1ZPTA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
271
Chain Sequence
HASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 93
structure length 271
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zptA00
3IJDA 4JNYA 3E2SA 1V93A 1ZPTA 1TJ0A 2FMOA 1ZP3A 1TJ2A 2FMNA 3FSTA 3ITGA 3E2QA 3E2RA 1ZRQA 1ZP4A 1B5TA 4O8AA 3APTA 3APYA 2FZMA 3FSUA 1TJ1A 1TIWA 4JNZA 2FZNA
chains in the Genus database with same CATH superfamily
2XTKA 2X30A 4W89A 3TTEA 3HM7A 1BEUA 4LYPA 3UWYA 4QR6A 4C90A 3SJNA 4W9TA 3IJIA 3FK4A 3HTWA 3S6TA 3V5OA 2I16A 4QG8A 2J7DA 2IXUA 4GUFA 2DZUA 3PZQA 3VD7A 2NUXA 4DJFC 1EXBA 4KEZA 2DVXA 1QNQA 3B0XA 2X0SA 3RXZA 3UR7A 1POJA 2QJGA 3YPIA 2CXGA 1V7AA 4O8RA 2OWWA 2OYLA 3CC1A 3NYDA 3SURA 3TZFA 4S3CA 3P67A 1X8CA 3NAVA 3R1ZA 4AY8A 1S1PA 1XH1A 5HOSA 1X6NA 3QF0A 4D6CA 2DV0A 5F2IA 3L65A 1QI2A 3TC6A 3W82A 2NVAA 4IFOA 3ENLA 2HNEA 1EDGA 4WF7A 4U10A 4IMEA 2J7CA 1X96A 5HNNA 4WOQA 1ADSA 1PV8A 1A47A 4GZEA 3TFCA 4M19A 1EDQA 4WGXA 3R6IA 4JL1A 1DWHM 1JCMP 4CQAA 1XKYA 4PE8A 2W67A 4WGHA 3W1QA 3NPVA 3RFAA 4J3WA 1QHOA 1M1BA 4YN5A 4AF0B 1ZB5A 1X1NA 1FH8A 2H8ZA 3DHUA 4AZHA 4FOJA 4N2YA 3TC3A 2WSYA 4LX4A 3N15A 1UBPC 2J88A 4CN4A 4MDPA 7A3HA 4I7VA 1OK6A 1VHNA 2A7RA 5EFDA 2ZRXA 1TMQA 4UOJA 1PTGA 4JR5A 5MKGA 2D2JA 2Y8UA 1J0ZA 3WQCA 3H7UA 4HNLA 3AFBA 3SCSA 3L4XA 1NELA 2C91A 1S2TA 1GUVA 1OCJA 4EANA 2W62A 3DC8A 3AIRA 4MZ8A 1FH7A 3WQ4A 3WUBA 1WPCA 3W7CA 4MHBA 4K8EA 5CJMA 4CUCA 2VDGA 5BOEA 4HPGA 3LQLA 1RP8A 3UW6A 4PTWA 3PFRA 4IQEA 1VFTA 5HPOA 2DSKA 4RX0A 4P8XA 3T0CA 4E2VA 3CHEA 2QJIA 1GVFA 1IR2A 1H7XA 1CPUA 3ABZA 3QW4B 6XIAA 4FLOA 1EGVA 3TOPA 1OX4A 3WH8A 2J8FA 3UWUA 5PTDA 1LQ0A 1KV5A 4LRSA 4PC8A 3ATZA 3EMQA 1E43A 2QCMA 2O7QA 4GINA 2QCLA 1Q85A 1BLIA 4GY0A 3WX7A 3AIVA 4C1NA 3PANA 1D9EA 3UZXA 4UQAA 1EIXA 1Z8AA 3M44A 2QXWA 5F7UA 3GRIA 3EWDA 3VO0A 3SUWA 2G3JA 2TPSA 1KCLA 1BG9A 4KH2A 1KV8A 4ZODA 3S1XA 3ZR5A 5FOOA 2E4TA 4I7WA 4OV4A 5I77A 5JH1A 3TUUA 3PVFA 1XRTA 3EBVA 3WL0A 1OFPA 1OGSA 1WV2A 1YTEA 4AEEA 3UCDA 1EOMA 2E77A 4RE2A 3U4FA 3P60A 4LT9A 2GL5A 4HA1A 3UT0A 5SWUA 2R1PA 3N04A 4L5ZA 1TJ0A 4JGDA 4CEUC 3DFOA 3DFNA 3KL0A 1V02A 4EOUA 4HZ8A 1CGXA 4F0HA 4JD4A 1VBRA 2PWEA 1M7JA 2ZDRA 2V5JA 1XYBA 3LBMA 1HO1A 2DZWA 2OR2A 2VQTA 1HP5A 4EIVA 3TR9A 4AX6A 1K7EA 1VIZA 3THAA 2F6UA 3TNBA 3CUGA 4HN8A 4MJ2A 4FNUA 4M80A 1XLAA 2WYSA 1M7OA 1XLBA 4E38A 3BANA 2NX3A 1Z7AA 3IIZA 2UZ9A 3TQ0A 3HU7A 2E8ZA 4XVEA 1HKVA 1DJQA 3QMTA 2FHCA 4FXSA 1PIFA 3DG3A 1MQRA 1UYQA 1E3XA 1W9UA 3QHNA 4DAIA 4KRZA 3U6WA 1BRLA 1E9ZB 4JTTA 1GOKA 1ME9A 5T26A 5LHEA 1R3RA 4GJIA 4AHOA 5CEWA 2EJ1A 1DWFM 2E0PA 3FEMA 2OLAA 3KLKA 1HXJA 2Y5EA 2VZTA 2QCGA 1VRDA 3GBEA 1CDGA 2I9UA 2YFNA 4QNWA 3WFLA 3R8HA 1RP9A 1BQCA 3OYXA 9XIAA 5CBJA 5BMXA 1DXEA 1DJZA 4RXFA 4IGSA 3TMLA 3MKVA 4I8DA 5I7GA 4UFLA 1UD3A 3N2OA 2BBFA 3U3HA 1O68A 3QV7A 4HK5A 3CLWA 1HO4A 2Z4GA 1BXNA 3GZ3A 5C7HA 2IPGA 2O56A 1RQBA 4CU6A 1EC8A 3NFUA 3G1FA 2X2YA 4LAMA 1I2QA 3H2OA 3O3RA 3OA3A 4H9MA 3CAKA 1KNWA 3GY1A 3GNXA 4E2OA 2Z00A 3W7HA 3TWAA 2NWRA 2BB0A 2KZHA 4O13A 4DBUA 2GVYA 3CXOA 1RBOB 3A5FA 4GOAA 4HMCA 3MWAA 3TSMA 3CZKA 3EDDA 1E6SM 3L4ZA 4Q3MA 3BTNA 2AMGA 2P50A 1O6IA 4FB7A 3PTMA 3TE9A 3TU9A 4LV4A 2OYKA 5HMFA 3VIHA 2C79A 3H4GA 4LCRA 4LUTB 1UWIA 3LCIA 1JEZA 4K8HA 1H7NA 1RD6A 3IVTA 4KESA 5GNXA 4RE4A 3HQPA 1ALDA 3PJXA 1WOAA 4WSHA 1ZAIA 1EDTA 2Y7FA 3NDZA 4NP7A 5FCZA 3FJLA 3N14A 3NQVA 4HA4A 4PMJA 2E6YA 4LSBA 2EG6A 1FWDC 4PCTA 3GU9A 3ARWA 5CC6A 3THCA 1IQ8A 1MW0A 3NL5A 1V0NA 4YIWA 3UZWA 4J3UA 1V3KA 5REQB 2WJZA 2RDUA 3I7SA 4PR4A 3FYPA 4H9XA 1E4NA 3EXRA 1P0EA 1VFMA 4GC3A 4WD0A 3HN3A 1OFBA 4X2PA 4GJ1A 1AJZA 3V7PA 5K7JA 4WXYA 1ZCOA 4WZHA 2DQWA 1B9ZA 3WELA 4Y8FA 3WLOA 1VIWA 1P6CA 4Y96A 1GOXA 1UKQA 3SJ3A 1PZ3A 4Q8TA 3QKEA 3BK0A 1KM4A 2QGHA 1FWWA 3VC5A 1GOOA 1AG1O 1Q6OA 3WDIA 2WMIB 3GFYA 4I6KA 2FIQA 3PPFA 1IHIA 2FTYA 2W61A 1FHLA 3E12A 1NWTA 2QMKA 1W1TA 5CAHA 2VDHA 1ITUA 3U2CA 2ATMA 1QI0A 1XQKA 3K1DA 2XFRA 3B8SA 3OJGA 4AY7A 5HQEA 3CGTA 2HPMA 1DTNA 1ONXA 1WAUA 2A6NA 5LXEA 5J04A 4N4QA 4K38A 4RNHA 1T6MA 5CSUA 3S9IA 1WUEA 3BMWA 1CGVA 2H3BA 1F7BA 4WCJA 4S3GA 2W4XA 3PNUA 3FVMA 2OOGA 2H9AB 3B40A 3AAMA 4DZHA 1V7YA 3DYMA 1GJWA 1Y8BA 1PIGA 3N25A 4PL1A 1Z32X 4E2BA 3NM3A 3O15A 1OFRA 3G1SA 1A5MC 2EPMX 2J7BA 2PWHA 3NA8A 4LBUA 3S9ZA 3W25A 3H2NA 1DVJA 1EZWA 3D47A 4AB4A 1FFRA 1E0TA 3BWWA 5D2VA 4F66A 3MI3A 4PUDA 1ZHAA 3FA4A 5CZTA 3PULA 4DXVA 3IANA 4F0MA 1HT6A 2CHRA 3OBKA 1R87A 3DYPA 1JUBA 4YS1A 1XQLA 3QV8A 5CGTA 4JZ5A 2EKGA 2R1LA 3ES8A 3S3GA 3EDFA 3VCNA 2H3DA 3VD9A 3GNPA 4M5PA 2WNWA 2ZE0A 2OLSA 1DTUA 3URAA 2J77A 4C1LA 4H04A 2IQDA 4A05A 5AFDA 4U3CA 3QR0A 5TNVA 2VGGA 1S5WA 1Q5MA 1E1CB 4D6GA 4DWSB 1PZ0A 4CD4A 1LBMA 1J2BA 2IKHA 4P8VA 5CSYA 4HU0A 4G1NA 4FHAA 4HHPA 2ZUVA 2XYLA 2MANA 3H4XA 2E5DA 5DQPA 4O10A 3RCNA 5G4HC 3H70A 5IDIA 3VDHA 5I00A 3EMZA 4QM1A 4TVUA 4O1DA 3LHWA 3B8WA 4L4OA 4IICA 2E5BA 4XZIA 3K2GA 1L9WA 4XUYA 3T9PA 1B4EA 3UXIA 2EXOA 4NZ3A 2BS9A 1P0DA 1RK5A 1AK5A 3G3MA 1XRSA 3IIVA 3W87A 2VFIA 1OFEA 2HS6A 3AYRA 4S2CA 1GQIA 2C0AA 3VGBA 2CERA 2PS2A 