1ZPTA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
271
Chain Sequence
HASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 271
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zptA00
1TJ1A 2FZNA 3E2QA 4JNZA 1TIWA 1B5TA 3IJDA 1ZP3A 1ZRQA 1ZPTA 2FZMA 3ITGA 2FMOA 3APYA 1TJ0A 3FSTA 3FSUA 3APTA 1ZP4A 1TJ2A 2FMNA 4O8AA 3E2SA 3E2RA 4JNYA 1V93A
chains in the Genus database with same CATH superfamily
3GKAA 3W1PA 4IQDA 4RZ6A 1KRCC 1M1BA 1T40A 1J10A 3N2XA 4NAFB 5HPCA 1CGUA 2OX4A 4DWSB 1E56A 3BGGA 4IG2A 2Q09A 2G96A 2ONEA 3S9IA 2D2GA 4NASA 2NT0A 1BXCA 3UBPC 5BXSA 3M5VA 4IUGA 3CJPA 1OIMA 1PVNA 2PP1A 1FWBC 5M17A 3SJNA 3AMCA 3IAPA 5AYBA 5E9XA 3WQ5A 3HG3A 2FZDA 3CL7A 4L1XA 3GIYA 4XQ6A 1VFSA 2QT3A 2JKAA 1RCXB 4ZB2A 5HA7A 3VPLA 1DJGA 3QY8A 3IJ7A 3LHZA 1S2WA 1SFLA 4GXPA 1XUZA 3TFXA 4E3TA 3PJUA 4DO5A 4C6MA 1QW7A 2WQPA 1UZHA 1JPDX 1HZYA 1NFGA 2X1UA 1LF1A 1W1A1 2PWVA 4AISA 5CC3A 4DI8A 1SJDA 4PN2A 3R10A 3MHFA 1HL8A 1FWNA 4BI5A 3WLIA 8A3HA 4EAMA 1AD1A 4G8TA 2ZDSA 1BRLA 3RFAA 2QVNA 2WVVA 3S5ZA 3HPZA 3UZJA 1IEVA 1IGWA 1D8CA 2Q3RA 3MSDA 2W67A 4DBUA 4IMDA 3RIKA 1XLBA 5DT5A 5AYYA 3B0XA 2BS9A 2YXOA 3ENLA 1HT6A 4UTUA 1XYCA 2DT2A 1Z69A 2FTWA 3M5ZA 1RLDA 4IFRA 2HEJA 1RLCL 2YCKX 1GCYA 4NZJA 4NU7A 1ZP4A 4OQVA 3MW7A 2C16A 1GKRA 5AHMA 1QT1A 4OOUA 3N2TA 2PDCA 2MUCA 3WBAA 5IFTA 3RNDA 5KEZA 2CZ5A 1UD2A 1PO9A 2C6QA 4WXZA 3N13A 4Z2IA 3CB8A 1A5SA 3DFOA 1X98A 2BX7A 3KBMA 4IP4A 1KQZA 4D6DA 1B90A 3EWDA 1VHNA 3TW9A 3ZJKA 1WDQA 2IKHA 2VDIA 4JTRA 1HJXA 1EB3A 5T26A 4TX9A 2BHYA 1E9LA 4PRTA 2Y24A 1K8ZA 1G7UA 1YDNA 5KSWA 1Z42A 4HZMA 2DPEA 2QV5A 3PZOA 2RGLA 1FKXA 3HV8A 3N9SA 1DQWA 2A7NA 5ECUA 5F2LA 2YCJA 4QLLA 4PTWA 4MB3A 3LBMA 3WF4A 2XM1A 1K70A 1UKTA 1A0EA 3ZVIA 4PZVA 4AZGA 1Z6KA 3ABZA 3LB0A 1UR1A 4LVAA 1UWIA 2GVGA 4TX6A 2ZA1A 1JDDA 1IV8A 1LT8A 3PBGA 1N8FA 3CHEA 2ZUNA 3TFCA 1YX1A 1X8FA 1S2VA 3WLKX 3OYXA 2C8NA 1IGSA 1YEYA 1L8PA 3K8KA 4XD5A 4MAVA 3RGTA 3KTXA 1R3VA 1FDZA 4PL2A 4PCFA 3M64A 1MUCA 4DZIA 1WB0A 1HJVA 1PTDA 1E1CA 2QAFA 2A3EA 1UASA 1S5TA 2EKCA 4J3TA 1MI3A 2Y7EA 4QG9A 1QOQA 2WSPA 2AQOA 4ZSUA 1TPWA 3T81A 1XW8A 2NUXA 5C9XA 3NIYA 3IARA 4S3KA 3BW4A 3L4YA 4MB4A 1FHVA 1HG3A 2P53A 3GC4A 5AYXA 3QGVA 3V0SA 1XLHA 3TP4A 5I3GA 1E3ZA 2BBFA 3V35A 3SQLA 1DPMA 3WK2A 1W9DM 1XIJA 2E25A 1JIBA 1TQJA 3SIMA 1E6SM 4MWAC 3IIPA 4DJFA 2Y5SA 4RZ4A 4EWND 1OT1A 5F1VA 3W02A 2DV0A 1XLFA 2Z7KA 4HMDA 5F1UA 4F0SA 3AMGA 3REQB 4ADSA 5CXPA 1TPEA 3AI0A 1ZGDA 5A6KA 2P8BA 1MYRA 1MZHA 3ECQA 3QKEA 2EPKX 2PTDA 2WZTA 4FOKA 5IHSA 3BE7A 4YIWA 2XVPA 1TTPA 3AWOA 3HO8A 4MKNA 3P14A 5CGQA 1DJXA 1ZL1A 5A2CA 1H0IA 3EPNA 3R8GA 3RRXA 3LQGA 2QYGA 3L4ZA 3UWWA 2VELA 1HKKA 5D9PA 4JTFA 1TV2A 4G2DA 1R8LA 2VWSA 4IF2A 1BYBA 1W5PA 3NDYA 1OCQA 2PURA 1Z8AA 3MI2A 2QJJA 4OUEA 1UR9A 1W1IE 2ZX7A 3S5SA 1EEXA 1C29A 1ICSA 2YKKA 3DHDA 4C91A 1EL3A 4M24A 1GW1A 1WP6A 2G5WA 2XVLA 2PDPA 4XUGA 3W1NA 2PDQA 1QNQA 4IP5A 4JIQA 4D6EA 1H11A 3CYJA 4XBSA 2ISWA 4UTJA 3URNA 3E0IA 1Z9AA 4EXBA 1Q6OA 3S8HA 3ARTA 1OCJA 3IRDA 4JYEA 4FIQA 3ZT7A 1LBFA 4QAWA 3M41A 3NQVA 2Q6ZA 3H53A 2IPJA 3SRDA 1FCQA 1TJPA 4GZIA 4Z2KA 4NNAA 5LNWA 4EPKA 1K9EA 3TYCA 4NI8A 1NEYA 1S3HA 3KX6A 3DHFA 1T6MA 3MHGA 4MNJA 5HNNA 4ATDA 3IJIA 3VOJA 4P5UA 1WNOA 2PDHA 3MUY1 5FI8A 3ANVA 4Q22A 4S3JA 4JTLA 2YDRA 2D0FA 3H2AA 1R86A 2WLYA 2GQ9A 1XG3A 1ONRA 4IIGA 1DIOA 4ROQA 4AQLA 3ZR4A 3QOKA 4ZO7A 4ZCWA 2FDMA 4B5UA 1O5QA 1V7YA 1TWWA 4RPPA 4BKNA 3SCSA 4AWUA 1FA2A 3PZMA 4X22A 1CDGA 5E9AA 3UPMA 4QCEA 6TAAA 1TWZA 4GZEA 1VFUA 3P60A 4IIDA 4U31A 4J3UA 3B8UA 3WDIA 1OFEA 3QZEA 2YDSA 4I9MA 3ERPA 3FN9A 4ZGYA 3BJSA 2ANUA 2DQXA 4OOZA 3TK7A 2Y7DA 2J6XA 1V4YA 4O14A 2W91A 4XAFA 4KFPA 1PYFA 4H6QA 3OVPA 4J3XA 2IQ0A 3QFWA 3F4WA 2Y1HA 5HINA 1K1DA 5DF0A 3NAVA 1TJ1A 5A2BA 3LBCA 1IT7A 7A3HA 3PVFA 4NNCA 1VEMA 3M0LA 3R0UA 2XU2A 1O12A 4HCHA 1DXIA 4CN4A 4DPPA 3IAQA 1KRBC 1DV7A 3EYPA 4GNJA 2Y0FA 1A5BA 4AD2A 3M47A 1H7PA 5LNSA 3SECA 2OYLA 1PJ9A 2CHOA 5FEXA 3BMVA 2QJMA 4HMNA 1UBPC 3NNTA 4LBRA 3CWNA 1PX8A 3L0NA 3LHWA 3A64A 4DBEA 5EFDA 3OA5A 1G01A 2HV5A 1L6YA 3CM4A 4P8WA 3K13A 4J5NA 3VM5A 2BNJA 4UZUA 3P62A 3VUPA 3C0SA 1W17A 1UPPA 3CAVA 3K4DA 4CQCA 4WDTA 3AUOA 3TOPA 3LD5A 1QI4A 1H7OA 1PUDA 3H7RA 4MWAB 1XHGA 4D9PA 2AAMA 1MFVA 5PTDA 1FWDC 1HJWA 1VFFA 1IT0A 1Q6LA 2ALDA 1BWLA 4X0VA 1R30A 1GOOA 3MWCA 2HBVA 2JF7A 1XKJA 1BF6A 3R94A 3MKCA 1LOSA 3ABXA 4HCDA 1AODA 2INFA 3S2NA 3GUGA 4Z2JA 2OLAA 2PFHA 1HIZA 2OTDA 1BF2A 3SFWA 1E4NA 4ZQCA 5HQLA 2JEQA 1YE6A 4K8EA 1E40A 1E0XA 3N18A 2PTWA 2X0SA 2OEJA 1RVGA 3WQWA 2IPGA 1ISZA 5HWNA 4WR3A 2E6YA 3WMSA 3ARZA 2ZE0A 4QE5A 3LMZA 1OD0A 3G8EA 4FPSA 4OUIA 2Z27A 1XRFA 3N04A 2DQWA 2YSWA 1JPMA 3G1VA 3FDGA 2WJEA 3K30A 1TIWA 4KQNA 3ID7A 3SB0A 2GJPA 4U5KA 3WNLA 2UWFA 3VXGA 3KAOA 1XLCA 2W63A 3TU9A 1XC6A 4H19A 2R1PA 2VFGA 3WF1A 4LC8A 4MY1A 4KIEA 1N8WA 3TYDA 3C0LA 4UWMA 1OX6A 4OHQA 4QTGA 4FMVA 3HPAA 5LXXA 2QJNA 4LF1A 5EFFA 1XIFA 1UH4A 3SCRA 3EWCA 1ZJBA 3KOYA 3MSYA 4MFDA 2J77A 2OJPA 4KCTA 1SFSA 1MO0A 2QIWA 1TJ2A 3CH9A 3NTYA 1AQMA 4C6JA 1EQCA 4LQ1A 3TLLA 4XTDA 1IEXA 1EP2A 