1ZPTA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
271
Chain Sequence
b'HASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 93
structure length 271
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zptA00
4O8AA 1V93A 3ITGA 3E2QA 2FMNA 2FZMA 3FSTA 1ZRQA 3IJDA 3E2RA 2FMOA 1ZPTA 4JNYA 1TJ2A 3APTA 1TJ0A 1TJ1A 3APYA 1ZP4A 2FZNA 1B5TA 3FSUA 4JNZA 1TIWA 3E2SA 1ZP3A
chains in the Genus database with same CATH superfamily
2I5GA 3PG9A 1C8QA 3S42A 3M43A 3W1AA 2E9MA 4H1ZA 4RDZA 5HQMA 2ZUVA 1IT8A 4OU1A 2O55A 1EOMA 4XZBA 1EB3A 3MCOA 3TROA 1FUYA 4IQEA 3D3FA 3FYOA 3CXOA 4JICA 3HPAA 3AZRA 1XI3A 2ATSA 1IEXA 3RIKA 3UR7A 2FVKA 3VIPA 5LGXA 3LBMA 4O12A 4WDUA 1BTCA 1EPXA 3PZVA 5J8LA 3QY8A 4CQ9A 1WQ5A 5HR7A 1PB0A 4K2SA 4FF5A 3WBEA 6TIMA 1NQ6A 1XRSA 2IKIA 1UR0A 3E0FA 1VBUA 2ZRVA 4CQ8A 2CITA 4ZSTA 2CHOA 3EZ4A 3FA4A 4IQDA 2E40A 2BGSA 3V0SA 3MS8A 2O9TA 3GE7A 2QLYA 2I9UA 4GC4A 1W9UA 2XH2A 3C2EA 3KUMA 4UFMA 3EMCA 4X63A 5CPSA 3M6YA 5AYZA 4CKQA 1DXIA 2HK0A 2FB3A 3F5LA 2A6LA 3RRAA 3FDKA 3QPYA 3QGVA 3N4EA 3GDMA 5CJNA 1LLZA 4LT9A 4R7WA 3Q94A 1A5KC 4FNUA 1V51A 2HTMA 2WSPA 1WZMA 3LA4A 2FGLA 1ZSXA 3ZLHA 2J47A 4JTRA 3NQMA 1FDYA 4QE4A 5ABTA 5ABHA 1SGJA 3W7CA 3W1TA 5I3FA 4DWSC 2QUMA 4LFYA 1QRQA 1UZHA 4Z2IA 1Q6RA 1WXYA 1KXVA 1UWQA 3TAOA 5AYXA 5E0CA 4E2BA 4C6DA 2OXNA 4NHVA 2X8RA 4JN6A 2POZA 4PMYA 4LEQA 1H5YA 3QC0A 2GDQA 3RAOA 4M29A 2PTDA 4JQAA 3VX0A 2PDIA 4DHGA 3P5YA 3QHNA 3W28A 3CAQA 2JQXA 4Q8NA 1F6YA 1E6NA 5C9UA 1WDWA 2AQOA 4KWWA 2YB1A 4H04A 1VFOA 3AHVA 3W02A 1W1YA 1OFDA 3W7DA 2PDWA 3NO1A 4DBDA 1VF8A 5JVLA 2X05A 2Z7KA 1T99A 5HULA 4GNKB 1QVBA 4V15A 2OCZA 5CPOA 3B8TA 4WK9A 2FTPA 2P0IA 1BVZA 4JTLA 4DJFA 3W7IA 1A5UA 1P6BA 2VC6A 4US6A 2VCCA 3URAA 1FCVA 1S2TA 1E51A 1Z3NA 1TPVA 3DESA 4AWSA 3N25A 1A5MC 1DJYA 4PA8A 4HT3A 4WKHA 3QOKA 4AEFA 3FLUA 5DY2A 2WANA 4DWSA 4NJKA 4XWUA 4B5VA 1F3EA 4LC8A 4OT7A 1GONA 3NZ1A 2I14A 3FOKA 1XCXA 3A23A 4LUTB 3QZEA 2YL6A 4R33A 3W07A 4ZGYA 5G5IA 2QPXA 2DZTA 5FEWA 1AODA 4A3QA 4D71A 4FO4A 5BROA 3SCSA 1BLIA 5C9ZA 1Q63A 1M1BA 2IKGA 2VL4A 3UP8A 1OADA 1I2NA 2BWGA 5I24A 3NYZA 3BG9A 4RNFA 4UTHA 3RCNA 2ZICA 3WMLA 1FCBA 4ZENA 3S2NA 2Y1HA 2P50A 4FPSA 5EY5A 4XSLA 5DCBA 1ZTVA 2PODA 3EOLA 1P0EA 4C7GA 1OHLA 4DX3A 1YYAA 1RJRA 2GLKA 1S38A 2W67A 1LWHA 3R5EA 4DLFA 3B8SA 3V7PA 5I3KA 2A85A 1HVQA 1HUVA 4W84A 4FEZA 3VOHA 1UWIA 2Y6ZA 1HJSA 2PGFA 3GTFA 1YIXA 3BLDA 1JPHA 1FHLA 2HISA 2MANA 3AZSA 4X2PA 3GTIA 4DYKA 4DM2A 2PWDA 3EB3A 4JKMA 4H2CA 1RHCA 8CGTA 3W1XA 2FB2A 1F3WA 2X0YA 4C60A 3NPVA 4PMVA 1A0EA 4XZMX 4JFTA 5CZ0A 4B2DD 4QX4A 3NZGA 1KRBC 4JTJA 1R6WA 1K3UA 2QR6A 3HQ1A 2ACSA 2JF7A 3OGSA 3TN5A 3E5PA 2P3EA 4W5UA 3N4FA 3LRLA 2RDTA 2Y70A 4IIEA 1KQZA 5BRQA 2BDQA 1XGDA 3PPFA 1DOSA 4Y6GA 3LHZA 1O60A 3FJ6A 5AHFA 2X40A 3WELA 3CNYA 3KHDA 5LZLA 3C8NA 4IQJA 2X16A 3TLLA 1TIWA 4LNCA 4EP8C 1QDSA 5K4XA 5A6SA 1P0BA 4QXIA 3SURA 1EWDA 1PXGA 5EYWA 2OPJA 3LD5A 1RD5A 3WQ4A 2J7DA 5E5CA 2VDHA 4EKJA 1K8ZA 3VIOA 5CBBA 1E70M 2WNNA 1G4PA 3LEPA 3MU7A 3DHFA 3AIWA 4OWGA 4I90A 3VD5A 2RGLA 3GIPA 3M0YA 2ZWYA 4UFKA 3UXLA 1IR2A 3C2FA 1GOQA 5H8PA 2H9AB 4NZCA 4ACZB 1R9XA 1MRQA 1UKSA 4QBXA 3EPMA 2WC3A 3S1VA 1YBQB 4N42A 2YBVA 3EBVA 5D37A 5D2VA 4XO6A 5E6YA 4QS5A 4L80A 1DBTA 4AC1X 3IUDA 3TR2A 1DYSA 1UWTA 4IFOA 4IXHA 3W1MA 2QXWA 1UWRA 4P8VA 1L6GA 1D3CA 2FKPA 2OR2A 1M03A 1V3LA 2P76A 1I75A 3S83A 1ONXA 4J2MA 3JU2A 3N04A 3JW7A 3HMJG 3W84A 1RK5A 4FA3A 3W7QA 1TUFA 2ZZ7A 3G3MA 1ICPA 2E5CA 1N82A 2D24A 3LQGA 4ZA0A 3HGSA 1X7IA 3UG3A 3E74A 2REQB 2FZBA 4PUNA 4WY0F 2C14A 4J1OA 1AQ0A 4MMWA 1Q2SA 4XBSA 1UPPA 3EWZA 1RR2A 3OYZA 1CXEA 3LRMA 4IG2A 4C90A 4F0MA 1HO4A 2PDKA 3LU2A 3ZJKA 3L4WA 1T0OA 5JBEA 1C29A 1OC7A 1OT1A 1BQGA 1S46A 1QWGA 3C0LA 4PB3A 3QRHA 4J9JA 4MWAC 4QAWA 4D1IA 1JUBA 3KP0A 4CVWA 3DFNA 3WLTA 3K5XA 4LOCA 2W6RA 2Y5JA 1CX9A 3AHXA 2PCQA 2P53A 3AICA 4B3KA 1A4LA 3I6TA 3NCOA 3VA8A 2QCCA 4PMOA 5GNYA 4O54A 3TMLA 4I7VA 1IEQA 2VRQA 2QUVA 4EIVA 1TCMA 3E0IA 1SSDA 1B4EA 1RA0A 3W1UA 2NXGA 3W01A 1US3A 3S0CA 2QGHA 1OC5A 1OZQA 2OJPA 1R7OA 4YTUA 5G4HC 4H7CA 1TPH1 5TD4A 1WDSA 3PPCA 3E0VA 4IISA 5T9BG 5I09A 2EGZA 1NY1A 2EPOA 3PBYA 1UUMA 3KAOA 4TVUA 2J9XA 3GX9A 3W3OA 1XW8A 4HIBA 4H7VA 3TFXA 3ZM8A 3LGGA 4O8RA 2UY5A 4HSHA 4DI8A 2WWDA 1QFEA 5FSDC 3C56A 3H54A 4C1NA 1AG1O 1JULA 3B8DA 2EXOA 4YHGA 4S3GA 4W87A 3N18A 3GNXA 2QJJA 1OF8A 2PPGA 1W5MA 1M53A 2DSUA 3ZLFA 1D9EA 4O16A 2FH6A 5TBOA 3DDMA 1UWSA 3CAKA 3IRDA 4J3WA 5EA9A 1ITUA 4LS2A 3O6YX 1E1CB 2FGZA 3WNLA 4JPGA 1O1HA 2XYLA 3MUIA 3QM3A 2F2KA 1UD5A 5KINA 1LT8A 2PWFA 1ODZA 3W7OA 5HNNA 4ADUA 2NWSA 4OECA 4CNUA 3PZ9A 3CUGA 5H8UA 2ISDA 3WMBA 3S47A 4AVFA 1GVSA 3H21A 1DVJA 1LQ2A 5IDIA 1J4EA 1EJVC 2PURA 2HE5A 3AXHA 2KZHA 3BLFA 3RX2A 5JIPA 4PSRA 1PCKA 1H7WA 3M16A 2WC7A 2XJ7A 2XH0A 1Y5WA 1B1YA 1HVXA 2V82A 3CHFA 1DJZA 1QPRA 1EYWA 3ZLGA 3GTXA 3DFYA 1RLDA 2WCGA 2GYIA 5CZSA 1HZYA 3A4WA 3GYEA 4MB1A 1QTWA 3UXDA 5GNZA 1XSKA 4YTQA 4BZYA 2HE8A 4J2PA 2Q09A 2FPYA 2QCEA 3VM7A 5ECUA 4DZAA 1G9HA 3KFTA 1K02A 3AS1A 1BXCA 1OYAA 2ZIDA 3VNIA 1Q8AA 4E4UA 2XGIA 4YCOA 2PA6A 