3VD3A 4QS6A 1HGWA 3TTOA 3IARA 2VX4A 3W7DA 4UTLA 2HE8A 1VD6A 1LL4A 1TPUA 1XICA 1B3ZA 3W00A 1BD0A 3AMCA 2P1FA 2REQB 5I3IA 2C18A 2OSXA 1RBAA 1KXHA 2Y88A 1IWBA 5HR7A 1F3EA 2FVLA 4PB4A 3T09A 3B04A 1PZ1A 5CCZA 3G8EA 3W1XA 4L9YA 1YNQA 4N0RA 1LOQA 1XGZA 4AF0A 3VGHA 4O0KA 1NWRA 1U5HA 4NRRA 1TWZA 2YW4A 4BK9A 3IVSA 2E9MA 2ISSA 4PUKA 4IMFA 1DIOA 3I10A 1UBSA 1U22A 3TJIA 2PLKA 3ITTA 3RLHA 1QTWA 1A5UA 3DI1A 3EB4A 4P8WA 3C56A 1TE6A 2GUUA 3TNOA 2AQVA 1QI3A 4CNTA 1TPDA 1XS2A 4GUIA 4P2VA 1E55A 1ZBWA 1HJQA 1W5OA 3N18A 3BSMA 5CZSA 2ZIDA 3FHAA 3H55A 3S1VA 1TUFA 2D69A 3VNYA 4KEMA 5I02A 1FHUA 1TTIA 3KEHA 3PJTA 1UWQA 2A3LA 2FJUB 5E09A 1EC9A 4UMCA 3RRXA 2AKZA 8A3HA 1A5LC 5HK4A 4DO6A 1GG0A 5B80A 4HZMA 5A3HA 3KDOA 3MSYA 3THQA 4JX6A 2DW7A 4L61A 4F40A 1RA5A 2WC4A 3DOPA 3N19B 1A3WA 1VF8A 4OHQA 1S46A 3C0SA 3VKJA 3J7HA 5KITA 3GR8A 1KGXA 1G0CA 1OWQA 1LCOA 5IOBA 1FA2A 2EF9A 4GQGA 1BKSA 1MDLA 2P10A 1VCGA 3WLIA 4I5UA 4ZFCA 4Z2IA 4ZQNA 3E2QA 5F1VA 4P7NA 4AZGA 1GTEA 4XAPA 1PS9A 4HQVA 3CBWA 1H63A 3VKKA 1V08A 3AICA 3JZUA 4F3HA 1YKWA 1VHCA 1QPNA 2OT1A 4HA0A 2ZUUA 1PX3A 3ZSSA 2TODA 1P0KA 4CQ9A 2DORA 2NXHA 4RDVA 1FWRA 1FWEC 1AVAA 5CSRA 3KM8A 1X39A 4GCAA 2I1OA 3ZFHA 2H90A 3RYSA 3KBNA 1SW7A 3PZOA 2X1SA 5H91A 2HNHA 1EIBA 3OVGA 3CL6A 1ZL1A 3GDLA 3LXCA 1H0IA 2WSRA 1LL6A 3PK7A 1TWWA 2VEFA 5AC6A 3WDQA 1U5JA 3ARQA 1T41A 2EG7A 2RDTA 1RR2A 2CHOA 3E9AA 2VOTA 3RM4A 3STPA 1FP8A 5H8UA 1UMLA 4L1XA 1QR7A 2PU1A 1EJUC 1SW3A 1W1B1 5FA5A 4KCVA 3LCWA 2PDHA 2Y7GA 1ICQA 2J66A 4ORIA 3CL7A 5DANA 1ISZA 2ZE3A 2EAWA 3LNPA 3GC5A 5A1AA 2BOGX 4ZL1A 3DH7A 4UNKA 3R8GA 4AYSA 2VEIA 1HJVA 3H54A 3OBAA 4HOXA 3GLCA 4AEOA 1UKTA 2B81A 1LZOA 2YCLB 3CHFA 3L5LA 1FFQA 4LVGA 3IVUA 1VYPX 2ZTKA 4M6UA 2V3GA 1K03A 2HV5A 3DERA 3CMJA 1E5JA 3WCZA 3K8LA 3WDJA 1O66A 2OZTA 3LG3A 1J18A 4Q7BA 5JIWA 5FJRA 4C6NA 1VFOA 2YGYA 4KIEA 3PG9A 3DEQA 3QM3A 4DBSA 5AC5A 3GNDA 1JXJA 1UUMA 4M6PA 3D46A 1C7SA 4G8TA 4Q4RA 2XGZA 1DXFA 2PGEA 1E6ZA 1AJ2A 1IT7A 2YL9A 5K9XA 4F0LA 3QY8A 4M8UA 2XVPA 3QZEA 4D1JA 3WNPA 3K5XA 2J79A 3N4AA 2NSOA 1PB0A 2GJRA 3PTDA 3CPUA 3QPZA 1AMYA 1A0DA 3QN3A 5CKSA 3F5JA 3PZVA 5A8PA 2PP3A 2ZVIA 1MI3A 1WBHA 3AALA 3HMCA 1SFJA 4PSPA 3VKBA 1PX4A 2NT0A 3VZXA 3G18A 5J5DA 3CH9A 2G37A 2XM2A 3CU2A 2D20A 2G4FA 1DXIA 1ZBCA 2HXTA 1F07A 1A5SA 4ZOBA 1UJQA 3FSTA 4JDBA 4W7UA 1J0JA 3WD3A 1LUCB 4LUTA 3AUJA 4GYFA 4DZ5A 4ZQOA 3H2MA 3GXTA 4NJKA 4NU7A 1JYWA 1KQZA 1BWKA 3DFSA 3OB8A 4C6IA 4O52A 2HROA 3UY7A 3BV7A 5A2BA 2PRHA 1HL8A 4MWAA 1UW9A 4XO7A 4PH6A 1KD0A 2Z1VA 3RM9A 1U1JA 3UZJA 3MHGA 3M64A 3EWUA 2ISFA 2ALRA 2CXEA 1MQQA 1OGBA 1VCFA 3PTQA 4UR7A 2BG5A 4IQLA 2XH2A 4I5RA 5AKQA 3SEPA 3UWEA 1SYTA 2DGAA 1BHGA 4LANA 4PRRA 3WK1A 3BLDA 1TV7A 4X0VA 3DKLA 5FI8A 3W7EA 1LL7A 3SRKA 1GKRA 3OZOA 1H7PA 2PLMA 4K1GA 3GG8A 5BU6A 3VUPA 4UTIA 1V3LA 3MW7A 1HX0A 3S6OA 5RUBA 3FDGA 1E40A 4OWGA 3AISA 5FESA 4DUOA 3AMLA 1AW5A 2A5HA 5LA1A 3LCFA 3L4WA 3QY6A 4HNVA 1W8GA 4H4IA 3W88A 2QF7A 1H61A 3W02A 1QNVA 1T96A 4MUZA 2WJFA 1NF7A 3EWXA 3F4CA 2WMIA 1RV8A 3REQB 1J11A 1GEHA 2IUZA 3U5UA 1B0IA 3BSGA 2HXUA 1K1DA 5M03A 3QOKA 3LLXA 4WSJA 2V5DA 3LCXA 2VC9A 1M7XA 4AG0A 1JAKA 3RU6A 3VXGA 1QWKA 1Q65A 3BG3A 4KS0A 4TX6A 1R0MA 2F7FA 3CHDA 3AZTA 3RUBL 4HTBA 1RALA 5CJ5A 4RV8A 2A6LA 3MT1A 5D8WA 4X2RA 4Q8NA 1UP0A 1ICSA 5AZ1A 3W22A 2ZUMA 4JIPA 5HWMA 3TLQA 3CZLA 1P1XA 4UQEA 1UROA 2C3ZA 1UQZA 3WQGA 1JGIA 1W5MA 1XYLA 3CV1A 4JTRA 1KWKA 1L2QA 3V1HA 3HFYA 3EPMA 1B31A 2QJJA 3VAVA 4S1FA 3L5AA 4GIRA 1UD8A 2EPOA 4UR9A 5DCEA 4O16A 2E28A 4JQ4A 3KOFA 4P8UA 1H5VA 3KZSA 4QJ4B 2FMNA 2J7FA 3RU8X 2VGBA 3W1RA 5IRPA 1XLEA 2ANUA 1Q4WA 2V81A 1HQTA 3CYJA 1MXSA 1JVNA 4XQ6A 1VBGA 5A8MA 4NVTA 4YCPA 5D9MA 1OD0A 4HZ7A 3GXNA 3MV11 8CGTA 1XRVA 3WNKA 1CB7B 1NY1A 2OQHA 1HIZA 1S3TC 4JN7A 5L9FA 3W71A 4JYEA 1UJPA 4GO9A 4WVXA 3PJWA 4TQTA 3WLQA 2CLPA 3G1DA 2FHFA 3FYYA 3DECA 5M2FX 3HG5A 4H01A 4U4MA 4CQ8A 1TB3A 2OFJA 3WEMA 1MEIA 3N2XA 4MVAA 1E1CA 2PWGA 1V6WA 3HPAA 3VM5A 1CZ1A 2QUVA 1EP3A 3BC9A 3ZR6A 5A6TC 1JZ2A 5CZKA 1UD4A 3GFXA 3IEBA 2XZ7A 1JL8A 3OBEA 1S2AA 1B3WA 1CXIA 2BFGA 3FXGA 3K13A 3RM8A 3CB8A 3CAVA 1KBJA 1GGOA 5M5DA 4QJ3B 4JQ2A 3U5YA 1ZSXA 2J8GA 3PB2A 3W72A 3ALGA 4DQWA 4LS0A 1BFNA 2ABAA 2CITA 1TVNA 1E4MM 2XDFA 3NQ2A 2PPGA 3AXMA 5EMLA 3S4TA 1ITXA 4URIA 2PLJA 4ZVJA 1ITCA 2REQA 3LRMA 2BY1A 1YXDA 2ZRVA 4FLQA 4DHGA 3TTQA 1EUAA 4RDWA 1QO2A 3MI6A 2FPTA 2QCDB 1JZ5A 1OFQA 4YTTA 2JEQA 1A80A 2QUMA 2QHAA 1S39A 3UJFA 3WD4A 4Z0JA 1C91A 3BJTA 4IT1A 4JTEA 4ZE5A 2IPWA 5FF2A 2HRWA 5BWAA 1S2VA 4TUFA 3WEOA 4GHRA 1ZQ5A 3NQAA 5EB8A 3G2GA 3CIVA 5JU6A 2ZX6A 3ITVA 1R5YA 1YMYA 2X1IA 3DBNA 3NL6A 3PWGA 1XIDA 5T9BG 2YL5A 3KBVA 4QEHA 2VFHA 1YBQB 3SSJA 1UWAA 3N1AA 5U4NA 4JX4A 1VFUA 3TAOA 2ZUNA 2WM1A 1B3VA 3HQNA 4IG2A 1JD9A 4OOZA 1C8YA 1ISYA 5F2LA 1JDDA 4N9DA 4MWAD 4ECLA 5H6HA 3P62A 1HL9A 3UR5A 1AH3A 1IZKA 1DIKA 4NI8A 3B8IA 1XC4A 2J27A 4IJRA 2OZ8A 2QQ6A 2VM8A 2E68A 3W7JA 1M9HA 1E6NA 2BGSA 2NWSA 4M56A 3R94A 1XJBA 4H2HA 4JQ1A 3GVWA 1GQNA 4O4WA 4JBRA 3G1YA 2VR2A 5LYRA 5AYXA 1TFVA 4NAEA 4DELA 1IYXA 2RDXA 5T9CE 5EGRA 3SCPA 