KA 1F4AA 3PSVA 3MANA 3BGJA 1ICQA 4HK5A 3MP4A 5A6TC 2FMNA 3MUCA 3A4XA 1R0MA 3C2OA 4XVDA 4QISA 4QSHA 4DJDD 4AWEA 4A05A 1TMQA 3V5OA 3ITOA 4AEFA 2ZWYA 3A6OA 1H3GA 3W9ZA 3K30A 1ZRQA 3AHTA 4BJHA 2BXZA 4PMXA 1BYAA 3N18A 3VIKA 5AFDA 3MJMA 2CBVA 2QV4A 4ZQNA 1UJPA 4XK2A 3H7UA 1M65A 4EPDC 2WM1A 4H7VA 3PUEA 1YQ2A 3BSGA 3ARUA 4R7JA 3R0DA 1ZU8A 1HIZA 1WXJA 3E38A 4IL2A 4YL2A 1CXHA 2E0PA 3RGTA 3SY5A 2YJQA 3T2OA 1TJ1A 1R3SA 4HYRA 3AMCA 3WEOA 2P10A 3UGVA 4JTKA 1TRDA 3F5LA 3GTNA 2FJKA 1R3YA 2J79A 3LLXA 1DHPA 1UR3M 5H2ZA 1XCFA 2J8GA 2WNZA 4AEOA 3W70A 2HMCA 4J4KA 1CXLA 4L4LA 2JF6A 1FKXA 1LOLA 4MTVA 4NXSA 2PZNA 1OFRA 2WOQA 1GVYA 3BGAA 4Y9NA 3ABOA 3W73A 3PP7A 1P6WA 4QS6A 2X8RA 4GXPA 4D6DA 2PP1A 2YCJA 2BXYA 4Q4OA 2WJZA 2YA1A 2OPJA 4O1BA 2X2YA 3LTPA 1EYEA 1VFMA 5ECUA 4IGHA 1RBLA 5JXQA 4NI3A 1NOWA 4OZOA 3KCJA 4ZOEA 3SM0A 4E8GA 4B15A 3R94A 1XYFA 3V35A 2J7DA 4S3DA 4Z2GA 2XFFA 1TX2A 1UKOA 3THUA 3CIWA 4LQ1A 4NJJA 2QCNA 2CKRA 4NAEB 1TYGA 4B4HA 1BFNA 1SO4A 3ARPA 2ZRWA 1IWAA 1YTDA 3TAOA 1DBTA 4H3DA 1TPUA 5D32A 1E40A 1SO6A 4MJ4A 3LEPA 1G4EA 4S38A 5D9OA 3HG2A 3WUFA 5LIXX 3M43A 4GBDA 2IS7A 1BRLA 2YB4A 4GINA 5A2CA 3LI1A 3WJWA 4AH7A 1JYNA 1VIWA 4NILA 2J74A 3LPPA 1GVFA 4O4VA 4HD5A 1ZSXA 4D6GA 1REQB 2VD8A 3OQEA 3LA4A 2AKMA 1R3RA 1W37A 1YPFA 4GABA 1V0KA 1Z9AA 5EBAA 5DMNA 2HK0A 4L9ZA 2D2GA 3AYTA 4G2DA 4X2RA 4L1WA 1BKHA 2KX9A 3CLMA 4NX0A 1MEIA 2Z26A 4ERAA 4LF2A 2GGHA 2PDNA 3SFKA 3BG5A 3NFUA 1T99A 2B7QA 2XZ9A 1M41A 1OCQA 3SUVA 1CTNA 4R7WA 3IK2A 3NG3A 4M7TA 1HVQA 1ADOA 4Q4QA 3GDLA 3HPSA 4M6VA 3N73A 4NXKA 3W07A 2HISA 4XD6A 3NNTA 2VDIA 4V28A 3VDHA 2BS9A 4LRSA 2PDQA 5DFAA 4C7DA 3GFXA 5AOUA 1T96A 4IL0A 3B4YA 4O28A 3FX4A 4POCA 3BMWA 4L4MA 1A53A 3OG2A 