1ZPTA

Escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
271
Chain Sequence
HASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTYTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFDGLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5,10-methylenetetrahydrofolate reductase
publication title Structures of NADH and CH(3)-H(4)Folate Complexes of Escherichia coli Methylenetetrahydrofolate Reductase Reveal a Spartan Strategy for a Ping-Pong Reaction
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 93
structure length 271
sequence length 290
chains with identical sequence B, C
ec nomenclature ec 1.5.1.20: Methylenetetrahydrofolate reductase (NAD(P)H).
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02219 MTHFR Methylenetetrahydrofolate reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.220 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1zptA00
1ZRQA 2FZNA 1TIWA 3FSTA 3E2RA 1TJ2A 3E2SA 3ITGA 1TJ1A 3FSUA 4JNYA 2FZMA 4JNZA 1B5TA 3APTA 1ZPTA 1TJ0A 3E2QA 1V93A 3APYA 1ZP4A 2FMNA 2FMOA 1ZP3A 4O8AA 3IJDA
chains in the Genus database with same CATH superfamily
4N6FA 1C7TA 2Y5SA 3RK8A 1Z89A 4K1GA 3URQA 4QP0A 1AJ0A 2V3FA 4UR8A 3OHMB 1BQGA 2E1DA 5I06A 4R27A 3PS7A 2PA6A 4TU1A 5HNUA 3E0FA 4P7RA 1SJAA 5KZEA 1ONWA 1UOZA 4PH6A 3BLIA 4K3ZA 1LRQA 1YTKA 1XI3A 3N29A 1X98A 2LLEA 1ONEA 2XIIA 3WKZA 4OIFA 3V18A 3A4JA 5LIYX 3PPFA 3SSJA 3A3HA 2NLYA 4J5NA 3UG5A 2D22A 3INPA 3OVGA 3VIPA 1NQKA 3L0KA 1U83A 3A24A 4V2XA 4NJHA 2HQAA 1VAHA 3AZTA 4GI6A 4GVGA 1XLIA 3WMSA 4ZA0A 3SCWA 3H2CA 3LOTA 2HVMA 5DMMA 4D8LA 1OK6A 5IDIA 4LVBA 3SI9A 5CAHA 1O4UA 3S2JA 5ABFB 1UBSA 2YCLA 1LBFA 2CYGA 2CLLA 1WOBA 4X22A 4O8RA 1RQBA 4LBUA 2ZZ2A 3PTDA 3N9RA 4IT1A 2DW6A 3AIBA 1DXEA 5JIPA 1F2JA 3A13A 5JH1A 5E5CA 2QCEA 1PHWA 1V7YA 4H8VA 4B3KA 3QZ6A 4HPGA 2VZSA 3GBDA 3E0IA 5FJUA 4DBEA 1ME9A 1S5MA 2BVTA 1WXZA 3RPMA 3O0KA 2J9XA 4YWIA 3S5YA 4EE9A 1Z44A 3PB0A 1P0DA 1W6TA 2NQLA 3OGSA 4PN2A 2E7FA 1IEIA 3NQEA 4GQRA 4JDYA 4IIDA 4A4AA 4DZ5A 3ITYA 3TYZA 3W72A 3B97A 3TK7A 1US0A 2Z6JA 4E3TA 1UMLA 3TDFA 1KCLA 2PUZA 2ZZ1A 2WVSA 3WK2A 2NLIA 4PCFA 2X05A 2UY5A 1JF5A 1CB7B 5AHLA 2RH9A 1V7AA 5BXSA 1WQ5A 4KFPA 1Q6OA 3QZAA 3N6JA 2JK2A 2VDGA 1M03A 4HP5A 4NKCA 3UCQA 3ARQA 3VFLA 1B54A 1V3KA 4UCFA 4C6PA 1FWNA 3M5ZA 3TV8A 2EO7A 1XBXA 2NUYA 3A9BA 4O50A 3P74A 4HA3A 1JCNA 6TAAA 1UIOA 2R82A 4ZFCA 2W6RA 3FHAA 4KGJA 4S3EA 1Q4WA 3FAXA 1DV7A 4MKVA 1H7XA 3NQDA 1DKWA 1BXBA 3P14A 3WK1A 1PZ1A 2PP3A 1SW0A 3HGSA 4Q7BA 3MU7A 4C7FA 2QPUA 3DKLA 3R25A 4GQ0A 1YADA 4EWND 2JIWA 3UXLA 6ENLA 5J8LA 1FP9A 5KZMA 4MDPA 1T96A 3IUHA 2PDHA 2W3ZA 4KFNA 3OA5A 3M07A 3UF9A 3HBLA 1XPYA 4QJ5B 2C3ZA 1VFMA 3N2OA 3B8VA 3RGTA 5AHEA 4JL1A 1FWSA 3K8LA 2V3EA 4TO8A 1MZHA 3OLIA 4DPPA 4Y9AA 4PA8A 4NX0A 1VRDA 3ES7A 3EWWA 3CV1A 2GVEA 2CCRA 1BSLA 3M7SA 5E0FA 5A8OA 1BKSA 1KR0A 1QR7A 2OO0A 4LX4A 3BOLA 3W71A 4PEKA 3BL3A 4IFKA 3MCNA 4OOUA 4IHCA 2QPSA 4M6UA 3T7VA 2IPFA 3C8NA 2X7WA 5LHEA 4MDOA 1E0XA 1UC5A 4FEZA 4AD5A 1E3XA 2ZFAA 4K1WA 4C6CA 1X8CA 1F61A 1CZ1A 3CB3A 2PDNA 3I7RA 1OVDA 5FL1A 5D38A 4AMAA 4OHQA 3MT1A 3UXAA 1YE6A 3D47A 4Y90A 3MP5A 3W87A 1M5WA 4U2YA 1A0EA 2Q01A 4Z1AA 