3AYTA 2O56A 1R3QA 4JTTA 1WCGA 3BCJA 1PV8A 3VI2A 3QR0A 1ZCCA 4DXXA 3KHJA 3KFTA 5E5CA 2WNNA 3PC0A 3CAQA 2CKSA 3CC1A 3E0WA 3ALFA 4MDOA 3AFBA 5BU6A 2WBGA 3AIQA 3Q67A 5K4XA 4ZE5A 3NQFA 2MANA 3ARQA 3PBUA 4H1ZA 3S47A 4FNTA 2AOSA 1RQEA 4WDXA 3D5HA 3GU9A 5DBUA 1NP0A 1RBLA 2OO0A 4UQCA 4WJXA 2HJPA 4E4UA 3PANA 1TUXA 4A2SA 4PMXA 2WSQA 1M65A 2NV1A 4WX2A 3WF2A 1F8IA 3HMCA 4CNPA 8TIMA 1KD0A 4AWEA 5E0CA 1XLEA 1SO6A 2P76A 1PIIA 4M6UA 5BWAA 2CLMA 2GJNA 4PE8A 3AMDA 4YHEA 2ZTKA 3QGKC 2YBTA 1TWDA 2YJQA 1OK6A 1YADA 3KP1A 4G1NA 1E9IA 1H62A 2Y61A 4ZQMA 4ASTA 2E28A 1E6QM 1Q7QA 3SN0A 3G3DA 3C2RA 2YYUA 2GK1A 3TTQA 2ATSA 5A6BA 3OP2A 1JD7A 1R3YA 1GYMA 2ZX9A 4JTSA 4ZOEA 3S2CA 3OIHA 4JTGA 3AXHA 4RDWA 4H8NA 4P61A 5F4XA 2DJXA 1XLLA 3ANYA 5IFPA 2OFJA 3FGCA 1GNXA 3TC7A 1C7SA 3GNXA 4C6NA 4P7LA 3FCPA 4N7QA 3POHA 3HPFA 1IIGA 3FXYA 5J5DA 2QNEA 1RK5A 1FP9A 3SY5A 3E1F1 3UA4A 2O4QA 2V67A 3QQ1A 1X38A 3NZ1A 1L0PA 4IFKA 3RG6A 2QR6A 4IM4A 4LBUA 3RF9A 4S38A 3FV9A 1E6XM 2IQTA 3KL0A 3LGEA 5F4WA 4XKYB 3CU2A 2J7EA 4IT1A 1UP2A 2L5HA 3GAYA 3GM8A 9XIAA 3PAOA 1CB7B 1LL6A 5ABGA 1L8NA 5FEZA 1TCDA 2FJKA 3S5NA 3VX1A 2YCLB 4UZSA 2VFHA 4PEKA 3NR0A 5DMLA 1F9CA 2WVUA 2PMQA 3GG8A 2E7FA 1U5JA 3NOYA 1PE1A 4UQAA 4GK8A 1DWIM 3TJIA 1MNZA 4LAUA 2IPWA 4LVFA 4C1NA 4B4HA 2NQHA 3EB4A 4PMUA 2P5NA 3ZSSA 3A6OA 4O0QA 3W25A 1SZGA 3AICA 5TAOA 2QDEA 2GGEA 1QR7A 4HZ6A 3LCGA 2Z25A 3P7YA 2X40A 3PAJA 1DTNA 1N82A 5KTLA 4DUWA 4B5SA 4EPBC 2ZZ5A 3CTLA 1LTDA 3MZNA 1XH1A 3O3RA 1DWAM 1IYXA 4Q8WA 4PULA 2X42A 2IMRA 4BHYA 1HKMA 1EJSC 2WKJA 4FLRA 4D8LA 3EPMA 3DFTA 4RDYA 1HO4A 1OJXA 1VYPX 3VKKA 1UUMA 4X61A 4WEVX 2OG9A 4B5VA 4S3FA 2XUCA 3DESA 5CKSA 1QFEA 4E6MA 2R1MA 3G24A 1RCQA 4Z1YA 2CLLA 3V16A 1SU5A 5FOOA 4JFUA 3EX6A 4ZBCA 1JYNA 5AFDA 3U2ZA 4H6KA 3UJEA 3A12A 3GXDA 4O1DA 4AZBA 3W1LA 4DZ5A 4H83A 3GZ3A 1Q63A 1K77A 4I90A 3EDKA 3ATZA 1KRAC 3E49A 4QEHA 1UD3A 1A3HA 4D71A 4F3HA 1ZJIA 3TQKA 3ES7A 3W2JA 3W71A 1HKWA 5A3HA 1IIHA 2XPKA 2WYSA 4QJ5B 4O28A 1CENA 2YA2A 1C8XA 2ZDRA 5I02A 2HBXA 1FKWA 4I9AA 4NXKA 2JKPA 2NWRA 1UB3A 2QGHA 5DMMA 2FB2A 2FZNA 1A5AA 1SSGA 4MPQA 4IGHA 3MP5A 2QPXA 1RD6A 3VKBA 3UJRA 5DFAA 2R9RA 3QYQA 1J11A 2AGKA 1AZ2A 3I68A 2VZTA 4NYUA 1S2TA 2UZ9A 1LJYA 1WBHA 4F0RA 3E9AA 5E0KA 5DY3A 4O8RA 3ZT6A 3UD6A 2INEA 1KXQA 1UWQA 3HGOA 4CKQA 3MV01 2E6FA 2QV4A 2AKZA 4M3PA 2ICSA 4MB1A 5J5RA 2J9ZA 2Q8XA 2P8CA 3OHMB 3W85A 2F61A 1BYCA 1OC5A 4E3VA 1UMYA 4PH6A 3CT2A 4JFVA 5GNXA 2WMKA 5CC5A 3NQDA 4NX0A 1OCBA 5L6UA 1XSIA 3AUJA 1OF8A 4ZOCA 3UPBA 1M5WA 1U22A 5CJ5A 3KBSA 1WBJA 2NV9A 2QVHA 1JZ2A 4JY9A 5C55A 4A6GA 3L12A 1W9XA 2Z00A 4YLWA 1QBAA 1U5VA 1US2A 3GW3A 3H2CA 2GQAA 3N34A 1Q6RA 1XRVA 4AX6A 3W7DA 3QMTA 2Y8KA 4DQWA 2J62A 2J78A 3CV7A 3TE9A 3ZJ7A 4JIRA 4IUOA 4CVUA 3TC3A 3GNOA 1MUMA 1KCXA 1KKRA 2WSRA 2WANA 4B9ZA 4BY3A 3GXPA 3QGAC 1D9EA 1GVRA 2HQAA 1LRNA 2NVCA 3O0KA 2J27A 3B8IA 4MLJA 4NJHA 3CMJA 1XLMA 1OGGA 3MQTA 1JYXA 1XL9A 4FF5A 2HVOA 3WY1A 1E9ZB 5D2XA 1P7TB 3GAKA 4DEFA 4TTGA 3B05A 1WQ5A 3WLSA 5EBAA 1TMQA 2QCCA 2XGBA 3BURA 3WBWA 2PBOA 4J35A 2W62A 1TVNA 1R46A 4AF0B 4PMZA 1MVYA 4AWSA 3GG7A 1TQXA 3C2YA 2PLKA 3URAA 4PMDA 1MW3A 4C7DA 1EJ7L 1NU5A 1PDYA 1MUWA 1A47A 3SCUA 3L23A 1TELA 2CWNA 4P8XA 4JICA 3HA1A 2BOFX 1VKFA 2V5LA 5EA9A 4MY9A 7PTDA 4RW5A 2PP3A 5CZ0A 3AHYA 1W9UA 2RDUA 3WLMA 4ZXOA 1SR9A 1G4PA 1G69A 3C0QA 3A9IA 4V28A 1XX1A 1Y65A 4K7VA 3P8IA 1CYGA 4HP5A 2REQB 1JZ5A 1HL2A 5DCEA 4JYFA 2BOGX 4LJ3A 1UQYA 4K6AA 4YCPA 4L6OA 1F4HA 1VC4A 4PTMA 1UROA 4OT7A 2W92A 1FWWA 3WYZA 3QKZA 3GXFA 3D3AA 4Z17A 3CV1A 4EXAA 1ZALA 4JEJA 3E0LA 4GA8A 1ODUA 2VGFA 3D0CA 1W9VA 4HN4A 1ADOA 1M9HA 2I1OA 5KINA 2FGZA 4ZODA 5LNVA 4HHHA 4ALDA 3OU8A 4MMWA 1GQKA 3B3DA 3HJEA 2O92A 4O11A 3LUTA 5XINA 1YDOA 5LIUX 4YS1A 3L66A 2EAWA 3OLDA 1JDAA 1V0KA 2XVGA 1M41A 2ADAA 3ZO9A 3BG3A 3R12A 3KS5A 2V0TA 4KEVA 5CJMA 3VNDA 3B0VC 1T5AA 3NQ8A 3QR3A 1HKJA 3LV6A 1DL3A 1H41A 1JGMA 4H6RA 4JTCA 2P10A 1FCVA 2FZ8A 2OSXA 4XO7A 1GK8A 3CNYA 3L7RA 1W91A 5IDIA 4I8YA 2I56A 3KXQA 1FVPA 4XB3A 2WWDA 4AMCA 1HUVA 1EX1A 4NX5A 3CUGA 1C93A 4GYFA 1OFOA 3C2FA 3GBEA 2XN0A 3QV8A 2WCAA 3BW2A 3QZ6A 2OMAA 5G1TA 1H51A 1VEOA 5C6MA 1T96A 3KVLA 1M7OA 1DTUA 4H8UA 4QX4A 4ZQNA 1QPRA 1ESWA 1S38A 1Q6GA 4L9XA 4U5IA 3CLWA 3BTNA 4W87A 4NF7A 3V75A 1UKQA 3LXAA 5M1TA 1OG0A 5FEWA 3NDZA 4UNIA 4I9JA 2GSEA 1WKDA 3UXKA 1ISVA 4PBEA 2J66A 2ZICA 1VFOA 2QUUA 2PDNA 4Y90A 4URIA 3OB8A 4AZCB 4P8VA 4AHOA 1JUBA 3KWSA 1EOKA 4L1GA 3VZZA 1UWSA 1LP6A 4RW3A 1TZ9A 1WZLA 3HG2A 2YOCA 2CBUA 1BKSA 3CPGA 3QM3A 1Q3NA 1GG1A 5A6SA 3M9YA 3LX9A 4N6EA 4HJWA 4RCXA 1EC7A 4C6BA 3U7BA 4BZYA 2XGIA 1JZ3A 3ZR5A 1NDZA 4E2OA 1R3WA 2PDXA 4H8VA 1YYAA 1VJIA 4C6OA 4AYSA 3LN3A 1GJUA 5G4WA 5G5IA 2PDIA 3AXMA 3WUBA 5CBIA 3O8AA 1AQFA 2E68A 3WD3A 1F74A 1QO2A 2C91A 1E15A 1HXJA 4K2SA 3CZGA 2BFGA 2J13A 1V7AA 2B7NA 2E4TA 4RE2A 2CXEA 3W86A 1DOSA 1XISA 4DJFD 4W84A 2FIQA 3LZ3A 1V08A 4QAIA 1LBMA 3M07A 1ZBVA 4XVEA 4Q7IA 3NGJA 3G18A 4JY8A 4UFHA 5D38A 3FHAA 4LUYA 4EE9A 5I77A 3DECA 3LENA 4HA4A 1Q13A 2O55A 3VDHA 4L6DA 3MSGA 1AL8A 5A8PA 4M51A 4UMBA 1GOIA 