4MWAC 3V1PA 2OQLA 3P81A 3KP1A 2X1RA 4ZB0A 1FX6A 4RJEA 2XZ9A 2QUUA 3GG7A 1J93A 1FWBC 3GXPA 1IR1A 3M0KA 3K4DA 3MZNA 4KWSA 3H24A 1KRMA 1QCWA 4PMOA 2X1UA 3VCRA 1FCUA 1E56A 1P5BA 3G1AA 1KO0A 3IPWA 3WNMA 1NU5A 2YBTA 4JY9A 4MIMA 1D7FA 5I3DA 4J3ZA 3CH0A 4B16A 1S2CA 3CZEA 4DLMA 3CIWA 4J7RA 5CBBA 3PBVA 1TSIA 3S2MA 3U4AA 3LMYA 1UWSA 6ENLA 3S1GA 1F5ZA 2OSYA 2BV9A 3M0VA 3BZGA 3WJYA 2VRQA 3T0AA 2V3FA 3WLPA 1EHAA 2V69A 4EXQA 3HGOA 4Z2JA 3VPLA 4FALA 3L4TA 2FFCA 1H09A 3F7JA 4JYDA 1RCXB 3GXIA 2X16A 5C9UA 5G1MA 3T1GA 1CGYA 3LTSA 1YE6A 2ISVA 4JFUA 4QXIA 2NQZA 2DT1A 4B5WA 3U48A 3OVRA 2D2OA 2GDQA 3KBWA 2ACUA 3NL3A 1D8WA 4N9EA 1ZJIA 2E40A 3TOYA 3VUSA 2W5FA 3IJ7A 5JBFA 4HNTA 3P82A 3F4WA 3LHZA 1JPDX 3VCCA 4S2BA 3PAOA 1J5SA 4JQ3A 4ZO8A 4AUBA 1WZKA 2VZVA 4GFIA 5HR6A 2V67A 4WDTA 3GYCA 4NJGA 4R33A 1SW0A 3TX9A 2AAAA 2VUNA 3GR7A 4DIAA 3EWYA 1T8XA 3I4KA 3RR1A 1OC6A 4OBSA 4GX8A 3BQ6A 5LIUX 4IP7A 1Y5XA 2YR1A 2PTWA 3SO7A 2UBPC 3AHYA 4IJBA 4HSNA 1XV8A 4Q32A 4XUGA 1NFPA 1JCXA 1MYRA 1F61A 2E6AA 3GTIA 1W9BM 1TREA 3DFPA 3R5EA 3TQVA 3IGXA 1OGGA 3KCLA 3ZVHB 4OIFA 1XWYA 3WJWA 1V79A 3VILA 3MVIA 4M6QA 4N6EA 3W4RA 1Q6EA 2OWXA 2ZRWA 2DT0A 4PMVA 4XZMX 4EE9A 3OU8A 1FDZA 2FPVA 3BG5A 4IUOA 3M0ZA 1NTHA 4GXWA 1ADDA 3VIKA 3GR4A 3KBMA 1Q6FA 4UTTC 4EXBA 1KCZA 1GW1A 4AMAA 1ZAHA 2NW0A 2X05A 4CQCA 3AS0A 3W38A 5BCAA 2P53A 3W1TA 1EEPA 5EYWA 3QRHA 1CX9A 1AUSL 4TOQA 1Y7VA 3THDA 1EB3A 3L0KA 3MA8A 4IMGA 1TPC1 1ISXA 4HPJA 1HVQA 1JJKA 2J75A 4AISA 3GZAA 1WA3A 4GNJA 3T07A 1H49A 4GI4A 5AYBA 2FLIA 2OO6A 4GNKB 4HPHA 1UD5A 2E09A 3MJYA 1I2PA 3KFTA 3AQUA 1WZLA 4EAMA 3N29A 2ZA1A 1M65A 2ZICA 4NXSA 1KRCC 2C1IA 5CXPA 1LUCA 1RH9A 2YYUA 1VH7A 2Z1BA 2BODX 3TYAA 4AVFA 1K9FA 3M5VA 3R0KA 3N4EA 4Z1BA 1OYBA 2EPLX 3GW3A 4E4PA 3OHMB 5FJTA 1QI4A 1UMYA 3A9IA 3E6EA 3V5FA 3M5XA 2FDMA 4N4PA 3U2OA 4XSLA 3N17A 3W6MA 1M68A 3NGJA 4GZIA 4L6HA 1VEOA 4NASA 4N6FA 2YCJA 3GDMA 3O9NA 1CT5A 2Q01A 3P6LA 4PL2A 2ABBA 4QG6A 2GVLA 3KTCA 1W5PA 2CHNA 1O4UA 1TCDA 3FA5A 1Y0EA 1P4CA 3TN3A 3T2QA 2GVEA 3HOJA 1VS1A 1YTDA 3GHSA 2BMBA 4B2DD 3TK7A 2VEPA 3BW2A 3TEVA 5C9RA 3WNLA 4S3JA 5A6BA 4O4VA 2A2IA 2NQJA 5D9PA 2CLFA 4G9PA 4QAIA 3TYDA 4NYYA 3LCLA 3TN5A 4DJEA 4DLFA 5CZ0A 4JCMA 3TZNA 2DSZA 5A5WA 1HFBA 3KUMA 5LNSA 4DRSA 3STEA 4HK6A 3QSRA 2VHLA 3VKAA 1JNDA 1C90A 5FL0A 4E0CA 4H8UA 5M1TA 4GLEA 4INFA 1UP2A 1J2WA 3K1GA 3FKKA 4DM2A 5I03A 4W4QA 2TYSA 3M0MA 3WH6A 1PSCA 3UVIA 1W1ZA 4HCLA 3ZO9A 4B5XA 1NQKA 3B9OA 3BARA 4HIBA 5AHNA 1LBLA 4AC1X 2G0WA 2YBVA 4A3QA 1R9XA 4HOWA 2ISDA 4WIWA 4W87A 3UA3A 4GD0A 1KQYA 2VP8A 1XIJA 3V0UA 3USZA 3KCJA 4UR8A 4F48A 1KBIA 1KCXA 4A29A 3F1QA 4PMZA 4JTCA 1XD1A 3NQ6A 3WIJA 3MPGA 3SQSA 3NZGA 4AZCB 5FKYA 3LZ5A 4P7OA 4MZYA 1GHSA 1PL9A 4FLSA 3ZOAA 4NNBA 4O0ZA 4F79A 2G3FA 3POHA 2NV9A 2V3EA 4ZQPA 1WKDA 2D0FA 4LEQA 2G3MA 2DQXA 5C7VA 3NOYA 3PZIA 3B9DA 4G7EB 1OD8A 5T91A 1LLOA 1POKA 3DZ1A 3PC0A 4ONVA 3GYEA 4GZJA 5C6MA 3UNDA 2PC8A 3QTPA 1QMLA 1IXOA 4Z0SA 4NZ4A 2XSBA 1QOPA 5E1QA 4A2RA 4JXCA 1S5TA 3M0YA 2WJEA 3LHVA 3FIGA 1FRBA 1WUFA 4ALDA 1UZDA 4M6VA 1UKOA 4PTXA 1Y5VA 1CLXA 3P84A 2JIEA 4RXGA 2B7QA 3E2SA 3VIMA 3ZT6A 4DJDA 3TJ4A 2XFYA 4ZR8A 1E70M 3VIIA 3GC2A 3DC0A 2I5GA 3G6MA 1XUZA 3Q45A 3NUKA 3UJRA 4WDUA 4XTDA 5D2XA 4QX4A 4DN1A 4DUWA 2FQIA 3OPSA 3M0JA 3LLDA 5AOUA 4W8BA 1L6YA 1O12A 4BEUA 2CLOA 4LWWA 1Q6GA 4NNCA 1V0LA 2ONEA 4KRTA 4KFNA 2VL4A 1L6GA 4MJZA 5BOFA 2ALDA 1W9XA 4D6IA 3EXSA 4R9XA 3GDRA 1KCKA 2CYGA 3WMCA 3BUVA 3B0VC 5FAJA 2EQDA 3TSBA 3SADA 2F2KA 3IK4A 1G4SA 4JIIX 1SSDA 4W7WA 5GNYA 1QO5A 2JKAA 2ZUWA 3HGJA 5C0QA 1VFLA 4YVXA 3BOXA 4C6LA 4BI7A 1DWAM 2JIWA 5D02A 4PUUA 3AXIA 2EPHA 4GBDA 4UMBA 5G2WA 3DENA 3M4HA 2X0HA 4M3PA 5FEXA 3W74A 3KLLA 4J9JA 2J9YA 4PULA 1R6WA 5TD4A 1PCWA 5BXTA 5EFFA 1W2VA 5LA0A 2NXGA 1E72M 3AYTA 3C2VA 1Q8JA 1R3WA 1F3WA 5F2MA 4AIOA 3C0QA 2QCDA 3IRSA 1EX1A 3TC7A 3ZLFA 1JUKA 4L9ZA 1QDSA 1ZP3A 2DZVA 5LIKX 2PD5A 2PDCA 2PWUA 1THFD 3FW6A 1V0MA 3WL1A 1B5TA 1X1OA 3DUGA 2GJLA 4V2XA 3WQEA 1EZ2A 5CJNA 1R7OA 2XSAA 1CB2A 3MDUA 1B3XA 4D71A 4M51A 3WK2A 4UFHA 3AJXA 4ZENA 3LGEA 3A64A 1FWGC 3GQYA 2QV4A 4L4MA 3H7VA 4EX4A 1V5XA 2YL8A 3B0UX 2VRKA 6TAAA 1IZCA 1YBQA 1D2KA 2J4GA 4XD5A 3MBDA 5EMUA 1L6WA 2YDRA 3U9IA 2A3EA 4EKJA 3WLTA 3RITA 2DSWA 4YLWA 2Z1SA 1TPEA 1HUVA 4AD0A 5LHFA 3I6TA 2OXNA 1NP2A 1SFLA 3K30A 4ZTXA 1XCXA 2H6RA 2RKXA 3MUAA 1TE1A 4I9TA 1T40A 1WX0A 3UESA 5JIPA 2OODA 3NTYA 1SJDA 1DJNA 1TMLA 2ESCA 4CN6A 1K77A 3G24A 3OVPA 4XZWA 2ON3A 2UY2A 1HP4A 3MTWA 4UOZA 2Y1HA 3D0CA 4B9ZA 2ZZ1A 1AL7A 3QYSA 1RJRA 5AC4A 2OB3A 4C6JA 2RJGA 3V5CA 3VOCA 4JTDA 5FJJA 4TXEA 3AXKA 1FY6A 5A6BD 3NZRA 3VDGA 1E0WA 3TJXA 4LYKA 1DHKA 1EQPA 1X98A 3P7YA 3UF9A 8RUCA 1LTDA 3BQ5A 1I9CB 3M7SA 4MKNA 1LDCA 1YIXA 5DCBA 4QNEA 4GVFA 1OFAA 4DJED 4JYFA 1EPVA 2EO7A 4RLIA 4AHPA 1ZCCA 3B4YA 4KW2A 3UYCA 3RF9A 4F2TA 4CU8A 2Z28A 1OY0A 2GJPA 2YBUA 1SZNA 4JFVA 3ATYA 4KWUA 3A6OA 4PTNA 4M81A 3OHIA 4UFMA 5DBTA 1EJWC 4QFUA 1I2RA 4A35A 3APGA 2ZBTA 4A3RA 3VIPA 3S2LA 5KZMA 1OM0A 2NSXA 1QAPA 4Q8MA 1BYDA 3PZMA 2P76A 3CMFA 3FFSA 3NZ1A 4DJEC 2P3EA 1HGYA 2OKTA 