2EEXA 4GGBA 4M1RA 1JCYA 3RM8A 4UQBA 1K9EA 4WOZA 3TONA 1EJWC 2GJNA 1V6XA 1WCGA 1E3XA 3GXMA 5F7UA 1XINA 2GK1A 1F74A 1XH0A 2WZTA 3LCHA 3UETA 4D2JA 2DSVA 1QO5A 1BSIA 2X0HA 3CLWA 3VCCA 3MB9A 1UOZA 4V1XA 2ZZ1A 2ZRXA 4ZQPA 3EYPA 3KOFA 1V4YA 5KITA 1SFLA 4C7DA 1V5XA 5LHFA 4WJEA 1XCWA 3WK3A 4E6MA 4JNZA 4HKPA 4IJBA 2H3DA 3L12A 5LIWX 3CPRA 2WHMA 2ACQA 2VWTA 2KX9A 4L6OA 4Y90A 4MNKA 4GXPA 1EO5A 1HW6A 4UFJA 3TEVA 4A22A 2F6XA 4JQ3A 1G1YA 2EJAA 3UESA 5M3WA 4DXKA 3WF2A 1MW0A 4M5PA 2VEGA 4IX2A 5G1MA 1XIEA 2FJUB 1PJ9A 4NZFA 1YW1A 2Z1VA 2X42A 4NX5A 2ACRA 2E6FA 2HROA 5CPLA 4MSSA 4QG9A 4HU8A 4ZQNA 3A3XA 3AIEA 4ZR8A 4GIRA 1NM9A 2DUAA 1QASA 2JALA 5CLWA 1C8VA 4OFCA 3BMWA 4GVGA 2WHLA 2WZEA 3CLMA 4JYEA 9XIAA 4M56A 4GK8A 4OUIA 4O1EA 2ZUWA 1DORA 1IR1A 1HG3A 4FX6M 3PBWA 2DT0A 3GBEA 3UWQA 3PB2A 2OWWA 3V4BA 3V1HA 1V6VA 3L4TA 5H1WA 2AKMA 1IZCA 1G4EA 1LRTA 3TU9A 1PKMA 3CHDA 1TTQA 3PNZA 1KRMA 3AIRA 3WQPA 4TUFA 5AVNA 2B7OA 1KLZA 3I7QA 4HA0A 3TW9A 4M1BA 3L2MA 4PTNA 1XCFA 2INFA 1ESWA 3TCEA 1W17A 5HUOA 5A8PA 2PMQA 1XPYA 4LVBA 1KC7A 4ZXOA 3IV8A 3OQEA 1BYAA 3L5LA 3AHTA 4RXGA 2OOGA 4LX4A 4NAEB 3GNPA 1RH9A 3LN3A 4AB4A 1E40A 1M3UA 1XIDA 2Q6ZA 1E4MM 1KXTA 3W1PA 3L21A 1HTIA 3AMDA 5CPMA 5AC7A 2Z29A 2QAFA 2WM1A 2DW6A 3PWGA 5DMYA 3CMGA 3K4AA 3O9NA 1NFGA 2Z1KA 3EKLA 3UJSA 4C1LA 1RP8A 1HFBA 4C1KA 4JIPA 1QPQA 3GD6A 2Y61A 1X38A 1CGUA 3THAA 2QGYA 3L66A 2Z1BA 4L4OA 3CM4A 5CC3A 2D23A 2XVNA 5FA5A 1M5WA 1T41A 5HA7A 3V5FA 2ISFA 4PCFA 3DFSA 1IT0A 1IQ8A 1RQHA 4AX6A 1LM1A 1NVMA 5AY7A 4JFWA 1KWGA 1TVPA 2F2HA 2CYGA 4BQ5A 1WZKA 3E49A 3UWVA 4I5RA 2Y88A 4DO4A 1LBMA 1JI1A 3VPLA 4IFKA 5M17A 3JZUA 2NLYA 1OFAA 4ROQA 3U6WA 4OE7A 4MTVA 5C55A 3TK7A 4UQEA 4F2BA 2GQ8A 3U7BA 2ZTJA 3FJ4A 3VTRA 3NO3A 1P43A 1H7NA 2QJMA 3UYCA 1V0KA 4ZQOA 1T40A 1BRLB 4LNYA 4IJRA 3NEHA 1ZHAA 3QPZA 2RH9A 5IBXA 4AY7A 4A4AA 3WG6A 3W7NA 3A47A 3W53A 1JNEA 1TMLA 3JZEA 5F4WA 4NU7A 4QM1A 2WVTA 4NJIA 1DPMA 2ACUA 4Z08A 4O0ZA 1XIMA 3CBWA 1CECA 4YVXA 5ENLA 1PZ1A 1J8VA 1QR7A 5D33A 2EG8A 2GQAA 4CN4A 7A3HA 4GYKA 1OFPA 5JH2A 2CEQA 4N4PA 4ACYA 3W2MA 3G1SA 2X1RA 6REQA 1QO2A 4EWND 1QAPA 3CWOX 4GINA 4KBXA 4BK9A 4H41A 4N9BA 2NUYA 3K8LA 3VD7A 4Q4OA 5C54A 1FY6A 6ENLA 4B92A 4XSMA 3CAVA 5BW6A 3H4XA 2C8NA 2QCDB 1TR1A 2F84A 2NVDA 1JPMA 1HIZA 1H62A 1LL7A 2VOMA 4AH7A 1THFD 4O1DA 4XD3A 5AC5A 2CXGA 3W37A 3KBWA 3LV5A 5HQLA 2P88A 2OT0A 4GY1A 4R9OA 1UZ4A 4URIA 3UA3A 1KGWA 2OZ3A 3VUPA 1H7RA 5EFDA 4OKDA 5E6ZA 3GSMA 1EFZA 4U4MA 2GQ3A 4I6VA 2XSXA 1U1UA 2HXTA 1S1PA 1XLMA 5HWNA 3BSHA 3NL5A 3B3DA 1R38A 4R85A 3EB4A 1JQVA 1P48A 1G7UA 3MDUA 2E9LA 3S2CA 1EH9A 2FZ9A 3NL2A 3WLIA 3TOYA 3VE9A 4WJXA 1DKWA 1V02A 2AL2A 3LK6A 3MV11 2OB3A 3EKZA 4TV6A 4PYSA 1E55A 4U10A 3H55A 4PTVA 4GXMA 2VC5A 1XIFA 3KCOA 2HMCA 4ZQCA 1YNPA 1GWJA 3W2NA 3U5UA 3BZGA 3VDHA 3GO2A 4EPEC 2O9PA 1TJ2A 1WBJA 4GI9A 4CD7A 3P0WA 4B9YA 1IGSA 1I6NA 4Q8MA 3S1GA 2JF6A 4HNLA 3PFRA 3A9IA 3LCFA 4U2ZA 5C2CA 4FX7A 1NP0A 4QS6A 2A4AA 2VEFA 1DE5A 3WLQA 1UMYA 1J6OA 2WNZA 3NDZA 4ATLA 2JKEA 4R5EA 3LXBA 3URQA 1UH4A 3OHIA 3PF3A 1OFEA 4YVVA 1S2VA 3W0KA 1LJYA 1TCDA 1TRDA 3DKLA 1H09A 3BGAA 2BY3A 1XSIA 2YOCA 4HK6A 2NV2A 5J04A 3CHCA 5E0KA 3CUHA 1ML1A 1JZ2A 5BOFA 3SRDA 3TH6A 2WPBA 1JGMA 4GY0A 1YTEA 1JFXA 1AZ2A 4GCXA 1L8NA 3TE9A 4ZOAA 4JTDA 1B3YA 2DZSA 4UFLA 2QCLA 3LZ3A 1KV5A 1EDTA 3MSRA 4M80A 1QNPA 5LIUX 1A5LC 2VX6A 2OGYA 3FGCA 2ABBA 3LBOA 5C70A 2RAGA 4Q6JA 1I2PA 2WV8A 2P5NA 3PZQA 1PEZA 1YE4A 5HJLA 2GGHA 3BICA 4FZIA 5CZKA 3MKCA 4G5DA 3R43A 3WDIA 2FPTA 7REQA 2DY3A 2DUZA 4W88A 3UNTA 3KOXA 4AD5A 3K4WA 2JK2A 4O1BA 1W1A1 4LUYA 3B03A 2F61A 1SFTA 3QH2A 2WVUA 3ZWTA 1RV8A 9XIMA 4MG4A 3HIJA 1XICA 4PODA 1QWKA 4CVUA 5C9WA 1R3WA 2X7WA 3I68A 1Z6KA 3TXVA 5AZ0A 1UC4A 1DJNA 3RF9A 4PMNA 1H2JA 3ARXA 3W38A 3VKAA 3BV7A 1W3HA 3LHUA 2GWGA 3VNYA 1W9BM 2YDAA 3FX4A 3UZ5A 3WLOA 2PDLA 4CU8A 2D2OA 2Y7FA 3B06A 4RE4A 3T81A 3GTNA 3VGGA 1LDCA 4LUSB 2ZX5A 2V5JA 3RNDA 1CTNA 3BVJA 1TPB1 2HPIA 2NUXA 4ZMGA 1ZJBA 5C8BB 3O06A 5AVHA 4AX7A 2GVEA 4NX0A 3ZJ7A 3FSTA 3ZQ9A 4O10A 4KF1A 3ARTA 3Q58A 4UOJA 3VGBA 2E6AA 1RCQA 5GVJA 1GT8A 4JS3A 1K1DA 1DIDA 4GUHA 4XAYA 4UIOA 4S1FA 3LV6A 3G8RA 3G8EA 3CH0A 3W6MA 4CQDA 2XM2A 3U7VA 2RJHA 1QMLA 1YDNA 3TDFA 2WKGA 1TVNA 1W9PA 3TWAA 4GUGA 1J9YA 4U5KA 1KBLA 2CZVA 1TWIA 2XINA 4GVFA 1TPDA 1Q8JA 4O0QA 5CAHA 4P7OA 2E6YA 1QUMA 3DOPA 4CNNA 2XU2A 3ANVA 3RUBL 4WDXA 4M7SA 4RPQA 3LLFA 2GQ9A 3MI6A 3S1UA 1B31A 1TTIA 1YTKA 3CMJA 1BWVA 3VXGA 1CENA 2XWDA 3LB0A 1IXQA 5CSUA 4G1NA 3VD4A 4IMEA 3EX2A 4U31A 2CETA 4MUZA 4N0RA 1GOOA 1R87A 1HKWA 1IEIA 3SI9A 3VNDA 3A13A 5HINA 3PY2A 4INFA 2NQ9A 1DIOA 1NH6A 2WVSA 1H0GA 1O5QA 1SZGA 2B31A 3HJZA 3M5YA 2PDUA 2VMFA 1XDJA 4ZODA 2WZHA 3P67A 1VYSX 4E8CA 1E6QM 5BNKA 2PWEA 1M7OA 2G3JA 4UR9A 1UW9A 4I9JA 5A6JA 3AYSA 1WDDA 1J0ZA 3VABA 1J5SA 1Q6FA 3IS4A 5G1YA 8XIMA 3NIYA 1KTCA 5I03A 1H5VA 3VOIA 1SW3A 3FKKA 4K7VA 3F2DA 3OBAA 4I8DA 3PZNA 4JX4A 4A3UA 2J8TA 3PZUA 2BBFA 2HNHA 3VOGA 1K70A 4WXZA 2YFOA 1IF2A 4H9XA 2ZZ5A 1KNWA 1FH8A 4AFYA 2XM1A 4MNMA 1ZS2A 3VC6A 5DCEA 1H7OA 1PDZA 1OFOA 4HPXA 4JL2A 5DRIA 