4JXCA 1J4EA 4OOZA 1A53A 4LT9A 3AO0A 4C5YA 4AEOA 3NQMA 2YIHA 1NFGA 3I6EA 4HTYA 1GUVA 1JRCA 4CQAA 2VMFA 2JIEA 1W5PA 1R3WA 1A0DA 2FMOA 2OMAA 4K37A 2VO5A 5D37A 3E1F1 4PMJA 4B5TA 5DY3A 1V6XA 4HZMA 4Y9PA 2O55A 1F07A 1O94A 3LMYA 3MTWA 4C6KA 2IXUA 6PTDA 1H1YA 1PVNA 3QPYA 2BSLA 3I7QA 4M6QA 4PFMA 1F73A 2X16A 3AROA 4LS1A 1TPB1 3P84A 4NZJA 1H7RA 1M04A 4DNHA 3AHZA 2OSXA 4B9ZA 4D1JA 5XINA 2EPKX 1Q6RA 3UR7A 1QHOA 2QGYA 1R3YA 3W84A 5C6MA 1E15A 4Z17A 4I90A 4A8IA 3MSYA 4Y7EA 2V9DA 4IGNA 1EA9C 2CIPA 5D8ZA 4GI9A 2XU2A 2ZZ7A 4C91A 3UFYA 2X30A 1LG1A 4H7ZA 4D8ZA 6ALDA 1XUUA 5I2UA 4AVOA 3SBFA 3WUFA 1KQZA 5H8PA 3MV01 3NQ2A 1ZAJA 2VR4A 3SN1A 3DHPA 3OZOA 3QR3A 1GEHA 2NVAA 3WELA 1DXIA 1RJPA 3BTNA 4JICA 1QW8A 2GJNA 2J66A 2QW5A 3AIQA 2J47A 3LNMA 1NDZA 5I03A 1KGUA 1KXTA 3WNOA 3SURA 3VGBA 5AHNA 1W3LA 3BDKA 2YA1A 4JNZA 4BQ3A 4PBGA 3B9AA 5IHRA 3WH6A 1M53A 4IIGA 1AH4A 3RILA 5E9XA 2HE5A 1V77A 4UTMA 2W4XA 1AQ0A 1WKFA 3N04A 1CECA 1RK5A 3RG6A 4NZ5A 3GUGA 4X2PA 5KETA 4ZQNA 3EBVA 3R0KA 3QBUA 2CLFA 3W2UA 5CZKA 1QOPA 1H0IA 4FNQA 2J4GA 1J0IA 3GG8A 3OZMA 1R3SA 3O6CA 2D3NA 3GIQA 5LZLA 4M1RA 4UMAA 3EX3A 3TXZA 4A2RA 1XC6A 4QTGA 1ZAIA 1IT0A 3L2IA 4H9XA 1EHAA 2AAMA 1SZFA 1FWAC 2PP0A 3VK5A 4P7LA 1JD7A 2OZ0A 1IGSA 4GH1A 4UTLA 2D1ZA 2Z1KA 2DDXA 3QOMA 2JKAA 4MLJA 4MAZA 3GDLA 3UJEA 1JI1A 4EP8C 1DWFM 3C2RA 4ZQCA 3NNTA 4MVAA 4EX4A 3TYCA 3KX6A 2WM0A 2ICSA 1WUEA 3A4XA 3TONA 1TIMA 2OT1A 4XD6A 5HMEA 5CSUA 1X8FA 2P5NA 1F3XA 3EXTA 1GVIA 4JNYA 3BLKA 3WQFA 3LPOA 3EB4A 5F2MA 3TSMA 2AGKA 4W9TA 1XRFA 3AMDA 5FD0A 3WFLA 4I9JA 1DJXA 4PB4A 3W01A 1E0VA 1W3JA 1ONXA 4GWEA 4AWTA 2CC0A 5DXYA 2J7DA 3R2GA 3AICA 4AD2A 3WLTA 1YTEA 5K9DA 3A3WA 5CSYA 1B4EA 3ELFA 3HO8A 4E2BA 4ZTYA 4GYPA 3LRLA 5G2WA 1K9EA 3TIMA 4HN4A 3TN3A 1GKQA 3VZZA 4FIRA 4LUTB 3U0HA 3ZR6A 5C0QA 3BOFA 5CC7A 4ADTA 2V68A 2VC7A 2IKJA 2WQDA 3VOHA 2A0NA 4O0ZA 3OLGA 1HVXA 3OP2A 4X0NA 3RUBL 4IWWA 3B04A 4LAUA 5EBUA 3IPWA 1H0GA 1S2UA 3M0LA 3C3UA 5LA0A 3E2VA 3MZNA 1GEQA 2WBKA 3LCIA 4XZLX 3BAKA 4O12A 1JGIA 2C8NA 3G22A 1VR6A 3PWIA 1JDAA 1M7PA 2Z27A 4FZIA 1H4PA 2PAJA 2PGRA 4F2BA 3FKKA 3WN6A 1OEPA 1OFOA 1W8SA 4JGDA 4E38A 1TV5A 3W2LA 4IOTA 2OKTA 3LBMA 1PKMA 3T0CA 5D33A 3W7OA 1C9WA 3ZYZA 4NL1A 2PDIA 2VFFA 4LCQA 3FN9A 4RXGA 1Z48A 3NG3A 3HPAA 3EX1A 3NTYA 1SUXA 3THDA 1YIXA 3W7MA 1TTIA 1ZFJA 1PZ2A 5HDRA 1PXGA 3VE9A 4ZSUA 2ZZ3A 1KBBA 4DO7A 2PTZA 1SYTA 1QCWA 4AIOA 3UY7A 4AZIA 3BAJA 3P5ZA 2ACQA 1KWGA 2UWFA 1UW9A 3TN4A 3NPVA 1OX5A 1SW7A 4Q6JA 1QWGA 1EO5A 5EMUA 3GHUA 3CPGA 5AVNA 2WVVA 2OSYA 5FJOA 4RZ6A 2E67A 1KM6A 3AS1A 1MNZA 1E9IA 1QNOA 3T0TA 3GU2A 2AQVA 4BI6A 4NXKA 3HV9A 3CUIA 3EWBX 3G3DA 4GC4A 4A22A 1KBLA 4OGZA 3E3HA 3RAOA 2X0HA 1HJQA 1JCXA 3VD3A 3M0KA 3ITTA 1ZBVA 3EOUA 4JCLA 1HKWA 1AD1A 2GOUA 1TX2A 1JCMP 3VKCA 3W7PA 3TFCA 1MMFA 2CFFA 2BMBA 2EG6A 4IGMA 2QV5A 2Z2AA 5G1MA 2BY0A 3BARA 1AUSL 1YTDA 1PTAA 1XYBA 4JY9A 1NU5A 1N8IA 3MMTA 4C6OA 3VOIA 1E6QM 3MI6A 3GQYA 1KXQA 1C91A 3APYA 2DZPA 3R13A 4PUNA 2FTWA 1RXOB 4HK6A 4TVCA 1SQ7A 5A94A 5I0DA 2PDYA 1U30A 1XYCA 4JNMA 3A64A 2V8ZA 2BOFX 1QNRA 3EA1A 3DFPA 4QQUA 3S0CA 2A3AA 2OODA 1N8FA 4KEMA 3KBJA 3RYSA 1OINA 4PEEA 3GIPA 4JAWA 4ACZB 2VDHA 3ARUA 3M0HA 3N4AA 3C2VA 