1SO4A

Crystal structure of k64a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
213
structure length
213
Chain Sequence
LPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAAIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-keto-L-gulonate 6-phosphate decarboxylase
publication title Evolution of Enzymatic Activities in the Orotidine 5'-Monophosphate Decarboxylase Suprafamily: Crystallographic Evidence for a Proton Relay System in the Active Site of 3-Keto-l-gulonate 6-Phosphate Decarboxylase(,)
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2004-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1so4A00
3GB6A 5IBXC 4TU1A 2JKPA 1V7YA 3C2FA 3LI0A 1KM4A 2QAPA 2PRMA 4TR9A 2NXHA 2V8ZA 1SW3A 2I9EA 4ORIA 1KM2A 4A22A 3S5YA 3OVPA 2BSLA 1W3NA 4MZYA 3QJAA 1K8YA 4ZQOA 3NQCA 3B0UX 1Q6RA 2FDSA 2J88A 5KINA 4FF7A 1ZALA 4QISA 1O94A 4NT0A 5F2LA 3TV8A 3BW2A 1QNVA 2I14A 3MI6A 3O16A 2ZRUA 1EP3A 1RPXA 3NQ6A 3PBVA 3FKRA 1QPQA 1GTHA 1Z42A 5HUOA 4UTLA 4MJMA 3HPSA 2ZRZA 3GKFA 4IX0A 1W56A 3BG5A 3LHUA 3A21A 5G4WA 3FEMA 3TH6A 3W75A 5FESA 2TYSA 2C13A 3N2MA 2NV1A 1VH7A 1RD5A 3IGXA 1JCMP 3S42A 1M5WA 2EHHA 4O52A 3G0XA 2NXIA 1AW1A 3KVKA 3W7CA 2C6QA 2QF7A 4AF0B 3CM4A 4ZQCA 1EA0A 4IPJA 1YXYA 2DJLA 1R47A 2Y85A 3R13A 1KFBA 1H7OA 4JTTA 5CSSA 3G1SA 4CQ8A 2Q8LA 3NAVA 3W7MA 1ME8A 2R8WA 2Y61A 1BTMA 3L68A 3KRSA 3F1QA 3UWYA 3B05A 1DHPA 2Y63A 4GE8A 3O8AA 3NR0A 4AMAA 1VCFA 1OFBA 4JTSA 4RLIA 1OJXA 1FCVA 1XBXA 3VE9A 1NFBA 3TUUA 1GT8A 2QAFA 5AOUA 4FHAA 1G4SA 1TPH1 3C2RA 2WNNA 2X2GA 3A5VA 1CI1A 1DQXA 5DXYA 1XUZA 4FO4A 5HNRA 3G18A 1PVNA 1WQ5A 3P7YA 2V9DA 3OA3A 4LNYA 4OV4A 3W1AA 3EXRA 4WQ6A 5BOOA 4XQ6A 3SJ3A 4LT9A 5D33A 2E5BA 5D2XA 1P1XA 2ZZ6A 1Q6QA 1O5KA 3PR2A 3W7HA 2YDAA 1QO2A 3E0IA 3ELFA 1SU5A 1TSIA 2A2IA 2GUUA 5D2VA 2ZA3A 4WZHA 3W9ZA 1JUBA 1KM0A 2QEZA 4Z0JA 5LNVA 4FB7A 3W2NA 3LOTA 4RKAA 3ABSA 3FS2A 4LW7A 5AC8A 5D09A 1YTEA 1LLWA 2B7NA 2QCHA 3SSJA 2DZTA 4CCEA 1PIIA 3C8FA 4DF1A 2EAWA 5GVJA 5I3KA 1DVJA 3W74A 4IWWA 1QPRA 2W6RA 4JYDA 4JEQA 1GEQA 2FB2A 1DKWA 3NVTA 4AHOA 4NUWA 4O18A 5CPLA 5ABTA 3MYPA 5F4XA 2Z2UA 4TX9A 4NXSA 2OT1A 1GPWA 3IGUA 3NL3A 3IRDA 4YWIA 4BF9A 1RZMA 3U6WA 3STFA 1M7OA 3MP5A 3KFTA 4ZVJA 3WJYA 4PC8A 3GR7A 3C0JA 1FWSA 2WOQA 4DBEA 1IIGA 4NNAA 5D32A 3HG4A 3DFNA 4M7TA 3QZEA 3DGRA 4CNPA 1WDWA 3SW6A 2DZPA 4NJGA 3S6DA 2ALDA 5FEPA 3W72A 1H7NA 3W7EA 2H90A 4CLMA 4JXCA 2BXVA 3OIXA 4NJHA 5I3JA 5BW6A 1OX4A 5MHBA 1MEHA 4UFJA 2FPTA 5EY5A 3W3OA 1X8FA 1EPXA 3U8GA 4NU7A 2A0NA 5L9FA 3E9AA 2CLKA 4LVBA 2E1DA 4K37A 1VYSX 3LHYA 3GNNA 1O4UA 3ZS4A 1W5OA 1H7PA 4MY9A 3WK3A 2B4GA 2X1SA 3WFAA 5D2WA 3EX6A 1TMHA 5CPMA 1ALDA 3TIMA 4ZQMA 1K03A 4LUIA 3UPBA 3W7QA 5LHFA 1QPOA 1XBZA 4BWLC 1H62A 3TXVA 4BK9A 3DZ1A 5LZLA 1TPUA 1ZAHA 2NWRA 4EVZA 4P2VA 2RFGA 4WX2A 4E2DA 4R33A 1HTIA 3DI0A 4UTJA 1LCOA 3L21A 4NNBA 5KZMA 4O53A 1GVFA 5SWUA 2B7OA 5AHMA 5CZJA 3W73A 2WV8A 2Y89A 5D2YA 3OHIA 4JTUA 5AHEA 4ZQRA 3A22A 2ZTJA 3NEVA 3EXTA 2OT0A 1A5AA 2W0UA 3BARA 3DAQA 5BMWA 4K39A 2C0AA 3BV4A 2Y62A 4HNUA 3NA8A 3TAKA 3RMJA 2X1TA 2OJPA 4JDYA 4JTLA 4O14A 5D02A 3PG8A 3PG9A 3W76A 1VHCA 3BG3A 1TPFA 3G22A 1JRCA 3NXFA 3HGSA 2VFDA 1KFLA 4JN6A 2GQ9A 1JCYA 2Z6IA 4K7VA 3TNOA 1XCFA 4MUZA 3MBFA 3G1FA 2ATMA 2CU0A 1KBJA 2D73A 4FEZA 4O8RA 5EKYA 1GQNA 3HQ1A 4KWVA 1ZENA 5K7JA 3LCXA 4X3ZA 2HTMA 2NX3A 1T8XA 3LBMA 2P1FA 3QM3A 1Q6OA 1XBYA 4CNNA 1O5XA 1FY6A 4E0CA 1XDMA 1FBAA 3KXQA 4IX2A 1TPDA 4O0KA 3TA6A 1H50A 1L9WA 1RV8A 4L4LA 5CKSA 5KZEA 1TRDA 4GUFA 4DO4A 3LV6A 1UB3A 1C8VA 4Z1BA 1CW2A 1CX9A 5T26A 4MLJA 3CLMA 5I3IA 4YXGA 1QPNA 5LKYA 2Y6ZA 4JDBA 2QCEA 4GUJA 2PRHA 1JULA 2RH9A 1YTKA 4S2CA 3TQVA 1U5JA 4WD0A 1OHLA 4PEKA 1I2PA 1I2RA 1TPEA 3H55A 3O15A 1ME9A 3W7LA 3KAOA 3BPWA 3FFSA 4O4WA 1D3HA 3WJWA 1W8SA 1DBTA 3NPUA 4UR8A 5HQEA 1Q45A 2NUYA 3FYPA 3NQ7A 1M6JA 2KZHA 3SGZA 3CWOX 1AL8A 2EPHA 4NZJA 2VFEA 4UCGA 3NDOA 1PCWA 1LORA 3HGJA 1DOSA 1PS9A 3EX4A 4JTEA 3QMSA 3B03A 4NX5A 3LGEA 3M41A 5FEWA 3UWUA 1X7FA 5AN7A 5DY3A 5HMSA 5I3HA 5F2GA 3JS3A 1ZNNA 3MHGA 4MZ8A 1S5TA 3TK7A 4JNMA 5EPDA 2CZDA 4I7WA 2C16A 2FB3A 2WQPA 3LHVA 5A8GA 4IMFA 5CPOA 2E68A 1P0NA 3BLFA 3FLUA 1FWNA 4Z0SA 4L4MA 1VLWA 3SFKA 3NQFA 2DZUA 1VRDA 3TAOA 1TV5A 3PULA 3LRLA 4O50A 2P10A 1EWDA 3CIWA 3RFAA 1H7XA 3N9RA 2YYTA 4UTUA 4O0ZA 5HR7A 1IGSA 1N55A 3NYZA 1OG0A 1MXSA 4HIBA 1R46A 4ORMA 4QJ1A 5HR6A 1SZNA 3QQ0A 1W31A 3W86A 4AF0A 1OFDA 4LVGA 4WY0B 3LERA 4JD4A 5F1VA 5AHLA 5LGXA 1Y0EA 4AEOA 2TPSA 1EP1A 1GYNA 3ATYA 3BO9A 4BWLA 1WOAA 5H91A 3WJZA 2FTPA 4FX7A 4UTHA 5D03A 3B8DA 1AG1O 1NF0A 4DO6A 1DJNA 1XL9A 2X16A 3NO5A 4PA8A 2NX9A 2QDGA 5CZSA 3P61A 4DPQA 1G6CA 1U83A 4CCCA 2ZRXA 4JIQA 4LVDA 3T4CA 3PSVA 3QQ1A 4ZL1A 2VELA 1IXQA 3RF9A 3L9CA 3KOFA 3LCWA 1PHQA 1X1ZA 1MO0A 5DN1A 1F2JA 2Z6JA 3T7VA 4J9JA 1TTIA 2ZDRA 3W1QA 4MKNA 3INPA 1F7BA 1L2UA 1I8JA 5D05A 3UY8A 1TRIA 4N6FA 1F05A 2GVJA 5C54A 2DJXA 2A85A 1ZJIA 1FCQA 3Q37A 4KFNA 4MIMA 1EUAA 1W5QA 2V81A 3W1NA 4O19A 4A3UA 3QF0A 4DEFA 1H7WA 4K8EA 1KFCA 4CQAA 1NSJA 4XTIA 3GDLA 3IVUA 3TSBA 2ZZ1A 1JCXA 1JCNA 3TROA 4UFMA 3W71A 2QCDB 3K30A 3I7RA 1KTBA 4Y8FA 5G1TA 3BG9A 