4REQB 1MFVA 4CKQA 4GXPA 3NL2A 3C2YA 3VM7A 2V0TA 5HUPA 2NZLA 3TYZA 4PB5A 2PDWA 4MJ4A 3ONBA 3A9BA 3RNDA 3EDKA 3CM4A 3INPA 4IL0A 2PZ0A 2R94A 1X6UA 5A2AA 3NPXA 2PDXA 2VXNA 3VDBA 2F6XA 3IGHX 3A22A 3G0SA 3M6DA 1RUSA 4O14A 5H8MA 1J0YA 1UR9A 4HMNA 4C5YA 1BVNP 3P93A 2J74A 5FF4A 4L4LA 4HTYA 3SECA 3U8GA 1YLVA 1JDEA 4J5NA 1G4EA 4I3GA 1RCQA 1VB9A 5HJXA 2AGKA 1RVGA 3I4EA 4FP1A 5HPCA 3ZT5A 6XIMA 4ZCWA 1XIHA 3P61A 3UEQA 5FL1A 1GORA 4ADUA 5ABHA 3GDBA 4UFIA 1SO3A 2YKKA 3PZ9A 3KZPA 2L5HA 3HZ3A 1U1UA 3D3AA 2VZOA 3DHFA 3A23A 3HJZA 3WF3A 4D8LA 2QMJA 3Q94A 1QRQA 1J0IA 2J8TA 4OE7A 4DJDD 2OLHA 4LBSA 2RAGA 4ZMGA 2NVCA 4E8CA 4BEQA 2WNZA 4GISA 4JTIA 3C2RA 3DAQA 3WUGA 1I60A 3ZVHA 3VC6A 1EP1A 3CTLA 1KFLA 4Q4QA 4N9BA 2Z1XA 4UTFA 3SAZA 3WJZA 2AQOA 1QU4A 2V2DA 2DZXA 2OU4A 1F8IA 2ADAA 1TWIA 5I3KA 3V16A 4JHZA 5FJIA 2DDXA 3CUJA 3WKZA 1SZRA 4LF2A 3CHVA 2B4GA 2WBKA 4KEVA 3E0FA 4AXKA 4N02A 3FDKA 1BVWA 4DJDC 3WDRA 3KCOA 4BI5A 4DYKA 2GDUA 1C7TA 3IACA 1B90A 3AIWA 1W31A 4WOZA 3W2NA 3MUXA 4L65A 2PEVA 4Q22A 1TKKA 5JH2A 3GUWA 3CV6A 5I3HA 1IGSA 3GO2A 3VFCA 3T42A 4NY2A 2DZAA 3TVAA 4G7FA 1DE5A 2HEJA 4FR6A 2WVTA 3LN3A 1DPMA 4QISA 3W7IA 1ME8A 4AWTA 4CD6A 2XSXA 1XSIA 2PD9A 5D9NA 1O5QA 3UU0A 3UNTA 2PWVA 1BPLB 4DNHA 4I7UA 8XIAA 1ZZMA 5D4YA 2WCSA 1Z89A 2A4AA 3BURA 3VX1A 1OYAA 2QVHA 1R9ZA 2QF8A 1GQJA 4JIEA 1NARA 3F2BA 3B05A 2PBGA 3VNMA 1YYAA 3UR2A 1O60A 4IX0A 3N9KA 4H9ZA 4RPPA 5EPDA 1XGEA 3ERPA 1E9LA 1VCVA 1LBFA 1JXKA 4XAFA 3PN8A 4JY8A 4TX9A 1TJ1A 5HXMA 4ICMA 2F38A 1EGZA 3KRSA 4Z2LA 3MUCA 2J78A 4HP5A 3ISIX 5HMEA 4DYEA 4XISA 3SFWA 5K4ZA 4YTUA 4AWSA 1LOSA 1YQ2A 3MUZ1 1E51A 4XD3A 3T05A 3OLDA 8XIMA 4QITA 2CNCA 4NJJA 4AD3A 1XH0A 1RK6A 2I5IA 5AYZA 2A85A 4ZXLA 1TRIA 1TV4A 1WDDA 4K7VA 3NQBA 1UWRA 4YTRA 4FIRA 1LRTA 5HA7A 3MO7A 3W24A 1KTNA 5AN7A 1H60A 1O7AA 1QFEA 3MSDA 2YCKX 2OTDA 2POZA 1UZ4A 4HD5A 3BAXA 1WOBA 3MYPA 4BQ5A 3N13A 3UPWA 3U7BA 2PGWA 3TFXA 3CZ8A 2WMHA 2WOQA 3HQ1A 4HNNA 4TR9A 4LYRA 2J13A 3NDOA 1Z44A 4RZ5A 2G41A 1XLGA 5E6YA 4Z1YA 1OG0A 4KGJA 5KETA 1HKKA 2Y6ZA 5CLWA 3GDTA 4P5UA 1H4PA 3W37A 3CQIA 5C9XA 3TP4A 2V2HA 1BF2A 4TX8A 4NZ5A 3WN6A 2HK1A 4AZCA 3DHDA 1XLFA 3VOGA 2AQWA 4QE4A 4NQ1A 1EA9C 4J40A 3II1A 3C86A 1WDPA 3IIXA 3ZSTA 4CNUA 4KETA 4HNCA 2PDNA 1GOMA 2YXXA 4RCXA 3VA8A 2VX6A 1UOKA 4Q8WA 1ODZA 5CPTA 4G7EA 1ADOA 3WUEA 1VBJA 4JFTA 4J35A 5BMWA 2QW5A 4Y9PA 3S5OA 2UY5A 5IHSA 5AHFA 4GI9A 1I4NA 3Q37A 1LJYA 2D1ZA 3W84A 3RX2A 1BWLA 3A4XA 1I75A 4H6EA 1CCWB 1U83A 3STGA 4H19A 5L6UA 4K6AA 2C13A 4UC5A 3AIEA 2P8BA 4D6DA 3G1VA 5C2CA 2ZA2A 1NF0A 2JGQA 2CW6A 3BGJA 4A4AA 5KTLA 2XVKA 1CXHA 4AQLA 1H2JA 3LENA 3S6DA 5DT5A 4QCFA 4LVAA 3TA9A 1H7RA 3TYUA 3VI2A 1XINA 1MRQA 4F8XA 3ID7A 5C5YA 5FF7A 1DE6A 4FO4A 3QEZA 4K3ZA 5IM51 4NZ1A 2QYGA 6TIMA 1BTCA 5BXRA 5IFPA 5D09A 4CGTA 1OIMA 4TVCA 1MEWA 3QLDA 1F3TA 2QV5A 2WNNA 3RLGA 2VCBA 1I6NA 4S39A 3BAYA 1F8MA 6A3HA 2BVWA 4GI8A 4LC6A 1LOLA 2CBVA 3D5HA 1P43A 2GUYA 4XVDA 4Z08A 3POCA 4XZLX 1GPFA 3IIOA 4B4FA 5XINA 2GQ9A 5CPMA 4H9TA 4KKXA 1DQXA 4ADSA 3GNRA 1HF6A 1W1A1 3W1LA 1I1XA 3VGDA 3ZJ8A 5CZJA 1TPWA 3D6NA 3BLKA 4IIDA 3QGKC 2XIMA 3LQGA 5I79A 2R6OA 3M0XA 3ICJA 4QCEA 3N3TA 1TELA 1ZENA 4MFEA 1N7KA 4GO8A 5D37A 3I6EA 1KM6A 4CNPA 5HMDA 1T7LA 3V18A 3L0NA 3ITOA 3A3WA 2QCFA 4XG1A 2I57A 3XISA 3S2CA 2Y7DA 4MTVA 4YL2A 3GAYA 5D2YA 3MY9A 1N82A 2AL2B 1C8VA 3I3DA 3PG8A 4PGLA 5FF0A 4H83A 3CWNA 3B03A 3CV2A 1P7TB 2VFFA 5LGZA 2OO0A 2ZZ6A 1YDOA 1UH4A 4AMCA 1FCQA 2G5WA 7CGTA 3P8IA 1SVDA 5A8NA 5K9DA 4P7RA 4BJHA 1DYSA 1AD1A 1JQXA 2FH8A 3S5YA 1REQB 3MB9A 4CCCA 1BF6A 4MKSA 2W3ZA 3WLSA 2WZTA 4UQCA 4YHEA 7ENLA 3CPGA 3AMKA 4U2YA 3H6OA 1H1YA 2ZXDA 1KR1A 1G9HA 2CWNA 3WG6A 2PP0A 3WQWA 3RMJA 3APTA 2Y5JA 3IV8A 5I09A 2G3IA 2EBNA 4YTQA 3GHTA 1EA0A 4MLRA 4YCOA 4IJCA 1VAHA 1PWMA 4ZSUA 2PDQA 4O12A 3RCYA 3FNDA 2R82A 4V33A 2QUTA 3HURA 1UOZA 4Z17A 1R46A 4GNVA 4RPQA 4DO5A 3GK0A 3WENA 5HQMA 1C92A 4E4FA 4QRNA 3R13A 2Z0IA 3GHRA 1DEDA 3URQA 4YYFA 1EYEA 4PTDA 4QDWA 2VELA 4NZJA 2XPKA 2DUXA 1GQKA 4DZAA 1XDMA 1LF1A 4Y9NA 1GT8A 3EX4A 3M5YA 1ZS2A 1TIWA 3MUIA 1O5KA 1V3HA 2G96A 1HG3A 1W5QA 4LH8A 1YHTA 4O1BA 3NYZA 2XGIA 4LUJA 3IUHA 3CS2A 5BRPA 5FSEC 2GJNA 1ONRA 2HZGA 5IDZA 1PO9A 2DU2A 5CGQA 3PR2A 5DLCA 2X0YA 3TTYA 3W2UA 1ZBKA 2IQTA 1Q7ZA 4X0NA 2NV2A 4U31A 3TH6A 4R27A 3EDEA 2HQAA 4IM4A 5G5IA 4AD2A 8TIMA 3EOOA 1YNPA 1NDZA 3IUDA 1BAGA 4OU1A 4PODA 3HG4A 2ZZ2A 3L21A 4DEFA 1EKOA 4QAWA 4IGMA 3M6YA 3DESA 3O16A 1QNSA 1XP3A 2CKSA 5BROA 1ENUA 5CGMA 2YDSA 2E9LA 3UR8A 4HOZA 2ZVRA 4JAWA 3LX9A 1HJUA 2HK0A 4XKYB 1AZ2A 3AHVA 5D03A 2IW0A 4XBSA 1J0KA 1UCWA 3H53A 4LVBA 5HWJA 4GVHA 3TLLA 3H2FA 3C5QA 1AL8A 4PMNA 4US5A 3W23A 1E9YB 3CEPA 1Q2SA 1G1YA 2YLLA 1HNYA 3BLOA 1MXDA 3CMGA 1OF6A 3RPTA 2Q02A 3H2EA 4GIAA 3GH5A 3KL5A 2YCEA 2Z2BA 4CLMA 1KXQA 1VENA 1MQPA 3SFKA 1DWGM 2CLEA 3JR2A 4UQ9A 2Y61A 4X3ZA 5FEPA 2PU0A 1P1MA 4ZB5A 4DYJA 1QNOA 5HBFA 5TBOA 2VURA 5AB3A 5DRIA 1F3XA 1W37A 2A3BA 5I0DA 4M1BA 1J10A 4O15A 1HKMA 5CPQA 3JVAA 4JTLA 5AECA 2FB2A 4MY8A 1W5NA 3ZZ1A 4IPLA 3M5ZA 1XHGA 1HN1A 4NILA 1ISVA 4S3AA 2Z26A 