3GSMA 1XCWA 3BCDA 1F2JA 1JZ7A 1GEQA 8XIAA 4CEXC 3HQPA 2VGIA 3KOZA 4GINA 3DXIA 2Y7GA 4JNZA 4AXNA 2YL6A 3GDBA 1ZPTA 4KT2A 1V3KA 4FAMA 4ENLA 3CZEA 4S3AA 1S5VA 3MU7A 3SDOA 1XLDA 3W01A 1B3ZA 1VB9A 4NVTA 1W3HA 1QPOA 3WBYA 1S1PA 2E9MA 4N2YA 1OYAA 3TROA 4UTFA 1JVNA 3LSCA 3OW1A 4K36A 4PMNA 2NLIA 3VZYA 1KBJA 3LQLA 3U2CA 3LXCA 4BS0A 2J7BA 2XH0A 4S2BA 2G8ZA 2OPJA 5FJJA 3VYLA 3F2DA 3PSWA 4M81A 4JHOA 4A3QA 2PLJA 3CHCA 1H7RA 2YLAA 3VFLA 1A3WA 3WD4A 4UC5A 1QHPA 3OGSA 4G7EA 2EBNA 4C6EA 2XVNA 4M29A 1AL7A 4F9DA 1XLAA 4JQAA 3SY1A 1YDVA 3U8GA 2A7PA 3VKAA 1SPQA 1GZJA 6A3HA 2IPFA 4ILSA 4DLMA 1WDRA 5H1WA 4B92A 3RM9A 5A95A 2YFOA 1E0TA 2WPBA 1UR0A 1FH9A 1V77A 3FJNA 2Z24A 2ZE3A 3PBVA 3SGGA 2GSHA 4J3VA 3N3MA 4K37A 2YA0A 1NSJA 3OJGA 2FH6A 2VUYA 1OC6A 1TSIA 3SFKA 2PSNA 4ZFCA 4X9YA 4N02A 4NNBA 1KC7A 3KUMA 2R8WA 1D3GA 1B54A 1LBLA 2WLZA 4GYJA 2V69A 2GGGA 4ACZB 1F6PA 1H1YA 3G0XA 4LPCA 2CZFA 1M53A 5HJYA 3UWVA 5DXYA 4R7JA 1IEWA 1XLKA 1DORA 1SSDA 1E6RA 4F0HA 5MF5A 4DJEC 3T7VA 3V3WA 2DH2A 1EGZA 2YL9A 3AS1A 1Q2RA 2HS8A 3U6WA 1Y7VA 2Z28A 5HOSA 1AW1A 4DO4A 2J8FA 5D9OA 5KETA 1YIXA 2V2HA 4ML4A 1XIGA 4OFCA 3TNBA 3UCQA 1ONEA 3GDMA 1KM4A 3AO0A 4LUIA 1HJSA 1NTHA 1S2UA 3WLTA 1QUMA 2GJLA 3OO2A 3D47A 5A94A 3E5BA 1OC7A 3LI1A 2ZZ2A 3IJ6A 4M5PA 3V36A 1R47A 1O1HA 3SCQA 3CO8A 3G8RA 2VUNA 1AH3A 2YA1A 3CV6A 1Z41A 2VM8A 4E8DA 1DJYA 1JYWA 1A4MA 3EZ4A 4JOMA 3CIVA 1XLGA 3A21A 3W2KA 3I3DA 3UT0A 2B7OA 4LRSA 5EL1A 4NRRA 2J7HA 3GKFA 4LCQA 3GE7A 1M3UA 4PRWA 4WSJA 3CIWA 1XH2A 2WMHA 2X41A 2PGFA 3QY7A 1E1FA 1GQNA 2H3DA 5LIKX 1OFDA 3H2NA 1TE1A 3LY0A 1EA0A 3FYOA 2QCGA 4CNTA 2A3HA 2QF7A 1P48A 7XIMA 1Z44A 4U3AA 3WQPA 1W3KA 1UJQA 5D8WA 1F3WA 4CQDA 3B9NA 3SI9A 2EPHA 3LLDA 4AD5A 1XDLA 5F4SA 3UF9A 3OEXA 3GXTA 3NOEA 4HPNA 2YPIA 1V02A 2E0PA 1O6IA 2E8YA 3AXKA 4YTUA 1FY6A 4UTLA 4XWUA 4LAMA 2Z2BA 1W1ZA 4TVDA 5CPNA 4WDUA 3AAMA 4KMQA 3B8SA 1KKOA 4NJKA 5FACA 2E77A 4LY4A 1TPH1 3ARYA 2F7FA 2YB1A 3BLKA 2D23A 3XIMA 5IBXA 1BVWA 5FJUA 2D24A 4IH3A 5HULA 3CZLA 1V3HA 3FHQA 3AMKA 2PD9A 1GYNA 3UETA 2NUYA 4KCUA 2DZPA 1NDWA 2VT0A 3PS7A 3GU2A 1TYGA 2EG7A 1PL9A 1F3EA 3BUVA 1ISYA 9CGTA 2W4XA 2BODX 4DM1A 1S39A 4GE8A 1KCLA 3ARPA 4BF5A 3VA8A 5JXQA 1W1YA 1E5JA 2C15A 3ZJ8A 4C65A 4N9DA 3NQBA 1MRAA 3H4GA 3MV11 4HNNA 3RLGA 3IUIA 1O5XA 3BANA 4UTHA 4QJ3B 1CT5A 2D3LA 4FNSA 1KTCA 2DSWA 3N15A 5BRPA 1BEUA 3WQCA 3LPGA 4XO6A 3R43A 4O4VA 2DSVA 2PLCA 4PTNA 4ACYA 4AIOA 5DMYA 6REQA 3APYA 1F8MA 1KM1A 3FKKA 3KRUA 3QHOA 1QJWA 5FF4A 2Y5EA 3MVTA 4JQ4A 1TPVA 1VCGA 4EPDC 3PWGA 3IJDA 4X3ZA 3TJXA 1XYMA 3R1ZA 2YR1A 4CU6A 3WK3A 3CEPA 3O6YX 4O10A 5HWJA 1GUVA 1GJWA 3GQYA 3LGGA 2NXHA 3ABSA 2XIJA 4ZTXA 4LS2A 5A2AA 4HMCA 5G2IA 3GRIA 1HJQA 3WJWA 1UWUA 4Z42C 4PB5A 1GVSA 3IIVA 2J7DA 4I5UA 3MJYA 4NI3A 4I6VA 3RX2A 2CPUA 3G1AA 2C1IA 3ZFHA 1M7JA 4PODA 4YXGA 1UQZA 2HE5A 1Y8BA 3LM3A 3WF3A 3W7JA 3R11A 1JRBA 2CETA 2A4AA 3C61A 4UR7A 1GTHA 4J3SA 3VU2A 5HR6A 5CPMA 2UV8G 2H9AA 2I9EA 2FFIA 4QLKA 4UMCA 4AX7A 4QG6A 1LUCB 2VGGA 4FEZA 2E8ZA 4KFOA 1WUFA 2G41A 1ZSXA 4E8CA 3ITCA 5C7HA 3W2MA 4AIEA 3PWIA 5LNRA 1SW3A 4LUSB 1US3A 4AIUA 4WKHA 5FF2A 1UZDA 2GFTA 3GDTA 1PWMA 2E5DA 3QHMA 4LTSA 4HOZA 5A8OA 2V38A 3AOFA 3AROA 2HVMA 4DPQA 2G50A 5AHLA 3TAOA 3HF3A 5A6LA 1QPNA 3TYEA 1IZCA 4JTHA 4JHMA 2YCLA 1ZUAX 4XSLA 3VKJA 2BHZA 2Q01A 3GH5A 1S5NA 4HTBA 2V3EA 5CPSA 4S23A 4LNYA 1GT8A 3KZPA 5JH1A 4DXKA 4H9MA 2BP1A 2QUVA 4YVXA 5A6TC 3Q58A 3A3XA 4Q4RA 1T0OA 1J6OA 4LVDA 3WDJA 1UA3A 1I2OA 2PWGA 2XFWA 2NX9A 4AD3A 4I7WA 4TQTA 1G94A 1O5KA 1TG7A 3WJXA 4DBDA 3T40A 1GOXA 1W56A 1UZ1A 4L4OA 4QJ4B 3TSBA 2C1HA 3TTSA 1JRCA 1DXEA 3M0KA 3WLJA 1EBGA 1ZAHA 1CIUA 3NWRA 3R2GA 2EG8A 2VX7A 2WZEA 1L6GA 1JZ6A 1I2PA 1XPYA 3QJAA 2OT1A 4D8ZA 1Q6FA 3WQOA 3YPIA 3BAYA 3USZA 1DYSA 3D3FA 4J3WA 5D9NA 5ABFB 1ZTVA 3DYMA 2ZZ7A 5IHRA 2BY0A 2R94A 1BD0A 3V18A 3SUVA 4GC3A 4L1WA 4RE4A 4XV0A 4JN7A 4HU0A 3E6EA 1IZKA 4IWWA 4Q8NA 3M0VA 2FPYA 3RUBL 4M6QA 1U2YA 3W7MA 1U33A 4GY1A 1PKYA 1FXQA 1K8YA 4REQA 2RDTA 5FAJA 5ECVA 2P3ZA 4WD0A 1TZZA 3ZIZA 2HROA 4FX6M 3FJ4A 2PRHA 2VENA 3OPSA 1U83A 3T44A 1JXJA 1NDVA 1JPHA 2RFGA 3DAQA 5A1AA 3G1RA 2ZUSA 4RNHA 3QPYA 4RDVA 5AY7A 2PDWA 3N29A 7REQB 2ZX8A 4LWWA 1FCBA 4PYSA 4PUEA 3GB6A 3KRBA 3GU1A 4JCMA 1AFSA 3WH5A 3T2OA 5FSDC 3NQ2A 5D04C 4Y6GA 1CLXA 3BJTA 3SQMA 1B0IA 2V5JA 5XIAA 2V8ZA 3G1HA 4XIAA 3STCA 3T2QA 2D22A 5HNTA 3BLLA 4MVAA 4QJ1A 1G67A 4U4MA 2AL2B 1IWAA 2OX1A 2A85A 3KCJA 4JYDA 3FKRA 4WK9A 3H8AA 1E4MM 2QQ6A 1OX4B 2Z1SA 3EAUA 3LOTA 3PFRA 4Z1CA 1M6JA 1KWKA 4PUUA 3TONA 1JCNA 4B9YA 3M0MA 1V93A 3S3GA 4B90A 3S5OA 3P0WA 4ECLA 1Q66A 3H22A 3MY9A 1W2PA 4AG0A 3CUIA 2VRJA 2IKIA 2CU0A 2WNWA 3LG3A 5HDRA 2Y89A 1MXDA 2OOFA 1A5LC 3IJLA 5HJLA 3N1AA 4ERGA 2D69A 5CCZA 1IWPA 3WFAA 1VBGA 4GX9A 1BXBA 3MJMA 3BLDA 4MUZA 3QLLA 3DG6A 1QWGA 3DFSA 1GJPA 1B1YA 2BDQA 4I8DA 5LA2A 1QWKA 4D6FA 3KRZA 1CGYA 1VRDA 3N2MA 1P7TA 1KFBA 4RXGA 3QF0A 1EIBA 2RDXA 4TUFA 1WO2A 4AF0A 1WUEA 1K4GA 4AVNA 2WSKA 2OQLA 2WZHA 4R3UA 2ZC1A 3L2IA 1K4HA 1A3XA 3VNMA 1OYCA 1CW2A 4ERAA 3AIEA 5HMSA 3KHDA 3NVDA 2EKGA 1MEWA 3WBXA 3UZZA 