1K3UA 4EOUA 3A5FA 3TQ0A 1PHWA 3LBCA 3DFTA 3W70A 3O07A 4MVAA 4R34A 4HN4A 1SSDA 2ZZ5A 4RR4A 5BRBA 3QPZA 1PV8A 3TCEA 3N14A 1WX0A 2X1UA 3W6YA 3LRKA 4N02A 3G8RA 4AHQA 5IM51 1LBLA 4O28A 2DZXA 4DBDA 3W7OA 4ADUA 2RDWA 3T78A 3DI1A 3ABQA 4RZ6A 4GXMA 3UWVA 2C19A 4K7YA 4X22A 2VEMA 2GJLA 5TIMA 4K8HA 1O95A 3H54A 1KM6A 3PUEA 3PY2A 3EX2A 4H6KA 4LUJA 3SIZA 3RLVA 1UBSA 1W54A 4M5PA 2ISWA 2RDTA 1UJPA 3W7NA 2H8XA 4UTKA 3SY5A 1KTCA 3VFLA 3EWXA 4A2RA 2ABAA 2ISVA 1H1YA 1KA9F 1JQVA 2J24A 2C18A 4LV9A 3P74A 2DZSA 3WK2A 3Q58A 3DBPA 1TV7A 3EEGA 2FQIA 4MY8A 2W79A 5AFDA 5G2HA 3HGOA 3QW3A 3PM6A 3C3NA 2ZZ4A 5HJLA 2QCCA 4CCDA 3LLDA 3LCHA 4WJEA 2HS6A 3EWUA 3F4WA 1TCDA 3FJLA 4UIOA 3GIYA 3W7GA 4HT3A 3STGA 1TTQA 3JR2A 4R53A 3TU9A 4AWTA 3KHJA 1WA3A 3E12A 5LHEA 3M6YA 3S8HA 3MWAA 1WV2A 4OV9A 1G4TA 1H63A 2VFHA 5J5RA 3VCRA 1EWEA 3HO8A 1YPIA 2Y70A 5E93A 3QEZA 3KRZA 3UWQA 1IXOA 5HWJA 2ZQ0A 4KFPA 2E77A 2G97A 1KW1A 2OCZA 4Z08A 1DQWA 1F6PA 1K8ZA 1HL2A 2V0TA 3NPXA 4OT7A 1J5TA 3W2UA 2QCNA 1NVMA 3NQDA 2CLMA 4ONVA 2A7NA 4X2RA 4AWSA 3C56A 1OFOA 3QH2A 3LV5A 5DY2A 4IPIA 1X1OA 1SZGA 1YDNA 4O1DA 5K9DA 1OX5A 1W5PA 3DFQA 1B9BA 1LRTA 1SW0A 3LHZA 3W84A 3O6YX 3MW7A 1RQBA 2GPTA 4LRTA 2E5CA 1IXPA 1H5YA 3GKAA 4O1BA 4OE7A 3STEA 3G3DA 2RHGA 1FCBA 5AYYA 1OK4A 4OWGA 1QFEA 2YW4A 3GXNA 1VJIA 3EKZA 4K36A 4TMCA 3GLCA 3GNDA 3HPXA 3TW7A 5U7SA 1FXQA 3P8IA 3W1XA 2AGKA 2ZBTA 4DF0A 2Y88A 1K02A 1W0MA 3MYOA 4UNKA 5C2XA 4ALDA 3FIGA 4FNTA 4DQWA 5F4WA 3QMRA 3R12A 3EB2A 3W7RA 1A53A 3W2MA 1GVSA 3FA5A 2QUVA 2LLEA 1HUVA 2HSAA 3CC1A 2ZRWA 3R8RA 1BWKA 3G24A 3O1NA 3NM3A 4YL2A 1SFJA 4ZQNA 4AXKA 4PH6A 2BZNA 2QJHA 1OFRA 1SR9A 1VPXA 1GVOA 4QM1A 4E2BA 3S1VA 2C15A 3TQKA 2NWSA 4QIUA 3ZFHA 4PFMA 4WXYA 3G0SA 4JX6A 5H2ZA 3LHTA 2AAMA 3QPYA 1TPWA 2YFNA 3I6RA 5L6UA 1XDLA 3ZWSA 4EF8A 4MYXA 3QW4B 1KBIA 1VCGA 1GWJA 1UASA 2WNQA 3CHVA 2ZYFA 3OEXA 2JGYA 4WXZA 2ZCGA 4TIMA 3C52A 4AAJA 3FJ6A 3W7PA 4UMAA 3W1LA 3IIZA 3TKFA 4NX0A 5F4SA 1ZAJA 4GUGA 4JX4A 1YTDA 4LTSA 4Q4KA 1VCVA 3LCFA 4Y9AA 2PURA 1Q3NA 1D3GA 2VXNA 4FNPA 4N6EA 4IGHA 2A6NA 4IMGA 1B4EA 3HBLA 3W2KA 3THQA 1B57A 1H51A 4MZ1A 2B7PA 3QFEA 1W37A 3M5XA 3Q94A 3EWYA 3M0ZA 3RK8A 1KTNA 2CZEA 5CSRA 3N9SA 1VS1A 1WYIA 1L6SA 1SZFA 4M6QA 6ALDA 2CLLA 1PL9A 3CPRA 3LRMA 1JRBA 1TO3A 5AHIA 5CGQA 3OBKA 1I2OA 2YYUA 3IGSA 1LP6A 2YPIA 3A9IA 2QJIA 2G96A 1FDZA 3M43A 4D2JA 3CB8A 4NZFA 3E02A 3W1PA 4WY0A 5HUPA 1WBHA 3IEBA 4HPXA 3MBDA 3SR7A 3TW6A 1H1ZA 3W7JA 3M7WA 3P84A 3C4UA 3DFPA 3GDKA 1OFPA 3KVLA 3EX1A 2I1OA 3LI1A 1QO5A 3G1AA 5DCEA 2YR1A 1TYGA 4RXGA 5F2IA 3W85A 3N3MA 3G1YA 1GTEA 2JKEA 1P4CA 3AO0A 2J9YA 3DENA 4JYEA 2A7RA 1IIHA 4IMCA 3FKKA 3SGUA 3W1RA 4W9TA 4A21A 1A5SA 4GJ1A 1SSGA 4QITA 4A2SA 4UTMA 1ZY9A 1G7UA 1JR1A 1DV7A 4IMDA 3W2JA 4N2YA 3GX9A 4PTNA 1EUNA 3HOJA 1P0KA 4JY8A 3DU0A 4JTKA 3DH7A 1IXNA 1LDCA 1LOQA 3BLIA 5DCBA 3RLUA 4Y90A 3R5EA 1TPVA 3N34A 1B4KA 1VR6A 3BGGA 5AYXA 1OF8A 1A5BA 3L0NA 2YXGA 5FI8A 3LHWA 4UTTC 5K3VA 1AK5A 3TMQA 3L0GA 1OVDA 3W22A 1F6KA 2CLHA 2ZZ3A 3HIJA 2OZ0A 3I7QA 2CLOA 1QMLA 5LNWA 1OYAA 1XI3A 4O17A 3LLFA 5G5IA 2YZRA 2QCDA 4NVTA 2CLIA 3UXAA 5I3FA 3LCIA 4N9CA 3Q2DA 3VI2A 3UYCA 3QSTA 1OYBA 3I68A 3DFSA 4JGDA 4LS2A 4Q33A 4FNRA 2P0OA 4GNJA 1FWWA 1YDVA 5CPNA 3B06A 1QCWA 3F03K 1PE1A 3A23A 2CZFA 4LU0A 3NOEA 4WY0F 1UUOA 4BI7A 4JX5A 1LRQA 2DP3A 2QR6A 3EKLA 1RVGA 2YW3A 3YPIA 1OX6A 5EMUA 2VEPA 1KFKA 2CWNA 2FJKA 3NNTA 3BW3A 1OX4B 1VQTA 1JCJA 5D04C 4M6VA 4MLRA 1KV5A 1RQHA 1YLVA 2X30A 2DORA 3NZRA 3T40A 4AVFA 4CQ9A 1VZWA 2VKZG 2VEKA 4O13A 2NV2A 4RCXA 4BFAA 4JS3A 1OK6A 1FX6A 1HG3A 1H7RA 2YCEA 2VFGA 2UV8G 3ZWTA 1ZHAA 2ZRYA 3EWWA 4OBTA 4N4QA 1KFJA 4UXDA 1IF2A 4JYFA 4MFDA 3W2LA 3M44A 4BI5A 4UMCA 2EF9A 3UWZA 1R2TA 2JGQA 3UXDA 2XFWA 4FIQA 5BMXA 1YPFA 3C2VA 3PSWA 3N2XA 4QNWA 3GAYA 1EIXA 5G2IA 4K38A 4DELA 1EB3A 3HB9A 5EBUA 2VFFA 3TJLA 3SI9A 3L65A 4JTJA 5BNKA 3CWNA 5K4ZA 5FF2A 2XN0A 4ZZ9A 3LXBA 1XXXA 2Y7DA 3BVJA 3P5YA 2NZLA 3G1VA 4LOCA 4RX0A 1LZOA 4WOQA 2E6FA 3WK0A 2F84A 1I4NA 2QCGA 3BLEA 4JR5A 3G1XA 1WAUA 4UTWC 3QC3A 1XM3A 2HS8A 2FPVA 3T44A 1F76A 1M7PA 1I2QA 3P60A 3LCGA 2QUUA 4IQLA 4FX8A 1LBMA 3NQEA 3PUDA 1KLYA 2CLEA 3PB0A 3W83A 5D2TA 5TQLA 1TJPA 3NQVA 3C6CA 3P81A 4E38A 4OHQA 1GG1A 3GYEA 3MHFA 4EIVA 2E6YA 1GOXA 1TPB1 3LTYA 1NEYA 3LXCA 4R7JA 1EP2A 2ISSA 5KZDA 3IVSA 2ZTKA 3G1HA 3MUXA 4UR7A 2E5DA 3TSDA 2QCMA 5G2WA 1LYXA 4Y6GA 5C55A 4BR1A 3GZ3A 1FDJA 4FIRA 3W1TA 1WBJA 3IVTA 3OVQA 1G69A 3MMTA 4NJIA 5G1YA 3IIVA 1SW7A 5D30A 5E1QA 3N73A 3B04A 5AB3A 4HSNA 3WJSA 3HG5A 1W5MA 3TFCA 1SO6A 4Q32A 3MJYA 4O15A 2A6LA 1XKYA 2BWGA 4XUGA 2Q3OA 1ICQA 2WSRA 1LLZA 4FX6M 2CW6A 4LS1A 3HGRA 2QDHA 3N19B 1Z41A 3L0KA 4XKYB 3S5NA 4GWEA 2JKAA 2DZWA 3STCA 1S5WA 3S5OA 5I3GA 3FOKA 3P67A 2BTMA 3LM7A 3TC6A 2A21A 3PVFA 3TSMA 2YFOA 3QYQA 3O63A 2GJNA 2ZA2A 3QRHA 3LX9A 1A50A 1JUEA 4UTTA 5C6MA 2Y7GA 1VYRA 3IV3A 5K9XA 1ONRA 1LRNA 5K4XA 1NF7A 5FF4A 3NQMA 5LSMA 1G4EA 3QSRA 3W1UA 4MPQA 1FUYA 5A5WA 1ME7A 3LTPA 4O1AA 3NQGA 3GDTA 2QJGA 1T0OA 1VC4A 2O7QA 1BEUA 1GYLA 2Q3RA 4MFEA 5CZTA 5DCDA 2FPYA 4WUIA 1V5XA 3PAJA 4RV8A 2V30A 3PBWA 4HPJA 1R2SA 3VKJA 3G1DA 1P5BA 5D37A 