3ES7A 1W3KA 2I7GA 4WJEA 1NFGA 1ZL1A 3NQAA 2ISVA 3Q2DA 1BEUA 4J9JA 2J4GA 1RXOB 5DCDA 1CB7B 4ZGYA 4DJED 3KOZA 2E7FA 2YYTA 1W1VA 1TPVA 4JXCA 4UFKA 1ZUAX 1D3CA 2B7OA 1W8GA 4MZYA 4ZMGA 5CH9A 3BZJA 2XUCA 1AH3A 2WMFA 2V38A 3H6OA 1JCTA 3OYZA 5CLWA 4OJYA 2QYGA 3DIPA 2H6RA 4C1LA 1O5KA 4ZCWA 3NYZA 4HKPA 3WNOA 2GQ9A 3TC3A 2FB3A 2XPKA 3MHFA 2W3ZA 3I3BA 1YDVA 3WNLA 2NVAA 3VFLA 1UR4A 3S83A 4GGBA 2ONEA 3MU7A 2J47A 3N29A 2Q09A 4D8LA 2VCBA 3OVRA 3F4WA 1JVNA 1R3TA 3NZPA 4O1AA 1I1XA 1WXZA 1OWQA 1WO2A 7REQA 3KOFA 1FKWA 4TR9A 3ABSA 4TMCA 2Q01A 3OG3A 4OKDA 3EX6A 2DSUA 2QPUA 4MYAA 3QHNA 1ELSA 4NKCA 2PWEA 4O1FA 1J0YA 4HA1A 1E1FA 5AECA 4JTDA 4AB4A 4L5ZA 3GW3A 1XD0A 2XN1A 2GSEA 3Q37A 2D24A 1RPXA 4EACA 2PDGA 3M46A 1AW1A 3T7VA 6XIMA 1VQTA 3RJXA 2CLFA 2J25A 3M5XA 2OGYA 3OB8A 2C16A 1L6GA 1FHDA 1TR9A 3PHAA 4GH1A 3LS9A 3BZGA 4HBKA 3OLGA 3WFAA 2VEIA 4D1JA 1EP2A 2QMJA 1HP5A 4IMFA 4QS5A 1F4HA 4CKQA 1NWSA 3WUBA 1RP8A 2GGEA 4WJ8A 3CMFA 4MOZA 2DFAA 5CKSA 4F0RA 3GTFA 2OXNA 3UERA 3S0CA 5I3HA 2BLEA 1RSCA 3B8VA 4F66A 1OCJA 3S5OA 1TPH1 2QHAA 2YXOA 3AXIA 1SW7A 5G1TA 3TONA 2NUWA 4HZ6A 3P80A 1ODUA 1W2PA 5TF0A 4H6RA 4WK9A 1TIMA 3BLFA 3EX4A 2WBGA 1VBRA 3FJLA 2H3BA 1MEWA 4PTWA 3D3AA 4QNEA 4PTMA 1N8WA 4XZ9A 2DP3A 3QBUA 3NQCA 4DJEC 3MUAA 4UNLA 1YHTA 3N25A 5BYWA 3NYDA 1U83A 1IWBA 4CU8A 3LENA 3SCUA 3CT7A 1WKYA 1QOQA 1E9IA 3NPXA 4B3KA 3LGEA 1UHVA 3PAJA 3O9NA 2PGRA 2CHOA 3EX1A 5CBIA 2DH3A 4GI9A 4DO6A 3F2CA 2OLSA 3R13A 2Q3OA 3F2BA 2ISFA 2AMGA 1V6YA 3Q67A 5BWFA 1JCJA 3KVJA 2E09A 3BW3A 4WJXA 3S9ZA 2E5BA 3R11A 4JAWA 2PF8A 1GONA 2BHUA 3G22A 4EOUA 3EDEA 3B03A 2WAGA 1YXDA 4HHMA 2ZXBA 4UOJA 3ANVA 4ONVA 4TTGA 3G6MA 2BOEX 1GJPA 1LG1A 3I7RA 3D46A 2Z2BA 3P6LA 1UR9A 