4H6EA 2E25A 3MDUA 1BRLA 4ZB2A 4TUFA 4DF1A 1HL2A 3CXOA 3L0GA 4JTCA 2QCLA 5EFDA 1G6CA 4J40A 3WQ4A 5GJPA 1LL6A 1ISYA 3GK0A 3CMJA 3W1XA 2VZUA 4E8CA 1H7WA 2QEZA 3GDTA 2R1MA 4HHMA 1KM2A 1GOKA 4MKNA 1YXCA 3FXYA 4CCCA 4S3FA 3VNKA 4J3SA 2HEJA 4RNFA 2W63A 3FIGA 2ISFA 1Q6QA 1EO7A 1D7FA 3B06A 4PFHA 4C1LA 2GQ8A 4HK7A 4JS3A 1DVJA 1TG7A 1XSJA 1G4TA 2CW6A 3PR2A 4JQ1A 3HA1A 3NIYA 5IOBA 1JDDA 2OEMA 2TRSA 1RZMA 5FF0A 2OJPA 4HNOA 5I7GA 2DSVA 4LUSA 1XM3A 5FJTA 1AZ2A 5AYZA 5D9OA 3UPWA 2PRLA 4UTUA 4TTGA 2ZXQA 1XYLA 4Z1CA 3FV9A 1IZKA 2C15A 1XRTA 1FWFC 3PPHA 4CQ9A 4JBRA 2OZTA 3M6DA 3VDAA 3PUOA 4JTHA 1BEUA 4AY7A 4HIBA 1V3IA 4NQ1A 1UR4A 5K9XA 1RPKA 2CLHA 3N4EA 1TQJA 4X63A 5CSRA 3BW4A 3G1YA 1H09A 4EXQA 3MSDA 2Z6IA 4UNIA 1ZALA 3AZRA 2W67A 3VNLA 1J96A 4PUKA 3WQCA 2E8YA 4M82A 3GM8A 4TQTA 2A6NA 3W4RA 2WKLA 3EPOA 4O19A 4G1NA 8RUCA 4FIQA 2CKSA 3PK7A 4TVUA 3MW7A 3P0WA 1UUQA 1KRMA 4DUVA 4JL2A 3AXXA 3WH8A 3VKAA 3DI0A 5J5DA 1IQ8A 5RUBA 2E09A 1J6OA 1KNWA 1R8LA 2C13A 1EJSC 1B3VA 2VFGA 1XC4A 2YA2A 3N2TA 3MB9A 1PHQA 4KMQA 3TLQA 3PF3A 4MNKA 3DZ1A 1LLOA 1NY1A 1OZQA 4PUUA 2A79A 2ALDA 1AFSA 2VGBA 3E2SA 3O6DA 4EF9A 3S9YA 3VNMA 2FHBA 2F7FA 4LSBA 1EUAA 5DT5A 2IPGA 3LLDA 1AQMA 3TZNA 2WSYA 3SCNA 2V2HA 4RZ5A 3V75A 3AHVA 4WDWA 4DYEA 2DIJA 4N9DA 1RD5A 1SMDA 3SRKA 1RCQA 3TX9A 4GYKA 2G3NA 3VMNA 3LBCA 1LL4A 1BPLB 1H5YA 2IW0A 1UHVA 3C0SA 3EKLA 3BC9A 2I7GA 4TX8A 2WKGA 2PDGA 5J04A 4NAEA 3T8LA 3AOFA 3QV7A 3WBEA 1TZZA 1EP2A 3O8AA 1JZ8A 2YYTA 3BSHA 1UWSA 3SZ8A 2R1LA 5J5RA 1PYMA 3GLCA 3C52A 4KH2A 4XTDA 2ZE3A 1E9LA 5C70A 2PDWA 1MFUA 1QI0A 5B80A 3USBA 4ALDA 3NXFA 1JXKA 1R9ZA 1DBTA 2C1IA 3PUEA 3SN4A 1OFPA 4CCEA 3AWOA 1G1YA 3ERPA 2A7RA 3PBGA 2WCGA 3W23A 2V82A 4L9ZA 4P5UA 2YFOA 2CZVA 3C61A 5HPCA 3QRHA 3C2YA 3ABRA 3SQSA 1C92A 4Z1DA 3VNDA 1TV3A 1TZ9A 1SMAA 1H11A 3OQ8A 5IXEA 3E5BA 1Z42A 1W1VA 3II1A 5C55A 4W93A 1HO1A 2INZA 4F0HA 3FEQA 2PU1A 1X97A 3OVQA 1EIBA 1CXHA 1PX4A 2NW0A 3OYZA 5DXXA 1EBGA 2Q8XA 3H12A 4DEFA 4RXFA 1KFBA 1IWBA 2RAGA 2XFRA 2W5FA 4WQ6A 1EYEA 4DWSD 4EAMA 2OVLA 3SRHA 4D6EA 3PZNA 2GDVA 3HQ1A 2D69A 1XSKA 4Q8OA 1PX3A 1OWQA 2P3EA 1JIBA 4P8UA 1IXOA 3ARVA 3MCMA 3G77A 1N7KA 1CX9A 5DT7A 1EGVA 3E0VA 4ZZ9A 1AG1O 3H7VA 4R9XA 4OKDA 3PBVA 4AZ7A 3BQ5A 3LI1A 1GGOA 3QFEA 4J27A 3O0FA 3W76A 1IR2A 1V8EA 4X9SA 3M0IA 1V3LA 1HT6A 4GO8A 2PRMA 2D24A 2HPIA 3DFHA 1ZCOA 3MYOA 3WLQA 2XWDA 4GVHA 4GGBA 1OCQA 4M56A 2WVTA 4N9CA 2O92A 4FSAA 1EA0A 5CC6A 3AJ7A 3QOKA 1DWGM 3TC6A 2EPHA 1CXFA 1ZP4A 3SCVA 2IMRA 3WJZA 2H3DA 1JYWA 1QNPA 4S23A 4US6A 1PB0A 3WQ5A 3FVDA 3M64A 4Z2LA 3L4YA 3IK2A 4D6IA 1L6SA 4RZ4A 2ZTKA 2ZX8A 4PCNA 1DPMA 1N2VA 4XAFA 7PTDA 2GJRA 1XIHA 2JFEX 1GKRA 3DUGA 1TR9A 4Q8PA 5I00A 2FKPA 4O57A 4K36A 4XSMA 3WD0A 1GZ1A 4EPBC 5AC6A 2Z1WA 5REQB 2X0YA 1TV2A 1KTCA 5BW6A 3V4BA 2H9AA 1Q4NX 3BAYA 2B81A 1I9CB 3XIMA 4CVUA 2GGGA 4ZXLA 5EL1A 1VC4A 2E68A 4M81A 2VFHA 1K02A 2VGIA 1CCWB 2GUUA 2DEPA 1MQRA 1OZMA 2C0HA 4GHRA 3L4XA 3A23A 3SB0A 1ICPA 3PVFA 2E6FA 5BCAA 2QDDA 2P53A 1TJ1A 3V5OA 2G96A 1IE7C 1R3RA 4H9YA 3GC2A 4AHPA 1Q13A 4TMBA 1XGDA 2ZRVA 4WKHA 4NG3A 3KRZA 5F2LA 1THFD 4MB3A 2OFJA 3S9ZA 1W3TA 4PR4A 3ITGA 2V38A 1W1TA 2D0FA 3IV3A 4P8WA 4ZOBA 4R7WA 2MUCA 3NZQA 