2PDYA 3SGZA 2EPKX 4J3VA 4EPBC 1A5NC 1FH9A 3PSWA 1EBHA 3NQEA 3LGDA 4D9PA 4JPGA 3M43A 4LUSB 3FXYA 4JTAA 3SBFA 3UZZA 1XDJA 3W86A 4W5UA 1M6JA 4ZSTA 3M47A 3L4YA 4PB3A 3KTXA 3LSBA 1TUXA 4MY9A 4XD4A 4EF9A 2EG8A 4A8RA 5EA9A 3E96A 4KMQA 5BNKA 1E1FA 1XYCA 2ZOXA 1WKYA 3G1XA 1DHPA 4K1WA 4FK9A 4G56A 3LGGA 1UKSA 4IIBA 4LAZA 2QLYA 3G8RA 1UC4A 6REQB 3F2DA 1N8IA 1E4LA 1JDAA 4OUEA 2DP3A 5KINA 1FKWA 3TQKA 1OC5A 4OGZA 4FNTA 3BLFA 3H12A 1SM9A 5FEZA 1JIBA 2PDLA 2RDWA 5LXXA 3G3DA 3A3XA 4WY0A 1W1IE 4H8HA 2HVNA 2DSVA 2ZKMX 3O0KA 2C16A 4F0KA 2Y5SA 3L23A 4QGCA 3P5ZA 1EXPA 3RN6A 1A5AA 3ARYA 5D33A 1FWSA 3BG9A 1IEWA 2DH3A 3CUIA 1QPQA 2DUZA 3T44A 3CYVA 3AIUA 4UBPC 3VYLA 1XF0A 3N12A 4PZVA 5DXXA 1ZU8A 4HHHA 1NDVA 2FB3A 2HMCA 5JQ9A 2OX4A 4UTMA 1PKYA 4C6KA 4D8ZA 1VJIA 1E5NA 1UR1A 4Y7EA 3FA3A 3O2LA 2XFFA 2BXYA 1OVDA 3FGCA 3B8DA 4S3FA 1S2WA 3DGBA 3SCQA 3UGRA 5DF0A 5EMKA 3PUDA 4E4UA 2XN2A 1GVYA 1KM1A 1EPXA 4LS2A 1QPRA 2OGYA 1R47A 1M01A 2BVYA 3WBAA 3LPGA 3L12A 3CUFA 4CQBA 3KAOA 1AW2A 2VEKA 3WH9A 3FY1A 3CAQA 1W1YA 3W7MA 1UR0A 4HSHA 1GYLA 3OLGA 1VEPA 3EEZA 1FOBA 4F0SA 1W3JA 1O94A 3DFQA 4UTWA 2WSPA 4YWSA 3GVGA 3N6HA 4Q6JA 3RIKA 2CLIA 3BGGA 2B7OA 1I2NA 1XIGA 1JPKA 1SR0A 1U30A 4JKLA 5TF0A 4LB3A 4KFOA 3NO1A 4WQ6A 3VGFA 4A22A 3UVAA 4GCXA 3OVQA 3O6YX 4I9AA 3NQFA 3N2TA 2HBXA 4WSKA 2E3ZA 3T78A 1PTAA 5AHLA 3R79A 5HUOA 3QMRA 2EGZA 3AU6A 1FWIC 4UUIA 3WO8A 4B5SA 5FD0A 3QQ1A 1PKLA 2D73A 3LUTA 3PB0A 4RV3A 3URBA 4F0RA 5BXSA 3A12A 1EX5A 4EPDC 1GOQA 2VC6A 1G01A 1GOWA 3IK2A 1X7IA 2OT0A 4PRWA 2B0MA 5HQLA 2CZ5A 3G0UA 1FTXA 4Q4OA 2XN0A 1JDCA 4AY1A 4PTMA 3VK5A 1R3YA 3GIPA 3NIYA 2C71A 3BDKA 2IXVA 1XIIA 4OQVA 4CVUA 1WE5A 2QR6A 5JXQA 2Y2WA 2QULA 2WO5A 1N8FA 1W56A 1XGDA 2JQXA 3OYZA 4DPQA 1V6UA 4KERA 3BCJA 2GOUA 2YB1A 3GAKA 3QR3A 2NUYA 3H26A 3WLJA 3L9CA 4HU4A 4HYVA 5E5CA 3TROA 4US5D 4GWEA 4LOCA 1MZRA 4C6DA 3W3OA 2O9OA 1W9VA 4JKKA 1QNRA 2I9EA 2INEA 1ME7A 1R2SA 4GYJA 1JCNA 2GLKA 3FJ6A 4NXKA 1J5TA 2OEMA 5A6MA 1R2RA 4FSAA 4M24A 2PF8A 4QROA 2WPGA 2OGJA 7REQB 1AQHA 5TIMA 1M3UA 2VGIA 3NQ7A 3ONCA 1F4HA 4IQJA 3ARXA 4BA0A 1TTJA 3V4BA 3VOFA 3R89A 4S3KA 3WEZA 3PSVA 3SCOA 2HSAA 4DBWA 1CGWA 1DBTA 1EJRC 5EMMA 3NSNA 2DIKA 2GDVA 4O28A 3FLUA 2VCCA 3FAXA 1LRNA 4ROPA 1EEXA 3PHAA 2BSLA 2J7HA 1E9IA 4HMDA 3EA2A 2CC0A 5MKGB 3QFWA 4D6HA 2ZRZA 4PFHA 1XYMA 1A0EA 4NSBA 1OINA 1QVBA 4Y90A 2VNCA 4QQ3A 4GVGA 2FTPA 2X2GA 3PPHA 5DMYA 3U7VA 3WQPA 5GJPA 2VYOA 3ZIZA 3E2RA 1A3HA 3QZ6A 3KHDA 3RCMA 4I5XA 4JTFA 5I06A 2B31A 3BXWA 1QATA 4JEJA 1B9BA 1RA0A 5FSDC 1UB3A 1VLIA 2WPBA 1UZ1A 4LYQA 4Q33A 5HMSA 2QJNA 1M7PA 1E73M 3C3UA 2R9RA 4CNOA 3ZS4A 1AQMA 3LBOA 1SMDA 1WP6A 1VYSX 2VWTA 3A4JA 4JIQA 2ICSA 1XH2A 1F73A 2ZYFA 2D3NA 3P5YA 4PCPA 3CZJA 2AGTA 4US6A 4XIMA 3NOEA 3A3HA 5XIAA 3C0LA 3MANA 4H9UA 1P7TA 3HA1A 3LHUA 5BYWA 4XBJA 3SN0A 1MDRA 3UD6A 1REQA 4IMAA 1JRCA 1RSCA 3GXMA 3ZWSA 1FP9A 4N7QA 1ZFJA 1TJ2A 4I9MA 3NNTA 3TXZA 2VD8A 3KRUA 4TTGA 3VVGA 4EAYA 5F2GA 4GMEA 1TR9A 3S8HA 4UTUA 5LNVA 2VT0A 1J6PA 1XYZA 3VNDA 1CYGA 5F4SA 4LAKA 1M5WA 4K36A 3PZUA 3N73A 1GONA 4KWVA 1OF8A 2PGRA 3V0TA 3HPSA 3GW0A 5KMYA 2NT1A 2PC4A 1K9EA 1V03A 1J9YA 4FPSA 3BLEA 4AIEA 1H1NA 4XBKA 3EYPA 2HVOA 2NV1A 1CWYA 1WDSA 2ATSA 3EX3A 4HYRA 4KPLA 2R1KA 2WCGA 4QS5A 4FS9A 3CQ0A 3MP5A 3QQ0A 4HNUA 3BMXA 3O05A 3KXQA 1GTHA 4G5DA 1CXEA 4AD5A 1JF5A 1SQ7A 3PP7A 1XSKA 1FHDA 3PBYA 3R8RA 1TG7A 1QASA 2GGHA 3MKCA 1DJHA 3OLEA 2QS8A 2IKJA 3KVKA 1OADA 3BOFA 1J79A 5CPNA 3TSDA 2D2GA 2F84A 3MSRA 3KRBA 1HVXA 1E6XM 3SUTA 3WLHA 4GYPA 2RUSA 3RRAA 2WWDA 4MUPA 2VC5A 1TQXA 1GYNA 4S3EA 1W9PA 3FN9A 4WEVX 2ZZ3A 4ZO6A 1F2JA 1O5XA 3WFAA 1BRLB 3MI2A 4U33A 1F6YA 3GTNA 4E2DA 3VIJA 1AH4A 4B5NA 2F6KA 1FKXA 4ORMA 1WXJA 4A8IA 4XIAA 2XN1A 4KEUA 4O1AA 4V1YA 2OSWA 3ANUA 1E1EA 1GNXA 2XVLA 4O8AA 2WZEA 3SUSA 3M1ZA 3TV8A 2JK2A 4XKYA 3N11A 4LV9A 4PCSA 3KWSA 1IXNA 3G5EA 1C8QA 4NYUA 5KZDA 1JPHA 2A7PA 4UTWC 4WKAA 2CZFA 3ABQA 1UH3A 2OEKA 2CBIA 4QLJA 1T99A 5K2ZA 1U33A 3MBFA 3ZWTA 4TTUA 2V30A 2FFIA 1W32A 3VOJA 3W70A 3ALFA 7TAAA 2J7GA 3PM6A 4CU7A 2XVNA 2I56A 1AQ0A 3SRHA 1OB0A 1GVRA 5FJOA 3VD4A 5A95A 2A7NA 4QBXA 2W63A 3STFA 2XIQA 1SO4A 3LLFA 5D9OA 5DMMA 2AKMA 1B3OA 3RAOA 1FWTA 3OQEA 3WK0A 3N6JA 2BVTA 4DY1A 1U1HA 1TR1A 4GGHA 3DFHA 3BV4A 2GWNA 3H8AA 3GU1A 1H51A 4HCHA 4H41A 1TPFA 3S47A 1UPPA 2FZ8A 2ZXAA 1K6AA 3MVTA 4FX7A 3SRFA 1ZJBA 3TA6A 2ZFAA 1P0BA 4V15A 3S5NA 1GKQA 3NO3A 5K9CA 1WXZA 1ZJAA 3I7QA 1ISWA 1DJYA 3SCTA 4PMUA 4GACA 4WLCA 3VMNA 4DUXA 4ERIA 2INZA 3S9YA 3N9SA 2BNJA 3UWQA 4PBFA 1YPFA 1MRAA 1BKHA 5J8LA 3N2MA 4WRHA 3O0FA 2GGEA 3OG2A 4C6BA 4P61A 4L1GA 3LXAA 3FJ4A 3W7OA 3GBDA 2HPIA 3W7NA 1RY0A 5HNTA 1LYXA 4Q4MA 1V8EA 4AVOA 3KW3A 4H8VA 1JZ8A 6REQA 3K4AA 4P7LA 3NSXA 4LXFA 3SCNA 2WV8A 4JTQA 4MDOA 5AVNA 3AHXA 1NAL1 4L1WA 5I3GA 3ARTA 1Q3NA 4LAUA 3FS2A 1XRFA 4MADA 5CLTA 5G4WA 3VABA 1QWGA 4LW7A 2R14A 4IFKB 1F9CA 3KBJA 2ZDSA 2QDEA 1Q6QA 5CSSA 2XINA 4JHMA 2W6RA 4GABA 4W85A 2XJ7A 1MVYA 4NZCA 1ELSA 3KRZA 3BVJA 3WQOA 5H8PA 2O55A 1RJPA 3DG7A 2PFHA 1JR1A 3RILA 2WK2A 3WQ5A 3L2IA 4AIUA 1TMHA 2VFDA 1DJWA 4K2SA 