3RJYA 3EEZA 1K6AA 3UJRA 4PUWA 4JFSA 5CBIA 3TZNA 4WXYA 2H90A 4AHPA 1HKMA 4EVZA 1QK0A 2GWNA 2Y7GA 3R8RA 1RJQA 1VLIA 4O8AA 1OX6A 1A5CA 3VOJA 3SCPA 2VX7A 3AXMA 1H7XA 2XN0A 1H60A 3BG3A 3MJMA 3GVQA 3EWYA 4PMDA 3MVIA 1E4IA 2YW3A 3IUIA 3L5MA 4HN8A 4C6PA 4RW5A 3LHVA 1EPVA 4IGHA 1R46A 3H6OA 4MB3A 3GC4A 1UMLA 3U4AA 4WQ6A 3HG5A 3KBNA 5T8GA 3LERA 3LYEA 3UG4A 4WR3A 3CUIA 3VNLA 3FEMA 4EF9A 2DU2A 3HF3A 3RXZA 5FIPA 3VO0A 4XG1A 1NDYA 1VC4A 1TJ1A 2QDDA 2YXGA 3NM3A 4H9TA 4TVDA 1O5KA 1YKWA 5L9FA 1VLWA 1W1IE 3V75A 4LPCA 4E2OA 2ZVIA 1EQCA 4G56A 2VO5A 4OOUA 2BP1A 4ORIA 2Y2WA 4X9SA 3SSJA 4UZSA 4GZIA 4K38A 2DSWA 1F05A 4GQ0A 2VQUA 4B2DA 4DO5A 3ZT5A 2WSQA 4TV5A 1FH9A 4PBFA 3S6TA 1UA7A 1T5AA 1XRFA 2PGEA 1UB3A 4IMFA 3WQ6A 3R25A 5CPTA 2BVWA 3KL5A 1PYFA 1Q7MA 4F2TA 2AKZA 2J79A 1UWAA 1ZJHA 1CLVA 3M0KA 4AXKA 4RCXA 5U4NA 1QU4A 3RMJA 3UZZA 5DXYA 3MSGA 3U9IA 1E56A 4WVXA 1GG1A 2VQTA 1JZ6A 1EHAA 1W8GA 4IWWA 1PTDA 1OIFA 3VMPA 3WQDA 3E9AA 4HYWA 3SJ3A 3QY7A 1XIJA 2HEJA 3ZT7A 4H9VA 3MBFA 3ARWA 2R6OA 1RCXB 1I2QA 3B97A 2NQ5A 1RXOB 2NX1A 4LAMA 1ENUA 3G24A 4ZE4A 1NP2A 5A6AA 3GFYA 1TZ7A 1OX4A 3SR7A 3AC0A 2OEMA 4B9ZA 2CLIA 3HA1A 3N9SA 1Q6LA 5LNRA 4XD6A 2I16A 2ANUA 5F1VA 2WZIA 4CQAA 1LZOA 1ONWA 4JYFA 3VD9A 5IFPA 2CW6A 2W0UA 4F9DA 2CBUA 1DIKA 1DQXA 4EANA 4UTJA 2EF9A 2QS8A 3NFUA 4C6KA 3W82A 3VOCA 3MZ2A 1NWUA 1O5XA 2X41A 2VFIA 3WQ5A 4CCEA 1MEWA 2XSBA 4C5YA 1HXJA 3KRSA 2RDUA 4BI5A 4W89A 3LCGA 1WV2A 2FMNA 3LCXA 3UXKA 3ICJA 3LTYA 3RJXA 3H8AA 4LBRA 3WLSA 2VGIA 4WGXA 4AZIA 5KZEA 2Q3OA 4D6DA 1EGMA 1OYBA 3IK4A 3LY0A 4LF1A 3G1HA 3DC0A 1RVGA 1R3RA 2WJFA 3M64A 3W2JA 4HZ6A 4YNGA 2I1OA 3AROA 1VCFA 1SJCA 5BMXA 4MKVA 3ARZA 1JDEA 4JTAA 2HK1A 1HJUA 3NVTA 3OLIA 3CUXA 5CC7A 3C2OA 4DQWA 5HOSA 2A3BA 1B3OA 1SSGA 1NDZA 4HCDA 1B54A 4YTTA 1QPNA 3PTDA 3ONCA 5ABGA 3T0CA 4JTKA 1YPFA 1SZRA 4AC7C 1K7FA 4OQVA 1Z9AA 2A5HA 5ABEA 5FOOA 1JPIA 1UD8A 1GZJA 5K4ZA 4M8UA 4EPBC 2BMBA 2RHGA 3BW2A 3VE7A 3AMLA 3EWWA 4GYPA 4GACA 4XISA 1XQKA 2A3AA 1OGSA 3DEQA 4GABA 4MB4A 3F4NA 4UFIA 3RILA 3S2LA 1XLIA 4H01A 2G4FA 3ABZA 1U2YA 3PB0A 4FK9A 2JIWA 4DBUA 2OGJA 2V2DA 4MLJA 2I7GA 3TYCA 1NFBA 5LNWA 1ICSA 3IIPA 4GFIA 3TAKA 4E3TA 3ZS4A 4IIDA 5TF0A 4JHMA 3DENA 5CGQA 3QYQA 4NNCA 3KE0A 1V6UA 2R24A 4MY8A 3CYJA 2UY3A 4S3KA 1S3HA 3VIHA 2QAPA 2ZZ6A 2FTYA 4CQCA 2F7FA 1YRRA 4Q7NA 3W70A 4XO7A 2YXXA 1J0KA 4S3JA 1KTNA 3VFCA 2QMJA 3AJ7A 1EIXA 2WSKA 4HPGA 1H4PA 1BVNP 4GMEA 1JCMP 1V8EA 4JY9A 3LM7A 4HTYA 3A12A 3H7RA 1V77A 1IEWA 3VU2A 4BJHA 3T4CA 2YPIA 4MAVA 4QP0A 3MDWA 4LBUA 4DUXA 3AAMA 2A6NA 5CGMA 5G2WA 5A6MA 1XIBA 3HV9A 3M7WA 2XVLA 4Z2HA 3B05A 1C3FA 1B90A 1XGEA 1OWQA 3NXLA 3QVQA 5BRBA 2CWNA 4CCZA 2D0HA 2OFJA 4M6VA 4DY1A 3WBAA 3Q65A 4N4QA 2F8QA 1Q6CA 4XZIA 3O07A 1EX5A 3HG3A 1U22A 3BAYA 1GVEA 4XZNX 1Q2RA 2WMHA 4LU0A 3PJTA 4GH3A 3BLOA 6XIMA 2VELA 2VWSA 2J27A 1DE6A 1OSEA 4K39A 1PSCA 4XBKA 3IVSA 4N9CA 4J35A 4KIEA 4ML9A 4LF2A 1X97A 5A3HA 4PUMA 5HMSA 1Z89A 2Z1XA 4H9MA 3VIFA 3LNMA 3E96A 4M7TA 4ZFMA 3U0HA 4JDBA 3H7VA 2DUXA 1LRQA 1RJPA 3ITCA 4PMQA 1HL2A 4JTHA 3QQ1A 2F38A 3TOPA 3W81A 1JZ7A 2J8GA 3HM7A 5KETA 2VEIA 4GVHA 3H4GA 1IWBA 4QJ5B 1QT1A 3L4VA 5FEZA 2QJHA 3ONBA 4C6CA 2DH2A 3KW3A 5IFTA 1UROA 4ZEPA 4TX8A 2YJQA 4FOUA 4JFVA 3WMCA 3MI3A 5CG7A 4ZQRA 1E0TA 1MMFA 1KBBA 4RE3A 1F6PA 1Q7ZA 2ZZ2A 2C7FA 2IPFA 1XF0A 2Y7DA 5JU6A 3RO8A 2CKRA 2DEPA 2GVYA 2DVXA 4IUGA 5H8MA 3F4WA 4MZ8A 5LXEA 1KFBA 4QLKA 1MYRA 4JTGA 5EBUA 4QLLA 5CC5A 3I65A 1BEUA 2BVYA 2O0TA 2QQ6A 3OJGA 4PN2A 2Y85A 3UGRA 5FEXA 1XBZA 4NZ3A 1VIWA 2GDVA 1K8CA 4ZOEA 4DJDD 4B5TA 1ZY9A 4RV8A 3W27A 3GAYA 3IGUA 1R9YA 2CZ5A 1XIGA 1REQA 5DN1A 4D72A 3QHOA 4CUCA 4NYYA 4FALA 3LENA 4S3BA 5K2ZA 4Z0SA 1XP3A 2J74A 3FV9A 2V9DA 2ZUNA 4UNKA 4RDVA 2XIOA 5HMDA 4JTFA 4BFAA 3TKFA 1XKJA 4GZJA 1YE6A 2G4JA 2HBXA 1R0MA 1R8LA 1YDYA 3QY6A 3GM8A 5D09A 4YMZA 3KRBA 3VINA 4OVXA 1ZFJA 1GVFA 2C6QA 3EX3A 4UTLA 4HNTA 1JD7A 3GVWA 1HL8A 3SUWA 3U57A 1UKPA 1OEPA 5BOOA 1VAHA 4JTCA 7TIMA 4I5UA 5FL1A 4OIFA 4DWDA 2A7PA 3NR0A 1KCZA 1KKOA 3GR8A 4JEJA 1Q13A 1TTJA 5AYIA 1US0A 1FWWA 1LF1A 1K4HA 4FR6A 3IIXA 2IPJA 3B9OA 4KFPA 1UIOA 1OCBA 2PFHA 4IIFA 2ONEA 1XC4A 2W62A 4JIHA 4Z1CA 2O56A 4ZOBA 3INPA 3CIWA 1LT7A 2AGTA 3WN6A 2V5LA 3PWIA 2YCEA 2V81A 4LY8A 1XDLA 4C5ZA 3T05A 3IWPA 1L6WA 1LQAA 3CIXA 3CL7A 2OSWA 4DAIA 3ITOA 4X0VA 3H23A 3WFAA 1Q85A 4ICNA 3RO6A 3BAKA 3QMTA 3QBUA 2F6KA 1XYAA 1YMYA 3LUTA 4MDOA 3MSYA 4F79A 1JCTA 3NM1A 2PTWA 2IPWA 3BAXA 2R1KA 1HP4A 4RZ5A 3TYAA 3S9ZA 2CLPA 1EXBA 2WLZA 5I23A 4I7UA 3WK0A 3MP4A 3UPBA 2VT0A 1C8YA 4F2UA 2BV9A 2IW0A 4UTFA 3UEQA 2VFGA 1QJWA 2C15A 3W7RA 3M4HA 1CPUA 2TPSA 1PHWA 1XSJA 1OIMA 3W7JA 3R6IA 3L67A 3SZ8A 3IJ9A 4DB7A 3OODA 3NQ6A 1HGWA 4Y96A 4FLSA 3KBJA 1RAKA 1VFSA 3AALA 3CMFA 9CGTA 5AHMA 2QJIA 4W4QA 3JRKA 3G22A 2C0HA 4UTKA 1NOUA 2VNCA 3WL1A 3T2PA 3O2LA 3HN3A 3I3DA 3EWDA 1MWOA 5EMYA 1BYDA 4U33A 3WQOA 3CEUA 3WF1A 3HPSA 4KCTA 2D1ZA 4AWEA 4X61A 1R5YA 4JYDA 5BOEA 4XTIA 3AIVA 2V2HA 1UR3M 2PE4A 1B57A 2C3ZA 1TSIA 2Z28A 5HBFA 2NZLA 1XIIA 1O68A 4E5TA 1KTBA 1VFLA 1MUWA 3I4KA 3MC5A 2O7QA 2IQDA 