3S1GA 5DY2A 3WK3A 2P50A 3FDGA 1UPMB 3RCNA 4R9OA 4GUJA 3KTCA 1QAPA 3ZVHB 4A05A 4UXDA 2QJNA 2X1IA 5A6AA 3KS5A 5D9PA 3F5LA 2UZ9A 4NILA 3NM3A 3GTHA 5HMDA 2HISA 3NL3A 4NZ4A 2ANUA 3TZFA 2GQAA 3QZEA 4C6IA 4WKAA 1ZL1A 3K8MA 1AMYA 2PDJA 2ZZ5A 2A3LA 1HKMA 3RU6A 4XD5A 3BUVA 4MWAB 4B4FA 1L6YA 4U10A 1JGMA 1EP3A 4Q8UA 3LEPA 5EYWA 1EDQA 4CNTA 2VOMA 5JBFA 3SUSA 3G18A 2TMDA 3H2AA 3GFZA 3W29A 4XZMX 4GBUA 4ADUA 3LYEA 4Z2JA 2HSAA 3CAVA 1E43A 3GAKA 3UETA 2Y62A 4YTRA 3KCLA 4E2VA 4UTFA 1J18A 2J78A 3EDJA 3VX1A 3PZQA 1MW2A 4RL3A 3KS6A 2OWXA 4C6NA 2OGYA 3H23A 1OGBA 4UFLA 3WLRA 3EDFA 1SO5A 4JQAA 1SPQA 4K6AA 1LOLA 4L7ZA 7TIMA 3ZM8A 2VFEA 4W8LA 1B2YA 1TPH1 2OLAA 4UFMA 2BDQA 1HL9A 4I6KA 5JUVA 3MMDA 5HQMA 3NL6A 1M3UA 1WNOA 2G5WA 5FEPA 2DH3A 2VELA 3RITA 4C1NA 4XQ6A 1PPIA 5C7HA 1Q8JA 1W3IA 1FWDC 2CLMA 1AD4A 3T4WA 3VFCA 4GQQA 3WF0A 2F2HA 5C9ZA 1ENUA 5FA5A 3CZGA 3MO7A 3Q2DA 3BWWA 4HU4A 3H70A 4HMCA 1IXNA 5DX7A 2NUWA 3GRIA 1RALA 2W91A 1CENA 1IXPA 2W27A 3CWNA 1UZ1A 4BQ2A 3W7QA 2A7PA 3PNZA 4GZEA 2AL2B 3TE9A 3VMPA 4LW7A 3ITOA 4H3DA 1LG2A 1O6IA 2H8ZA 3D46A 4IPLA 4IQDA 1OIFA 1TO3A 2E0PA 3WQDA 3KOYA 1E0UA 1FFRA 4GI8A 3DGRA 5FACA 1PE1A 1KTNA 4UTTC 2NWRA 4AZ6A 2GJXA 3LXAA 5HWMA 1RVGA 2XFFA 1EJRC 2J88A 2X0SA 4BFAA 4YU1A 4KETA 1NWSA 2REQA 3GR4A 1DHKA 3KHDA 3KL5A 1L2QA 1L9WA 1MQPA 4GXMA 4M6VA 1T41A 2TSYA 3NPWA 4TV5A 1CLVA 1GOIA 3IVSA 3HM7A 4HD5A 3RXZA 2DZAA 1AK5A 4QJ3B 3AWNA 3ITVA 3PZUA 4K2SA 1QPKA 1T99A 4UTIA 3B4YA 3ZOAA 3ARZA 4IGSA 5DBTA 2Q8ZA 5BU9A 5DMYA 1H63A 4YTQA 4D8AA 2OXNA 5ECVA 3F1QA 9XIMA 4XAPA 1S5NA 4H6KA 3TEVA 4HA4A 4C1KA 2JE8A 4HB7A 3ABOA 5E1QA 5CGTA 3GG0A 2GGHA 1SW3A 3GHSA 2HV5A 4B3LA 1R9YA 2J7FA 1QW7A 4GH3A 2XIOA 4MNJA 4GZJA 2P0OA 6CGTA 4ZO7A 4EK7A 2PWUA 3W82A 3M9YA 1Q2SA 1BFNA 3P80A 3M0VA 3CWOX 4E6MA 5CXPA 3QV6A 1JYXA 2XSXA 2ZYFA 5KITA 4I8YA 2C19A 1MI3A 3LDVA 1SR0A 1CXEA 1XIEA 1QXLA 1HTIA 4I7VA 4A3YA 3SCOA 1F76A 3JS3A 1EF2A 3VNYA 2WJDA 3EOSA 3M46A 2VWSA 1NP2A 1G4PA 3ATYA 4Q7NA 5M17A 3KTSA 5F2GA 3W85A 5CC3A 3WEMA 3O2LA 3AXKA 3FOKA 1MW0A 4HA1A 3GXNA 1OX4B 4ML9A 1UWRA 2AOSA 3NQFA 3TR9A 3W22A 2NX1A 5AC5A 4N42A 5HBFA 3JW7A 1JYVA 1O5RA 3NWRA 3UWQA 2WNNA 1IF2A 2CBUA 2PRHA 3QQWA 4JFWA 3EKGA 2BFGA 1VBRA 4RE3A 4YNGA 1CGVA 4XUYA 4GIYA 4RDYA 1XH2A 3QEZA 5GVJA 3IJ9A 4AMCA 4ZXOA 2FGZA 5EMMA 2UV8G 3L21A 4H1ZA 2DW7A 3IAPA 3WD1A 4NYUA 4PTDA 1P0EA 2FYMA 3M6YA 5CH9A 3B8WA 1W3NA 3V1HA 1Q85A 1S5WA 4S3JA 1MYRA 3CUFA 2CU0A 1REQA 2BHZA 3QJAA 1DJHA 3VOCA 3L4ZA 2CITA 3FJ6A 3W1NA 2QUNA 2EPLX 2VEPA 4WDXA 1FBAA 4UOJA 3LPPA 1F6YA 2OOGA 1V51A 3DYMA 1VPXA 4A29A 1OT1A 2WVVB 2RHGA 1DYSA 2E28A 4JEQA 4Y6GA 1WDQA 1VF8A 1C8XA 1UR3M 2VX6A 1K7EA 2FB3A 2RGMA 3PUDA 5FIPA 1KFCA 3FAWA 1PKYA 1JZ2A 2PSNA 3B0UX 1WDWA 3WJSA 1HJSA 4M51A 4J3TA 2DT2A 3FDKA 3H24A 2GJLA 4ZODA 1O68A 2Y61A 3DX5A 3WNKA 4DHGA 3H4GA 4K8GA 4Q4MA 3DG3A 4YYCA 1ELSA 3VZYA 1TJPA 5PTDA 3EAUA 3SDOA 3KP0A 3T44A 3DG7A 3VKDA 1F7BA 1Z6KA 2WHLA 1J93A 3NM1A 1G7UA 1EX1A 5FKYA 1VS1A 1TJ2A 3EOLA 2KAUC 4D1IA 4PTXA 1QI2A 2HDJA 2CXEA 3WL0A 3LX9A 3R6IA 4RLIA 3IWPA 4QCEA 3ZLFA 3L5LA 3LHTA 1J11A 2Z00A 1MXGA 3VMOA 1QNVA 1NTHA 3RX3A 4QIUA 4BF7A 4QDPA 3ZZ1A 3TCEA 3K5XA 1W1A1 1V6VA 3CQIA 5M03A 1E70M 