2CLMA 1PPIA 5DY2A 1V6UA 4F9DA 1LTDA 1WDWA 4B5VA 6ALDA 4GIEA 1B3WA 3E6EA 1U1HA 1XF0A 1XBZA 3TWAA 1NDYA 1R2TA 2E1WA 3SUSA 5TNVA 4AZHA 1N8FA 4CQBA 1O5QA 1YXCA 1MNZA 3W7HA 2OYLA 1NEYA 2SFPA 4RDVA 5HJXA 5JH1A 1UD6A 2FJUB 3WLKX 4AD5A 4CEUC 4DAIA 3CL8A 1LQ0A 3U7VA 3WQ6A 3B40A 2PDUA 4NU7A 1GQLA 5JBFA 5FA5A 1OVDA 1MWOA 2EJAA 1A5BA 3RLHA 4H00A 2F8QA 5L6UA 3VGHA 3IJ7A 1OYCA 1IT7A 1KXQA 5CGTA 4OU1A 1R3QA 2VGFA 5FL1A 2VGGA 4C6MA 3TN6A 2WMHA 4B3LA 4Z17A 1E43A 2DW7A 3NQMA 1XLIA 3B8WA 1XPYA 3UA3A 1HZYA 5FJOA 1O12A 1NJJA 1CWYA 3QJAA 1ITUA 1RV8A 3L4VA 1IF2A 1YTKA 1J01A 1EWDA 1OFBA 3W7JA 1ADDA 1EF3A 3CUHA 3O6DA 3ZVIA 3S5ZA 4B9YA 5HJYA 2GVGA 1NY1A 5FEZA 4A2SA 4NRRA 3KBJA 4QXIA 2WMGA 3EWUA 2WW5A 1O68A 1XWYA 4IPIA 1RCXB 4ADUA 3XISA 4BI5A 1GGOA 3WQPA 4DF2A 5TQLA 3JUGA 5CSUA 3PBUA 4FIQA 2Z29A 3GXMA 4OBSA 1UWUA 3M0KA 2BY3A 4CD8A 6XIAA 2WVVA 3MP3A 1E0WA 4J5NA 3ZS4A 2Z1SA 4BR1A 1LT7A 1N55A 1KTCA 1WOAA 1IR1A 1OIFA 4PFHA 1ISZA 1Z48A 2DSKA 3GXIA 1HKJA 3MA8A 3JRKA 1GG0A 3M5ZA 5BCAA 2CERA 3CQJA 3BMVA 4MY9A 3VKKA 2VC6A 4DF0A 1EL3A 3QZ6A 5K9XA 3QC0A 1W5PA 1H0IA 4FLQA 1VFLA 1CIUA 2E77A 1O60A 1Z44A 4ML9A 2A7NA 3TU9A 5AYIA 3N6HA 3ZSSA 2YW3A 1D3GA 3NQVA 4QG9A 1RQHA 2IQ0A 2QJGA 3NO3A 2C1GA 3GWQA 5DXXA 4LW7A 4QBXA 1QHOA 5D2XA 1VBJA 3NDOA 2DJXA 3CPGA 3NVDA 3UZWA 3ZOAA 1ZBVA 5KETA 1A5LC 4BQ5A 2V3EA 4S3JA 3GXNA 1L6WA 4W87A 3ANYA 2J6XA 4FLRA 5KTLA 3DYOA 5CSYA 3AXXA 4R3UA 4GC4A 1KRCC 4RNHA 3QYSA 3JVAA 1PKLA 1AW2A 3G1XA 4V27A 1BWKA 4FXRA 3H26A 1JCYA 2HE5A 1SR0A 2X1SA 3MPGA 2GUBA 4HNUA 3CB8A 4JIPA 1TZZA 2A3HA 4P7RA 4AC7C 3A4AA 4YTRA 2W63A 1XLLA 4PULA 3TR9A 2ZA2A 3DESA 1Z42A 1RJPA 2Q3RA 4BWLC 4N9BA 2NSXA 1SSGA 3MHGA 4JPGA 3AISA 3TQVA 3UWVA 1L6YA 