3LSBA 2G3FA 1E4LA 3TSBA 1RPXA 2OO0A 4S3AA 2VR2A 3V35A 4Z17A 3TQPA 1D7KA 3NL6A 1QOPA 3CUJA 1WXZA 5G1TA 3QLLA 2VX4A 3TIMA 1V3KA 1M04A 2WKJA 1ECQA 1UJQA 4F8XA 4RJEA 3UY7A 2X30A 4DUWA 3ALGA 4M6UA 1B9BA 3P6LA 3LQLA 2D69A 1JPDX 3B9NA 2NQZA 5FJPA 1V08A 4FAMA 1JVNA 3IGHX 1XLJA 2P1FA 3T9PA 3IVUA 4E0CA 3VNJA 1P6CA 2XIJA 2D22A 2YLLA 4ZO9A 2EG7A 4L6DA 3EWUA 4LUTA 1Z41A 5CPNA 1LYXA 5I79A 3CUFA 4C6MA 3NSNA 3OVGA 3UXIA 5DMLA 4XIAA 4NXKA 1EZWA 2RDXA 2VX5A 1KM6A 2CLFA 1MEIA 4H83A 2X1SA 3L4YA 1W8SA 2E1WA 2FZDA 2VEMA 3W76A 5LNUA 1SJDA 1FH7A 3GRIA 1FP9A 3KOWA 5IRPA 4IICA 4ZXLA 3ZJ8A 4O50A 1W31A 3FHQA 4NSBA 1MW2A 1W3NA 1QK2A 3GFXA 1LQ0A 1BFNA 2WMKA 3L68A 3RM4A 3UA4A 3E5BA 4NI8A 4XB3A 4ZBCA 4Q6XA 3MO4A 4YYCA 1EF3A 4QAIA 4KRZA 3ZMRA 2E28A 1JI2A 4PBGA 5D04C 1O95A 3WNOA 1MW1A 5F2IA 4K8HA 4A3HA 2W79A 3ARUA 4UCFA 4WCJA 1ICQA 3F2BA 1Q3NA 1UD4A 4HPJA 3K1GA 2E3ZA 4MVAA 2CZEA 3W24A 3H22A 1FWEC 3ARSA 2E67A 3ME3A 1TR9A 1BF6A 2V6AA 4Z1AA 3PPGA 3EMQA 1XLHA 3WUFA 1JAKA 1HL9A 2W9MA 4RE0A 1WB0A 1KB3A 2VRKA 3GG7A 3MTWA 3R11A 6ALDA 1VJIA 5FSEC 5AYYA 3DFHA 3PK7A 1JCNA 1PCWA 1A5SA 3EEGA 1J79A 3KXQA 3ZSTA 1A47A 1LTDA 1JRBA 3DFPA 4DBSA 2WPGA 4HNUA 3OGRA 5HWJA 1OD8A 5B7YA 5B80A 4HQVA 3U2OA 3ARVA 3CB3A 2E7FA 4GE8A 1RBOB 1B3VA 3VUSA 2RDWA 1EJSC 2YR1A 4W85A 3TZFA 2PP3A 5C9RA 1KW1A 5FEPA 1CWYA 4CQBA 1VD6A 3GHSA 2PD9A 1GNXA 1AJZA 2NLIA 1XG4A 2YCKX 1RALA 2C79A 2ASHA 4ZO7A 1SVDA 2NUWA 3TR9A 4TR9A 4HZ7A 2PRMA 4E2DA 3USBA 2GGIA 4PTWA 1FA2A 1XLCA 4RLIA 2GVLA 2DQXA 3HB9A 3R7MA 2H9AA 2VVSA 3MMDA 2ZC1A 5CSRA 3EX6A 4ACZA 3G1RA 2ZKMX 1R47A 3G1DA 4HMEA 4MAZA 1FRBA 3B4UA 3P81A 2EPNA 3BLKA 4LRSA 2OYLA 2XN2A 3DGBA 1KLYA 1H0IA 4TTUA 4HYRA 2OKOA 6XIAA 1ALDA 2DZBA 1BGAA 3KZPA 3N2BA 3ZOAA 5B7ZA 4QIUA 2V3DA 2VCAA 3ITXA 1E72M 2V63A 4NJGA 3M0LA 3IJ6A 3CZGA 2EKCA 2Y5EA 3AS0A 2XZ9A 4FS9A 3AJXA 2FZ8A 3AOFA 4KRUA 1LRNA 3TMQA 1VHCA 3LNPA 1SMAA 3FDGA 1H7PA 2OLSA 4U3AA 1CXFA 3K1DA 4ECLA 2AQWA 1AZ1A 1SZEA 1K7EA 2REQA 3NG3A 4IP4A 5K9DA 3UNDA 4E8GA 1RY8A 1RPKA 1GKQA 3BOLA 3CZKA 1PVNA 4AZCB 2GOUA 1ZENA 5HDRA 2AL1A 4HU0A 4AD4A 4MUPA 1EDGA 4XAGA 5EMKA 5C0QA 1I2RA 2J13A 4MYAA 4HOXA 3RG6A 5JH1A 4C6QA 3G1FA 3S8HA 5FL0A 1EBGA 4HGXA 2VZVA 3XIMA 3EDEA 4NNBA 3E02A 5LSMA 1MQRA 3Q2DA 1PE1A 3CQKA 4K8GA 3P5ZA 1YPIA 1NDWA 2J66A 2PCEA 2PLCA 3IV3A 4KWOA 3C61A 3CK5A 1JCXA 4LS0A 3DHUA 4MY9A 2FTWA 1AA1B 5U7SA 1F3XA 3J7HA 1DTNA 4DNMA 3RRXA 4V2XA 5REQA 4ONVA 5DY3A 2HPMA 1JUKA 4JDYA 4RPPA 1W1PA 3KWSA 4M6PA 1B3WA 3QF0A 5HK4A 5XIAA 3KCJA 1QNQA 4H6QA 4REQA 2DH3A 5I3DA 3LPPA 2V3FA 4FOJA 3N6HA 4LVGA 4BF9A 4RNIA 3RFAA 3PSVA 1TZZA 1UG6A 4G6CA 3VDBA 1GEQA 2J78A 1VS1A 4MDPA 4UOQA 1SJAA 3N1AA 2Y8UA 3BW3A 4NJJA 1W3LA 1W3JA 3FN9A 3WFZA 1W9XA 3RDKA 4LVDA 4ES4A 4AMCA 4KGJA 4NRSA 1GJPA 1EO7A 4DEFA 4E38A 3M07A 2QV5A 4QR6A 5CLTA 2A79A 3NQFA 1XFCA 2OZTA 3G18A 4XBJA 4A8IA 2CBVA 5EMJA 4KESA 4LALA 4LYKA 3KOYA 3I7SA 4HHHA 1SZNA 2PWUA 2YL9A 3RX3A 1QCWA 2XSAA 2XFYA 3PJXA 1BG9A 5DFAA 3UWUA 3T40A 3C52A 1Q66A 1CGXA 3SIMA 3TWBA 2HVOA 4J7RA 4GNVA 4XUYA 3QPEA 2PDGA 1EHNA 1VPQA 1JYWA 3KDNA 5EMUA 2DDXA 2E5BA 4ORMA 4Y8EA 4DJFD 2NXHA 3BL3A 4H6EA 1XJBA 4RNHA 3T8LA 3UY8A 5A6BD 2YKKA 3GDLA 5DF0A 4UTWA 4BI7A 1GVYA 1PZ0A 1SR9A 2VJXA 5HWMA 1V6YA 2JKPA 1IE7C 4JIEA 4F9JA 2E5DA 1XQLA 4DF1A 4HNVA 1WP6A 4X2RA 1BKSA 4E4PA 3UJ2A 1MXSA 3KBMA 3B0VC 1GVIA 3PTQA 1ADSA 5AOUA 3DFQA 2LLEA 1DWHM 6REQB 3RLHA 4JBRA 1Y8BA 1UR2A 4JY8A 3IGXA 1A49A 1BG4A 2BXVA 4UUIA 4Q32A 3OIHA 4H8NA 4ALDA 2OLAA 3G1XA 4R34A 4NL1A 2C1HA 3G1VA 1S39A 2QPSA 1LLOA 3ELFA 1DL3A 2O4QA 4O0KA 4FNSA 3WF3A 1OYCA 2J88A 1VGAA 4L4LA 3NQBA 3WD2A 1EJUC 3PZMA 4IL2A 1RA5A 1HJXA 5DBUA 1BSLA 2V0TA 3EPOA 3FVDA 3M47A 4L9ZA 1UD6A 3W6YA 1YADA 1QI3A 3WJZA 3THDA 2YDRA 4JNMA 1A5BA 4MHBA 2V5DA 1A80A 4YWSA 4GUJA 3OLDA 5D03A 2Z1SA 2E25A 2GDUA 4O15A 5KZ6A 5D30A 2XDFA 3TTYA 1OZMA 5BWAA 3B8WA 3AYRA 1XV8A 3HG4A 4ZB0A 4P8UA 3M7SA 4ICMA 1WBHA 2AL2B 3QTPA 3IVTA 4K1GA 3O16A 2ZUUA 4ROPA 1ZL1A 5HQEA 1ZJAA 5CZJA 2R1MA 1WZLA 3WCZA 5K7JA 3BSGA 3VZYA 3QQWA 1GTHA 3TYUA 4DZIA 3VYLA 2R94A 3DX5A 3IIVA 1HGYA 3FFSA 1R9ZA 4Q8QA 1V7YA 1TWWA 3QLDA 1KA9F 5DT7A 3D6NA 2V2CA 1QXLA 2HS8A 2Y89A 2G3IA 3STPA 2GJPA 5LGZA 1XWYA 3W72A 2ZX8A 3LMYA 3RR4A 3OW1A 3MZNA 3T44A 4ZFCA 1PWMA 2RFGA 1K77A 3HV8A 5DRCA 1FHUA 2GOKA 1T96A 5KZDA 4YIWA 2WW5A 2YA1A 3CZEA 3CT2A 4MNLA 4DO6A 5E1QA 3FK4A 4YYFA 3ITVA 1GOIA 3DHDA 3VIKA 1XGZA 3FAXA 3RR1A 1TV2A 3CZLA 2OWCA 3WD3A 4WSHA 2CFFA 1LBLA 3W1QA 3KTXA 3ALFA 1KQYA 2WMIB 1E9IA 1H11A 1LBFA 3OA5A 5EMLA 1DQWA 2C13A 1JL8A 4KEMA 5H91A 3N9RA 4AVNA 2BNJA 4GQBA 5CXPA 1S5WA 1W56A 1PIFA 4I9MA 4Q8OA 1LUCB 2EHHA 5G2IA 5F2GA 1V3HA 2UWFA 2QPUA 2PEVA 1GEHA 4JX6A 1TVLA 1IXNA 2Y5SA 3EKGA 5HNTA 3KVLA 4JQ4A 3FY1A 5TAOA 2NV1A 1EA9C 4KCUA 3FGCB 1S5TA 5HANA 2X09A 3WX7A 5FJIA 5C6MA 1OGGA 3C8FA 1OG6A 2WYSA 3TP4A 4ZTXA 4LV4A 4BEUA 3CIVA 3HQPA 1ZBVA 5KEZA 4D1JA 4H19A 1NOFA 1GHRA 4Q33A 4HBKA 4PCPA 1NDVA 4JQ2A 7REQB 3O8AA 1OGBA 1P0NA 2VR4A 3OVQA 2QKFA 2JGQA 5M1TA 2WAGA 3QSRA 4IF2A 3MHGA 4HA1A 4KFOA 2HXUA 3H2AA 1JYVA 3M5ZA 4K3ZA 