1V0LA 2HZGA 2B4GA 1GW9A 3DXIA 2VM8A 3R12A 3C6CA 3ZLGA 1WE5A 4LB3A 2QDGA 5A5WA 5ABFA 4E8DA 2OCZA 4I7UA 3W7RA 2I14A 1TUFA 4LV9A 3WO8A 2ZUMA 5FAJA 3K30A 4Z0JA 1O5QA 3WQGA 3KUMA 4X9YA 1BXCA 1DWAM 4N9EA 2O9TA 1TVPA 2WZIA 1TE1A 4ZO6A 1POKA 2DSZA 5DO8A 2DJXA 4WY0F 4EPKA 1GOMA 1OADA 3ORWA 1AMKA 5LKYA 3ITLA 5LNVA 4F4RA 1A5KC 1S2AA 3VAVA 5E6YA 4NI3A 3NQBA 5DBUA 3JR2A 3B9EA 1JZ3A 3EYPA 3WH5A 4CLMA 5HQLA 4RV3A 3I7SA 1OCJA 3BVJA 5JH2A 2WHKA 5M3WA 4WHBA 4OV4A 1HG3A 4LUSB 1CDGA 1QBAA 4K7YA 4DUOA 2VZOA 4GUIA 4KCVA 2GDQA 4G7FA 3SJ3A 3CS2A 3U2EA 2IQDA 2H6RA 2ZXAA 4D6DA 2OEJA 1NIUA 3NSXA 4AZCA 1GJWA 3GH5A 3LN3A 2VD9A 4KEUA 3QLDA 1YNPA 2VRQA 2R1NA 1FA2A 3HFYA 3T0DA 3PTQA 4AYGA 1QTWA 1M68A 4K68A 4WRHA 2Z25A 3C0LA 3I3EA 1HVQA 4M8UA 3LB0A 5E0KA 1VBUA 4ZO8A 1GZJA 3GKAA 1E1FA 4WSKA 3Q94A 4IMDA 4QE4A 3GNNA 4Q33A 1V0KA 1LORA 2EPOA 1XD1A 4DPQA 3VCRA 3QGAC 1DWIM 3WNMA 1O5XA 4BI7A 3BO9A 2WBGA 3QTGA 1GVEA 4RDVA 2I5GA 2XZ9A 1VHCA 2G95A 1DP0A 1D3CA 4XBSA 4CD8A 1IYXA 2YR1A 1U22A 2HMCA 3PPGA 1C3FA 4E2DA 1WA3A 3QVQA 2NQZA 4XISA 4GFIA 3DECA 3KBWA 3W00A 4IXHA 1LOQA 3E9AA 3C86A 5GNXA 3ANUA 3GVWA 3O05A 4ES4A 4EXBA 4XKMA 3NQAA 3SY8A 3ZJ7A 4IUOA 1H7OA 3CH0A 4AZGA 3PANA 2PWHA 2WMKA 2RDXA 3NZRA 1A5LC 2ZRUA 4GY0A 3CQJA 3WSUA 3J7HA 3C2EA 1J12A 2BS9A 3QPEA 5I24A 1TSIA 5DCEA 4AF0A 5DF0A 2YXXA 3W7CA 1HXJA 3QW3A 4PCPA 4MKSA 4MJ2A 4DZAA 3RU8X 2V69A 4NAFA 4P2VA 3N2MA 4DWSC 3WQWA 3LXBA 4LANA 3EX6A 2HXTA 2XVLA 3A4AA 2PF8A 4DB7A 3VKJA 5AC7A 3WDPP 3KE0A 3G1RA 1JVNA 5HINA 1YMYA 1EPXA 4G7EB 1NARA 1NAL1 5L6UA 1KBKA 1IZJA 1K9TA 1V03A 1YYAA 4M5PA 3G5EA 2YZ5A 4NSBA 4GQGA 4H7CA 3L66A 4L4PA 3N2CA 1R85A 1VQTA 4JTEA 2DSKA 2VVSA 3TNOA 2WZEA 3VCNA 3VDCA 1EC9A 3P8JA 2B7NA 1AL8A 3WLSA 4AC7C 1W8GA 2QGHA 5E6ZA 3NQCA 1JD9A 1KXHA 3L23A 2C79A 4CN6A 1EOMA 5IRPA 4U5IA 4AY1A 3TQVA 4OU1A 3MZ2A 1RJRA 4BQ5A 5LNWA 2AGTA 1VBJA 5BWFA 2WZTA 4L9YA 2CBIA 2YCJA 4PB5A 1SSGA 5LIXX 3REQA 5I77A 4GMEA 3GR7A 4FOUA 5JBEA 4CU6A 4RUBA 2IS7A 4YXGA 1PTDA 3OQEA 2XN0A 2CBVA 1WV2A 1FHDA 3C3NA 1ZHAA 3KHJA 4Z1YA 4BI5A 4A3UA 3H8AA 5E09A 3N13A 2OLSA 2XH2A 4QSHA 2DZBA 1AJZA 3N18A 1AA1B 4CU7A 5BNKA 5C7VA 1LT7A 1OT2A 5A6KA 1KGXA 3FX4A 4LFYA 3CL8A 3QMRA 3RFAA 1TJ0A 3QV8A 3BCJA 1AQFA 5KTLA 3L2LA 3S5NA 4B15A 3SGUA 1P0NA 3L2MA 1GOWA 1NDWA 4NJIA 2HK0A 4KIEA 2WPGA 1K6AA 3DAQA 5AHFA 4D9PA 4XO7A 2J25A 1VRXA 3KP1A 3VU2A 1LLWA 1CGWA 2J7BA 2VQTA 1DTUA 4QHRA 1D3GA 4MZ1A 1ZLPA 4AZBA 4J35A 4HKPA 4OQVA 3UYCA 5AHIA 5HJXA 2J9ZA 3KDOA 2HVNA 4IL0A 1Y65A 5FEZA 4G1KA 5I79A 2DP3A 1VYSX 3VD5A 4LC6A 1JDFA 2OWCA 3TUUA 4DBDA 3B3DA 1MSSA 1DWJM 3EX2A 2DT1A 4IM4A 3EWXA 3THAA 1OK4A 3LZ3A 3TLLA 1XLDA 2L5HA 2VQUA 4GGHA 4MYAA 2PDXA 3ITCA 1WX0A 3RLGA 3NYZA 4LUJA 3CQHA 4RE4A 5BYWA 3G0SA 4YPJA 4UCGA 2DH2A 3IIOA 3AHTA 4XZBA 9XIAA 3NL5A 3W88A 5H2ZA 1HKKA 1SFLA 4KFOA 1GORA 3TMQA 1TCDA 3FYOA 2G37A 1DJYA 3PJXA 4O1AA 2QVNA 1W2PA 1XH1A 5H8UA 4AZHA 5ABTA 4R34A 3OEXA 2B7OA 3KM8A 3TSBA 1FWCC 4O0QA 1GVSA 2E6AA 3TXVA 3R10A 1B3OA 4MGGA 1BGAA 1JULA 3OBEA 3B0PA 3CU2A 1LQ2A 4HK5A 4U5KA 4NUWA 3WF1A 1FCUA 3K8KA 2VRKA 1W56A 4O15A 1LT8A 3N11A 3CC1A 3SAZA 3ZJKA 3GNDA 3C56A 4IL2A 1BVWA 1PKLA 6XIAA 1FWJC 3TROA 3KBVA 4KRTA 2WSKA 