2FZNA 3V36A 2V5LA 3ZQ9A 3ARVA 3LD5A 3O06A 4H2CA 2YDAA 1ML1A 2PDPA 3ZLHA 3V35A 5I07A 1UUOA 5CQ1A 2FKPA 1UWUA 3CT7A 2PDGA 4JTSA 1RXOB 3GVRA 4L4PA 2FGLA 4F9JA 5C9ZA 1NOUA 3SQLA 1N8WA 1MWOA 3W1PA 1NDYA 3VDAA 3K8KA 3EPNA 1V3MA 3QYQA 4PSRA 5CPOA 4YVVA 5A8QA 3DG6A 4TO8A 4W93A 3UG3A 3USBA 3K4WA 5G2IA 1VPYA 3O1NA 1UR4A 3HPXA 2GQ8A 3QH2A 2WB5A 3SCUA 4MJMA 2YXGA 2FHBA 4HPXA 3AROA 3I65A 2OQYA 2ZC8A 1GQLA 4BF5A 5HANA 1RBLA 3OA5A 1ZY9A 2ZX7A 1RZMA 4JN8A 2D24A 4ML4A 1SJCA 1RY8A 2UV8G 5DT7A 3VDCA 5KZEA 3QHMA 1D8CA 1SGJA 1CEOA 4R53A 1D7KA 2GPTA 1O95A 4K7YA 1PKMA 3DFYA 3DHPA 1NWUA 3BO9A 1AJ0A 3QXBA 1VPQA 4NAFB 3PBWA 3B0PA 3NQGA 3LTPA 1XL9A 3R58A 1TZZA 3W6YA 3COTA 2V5CA 2GVJA 1FVPA 3KBSA 3CUHA 3FHQA 1CLVA 1Q6RA 2DY3A 3UZYA 1ONWA 1L8NA 4ILSA 1XBYA 3NVDA 5FJUA 4W88A 4GYPC 5REQA 3AXHA 1PX8A 3ITXA 1YPXA 2GSHA 4XAGA 1DJGA 4HPNA 4MFDA 3WK3A 3H21A 3LHYA 4DI8A 1JYNA 4ES4A 3EA3A 1T8QA 4N42A 2XFWA 3SQMA 4QDPA 1EWDA 1T5AA 3H7RA 4I9JA 2IPJA 4RNFA 1P0NA 1TO3A 1A49A 4KIRA 5BW6A 2QIWA 4I8YA 4HU8A 4JNMA 4DF0A 1OEPA 3C2FA 4IIFA 1LT8A 2DVUA 3DKJA 3NXFA 2CLHA 2YJQA 2PZNA 4PMDA 2ZX5A 3VGEA 7REQA 3GX9A 3W1MA 4OVXA 4EVZA 1KKRA 4H8NA 5DFAA 3BLIA 3BAJA 4B3ZA 1CTNA 1UZHA 4IF2A 1RQEA 1TPB1 2Q3OA 1R2TA 3MV01 3AOFA 1VP5A 3BGAA 2FVKA 3EWBX 3LPFA 2PUZA 1FCBA 4GH1A 4N9CA 5H2ZA 3O6CA 5GQBA 2JEPA 1WZAA 4Q4KA 1E0XA 2ZZ4A 3EX1A 3UY8A 1T0OA 3UWWA 3AS3A 4PUJA 4L64A 1A3XA 1SO5A 1G7UA 2ZXBA 1C9WA 1DOSA 1TX0A 2X8RA 4HGXA 3EEGA 1PWLA 2DFAA 3CUZA 3T8LA 2H9AA 4R88A 5HATA 5C55A 1GKPA 2PWFA 1S5MA 3NEHA 1EWEA 4IPJA 1XYAA 4H6QA 3UCQA 4OV9A 3W0KA 4IUGA 3XIMA 2GFTA 2WBGA 3GG0A 3JUGA 1O1HA 1PHWA 4X60A 2A0NA 3T40A 1JPMA 1KW1A 2ASHA 1AZ1A 1UH2A 1NFGA 1S38A 4MNMA 5HJLA 3R0DA 1KKOA 3IJQA 2GQ3A 5E9AA 3W83A 1C3FA 2PCEA 3CWOX 1VC4A 1LG1A 4TU1A 2UWFA 3HMJG 5JUVA 2O4MA 2PDKA 2DT3A 3SI9A 1K4GA 1AD4A 2BHUA 4BQ4A 3P14A 2PURA 1VGAA 4EXAA 2JGYA 2O0TA 1N55A 4G6CA 4UXDA 1L6FA 2Q3RA 2VOMA 3GC4A 4PEEA 2Z1WA 1XW8A 2FZDA 3LRKA 3ITLA 3AU2A 2VKZG 1U5VA 3R4IA 4DWSA 3OW1A 4EF8A 3MHUA 2BZNA 2QPUA 1KTBA 2Y0FA 2TSYA 2I7GA 2CU0A 4AZ6A 2OX1A 4Z1DA 5BXPA 3GS6A 4QSFA 1PEZA 4LJ3A 4NZFA 2A3AA 1K9DA 3E0IA 3LTYA 3ARSA 4OKDA 5FIPA 4LB4A 3WQDA 3S5ZA 2CLLA 4ZEPA 1JZ7A 1KM2A 4HCDA 3A4WA 4AWEA 1KXVA 1NJJA 4O0QA 3WBWA 2WZMA 4FOKA 4Q4SA 4E5TA 2Z6IA 1VKFA 2ZZ5A 3QV6A 3B8TA 2V68A 2NQ9A 5I2UA 3DYOA 1LQ2A 4POCA 3WH5A 4XD6A 4JFWA 2DSUA 3ZR4A 1K4HA 3G0XA 3F4NA 2Z27A 5KEZA 1FWJC 3AS2A 4JNZA 3M0HA 4G1KA 3WNNA 2OG9A 5I23A 1Q6LA 4B9YA 4XWUA 3EDJA 3P0XA 1B30A 5E6ZA 7TIMA 3DCPA 3FSUA 1QNPA 2YW3A 3THUA 3T81A 1ICPA 2MNRA 3AI0A 4NJIA 4BZYA 2O4QA 1A5CA 2QUNA 1IWPA 4NT0A 2ZXQA 3C2EA 2VQUA 1A0CA 2VR5A 5D04C 1XYFA 1VLWA 2XUCA 2ZX8A 4V1XA 4RKAA 4H6KA 3BJSA 1K3UA 3W73A 3ZYZA 2WSKA 4Z2HA 4FAMA 4M7TA 1ZPTA 3JRKA 4MNLA 1YDYA 4KT2A 1ZJHA 4CCDA 4U5IA 2GK1B 1HKJA 4UOQA 1SZGA 4IMCA 5AY7A 1W3KA 4GE8A 2YCIX 2WC3A 3EA1A 1IV8A 2VEMA 1JQVA 4RR4A 3T08A 1PVNA 2CZVA 1LQAA 3HJEA 2B7NA 3RO8A 5DN1A 1G69A 3EB2A 1I45A 1Q66A 4FXRA 1OJXA 1L2UA 4KGLA 3MQTA 2W0UA 3CNYA 1F76A 2SFPA 3UGVA 4WHBA 3C4UA 2AMXA 4NX5A 4RDYA 5JMUA 2JKEA 4NI3A 2YPIA 3OOQA 1G4PA 1PHQA 2FGZA 1DJIA 4XTIA 2O9TA 2HDJA 1J6OA 2CPUA 4JFSA 1DWIM 1XLJA 4UCGA 3M9YA 3NCOA 5J5RA 3IAPA 1S5VA 2WHMA 1ECQA 3MP3A 3OIHA 3QQWA 4JOMA 2D0HA 4O1EA 1KFBA 2DVTA 3A24A 1FWFC 1BG4A 2FDSA 4YPJA 2QNEA 4NUWA 1YW1A 3VKDA 4IIHA 1GW9A 2IPFA 4E3TA 2DZTA 5LNWA 1JZ4A 1SJAA 1ZGDA 1OK4A 1YPIA 1IWAA 4MWAB 2PA6A 1GVSA 4F4RA 1V77A 4HZ6A 4PMRA 3MYOA 1GVIA 3E3HA 4GKTA 4AU0A 1YX1A 1VJSA 2QKFA 2HS8A 2OOFA 2BXZA 4MB1A 1ZNNA 1LP6A 1WQ5A 3QJAA 4DB7A 2MUCA 4IMDA 5E93A 2B7PA 4JICA 4C7DA 4Y6GA 4ZOCA 3PBGA 3WD0A 2BOFX 1TV2A 4YJ5A 4FF7A 5IXEA 1V51A 2BHYA 2X7VA 1DWJM 3OEXA 2I5QA 2V3DA 2Q8XA 1XKJA 4PBGA 2R1NA 1NM9A 1TJPA 3ITGA 1KRBC 1KTCA 3EAUA 1BXCA 3KOYA 3XINA 4JIRA 4P7QA 1L6SA 4IFKA 3UYIA 2QCCA 4ZXOA 1FWHC 1K8XA 1EYWA 3AJ7A 1XX1A 4X9YA 4WK9A 3S5SA 3NJ3A 3SCWA 3WYZA 3PJUA 1O1ZA 1CGUA 4KBXA 1OT1A 5D30A 4D8AA 3SW6A 2CWXA 2ZX9A 2PDFA 4NRSA 2D3LA 3TQPA 2VGFA 2YCLA 1H3GA 4IWWA 1M04A 1IEIA 4Y2WA 2A3HA 2YYTA 4KCWA 1J8VA 3MDWA 4EP8C 4GZ7A 4AD4A 2ZC1A 1HL2A 4HN4A 3B3DA 3KL3A 1I8JA 4O11A 4GIYA 3EOUA 3BICA 4MGGA 4TMCA 3SGGA 4ATLA 4K68A 4DWSD 2FJKA 4YWIA 3QBUA 3VE9A 3W1AA 2H8XA 1JCTA 1OX5A 3VNJA 3PPGA 3EOSA 3E2VA 3SUVA 3AS1A 4NHVA 4IISA 3VZZA 1XFBA 3LXBA 1LT7A 2I17A 1EJVC 5ECVA 4FNPA 3B8UA 3LRLA 2GVGA 1IT8A 2OYMA 3CK5A 3BLPX 4O1FA 3LV5A 3VNIA 1W91A 2E25A 4UTKA 4RW5A 4C65A 3BLLA 1KFJA 1QXLA 2W9MA 1VEMA 3KVJA 3M0LA 4S38A 4DWSC 3VIOA 4RZ4A 3WDHA 3WDPP 3LM7A 5ABFB 3B06A 1EO7A 4O53A 3RR4A 3UWVA 1R8LA 5FJPA 5E70A 2PRMA 3RJXA 2UY4A 3C3NA 1A5BA 3W7KA 2BP1A 1RLCL 2FYMA 4ICNA 3WBEA 3URNA 3LOTA 1W2PA 1H0GA 3MMTA 1DL3A 1XD0A 1Q7QA 5IFTA 2BX7A 4LS1A 2E1DA 3QR1A 4NAFA 3OLIA 4OTKA 2YZRA 3N9RA 1KXTA 3ORWA 5JBDA 1E6RA 4UIOA 1EBGA 1VFSA 5XIMA 4KRUA 4JCLA 3BAWA 2EKCA 1Z9AA 1BSLA 3N4FA 2VFEA 2PTZA 2C1HA 3KS5A 3EWWA 4WDXA 4D6JA 1V6TA 3GUGA 3NR0A 3MCOA 4DPPA 5HNUA 2X41A 2W91A 4AZIA 1S3HA 1IEQA 3SGUA 5D32A 2Y63A 2Z6JA 2A1YA 1M53A 3UQNA 4CVWA 2E7FA 2DIEA 