1BKSA 1KV8A 3NL6A 3UNDA 1YADA 4LRSA 3DHDA 5HINA 1KM1A 1K8XA 4M19A 3RU6A 4O11A 1TQJA 4RZ5A 3TX9A 2XN2A 4EF9A 4I9AA 4RZ4A 4Y96A 4FNSA 1DL3A 1UUMA 4O4VA 2VFIA 3M5ZA 3FYOA 1OFEA 1X6UA 2TSYA 4LC6A 3P80A 3MP3A 3UZJA 1AMKA 2YGYA 3UY7A 1YDOA 2NX1A 3TC7A 3MI2A 2HMCA 4N9EA 5HWNA 3NL2A 4B5NA 4BI6A 5HWMA 4GUIA 2J6XA 2NLIA 5FF7A 2G95A 4S1FA 1W1ZA 3ABRA 4I7UA 4RXFA 4HNTA 1S5VA 4AB4A 2F7FA 5KITA 1TTPA 2IQTA 4O10A 3NPVA 4M7SA 3GVGA 4XZ9A 3EWBX 4GFSA 2C1HA 4QAIA 3HG2A 3THAA 7TIMA 3NG3A 3HPZA 3M16A 3TMLA 4LVFA 1C29A 2NXGA 3OVRA 1QWGA 3NPWA 3S0CA 3B0VC 1JCLA 2H8ZA 4POCA 1Z48A 4GBUA 3WJXA 1LOSA 1VYPX 4OQVA 5KMYA 5FEXA 3MO7A 5EA9A 1TQXA 1QR7A 3F4NA 3CU2A 3TXZA 1FWTA 1ADOA 3IIPA 4IOTA 1PCKA 3I65A 5DXXA 4U28A 4X9SA 4UTWA 4EWND 3QMTA 1I45A 3NGJA 3VE7A 2QUTA 3P62A 3C2OA 4U4MA 3PS7A 3EXSA 1VHNA 4K6AA 2JBMA 4S2BA 2PC4A 6TIMA 1FXPA 3PWAA 2VEIA 1DJQA 2R91A 2V2DA 1Q6LA 4UTIA 3BK0A 2E6AA 1GVQA 4RJEA 5D38A 4LV4A 2NUXA 3M9YA 5FF0A 1DORA 2ABBA 3G3MA 4P61A 3LB0A 1JQXA 4UFLA 1I2NA 3UZ5A 4OU1A 3W7DA 3PBYA 5K9CA 1K7XA 4JTFA 2Q8ZA 4YMZA 2ZZ2A 2WNZA 3KVJA 4JTGA 1F74A 1AW2A 1T96A 2PE4A 1ICPA 3P82A 3UD6A 1YYAA 1F5ZA 4N9DA 4O16A 5KTLA 4C1LA 5HULA 2QKFA 1ML1A 4O1CA 5AC6A 3USBA 2BX7A 4O54A 1QOPA 3M47A 4UFHA 3GK0A 1G7VA 1L6YA 1MSSA 1ZAIA 4PL1A 4IXXA 5IBXA 4MY1A 3UQNA 1QDSA 2AQWA 3MP4A 4TMBA 1GG0A 3TE9A 1SO5A 1QAPA 1VGAA 1MZHA 3M5YA 2A1YA 5CZ0A 1ZCOA 3BGJA 1J4EA 2OMAA 4HHPA 3G8EA 3OG3A 4QNEA 4NNCA 3UWWA 3KX6A 3DFOA 4PL2A 1TV8A 3GXTA 3RNDA 3M1ZA 2YX0A 3BW4A 3VNDA 3PC0A 1SFLA 2A7PA 1MEIA 5KSWA 4N9BA 1KFEA 1W3TA 3CTLA 4AHPA 4AWUA 2QCFA 2GQAA 3E49A 3M5VA 2DZVA 2A5HA 4M6PA 3DKJA 2R14A 3E96A 4GUHA 1G67A 1N8FA 2GOUA 3H53A 1QOQA 1L6WA 1JJKA 4IMEA 1RR2A 2H3BA 4FXRA 4HNVA 2VOMA 3LXAA 3O6CA 1NAL1 1AW5A 5LGZA 2C14A 2B7QA 4Z1DA 5CG7A 1LM1A 4MOZA 1HFBA 1JUKA 1N7KA 1FQ0A 1HO4A 4GRSA 3S1XA 1UCWA 1F73A 1KLZA 4ZQPA 2PCQA 3G0UA 2WPBA 1XBVA 4XBSA 3V1PA 1R2RA 4UC5A 3NQ8A 3PF3A 1KM3A 2ATSA 1D9EA 5DELA 1WXJA 3S1UA 3ABOA 4ZMGA 4YCOA 3W1MA 2A4AA 2G5WA 1SO4A 3IIOA 4PODA 4H3DA 3S1WA 2Y7EA 1H60A 2FIQA 3IIXA 1KM5A 2E6DA 3TR2A 2V5BA 4NJKA 4UUIA 2CZ5A 4HSOA 3CEPA 3W23A 1TIMA 4IUOA 3L5LA 4LWWA 4YLWA 3L2IA 4MJZA 4QQ3A 1TJRA 3ANYA 5U4NA 4NJJA 2WSYA 2X1RA 1LOLA 1YXCA 4UFIA 1H61A 4LY8A 3DHFA 2EGZA 3O06A 4XTDA 1OYCA 3L5MA 4LC8A 3WK1A 3S5ZA 2J9XA 2WSQA 2CLFA 2E09A 2V82A 1SQ7A 2EKCA 3L66A 1SO3A 3C2EA 3R89A 2JK2A 2RKXA 2GQ8A 5G4EA 3GDMA 3W7KA 4MYAA 4XKYA 4DO5A 3V75A 1G4PA 4IXHA 4UNLA 4ADSA 5EL1A 1BWLA 3CT7A 3HG3A 1J2WA 4GC4A 4DF2A 4JTIA 1R30A 3A24A 3CIXA 4YCPA 1FCUA 3P5ZA 1OFQA 1TTJA 3B0PA 5AHNA 1Z44A 2ZFAA 1XUUA 1K7EA 3SZ8A 3C61A 8TIMA 3NM1A 3MI3A 1LTDA 3HF3A 2V2HA 2TMDA 4ML9A 5DBUA 1B3OA 3W88A 4NQ1A 4H4IA 4JIPA 2Z1BA 4KFOA 5F1UA 1MEWA 5LNSA 3JRKA 5DLCA 5J5DA 5EYWA 1AL7A 2J27A 3DKLA 1SZEA 2V5LA 3R2GA 5AYZA 4ICNA 1T99A 1EEPA 3NQAA 3EX3A 2RDUA 2B0MA 3GDRA 3KVMA 5E0KA 5K2ZA 3B4UA 1OF6A 3L5AA 3NZ1A 3PUOA 1VLIA 2V2CA 2CFFA 2H3DA 3HMJG 2XN1A 4IJBA 3LTSA 1THFD 3W7IA 1JVNA 4O12A 1EX5A 4JICA 2YSWA 1A5CA 1O60A 2BLEA 2Y7FA 1C9DA 3CEUA 4G1KA 5TBOA 3MHUA 3U2OA 1TPC1 4QSHA 2OX1A 4KKXA 5C5YA 2FFCA 3O05A 3ATZA 3O6DA 1GZGA 1OABA 3GAKA 1LROA 3AJXA 2Z0IA 2FLIA 3NL5A 4HNNA 1YXDA 4XWUA 3HJZA 4C1KA 2NUWA 2GVGA 2J9ZA 1K7FA 2WO5A 4HKPA 4UMBA 2VC6A 5AC7A 1XFBA 3GR8A 4O57A 4NXKA 4JY9A 3CQ0A 4KWWA 3TFXA 3LCLA 3D0CA 2H6RA 3S9YA 4WOZA 4UFKA 1HO1A 1ICSA 4AH7A 1TREA 3EWZA 3KRUA 2ZRVA 3TDFA 3PBUA 2DU2A 5FEZA 2O7SA 2WJZA 3GXPA 4FNQA 5AHFA 1W5NA 5FF3A 1WOBA 3DXIA 1XC4A 2PRLA 3NQ2A 4OGZA 2GVLA 2TRSA 5F2MA 5LNRA 3W87A 2ZA1A 3P8JA 4Z1CA 1LBFA 1SPQA 4DXVA 1FWRA 1GVRA 3W07A 4ADTA 4TO8A 1FDYA 3TJXA 4PCFA 4XBKA 2WKJA 3ZR4A 2R94A 1GJPA 2VENA 4CNOA 3UPWA 4A29A 1SUXA 4LVAA 3T55A 3I7SA 1S3HA 2C3ZA 5DBTA 1W3IA 4JTHA 1RQEA 4I7VA 4FXSA 3SECA 1E51A 4N4PA 1OFAA 1ZFJA 5LNUA 4LS0A 2QCLA 4DPPA 3L67A 3LDVA 4Z1AA 4RK8A 1TB3A 4FNUA 3PB2A 2ZZ7A
chains in the Genus database with same CATH superfamily
3WF3A 1V02E 3OZPA 1CWYA 1V7YA 3TN3A 3LI0A 3C8NA 1JI1A 2FZNA 2NXHA 4S39A 4ORIA 1PSCA 1L6GA 3FSTA 4PULA 4MZYA 4ZQOA 3B0UX 2ONEA 2J88A 3GUWA 4BF7A 2BXYA 1V6WA 1MI3A 2D69A 1O94A 2VZTA 3OGRA 3TV8A 5F2LA 1GQJA 1TG7A 2W9MA 3V1HA 1TELA 2I14A 2ZRUA 1EP3A 4D6EA 1W9XA 1TUXA 4PMJA 3HPSA 1R8LA 1FKXA 1QI4A 4LF1A 4YS1A 4GXWA 3GKFA 4AD5A 4ZB0A 1W56A 5A6SA 4KH2A 3DHPA 4Q4QA 3TH6A 3W75A 2PWHA 3CPGA 2NV1A 1VH7A 3IGXA 3DG6A 1UC4A 2NXIA 3G6LA 1XGDA 3KVKA 5ECVA 2C6QA 3NGFA 4TVCA 1IQ8A 1EA0A 2Y85A 1KFBA 4CQ8A 2Q8LA 3VNJA 1ME8A 3NUKA 4KCVA 3DYPA 2Y61A 1ISVA 1B2YA 4CN6A 2PGEA 1DHPA 3ENLA 4B4FA 2PDKA 4GPNA 3BJFA 1OJXA 3VE9A 3TUUA 1EQPA 2QAFA 1V7AA 3MCOA 5AOUA 1S39A 1WDRA 1CB7B 4FHAA 2X2GA 3A5VA 4KF1A 3IGHX 3STPA 2EKGA 3GH7A 1GOOA 3AWOA 1GZJA 3DG3A 5M3WA 4U10A 2V9DA 3VIKA 3CUZA 3EXRA 5BOOA 3BMXA 5D2XA 3IPWA 1P1XA 2XINA 4MTVA 3S2MA 3A4AA 3E0IA 2YDQA 3MPGA 2RDXA 1CIUA 2ADAA 2X7VA 4WZHA 4C6NA 2QEZA 1AA1B 3LUTA 4Z0JA 2XIJA 2XZ7A 2YKKA 3AIBA 3LOTA 3GG0A 1HKVA 3ABSA 3FS2A 1V3JA 3N2CA 5E9XA 4LSBA 8A3HA 4J3SA 1GPFA 4J40A 1PIIA 3C8FA 4PUNA 2ALRA 4Q4MA 2EAWA 4PMRA 5EGRA 2OOGA 1QPRA 3I10A 3A12A 4J3XA 2G3MA 2O4MA 1ISWA 3CV1A 