4GUHA 1GJUA 2BNJA 3LA4A 2NQ9A 3I3DA 4Q4PA 2BY3A 4JTKA 4QDMA 2NSOA 4HPNA 3VIKA 2X7VA 2X42A 5F1UA 3BQ6A 4AC1X 1OYAA 5D2VA 4GG9A 2WNZA 4QRNA 1MFVA 3I68A 4DELA 1TTJA 2WMIA 1Q65A 3OZPA 1J5TA 3GBEA 2VGGA 3U2CA 2GZXA 2HWGA 1TPC1 4ZMGA 5D02A 3AHYA 4AZ5A 4F0MA 4PULA 5LNUA 4JHMA 1BVNP 1XLGA 3TWBA 2YCKX 5HUOA 2UY4A 3PZMA 5CBBA 3I4KA 3MHFA 3C2FA 4H8HA 3ZIZA 1G94A 1PSCA 4LUTA 4J28A 4B2DA 3T78A 2ZC1A 4UNLA 1DL3A 3CAWA 3TCSA 3CZJA 3D0CA 5HATA 1T8QA 4NU7A 4ZSTA 3TQKA 1NP0A 4BWLC 4IPIA 2DSWA 1XPGA 3BZGA 3CZLA 1DTNA 2E1WA 2IXVA 1CTNA 3H6OA 3GH7A 1AH0A 1W9BM 1TVLA 4ZVJA 4P8VA 5CGQA 1LQAA 3H2EA 3T2OA 5LNRA 1VBHA 3LGGA 1Z32X 2VCCA 3W81A 3H7UA 4F40A 3U6WA 1WKDA 1UD8A 4QNEA 3SCUA 4AU0A 1WO2A 3FA5A 1IHIA 4P7QA 4V1XA 3ANVA 1FH8A 4CQCA 4CD5A 3DFTA 2QR6A 2Y7FA 4JEJA 1YLVA 3FK4A 2ZA1A 1J01A 4JTQA 4C6MA 1HUVA 2EEXA 4JX6A 4GISA 1WDSA 2GPTA 3R1ZA 3CEUA 1OFBA 1H50A 1MZRA 1HP4A 3N4FA 1DE6A 1OFRA 2QUVA 3LD5A 4FAMA 1EL3A 5FESA 2C0AA 1WXJA 3R0UA 1LDCA 1W3KA 5FSEC 1AVAA 1Y5VA 3KWXA 2VEGA 3UWYA 2QCCA 1MWOA 4PMNA 3IGHX 1F3WA 3WCZA 4DQWA 1C29A 2IKHA 4CQDA 1R6WA 3O63A 1IIGA 1S2TA 3ALFA 2VI0A 5D32A 5CZJA 3HG4A 1OHLA 2HXUA 3FKRA 1TMHA 2G50A 3S5ZA 3EX4A 2DPEA 4TOQA 2YL8A 1UH2A 5C5YA 4F0KA 3VVGA 4IUGA 3ZT7A 4O1EA 4ZOCA 2H3BA 1L2UA 2PDCA 3I65A 2D23A 2VGFA 5ENLA 2WCAA 2NQ5A 3BGGA 4PMYA 2FPVA 1LOSA 1KFLA 3MUIA 1TRDA 2KX9A 4YS1A 1ZZMA 2DUAA 2X09A 3TC3A 4UOZA 5HR6A 4UTWC 3RPDA 3WFZA 4DJDA 4R7JA 3GZ3A 1QFEA 1NEYA 3AFBA 5EY5A 5I3IA 3ZSSA 1FDZA 4FXJA 4Q8WA 3WMCA 3PFMA 3RM8A 2CZ5A 4DBUA 1YHTA 4LB4A 4RCXA 4XUGA 1C8VA 1GYMA 3DOPA 3V5FA 2VX4A 4DXKA 3B8IA 3P7YA 3KCJA 4BCEA 2RKXA 3UVIA 3FSUA 4KWSA 1ECEA 4FXSA 4IJCA 1J0HA 3E12A 2QAFA 1I8JA 4ACZA 1XXXA 3UGRA 2ZA3A 3AIRA 3S2MA 7A3HA 4GABA 5K9CA 1RQHA 2VX5A 3JZUA 3LRMA 2FZ9A 3G3MA 4MG4A 3CTTA 4AYSA 1XFCA 1LWIA 2QNEA 1ADSA 2BGSA 3SGGA 3VZXA 2V5DA 2PWEA 3MVTA 2XIJA 4G9PA 2VT0A 4WJEA 3UP8A 1R7OA 5A6BD 3F4VA 3AZSA 3CT7A 3VOFA 1FP8A 2XFYA 1RR2A 3SECA 3AYVA 2AMGA 4QS5A 1H2JA 4IMEA 1WZMA 3T9PA 3BMXA 4ERIA 1W1B1 4O13A 2OQHA 1HIZA 4KW2A 4AIUA 3BICA 2QF7A 1MW1A 3H7RA 4GZ7A 3FJ4A 3S5SA 3KZPA 1QWKA 1R7AA 5G4HC 4YWSA 4DF0A 4M29A 3TMLA 5AFDA 1A5MC 3V0SA 4IQEA 4PMXA 3DC0A 4QDWA 2DZSA 2RGLA 3JRKA 3AIVA 2PTWA 4JN7A 3WQ6A 1O66A 3LM3A 2FVKA 4XAYA 4Q4QA 4P7NA 4H2HA 4QEEA 4E2OA 3R94A 3TU9A 1W1YA 4GNKB 2VZTA 4ACYA 3CHDA 4CQBA 3VABA 5C9RA 3V1PA 1E6NA 1P5BA 2F8QA 3W70A 3RCMA 3TYAA 5GJMA 3GNPA 1JQXA 1Q3NA 5DEZA 3APGA 3U2OA 3G1FA 3AMCA 2V0TA 2MANA 4Q8MA 2V2DA 1O5KA 3GW3A 1VENA 2Y24A 3E2RA 5A2AA 1ITQA 1QNSA 3LCWA 3BW3A 4OUIA 2PWGA 3HJZA 1JNDA 4XK2A 3GXIA 1FHLA 4BZYA 4Q8VA 4DRSA 1WZKA 4LYKA 1G4SA 1VFFA 2VD8A 1UR8A 4XIMA 1FRBA 1XYAA 5HNNA 3DC8A 2Q8LA 4WD0A 4H8NA 4GFSA 3QC0A 4D6JA 1U1UA 2WC3A 4MY1A 2O7SA 3IVUA 3RJYA 3S1WA 2J24A 2ZBTA 1ISWA 5ABEA 1E6RA 1JFXA 1EHNA 1M1BA 3SQLA 1VEPA 3SW6A 4UQCA 1KM4A 4O1BA 4JIIX 4DJFD 3VKKA 4IJRA 4O16A 4PBFA 3VCCA 1XGZA 3QW4B 3KEHA 4E3VA 3TYUA 3OU8A 3U48A 4A3QA 2J13A 1UJQA 1OFDA 1OBAA 1SJBA 5E93A 1JPIA 2J27A 4Z2GA 1VJZA 1GOQA 4JTRA 4XZ9A 4I7WA 1N55A 3ZWTA 2Y89A 5LHFA 2OQYA 4R88A 4S38A 1XISA 4HYWA 3DYOA 3WBWA 4DNMA 2WAGA 5G2HA 3W38A 1QNQA 4ERAA 5A95A 3AHXA 3OB8A 3B03A 3TQPA 