4AEOA 2D0GA 1LLWA 3UWYA 3UZWA 3ZVHB 3DEQA 4AZ7A 3VABA 3LCFA 2W66A 3RK8A 1DP0A 4PSRA 4GYPC 4ZQOA 3N25A 3AS2A 1EDQA 2KZHA 1W8GA 1WAWA 1GPWA 3ABRA 4O19A 4C1LA 1MDLA 3AU2A 1MEHA 1MW0A 6CGTA 3T9PA 4LYRA 4K39A 4Y9MA 5CZSA 1OADA 4RJEA 3AQUA 4NRSA 1KBKA 4LAOA 1EUAA 2B7PA 1D7KA 4M80A 4FR6A 2E1WA 2H3BA 9XIMA 1JR1A 3GS6A 4EAYA 3M6YA 1PEZA 4CUCA 1MQQA 1UC5A 2CLKA 5LIYX 4V1XA 3AYSA 4OV4A 1CNVA 3K4AA 3KL3A 1DWJM 2PDFA 3NXLA 1EH9A 1XIBA 2J8TA 3GLCA 3LA4A 3WLRA 2EPOA 2J25A 2OSYA 3FSUA 3VNZA 1QNRA 1AVAA 1DJQA 4GVHA 5G2HA 1NVMA 1ZS2A 3KM8A 2TMDA 1PCKA 1YNYA 4N9CA 4A29A 4OJYA 3W7GA 4CVWA 2W3ZA 2VL4A 4AH7A 1OCNA 3WLQA 1ZBKA 3UZ5A 4XAPA 4W5UA 2NQZA 3IK4A 4S39A 1I45A 4XD4A 2CWXA 3EMZA 2ZXQA 1RA5A 3WH6A 3PP7A 4G6CA 1J4EA 3BZGA 1XICA 4HYWA 3L68A 5FF0A 6PTDA 1UKPA 3HURA 3ITVA 1XD0A 1QO5A 1CEOA 4FLOA 3SQSA 1LLOA 3E96A 4C7FA 4NZ3A 1SZEA 3WCZA 1CGXA 2DUZA 1A0CA 4C6PA 1H49A 4JTEA 3MYOA 4QE1A 3WG6A 4W89A 3BCFA 1QI2A 3EX2A 4S3EA 3VMOA 3EOUA 2D1ZA 1R3SA 4LANA 1VYRA 2Q8LA 3L4VA 1BTCA 4FNUA 2Z1WA 4PB3A 4DRSA 2WVTA 4DLFA 1JCLA 3CHVA 2XTKA 1EDGA 1EJXC 3TQPA 3EX3A 1A5MC 3ATYA 3UWEA 3M0XA 3WNMA 2ZUVA 2C3ZA 3I7RA 4LV4A 3TAKA 3XISA 4B15A 4GJIA 1QHOA 4FNRA 3GNNA 3BZJA 1UJPA 4GFSA 4U33A 3KTCA 2PWEA 4BEQA 5AZ0A 3T0TA 3BSHA 4MKSA 4Q4SA 3I4KA 4NG3A 3WDPP 1JI2A 3C4UA 4NZFA 3WH7A 1SZRA 4RNFA 1ADDA 1XV8A 2V3FA 2YFNA 5C9ZA 2FGBA 1POKA 3G6MA 1W5OA 5LA1A 1J2BA 1GWJA 4EIVA 3S1WA 1KB3A 1J9YA 3H6OA 1IQ8A 4JTIA 1X96A 3GDLA 5D02A 1VBHA 1NIUA 2DZWA 4GACA 3VTRA 2VQUA 1KNWA 3PJWA 3MUIA 4IP7A 3W0KA 2PTXA 5GJNA 3MKKA 3TYAA 3R6IA 2ABBA 4V27A 3VOFA 2ZFAA 3M7WA 3PZTA 4Z1DA 3V1HA 5GVJA 1TRIA 4NQ1A 4UFJA 2WVSA 2E67A 1PKLA 4CU8A 2Y7FA 1YXDA 4JS3A 2ZOXA 2QJGA 1W3JA 4EVZA 3WD1A 4IL2A 3ABOA 1B3VA 2OZ8A 2OQHA 4FXSA 4KPLA 4J4KA 4GNVA 4WQ6A 5EMYA 2G97A 4J3ZA 3O15A 3T0BA 5CQ1A 4PFHA 3OZOA 3HPSA 4R53A 1PTGA 3CMFA 3MO4A 4EF9A 4GJJA 4EP8C 5I09A 4A8IA 2ISDA 5ABHA 1MRQA 4XISA 2E40A 2GJXB 1XG4A 3TJ4A 1I6NA 5FA5A 1ZNNA 2DIEA 1QNOA 3PG9A 4PMVA 4AXKA 2UY2A 3UWZA 4IICA 1PIFA 1FDJA 2DVUA 2NX3A 4KWSA 4D6IA 2VO5A 4HZ8A 2AGTA 5REQB 3CBWA 2GDQA 3CL8A 3OG2A 3WEMA 4BQ5A 4GUGA 2Z26A 1XS2A 2WCGA 3N6QA 3W07A 4CCZA 4DJDC 3CL6A 4NJGA 3T8LA 2YCEA 1F5ZA 1KW1A 1TVPA 2PC4A 1J0YA 4R34A 2VR5A 3GVVA 2GJRA 1CGVA 5ABEA 4HVXA 1HGWA 3B8WA 2F6UA 1IZJA 4NAEA 1XPGA 3N4FA 1NDYA 3TSMA 4IOTA 1ITUA 4Z0JA 4ONVA 1JAKA 1AW2A 4UMAA 3VGFA 4MOZA 1JZ8A 3QC0A 2ZRUA 4CQ8A 3J7HA 3PG8A 1JNEA 2DZSA 4QBXA 3H2OA 3NZPA 1SMDA 1A80A 4FXRA 3UU0A 5F2GA 4GVIA 8XIMA 1H7WA 1X1NA 3GXIA 2ZC8A 4PUKA 2WMFA 4LUTB 4Q7NA 4W7WA 3SRFA 4AVFA 1T41A 1VJZA 4AZ5A 3VGGA 4GKTA 1YBQA 1B30A 1I8JA 5I3FA 4NP7A 4CD6A 3LCXA 4ZO6A 2GUUA 3EGJA 2CHNA 5HWMA 4JZ5A 3W7KA 3T1GA 3B0YA 5LA0A 1HFBA 4GUJA 3QOMA 2ACSA 2O9RA 3B06A 3TCEA 3VCCA 3WQ6A 4YU1A 3OBKA 3EOLA 2CHRA 1I2QA 2QHAA 1VLIA 4DIAA 4JNYA 2VYOA 1XQLA 4IIBA 1REQA 4HNUA 1KFEA 3TVAA 5CLTA 2TRSA 2JF6A 3AIBA 4AZHA 4Z2LA 1BG9A 2D73A 3DC0A 1TV8A 3V5FA 2YBVA 1MEIA 3SCPA 1FTXA 1TR9A 4JKMA 3WQFA 4KEMA 2SFPA 3E74A 1US0A 5HATA 1KLYA 1HGYA 2Q71A 3MUXA 3AIWA 4YVPA 2X7VA 4CEUC 4WCJA 3IGXA 3BWWA 1PTAA 3OVRA 4X2RA 3E5PA 3PZQA 1OX5A 4MJ4A 3GNRA 2WBKA 1K8CA 1PHQA 4LALA 1JFXA 4IXXA 4Q8TA 4K8GA 5KZMA 4IPNB 1AQ0A 3ANUA 1FDYA 1JDFA 2VJXA 3W84A 3VGBA 1MMFA 5D37A 5DCBA 5GJPA 4UQEA 4AWTA 1ZZMA 1TR1A 3GFXA 1GYLA 2Y8VA 4I7UA 1XBZA 5DN1A 3L4WA 3ZXWA 3CQHA 2YIHA 4B5NA 4O15A 5I06A 1YE4A 5IRPA 3W2LA 1Z32X 1EJRC 3LZ5A 2BGNE 4UOJA 2VZSA 2IKJA 4MZYA 3VIOA 1OIFA 4K1GA 2C0HA 4E38A 1IR2A 4MG4A 1KCKA 1XCFA 4MJ2A 1P6WA 1F61A 1O5RA 2FGLA 4IMFA 2DU2A 4UNLA 4H9ZA 1U1JA 1VYSX 4WY0B 1SFJA 4NL1A 3NXFA 5EPDA 4W5ZA 3DKJA 3G1XA 4GD0A 2OYMA 3MB9A 2AMXA 3BAWA 2WQDA 2H6RA 3DG7A 3P8JA 1KFCA 1PWLA 3ES8A 2BGSA 3DHPA 4O54A 4PSPA 3I6TA 2E3ZA 4MF4A 4H7ZA 1W8SA 1WZMA 3H70A 2VDGA 3EOOA 3DFNA 3H4WA 1UOZA 4QIUA 2V2CA 2D2JA 3BLFA 4KS0A 3QC3A 5AECA 4S3GA 5JUVA 2D0HA 3G1YA 4GABA 4E2VA 1SQ7A 1TV5A 2VKZG 1AZ1A 4DJFC 2WZIA 1DE6A 1EGMA 1TPDA 3H54A 4R85A 4BQ4A 1RV8A 3POCA 5ABTA 4GY0A 4YYFA 2OGYA 1V6YA 3E3HA 4MUPA 4KCWA 3P81A 1H4PA 1W3TA 3CK5A 2FHCA 2UY5A 2Y6ZA 1H3GA 2H8XA 4MTVA 3JU2A 4DZAA 4L80A 4TOQA 1WKEA 2RKXA 1RJPA 5I7GA 1NQ6A 1ZJHA 5DO8A 4RPQA 3A13A 1EQPA 3OGRA 2A3LA 2PLMA 1BRLB 1QTWA 1ME8A 2WVVB 4Y8EA 2OWWA 4PMOA 3TMQA 4O1CA 3OQ8A 1F73A 3RLUA 4XBJA 3WJYA 2YW4A 4US5A 3ITXA 1TTQA 3C3NA 1RALA 2POZA 1O94A 3W6YA 4GIEA 3BQ5A 1SVDA 3DC8A 4W93A 4B4FA 5I6SA 3UJ2A 1B31A 5JQ9A 1R9YA 1MXGA 3NVTA 3DU0A 2CKRA 1K6WA 4HPXA 3KDOA 3R58A 1Z48A 5C2GA 3M0ZA 3QY6A 1FWAC 1FH7A 2FFCA 3PPHA 1OD8A 1MW1A 3APGA 5CPLA 4FSAA 4JTJA 3RDKA 2BV9A 2QMKA 4IGMA 3LPFA 2XHYA 1R6WA 3E0FA 3GR4A 2HSAA 1H2JA 3IV8A 2XINA 1UW9A 2PS2A 4FOJA 5LGXA 2DIKA 3NURA 4E2DA 2GVEA 4DJEA 1HL9A 4CLMA 1JCYA 3WH9A 2CNCA 3OTRA 1FH8A 3G22A 2XSXA 1EF3A 3WQVA 4AVOA 1NOUA 2PF0A 4N4PA 4ZVJA 1E3XA 1H7XA 2GDUA 1HP4A 3GIPA 1QCWA 1XGZA 3NA8A 2R91A 3FJLA 5BXRA 3RCNA 2WHJA 4DYKA 4L56A 3RJXA 2DZXA 2Z1KA 1EXPA 2C18A 3B0UX 3LLFA 1B3WA 3C86A 1LUCA 5BMXA 2O4MA 3EKLA 4MNLA 3WUEA 1WZKA 3M5YA 2WO5A 1XR2A 2VC7A 1W5QA 4H41A 1G0CA 