1GEQA 1CBGA 2FB2A 2IMRA 1E70M 5I2UA 3OB8A 5E0FA 3MYPA 3LBOA 4KIRA 5F4XA 4TX9A 4HZMA 3GNXA 3N6QA 1GPWA 3VIOA 3R6IA 4BF9A 1FHUA 3M0LA 3AS2A 3KFTA 3GR7A 3TCSA 4DM2A 5A6KA 1FWSA 4DBEA 3HG4A 2XM2A 2HJPA 3B8IA 2JEQA 3MZNA 4CLMA 2BXVA 3VKAA 3OIXA 2VYOA 3U7VA 4GJJA 4UFJA 2E28A 2FPTA 5EY5A 3GHUA 1W2PA 4FS9A 2NVCA 3GR4A 5L9FA 5EU9A 2QMKA 3V4BA 4D9PA 4K37A 4XAGA 3GNNA 4RDWA 4Y2WA 4DWSB 3WK3A 3GSMA 4NIRA 2B4GA 2QUNA 3TIMA 3RX2A 3SUSA 4AC1X 2GDQA 2Y5EA 1H62A 3VNZA 1Z7AA 4EVZA 4P2VA 1FVPA 2Y4SA 3F4DA 4E2DA 3FHQA 3JZEA 2BOEX 4C1NB 2WNWA 2UZ9A 2B7OA 5CZJA 2BS9A 2Y89A 3OHIA 3VABA 2X0HA 1HL8A 4ZQRA 2FH6A 4GYKA 2OT0A 4CQBA 1YBQB 3CZJA 1CCWB 2WQDA 2C0AA 3G6MA 2KAUC 4G6CA 3BV4A 3SUVA 3KWSA 1V6UA 3VUPA 3IJ6A 1BAGA 3TAKA 1FHDA 1N8WA 4O14A 4MWAC 3MUZ1 4H6RA 2FKPA 3G22A 2PLKA 1JRCA 1LWHA 2OR2A 1KFLA 4K7VA 3B0XA 3ITTA 3ICJA 1XCFA 3MBFA 3G1FA 2CU0A 4FEZA 5EKYA 4KWVA 1ZENA 1PWLA 1C91A 3LCXA 4X3ZA 2A3BA 2NX3A 3LBMA 1Q6OA 5D8ZA 1XDMA 5LIKX 2GGHA 1H50A 6REQA 5BOFA 2G3NA 2UY3A 2OELA 4HYRA 1X39A 4NF7A 4GUFA 1YX1A 3LV6A 1UD2A 1NM9A 2WHLA 3GXDA 5T26A 4PUKA 3B97A 3UCQA 2O0TA 3L2MA 3FX4A 5GNXA 3WMBA 1XRVA 4GUJA 5JXQA 3KCOA 3SCUA 1BVZA 4M6UA 3WDRA 3SN0A 1XS2A 1OHLA 2ZKMX 1I2RA 1ENUA 2XGIA 3H55A 3KAOA 3FFSA 4JQ3A 3FY1A 1D3HA 1US2A 3WJWA 3IK4A 3CWOX 2VR2A 2INFA 3BJSA 3PN8A 1LORA 5JH1A 5EMMA 3OJGA 3QMSA 3B03A 1PYFA 3FDKA 1ZGDA 4MZ8A 4CNUA 4O1FA 5EPDA 4GLEA 4I7WA 7REQB 2FB3A 2WQPA 1ZBWA 1P0NA 1JF5A 3FLUA 1FWNA 4L4MA 2DZUA 5A6JA 3BL3A 1J10A 3T2OA 4US5A 2BVTA 2FHBA 1B30A 3WLHA 4F0KA 3RO8A 3N9RA 1LL7A 1J9YA 3NTYA 4UTUA 1JL8A 3RCNA 1TCMA 4GIYA 5CC7A 1XLIA 3C0SA 1CLVA 1OG0A 3N11A 4FOKA 4AVNA 3KBWA 3VYLA 1F9CA 5ABEA 1IT7A 2PDYA 4HCLA 3A4JA 3QQ0A 1W31A 1OFDA 4LVGA 2VWSA 2VEFA 1S5NA 5LGXA 1NDYA 4LYQA 2C1GA 1UZHA 4ZOAA 1AH0A 1WOAA 4NAFB 4QG8A 2WZEA 3WL0A 3XIMA 4RNFA 1GQLA 4AQLA 5CZSA 1MUCA 3AMDA 1XG4A 5GPRA 2DY3A 4DBSA 4CCCA 4I9JA 1Y7VA 4E3VA 4LVDA 1Z9AA 2Z29A 4ZL1A 4PCTA 1IXQA 5A69A 1K6AA 3E1F1 3RF9A 3LCWA 3CHCA 1PHQA 2PDCA 3NCOA 2Z6JA 4J9JA 1TTIA 1CXLA 5D05A 3TLQA 2X40A 1F05A 5C54A 2DJXA 4DJEA 4KWUA 4WRHA 4KFNA 1HZYA 2VZUA 4J3WA 1TJ2A 4YHGA 4A3UA 2I56A 4DEFA 2PSNA 5IFTA 3AMGA 3ARZA 4AX6A 3TSBA 2ZZ1A 2R1MA 2BFGA 2G8ZA 4Z17A 4DZ5A 3W71A 3K30A 1KTBA 4Y8FA 3TQ0A 3KS6A 1PHWA 2PDLA 2POTA 1WUFA 3LBCA 4K8GA 3DFTA 3I3DA 3B9EA 4IPPA 4AD3A 3QPZA 4OOUA 3TCEA 1WX0A 3QYSA 3VOIA 4C6LA 1QPKA 4C60A 5IM51 4D6GA 1HQTA 4XIMA 4DBDA 4ADUA 1BRLB 1MMFA 4DZIA 3WMLA 2C19A 1V3KA 5E70A 2VEMA 2GJLA 4B90A 3H70A 2PGFA 2XGBA 5CSYA 3PY2A 1KBBA 3EX2A 3UETA 4LUJA 1UP0A 3MKVA 3RLVA 2RDTA 3ZJKA 3S9ZA 9XIAA 3WQPA 4UTKA 1XX1A 3AUJA 3EWXA 1ODUA 1OM0A 2JIEA 2VP8A 5BU6A 4NYUA 3IJQA 3WK2A 3MT1A 2FQIA 2GK1B 2Z27A 4C6OA 5HAOA 4DWSA 2P5NA 3PM6A 1TWDA 4CCDA 4W8AA 2HS6A 3EWUA 4G9PA 5LXEA 4E8GA 3ZMRA 4AD4A 1BQCA 1LJYA 3GG7A 4Q8QA 1XIEA 4HNCA 3ZM8A 2ZC8A 3PANA 2UBPC 2Y8UA 4C1NA 1PDYA 3OA5A 4H6QA 5D9PA 4OV9A 1OSEA 1R9YA 5AYBA 2E25A 1EWEA 2PWGA 2OSWA 2Z1XA 4CU7A 3UR5A 3QBUA 2C1IA 4KFPA 4KESA 1DE5A 1YNPA 1FWBC 3VGEA 3AYSA 4B3ZA 2X8RA 2OXNA 1DQWA 3TOPA 4KEVA 1HT6A 4AWEA 3R10A 7ENLA 3NQDA 2A7NA 1H41A 1P6CA 3UFYA 4EXAA 1OFOA 4F48A 4IPIA 4JN7A 1SZGA 2DUXA 1Q8JA 1X6LA 1OX5A 4JZ5A 4ASTA 4YTRA 3O6YX 1XYCA 1RQBA 3BSMA 4QHRA 1RJPA 3GE7A 1IXPA 3GKAA 4O1BA 1A3XA 4JTAA 5IDIA 2XVNA 1OK4A 1QFEA 1FWDC 1TE6A 2EJAA 1RPKA 1C3FA 1VJIA 3SUWA 1PO9A 4IJRA 2V5JA 3W1XA 3ZXWA 5J04A 2Y88A 3GNOA 2O55A 4UNKA 3FIGA 2FYMA 1BPLB 3HA1A 2ISDA 4JPGA 3EB2A 1A53A 3FA5A 2LLEA 4GVHA 1CEOA 5HMDA 2ZRWA 3QR0A 3UR7A 3V3WA 4YL2A 4ZQNA 4AXKA 2QJHA 3T81A 3O0FA 3TQKA 4XG1A 2D23A 3UZWA 3ZFHA 4KCUA 3FJNA 4WXYA 2CCRA 4IUGA 3CZLA 3TW9A 1NFGA 2E0PA 1H2JA 2WNQA 1B54A 2J6VA 1NWSA 4WXZA 4TIMA 1JXJA 3CMJA 1NWRA 3C52A 4M81A 4D6IA 3KDNA 4GACA 3W7PA 2VCBA 3GTIA 3TKFA 4E8DA 5F4SA 1O5QA 5IHSA 1D3GA 4N6EA 4IGHA 2A6NA 2ZUMA 2I57A 1B4EA 7REQA 4IQJA 1RHCA 1HGWA 4MZ1A 4QROA 3FHAA 3M0ZA 5MKGB 1PWMA 5CSRA 4HA4A 3ZLFA 1PL9A 1RD6A 4E8CA 3LRMA 3U2CA 1TO3A 5CGQA 3OBKA 1B9ZA 1Q4WA 2CEQA 1E9LA 4TQTA 3GVRA 2QJIA 1RY0A 1A0CA 1ECEA 2OQHA 3UG8A 4YN5A 1GONA 2PTZA 1WBHA 3ITVA 4WKFA 4QCEA 4HPXA 3MBDA 3VD4A 3M7WA 3S6TA 4NRSA 1X8CA 2F38A 4HBKA 3SFWA 4DY1A 4NAFA 3BH4A 2WVTA 3KDOA 2GJXB 1QO5A 3PPCA 1R3TA 5HMEA 1O68A 1GTEA 2JKEA 2IPFA 3DENA 2VC7A 4W9TA 1KKRA 1TMLA 4Z2GA 1B3YA 3NZPA 4S3BA 2Z2AA 1DV7A 4IMDA 3UT0A 3W2JA 3GX9A 3E2RA 1TVNA 4NZ5A 1G5AA 2ASHA 2NLYA 3AZRA 1EUNA 5IRPA 2R1KA 1P0KA 4JY8A 3RLUA 2J47A 3R5EA 4HYWA 1VR6A 5AYXA 4PSPA 1A5BA 3H7UA 3L0NA 2YXGA 4JKMA 4CUCA 3NO1A 5K3VA 1EJWC 1AK5A 1GOWA 2PS2A 1AUSL 3EKGA 3W22A 2ZZ3A 1WKYA 3CZKA 3I7QA 4PZVA 4AYGA 2J77A 2VD8A 1T5AA 4F79A 4Q3MA 2V69A 4LFYA 3I68A 3DFSA 1J79A 1U1HA 5I79A 1VF8A 4FNRA 6ENLA 4RW3A 2WKGA 1A5UA 4AZ5A 3ORWA 1PE1A 3IK2A 4AFYA 4WY0F 3QV6A 3SCWA 1HJQA 4JX5A 1RVGA 4F0MA 3LSCA 4Z1YA 2VEPA 1BRLA 4P8UA 1ZPTA 3RYSA 1JCJA 5D04C 2NQ9A 1RQHA 3P6LA 1EJTC 1XLMA 3E2SA 2Z7KA 4AVFA 4UZUA 4O13A 2NV2A 4RCXA 4BFAA 1DXIA 2V3FA 4JS3A 3UGVA 2VFGA 2V38A 1ZHAA 4ZODA 2VZVA 4MGGA 2DSUA 4OBTA 4B2DA 3VMNA 4A8RA 4N4QA 2WJFA 4JYFA 2GK1A 4MFDA 3HPFA 5HA7A 3UXDA 2GGIA 2IXVA 2WBGA 