1CI1A 3FNDA 3BXWA 5JIWA 5KZMA 5DO8A 4BA0A 2H3BA 3A5VA 3N9KA 2JEPA 2PDCA 1DJIA 4IP7A 1FWHC 1J2BA 5HJXA 2DZPA 1B0IA 3TJXA 1SO6A 4ZB2A 3GWQA 4GUIA 2YCJA 2A0NA 4CEXC 1GZ1A 1KM3A 1VYRA 4LUJA 4L9YA 1QHOA 1UHVA 4GZEA 1L0PA 4LV9A 3N11A 3TA6A 1TQJA 1H49A 4C6JA 4A21A 2H8ZA 3AXKA 2VGBA 3HGJA 1XL9A 1TA3A 1WKEA 2DJLA 1XISA 3BOXA 5KMYA 3WLJA 4ADTA 4FLQA 5AN7A 3R12A 3BLIA 4GY7A 5I2UA 4CD8A 4NAFA 1BTMA 3L2LA 4FHAA 1F8MA 4X9YA 1BYBA 3OG2A 4GNJA 4WZHA 3H12A 3IANA 2EPMX 1WXJA 3EX1A 4O1AA 5FF4A 3WDJA 4AYGA 2AQVA 1W9VA 3GUWA 1GYNA 3OZPA 3HPFA 1ME9A 3WYZA 2PGWA 3N73A 1PZ2A 4GH1A 3HJEA 1ZNNA 4GG9A 3PBMA 3KZSA 3P3BA 1VEOA 4N02A 4W7WA 3ZYZA 3GK0A 4B3ZA 4HMDA 1LOLA 3CAWA 3UCCA 2OO6A 1EJ7L 1LOSA 4C6FA 4GIYA 2HDJA 3GG1A 3SN4A 4U3CA 1EEPA 2YZRA 2GPTA 1MQPA 3L0GA 2RJGA 5I07A 1L6SA 2HS6A 2NVAA 2ZX7A 2EO7A 4GQRA 1TG7A 2D2JA 3KLLA 4IGMA 2XISA 1HKKA 1KM1A 1UPMB 3SSZA 1A5NC 4N9DA 4CLMA 1ZU8A 3WBXA 2C18A 1GZGA 1GQJA 2ZXBA 4MOZA 3B0XA 1E6SM 2BY1A 3R0DA 1EUAA 4H8UA 1Z48A 4HSOA 1XYBA 3W4RA 3KX6A 4DJDC 3W23A 1UD3A 3MWCA 1V3MA 3DCPA 4Q8VA 1RD6A 4EAMA 3VD3A 2J4GA 1H3GA 1C7TA 3AZTA 4UZUA 7ODCA 3FA5A 4HJFA 3UVIA 4ZSUA 2ZCGA 3RLVA 3WQWA 3ABOA 3ANYA 4RZ4A 3VKDA 5CJMA 1FWRA 1MXGA 2ADAA 3PTKA 2BTMA 3EXRA 2ZA3A 2J9YA 3S2JA 2CKSA 3AIBA 3R1ZA 2E1DA 1LOQA 3GNRA 3EA1A 3PAJA 3U3HA 1NWTA 3MV01 2DSZA 5D9NA 3P93A 1W5QA 3CC1A 3VX1A 3NL3A 3TN3A 2QUNA 1FBAA 4QNEA 2YGYA 4C6BA 1XIHA 3ZFHA 2Z25A 5DCDA 4IQLA 2OKTA 4WSKA 1NIUA 2XTKA 3LTSA 1DWFM 3CTLA 4RL3A 3IPWA 4F66A 3B8IA 1L6YA 3MMTA 1POJA 3NQ2A 4Q22A 4DJDA 5H6HA 4IHCA 3QN3A 2VRJA 2Q8LA 3H2FA 3F03K 2R1PA 3PG8A 4GVIA 3TYDA 2OX4A 3BARA 2XVPA 3SQLA 4HU4A 3NUKA 1PIIA 2QIIA 3TQ0A 3RN6A 3UCDA 4GBUA 2PC8A 4Q4MA 4ZVJA 5BMWA 4MWAA 4HYVA 5A8NA 3EOSA 3A5FA 4HHPA 3VCRA 4WLCA 4PCSA 3NTYA 1DHKA 4GO8A 4DIAA 2DT1A 2VCBA 4Q8WA 2WQDA 2E8YA 2GZXA 3TSDA 5IXEA 2VUYA 2CXEA 2WK2A 2G41A 1LG1A 4JKKA 4JHZA 4XKYA 3VM5A 3IAQA 2IUZA 3FYPA 4JTTA 4D6HA 2V3GA 4QNWA 1GG0A 3PANA 2G8ZA 1VENA 2BVDA 3THUA 4EACA 4K37A 5TNVA 3A24A 3GFZA 1D7FA 5AKQA 2BX7A 5GQBA 3UR8A 1MI3A 3VGDA 3VIIA 1O94A 3FXYA 1KM2A 3GDRA 4MZYA 5E93A 3SQSA 4Y9NA 4FLRA 3BAIA 1OX4B 5GPRA 4KS0A 1ZBKA 3USZA 2WBGA 1F4HA 1GPFA 3VFLA 1G7VA 2QF7A 3GH7A 4W8BA 4NXSA 4F0KA 1UCWA 2DJXA 2QNEA 2BZNA 1K8XA 3AU2A 1GJUA 1L6FA 1XS2A 2Y63A 1E1EA 4RXFA 1W3IA 5D05A 3URNA 2HCVA 3VKKA 3GC2A 2R1LA 3RU6A 4JQ1A 4S38A 2F9RA 2WVVB 4Y9PA 1KM5A 2C1IA 2YDSA 3CO4A 4LSBA 5AHLA 3MYOA 2UZ9A 5D2WA 2NWRA 5DQPA 1NEYA 2J7FA 2ALRA 2D0GA 2G50A 3L65A 4RDWA 2BASA 2A2IA 2XG9A 1TREA 3AYVA 1PAMA 4CN6A 4PB5A 2VI0A 3GY1A 3D47A 1X7FA 4FI4A 3TNBA 5I02A 1HKIA 1YPXA 3PNUA 3G0SA 5D2XA 4KQNA 4DBWA 3QV9A 4QFUA 1P7TA 4LW7A 3V18A 1R86A 1ISWA 1Q7QA 2BSLA 3ZVHB 1OCJA 4IGSA 4OUEA 4TXEA 3E2SA 1Z69A 1ZP3A 4CEUC 3KVJA 1KR0A 4XZ9A 3KTSA 1TE6A 2B7QA 1VFHA 1VB9A 1XH1A 1QI4A 2QZRA 2BHZA 3WNKA 1FKXA 5GNXA 4F3HA 1MNSA 1L8PA 3GXFA 1BWKA 4G7EA 5CSYA 5FKYA 1UYQA 4S23A 5J5RA 2JIEA 4LQ1A 3VILA 4FXRA 3DYPA 4V27A 4M3PA 5FJTA 3WF4A 4Q8TA 2Z2AA 4QQUA 3W26A 1FQ0A 3EOOA 2YFNA 1Q6QA 3WUEA 2IQTA 1E0WA 1OF6A 4IOTA 4ERIA 4OOZA 1HNYA 4J3XA 1XLAA 4K1WA 3LTPA 3L7RA 2PLMA 4O1FA 1TJPA 1BXNA 3N12A 2V5BA 4AXNA 2Z6JA 1UKOA 2WHKA 1A4MA 1AMKA 1BKHA 4IH3A 2R82A 3QZAA 1KRAC 3QC3A 1CW2A 1U1HA 1G6CA 5BRPA 5FI8A 3HGRA 4DRSA 4ZE5A 1B9ZA 1PS9A 4L1GA 3VDAA 3EWBX 2GUYA 3QKZA 4XV0A 4DXXA 1NFPA 3ZR6A 1XXXA 1MDLA 3DI0A 2DQWA 3HO8A 1KFEA 3N34A 1EBHA 3EDJA 3GR4A 1M41A 1Q45A 1I2OA 1F4AA 4GGHA 3BG5A 5LIYX 2J7GA 2DW7A 1YEYA 3SBFA 2EJ1A 3WJYA 4Y9AA 4ZB5A 1QI2A 3POCA 1M68A 1UKQA 4XAZA 3HFTA 2WMFA 2C16A 1TKKA 1NU5A 4K68A 4Z1YA 3BMVA 1H50A 1XYMA 3DFOA 2GVGA 3HOJA 4Z1BA 3T7VA 4XQ6A 2X1TA 3MUZ1 2F6UA 3SEPA 2WC4A 3PTMA 1XBXA 1ZZMA 4M6QA 3WQGA 1X1NA 1TPC1 3WQVA 3OQ8A 4PMUA 2OEJA 4LH8A 4S3CA 3PN8A 3M1ZA 1PKYA 1J2WA 3HTWA 4RE2A 1ISYA 3IIOA 3NVDA 2PI6A 4PEEA 2V3EA 1VKFA 1I60A 1XM3A 2FFIA 3DERA 1OK4A 2DT3A 3CT7A 3P61A 3WQ8A 5C9XA 3BLPX 2ZZ4A 4IIBA 3QJAA 1QW9A 4F48A 1TPFA 1EJTC 2PS2A 5LYRA 1A3XA 4HHMA 1B30A 1GCYA 4Y9OA 4PH6A 4PCNA 1B3ZA 4NY2A 4DYEA 4TIMA 1VZWA 3S5SA 2XN1A 3O05A 4J5NA 3EGJA 4JFUA 1NQKA 1S3TC 1YDVA 4D6IA 4WF7A 4TX6A 3T55A 4GX9A 2J24A 3EB2A 3MP3A 1SO5A 3KBVA 2WWCA 4BF5A 2B0MA 1SR0A 2G3NA 1VBGA 3CZ8A 3V0TA 1Q65A 3I10A 1R2TA 2XGBA 4US5D 4LUIA 2O92A 3RCYA 5A2BA 3PHAA 1PX8A 4UNIA 4XD4A 1M7XA 5DEZA 3SCNA 2PD5A 2HSAA 2VENA 4IPIA 3MT1A 3SGUA 5A94A 4J3VA 3CWNA 4B90A 4EXAA 1O7AA 3CQHA 4QG6A 3ERPA 4PL2A 4WDWA 4BWLC 1CT5A 2Z0IA 3PUGA 2GFTA 3V3WA 4LS1A 1HO1A 1UH3A 1KXHA 5G4EA 3C2VA 3I7RA 4WDTA 4L5ZA 5K9XA 1KBJA 3FEQA 2BHYA 5FD0A 4MNJA 1TMQA 2OOFA 3STGA 4B15A 2WXDM 1W2VA 4O18A 1GQKA 3ES8A 1REQB 2B81A 2GGJA 4IX0A 4DUVA 4R7OA 3BK0A 1ZAJA 3EDFA 1EXPA 1O4UA 3OLEA 3TXZA 4PMXA 2WJEA 2PDQA 4DLMA 4UTMA 3ZR4A 4DPQA 2Q3RA 4H8VA 2GJRA 2XFWA 3WH9A 5DX7A 1N7KA 1JYNA 5C2GA 2FDSA 4PTMA 1L2QA 1GPWA 1VPXA 2OQYA 3W1NA 3A64A 4UR8A 4B3LA 1HKVA 1CXLA 3KLKA 3NSMA 4FX8A 1JGIA 3CUZA 3WUGA 4KETA 1VJZA 2FHFA 5I6SA 1W1VA 4GO9A 2PP0A 4XZLX 1GYLA 4HK5A 1TQXA 1R3VA 3G6MA 1KKRA 4AD2A 5AHNA 5LIXX 3W74A 1JZ8A 3KHJA 5JUVA 