2VEKA 3CUZA 5D2WA 1Y5XA 4ZQMA 3H55A 3UPBA 1PUDA 3IVTA 3Q67A 1EH9A 4R33A 4QISA 1J79A 4KCWA 2GK1B 2EG8A 1SR9A 3EGJA 4FNRA 3F2DA 3WLOA 1TPUA 4GUGA 4M1BA 3KL0A 5C2GA 2UY2A 4AXKA 3NAVA 1ADOA 3HV8A 1Z8AA 3GTNA 2ATSA 3KZSA 4PRTA 3USZA 4CEXC 4AD0A 4CNSA 4MTVA 1ODZA 3HMCA 4M0XA 2ZX7A 1XGEA 3F4CA 1K7XA 1OFEA 2BOGX 4PUWA 3EA3A 2JGYA 2I9UA 1EZ2A 2A7NA 4JX5A 3SM0A 4N02A 2YCEA 3NGFA 1RHCA 4CD7A 1CB2A 4ZQPA 1F74A 2DORA 3UT0A 4L1GA 4ZB0A 3NCOA 4BEQA 2QT3A 3BG3A 4FLOA 3H4WA 4LQ1A 1C7SA 1TVNA 5T8GA 2QV4A 4NJKA 3ABZA 2E5BA 3W26A 1PEZA 3TWAA 3IV8A 3B0VC 2BV9A 3QFWA 5CPMA 1KR1A 2PC8A 4DLMA 1F6KA 3R8RA 4XG1A 2XINA 1SU5A 4FHAA 4HU8A 2YGYA 3ZWSA 4NX5A 4B2DD 3U8GA 5CSSA 4GXWA 1C8YA 1R47A 1ZSXA 4H01A 1KLZA 1EWEA 3NVDA 4ZCWA 2AKZA 3MO4A 2XGIA 2MNRA 2NXIA 2QCDB 2ISSA 2FFCA 3LHWA 1V3HA 3AUOA 4AZCB 2EHHA 4PUEA 3MV11 3B8UA 2O4MA 4LRSA 4Q3MA 5FJPA 3MKCA 3RLVA 3Q4DA 4WDUA 3LCHA 2YA0A 4JTFA 1F5ZA 1RAKA 2YDSA 2PDMA 3CIXA 1V0NA 3SJNA 1R9XA 1YW1A 4XB3A 4X60A 4Z2KA 3S5OA 4QQ3A 1XIJA 1EKOA 3WBYA 1EDGA 3VNIA 2CHRA 3ENLA 3W25A 1NOUA 2YL6A 1DIEA 1I75A 2BASA 2DV0A 3HGOA 3R11A 4TR9A 5CPLA 4E4PA 2PFHA 2WOQA 4M19A 1PDYA 2A3CA 4OVXA 3W7DA 4IQLA 4U2ZA 4A3RA 2WMJA 4ICCX 1RBAA 3EWUA 4DI9A 4YYFA 1RQEA 2EPNA 5F1VA 3W7IA 1EC7A 2B31A 3IJQA 1LM1A 2BXVA 3GTXA 4O28A 2J77A 4O8AA 4PTNA 1OQFA 2BY1A 3GVGA 3BLPX 1U1JA 4GKTA 1YXYA 1QW9A 4QROA 3T55A 1YPIA 4O1CA 1PCWA 4HA0A 5REQA 3ZSTA 5FJRA 3LGEA 5EU9A 3AMLA 3GXTA 2O0TA 4LWWA 4CEUC 1E6PA 5BWAA 1KCZA 5H8MA 2DIKA 3F7JA 1Y5WA 3STPA 4AF0B 3M0YA 3IGSA 2CWXA 1A5UA 1A3WA 3WJYA 4WSHA 1PCKA 2AQWA 3MHGA 3GR8A 3PAOA 3G24A 4PRWA 5CPNA 3I6RA 3BPWA 2B0MA 3UXIA 2PCEA 4NAFB 4DJDD 2JF7A 1Q6FA 4O53A 3E74A 3WQ8A 2F84A 4JCMA 4PB3A 4LAOA 1V6UA 4WGHA 4K8EA 3DENA 4HNUA 4XSLA 5K2ZA 4ZR8A 1TWIA 4G5DA 1XUZA 1NDYA 2PLMA 5C71A 1R30A 1UASA 3SQMA 5GJNA 3IIPA 4ROPA 3FA3A 1I2NA 4PUJA 4GA8A 1K03A 1WUFA 1N8WA 2Z28A 2JBMA 1VFTA 5JIWA 2P8BA 1VBGA 5JMUA 3KOXA 5KEZA 4S3DA 4YTTA 1F8MA 3ZVHA 4XX6A 4Q4SA 3FGCB 4BJHA 1EJTC 2G4JA 1XLAA 1CGYA 4AH7A 3AIWA 1G67A 4QLKA 1XBZA 1XHGA 4OE7A 3KVLA 3ITXA 2R6OA 1UPPA 4DUWA 3CL6A 4TV6A 4GIEA 5JBDA 3TW9A 1WB0A 4V33A 5C8BB 3W37A 3W7JA 2DY3A 3E5PA 3AMKA 1XWYA 4MWAA 3ABSA 4LVDA 1OG6A 4DI8A 3FW6A 4I9TA 1J2WA 4GACA 4KERA 3COTA 3REQB 3SFWA 1E40A 5HULA 5CCZA 3GVQA 2UBPC 2V63A 2F6XA 2O9PA 4QG9A 5MF5A 3SCRA 1EP1A 1IEQA 1VB9A 1Z69A 3MKVA 1GVFA 5HQEA 3AYTA 4B90A 4LF1A 2GJPA 3VM7A 1W9DM 4LUIA 4IFOA 3DFYA 1NF7A 3LM7A 3DFNA 1XIMA 4S39A 1KFKA 5AY7A 1ODUA 1EX5A 1WAWA 4C65A 8CGTA 4US5D 4XZNX 3VUPA 3AS0A 2DZUA 1R46A 3BLFA 4AW7A 1SSDA 2ZUWA 4JTAA 2Y2WA 3L4WA 1A5NC 2R1KA 5TQLA 1DE5A 3AXIA 3LMZA 2ASHA 5HPOA 4LCSA 3DI1A 1POJA 2BBFA 5G1TA 1AH3A 4MY9A 1G7VA 3A6OA 1W5OA 4RDWA 3PBMA 1E4LA 1NM9A 2GSEA 2RUSA 4AWUA 3SY5A 2HCVA 4LALA 3GD6A 2GYIA 4H4IA 2ABBA 3W3OA 1GJPA 1X39A 3ZVIA 4H41A 2AL2A 5A8GA 2PU0A 3A3XA 3GX9A 2A2IA 4HNNA 3POCA 1PZ0A 2HRWA 4V27A 3B40A 1DQXA 1HGYA 5C2XA 3JU2A 2OOFA 4BKNA 1QI5A 3MUXA 4M7TA 5DFAA 5F4XA 3CPUA 1CXLA 1U1HA 2ISDA 4U33A 1X38A 1IR1A 2Q3RA 3HIJA 1TV4A 3VIMA 1R3VA 1L6GA 1GOXA 3UNDA 7CGTA 4HNCA 3NQ7A 4JIRA 5D09A 2FFIA 4J9JA 4MZ8A 7ODCA 3KRSA 2VUYA 4EIVA 1NSJA 3MSRA 4FF5A 4D6HA 1I45A 3PBWA 