2F9RA 4QNWA 4OVXA 4QLJA 1HF6A 1EB3A 1DJXA 4LYRA 3PNUA 4L5ZA 4AZ6A 3Q4DA 2VFFA 5RUBA 4FA3A 1JZ3A 1XR2A 3SI9A 5BWFA 1UWAA 3RN6A 2ZX5A 1E72M 1Q85A 3P5YA 1UP2A 4KIEA 4HK7A 4WOQA 3LM3A 5FOOA 2E6FA 1PIFA 2BY0A 2QCGA 5IXEA 1VEMA 3F5KA 4UTWC 4GYJA 3SDOA 4FOUA 1V79A 3KHDA 5AVNA 4F2TA 3LCGA 2QUUA 1QNOA 4BF5A 5C71A 5DFAA 1KLYA 1BWVA 3PB0A 2PWFA 2Q71A 2QT3A 3T2PA 1TJPA 3OZMA 3EBVA 1J0KA 3D47A 4EIVA 5I24A 3LTYA 4YYFA 1V6XA 4H9ZA 2F2KA 3FYYA 5KZDA 3IVSA 3MUXA 3TSDA 1Z32X 2UWFA 1VEPA 3O2LA 4FIRA 2QS8A 3IIVA 5D30A 5E1QA 2E1WA 3TTOA 4FR6A 3TFCA 4QCFA 3BOFA 1LG1A 1SO6A 1S2WA 4EXQA 4HQVA 2BWGA 5I00A 1PYMA 2WSRA 4V1YA 3N19B 4XAZA 4ZTYA 2PDWA 3S5NA 3S5OA 5I3GA 1OC7A 3DECA 3GH5A 1KXVA 2BTMA 2I9UA 3U57A 1REQB 3PVFA 3QYQA 1VIWA 4MKSA 4YU1A 2IS7A 1O1HA 1M41A 1JUEA 4UTTA 5C6MA 2Y7GA 1VYRA 5K9XA 1ONRA 3R0KA 5K4XA 1NF7A 4PB5A 4OIFA 1G4EA 2PDXA 3U2EA 4MPQA 1FUYA 4GIAA 5A5WA 1I75A 1ME7A 1WDPA 4DAIA 5AECA 2PDJA 2XHYA 1X1NA 3H26A 3RM9A 1VC4A 2Y0FA 4INFA 3VNIA 1BEUA 1GYLA 4QS5A 1V5XA 1BG4A 5G1MA 3PBWA 4PTDA 1HKWA 3BGAA 3VIPA 3VKJA 5D37A 4YTQA 5M5DA 1HJXA 2B81A 3NL6A 1YADA 4NILA 2CLPA 4GY7A 4XZWA 1JPIA 4M19A 5DMLA 4RZ4A 2HPMA 4L9YA 1LWIA 2WM0A 1DL3A 5FAJA 3GG8A 4Q22A 4O4VA 3FYOA 1O1ZA 3NWRA 1X6UA 5HANA 1J01A 1VFLA 5MKGA 2AL2B 2MNRA 1AMKA 1TZ9A 3VIMA 2NX1A 4H9XA 3V35A 3ZT7A 2OKOA 1SVDA 1XLGA 3SRHA 3B9NA 1XFCA 2HMCA 5B7ZA 5HWNA 4PMXA 2PP1A 4BI6A 4GUIA 2J6XA 1V3MA 3QZ6A 3SQSA 2X0SA 1BGAA 1W1ZA 4HNTA 1S5VA 2J13A 3BOXA 1J0JA 3NPVA 3GTFA 4XSLA 4M7SA 5CC3A 3QTPA 3EWBX 1F8MA 3LZ3A 1UH4A 3SY1A 4XK2A 3VU2A 1DIDA 3EMCA 3MC5A 3HPZA 1C7SA 3EB4A 3LEPA 1IEXA 3W37A 2GJXA 3B0VC 4GIEA 2H8ZA 2YXOA 3H2MA 1Z48A 2VOTA 1LOSA 1VYPX 5KMYA 1TQXA 1PBGA 3U48A 4D8LA 1ESWA 2VZOA 4IOTA 4Y8EA 3I65A 4UQAA 3F2BA 3UG4A 2ZXAA 2XG9A 1P0DA 4Q8TA 2NT1A 2QUTA 3C2OA 4U4MA 2PP0A 4HA3A 4HHLA 2JBMA 1IEVA 2PC4A 1FXPA 2R91A 2IW0A 1JPHA 4RJEA 5D38A 2NUXA 3M9YA 2DUAA 4ACZB 4P61A 1JYNA 2XIIA 3R94A 4UFLA 1KXQA 1W9DM 3PBYA 5K9CA 1RUSA 3E2QA 2Q8ZA 1B3VA 3KCJA 4D6JA 4TX6A 3KVJA 1ZJBA 1F74A 4W84A 3WQGA 3SBFA 1ICPA 4O16A 4JTRA 5KTLA 4RDZA 1M9HA 3M64A 3MVTA 4QRNA 2BX7A 2POZA 2BVYA 4OZOA 1QOPA 2DVTA 2JEPA 3RCMA 4DJFA 1KQZA 1CGXA 3QV9A 1L6YA 1HL9A 1ZAIA 3MP4A 4TMBA 1TIWA 1I9CB 1SO5A 2VD9A 3NJ3A 1ZCOA 2QUMA 5C9XA 1UD5A 4QJ5B 3V0SA 2CBIA 1E73M 6CGTA 4QNEA 3DFOA 3QOMA 4ZOCA 2DVUA 3WNMA 1WXZA 3VNDA 3ITOA 5KSWA 2XGZA 5CLWA 1KFEA 4HPHA 1W3TA 1EEXA 4Q4SA 1KB3A 2WPGA 2DZVA 3AICA 2R14A 2DSKA 1E40A 4GUHA 3AXIA 2GOUA 1QOQA 2AKZA 2J74A 3QV8A 3UZZA 3VNLA 2WWCA 1KKOA 4FXRA 3HMCA 3O6CA 1UQZA 2VQTA 3QY6A 1AW5A 3GIQA 1ISXA 3ZSSA 2Z1VA 3QY7A 4GABA 2I7GA 1HFBA 3SQLA 1UROA 3URAA 1DQUA 3MMUA 3S1XA 4FXJA 1F73A 1KRMA 4CQDA 2G50A 1IYXA 1UIOA 2VC5A 3PFRA 4AC7C 4AIBA 2OWXA 3KOXA 1JAKA 2VO5A 1JAEA 3GU9A 4C6EA 3S1UA 3AXXA 3ABOA 2DPEA 4ZMGA 3F2CA 3S83A 3UXKA 1RK5A 4PODA 4EK7A 3WZ0E 2E6DA 2J7GA 3TR2A 4NJKA 4UUIA 3W23A 2D0GA 3L5LA 5AZ1A 3L2IA 5E0CA 4MJZA 4AU0A 3LQLA 4IZGA 3AIWA 1D2KA 4NJJA 4IHCA 2OWCA 1RBAA 4UFIA 1H61A 1JCTA 3U5UA 1JFHA 3B8UA 4LC8A 1EO7A 1VRXA 2PWVA 1J18A 3LU2A 2DIEA 2J9XA 2CLFA 3ZSTA 4HU4A 1YE4A 2JK2A 2GQ8A 3CH0A 2G4JA 4DO5A 3OZYA 2VL4A 1S2UA 1XIMA 4ADSA 2OTDA 4MHBA 2YCLB 1BWLA 1REQA 4GVGA 1XIDA 3HG3A 4P7RA 4MWAD 2XH7A 2OOFA 1TWSA 3A24A 3CIXA 1A5MC 2YA0A 3B0PA 4I6VA 1Z44A 4C6MA 2ZFAA 5C2GA 1K7EA 3VO0A 4AZCB 4MDPA 1JEZA 8TIMA 3HF3A 1Q63A 4ML9A 1TZ7A 4PBFA 5CEWA 4ZOEA 1UOKA 4NQ1A 4H4IA 4KFOA 4ZSUA 1MEWA 3NOYA 4C6QA 2BB0A 2J27A 5HXMA 2BVWA 1WZAA 3M0MA 4IF2A 4GXPA 1RA0A 4CU8A 5REQB 4UB9A 5HPCA 1YEYA 3WSUA 3K4WA 2Z1SA 1N8IA 4W7UA 4B92A 2V2CA 2H3DA 9XIMA 1FH7A 1RSCA 4IJBA 3BLDA 4KRUA 2GSJA 1THFD 5FCZA 4O12A 1EHNA 4P8XA 2AL2A 3FAXA 2YSWA 4JICA 4U2YA 3VX1A 4B16A 4DN1A 3WCZA 2BLEA 1C9DA 3AYVA 3WNKA 1LWJA 4V33A 3N25A 1OD0A 4IICA 2ZDSA 1MDLA 3U2OA 4PMNA 2OX1A 2OEJA 5HQLA 3DERA 1QBAA 1JGIA 3ATZA 4H1ZA 1DJZA 3AJXA 2FLIA 2D24A 3HJZA 1KGWA 3LPOA 4UMBA 4Q6XA 4GO9A 2WHKA 2INZA 3QY8A 4KWWA 3D0CA 3S9YA 1J5SA 3Q45A 3VVGA 5FL1A 2IKHA 2O9TA 4S3FA 1ICSA 3VC6A 1XWYA 2VGBA 3EWZA 2CZVA 4XO7A 3L23A 2ZRVA 3QGKC 5FEZA 3GXPA 1W5NA 2WXDM 4L61A 1XC4A 2VDHA 5F2MA 3RXZA 3TYCA 3W87A 3P8JA 5CBJA 2HZGA 3ES8A 1FWRA 4R3UA 3W07A 2GJPA 3VMPA 3EPNA 3TJXA 4PCFA 2WLZA 2QZRA 1K9FA 4F0LA 4L1XA 4A29A 3FV9A 1HKIA 4XVEA 3WQ6A 1XQKA 3UJSA 2CIPA 2V63A 1E43A 3PJXA 4UNIA 2PDGA 2QCLA 3F5LA 1OGSA 3VC5A 3WQ8A 1UWRA 3L67A 3EWCA 3LDVA 4Z1AA 1VBRA 3PB2A 1MXDA 1MNSA 1QVBA 1US0A 4ACZA 3WQOA 3RAOA 4XZNX 2RJHA 1XRSA 2QAPA 3SCNA 1YMYA 3T0BA 4HU8A 1R3VA 2BSLA 1AQHA 1K8YA 3NQCA 2CESA 4UQDA 1Q6RA 1W9BM 3K46A 3SUTA 1ZALA 1ZJAA 1JYVA 3CS2A 4HB7A 4A35A 2BP1A 3O16A 3DYMA 4EPBC 5FD0A 3EDKA 1QPQA 1Z42A 5HUOA 2VX7A 3H4WA 2J78A 1AVAA 4ZA0A 4E4UA 4GO8A 4ICCX 3P14A 2BDQA 3UR2A 4YNGA 1VJSA 1B3WA 4GNKB 1EF2A 2BBFA 1RH9A 1DIEA 3WEZA 4WDUA 1KD0A 4XUYA 1QW9A 1B1YA 3WD0A 1IWBA 3B8SA 4QFUA 1TJ1A 3L4XA 5A6BA 3W7CA 2QF7A 2X05A 1IHIA 4ZQCA 2W62A 3WQEA 2Q8XA 1B3XA 1JDEA 4JTTA 2VRQA 4ATWA 2R8WA 3V0UA 1C8YA 3KRSA 1XD1A 3UWYA 3B05A 4H9YA 5CC6A 3TWAA 3B9AA 4AZ7A 4B5VA 3LENA 2FHCA 4G5DA 1JYXA 1M53A 5I77A 4JTSA 4KEZA 1XBXA 2BG5A 