2PF8A 4P5UA 4BWLA 1TYGA 3R4IA 1SW0A 5DXXA 2HWGA 4NILA 2QMKA 2PC4A 4HVXA 2ZX6A 1H41A 3WDRA 4W5ZA 4O52A 5FAJA 2WCSA 1GKPA 4C6OA 1F9CA 1C8XA 1H1YA 4AIBA 2Z24A 5E9AA 1H51A 5ABFB 5CGTA 2C0AA 2B4GA 1FWTA 3G3DA 1V03A 1C9WA 1EC9A 4XKMA 2YBUA 2NQLA 4UQCA 4AQLA 3NOEA 1G69A 2H6RA 4EPDC 1P1MA 1ZQ5A 5D38A 1ITCA 1FXQA 3N3MA 5HMEA 3N6QA 3QEZA 1M01A 5EU9A 5AC6A 3GVGA 5L6UA 1KM0A 2PU1A 3EMZA 3UWWA 3Q45A 3SY1A 4HP5A 3BGGA 1RY0A 3FAWA 2QCGA 3LOTA 3A4AA 4RR4A 5A95A 3OIXA 2RKXA 3GNNA 1Q6DA 1I0BA 4P61A 4FR1A 1KFKA 3GB6A 3UZXA 4AIUA 4TMCA 4P7RA 2BG5A 3TYEA 1A0DA 3PR2A 4DJFC 3T0TA 2J25A 3S4TA 1J0JA 2DV0A 3OHMB 3S5NA 4H3DA 3MA8A 4NRRA 3ID7A 3SFWA 1G4TA 4GYJA 2D3LA 2FPVA 4HU3A 5GJMA 3H70A 3S46A 3U2ZA 3IJ8A 5CPQA 2Y0FA 3WMSA 2HV5A 1GW1A 1TV3A 3W87A 3VZXA 2CBIA 3W1LA 3WDQA 1XLEA 2DZVA 1FWCC 1V0MA 1A50A 4Q8UA 2AAAA 3LMZA 1SU5A 3WQEA 5A6LA 2GUBA 1CCWB 2V8ZA 4A3RA 1EJXC 1E0XA 1TWSA 1X39A 1YDOA 3OO2A 4HCLA 4WSJA 2VFHA 1J6PA 4I9AA 3DGRA 3NURA 1XRTA 5CSSA 4YHEA 1MFVA 1VFFA 3CB8A 2BXYA 3B9DA 3R58A 1DJXA 4LRTA 2YXOA 3LHYA 2PF0A 1Z44A 4R3UA 3IRSA 3NO5A 3TW6A 5A8GA 2YB4A 3QMSA 5FF0A 1OCQA 5I3HA 3N19B 2I17A 2FYMA 3EOEA 2DP3A 1PUDA 1K03A 2PLJA 3RHGA 4IIGA 2GL5A 2DZAA 2X0SA 3THQA 5A6BA 3PSWA 4O1CA 2QCMA 1KWKA 1E43A 1GVOA 4LB4A 3LLDA 4H6KA 2IS7A 1NELA 1UP0A 3Q37A 2ZQ0A 5MHBA 4C7FA 1O1ZA 3TQVA 1MQQA 4S3DA 3RPDA 1EC8A 4QJ1A 4IPLA 5SWUA 1E6XM 3BTNA 1U1JA 4C91A 4HA3A 2ABAA 2Y8VA 1XR2A 1M65A 3PZTA 3GR7A 5I3JA 1PKLA 3N3TA 2JBMA 3SUSA 1TTPA 1OC6A 4DJED 3DG6A 3B40A 3AMCA 3R13A 2XFFA 4X60A 2L5HA 1FHDA 3CQJA 5FF7A 4A3YA 4GIEA 1W1ZA 4M51A 1SO3A 3SAZA 4L4PA 4PB4A 4BF7A 4AW7A 4UB9A 4WHBA 3W7PA 3DYOA 5XIMA 4KW2A 4X22A 4WX2A 3K13A 3UFYA 1XUZA 5DMMA 3L2IA 4S2BA 4EAYA 4AZ5A 3GIYA 4HMCA 4M82A 2W27A 4A6GA 1MW3A 3TCSA 4PSPA 4JHOA 3RLGA 4YL2A 4J3TA 1BF2A 2CBJA 2VFEA 3UWYA 1Y0EA 1K9TA 3VVGA 4HNOA 4QCEA 3VKCA 5IM51 2ZX9A 3HG2A 1EQPA 1FWSA 1TWZA 3DBNA 2OWXA 2J75A 3FIGA 4LB3A 4YJ5A 1K9FA 3UVAA 4L6HA 4H00A 4B4HA 1JCLA 3UF9A 1AQFA 2PRLA 2WNQA 4JR5A 2PBOA 4CNSA 1XLFA 1JIBA 3W86A 3K8MA 4IMAA 1OK6A 3QV6A 1DP0A 1WNOA 2D2GA 3WD4A 1G94A 3AWNA 1JPKA 1KXQA 1FWJC 1AH3A 1VFMA 4GBDA 2G95A 3TVAA 1VBRA 3DZ1A 4YN5A 1HJQA 3C2YA 1KFCA 1VFTA 1IV8A 2PZ0A 3LHTA 4Q7BA 1MDRA 4P7NA 5D4YA 2PBGA 3E0LA 4IUOA 1GJWA 2OODA 5F4XA 5F1UA 1W3TA 3EXSA 1WX0A 1E9LA 1M6JA 3OBKA 1T8XA 5C7VA 3GUGA 4IFRA 5MF5A 4DVOA 4KGLA 1E73M 3L23A 3KRZA 3PBUA 4Z42C 5BWFA 3OEXA 3O6AA 4B5XA 1NARA 4IMGA 3N4AA 1TX2A 4RNJA 1SFJA 4TO8A 1JCJA 1V0LA 3I6EA 1D3HA 1GORA 4QE5A 3LI1A 2DZWA 1A3HA 4Q8PA 3CYVA 1UZDA 1R3QA 1AJ2A 1N8FA 4IZGA 4I6KA 1EP1A 5C7HA 2D2HA 3F5KA 2OEKA 2NSXA 6TAAA 1YXCA 3T0DA 2A7RA 3TC6A 3TNOA 4I9TA 4IMDA 3T6CA 3H2EA 3POHA 4BQ3A 1A0CA 4ATWA 4HOZA 2ZXQA 4QHRA 4AMAA 3EPNA 1XKYA 3LGDA 3UR5A 3B0YA 3KTCA 1L2UA 5TQLA 4FIQA 3C3NA 1KR1A 2ZE3A 2NT1A 3VGFA 1XLDA 5FJUA 4Z2KA 3MJYA 3VAVA 1O66A 1CGTA 1EWEA 2ZA2A 3E6EA 4PCTA 2WOQA 2YX0A 3WLRA 1SYTA 4D8LA 3SGZA 2CU0A 4XX6A 4C6NA 2VD8A 3M9YA 1GQIA 3TTEA 4QDMA 1ISVA 2VKZG 2ZE0A 4CNOA 5C5YA 4TVCA 1P0DA 3WJWA 4Z1DA 3IUHA 5M2FX 5D2YA 5BXPA 1FFRA 1V3IA 3F2CA 1SMDA 3QMRA 3OPSA 3BANA 4H9YA 3E38A 3O15A 3MMUA 4QQ3A 1XLGA 4LAUA 4H9UA 3TN4A 3R0UA 4FNRA 2V5KA 1TV5A 5D2TA 1TRIA 4MZ1A 1G4SA 3H4WA 3STEA 4UC5A 1B2YA 2A3HA 4CGTA 2PTXA 2FZNA 1PX4A 2BY0A 3NSXA 5MKGA 5A69A 3L4XA 2PDBA 5REQB 3N2CA 4BHYA 4LCQA 1LWJA 1T7LA 1JDDA 1E5JA 2IKHA 4AF0A 2A3CA 2CCRA 5FJRA 3SGGA 3W00A 3NQAA 3A22A 3REQA 3NNTA 4REQB 2WCAA 3UCQA 4WY0A 1UZ1A 3CHEA 3VNMA 1FWAC 3LCWA 3OVRA 5IHSA 3GTHA 3GU1A 3QV8A 3NQ8A 2ZA1A 2W61A 1OQFA 2CC0A 1RP9A 3UERA 5LNSA 1YLVA 4MKSA 4B5SA 1E6PA 1MNZA 1XG3A 4F40A 3NXFA 5T26A 3UXAA 4LANA 5BU6A 4V33A 4EXQA 2C1GA 4ZZ9A 3UJEA 2QIWA 3P60A 3ITGA 2JEQA 4PL1A 4KH2A 1UA3A 1Y5XA 3KVKA 4QDWA 2OMAA 3DG7A 3E3HA 3GG0A 4OGZA 1W6TA 1N8WA 2RUSA 1EZ2A 1Y5VA 2OT1A 2QF8A 1HP5A 3LZ5A 3APYA 3MY9A 4BS0A 4POCA 1B5TA 1HJVA 1VCGA 4L1WA 5AC8A 3GVVA 3Q67A 4HA4A 1W1B1 3SM0A 3S5YA 1VRDA 1VHNA 4XVDA 1FCQA 2RGMA 3A4XA 3GDBA 1AMYA 5D8WA 1WZAA 3S1XA 3M41A 4JL1A 4IXXA 1H61A 2E8ZA 3WNPA 3WSUA 2YDQA 1E5NA 1OY0A 3MUXA 3H26A 3GYCA 3HMCA 1Q5MA 2VP8A 3P80A 3KL3A 1ITXA 4GQGA 3M6DA 3STCA 1F61A 1P0KA 2HJPA 4F0SA 3UU0A 1J5TA 4OHQA 3SCUA 5F4SA 3UYIA 3ZR5A 1BVWA 2G37A 4N6EA 1Q4NX 2XVKA 2Q02A 3LSCA 1POKA 1Z32X 4YVPA 1GTEA 1GQNA 1OG0A 1N2VA 2VUNA 3OGVA 3S5ZA 4YS1A 4MIMA 3T78A 2Z27A 3U2EA 4N7QA 5EBAA 2NXIA 4JCLA 4YPJA 3E12A 1E6RA 3SUUA 3GVRA 3TJLA 1PV8A 3G2GA 2VEKA 1BD0A 4Z2GA 3W88A 1H1NA 1CIUA 2QJNA 4HNCA 1N8IA 5FF2A 1VH7A 2QULA 4MYXA 3I4EA 3IJ7A 2GJXA 4AVOA 2D0FA 3UJFA 3NQVA 1FXPA 3ABRA 5ECVA 2Z4GA 1I1WA 3QXBA 1V6WA 4Q4QA 1LL4A 1FWIC 1R2SA 1ZRQA 3S1WA 2WNWA 3C86A 2CNCA 4YTRA 2DVTA 1KCLA 1EUNA 3SRFA 1JG9A 3E1F1 3WQFA 4D9PA 3FVMA 2PWHA 2AOSA 4UNLA 5LKYA 3HPXA 3PP7A 4AD0A 1D8CA 3NQCA 1EJRC 3IK2A 5E9XA 3EAUA 3PZIA 3HGOA 5A8MA 4JTEA 3WD0A 3QR1A 2VZTA 3AISA 5I78A 4GC3A 4IPPA 3H24A 3T09A 1E71M 3L4ZA 2W91A 4AY8A 3BJTA 3PC0A 4DO7A 4LCRA 2WM0A 4PULA 4CNTA 5FJOA 2XZ7A 1KO0A 5AHEA 4H6RA 1S5VA 4QSHA 1WDRA 3FXGA 4Z2LA 1AFSA 3HQNA 3A4JA 4UXDA 