1A5OC 5J04A 1V5XA 2EXOA 2VP8A 4GGHA 1TA3A 1AG1O 3OYZA 3H4XA 1E4LA 3LERA 4KGJA 3NUKA 4A21A 3QRHA 3CH0A 5KZEA 2OLSA 3WFZA 4BFAA 4ORIA 4HB7A 1E1CB 2YBUA 1CTNA 3I3EA 3TSDA 4KRTA 3VX0A 1EEPA 5I78A 4G7FA 5GPRA 1A49A 1OEPA 3EWWA 2NQJA 1KM2A 4L6HA 4Z2GA 4EX4A 3MZ2A 4F48A 3UXIA 3VC6A 3IIOA 4MIMA 3NPUA 5DRIA 5IXEA 4HPGA 1XBVA 5C9WA 4O12A 3H7UA 1JJKA 1UUQA 4FP1A 4ORMA 4FHAA 2QCDB 3MT1A 3LNPA 4AU0A 2FZBA 3OZMA 2VEIA 2CYGA 1GZGA 2OOGA 4N9EA 4W88A 5T9CE 1MQRA 3RMJA 4GH1A 2VZUA 3GW0A 2OB3A 1Q2SA 1C8QA 2IXVA 2V30A 2DW7A 1QDSA 3LK6A 2W27A 1CXFA 1XJBA 3T05A 2VOTA 4DELA 4JTUA 3L4TA 4L61A 2NQ9A 1E71M 3U9IA 5LIXX 3A9BA 4N4QA 1Z7AA 2GZXA 1LDCA 4LB3A 2C79A 3PR2A 4DI9A 2X2GA 1RP9A 4WVXA 4DYJA 2PD5A 1IHIA 5EMMA 3H2MA 1C91A 3APTA 6XIAA 2WXDM 3R79A 1S5WA 1DEDA 4CD4A 3DHUA 4W8BA 4C6IA 2EPNA 2JK2A 4S3DA 4DF2A 5A6AA 1H50A 4R7OA 1XGDA 4J2PA 1F3TA 3EDJA 3N14A 1P0DA 4LVBA 1GPFA 1LG1A 3R0KA 1FWEC 1E55A 4MWAE 3A47A 1P0BA 4DUXA 1GVIA 3G3MA 4IMEA 3W1MA 3DFQA 2W79A 2YDQA 2NQLA 5EYWA 4ZSTA 3EDEA 4YTTA 2ZX6A 3BJFA 4P7NA 1SO3A 3U2OA 2GVLA 4ROPA 4WDWA 4WJ8A 2VC9A 3NEVA 5I3DA 2INZA 3W76A 1ECQA 1IXOA 5CPOA 1FUYA 4CD7A 1E1EA 4FF7A 2G95A 5M3WA 4CCEA 3GYCA 2DJLA 4PR4A 4UQDA 3A24A 3TA9A 2FZMA 3KCLA 5EY5A 1JCJA 1XUUA 4CGTA 3B9EA 3FK4A 4R33A 2OZTA 3FOKA 4JTKA 5FD0A 7REQA 5TF0A 4AY7A 4QR6A 3SR7A 3P67A 3O2LA 1YXCA 2X0HA 1I2NA 4BWLC 1CGTA 3DDMA 2ZIDA 1VIZA 6TIMA 3UESA 3C6CA 3H7VA 3TN4A 1SZFA 4H9UA 5KZDA 1XM3A 1JEZA 4Q8PA 1LQ0A 1WXJA 1B9BA 4CCDA 3KTSA 3ICJA 3ARUA 3A5FA 2HE8A 4XAGA 2AL2A 1V02E 5TBOA 4AFYA 1FWTA 5I24A 4C90A 2NT1A 3GZAA 5DANA 4LV9A 1JCTA 4PA8A 3P5YA 4GQRA 2I5GA 3GNPA 5IM51 3HG4A 1BWVA 2WK2A 1UD8A 2O7SA 3MCNA 4FX7A 4GCXA 2VFIA 2WHKA 2Z1BA 1WV2A 4TU1A 1HNYA 3NQCA 1UPMB 4GGBA 4U2ZA 3GTFA 4AHPA 5CJNA 3K8LA 4F2TA 3SN4A 5LIWX 3SZ8A 4GI8A 1ODZA 3EKZA 2G4FA 4IHCA 3UWUA 3SCOA 2IW0A 1K3UA 4C1KA 3N4AA 4RK8A 4ZTYA 2BHUA 3DIPA 3TX9A 3DG3A 3RX3A 3LU2A 3V5OA 4D6JA 3VE7A 1DJHA 4J7RA 3WD2A 2QGYA 4GPNA 4O0KA 4J28A 4EANA 1L6WA 3W1UA 3P80A 3T8QA 1J96A 4ZB0A 5EB8A 2I16A 2VX4A 1GKPA 4JKLA 1KV5A 3DFHA 4F66A 1NOWA 3T0DA 4B3ZA 4M1BA 2E9BA 3F4DA 2FMNA 3F03K 5AC7A 3L21A 4OBSA 1UKOA 2ZZ6A 4JFSA 5AHIA 3VVGA 2DT1A 4IPLA 3ZVHA 2F38A 2QF8A 2QJHA 2J88A 5CLWA 4E4PA 4YYCA 2PP0A 1XD1A 3C56A 3A4XA 3SEPA 2UY3A 3VIGA 3H2FA 4BQ3A 5DCDA 4FIRA 1OZQA 1RH9A 2FVKA 3AXXA 3GVGA 2PGWA 1UR3M 1XSJA 1ONXA 3EXTA 2TSYA 3SBFA 3UW6A 4HA1A 3QPEA 3F5JA 1GVYA 2BVTA 2OYKA 3QV7A 4JN8A 1IT8A 4NXSA 4RZBA 1VBRA 3VFCA 3Q2DA 3FEQA 5DRCA 3WMBA 1E9YB 2R6OA 1R2TA 4MLRA 3T42A 3SCWA 2PPGA 1E5NA 3PY2A 2V3DA 3NQ6A 5CBBA 1Q6DA 3H24A 1Y0EA 3O6CA 4IIHA 2XSAA 2WJZA 1K7XA 3FXGA 3LRMA 5BW6A 5FESA 2A7RA 1XBYA 1T7LA 5JH2A 5KZ6A 3TH6A 3DBPA 3QV6A 1BVZA 2OLHA 1QVBA 1PBGA 2OEKA 1UD4A 3TR2A 4JTDA 1KO0A 5EU9A 3OG3A 5LSMA 5HMDA 3JS3A 2OZ3A 1EYWA 1VJSA 3NL2A 4EPEC 4AMAA 4IPPA 3BVJA 1XC4A 1VFLA 3K46A 3PZVA 4W85A 3U7VA 3C8FA 2PUZA 1OG6A 4UXDA 2E5BA 2BVWA 3FJ6A 1NFPA 4E8GA 3N9KA 1Z89A 1QPQA 3S2MA 4RV3A 4A3RA 5TIMA 3E2VA 3UZYA 4OTKA 3SO7A 1KFKA 5FJRA 2Y62A 3MVIA 4HU4A 1NP2A 4HKPA 4M56A 1W5MA 2F9RA 4I9TA 4TMCA 3WJZA 3WEZA 3NYDA 1DJZA 3ARRA 2V5CA 3UVAA 4YVVA 3BH4A 3AS0A 5HXMA 3KBJA 3UVIA 2ZYFA 4LSBA 1W9BM 1VBJA 4AHQA 1WDWA 4WXYA 4HPJA 1DWFM 4GYKA 1BAGA 4UFIA 4GX8A 2HZGA 3W7OA 3W82A 3M5XA 4N6FA 1E73M 4OV9A 1GVQA 3EA2A 3USBA 5BOEA 3V0TA 4YTSA 3ALGA 3STFA 4EOUA 1G9HA 4QQ3A 3QW4B 5G2WA 3UG5A 3TC6A 3RPMA 3QTGA 4DO7A 2CBVA 4CU7A 2OU4A 3W74A 3F1QA 2ASHA 1A5KC 1V6UA 4ICMA 3G0SA 3S1VA 3B9DA 3ZMRA 4C6FA 1LL7A 1YLVA 3U4FA 3B97A 1S1RA 1V6VA 2NUWA 3M0YA 1VGAA 2VVNA 2OCZA 1PAMA 4FS9A 1KM3A 4HNVA 5DELA 2B81A 1Y5XA 5AN7A 1OFAA 3WNKA 3UCDA 3ITTA 1UC4A 2P88A 2XZ9A 1A5CA 4JEQA 4P8UA 2F2KA 3BLPX 2GQ8A 3S6DA 1W2VA 1RK6A 2GWNA 5D2TA 4IJBA 3FGCB 3WMLA 1JAEA 1EBHA 2XIMA 4F0MA 2WNQA 3PPGA 1HTIA 2HDJA 4JIHA 1J93A 3MPGA 3W2NA 3UPWA 5CAKA 1ZAIA 1I60A 2VEGA 4X0NA 5HUOA 1C92A 1TB3A 2ALRA 3AZTA 3PUOA 1EWDA 3KW3A 1KCZA 4GYPA 3AS3A 1V3MA 1NJJA 1BQGA 3JW7A 4PC8A 3VOGA 3I4EA 2VVSA 4M6PA 3T09A 2OR2A 4XUYA 1JNDA 1Q8JA 3VOHA 2PDKA 4RKAA 2EJAA 1GGOA 5K4ZA 1SFTA 1TKKA 5MKGA 1QNVA 3GH7A 4DUOA 4UTMA 2OWCA 4Q4PA 4LVGA 2RHGA 2V5KA 2BASA 2PBGA 4KEZA 4O17A 1QK0A 4IFOA 3PZGA 1ITXA 1S5MA 3O6DA 4XD6A 4A3UA 1QI5A 2ACQA 3R8HA 1QBBA 4D6GA 3VIKA 1MZRA 3O9NA 1X1OA 2P0OA 3EXSA 4UBPC 2PE4A 3OZPA 1E6NA 1BHGA 3RO8A 4WLCA 4ZFMA 2Y70A 3RRAA 3M1ZA 5JBEA 1EHAA 2I5IA 2PRLA 2H8ZA 4M8UA 4JBRA 1HW6A 3KVJA 1X6LA 2XVKA 3FIGA 3VDCA 3SAZA 4Z2HA 2IS7A 3AIUA 3QQ0A 1C7TA 2BTMA 4PMQA 3TWAA 4GCAA 1QW9A 4R88A 4D2JA 4LF2A 2GGIA 3DZ1A 3NQGA 4GBUA 2EGZA 5K9DA 4E2BA 2WHLA 1NARA 4F0LA 3DYPA 1TJ0A 1W6TA 3NM3A 3UYIA 1F6KA 1KXVA 5D09A 2PDLA 1RBOB 2FYMA 5G4EA 3ITLA 2J7FA 2O9OA 3N6HA 1A0DA 2PWUA 3EOSA 1EA9C 1GHRA 4MDPA 3VINA 2P1FA 3GHRA 1LYXA 9RUBA 3FA3A 1NAL1 1R38A 4F2BA 4GKLA 3DN5A 4Y96A 2ZX5A 1PB0A 2ZWZA 3RCYA 4MSSA 2EPLX 4D8AA 3VDAA 2WMIB 3W7PA 1ISWA 2V5BA 5C9RA 3NJ3A 4NHVA 5I07A 4BCEA 1P0KA 3NO3A 3QTPA 3E2RA 4V2XA 4P7RA 4DZHA 2V63A 1RCOB 3HV9A 2XSBA 1Q7ZA 3BAXA 3WF0A 1DJNA 3T0CA 1W54A 1XIDA 3CHDA 