4KWOA 4L65A 1F4AA 3VDBA 2QMJA 5DXYA 4LUTB 4E4PA 5HNRA 3G18A 3OA3A 4FMVA 4DUVA 3W1AA 4WDTA 1NH6A 1UJQA 1B31A 3SJ3A 1EHAA 4LT9A 2FZ8A 5DEZA 2ZZ6A 1O5KA 3PR2A 2YDAA 3OYZA 3PPFA 2A2IA 4MWAE 3W9ZA 1JUBA 4QQUA 4UOJA 3WBAA 1E6XM 4C6PA 1FWGC 3PZVA 3DFYA 4G7FA 1LLWA 4NL1A 1OQFA 2CHOA 3ZZ1A 2QCHA 3SSJA 2DZAA 4V2XA 1QHPA 1DVJA 5ECUA 1OWQA 3AMCA 4MB3A 4HPGA 4NG3A 4E3TA 4Q7BA 5BXTA 4NUWA 4UQBA 5ABTA 1JXKA 3RLGA 3W01A 3V18A 1Y65A 4HOXA 4GH1A 1MFVA 5FIPA 2Z2UA 3MUCA 1PUDA 3MCNA 2OT1A 1LG2A 3IGUA 3NL3A 1DXFA 4ZFCA 5EMKA 3P0WA 3U6WA 3HV8A 4PRWA 4ZVJA 3WLMA 5AC5A 4PC8A 4H9VA 2OZ8A 3F5JA 5CXPA 3C86A 3BQ6A 4NI3A 4M80A 5JBFA 3AISA 2WOQA 3CLWA 1IIGA 3FN9A 3USZA 1UR2A 4D72A 3DGRA 1DWGM 2GVYA 3PHAA 4NJGA 4V27A 4GQ0A 2PD5A 4JXCA 2YCLA 4NJHA 5I3JA 2E8YA 5BW6A 1OX4A 3D6NA 5I02A 1W9VA 4LQ1A 1EPXA 3U8GA 1PTGA 4H19A 1XGZA 2E1DA 3N18A 4HSHA 1VYSX 1O5RA 3VIFA 1FWAC 1W5OA 4MY9A 2X1SA 3EX6A 4AZCA 1KR0A 1ALDA 4ZQMA 1E3ZA 1AJZA 3VKDA 3MS8A 1M1BA 4BWLC 3CASA 3ZQ9A 3HJEA 5HNNA 3QGVA 3W02A 3RPDA 3GO2A 1TPUA 2NWRA 2RFGA 4WDXA 3TVAA 2X42A 4BEUA 1RVKA 2EPKX 1HTIA 3DI0A 4DLFA 5CAHA 3L21A 4O53A 1GVFA 4GD0A 5REQA 5AHMA 4QP0A 3QOKA 5D2YA 3BLPX 4LEFA 4L4OA 4DRSA 4LBUA 2ZTJA 4BQ5A 2ZVRA 2BOGX 4DM1A 5BMWA 3DAQA 2XTKA 1GYMA 1SMAA 5HPOA 2Y62A 2X1TA 3ERPA 3N1AA 1ZUAX 5D02A 2TODA 1BFNA 4PUJA 4QDWA 3HGSA 3K4DA 2VFDA 5JMUA 4JN6A 4MUZA 3ITCA 2D73A 3UWEA 1GQNA 3HQ1A 4P7QA 1Q7QA 3GM8A 3K8MA 1ZB5A 3EDDA 1XCXA 5FJUA 5EB8A 5IFPA 4E0CA 3UZXA 2PDHA 3VAVA 1XQLA 1LQAA 2AMGA 1TPDA 4F9DA 1L9WA 4L4LA 1W9PA 2CNCA 5H8UA 2D0HA 2J8FA 4DO4A 4JTCA 1XIGA 1BYBA 4GZ7A 1UYQA 1JIBA 3M0XA 3CLMA 1T40A 3WD2A 5FJIA 3QGAC 5CBIA 2PF8A 5LKYA 4W85A 3UERA 4ATDA 1JULA 3BAKA 5JIWA 2RH9A 3WFZA 1YTKA 4S2CA 4X0NA 4WD0A 3DOPA 2E9BA 1I2PA 7XIMA 3O15A 3EA3A 2OGJA 3FCPA 1NDZA 1NU5A 3BPWA 1VFTA 4O4WA 1UIPA 3NPUA 1HX0A 5C70A 2FGBA 4UR8A 5HQEA 4F66A 1Q45A 4GISA 1M6JA 2F6KA 2KZHA 3SGZA 1AL8A 1ONEA 4KERA 2VFEA 3AIRA 4Q8UA 1M03A 1PCWA 1DOSA 1PS9A 2YA1A 3EX4A 2BHZA 5I0DA 2HBVA 4HPNA 1Q2SA 4TTGA 5FEWA 3UWUA 1X7FA 5HMSA 5I5RA 5I3HA 4DVOA 3N04A 1ZNNA 3NZGA 2G37A 3PK7A 4LH8A 5ENLA 1UA7A 1X7IA 3I3BA 1AZ2A 2C16A 3LHVA 1W1B1 1UKSA 3W00A 4B5SA 1VLWA 3NQFA 3T9PA 2FFIA 1L8PA 5T9CE 3LRLA 4QGCA 2Z1KA 2UY2A 2YYTA 3BSGA 3TN6A 3VIIA 1VPQA 1R87A 4A8IA 1EC9A 3E5PA 4QJ1A 5HR6A 1PTAA 3CUFA 3BV7A 2R24A 2R82A 3AIQA 2EG6A 5A3HA 4WY0B 1CLKA 4GYPA 5ABGA 2D2GA 3RR4A 4Z2LA 2FDMA 4S3CA 5F1VA 2TPSA 5HJYA 3QV7A 3BWWA 4GKTA 3IANA 2C79A 1XV8A 1J0IA 3ATYA 3IUHA 5D4YA 3HM7A 3ARTA 4FX7A 4XVDA 1BGGA 4UTHA 5D03A 1V6TA 3PUGA 5AZ0A 3BC9A 3NO5A 2PBGA 1QNSA 2QDGA 4DPQA 1G6CA 1POJA 4JIQA 3T4CA 3PSVA 3ARRA 3QQ1A 4L9XA 3SAZA 5JBDA 2VELA 5GQBA 4HCDA 4QXIA 1E0TA 3KOFA 3W82A 4LUTA 4H04A 3URQA 5DN1A 2XFFA 2VR5A 4MG4A 2EG7A 2ZDRA 4MKNA 2BGSA 4B5TA 1F7BA 1TA3B 1I8JA 3UY8A 3M0HA 2GVJA 3WLQA 3AHYA 2XFYA 1FCQA 3VDCA 1EUAA 2V81A 5FA5A 4O19A 3E74A 1H7WA 4XTIA 1JCXA 1JCNA 1A4MA 4UFMA 1MQQA 1UOZA 1EGVA 3PTMA 2CWXA 4LAOA 4EOUA 4Z2HA 4CKQA 3A5FA 3EAUA 3ITYA 3W70A 3O07A 2Z26A 3H21A 1LT8A 1SSDA 2YIHA 1PV8A 3HTWA 2QGHA 3DX5A 2X1UA 4N02A 1X38A 3G8RA 4TTUA 3BZJA 4L1WA 2DZXA 3BJTA 2WSKA 4XD4A 5TAOA 3T78A 1NWTA 4YTSA 3S2NA 1TVLA 3DI1A 1UPPA 3IACA 4GXMA 5FJRA 3UWVA 1MRQA 4JQ4A 5HMFA 4QG6A 1C8XA 3RITA 2RGMA 3H4XA 2XSBA 3K5XA 1UR4A 2FMOA 3JZUA 2V68A 1KM6A 1CGYA 4H6KA 1XSKA 1W54A 4M5PA 1TV3A 2ISWA 2C0HA 2REQB 3WF2A 2R6OA 2J4GA 1V0KA 1KTCA 2VNCA 2ISVA 4PUWA 3RIKA 4L56A 1DTUA 4LAZA 3L4UA 5A6MA 2Q01A 3P74A 3Q58A 3DBPA 3NYDA 3HURA 4MY8A 2W79A 5G2HA 3HGOA 1VFSA 3G77A 1ZLPA 4H01A 4GI8A 5HJLA 2J25A 4S3KA 3GW0A 1QJWA 3FJLA 4CN4A 3UNTA 3W7GA 4R53A 2ZE0A 4JQAA 3SCTA 1R5YA 3GIPA 2D2JA 2CKRA 2D20A 5DRIA 5LHEA 3M6YA 3S8HA 3U4AA 3M07A 1R3QA 4G7EB 3ARYA 4GC3A 4LANA 4J3UA 1H63A 2VFHA 4AW7A 3RUBL 1OEPA 1UC5A 2DT0A 3HO8A 4RW5A 1S2TA 3QEZA 1IXOA 1WDQA 3CAVA 2GYIA 2YDRA 4WLCA 2E77A 2G97A 1F61A 4GI9A 2HK1A 3CQJA 4BS0A 3ANVA 1R0MA 4AXNA 1F6PA 1K8ZA 1R86A 1V3HA 3QVQA 5TD4A 4Z2IA 4UOZA 2QCNA 5LIXX 4X2RA 1LQ2A 3RDKA 3QH2A 3LV5A 5DY2A 3CXOA 2GL5A 2WMKA 1WKEA 4O1DA 1E6NA 1VPYA 1P1MA 3KM8A 1OB0A 1BF2A 3KTXA 1NQ6A 2E5CA 4OJYA 3R8HA 3IJLA 3S3GA 4OE7A 3STEA 1FCBA 5AYYA 4F9JA 2YW4A 3GXNA 3H2OA 3N4FA 3CUHA 3QFWA 3U4FA 4AY1A 4ZBCA 3HPXA 4PBEA 3UW6A 4PUMA 3P8IA 1R3SA 4D6DA 2XH0A 1K02A 4S38A 3UR8A 3NURA 3MYOA 3GFYA 2RAGA 3TLLA 5C2XA 1NTHA 5F4WA 3W7RA 3ZR6A 2WCGA 3CC1A 1EZ2A 3AQUA 3R8RA 3G24A 3O1NA 4KRZA 2ZADA 1SR9A 2FMNA 2YCJA 2XU2A 1XC6A 4E2BA 1J8VA 3WH9A 2NWSA 3IJ8A 4QIUA 4W7WA 1BLIA 2XUCA 1O7AA 4DXXA 3BUVA 1TPWA 3GC5A 3I6RA 3WF1A 3QW4B 1GW9A 1LQ0A 2PC8A 2ZYFA 4LF2A 1MW1A 3WN6A 1R7AA 1UZ1A 1UWTA 1QWKA 1GORA 3LPFA 1I60A 3H2NA 3VZZA 1VB9A 3ZR5A 4NX0A 4PRTA 4M1RA 3W27A 3QZAA 4GUGA 4JX4A 3MV11 2VX6A 4LTSA 2WSPA 4PTXA 2XZ9A 1Q3NA 3OG2A 4IMGA 3HBLA 3THQA 1H51A 1W37A 3VD3A 3DHUA 1YNYA 5B80A 3ZVHA 2Y5SA 2WZMA 2VHLA 1VS1A 1ADSA 1IZCA 4PB3A 1SZFA 3TWBA 4DI8A 2CLLA 1MXGA 2X09A 3CPRA 4HZ6A 1JRBA 5AHIA 4GJIA 2YYUA 3IGSA 1LP6A 2NQLA 3S4TA 1E0XA 1UKTA 4CVWA 3PZQA 1AQ0A 1NWUA 3M43A 4D2JA 3CB8A 3W1PA 4WY0A 3GZAA 4FPSA 3IEBA 4AZBA 2A3LA 5CC5A 1A5KC 4EPEC 3DFPA 