3W22A 1ZLPA 3TFCA 1QBBA 2XPKA 3OOQA 3RK8A 1IIGA 9RUBA 2DSKA 3T4WA 4UMCA 3S2MA 5HR6A 1WUEA 2AGKA 2V38A 1UP3A 3K46A 4TTGA 3AIUA 2WBKA 2C19A 3GXDA 7PTDA 4FMVA 3K2GA 4Q7IA 4JCMA 2ZOXA 3QGAC 1E4NA 5A2CA 1LCOA 2TODA 5BYWA 3NQGA 3ABQA 3TC7A 3QZ6A 4IPNB 1CEOA 1OVDA 4P7LA 3EX4A 3LXAA 4AZCA 1LL6A 1F07A 4CD6A 1AQHA 4FOKA 4GYFA 1KM4A 1FDZA 3U4FA 1S2UA 1NF0A 3WBYA 2NVCA 2G5WA 2WHJA 1D3GA 3S5OA 4JGDA 4JTQA 4C6IA 3MUAA 1PDYA 1SPQA 3SN1A 3VIGA 4JOMA 1Z8AA 4PRWA 2CHRA 2A3LA 1I4NA 3GH5A 4KT2A 3MUY1 1DQUA 2XFRA 3DXIA 3QV7A 2PDJA 3LBCA 4JTSA 5CG0A 1ISZA 4MLRA 1WO2A 4JZ5A 4G7FA 3WH7A 3GG8A 1NF7A 4GOAA 3KCLA 5GJNA 2XHYA 4DWSB 2VXNA 3GNDA 4FP1A 1BGGA 1TWDA 2AMXA 3IJQA 3VNZA 4L56A 4EWJA 2CERA 3MMWA 1N55A 3M0XA 2XIQA 4XK2A 4AZGA 4KIRA 1ISXA 3K4DA 4DUOA 3O0FA 5DMNA 1BWLA 1KD0A 1Q6OA 3BV4A 1C92A 3M0MA 4O4WA 4O4VA 4PUDA 1UIPA 4PMZA 1XFBA 2E0PA 1G0CA 2YCLA 3CO8A 3P14A 2X1UA 2E6DA 3UGVA 4BCEA 5IBXC 5J5DA 4MJ4A 3WDPP 4A05A 5EGRA 4GQQA 1TZ9A 2PB1A 1DHPA 3EWXA 3DUGA 5C2XA 5FF3A 1MEHA 3L9CA 3ZJ6A 1QATA 3PUDA 4WOQA 1XX1A 1FVPA 3L0KA 4GD0A 1TB3A 3CV2A 3GXPA 1XPGA 4IPJA 2XIBA 1UBPC 4QJ3B 3PS7A 3SFKA 3ITTA 1QHZA 3QR0A 3NA8A 8RUCA 3GZ3A 3EDDA 1CLKA 3FYYA 2PDYA 4I7WA 2ZC8A 5HXMA 1EP2A 3LLXA 4HPHA 3LG3A 3DYMA 1P6WA 1W3KA 4ZTYA 1TO3A 4ERAA 1W91A 1TX0A 6CGTA 3M0HA 1Y7VA 2C71A 2NQJA 4JXCA 4PMRA 4S3FA 2A1YA 1JYXA 1ELSA 3SW6A 4MF4A 3G6LA 1ZPTA 1S2WA 4QISA 3TTQA 4AHQA 2V68A 2XH7A 4AYSA 4HSNA 5TIMA 3N13A 1W54A 2OYKA 3AHYA 4EE9A 3BQ5A 5D9MA 3MYPA 4O53A 3GXNA 4NASA 4Q3MA 3R8GA 2CPUA 1GW9A 3DFTA 3A3WA 1TA3B 1EEXA 3OZMA 3SQMA 5EFFA 3NPUA 3TTOA 2PDPA 3WJSA 1GKRA 4Y9MA 2PTYA 1AH4A 1CZ1A 1GUVA 1X8CA 3F4DA 5KTLA 3RYSA 1HQTA 5AHIA 4NAFB 4V1YA 3CS2A 4GA8A 5DANA 2GGEA 1MFUA 5BXSA 3RMEA 1FWFC 2PDNA 1K9DA 4W86A 2HQAA 3S9YA 4ZCWA 1UR9A 5CBJA 1TUXA 3H2NA 2QDHA 1IT7A 2BVTA 2DZUA 3SO7A 3W1RA 3EA2A 1R2RA 5BZAA 1QBAA 4Z0JA 1JDFA 1CXHA 3DI1A 4DPPA 1DWGM 1EX1A 1PWLA 2AAMA 4DXVA 5I3GA 1YXYA 1JXKA 3R94A 1F8IA 3QFEA 1E0VA 2I5IA 4WUIA 2NW0A 4AU0A 5HPCA 4W9TA 4ENLA 5DT5A 3MSDA 4OV9A 3BLLA 2X7VA 4R88A 3C0SA 3KEHA 3H53A 3M44A 2PSNA 4S3EA 4G9PA 4GI4A 1XYCA 3N2OA 1H63A 1PKNA 3M0IA 3UT0A 3IIZA 3SB0A 1RBLA 4LY4A 2VFFA 4PBEA 3URBA 4EOUA 3T0AA 1R3YA 5BXTA 1AH0A 3SADA 3NZQA 4FIRA 2ESCA 3PBVA 4AHOA 4ICCX 1AW5A 1J11A 4GFSA 3L0NA 2VZSA 1PZ3A 3AO0A 2W66A 4NF7A 4HHLA 3QR3A 4D6JA 1TV7A 5FACA 2PTZA 3WEMA 3P84A 4W93A 4KEZA 2XVGA 4IG2B 3O7UA 4G2DA 3T8QA 1I1XA 5I0DA 1R30A 2XGZA 3G77A 1OFRA 4UMAA 2A3EA 1JAEA 2WMGA 5JXQA 3WEOA 2VZUA 3CV6A 4LC6A 4AD3A 3I3EA 1R3SA 1C93A 3NQ7A 1J0IA 3TV8A 4GJJA 3Q4DA 1EGZA 2FDMA 4N9EA 1W0MA 5HJYA 2FVLA 3MW7A 4HN4A 4QJ4B 4PUUA 4J40A 4JTUA 2E4TA 3WFLA 3B0UX 2WO5A 1GQLA 4PC8A 3SCRA 2OLHA 2Z2BA 4CD4A 1QNRA 4MPKA 5CKSA 3BJSA 3OZYA 4E8DA 4US5A 3CV7A 4HNNA 5PTDA 1JR1A 2WMIA 3PZOA 1OM0A 1ZJIA 3MPGA 4JX5A 4MKNA 3G1YA 1W5OA 2QV4A 3GS6A 2O9RA 1AD1A 4QTGA 1LROA 3HU7A 3GLCA 5CAKA 5CQ1A 4KCVA 3GU2A 3NZRA 4U2YA 1IYXA 3ARPA 1RVKA 3A6OA 4HZ8A 5I77A 2BHUA 1JZ5A 5H2ZA 5D9OA 2OSYA 1LUCA 2BODX 1ADOA 2OZ8A 4RV3A 1F3TA 5A6KA 1CXIA 4HK7A 3OP2A 5KSWA 3V1PA 3W2KA 2P3ZA 4OBRA 1WOBA 1EKOA 4ML4A 4NT0A 3QOMA 3DU0A 4C1NB 2YBTA 2W63A 3W7HA 1NWRA 1MZRA 1WKYA 2DZXA 2W4XA 2JFEX 4MB5A 1JZ4A 1P1XA 2YA2A 3LDVA 3DN5A 3G0UA 2OELA 4UTUA 4E4FA 1WAWA 4IM4A 4NZ4A 4MWAB 1QPOA 4Y7EA 1CDGA 1CGYA 3UZJA 2Z26A 3ZWSA 4R53A 3QHMA 3AMKA 3AI0A 3AXIA 8TIMA 3IJLA 3BMXA 3JR2A 5A8QA 4AWUA 1M7JA 1BXBA 1FFQA 1PIGA 2HZGA 3G1AA 3FHAA 1XLLA 1KCXA 1W37A 4A29A 1GVQA 1W5NA 1SQ7A 3K30A 3N2XA 2BB0A 4XKYB 2HNEA 1AJ0A 2Z00A 1RQBA 3DH7A 4GI6A 4NKCA 1KCKA 1UD2A 4LWWA 2JGYA 1ZBCA 2P10A 2CLEA 3C0JA 4TMBA 2NQHA 4O17A 2PU0A 1WKFA 3PUOA 1PX3A 7XIMA 2IKJA 4H4IA 3JUGA 4ZQMA 3BAWA 3VMNA 3CWHA 5F2LA 3TLQA 4UMBA 4XVEA 1HKJA 2B7NA 2YCIX 1O5RA 4PZVA 3EDKA 2O9OA 3GU9A 4QDPA 4K7YA 4MJMA 3O6DA 2BGQA 4GXWA 2ATMA 1FWNA 2V5CA 3O3RA 1AVAA 1F6KA 1TJ0A 3WLMA 2O4MA 2J6XA 3M46A 3UPMA 3VDGA 4A2SA 4MPQA 1R3TA 2CZFA 2D73A 3CQ0A 2Y4SA 4U28A 1EL3A 2R14A 4A8NA 1AUSL 3W73A 3B8VA 4DBEA 1VEPA 3TW7A 3D5HA 3M0JA 1NOWA 1EDQA 2OG9A 2CHNA 3G5EA 3ARRA 1KFJA 4JD4A 1TFVA 1OABA 3PAOA 1BQCA 5I00A 3OVPA 2Z2UA 4WKFA 1FWGC 3LI0A 4XUGA 1FWBC 1P7TB 1S2AA 3IARA 3NQDA 2GK1B 2YYUA 1UQZA 1CGVA 4MJ2A 1OD0A 4J3UA 3UPWA 4F4RA 4OBTA 1MUCA 1AQMA 5AECA 1YBQA 3W25A 4OBSA 3MUCA 4L9XA 4G7EB 5AZ1A 4P8WA 4QCFA 3ECQA 3WLLA 1YX1A 1HN1A 1A5OC 1J96A 4HD5A 1RZMA 3CZJA 3V16A 3V5OA 2OSXA 4LBSA 5HAOA 3OA3A 4AZ6A 4AIOA 3QTGA 1VEMA 2R91A 3GBDA 4O14A 4JKLA 1X1ZA 1TE1A 3R0KA 2OQLA 3DKJA 3EXTA 2G96A 3H2CA 3MCMA 4DJEC 5HUPA 1DJQA 3ITLA 1ONRA 1E9YB 3ZIZA 4RK8A 3BCJA 4UOZA 1K8YA 2NSOA 3SCVA 5A6TC 2J8FA 3NPXA 4W7VA 3L5AA 2DORA 1OT2A 3R8HA 2YZ5A 3GKFA 2OU4A 2VGGA 3AHZA 3GDKA 3ZO9A 3D3AA 4FXFA 3NPWA 2J77A 1IEVA 2DIJA 3V5CA 1IXPA 3A21A 3BC9A 3WZ0E 2VFDA 3DG3A 4UBPC 3H7UA 4GZ7A 3MP5A 1X6NA 3EOUA 3R10A 3UG8A 1AW2A 1ME8A 4I5XA 4KCWA 3T2OA 1XD1A 1UUQA 1I9CB 1OCNA 2YA0A 4HZMA 3RLUA 3DHPA 1SW7A 5XINA 1WE5A 5E09A 2GJLA 2Z1WA 3UBPC 3SCOA 1VPYA 4PUKA 4KEUA 4UWMA 2I56A 1QOXA 4ZO6A 3S3GA 4M19A 1MVYA 1VFUA 1JZ3A 