3H21A 3VE9A 1UR8A 3I3BA 5BROA 1VAHA 2DT3A 5HQEA 2OKTA 3HGRA 4ZXLA 3HB9A 4ZEPA 3GH4A 1Q4WA 1FWRA 1O95A 3CMGA 2PWHA 1LOLA 1BWKA 1Y5VA 3LV5A 3F5LA 1EJTC 4A3HA 4K8HA 4WSHA 3GHSA 3V4BA 3E38A 1QU4A 3C3UA 1XXXA 1YXYA 1H1NA 3BG9A 2P3EA 1BSIA 1Z3NA 1WKYA 2V9DA 3BG5A 3W3OA 2VFEA 1QNSA 2C14A 3AC0A 3QLDA 2ZZ4A 1E6ZA 2FB3A 4GQBA 1G4SA 2F6XA 3ONBA 5E09A 5BRBA 5KMYA 1YKWA 3QR1A 1OZMA 1DBTA 1UP3A 3ARSA 3M44A 1NM9A 5JBFA 4FZIA 2JGQA 4LU0A 4NAFA 3KLLA 4ICCX 4I5RA 1KTBA 4DWSA 2CERA 2EG6A 2Z4GA 3TXVA 3ITYA 4FXJA 1ADSA 4LXFA 1AW5A 4M7TA 2PU1A 4Y7EA 5CEWA 4GO8A 4Q8VA 1KM6A 5CG0A 5I03A 1JI1A 4GUIA 1HN1A 3PN8A 4PMRA 3MUZ1 1XIIA 3UR5A 5A6MA 4WZHA 2QDDA 1CLKA 4DJDA 4DF1A 1AMYA 4U10A 4OE7A 3LMYA 1R85A 1UWRA 4S2CA 1VZWA 1X8CA 3NSMA 1LWJA 5CAHA 3OODA 4O50A 3IWPA 4XX6A 1Q8AA 3G0UA 3W4RA 5BWFA 1ML1A 3NPXA 1K7FA 3PNUA 4G56A 3AHZA 1KBIA 4QRNA 2WNZA 4HNCA 4M1RA 4UFKA 4HSNA 3DX5A 2VI0A 2KAUC 3BPWA 3WEOA 4FO4A 1UKSA 2Y4SA 3GIQA 2ZZ3A 3OIXA 4MY8A 4MADA 3N19B 4H00A 5E70A 3FFSA 3HTWA 3GUWA 2ON3A 3JRKA 3N4EA 2GUYA 4GI6A 4IMAA 4H2HA 1RR2A 2QLYA 2ZA3A 5K9XA 2ZXBA 2J8GA 2QULA 3FEMA 4M6VA 3TW6A 3Q94A 4JTQA 4OIFA 1OGBA 2GWGA 3O7UA 1J01A 5AKQA 2ZRVA 3VIHA 5C2XA 4AD4A 4Y9AA 2J7GA 3NQMA 2WMJA 3T4CA 4XVDA 2XFYA 3FYYA 5AHFA 1KLZA 4XAYA 2WB5A 4QP0A 3PTQA 3ARXA 2A6NA 4GC4A 5FL1A 4XZBA 5K7JA 2R24A 1TZ7A 2C13A 4K3ZA 1C9WA 4HIBA 4H8HA 3R5EA 4Q4MA 1U1HA 5CZJA 6ALDA 3UR7A 1B3YA 1ZHAA 3MYPA 1OGSA 3AU6A 2ABAA 2ACUA 3P82A 2GLKA 4HQVA 4IPJA 5A5WA 4LCRA 2Y5JA 4US5D 5HJXA 4KIRA 4A3YA 3EKGA 4WOQA 1LL4A 4Q33A 1DJWA 4WGHA 1X7IA 3VIIA 1MW2A 3O05A 3ZWSA 2PC8A 3DOPA 4D6HA 2PDJA 1JUKA 1Q7MA 4GUHA 1VIWA 3T2PA 2J4GA 1XIMA 2VWTA 3WENA 1VLWA 1XWYA 4M0XA 3OBEA 2NVDA 4RR4A 4UTWA 1UA7A 1W9PA 3AZSA 4ML9A 1OT2A 1WX0A 3M6DA 1IEQA 3SJ3A 1TTIA 3V5CA 1DQUA 1YRRA 4QSFA 4DJED 2EQDA 1M01A 3W83A 4Y9PA 1YTDA 4G5DA 1S3TC 1CXIA 3WZ0E 4XZWA 1VRXA 5D2VA 1DWHM 2FMOA 3F2CA 4K38A 5JU6A 3CPUA 1ALDA 1K9FA 2VRQA 2Z6IA 1V0LA 4HJFA 3CLMA 1VFMA 3EEGA 1S46A 2GYIA 4DHGA 4XSMA 6ENLA 3CASA 4L5ZA 2VXNA 2I9UA 1XYBA 1U30A 3LHYA 4A8NA 1NWTA 4KGLA 2BGQA 1TX0A 1TV4A 3VD5A 2XIBA 1CB2A 4X9SA 3KZSA 1RQHA 4LEFA 1PZ0A 3QEZA 3OVQA 2CFFA 2DW6A 4UQ9A 1R7AA 5HANA 5FJTA 2QCDA 2F8QA 1LZOA 3N2CA 3REQA 2QXWA 3CZKA 3GXMA 2X8RA 2NXIA 1LROA 1PKMA 4MKVA 4CD8A 3VGEA 4F2UA 3GVWA 1RQBA 2D3NA 3KDNA 3S6TA 4CN1A 2VRKA 3U3HA 3F4CA 4HOXA 3EMQA 4H6EA 4HBKA 5I00A 3B9OA 1M7PA 4PBFA 2NXGA 4ZQRA 2VQTA 4GBDA 3T78A 2V2DA 1IXQA 3O16A 2YGYA 4GG9A 1H0GA 4GHRA 1NWUA 1XRSA 4WF7A 4DNMA 4YNGA 2GDVA 3BSMA 1TV7A 2ACRA 1KR1A 1KFJA 3SCVA 3KP0A 3WL0A 3SUTA 3TZNA 4HA0A 1ZBCA 1JL8A 3L0KA 1RUSA 1U5HA 4YWSA 4TR9A 3M46A 1B4EA 1VENA 2PGEA 4B16A 1KXHA 1FP8A 2X1TA 5FJOA 4HT3A 1TIMA 3GYEA 5FEPA 3EA3A 1JCMP 4DVOA 1EP1A 2XJ7A 2C19A 2PF8A 4Y9OA 1DIKA 2G3JA 1W32A 3IIXA 4HYVA 4E4FA 5CC6A 3IACA 3KVMA 3VOIA 1UWAA 3MDWA 1H5YA 1N55A 3S9YA 1V0NA 2RGMA 1RVKA 5IBXC 3EMCA 3IVTA 4JX5A 4DAIA 4HOWA 1SO5A 1P6CA 4ZR8A 1R5YA 3CQJA 2X09A 2QCHA 3NGFA 5H8MA 4ATWA 3UXDA 2EPMX 2A79A 3TXZA 4FOUA 2A3AA 5T91A 1PSCA 1KM0A 2PEVA 3W6LA 1UMLA 1TPUA 4F8XA 1HKIA 3K2GA 1U1UA 1VEPA 4G7EB 1XRTA 4G1KA 4DO6A 3G77A 3AXIA 3S1UA 5DT7A 2PZ0A 3VD3A 3URQA 3ZOAA 4LGXA 7TIMA 4YTQA 3WUFA 2XH4A 1VCFA 1SM9A 2QPUA 1RPKA 1X6NA 3JR2A 4KWUA 1UBSA 3JUGA 3W6MA 2VEFA 2VC5A 4TXEA 2POTA 3N12A 1P6BA 2QS8A 3RYSA 6XIMA 3W1XA 2ODOA 2Y63A 5K9CA 5IOBA 4HYRA 3N2BA 2OELA 3EEZA 4LAKA 3MBDA 4JQ2A 3RN6A 2H90A 4LYPA 5C7VA 5HAOA 4F4RA 1B3OA 1ZU8A 1T8QA 4KKXA 2OODA 2YDAA 3AISA 3PUEA 4U2YA 2C0AA 2JE8A 3TOYA 5KITA 3VNYA 4MPKA 3MBFA 1G4TA 2BVDA 2FVMA 3GG1A 1UZ4A 2HTMA 2WHMA 4DAFA 2ZCGA 4JKKA 2BXYA 3A4AA 3CV2A 3STEA 2VDHA 3UNTA 5C8BB 3B03A 2W9MA 3TWBA 3HIJA 4QITA 2ISSA 4OZOA 1EOMA 4F0KA 5A6JA 2QPSA 5E1QA 1SO4A 2OSWA 4NKCA 1KV8A 1KA9F 4MJMA 4QM1A 1KR0A 3WX7A 1TFVA 4E0CA 1AK5A 3PTKA 4O1BA 4K7YA 2PWFA 4FB7A 4MWAA 4QISA 1CLVA 1XFCA 3S5YA 3AMLA 4FX8A 1WYIA 3I7SA 1KFWA 3HM7A 3SCNA 5MHBA 4YCOA 4W8LA 3S42A 3Q37A 3HGSA 4GFIA 1NY1A 3BDKA 3SGUA 3N2OA 5DLCA 4JX4A 1L6SA 2I17A 3T0AA 2ZUWA 4WOZA 3VM7A 1W31A 3CUFA 4WKFA 4B2DA 4MZ8A 2BXZA 1LQAA 4LEQA 3WUGA 1CGWA 2OEMA 3JZUA 4GLEA 3PZ9A 1JULA 4KH2A 5D33A 3ZLHA 1MWOA 1CXEA 3PTDA 1G1YA 4QE4A 3WDQA 1MDRA 3AYRA 4W7UA 3W88A 2XN2A 3S2JA 1I0DA 1Q5MA 3WLPA 4O57A 4CD5A 1G7VA 4N9BA 2A0NA 5F2MA 3EX4A 1XYFA 2QCMA 2ZZ1A 4LH8A 5JIWA 4RE3A 3RAOA 4PMYA 3EX1A 3W53A 2WV8A 1O4UA 1YQ2A 4OVXA 3BLIA 3CAKA 3WL1A 1J0KA 2ISFA 1EKOA 3U4AA 3W7CA 1XFBA 2PRMA 4FK9A 2PZNA 1FWGC 3DYOA 1EC8A 3D46A 3NL5A 3S1XA 3VILA 1WOAA 4W86A 4MAZA 5A8QA 1GEHA 1F3XA 3W26A 2QCLA 3K5XA 3THQA 3BAIA 3DFYA 1KGUA 1CX9A 3BAJA 4MJZA 1J8VA 1XYZA 3CB3A 4CQ9A 3VZXA 3LCIA 3CUHA 1PS9A 2VMFA 1CZ1A 3SSZA 5TD4A 2DDXA 3LXBA 3GNDA 5C9UA 4H4IA 1W3LA 3MTWA 1TREA 1BLIA 2QIIA 3W7RA 1GZ1A 4IX0A 4KERA 2VCCA 1ME7A 4A8RA 1R87A 4KESA 1JDCA 5J8LA 2GVJA 1E0UA 2CLIA 4B3LA 4DB7A 1PZ3A 4XBKA 4JQ1A 4BWLA 4WRHA 4B91A 1F76A 3VO0A 3LPOA 4JDYA 1BYDA 3NSNA 2BG5A 4RZ5A 1LLZA 3LLXA 4PUNA 1AJ2A 4A05A 4BF7A 3LRKA 4DY1A 1GOMA 1EHNA 4WY0F 1E43A 3F7JA 1EX5A 1DQXA 4WKAA 1E4IA 