2QGHA 3KE0A 6REQB 1E55A 4HTYA 9CGTA 2Y8VA 3ICJA 1W31A 2O9OA 1CW2A 1VCVA 1P5BA 3E0IA 4F8XA 4R7OA 3T40A 1XUZA 5I00A 3ITLA 1A5AA 1OFOA 4EIVA 1UOZA 1A47A 1S38A 3W1PA 1UR1A 3CL7A 1J79A 3M0LA 3LCGA 4RE0A 1SJAA 1FWAC 4INFA 3DCPA 3CV6A 3WDPP 1PEZA 3VKDA 2GWGA 1Q6DA 3PWAA 1VFTA 3IGUA 4ICCX 3VILA 3UXDA 3M0VA 5BZAA 1VFFA 3WH7A 2FH8A 5HMFA 4LCRA 1SO3A 2P5NA 3CQIA 3L4XA 4D8ZA 4IG2B 2Y6ZA 4RX0A 5DRIA 5IDZA 1K1DA 1I6NA 4GE8A 3IUIA 4WVXA 4EXBA 1YIXA 1QI3A 3QLLA 5I07A 4ECLA 3QZEA 3FA5A 1H5VA 3E3HA 5DCEA 2B4GA 5DMYA 3UVAA 4Q8QA 3NEHA 4CQCA 4Q8NA 1TQJA 3POCA 1EQCA 3EGJA 4DUOA 1AJ2A 2X0YA 1W17A 4MDPA 2ZRYA 3DKLA 4IP4A 4PL1A 3ZT5A 4LYQA 2ZX5A 3A47A 3CAQA 2ZUWA 3S5NA 3ZQ9A 3DN5A 3NOYA 1XIEA 3WNKA 4GNKB 3DXIA 1AMYA 3THQA 4LAUA 3NQFA 1XBVA 4H6EA 3LXAA 2CYGA 3TKFA 4LALA 1BG9A 4NRSA 3W72A 4PL2A 3S42A 3MKVA 1IXPA 1SPQA 4IX0A 2CWXA 3CUJA 1PVNA 4PUEA 1Q5MA 2OWXA 3W7NA 1AW5A 2O9TA 2DQWA 4XAYA 4US5D 1DTUA 3GZAA 5BXPA 5KINA 3W37A 4R9XA 4HSHA 5CZSA 3LUTA 1FWSA 2XSBA 1W8SA 1PX3A 1PO9A 4O18A 1RVKA 2GVLA 5AHNA 3AOFA 1R7OA 3O15A 1EX5A 3QTGA 3U3HA 3G3DA 3W0KA 4DBWA 9XIMA 3UR2A 2DZSA 2JGYA 3AHVA 3UWUA 2PC8A 1DE5A 3GR4A 1NH6A 2NVDA 3R89A 1NQKA 1FFRA 3PB2A 2I9EA 1T6MA 1H0GA 3LY0A 3DG7A 4I7VA 2O55A 1JPMA 3WENA 2ZRZA 4UTUA 4IIHA 1TV8A 3EPNA 1MMFA 2A0NA 1G0CA 1ITCA 3EMQA 3CH9A 2J13A 4RL3A 3G1YA 3TC7A 4GBUA 8CGTA 5K4ZA 2J8FA 2Z2UA 3IJ9A 5XIAA 3N11A 3U8GA 3W7PA 1FOBA 3B4UA 4I5UA 1TA3A 4EK7A 2CHNA 3WQOA 1F07A 1EPXA 1SFJA 3H7VA 1ISVA 2VR5A 3AQUA 1XLDA 1JEZA 1NF0A 3GAKA 1OEPA 1MW1A 4M6QA 2YL6A 5XINA 4AF0B 3LBMA 4NUWA 4K6AA 5CJNA 4H83A 4FP1A 1CBGA 3PBWA 3W1TA 4BF9A 4WSJA 3GDBA 3AHZA 1VBGA 1MW0A 4JTHA 1VPQA 1UBSA 3FGCA 2Q02A 3G1SA 1E1CB 2X0SA 3NL6A 