2XM1A 3IGUA 5FF3A 1DIEA 4OJYA 5I78A 3QZAA 1XR2A 2QJMA 5A6SA 4C5ZA 2QDGA 3UWZA 1IIHA 4C6EA 1WXYA 2WHJA 3WLRA 1W6TA 3F2CA 2F9RA 2PDJA 3LCGA 3SSZA 4F2UA 2YA1A 5LIYX 2CETA 5DXYA 1FWAC 3QC0A 4WUIA 3PF3A 2BOEX 1EH9A 1TJRA 2WKLA 3REQA 4LPCA 1HKIA 4ROQA 4LCQA 5HDRA 3CTTA 3S0CA 1XLIA 5CAKA 3NGFA 1V6YA 3WMLA 4AH7A 1JULA 3HB9A 2NX9A 4W86A 3ABXA 4HHMA 9XIMA 1GYMA 1P6WA 3GU2A 1KB3A 4C6QA 2FMOA 3CQHA 2KX9A 3MHFA 4ZB2A 2OWCA 4PBEA 3TYCA 4A3UA 1AH0A 5A2CA 2V38A 4IG2B 5C8BB 2VEGA 2HE5A 3OQ8A 3T55A 2VI0A 4D6EA 4PRTA 2WKGA 3ECQA 1BTMA 2AL1A 3CUXA 3TN6A 3QVQA 1HJXA 2PWDA 1ECEA 3L4VA 4KQNA 4MZ1A 3FV9A 4GYKA 3R12A 4XAZA 3EB3A 4S23A 3RG6A 5U7SA 4ZTYA 4UMAA 3TAKA 3GFZA 4EPEC 2QCNA 1OZQA 1DQWA 3GNNA 2E67A 1G67A 3NQCA 3BAIA 3I6RA 3UPBA 1YDVA 4MG4A 3VIFA 1V3JA 4Q8QA 4NAEB 1OBAA 4FXFA 5BOOA 4IXHA 3W7RA 2JFEX 1G5AA 3A21A 4ZZ9A 1UC5A 4ERAA 3B8VA 1AA1B 2E6DA 3E38A 3BCDA 4H7VA 4GRSA 3S2NA 4B5VA 3R10A 1E0UA 3ZJKA 1K8YA 2HCVA 5DO8A 3ZXWA 1K9TA 4GJJA 5GVJA 4W84A 4J2PA 4CEXC 3KDNA 4O17A 2C19A 4BF7A 3DI0A 3EGJA 3EKLA 2DIJA 4PUMA 3LS9A 4B90A 3NDYA 3W2MA 2G3NA 2P0IA 2ZQ0A 4YNGA 3TYBA 4K39A 4JIHA 4MB4A 4NL1A 3UA4A 4OUIA 4B5UA 3GIQA 1A4MA 3EWCA 1Q2RA 4XX6A 1A5OC 2EEXA 3W29A 3L67A 4PUNA 3VNKA 2HWGA 4JTGA 3ABSA 3W1NA 2WHKA 4AVNA 4S3BA 1A50A 3RPMA 4GUJA 1YE4A 1B4KA 2QCEA 3PUGA 3KE0A 1XIBA 5A6KA 1JI2A 5D2WA 4QDMA 3CAWA 5DBUA 3T6CA 3WQVA 3TYEA 1E6QM 1JD7A 2FVMA 5LA2A 3UERA 3PUEA 2DJLA 5D38A 3LDVA 1XLCA 2YX0A 3OZYA 3ES7A 3WH7A 2X09A 4RZ6A 5JBEA 1EQCA 2J9XA 3Q4DA 1QHZA 4RNJA 2BVDA 3S1UA 2PGFA 3HFTA 2XVGA 3WQ6A 3PZTA 1KM3A 2G8ZA 4KF1A 4PCFA 3RHGA 3CEUA 3EPOA 3HQOA 1KRAC 3NZPA 4FZIA 2VVSA 3P2VA 1Y5WA 1K70A 2YA0A 3S42A 2Z7KA 5BU9A 3M0IA 4K8GA 1IZJA 2O9RA 2VC7A 5F4XA 5G1YA 3B9EA 3MMUA 1LM1A 1WDQA 2HBVA 4KCUA 1XPYA 1VYRA 3E49A 1J4EA 3QSTA 2ISWA 1QW8A 4OZOA 2CIPA 4BWLA 3B0YA 1I0BA 4QIUA 2YA2A 1NSJA 2WVUA 2RH9A 1OC7A 1JNEA 2GK1A 1RLDA 3T7VA 3AC0A 3EXTA 2BLEA 2W27A 1LWHA 2IKIA 3VGGA 5HWNA 3T2OA 4KWOA 4PTVA 1NP0A 4ZQCA 3QPYA 2WCAA 3BZJA 3RJYA 4EWND 1K02A 2DT2A 1S1RA 2FZMA 3LPOA 3E74A 5E0FA 1X1ZA 1K6WA 3EX6A 3TKFA 2O92A 4MM1A 2WZHA 1QK0A 3R25A 1RAKA 1OCBA 3RLUA 3TMQA 3RGTA 4E8DA 2WZIA 2PDIA 3G77A 5GJMA 1OSEA 1LRQA 1XFCA 1A53A 2X40A 3SCRA 4LAOA 4BHYA 3PPCA 4GXMA 2PDBA 3F4VA 2NVDA 4RNIA 3L4UA 1WDWA 1GHRA 1W1PA 4E8GA 2GQAA 3PTKA 1FXPA 1KC7A 2R1MA 4UCFA 1R3VA 2JBMA 3PY2A 1ZUAX 1YNYA 4UNLA 1ZP4A 1VR6A 3DX5A 4U3AA 1XISA 3NG3A 3QKZA 1FHVA 1R3TA 2Z25A 3OO2A 1X97A 4W8AA 1QOXA 1EJTC 3VFLA 2FH6A 1GJPA 4FLRA 3O07A 2CCRA 1XG4A 3E5BA 3WMSA 5LIWX 4D72A 4WDWA 2FZ9A 5GPRA 4RE0A 4LTSA 3T4WA 1WAWA 4Y9MA 2VDIA 3VOHA 2GZXA 4TMBA 1Q6DA 4ZA0A 1PIIA 4IP4A 3BOLA 4X61A 3F5LA 5A6LA 3DBPA 4FF5A 4WX2A 4ZOEA 3CIXA 4ZQRA 4GGBA 1SZEA 1SR9A 1UUQA 4J27A 3DDMA 3LERA 2Q71A 5HAOA 1L0PA 2BY3A 3IRDA 4JL2A 4FXJA 1KA9F 4MMWA 4FX6M 7ODCA 1PPIA 4G2DA 4RUBA 3OODA 4LALA 2Q09A 1UIOA 1US3A 4X9SA 3PFMA 1EF3A 3LV6A 1QPOA 1ZRQA 2ODOA 3KP0A 4FR1A 3SZ8A 1S2UA 3LCHA 2VRJA 3BAKA 3PNZA 4MAVA 2QGYA 3W27A 3KOZA 2JALA 1MXGA 4LRTA 3SY5A 2NXIA 2Q6ZA 2GSEA 3GXFA 3LZ3A 3V0SA 4ACZB 1PAMA 3OTRA 5CBIA 3MU7A 4XV0A 1VPXA 2ACRA 4AYGA 1W9DM 2VZSA 3B97A 1Q45A 3T4CA 5TAOA 2CBUA 2WLZA 4GFSA 3SIZA 4QEEA 3Q2DA 5LSMA 2PODA 3MSGA 1MW3A 3U0HA 3S2JA 4E6MA 1XDLA 5EU9A 3C52A 5MHBA 1E15A 2ZWYA 4WJXA 4XZNX 5KSWA 2Y85A 3P0WA 3SY1A 1JZ3A 3CV7A 4O18A 3LBCA 1UR3M 2Z7GA 3AZRA 3LMZA 1E3ZA 2IMRA 2XWDA 4OFCA 1F05A 2GYIA 5HINA 3E0LA 2PTDA 3NQ8A 5MF5A 4R34A 4YYCA 4UFKA 5CH9A 2WQPA 4QQUA 3W85A 2QAFA 1JRBA 2NUWA 2BY0A 3P8JA 1UPMB 4PA8A 1D3HA 2ZUSA 4AWUA 3PBMA 2BTMA 1G4TA 4DM1A 2IKGA 3M41A 1RJQA 3U2ZA 4B3KA 4JTHA 2RHGA 4DO7A 5G4EA 3GHUA 4OECA 1E4IA 3H2CA 1CBGA 5CC3A 4IIEA 2XIOA 2V9DA 2QAPA 1XBXA 4UTTA 3VKCA 3VNLA 5ABFA 3CQKA 1HJWA 1XIMA 4ATDA 1GCYA 1Z42A 4IOTA 4CNNA 3WSUA 4H9YA 4IGNA 3R0UA 5ENLA 4HK7A 3GKAA 2UY3A 1FWCC 4DF1A 5M3WA 5K3VA 5EBUA 2XH0A 1QHPA 4LC8A 1E0VA 4IP5A 5KZ6A 1QOQA 1GVQA 1I0DA 3SDOA 1KWGA 1KFWA 1W3TA 4IH3A 1BWVA 3BMVA 4C60A 2YZ5A 4J2MA 1U2YA 1DJXA 1UASA 4ENLA 3O6AA 3OG3A 3NXLA 3IJDA 1F74A 3GTXA 4LUIA 1EO5A 2F61A 1ZLPA 5BWFA 3D3FA 4RZBA 2V6AA 4L6OA 1KLYA 1Z6KA 3WLMA 1Q6CA 4QE5A 4GX9A 1V0KA 4MYAA 4UQBA 3LI1A 4IPPA 4GC4A 4GQRA 1OYCA 4XKMA 1YXCA 3QFEA 3PZNA 1JCYA 1XG3A 5LZLA 1BYAA 4JEQA 4FA3A 2XGBA 1EC7A 1V02E 3OGSA 2PAJA 4A2SA 3AUOA 3TN4A 4LVFA 3MS8A 3AXXA 1LG2A 4BWLC 2Z2UA 1JF6A 1SPQA 4GKLA 2Y70A 1WO2A 3HG3A 3EOLA 2QPXA 4A8NA 2OVLA 1AMKA 3GD6A 1OIFA 1OT2A 3MKKA 4H7CA 3CT2A 4YVPA 4Q8OA 2PE4A 3WF2A 1TA3B 2VTFA 2YL6A 3LYEA 3P3BA 1H41A 4Q7NA 3GTHA 4NIRA 2Y24A 4FIQA 4ZBCA 2P88A 1BQGA 4GBUA 3UG8A 2WMGA 4B2DA 5K4XA 1V6VA 1VRXA 1OQFA 3UP8A 4R7OA 4R9OA 2WMFA 4J28A 1CIUA 5ABEA 2Y4SA 4A6GA 1E71M 2Y8VA 4MPQA 1BSIA 3R43A 2OZ0A 4JTUA 4AZ5A 3EOEA 3E5PA 4HYWA 3AHTA 3SM0A 2CLMA 1K7FA 4UB9A 1XBVA 5A6JA 2HISA 2J24A 1A4LA 4GQ0A 4Y8EA 2ACQA 4QLLA 2D0GA 4V28A 5CPLA 2CZEA 2WHLA 1R86A 1WZMA 1MNSA 4C6FA 1PKNA 3UJSA 4AFYA 2XIJA 1EHNA 3GTFA 3WUFA 3IV3A 1MSSA 1GZGA 1R3SA 1WKEA 2E6FA 4JDYA 2ACSA 3BSHA 4WKFA 4XK2A 5DY2A 1LORA 3CPRA 2E8YA 1B54A 3JW7A 