3IGUA 1C8VA 2DORA 2PTYA 3THAA 3NDOA 2V81A 4PCTA 1M03A 2CIPA 3VD7A 3AZRA 3OQEA 1C90A 2CW6A 3VDGA 3EOEA 5JIPA 4MNMA 3BQ6A 4M7SA 1WPCA 2A2IA 2DVTA 6REQB 4JR5A 4S1FA 2WKGA 1UR4A 3RR4A 2BWGA 1I4NA 3AHVA 1IEIA 3ORWA 4O16A 3RO6A 4LAZA 3N11A 2VNCA 1NF7A 3V1PA 1V6TA 2EF9A 3BARA 3CWHA 2C71A 1NQKA 3SRKA 4HGXA 4IL0A 2XYLA 3PNZA 3A4JA 4GVFA 3C5QA 3AHTA 4S3CA 3VOCA 3ONCA 4DX3A 4AC7C 4MYAA 3L2LA 3TKFA 4HK6A 3UJFA 5FF7A 3M16A 3AHXA 1K8XA 1EPVA 3WD0A 3VUSA 5CC7A 4L4LA 4Q4KA 3LYEA 4OWGA 2NX1A 1AJZA 3R25A 2Z0IA 2W61A 4HCLA 3H12A 3W7QA 4L4PA 5D4YA 4ES4A 4TVCA 1R7OA 4IISA 2EO7A 2PWDA 3GY1A 2VR2A 3QFEA 3NL6A 2BZNA 2QCEA 3CQ0A 2H9AB 2WC7A 3GDKA 3U5YA 2X1RA 4P7OA 2VFFA 1EJVC 3W24A 2DH3A 3NM1A 4Q4QA 1E51A 5LYRA 2VURA 3A5VA 3G1FA 2E9LA 3VCRA 4D1JA 4KW2A 4XKYA 3UJSA 3RM4A 3CQKA 3DBNA 4A22A 1FWSA 2YZ5A 3RMEA 1PX3A 5FIPA 2G3FA 1CPUA 5A6BD 2CCRA 2HS6A 4CNNA 1XYLA 3WN6A 3QMSA 4LCSA 4OKDA 3MMWA 2P0IA 2NQ5A 1W0MA 4RV8A 2WPGA 3C52A 3L5LA 4UOZA 3WJSA 1I9CB 4MHBA 2F6KA 5H6HA 3HG5A 3RHGA 4OGZA 5I0DA 1XIEA 3EWZA 3ABQA 3EB3A 3T08A 3AIVA 1GVFA 4LT9A 2BMBA 2XN1A 4CNSA 2ZA2A 3VIMA 5FJPA 3WDHA 1JGIA 4US6A 1TVLA 3NZRA 4Q7BA 4U3CA 1JCXA 3CZJA 4UFMA 4P7QA 4CNUA 5D2WA 3XINA 3RM8A 3W72A 2CLFA 4C6CA 4Q8UA 5RUBA 2J6VA 1VBUA 4UQBA 2V3GA 3NQAA 4KF1A 2D2HA 1X6UA 4GWEA 4K1WA 5B7YA 5ENLA 4QEEA 5JMUA 4GIAA 1G4EA 1MSSA 4O18A 3RITA 3A3WA 2PDBA 1RAKA 4MNKA 5AHNA 1RP8A 1THFD 3FX4A 1OFQA 3H55A 2X16A 3UG4A 1H1ZA 3PF3A 2FQIA 3OOQA 4YMZA 3UXLA 4O4WA 3FNDA 3W7LA 4TX8A 1ICPA 5A8GA 3UFYA 1OB0A 3WFLA 3QVQA 4KCVA 1TUFA 4AYGA 1TRDA 5FJIA 4GQ0A 4W7VA 4W9TA 1OBAA 3KS6A 2I7GA 5HMFA 3SW6A 4N42A 1FHDA 1UG6A 2WMIA 3THCA 3W00A 4TIMA 3QSTA 1EXBA 1NWRA 3WQ4A 2CZVA 3RILA 1KBLA 3THUA 3SCTA 3I6EA 5HR7A 3SY8A 2DSUA 4REQB 2X05A 5GJMA 4MYXA 2DZAA 3VAVA 1LWHA 1S2AA 1D3CA 1TX2A 2O9PA 3WQ8A 4B5XA 3LRLA 4XK2A 3TIMA 1EFZA 1H7NA 4BA0A 1WDSA 1WKFA 2QZRA 4GIRA 8RUCA 4GQQA 2CLOA 3PPCA 1OFRA 4O52A 3NQ7A 3B0PA 5I3HA 3RPTA 3ZSTA 5DEZA 4BK9A 1BSLA 3CUJA 4QXIA 1R9XA 3GX9A 4O8AA 5A69A 3DUGA 5EMLA 1Q6CA 3SRHA 5CSYA 1PZ2A 1DWGM 4PCNA 3TUUA 1WZAA 2PB1A 2NSOA 4V33A 4EXQA 2QCFA 3KBVA 3KL5A 5C2CA 3KWXA 4YHGA 3DI1A 3E0VA 3LGDA 5AHEA 1CXLA 2R82A 1XCXA 3IGSA 1GVOA 1D3HA 1UD6A 1KGXA 3SURA 2ZVIA 3QBUA 3OGVA 1DVJA 2PU0A 1A5NC 3L5AA 5JVLA 4QS6A 3VNJA 4AEFA 5LZLA 3GC5A 3TTEA 3SUUA 3WQDA 5CPQA 2X2YA 2IQDA 1JD9A 2QUMA 4LB4A 4AC1X 4JGDA 4Q6JA 1VH7A 3I7QA 3LEPA 1N2VA 3DENA 4ZO9A 4HNOA 3AWNA 3PZNA 3WNOA 1UR2A 3LBOA 1E0VA 3P93A 3SADA 2V5DA 2DT0A 2VD9A 1HVQA 3VIJA 3UR2A 4JX6A 1Y5WA 1K02A 1QHZA 4QGCA 3VKCA 2FLIA 2UY4A 1W1VA 5M03A 5M2FX 1RJRA 2RAGA 4DWSD 3R8RA 4HHLA 1HX0A 2QCNA 3B40A 3LHVA 3L4UA 3SSJA 4NIRA 3S4TA 1V51A 4IIEA 2GVYA 3PFMA 4EK7A 3A22A 1ZAJA 1OWQA 4HSHA 1HJUA 4R27A 3W28A 1J2WA 3GFZA 4GI9A 3PSVA 3JVAA 2Q02A 4DJDD 2ZUTA 4QNWA 1AMKA 1AQHA 4O1FA 3C2OA 2REQA 4W4QA 3AJXA 3L9CA 1FFRA 3FVDA 4JNMA 3GTHA 4C5ZA 2RJHA 1DHPA 4HTYA 1PX4A 1M7XA 4NILA 3R4IA 2JIEA 4RNJA 3TN6A 3TEVA 1B3XA 2JKEA 2QAPA 4DUVA 4Q8QA 4D6CA 3MMDA 4CNOA 2EEXA 4J1OA 1TE6A 1R2SA 3TV8A 3OLGA 4J27A 4QLJA 1ITCA 3QYSA 1GVEA 1OABA 4BI7A 4AY1A 3TDFA 1RY0A 3V7PA 4JDBA 3HMJG 3S83A 4KRUA 4JXCA 3TCSA 3CZ8A 3P61A 5M5DA 2J24A 4JIEA 3TYZA 1BKHA 2W5FA 4IQLA 3IANA 4NZ5A 3WNNA 2CBIA 2HWGA 3W1RA 1D2KA 1ZB5A 3U5UA 1JQXA 3EWXA 1TMHA 1V6WA 4KBXA 4LOCA 3W70A 4ZQPA 3NO5A 3M7SA 1HQTA 1IXNA 1XQKA 2CITA 4WIWA 2CLPA 4I7VA 4J9JA 4S3BA 2KX9A 4XKMA 1ELSA 3FA5A 2XIQA 3TYBA 4YTRA 1ECEA 1B9ZA 1WOBA 5HNRA 3UXAA 4FALA 1N8IA 4DWDA 1SMAA 4PBGA 5SWUA 2Y85A 3RJYA 4B5WA 1EGVA 4XZMX 1EZ2A 3HZ3A 3P3BA 4WHBA 2WJFA 1ZFJA 4UTIA 5AVNA 2FTPA 1R2RA 3T6CA 1TPFA 2DP3A 4ZOAA 4HSOA 5T9BG 3BL3A 2J47A 3VDBA 3ZWTA 3SUSA 3K8MA 4NYYA 3DKLA 5U4NA 3TYUA 3TTYA 2D20A 3CTTA 5B7ZA 2YX0A 1TWIA 4NJJA 4K68A 3UEQA 2FVLA 4QNEA 4N0RA 4J2MA 3O0FA 5DQPA 1P1MA 1PCWA 5JBDA 1ENUA 4QDWA 3UWQA 4QCFA 4RE0A 2OQYA 2I14A 1RBAA 2XH2A 3GK0A 2A21A 3BAKA 3PZUA 4POCA 2CLHA 3A3HA 1TV3A 1FRBA 2G3NA 3BXWA 2J75A 5I3JA 1XLJA 3UQNA 4LBSA 1PZ1A 1C8YA 2DFAA 4AZCA 2XIOA 2YXGA 3L2MA 5BRQA 4O13A 4UTTC 2G0WA 2HXUA 5CSUA 1B2YA 4UNKA 4UOQA 2OWXA 2R1NA 1X97A 2PDMA 3N17A 2OGJA 2NV2A 2CXGA 1H63A 5EKYA 2AKMA 2JGYA 2O9TA 2RDWA 3STPA 2GPTA 1POJA 3ARVA 4NZ4A 2BB0A 4NSBA 2ZUMA 1A5UA 4ADTA 3OZYA 3GWQA 3MI3A 5AC5A 4DBWA 1Q85A 5CPTA 2Z7GA 5G1YA 3ZQ9A 2DGAA 1J5SA 1B57A 4CQAA 1F05A 4RL3A 2E1DA 3BGJA 3PPFA 3FA4A 1ZRQA 2Z1XA 3PWAA 4Z0SA 2PODA 2OO6A 4XIMA 5G4HC 3K1GA 2A1YA 2XH7A 4FA3A 1X7FA 3WQEA 1O7AA 5HBFA 1AJ0A 3CWOX 2Z2AA 4L65A 1UIOA 3OBAA 4YPJA 4LFYA 3O63A 2XG9A 4IJCA 1H60A 1WXZA 4UFLA 3UY8A 4GXWA 4H7CA 4L9ZA 3NPWA 5E6YA 3OA3A 1HVXA 1XP3A 4XZLX 1RY8A 5TQLA 1OINA 1TJRA 4TMBA 4PL1A 2QJIA 3DH7A 1KBBA 3VC5A 2ZRWA 3IRSA 3B4YA 3BOFA 2YLLA 3G6LA 3GG0A 3LTYA 3LNMA 4DBSA 1I2RA 2PDGA 1HKVA 4YJ5A 2WOQA 2NZLA 1RZMA 3WK0A 1WA3A 1JPIA 1JDEA 5BMWA 1TTJA 1ZLPA 3LSBA 5FCZA 1JG9A 3VD9A 4D72A 7ODCA 1B4KA 4BEUA 2ZVRA 4C6KA 1Q6QA 2CZDA 3BV4A 1RSCA 5BXTA 5E93A 4QQUA 3RU6A 2A3BA 2P50A 4HK5A 4Y9NA 1YW1A 3HQ1A 4NAEB 1EWEA 4JL1A 5HPOA 1NELA 3P0XA 4HN8A 4I5XA 1NF0A 