2IPGA 2A7RA 1JFXA 1XP3A 1RA5A 2NV1A 2NVCA 1XD1A 1U5JA 2V2HA 4PMUA 1V3LA 1NFPA 1K02A 1NDZA 3EX2A 4Z0JA 3V0SA 1K8YA 2CU0A 1JR1A 3HA1A 2QJNA 3M0XA 3BSMA 1H1ZA 3GC5A 3F1QA 3MZ2A 1GVRA 2VUYA 3MBFA 1GKRA 1JGIA 4E3VA 2JKEA 2YA2A 2VEKA 3ALFA 5EMLA 4FR6A 1E51A 1E72M 1KRBC 2C15A 3MJYA 1R7AA 2CPUA 4AMCA 1TMLA 4PUMA 4KERA 4FXJA 3UY8A 2P0OA 4LY8A 4GYKA 3ZLGA 4QGCA 3UCQA 1U5HA 2V2CA 4PMZA 3PZGA 3ITXA 1OT1A 3IAQA 3O3RA 1J4EA 2AL2B 1SZEA 5E6YA 2WSQA 2Y24A 4YVPA 4PTDA 4CN1A 4ADSA 1I60A 4J1OA 3TTYA 4LWWA 1FWHC 4N9DA 1PE1A 3ZVHA 1KFBA 2HEJA 3O6CA 1VHNA 2PBOA 1N7KA 5K9DA 1HNYA 4JKMA 5FF0A 1F9CA 5C7VA 5LA1A 3G1DA 1HJXA 5A6BD 2GJRA 3WF1A 3WQFA 4GZEA 1UKSA 3WK1A 5DO8A 3EB2A 1VLIA 1P7TB 5AVHA 4GUHA 1C8VA 2H9AA 5GJMA 4QE4A 3GHUA 1H7XA 1VYRA 1CDGA 4IQLA 3FIGA 3TVAA 1VD6A 3T55A 5L9FA 4H9YA 2WNNA 3FYOA 3EWCA 5EMUA 2INEA 2ZUMA 4FIRA 3LQLA 3RCMA 8A3HA 1VF8A 1LG2A 2X0HA 2C1HA 4DB7A 3UJ2A 2O0TA 4Q7IA 5LGXA 2ZDRA 2X16A 4PB4A 5C9RA 4M81A 3SJNA 2ZZ6A 3GH4A 2A4AA 4BA0A 1S2VA 4F2TA 1S5NA 3SRDA 2YX0A 3MKCA 2P3EA 3CZLA 1L0PA 3BK0A 4YPJA 4XKYA 4AHPA 4GUFA 3GG7A 1HKKA 1PV8A 2B81A 1A4LA 1UD4A 4MWAB 2WPGA 1BYDA 2E1DA 1J12A 3WN6A 3DC8A 1DJHA 3KRBA 8RUCA 5JBDA 1Q6FA 2EPHA 3KVMA 3PTMA 4A3QA 1F8MA 3TN5A 3LXBA 1FHUA 2CNCA 3W7CA 1QW8A 1WDRA 4QHRA 4PTVA 1KM2A 1XKYA 1DJQA 3W1RA 3C0QA 3HM7A 4E0CA 1KV5A 3IRDA 3N12A 1AA1B 2ZC8A 3WUGA 2QV5A 5M3WA 1YADA 2BGSA 4MJMA 3WO8A 5JU6A 4C6EA 2OYKA 1G01A 2OLAA 2DT1A 3CPRA 5J8LA 4XD4A 2WZMA 7ODCA 5B80A 3LCWA 3NQDA 2OEMA 4N4PA 4TV5A 4Q6XA 2J9ZA 1Q45A 3RG6A 3KEHA 4DIAA 2BFGA 3QR0A 4MF4A 3FXYA 2ISWA 1F7BA 3HB9A 3L0NA 4ICMA 3CZKA 4Y8EA 4NJHA 5GQBA 3JU2A 1UD2A 3SCWA 2GLKA 2DPEA 2IKIA 3QEZA 2CC0A 3VABA 3WNPA 2J75A 3PZMA 