1QI0A 4V1XA 2V67A 3VZYA 2I1OA 3EB3A 3WF4A 3L4VA 3PZUA 3G1AA 4GI6A 4RE0A 2YR1A 4ZGYA 4HNOA 1ZBCA 1GHRA 2BNJA 1CENA 4FOJA 2J9YA 4JYEA 2A7RA 3SGUA 4TUFA 3W1RA 3MB9A 3VTRA 4A21A 3BAJA 8RUCA 1SSGA 1CPUA 4YTTA 4A2SA 2OEKA 4BA0A 1ZY9A 1J0HA 2NVDA 1JR1A 4PTNA 4TVUA 1FWHC 4QBXA 3DU0A 4JTKA 3DH7A 1C93A 5I06A 5C7VA 3O9NA 1LDCA 1TA3A 4F0RA 4Y90A 1B4KA 1GGOA 4YTUA 3UESA 3AMKA 5FI8A 1PX8A 2NQJA 1LL4A 3L0GA 4PUUA 1F6KA 2ODOA 2HDJA 1QMLA 1OYAA 4O17A 1L8NA 1FRBA 2WM1A 1XYFA 2YZRA 1H5VA 1GOKA 3WH7A 3Q2DA 3QSTA 3VOFA 2V3GA 2ZWYA 2VCCA 5MF5A 4JGDA 3K13A 4JQ2A 4GNJA 3CQHA 1YDVA 1HIZA 3WDHA 1NP2A 1DJGA 1EJ7L 1QCWA 3F03K 1PKMA 3VGBA 2CZFA 3NOEA 4AMCA 4JAWA 1KQYA 2DP3A 3YPIA 1OX6A 5EMUA 4L9ZA 3MJMA 4H9UA 3OLDA 2X30A 4RL3A 2ZX6A 1YIXA 3T40A 1POKA 1VZWA 4UQ9A 3UXLA 2VC9A 3DC8A 6XIMA 4KCTA 2REQA 2YCEA 2QYGA 4OBSA 4IJCA 3EOLA 2UV8G 3ZWTA 2C7FA 2ZRYA 2V6AA 3EWWA 1P6BA 4QDPA 3NZQA 1EA9C 4ZXOA 1KFJA 4RE4A 1TV4A 2GWGA 3U5YA 4BI5A 3M44A 3VGDA 1R2TA 2HNHA 3TOYA 2XFWA 4FIQA 1Q6EA 1K9DA 5BMXA 2CBVA 4P7NA 4H9TA 3HB9A 5EBUA 2D3LA 2CHNA 3GVQA 3L65A 4JTJA 2ZUUA 5BNKA 5JH2A 5K4ZA 2XN0A 1JPDX 1XXXA 1ZBKA 3CHFA 4G7EA 1FWEC 1OINA 1OGBA 4RX0A 3TONA 3WK0A 2I17A 3BLEA 3EA2A 3W25A 3OTRA 1VAHA 1XM3A 4M24A 3GRIA 4Q7IA 1XYAA 2W3ZA 3ISIX 1F8IA 5XIAA 1M7PA 3P60A 4ZSTA 4FX8A 4ACYA 1LBMA 3NQEA 3PP7A 2CLEA 3CGTA 1XP3A 1HP4A 1WP6A 5TQLA 1Q4NX 3P81A 4PTMA 3HV9A 3MHFA 2WCSA 2EBNA 4D1JA 1GOXA 1NEYA 3N17A 5CAKA 1EP2A 3TNBA 3GTNA 1P0BA 2GSEA 3GBDA 2GUYA 2ZTKA 3G1HA 4L80A 2QCMA 1LYXA 2ZC1A 2DZBA 3GZ3A 1FDJA 3W1TA 4BR1A 1WBJA 3IVTA 1G69A 3MMTA 5G1YA 4GVFA 3HG5A 1WO2A 4QSFA 1DWJM 3MJYA 3OLIA 3AXKA 4Z42C 1HNYA 1ICQA 1Q65A 2IXUA 4FX6M 4LS1A 1UP3A 1Z41A 4I3GA 4XKYB 3OODA 4AEFA 1PIGA 1JDDA 3P67A 3TYBA 3TC6A 2A21A 4Y9OA 3TSMA 2YFOA 1K1DA 2FZBA 3QRHA 2PD9A 1UR8A 1A50A 3PJTA 5E9AA 4FXFA 3IV3A 3EYPA 4HU0A 4H2HA 5FF4A 5LSMA 3THUA 2JQXA 1G01A 3LTPA 1VENA 1A3WA 2ZXDA 3GWQA 3KS5A 4PE8A 3ZLGA 3IS4A 3R79A 2O7QA 4WSKA 3VPLA 2FPYA 1FWIC 1VFOA 2V30A 1HXJA 3BCDA 5FL0A 1P5BA 4ZOBA 1KV8A 1AH3A 2OLHA 2VZSA 1HP5A 1KM1A 1GK8A 1K8XA 4RZ5A 1GOMA 4AVOA 4EF9A 2HE8A 4I9AA 4Y96A 2ON3A 4FNSA 4IP7A 1WZMA 3CL6A 1UUMA 3VKKA 2VUNA 3WD1A 2VFIA 1DWHM 3E0VA 3M5ZA 4WIWA 4JHOA 2XIBA 4JL2A 1UKPA 5GNYA 3MP3A 4UCFA 2YGYA 1MDRA 2VI0A 4GYFA 1A5OC 2D1ZA 2PDBA 3N2OA 3TC7A 4LCRA 1XINA 3TTQA 4W8BA 1JZ5A 2OLAA 4B5NA 2PBOA 5FF7A 2OYLA 1UH3A 4S1FA 4RXFA 4Q4RA 2DQXA 4W93A 2IQTA 3NIYA 4O10A 1EXBA 2GDVA 3GD6A 5M03A 2NQZA 4BCEA 4GFSA 1XIIA 2C1HA 4QAIA 3HG2A 3THAA 3AU2A 3NG3A 1IEIA 3M16A 1XIBA 2W67A 4PB4A 2GWNA 3S0CA 3TJ4A 5FEXA 7TAAA 2WWDA 1QR7A 4V15A 3SSZA 3F4NA 4CU6A 4GH3A 1CECA 3AAMA 5DXXA 4U28A 9RUBA 4CN1A 1BTCA 3VE7A 4QEEA 3P62A 3PS7A 3EXSA 3SCPA 4K6AA 3CUXA 4S2BA 4E2VA 1UH2A 1DJQA 3MY9A 2WC3A 2E6AA 4KEUA 4L7ZA 1GVQA 3VX0A 1J11A 2IPGA 5FF0A 4KBXA 2I5GA 3T0AA 1JQXA 2PAJA 4WJXA 1ITUA 1I2NA 1GHSA 1XISA 4OU1A 1J96A 4D8ZA 2ZZ2A 1EPVA 2Z24A 2WNZA 4KW2A 4JEJA 2F61A 4WKHA 1NP0A 2PE4A 3UD6A 1YYAA 1F5ZA 4P5UA 1MUWA 5BXSA 2WMFA 1QUMA 1E9IA 3UEQA 3EDEA 4DIAA 4FK9A 2J75A 4O54A 3B8TA 1ZQ5A 3THDA 2QW5A 4BQ4A 1DP0A 1F4HA 1Y5XA 1MSSA 3LPGA 4JNYA 4PMYA 1A0EA 1EBHA 4IXXA 5IBXA 5A8QA 4MY1A 1QDSA 2AQWA 2YLLA 3HQNA 4DZHA 3M5YA 3CZEA 3L4TA 4BJHA 1GJWA 5CZ0A 3WF0A 3BGJA 4M3PA 3COTA 2OMAA 4S3DA 2ZIDA 1XKJA 3B3DA 3OG3A 4R7OA 3KX6A 2BXZA 3RNDA 5TNVA 3BW4A 2D2HA 4HA1A 5I07A 3PC0A 2A7PA 2R9RA 1V93A 3RM4A 2GQAA 4OECA 3DKJA 1O6IA 3E96A 1UD4A 1L6WA 4JOMA 1UR3M 2H3BA 4MF4A 1QT1A 3LXAA 2XPKA 1NAL1 1T41A 1V0LA 3RG6A 2B7QA 2QIWA 4Z1DA 2HBXA 3HN3A 3IJDA 4EWJA 1HO4A 4GRSA 4WGHA 1UCWA 2PTWA 2OGYA 2VJXA 3S6OA 4FZIA 2Z4GA 3A3HA 3EEZA 3R58A 1ZCCA 4UC5A 1MFUA 1OY0A 3V5CA 1G1YA 5DELA 1WXJA 3MUIA 2E67A 5E09A 4YCOA 3W1MA 2A4AA 2G5WA 5T91A 3I4KA 1SO4A 3F2DA 3MTWA 3ZT5A 2P8CA 3CYJA 1H60A 1Q7ZA 1KM5A 1JFXA 5LYRA 3T0CA 3EMQA 2CZ5A 1TIMA 4LWWA 4CD4A 3PZMA 2ZX7A 2YCIX 4C5ZA 4X61A 1SZRA 1JGMA 1WKDA 2QXWA 3VKCA 3ANYA 2OZTA 2V5DA 4Q8OA 2PPGA 3WUFA 2OLSA 4BHYA 4XTDA 1OYCA 1V0NA 3BSHA 3S5ZA 2YBTA 2E09A 1VBGA 4MJ4A 3GH4A 4O1EA 2EKCA 4F4RA 1EKOA 3VOHA 4XKYA 3A4WA 4IXHA 3UCCA 4D6FA 5FJJA 5EL1A 4JTQA 3W29A 1XW8A 3WX7A 1YKWA 4DF2A 2ISFA 1AZ1A 1CB2A 2E4TA 3WNPA 1Q13A 3T08A 4YCPA 3ZJ6A 3S2JA 4YVVA 1C8QA 3CV7A 1TTJA 3G2GA 3FEQA 1EL3A 3MI3A 1LTDA 2V2HA 2TMDA 3BXWA 1R85A 5DBUA 1E4IA 3WDIA 5F1UA 5LNSA 3WQDA 4IGMA 4N42A 3M6DA 1AL7A 4HYVA 1E5JA 2X41A 3ALGA 2XVPA 3N29A 3WDJA 1T99A 4ES4A 1EEPA 3EX3A 2RDUA 2B0MA 4PMZA 3GBEA 1Y5VA 1JDAA 3KVMA 5E0KA 3OVGA 3QLDA 4CCZA 4MB5A 3W81A 4EXBA 3BLOA 3B4UA 4LCSA 3UJRA 1DIOA 3PUOA 3S9IA 1P0EA 4W7VA 3BAXA 2PGWA 2XN1A 1KWGA 4U3CA 3W7IA 1IV8A 1EX5A 1JZ8A 2D0FA 1KC7A 3H4GA 2HVOA 3AHTA 1XIHA 4G1KA 4GK8A 4MAVA 4JKLA 5TBOA 3C5QA 1P43A 3T09A 1GVYA 3NVDA 1TPC1 3BURA 5C5YA 2Q02A 2AL1A 3O05A 2NV9A 8CGTA 3GAKA 1LROA 2FVLA 2BASA 4HNNA 1JG9A 4MADA 1XH0A 2NUWA 1H0IA 3KZSA 4HKPA 2VC6A 5EMJA 1XFBA 3NSXA 4GVIA 4O57A 4JY9A 2DT3A 3TFXA 2A3EA 4HCHA 4W5ZA 4WOZA 1E6SM 4UFKA 1HO1A 1BHGA 3WNNA 4DXKA 4PCNA 1EGZA 4YIWA 5HATA 4RUBA 4CD5A 3PBUA 2DU2A 2Z7GA 2JALA 2WJZA 4BQ3A 5AHFA 3KRBA 2INEA 3JW7A 1TVPA 2NT0A 