1UH3A 3FYPA 3CIXA 3QQWA 3MC5A 4UTKA 3N9RA 2ZWYA 3I6RA 4HHPA 3B04A 4QS5A 3ZS4A 3W2UA 3MMUA 2QDGA 2BLEA 2VCBA 4GO9A 3W27A 3TW7A 3R0DA 4AAJA 3N73A 5BYWA 1TCMA 3LDVA 1CWYA 4GH3A 4OU1A 1K9TA 1ITQA 2NVAA 3CYVA 3HFTA 2FTYA 8CGTA 3LM7A 3ZZ1A 2BSLA 2JALA 3PB2A 3O1NA 4FNQA 3UG8A 3S1GA 3B9AA 1YBQB 1ZJAA 3PZIA 1GOQA 3W38A 3NYZA 2PAJA 3R13A 4I6KA 5EMUA 1BG4A 3HN3A 1QOXA 3GVQA 5A8NA 2DZVA 3IJQA 3B8DA 4WSKA 4U28A 2CBJA 1O68A 3LCWA 4KFNA 4LUJA 4NZ1A 3RR1A 5AC4A 4ZO8A 1RPXA 2DZTA 4LRTA 1SR0A 1Q4NX 1REQB 1BXNA 3BW3A 4ACZA 1H61A 3UP8A 2YXXA 7CGTA 4KWOA 2O7QA 4GISA 2RJGA 3KLKA 1IXPA 4H2CA 4H04A 4XTIA 5CZTA 1KM5A 4TTUA 3EDFA 1W1B1 2B4GA 3ITGA 2FHFA 4WJEA 1GQJA 2PCEA 3NCOA 4A2RA 3CXOA 4KETA 2VC6A 2ZTJA 4LS0A 4OBTA 1QMLA 1DIEA 3S6OA 2ZRXA 3IK2A 4EF8A 3NL3A 4KRZA 2R14A 4O0ZA 4ZZ9A 1OK4A 2V82A 4HA3A 1XF0A 5C5YA 3PM6A 3BK0A 2V68A 5LKYA 1UCWA 2W0UA 4IGSA 3THDA 2HCVA 4UUIA 1F7BA 1W1PA 1PIGA 4LC6A 5DMNA 4H7VA 5CH9A 3WDRA 1LRTA 3SIZA 3LHUA 4HZ7A 2ZUUA 4QDPA 2PDYA 3WMCA 2G3IA 3S2LA 2HPIA 3F4NA 3DGRA 2C7FA 3CUZA 5U7SA 3W1TA 1XH0A 3EPOA 1PXGA 1KGWA 3N3TA 3WBEA 2YB4A 2TODA 2WM1A 1KQYA 1NH6A 3IJ8A 4JIIX 2GL5A 5AYZA 2XWEA 1QASA 1VCVA 3W73A 1E0WA 4C5YA 4MWAD 2PGRA 3TZFA 3TNOA 1XINA 4HMEA 1LM1A 1HO1A 4EACA 4AUBA 4IG2B 1QATA 4O53A 5HK4A 5AZ1A 2BY3A 1XYAA 1ZBWA 2QDHA 3UGRA 4XZNX 1EC9A 3L67A 4B2DD 2A6LA 2VEKA 2BOEX 3W37A 1KRMA 5G1MA 2VHLA 2HK1A 2ZKMX 1OF6A 4Z1BA 3COTA 3AIRA 1ONWA 2OVLA 4A35A 4AIBA 4EWJA 4LW7A 1J0ZA 4AD0A 1ICQA 3H23A 3H2EA 3TTOA 1BQCA 1MFUA 3UG3A 2OT0A 2HISA 3WH8A 3K4WA 1G6CA 1DIDA 4RXFA 5C71A 2DUXA 1DKWA 1VS1A 4GI4A 3NFUA 4GNKB 5BOOA 2E6AA 3WQGA 3IJ9A 3C2VA 2JBMA 5DY2A 2DZUA 5D8ZA 3UA3A 3WK1A 3W22A 4MFEA 2Z2UA 4DXVA 4HNLA 2BY2A 1MXSA 1VF8A 4ICNA 4XZIA 1R0MA 1XDMA 1XKYA 3UY7A 2XFRA 3ZJ6A 2JFEX 5F2IA 3MCOA 1KWGA 4ADUA 1LG2A 4XAZA 1VPXA 1NFBA 3WLLA 3IVUA 2WW5A 2VCAA 1QNPA 1VQTA 4GRSA 4H3DA 2GGJA 5K2ZA 1CI1A 1W5NA 3WO8A 3I65A 1EPXA 2XZ7A 4ATLA 2ZXAA 3AALA 5I23A 4JQ3A 1E6PA 2WM0A 3QW3A 2G37A 1K03A 3QH2A 4AY8A 5FKYA 1YPXA 5BOFA 1C9DA 3S9ZA 3U2EA 3NZGA 4BQ2A 3SN1A 3WKZA 3IUDA 3LTSA 1VPQA 3B8TA 4AZ6A 5A8MA 3Q65A 4Y8FA 3G2GA 5EBUA 1WE5A 5I3KA 1T99A 1GHSA 2YL5A 3W7HA 2I57A 4H9YA 4ZENA 5AYIA 1DE5A 2AAAA 1EDTA 4QFUA 1RA0A 3O06A 1SZNA 4W8AA 4PFMA 1BYAA 1V3JA 3WIJA 1QK2A 2HK0A 4XZHA 3KBNA 3H26A 1CBGA 4TVUA 2EJ1A 4LS1A 4C7GA 4JFWA 3C0JA 2AMGA 2FHBA 2NW0A 3URBA 3W75A 2X1IA 2BY1A 5AVHA 2C1GA 4R9OA 1LT7A 3A23A 3KRSA 3LI0A 1J5TA 2VGBA 5GNZA 3B4UA 2HRWA 3HFYA 3ZR6A 4HU8A 4R7WA 5HNUA 1ZY9A 1LOQA 5CGTA 3MHUA 2VR4A 4LUSA 1WAUA 2WJDA 3MP4A 3IV3A 4C6QA 4L64A 1ZQ5A 4JAWA 4NUWA 2HNEA 5H8UA 1QI0A 1J6PA 1D7FA 1TA3B 4RUBA 2ATMA 2BVYA 3NZQA 5CG7A 4H9VA 5D05A 5IDZA 5EMJA 4PEEA 3VIFA 3VNKA 2O0TA 4KEUA 2WAGA 4L4MA 3F2BA 4MM1A 1B5TA 1XBXA 3NEHA 4JPGA 4JL2A 2QKFA 1RXOB 5L9FA 3MWAA 3W7NA 2ESCA 4PCPA 3GVRA 2ZBTA 1FHLA 3BLEA 5AOUA 1RJQA 3E02A 3MP3A 4C6LA 5LXEA 4QSHA 4RX0A 5F7UA 4INFA 1X1ZA 1YPIA 1A53A 2B7QA 5FSEC 4OECA 5AB3A 3RX4A 1MQPA 3GR8A 1VHCA 2GOKA 4CCCA 3CQIA 2EHHA 1GW9A 5FAGA 4YWIA 2VTFA 2VEPA 1A4LA 2VX6A 2WC4A 4NZCA 2DSKA 3KOWA 1DHKA 1PYMA 3MUCA 4L9YA 1BTMA 3TN3A 1JFHA 5I2UA 1LRQA 1SYTA 1E70M 3EWYA 2J74A 3GHUA 3GC2A 2QUNA 2I5QA 4GMEA 1GOKA 3C8NA 3MO7A 1AA1B 2X0YA 3BO9A 4BF9A 1KTNA 1GG0A 2DY3A 2YCIX 4FI4A 3MMTA 4BI6A 1PPIA 4E5TA 3ARWA 4PRRA 4JHZA 3WLOA 1IWBA 1BPLB 4UR9A 3DERA 1BGGA 5D2YA 2ZRYA 3P5ZA 3FW6A 5BXPA 5E0FA 3W87A 3TA6A 2YZRA 3CO4A 3RU8X 5ABFA 3IVSA 3HOJA 1GKQA 3B8VA 3U0HA 3VNLA 2F2HA 1Q6EA 4RDZA 1FWFC 1NOFA 3M0HA 3GD6A 3T07A 2VD8A 2G3MA 1ME9A 2OXNA 2Z29A 2A5HA 2GGHA 4TO8A 1JUEA 3UERA 4AW7A 1WDPA 4UB9A 3M4HA 4PUWA 1GQLA 4GOAA 2VOMA 5LNUA 1CECA 5CSSA 3GTXA 1P0NA 1F4AA 3M0IA 1VR6A 1I75A 3KBWA 4JTAA 1FXPA 3G5EA 2XDFA 1QRQA 3PTMA 4QG8A 1JZ4A 1K6AA 4QDMA 2NLYA 3HU7A 1V6XA 3P84A 3F4VA 3HGJA 3O6AA 1R3TA 5I3IA 4Q6XA 5I5RA 3VNIA 3N6JA 3KEHA 4Q8MA 2Y88A 1SW7A 4IMGA 4DM2A 1P43A 3VKDA 5BZAA 3VD4A 4DF0A 3W7EA 1Q65A 5HMEA 3TQ0A 1OVDA 1CXKA 3ZLGA 1P4CA 4PGLA 3MS8A 4Q3MA 3Q4DA 3OLEA 1UIPA 4GUFA 1UH2A 2UBPC 2NSXA 1XGEA 4PUMA 3UGVA 4IIFA 4F9JA 1KXTA 4JIPA 3FAXA 4GVGA 4TV6A 2PDUA 3EB2A 4Q8OA 1YMYA 2Z1VA 3PB0A 3R7MA 4QROA 1QI3A 1CCWB 3CT7A 2X30A 4OBRA 1OX4A 4IX2A 4PUDA 3VIPA 1QOPA 3TLQA 1J18A 2DEPA 1LQ2A 4IGNA 4IJRA 1J12A 1GORA 1EUNA 1SJAA 2FKPA 2XGZA 1YHTA 1UWTA 3QZAA 3OHIA 3NG3A 5DXXA 2AQVA 3BC9A 1VPYA 1JYVA 1YNQA 1Q45A 3PUDA 2B31A 4Y2WA 3IIZA 5GQBA 1ZCOA 3L5MA 4RLIA 3CGTA 2BXVA 2TYSA 2HVNA 2CC0A 3NPVA 4Q4OA 1W37A 4B5TA 1UD5A 3EXRA 1XI3A 1QPKA 1A50A 3S46A 4Z1AA 1UYQA 1V3IA 3W7IA 1F6YA 1F07A 2VFDA 3W1AA 1J0HA 2WZMA 1IR1A 2CESA 1PHWA 1JQVA 3CAWA 5D30A 3UCCA 1PDZA 4GY7A 5BU9A 2J7CA 3G1DA 3VMNA 3R89A 4HNTA 3CEUA 3K1DA 4FNPA 3W29A 3IPWA 4IPIA 1L2QA 1FX6A 3AYVA 3FSTA 2XWDA 1XSKA 1OHLA 5FF3A 2FPTA 4HU3A 3MA8A 2Q3OA 2B0MA 4IQEA 1TPB1 1FWCC 2LLEA 1JF5A 4L7ZA 1P0EA 2CLEA 4WUIA 1VFHA 4ZA0A 1O1ZA 5H8PA 2R1KA 4V15A 3NO1A 1J0IA 3MANA 3BOLA 1DJIA 2DZBA 3PBYA 3T4WA 1SW0A 3WSUA 3WLHA 4UCFA 1K9DA 2ZXDA 1EP3A 2FJUB 3V0UA 3QSRA 2F84A 3DI0A 4UR8A 4X60A 3MCMA 5EGRA 2JIWA