4F3HA 3TXVA 3EWBX 1JCXA 2PZ0A 2QJJA 2F6UA 5CJMA 5I78A 2PODA 3H70A 4JKKA 1Y7VA 1GEQA 4KCWA 4IP7A 4LUTA 5AC6A 1F6PA 1GTHA 3GNNA 1WAWA 3ABZA 1F8IA 3RPDA 2HVNA 4JZ5A 2ANUA 1D3HA 1VFSA 4C5YA 3T8LA 1QBAA 2X1IA 5F1UA 4A8NA 4A3YA 2ZZ5A 2YCIX 4ZO7A 3OZYA 3QPYA 4PCFA 1VFUA 1QI2A 5I5RA 3M0HA 5LIUX 3POHA 3BPWA 3A13A 1TPC1 3UESA 3S2LA 4WD0A 1RA0A 3T42A 4Q3MA 2DVTA 1I45A 1GPWA 2FHFA 3BAKA 1W9PA 4HNOA 4HMEA 3CQHA 4EANA 2OOGA 3SY8A 3S2MA 5I24A 1FRBA 4KQNA 3PBGA 2VTFA 3PUDA 2B31A 3VNIA 1MZHA 5CZJA 5GNZA 4LCQA 4ZSUA 3T1GA 7A3HA 1EZ2A 2VM8A 1WP6A 1VPYA 1NVMA 4N6FA 1KA9F 1W3JA 2ZBTA 4BZYA 1W3LA 3EDKA 1EA9C 1CGTA 2IXVA 4ACZA 4XZLX 4MHBA 5A8GA 3M16A 5LYRA 2X40A 4M7SA 3HURA 1EZWA 1LORA 1XHGA 3E5PA 1C8YA 3WD3A 2OYMA 3VX0A 2PE4A 1HQTA 1UP2A 1E4NA 1M7OA 3GSMA 1PHWA 2Y63A 1T7LA 5CPQA 4GI4A 1OB0A 4UTMA 4UR7A 2J9YA 3W24A 5LKYA 2OR2A 3A64A 2YLLA 2DZTA 4JD4A 1WBJA 3SEPA 5FEXA 2CWNA 2PDYA 3M6DA 4P7LA 5D2WA 2ACSA 4UR8A 4E2BA 1UBPC 2NXHA 4OWGA 2YA0A 2CLIA 2PPGA 4I3GA 4FALA 4DZ5A 4K1GA 4DEFA 1F61A 3UG5A 4BQ3A 2TODA 5C2CA 1C8XA 2OWCA 2YDSA 3SIZA 4MAZA 3W02A 1XC6A 2W5FA 1OFAA 4MNLA 4QQUA 2EG8A 3WELA 3QSRA 1DP0A 2HROA 3AIWA 1QOXA 1HO4A 4RKAA 1RLDA 2PDKA 3GVGA 3S47A 3PPHA 4H8UA 1ITQA 2YSWA 4PE8A 1FWNA 4RE4A 1ZLPA 1F3TA 4H4IA 5IHRA 1I2PA 2ZZ1A 4WHBA 4Z2IA 4DJFA 1A80A 2DIJA 3VD4A 4LVDA 3WK3A 3UR7A 3FAWA 3TOYA 2ZZ3A 4QTGA 3P62A 5CZKA 2W27A 1ECEA 1TV7A 2W61A 3W2JA 3NJ3A 1XR2A 4JGDA 4ZQOA 2DY3A 3WBWA 3GTIA 2FPVA 3FJ6A 1V0MA 3GXFA 1CGVA 1Y65A 3PBVA 3R10A 5M17A 4Q7BA 3GUWA 4BF7A 2ZYFA 2RKXA 3BDKA 3EDDA 5D30A 2RGMA 1FTXA 2PDXA 2CITA 4HHPA 3B05A 3W74A 4DQWA 1G4PA 1OCBA 1JFHA 5HR7A 4FB7A 3G3MA 2PURA 3C0JA 4HPNA 1ONRA 4LVAA 3T08A 2WZIA 2GK1A 4G1KA 5D9NA 