3C8NA 3T0TA 1TRDA 4UZUA 3WBYA 1IT0A 1W3LA 1XCFA 4HVXA 4JTKA 3PWAA 1OFDA 1R38A 2ZADA 5E0KA 1LWJA 4F2BA 4RDZA 4IHCA 2XH7A 4U28A 4CN1A 2WC7A 4ZOAA 4DAFA 1PCKA 1UR8A 2J7EA 1PUDA 1ZALA 3S46A 4L56A 1F4AA 1S5NA 3W2KA 3I68A 1D3CA 1KGUA 3MMDA 4DXKA 1KGWA 5F4WA 4J3XA 2NQHA 3MP4A 3I3EA 4H00A 3VE7A 4BFAA 3WQ8A 4B3LA 5I6SA 3ANVA 3WD1A 1IXPA 4Q8PA 1SMAA 4ZO9A 4Z1CA 3MC5A 2ZTJA 3DGRA 4AZBA 1DIDA 4QJ1A 2VX7A 1NDWA 4XO6A 2GGJA 3RX4A 1VJZA 2R24A 3UXAA 4C6CA 4B91A 4ZFMA 4OOUA 4MNKA 1B3YA 4OBTA 1Q13A 3SN1A 2LLEA 4MAZA 2DZPA 4YTSA 3UXLA 3LY0A 2Y89A 1GK8A 3W75A 3AWOA 3B9AA 3CQJA 3C8FA 3MUY1 4I90A 4AW7A 1QBBA 3NPWA 4UQDA 3KOWA 3NM1A 2DW6A 2ZCGA 4L80A 6ALDA 4TV6A 4PN2A 5G1TA 1WCGA 2BGNE 2J9ZA 3N34A 1EOKA 5A69A 1SSGA 3FAWA 2AAMA 4LF1A 2J62A 2P3ZA 2VR4A 4JKMA 1RD5A 2E1WA 4WKHA 4GA8A 3EWZA 4D6FA 5B7YA 3IIPA 3ABRA 2A21A 3QC3A 3W7PA 1CENA 2E5CA 1Q63A 4NKCA 3ZM8A 3HPFA 2OKOA 4BCEA 3MMWA 2OELA 4TVDA 1W3NA 1UQYA 2A79A 3C2OA 2INFA 1XLKA 3JU2A 3H22A 3GE7A 3FCPA 1ESWA 4YMZA 2PB1A 2JF7A 1NEYA 3AO0A 2CBJA 2EHHA 2WKJA 4QSHA 2OPJA 1IGWA 3W2JA 4LFYA 1RPKA 4Z42C 3UG5A 1UD2A 2V5KA 2VX5A 1Y65A 3BW4A 1H62A 4M29A 4MSSA 5DEZA 5BRQA 1BVZA 1XCWA 3DN5A 1FWNA 2YIHA 1JCJA 4LQ1A 1FXQA 5EMJA 1QT1A 3NVTA 3Q67A 1EJSC 4HA3A 1R9YA 3L0GA 2AOSA 1AQFA 3SB0A 3QHOA 1JFHA 2ZA3A 1NOWA 1WDRA 4BI6A 5EY5A 4NNAA 2QDDA 1KFEA 3FEQA 3CL8A 4CCEA 4O19A 2QPSA 5C71A 3A4AA 3UJ2A 2VVNA 2NQ5A 3PBUA 3JS3A 2V2CA 1JI1A 4IXXA 3AZSA 3SN4A 4PMXA 4MKVA 1XI3A 2GJXB 1R85A 3W26A 4UZSA 1QBAA 4FMVA 3TW9A 4J3SA 4M1RA 4MLJA 3W7LA 1NQ6A 1BGAA 3R7MA 1SO6A 2RGLA 1IEVA 3NWRA 4GUGA 3ZLGA 4UFJA 1CNVA 2C6QA 3NQMA 2PDUA 1TZ7A 4XB3A 2KAUC 3LNMA 2A3CA 4QLKA 4IGHA 3AMGA 4BR1A 2DH2A 1GVOA 3BW3A 4REQA 1EUNA 2CESA 4O50A 3MJMA 4BF9A 3HGSA 4M0XA 5ABGA 4MOZA 4IZGA 2POTA 3VMPA 2WANA 4PEKA 4LEFA 1EGMA 4PYSA 5AYIA 3KWXA 5T8GA 3TTSA 3RDKA 2TAAA 4QHRA 4Z1AA 3H23A 1K7XA 2F2HA 4ZQMA 2QVNA 6CGTA 3IUIA 4W7VA 3N3MA 4UWMA 2CLKA 3TXVA 4GPNA 1YDNA 5HULA 1UA3A 3ZT7A 3APYA 3HO8A 4FNRA 1WKFA 4H3DA 5DX7A 4DXXA 4O1CA 1HKWA 1DP0A 4R85A 4ACZA 1OCQA 1XC6A 2Q8ZA 3UXDA 4Y9AA 2CEQA 3UBPC 4HMEA 1UWTA 4HB7A 1R7AA 1PXGA 3GXDA 3ARZA 3FYOA 3AWNA 1MO0A 3WF4A 3GVQA 3PUOA 4DX3A 1XLHA 1IXQA 2FPYA 4NJHA 4DI9A 3WLLA 9RUBA 1WBJA 1J12A 1XIEA 4WY0F 3WF0A 4HSOA 4BQ3A 3A5VA 2PBOA 1EP2A 2JF6A 3QW3A 3W7GA 1W1VA 3LEPA 3WD2A 3QTGA 3E1F1 5C9WA 3O8AA 4ATWA 1MMFA 2WLYA 1PDZA 1GJUA 3C0JA 3ZMRA 4DUVA 5LNUA 5FACA 3ME3A 2OZ3A 3RPDA 3L7RA 1LLWA 3AYSA 3BCFA 3B4UA 2BHZA 3W1UA 1FBAA 2Y62A 4AZ7A 3HGRA 3IGSA 5GNZA 5EL1A 4M7SA 3W07A 1CXKA 2HJPA 3C6CA 4IPNB 3WF1A 4ACYA 1SFSA 2OCZA 4MYXA 5C70A 4Q8UA 1SJBA 4FNQA 3G22A 3KX6A 1CLKA 3QMSA 3AHZA 1TWDA 2DEPA 1NVMA 2PF0A 3MCMA 2J47A 2O7SA 2XISA 1V4YA 1UHVA 2J25A 4DNMA 2WXDM 5D05A 2E9BA 3IJ8A 2YFOA 4HT3A 3JZEA 3EKGA 1UP3A 1X7FA 4PCNA 1QJWA 1CXLA 3M07A 1EJXC 2G97A 1CI1A 5A6AA 4R7WA 5DMNA 1HJSA 3P74A 3OGRA 1Z41A 2QZRA 4MNJA 5A8GA 2WNQA 4D1IA 5G2HA 2YB4A 4AX7A 4CD8A 1DV7A 4LBRA 3EMCA 3UCCA 3PS7A 3NQDA 2DZSA 1KLZA 2GSJA 2HVMA 1TTQA 1MW1A 7PTDA 3GKFA 3TCEA 4QP0A 5D8ZA 1KFKA 2D2HA 3NURA 3G6LA 2C0HA 3W53A 1TVLA 4GG9A 4C6PA 4NX0A 3L66A 3AIBA 5D2TA 2OEJA 4DVOA 2Y7EA 2PDMA 2HTMA 5EBAA 4R5EA 1VFHA 1B1YA 1MEHA 2DJXA 4C91A 2J6VA 2D23A 2WVVB 4LY8A 5FAGA 3AMDA 2BY2A 4D2JA 4EPKA 1GEQA 2Z2AA 3WJSA 2XU2A 4E3VA 4GQQA 2ZZ7A 1V93A 1G6CA 3CZGA 3S1WA 1MUMA 2VWSA 3R11A 4CCZA 3W2LA 1C93A 5A8OA 2BASA 5C2GA 5AZ0A 4IQDA 5CG0A 2D22A 1CECA 1I2OA 2XWEA 1H5YA 3T0DA 3LM3A 1XBZA 3TIMA 4Q6XA 4FOUA 3VU2A 1H11A 2VMFA 4AD1A 1QW7A 2GGGA 3TW6A 3LI0A 1TA3A 1PYFA 1J96A 1V6XA 1YTKA 5FEWA 1WB0A 1UD6A 3W81A 2VENA 2PRLA 1BGGA 1G94A 4MB3A 2QEZA 1XLMA 2ZRUA 4LNYA 1JPIA 4TIMA 3V3WA 3NSMA 1IF2A 7XIMA 2Z24A 4I6VA 1C9DA 1TIMA 2FTWA 3C61A 4PUEA 4BS0A 5BRBA 9CGTA 4HU3A 1IEXA 4H7ZA 3IS4A 1ZAJA 2P0OA 1XLLA 3T0BA 1VFFA 1EL3A 3CLMA 4A21A 3HIJA 1VZWA 3BJFA 5AHIA 3FX4A 4QJ5B 2RJHA 1H7WA 5LKYA 3HV8A 4MPKA 4FEZA 2OMAA 4X63A 1TQJA 4Y9OA 2YSWA 1VBUA 3QOMA 3DU0A 1GG1A 5E0CA 4PFMA 3W76A 4O54A 3KS6A 4JHOA 3M16A 3M7WA 1M41A 3OZPA 4L9XA 2WMKA 1NFBA 3RLVA 4LGXA 4FI4A 2CZDA 1JG9A 5IBXA 4ZGYA 1MFUA 3I3BA 3CB3A 4IIGA 2W92A 4C7GA 1N2VA 3F5KA 3RMEA 3A47A 4LY4A 2PLCA 3RX3A 3E0WA 2YLAA 3ITYA 1PTDA 1NH6A 4A3HA 5C2XA 2IQ0A 4JQAA 4FX8A 3WQFA 4C7FA 2ZWZA 4QE1A 3SRDA 4A3YA 1GOIA 2V8ZA 1TX2A 2PMQA 1MUWA 3ABOA 4PUWA 3MO4A 4YXGA 1ODUA 1XXXA 4GIEA 3QGAC 2Q8LA 1PYMA 3M46A 1A5KC 3VD5A 3BE7A 3ITCA 1AODA 4LUYA 4U2ZA 3BL3A 2JKPA 4XAYA 1OHLA 3QLLA 2ZRYA 4H9VA 4QTGA 3NZQA 5ABTA 2VUYA 1K8CA 1MUCA 1PDYA 1YRRA 1KBBA 3O63A 4BKNA 3A13A 1M03A 4X22A 2PI6A 3TCSA 1PJ9A 1Q8AA 3L68A 5DRCA 3AIQA 1BYBA 2C15A 4EK7A 1TPVA 5LGXA 3SCVA 4MWAE 1JYXA 2Z1KA 1LWIA 1W3IA 2QT3A 1QPKA 4LU0A 3TJLA 4R7JA 3BH4A 3CHCA 1H7OA 1H50A 3KHJA 3VIGA 4CD5A 5HJYA 4BQ2A 2VFGA 3QGVA 4NG3A 1QW9A 3N2CA 3W01A 3ARRA 3WY1A 3U57A 1KBLA 4LCSA 1JGMA 3NO5A 3OIXA 1RCOB 4S3DA 3VZYA 5DELA 2AL2A 3FKRA 4HKPA 2R91A 1ITQA 3W28A 2QCHA 1FUYA 5CC5A 1JAEA 4WXZA 5CG7A 1FCVA 1OX4B 5C54A 3EZ4A 4DBEA 4J4KA 2WWCA 5AHMA 3UPMA 3RK8A 3E02A 3LK6A 5E9XA 4WR3A 4Q7IA 4C1NB