3CBWA 1V77A 1LL6A 1LBFA 4DXVA 2QDEA 4ADTA 1FDYA 2WKJA 1UMLA 3R0DA 4UZSA 2R94A 1GJPA 2VENA 2QV5A 4CNOA 3W28A 1S3HA 3VFCA 4J5NA 5DRCA 3ZJ7A 3IAPA 3AS3A 1W3IA 1NQKA 2HVNA 3ZT6A 2ZVIA 4I7VA 4FXSA 3SECA 1OFAA 1BSIA 5AYIA 4QLLA 4DPPA 1XYZA 2WJDA 4OKDA 4JFUA 5IBXC 2GSHA 1IE7C 4TU1A 2JKPA 2QJJA 3RO6A 4EPDC 4RNIA 4BZYA 1UD3A 3CL7A 1SW3A 2PWDA 1ITXA 2DH2A 3UU0A 1XSIA 3QJAA 1M65A 2FDSA 3WIJA 5KINA 1Z89A 4FF7A 3WQ5A 1W1YA 3Q67A 1XH2A 1QNVA 3SUUA 3MI6A 3PZIA 3NQ6A 3QTGA 4KWSA 3FK4A 4UTLA 1D8CA 2PI6A 3S46A 3AXMA 4IX0A 3BG5A 3VCNA 2F2HA 3S1GA 3LHUA 3A21A 5G4WA 3FEMA 2DH3A 5FESA 3V5OA 4F3HA 5BZAA 1SMDA 2CPUA 1A0DA 1RD5A 4JFWA 4ATLA 3ES7A 1M5WA 3E2VA 2EHHA 4FI4A 2CERA 1J93A 3VZXA 1XLAA 4FLRA 3GXMA 5JU6A 4AF0B 3CM4A 4A4AA 2G3FA 4IPJA 3SRKA 2DJLA 3OQ8A 1R47A 3R13A 1NJJA 1A47A 1H7OA 2JFEX 3G1SA 1TZZA 3NAVA 3W7MA 2WK2A 3FVMA 3EPMA 1BTMA 1EJSC 4KCWA 3F1QA 3ANUA 3PBGA 2Y63A 1XLDA 4GE8A 5C9RA 4AMAA 1VCFA 3T1GA 2XH2A 1E56A 1MW2A 4TVDA 4HTYA 3K8LA 4JHZA 1NFBA 4J3ZA 1QASA 3VDGA 3GFXA 4JTDA 3ARVA 2WNNA 4JCLA 1CI1A 1ITQA 1DQXA 2FTWA 2GQ3A 3E0WA 4FO4A 2A3CA 1WQ5A 4LNYA 1VIZA 4OV4A 4WQ6A 4XQ6A 2WKLA 1M3UA 1CGVA 2E5BA 1J2BA 2WMIB 1QO2A 3ELFA 1SU5A 1FFQA 1H49A 1TSIA 2C91A 2GUUA 5D2VA 4MWAB 4I8DA 2ZA3A 1GEHA 4XZHA 1S5MA 5M2FX 2PWEA 4NZ3A 4FB7A 3W2NA 3LNMA 3WH6A 2AMXA 2MANA 5D09A 4LW7A 1YTEA 5GJNA 4X60A 2B7NA 1JZ2A 1JZ4A 1UWUA 3N6HA 3M7SA 5FJTA 1VKFA 4DF1A 4I8YA 2XSAA 4ENLA 2FZMA 3W74A 1VBJA 4IWWA 2W6RA 4JYDA 1GKPA 4C5YA 1K70A 1JYWA 1PX4A 2X1IA 5FACA 3NVTA 4O18A 5CPLA 4X63A 5CJNA 2FTYA 5ABFB 4NXSA 2BMBA 3A6OA 2VQUA 3ARQA 4YWIA 1JD9A 3LY0A 4K68A 3DEQA 3SQMA 1M7OA 3MP5A 3SURA 4TV6A 3AXHA 4Y9MA 3CQKA 4ZENA 2DT1A 4AX7A 4C6KA 2YL9A 1QOXA 3PTQA 4NNAA 5D32A 3FW6A 3GG1A 3MUY1 4M7TA 3N13A 3WBYA 3SW6A 2DZPA 1E15A 3L4WA 3W72A 3GW3A 1H7NA 3W7EA 2H90A 1M7JA 3M4HA 3XISA 1MEHA 3GU1A 1XDJA 1EDQA 3UJFA 3VM7A 4NU7A 2A0NA 3E9AA 2CLKA 1QATA 1I6NA 3ITXA 3KOYA 5HDRA 3LHYA 3KTSA 3B8WA 3ZS4A 1H7PA 5D2WA 5CPMA 3VDAA 2FGLA 2XVKA 1GOQA 2ZICA 5LHFA 1DIKA 4J4KA 3REQA 3CO8A 2EG8A 4BK9A 2UY5A 3DZ1A 5LZLA 4PMQA 1ZAHA 1T7LA 2QQ6A 2WLYA 4WGXA 3CHEA 4R33A 4XZIA 1ODZA 1W8GA 4R7WA 2J66A 3UPMA 3WUEA 5C0QA 1LCOA 3MZ2A 3H6OA 5SWUA 5I23A 2WV8A 4JCMA 1IT8A 1AH4A 1SGJA 3T8QA 3NXLA 5AHEA 2DW6A 2G41A 5I3DA 4ERIA 3CV2A 3POCA 2W0UA 3BARA 3OW1A 4K39A 4LYKA 5T8GA 4HNUA 3U9IA 4DJEC 4HGXA 4JTLA 2YL5A 4W88A 5EFDA 1TX0A 1H1NA 2J7FA 3NXFA 3AHVA 1JPKA 2VEGA 2GQ9A 1JCYA 4FSAA 1EBGA 3SN1A 2ATMA 1KBJA 1PDZA 4O8RA 3WMSA 2D22A 1TV2A 1YQ2A 6PTDA 4DAFA 5BRQA 2QJNA 4AY7A 3MDWA 6TAAA 1MNZA 4PMOA 2P1FA 3QM3A 4CNNA 1O5XA 1NFPA 1X6NA 3KXQA 1EH9A 4IX2A 4O0KA 4F2BA 4NRRA 3R11A 1W6TA 4ZE5A 4R27A 4JQ1A 3CWHA 2PUZA 4QE1A 1UB3A 3WLIA 2F6XA 4Z1BA 1CW2A 3W53A 4MLJA 1F3EA 5I3IA 3N2BA 3WLOA 3G1RA 4JN8A 3W6LA 2Y6ZA 2E40A 4IMAA 3BMVA 2EPLX 3DESA 1JI2A 3IJ7A 4L4PA 3WY1A 2PRHA 5HOSA 5A8OA 3M46A 3M0YA 4LPCA 3PNZA 4PEKA 4EANA 1EXPA 2HROA 1QI5A 2HISA 4GQGA 4RDVA 1W8SA 1DBTA 2GFTA 2HK0A 2NUYA 3MKKA 4DWSC 4DYEA 2EPHA 4NZJA 5LA1A 1BXCA 3VNMA 2DGAA 3HGJA 3ZIZA 4Q6JA 1IGWA 4NX5A 2XJ7A 1SYTA 3HFYA 3W24A 3JS3A 3MHGA 1S5TA 1UWSA 1ZSXA 3TK7A 4JNMA 1QI3A 4TV5A 3ZJ8A 2Z25A 2ZUWA 3AS0A 2E68A 3BLFA 4Z0SA 1UR9A 4WKAA 3SFKA 1VRDA 3TAOA 1TV5A 4XZBA 1BD0A 3DBNA 3PULA 4IQEA 1XLCA 2P10A 3WUBA 1EWDA 3MANA 3CIWA 3LMYA 2ZWZA 5HR7A 1N55A 3NYZA 4HIBA 1QW8A 3DG7A 4IL2A 1R46A 2ZX9A 4ORMA 1KWKA 1B90A 2NQ5A 3LPPA 4AF0A 3IUDA 1E4NA 4NZ4A 1JNEA 4L1GA 4JD4A 1Y0EA 5A8NA 1AQFA 2W63A 3W0KA 2PTDA 3BO9A 4HK5A 3KBJA 3WJZA 2FTPA 4C6FA 5C9WA 4Z2JA 3B8DA 1NF0A 4DO6A 2WBKA 1NELA 3A3XA 2BGQA 1DJNA 1XL9A 4PA8A 4HNLA 2NX9A 2WC7A 1U83A 2HXUA 1SR0A 1XLJA 4ZTXA 4DUXA 3EA1A 1QNPA 4NZCA 3IUIA 1FHLA 2PTXA 4J28A 3KE0A 1FWFC 1RP8A 3KW3A 3L9CA 3F4VA 4TX8A 3EOUA 1X1ZA 5A2AA 3WNLA 1MO0A 1TWIA 2JF6A 1F2JA 3T7VA 3THCA 3BDKA 2WW5A 1L2UA 1TRIA 2XDFA 4N6FA 4JFSA 4M51A 2WMIA 4IIGA 5LIUX 4MIMA 1ZJIA 1OCJA 1WPCA 1W5QA 3O7UA 4MWAA 3V16A 4K8EA 1HKKA 1X96A 1EX1A 1K9TA 3GDLA 5A6LA 5CGTA 3TROA 3GQYA 4XZMX 2CETA 3I7RA 4H8NA 5G1TA 3BG9A 3CMGA 3MSRA 1XRTA 2VCAA 4G1NA 3UCDA 3VK5A 4R34A 5BRBA 4W89A 3N14A 1WCGA 4ROPA 4RNHA 4AHQA 2ACRA 2QNEA 2PODA 5ABFA 3W7OA 1BVNP 2RDWA 4QDMA 4NI8A 4RZ6A 4K7YA 1MQRA 4OUIA 4QTGA 4X22A 1TWWA 2OYKA 3H54A 3TYDA 3BQ5A 3PUEA 5BXRA 1UWQA 1UBSA 3W7NA 5A1AA 3UZYA 2NQHA 4JBRA 4YJ5A 3PJWA 3SY5A 1RALA 4C90A 1W3KA 1KA9F 1JQVA 3L4YA 1ZS2A 1QHOA 1HVXA 1LF1A 4MSSA 1EIBA 5AFDA 3QW3A 5AVHA 5CPQA 1OIFA 1I1WA 3G5EA 3EWDA 2VGIA 4OBRA 4WJEA 2DW7A 2XISA 4GG9A 4MB4A 3H2CA 4KS0A 4S3GA 3GIYA 1TTQA 3VIHA 3JR2A 1UKQA 4AWTA 3WBWA 1K9EA 1OG6A 1D3CA 1DJIA 3NO3A 1CXIA 4ZO6A 5AKQA 3B4YA 4AIUA 1UA3A 4OTKA 2DSWA 1G4TA 3TYZA 4Y7EA 5J5RA 3VCRA 1YPIA 4MPKA 4W86A 5E93A 3KRZA 3UWQA 3WH8A 1R7OA 5HWJA 3ABZA 3IARA 4Q4PA 3KOZA 2QV4A 1KW1A 2OCZA 4Z08A 3WENA 2P0IA 3M0JA 3TN4A 2PTYA 4XAYA 3NPXA 4OT7A 1IWAA 3CZGA 2G0WA 1NVMA 4ONVA 3H7VA 4AWSA 3C56A 2WVUA 1X1OA 1HJUA 3V0TA 1IZKA 2XVLA 1B9BA 1ONWA 1LRTA 3GHSA 3LHZA 4WHBA 4LRTA 1JF6A 4MNKA 1H5YA 2C8NA 2RHGA 4OWGA 4A3YA 4DHGA 5BXPA 1C9WA 2XM1A 3EKZA 1OZQA 4TMCA 3GNDA 3TW7A 1FXQA 1US3A 4KPLA 3R1ZA