4GJJA 4O12A 4IUGA 1QNOA 2Q6ZA 1UWTA 1NSJA 4UZSA 5I09A 4UQ9A 1GOWA 3SGZA 2OSXA 4LPCA 4Z1CA 1KBLA 3AYRA 4D72A 3QOMA 3SN0A 3QF0A 4UQAA 1DTNA 4C6OA 3V5FA 3NGJA 1IYXA 2W62A 3DYMA 3K5XA 3MUXA 2QF8A 4J3VA 5T91A 4UIOA 1E0TA 1NF7A 1Q8JA 2OQHA 4CQ8A 3G8EA 3C5QA 1V3KA 4P61A 3CAKA 3SB0A 2F6XA 4W8LA 5ENLA 1QPRA 1FH8A 3AIBA 3ZSTA 1W6TA 2VCCA 2ZIDA 3QMRA 4H04A 2RFGA 1ONWA 3D5HA 3NXFA 1VYPX 3LG3A 2F61A 4KH2A 1NDVA 4GQ0A 4ENLA 1ME9A 3CMGA 1BSIA 4M19A 5FF4A 2FKPA 1F73A 3TFCA 4KEUA 4ZQRA 1SUXA 4AYGA 2B7NA 4I6KA 4I8DA 1Q66A 1A0CA 2R94A 4RXFA 4IFKB 1ISWA 3TROA 2BWGA 2YFNA 3CAVA 3QYQA 4FNRA 4O0KA 3W85A 1J2WA 3F2DA 3FOKA 4DJDC 2YFOA 4ZA0A 3CIXA 3WLLA 4Q4RA 3SW6A 2I9UA 2ASHA 2VHLA 3CEUA 3E2VA 5A6LA 5ECVA 1X6NA 3ZR5A 1IXQA 4FNQA 1GVEA 2HXUA 3LSCA 1YE6A 1HT6A 4WXZA 1TPB1 1UP3A 1JGMA 3ARWA 3U7BA 3W1NA 4M6PA 4Y96A 5SWUA 1EFZA 3AMKA 3VNJA 3S9YA 4FOKA 3LRMA 2VXNA 1OD8A 3ITYA 5K2ZA 3HV8A 4LTSA 3WKZA 2PDLA 3CU2A 2QQ6A 4QLLA 1LWHA 4ZFCA 1GYLA 2R14A 4NYUA 1TZ7A 2XG9A 3EA2A 3S2JA 4GQBA 1JG9A 4E2VA 3R25A 3GVVA 3ATYA 5I3GA 2VVNA 4JTIA 3PPCA 3CUGA 3VZYA 1VC4A 2X05A 5C6MA 4LS2A 3I10A 1A0EA 3DI0A 2VZOA 2ALDA 1PJ9A 3FJNA 2R1MA 1VEPA 3NPUA 1JNEA 1U5VA 5IM51 5D8WA 1B30A 3GHTA 3EMCA 1HW6A 3ONCA 4GYPC 1BF2A 3RCNA 4KEZA 2QCHA 3HMJG 1KCZA 5EMYA 4TO8A 1S46A 5CAKA 1J93A 3P84A 4ZB0A 4OQVA 3A12A 1C93A 5AC4A 3HQPA 3O07A 3C2VA 3NL2A 3PBMA 1FWCC 5A8PA 3DG6A 3AXKA 1IXNA 2PD9A 3PZTA 3QRHA 3N14A 4HNTA 4WY0F 1WZKA 1XM3A 3CHVA 4GQGA 5FESA 3G77A 2VUNA 4LRTA 3THCA 3MI3A 4EAYA 3SRHA 1SFSA 4H1ZA 3GFYA 3TW6A 1XLJA 3R5EA 3PULA 3IVSA 4MWAE 4CCEA 2QIIA 2DVUA 3W2UA 3W7QA 2PCQA 4IXXA 1M7PA 3E0FA 2WHLA 1KM5A 4FNUA 1M3UA 3SCNA 1TWDA 3R8RA 4FF5A 4O50A 5MF5A 1TQXA 1YTEA