2GSJA 1QNSA 2WB5A 4MFEA 4DJEA 4DZHA 3BCFA 2PDFA 3GXIA 5EB8A 4AIEA 2R9RA 4LYQA 2HVNA 3N17A 4FB7A 5K3VA 4LAZA 4QITA 3WLKX 4OZOA 2P8CA 5F2MA 5G4WA 1FHVA 3WENA 2J7CA 3SN0A 3WNMA 2ZWZA 4WRHA 2VEPA 4GRSA 3DAQA 2PP1A 2TSYA 2QUUA 2NT0A 3SUTA 4OV4A 3E0WA 3F1QA 4M0XA 4F0LA 2UV8G 3AS2A 4AZ7A 1HF6A 1TV8A 3ANUA 1OFQA 3B8UA 1JD9A 3P2VA 4XIMA 4G8TA 2PGRA 4R9XA 5IDZA 1W5PA 3AUJA 4JEQA 4IMCA 3T42A 3BURA 3W83A 3BAJA 1UP2A 1KGXA 2EPLX 4D6FA 4UCGA 1F76A 4L4MA 1VR6A 4M24A 2BS9A 3FS2A 3PBGA 4TX9A 4O28A 3OB8A 2ON3A 2Q8ZA 2WZMA 4HMNA 4IFKB 1E1CA 1RSCA 1V79A 1RBAA 3AS3A 2ISVA 4LJ3A 1ZB5A 4B4FA 4AD1A 4WD0A 4DNHA 2QCNA 3CQIA 3ATYA 3GAKA 1ZALA 1J10A 4NUWA 3WY1A 3B0PA 4MWAE 4FNPA 4KRTA 2X2GA 1MRAA 4RUBA 4UR7A 5DBTA 2FJKA 4KWSA 1EOKA 3TC3A 2Z7GA 3F5JA 3PVFA 4TU1A 2CLMA 4EXBA 3FKRA 1WYIA 4RDYA 4OTKA 3U2CA 3W9ZA 3SRKA 1HJWA 1X96A 1UC5A 4RZBA 2XIIA 5RUBA 2ICSA 5LA2A 4O11A 3UWEA 4KPLA 1KBIA 3MVTA 4DWSD 2WMJA 3GZAA 2GSHA 4YLWA 3THCA 4TOQA 1MSSA 2HVMA 1QW7A 1UR8A 2CLKA 2QYGA 1AK5A 3H2OA 4HPNA 3I3BA 5A5WA 3U5YA 4A8RA 1Q6GA 1NSJA 2BFGA 4RW3A 1RK6A 4GYPC 3A9BA 3DECA 4XAPA 1FCUA 2WVVA 1NJJA 3FA3A 4QG8A 3WL0A 3P74A 1DIEA 4AY1A 3IEBA 2HBVA 1RUSA 5C71A 4J3SA 2UBPC 3WQCA 4LAOA 1AD4A 4LVFA 5GJPA 4BI6A 3O0KA 3B9EA 3W2UA 2P8BA 1NAL1 1TPUA 1O12A 3VIJA 1GOKA 1XHGA 2ZUSA 3VK5A 3LHWA 2W92A 4EPKA 1IZJA 5T9CE 4AZBA 1TV4A 2ZRUA 4XAFA 4Q4PA 5BCAA 3CGTA 3GW0A 3ZVHA 4ASTA 5HNUA 1NWSA 3FJNA 4HOWA 1PL9A 5HPOA 3AIQA 1W9DM 2FMOA 4H2HA 1SO4A 2ZVRA 1CYGA 2IMRA 2I57A 4IIHA 4GUFA 3N6JA 4WKAA 2J6VA 1GOMA 4B16A 4AWTA 3F4CA 3ZVIA 1FP8A 3GKAA 2Y7EA 1X6UA 2Q8XA 1ZBWA 2E9BA 3B4YA 2ALDA 3BH4A 4G1KA 3C5QA 3XINA 1VP5A 3YPIA 3N2MA 4FSAA 3WH5A 4DF2A 3CEPA 4JTIA 3XISA 3C4UA 3UZWA 2C91A 4MFDA 1TMHA 4HB7A 1IXOA 1O6IA 5JQ9A 3PWAA 4XD5A 4W7UA 1GHSA 2DVUA 3F7JA 2VZOA 3IJDA 2O7SA 4WGHA 3QKEA 4Q4KA 2VTFA 2IQ0A 4LXFA 1JEZA 1WKDA 4PUJA 1UKTA 2CLOA 2J7HA 3KWXA 2XWEA 4A8LA 2ZTKA 2YW4A 1GK8A 2ZRZA 1XLBA 2B7PA 2CLLA 3GH4A 3N29A 3NOYA 2EG6A 4X0NA 1IHIA 2DIEA 4GWEA 4W8LA 4ADSA 5CC6A 3C0QA 1G5AA 2OZ0A 5IHRA 3CU2A 4Q4RA 4LAKA 4JAWA 3M5XA 2I9EA 2UY2A 1EYEA 4PGLA 4L1XA 4L7ZA 1W2PA 2H8XA 3LPGA 1F5ZA 5D8ZA 5EL1A 4K36A 2KAUC 4UTTC 2CLHA 5CJ5A 1QHPA 5CEWA 2J7EA 4F0RA 2ZFAA 1OB0A 4R7JA 4GX8A 4NP7A 3C2RA 1JQXA 3FSUA 4QLJA 1LLWA 3WDHA 5CCZA 1B4KA 1J0YA 2PZNA 2YYTA 2Z6IA 4NAEA 4EF8A 4RKAA 3AXXA 3HZ3A 4CU6A 5E70A 1BYCA 5AYBA 4C6LA 3ATZA 4O57A 4DAFA 3IGSA 4GKTA 3NZPA 1VIZA 4B5WA 1DTUA 3ZT6A 1D2KA 3BO9A 3WD1A 4NJHA 4Y2WA 1TPEA 2SFPA 3AQUA 4K8EA 3W7EA 1U33A 3OLGA 5D32A 3WEZA 1JXJA 3MHUA 1QI0A 3APGA 2J62A 1UJPA 1YXDA 2ZRWA 2EKGA 3WJXA 3II1A 3NEVA 1A53A 1ZGDA 3MO7A 5HATA 3VKBA 1ZCCA 4ZO8A 3I6RA 1C91A 1WOAA 1X98A 5EKYA 4BKNA 3ITYA 3WLHA 4PRRA 3S6OA 1U5VA 2GSEA 4S2CA 1E0UA 2ZBTA 3K8KA 2BOGX 3VDCA 2EPKX 5AB3A 3OG3A 1IGWA 3VI2A 4UTTA 6A3HA 4ILSA 3MANA 3RCMA 4E3VA 1AW1A 1TELA 4GI8A 4WJ8A 1UQYA 2VVNA 1JF6A 2OQHA 2WKLA 3M0ZA 1ECEA 1RCOB 3VOFA 1CBGA 1X6LA 4XZWA 1PHQA 2VYOA 3MHFA 1HT6A 1I8JA 3ARQA 3E2RA 1YNYA 2J7BA 1MXDA 1ZAHA 2Q71A 3UR2A 1BRLA 3IACA 4TQTA 3KP1A 1E9ZB 3P7YA 2AMGA 5M5DA 1LORA 1F7BA 2WQPA 1UBSA 3WH6A 1PO9A 2V69A 4D6CA 3BJFA 3TYZA 4PR4A 1FTXA 2Y62A 2PWGA 3CHVA 5LA1A 4DF0A 3PM6A 5CH9A 3KRUA 4NG3A 1TJRA 1ZP4A 3UWZA 1LP6A 4GCAA 4NNAA 4CN1A 1I0DA 3ORWA 2QJGA 3RGTA 5A2AA 4GJIA 1JFHA 3CL6A 5EMMA 4K6AA 2CIPA 1WAUA 3WH8A 2ZDRA 3JVAA 1KRCC 4QSFA 1UUOA 4ZOCA 3LCLA 3BLEA 4UQDA 3BSMA 1FWDC 3LM3A 1W32A 1JNDA 2NX9A 2VC7A 3P8IA 1PTGA 3WO8A 1CLXA 2YL8A 4J28A 1YHTA 5G2HA 3OTRA 2D20A 3RPMA 4DN1A 2VDIA 2XIMA 1K7XA 4V28A 1CGWA 7CGTA 2FH8A 3T08A 2QCDA 4MWAD 3TX9A 5JMUA 7ENLA 1E1FA 2VURA 1DWJM 3SUVA 3W71A 4RZ6A 2ZXDA 2ZUTA 3VMOA 5D02A 4LTSA 4BY3A 2VHLA 3L4UA 4O19A 4CD5A 2GGGA 1XLKA 3CPGA 3GQYA 2YLAA 1C90A 1D8WA 3BPWA 1QOQA 1J0HA 3SY5A 2HRWA 2W3ZA 4E2VA 1C9DA 2V30A 2QT3A 4MGGA 3VKJA 4QE1A 3PJUA 2TYSA 4IJCA 1EP3A 4HJWA 1W1TA 4NYUA 4F0HA 2TRSA 4KFNA 4IP5A 3VCNA 4X3ZA 2VOTA 4KEVA 4I8YA 3NGFA 1IWAA 1UR4A 3VZZA 4WEVX 2FQIA 2P0OA 3HQOA 3NGJA 4N2YA 4BQ4A 3C3UA 3P8JA 2FIQA 1L9WA 3SCQA 2BOEX 1Q6EA 4BQ2A 1NTHA 2INZA 2Y8KA 5ABFA 4JNYA 3WK1A 2INEA 4D6GA 4IT1A 4QEEA 1XRVA 2ZRYA 1ITQA 2GVJA 1XC6A 5I06A 1OBAA 1CB2A 2OTDA 4PEKA 2ZXAA 5A8OA 3RU8X 3PULA 1V02E 4D8AA 1R7AA 1ZUAX 4DI9A 1M7PA 1SFSA 4R27A 1CNVA 3TJIA 1E6ZA 5E0FA 1BHGA 3SCTA 4FNQA 1EIBA 4GJ1A 1S1RA 2ZUMA 2D3NA 5K9CA 3QFWA 4AISA 7TAAA 4KWUA 3ARYA 1OJXA 1VQTA 3MI2A 3TTSA 2A7NA 3GW3A 3GIQA 3T1GA 3ZSSA 2YL5A 1KBKA 4MJZA 1QI5A 1U5HA 3QQ0A 2PAJA 3KBSA 2EBNA 4LYPA 3MQTA 1KGUA 2BLEA 2QUTA 4B91A 3ENLA 3SDOA 3N2TA 4MY1A 1OX5A 3AYTA 1J93A 3BWWA 2PRHA 2PDXA 1MZHA 4YU1A 4YXGA 3H2MA 4LYRA 2I5QA 1FKWA 1QW8A 4LEFA 1CB7B 1OINA 3APTA 2ZADA 2FVMA 2FGBA 1WDQA 4IGNA 3BE7A 2QEZA 2DPEA 5I5RA 4CCCA 4KMQA 4J3ZA 5D9PA 1YNQA 3QYSA 4XTDA 4PFHA 3PPHA 3P62A 1VJSA 3LPFA 1WPCA 1G67A 1US2A 3MWAA 4C6EA 3SRHA 4W8AA 4L65A 3TQKA 3BCDA 5LXXA 3BGJA 1PYMA 2UY4A 3FCPA 1GVRA 1GOXA 2G0WA 3CV1A 1X1OA 3MBDA 3P0XA 2VM8A 3CTTA 3KVMA 1JRCA 8XIAA 2WLYA 2ODOA 4QEHA 4RX0A 1UOKA 4FF7A 2QVHA 5T91A 3AUOA 1FX6A 1PBGA 2IXVA