4L80A 2OEKA 1VD6A 5H91A 1M01A 3UERA 2Y8VA 4QE1A 4LYRA 3CASA 3SRFA 2WJFA 4UBPC 4G8TA 3FSTA 3CLWA 4Z0SA 5CZ0A 1QJWA 3LPFA 4FF7A 1QK2A 4TX6A 3KBMA 2P8CA 1LL7A 4WR3A 4IIBA 1W5NA 3FLUA 1QO5A 2CNCA 4MOZA 4YVVA 4WSJA 3ICJA 1G0CA 2YYUA 3HPFA 2VX7A 3U4AA 1L0PA 1W1ZA 3UY8A 3NO3A 2G3JA 3T42A 1RBLA 4IG2B 4UZUA 4U28A 3M0ZA 1UP0A 1WZLA 3DU0A 3E02A 1L8NA 3LNPA 4KRUA 3LG3A 2WMIB 5BXRA 4AVFA 2V5BA 3WL1A 1KKOA 1W9VA 5B7YA 3H54A 9RUBA 4RR4A 5A2CA 1R86A 3NA8A 3B8SA 5M5DA 4PTWA 4A35A 3S1XA 3D6NA 2G8ZA 3AQUA 2OZ8A 1BYAA 4QJ1A 4FR6A 2FIQA 3TTEA 3BAIA 4KWVA 3N9KA 3T07A 4TIMA 5H1WA 1OX4A 4HQVA 5D2YA 3GFXA 4YCOA 4LBSA 4V15A 2VJXA 2JALA 5AZ0A 1GG1A 4J1OA 1BWLA 3EMQA 4GE8A 2WW5A 1RA5A 1QOXA 4IJBA 4UR9A 4C6LA 3W9ZA 2DGAA 3SCPA 2O56A 2NQJA 2OYKA 3M7WA 3URBA 4FK9A 1C90A 3G1XA 3MC5A 4FLSA 3ARXA 4MFDA 5CAKA 3WF2A 2E3ZA 5XIMA 3PBYA 3N3MA 4L4LA 2EQDA 1G9HA 2VP8A 1K8XA 3UZZA 4CU8A 1HGWA 1XD0A 3HG3A 4JIEA 5I6SA 2DZXA 2ZE0A 5HJLA 3RM4A 1DQWA 2YSWA 4KIRA 3IGUA 3NOYA 4J2PA 3WDJA 1XFBA 2XUCA 4OBTA 1QO2A 1H62A 2Z1BA 4Q22A 1KA9F 3BE7A 3M0JA 4LNYA 1UUMA 1KW1A 5LGZA 1DEDA 2QF8A 3STGA 3W07A 1KFWA 2QHAA 2IKGA 3CHEA 3TP4A 1TV7A 1QHPA 3JUGA 4HZ8A 5SWUA 2ZWYA 3GU9A 2WSQA 1T7LA 3W28A 3OLDA 3P8IA 1UA3A 2XJ7A 1WDDA 3LHVA 1CW2A 1T8XA 2V5JA 3CUXA 1NJJA 5LYRA 1UMYA 4XAZA 3RO8A 3PY2A 4LJ3A 3F4DA 4XBKA 4JY8A 4UWMA 2SFPA 2XH4A 4ROQA 3SIZA 3FNDA 5CPOA 1JDCA 3IJLA 1E3ZA 7XIMA 1J9YA 2FGLA 3NPUA 4ZOAA 3L67A 1JCJA 3W7GA 1LTDA 1WPCA 1K70A 2E5CA 2PGEA 4NXSA 1B1YA 1WKEA 2ZX9A 3E2QA 4RPQA 1TMQA 3K2GA 4GVFA 4QNWA 1H60A 1UUOA 3M5XA 4JIPA 1JNEA 2C7FA 5C9WA 1B3ZA 4RE0A 4B92A 3MUZ1 1MO0A 3UNTA 5I3GA 1OG0A 4HZ7A 3I4EA 4NNAA 3TN6A 4MYXA 3SCTA 4A8RA 3AI0A 4DYKA 2ZUVA 2VUNA 1XCXA 4L4MA 1L6FA 1ZBWA 4ZEPA 2QDEA 3SRDA 1RCOB 3PBUA 4CQ8A 5F7UA 4U31A 3MS8A 3FFSA 1XRSA 5TAOA 3W7HA 3SFKA 4GYJA 3TTSA 1I1XA 3OGVA 3S47A 1Z9AA 3ECQA 4EPEC 2B7QA 3G6MA 4N4PA 1CXKA 2J7EA 4OJYA 1A5AA 4GNVA 2QJGA 2GVGA 1X1ZA 1MEWA 2RJGA 1UC4A 4DN1A 2ZADA 2HNEA 3P62A 1YPXA 4HVXA 1WCGA 4GC3A 3FA4A 2J7HA 3N73A 1C8QA 2WCSA 4O11A 4XZIA 1ICQA 1YNYA 2DJLA 1XP3A 1TKKA 4FP1A 2P10A 4HCDA 3QTPA 3TYEA 3UG8A 4BR1A 2R91A 4XO6A 4DJFC 4QX4A 3OPSA 4NZ1A 4ML4A 1KCXA 4PGLA 8XIAA 1YQ2A 4OFCA 3KDNA 2ALRA 4NY2A 4G56A 1FWWA 4I6VA 3OBAA 1XQKA 1O60A 2PWVA 2C1HA 2Z0IA 4MWAD 2F38A 4UUIA 2C6QA 2V81A 1ZQ5A 4NI8A 3WF4A 2F2KA 4LCRA 2XG9A 1YX1A 4PMOA 1UR1A 1R2TA 4Q6XA 5EBAA 1K8YA 2HS6A 1GONA 1FY6A 2E9LA 3RRAA 2CBJA 2VEMA 1Z3NA 1OIMA 4MB5A 4HMDA 4D72A 3S2LA 1VZWA 3QMTA 6REQB 3NYDA 1JFHA 4UOQA 3W1UA 4HMEA 4N9BA 3HTWA 5EPDA 1CLKA 3LCLA 2ZVRA 4NHVA 3UWEA 4Y9OA 5AN7A 1UWTA 4HNLA 2OG9A 3BXWA 4JTJA 1VFHA 1HZYA 4MUPA 3VIJA 4MHBA 2ZRXA 1TFVA 1RA0A 4UFIA 5AB3A 1R3QA 1XIIA 1Y7VA 3ONCA 3GXFA 4HHHA 2QULA 2RDWA 2QUMA 3AMGA 3O06A 5E70A 2JEPA 4CNUA 2TAAA 4Q8NA 5CPQA 5LSMA 1X6UA 2I5QA 2O9RA 4WGXA 5JXQA 2E9BA 2ZRZA 5HR7A 1PV8A 1J2BA 2OX1A 3TR2A 3FXGA 2ON3A 3GG7A 1EYWA 3PG8A 4JN8A 3IIZA 4S3KA 5I5RA 2Y63A 1EZWA 2DUXA 3LTSA 4IP7A 5A6JA 3HB9A 4AISA 4NT0A 3C8FA 4C6QA 2BXYA 5I78A 3GTFA 2WMHA 3SIMA 3LCGA 1UKTA 3KBNA 3QHMA 3GXMA 1Q45A 3G1VA 1TWZA 2WVUA 1GYNA 3T08A 1XV8A 4ZGYA 4Z2IA 1RPXA 1U2YA 2DVTA 3Q65A 1XSIA 2ONEA 1S1PA 4L65A 3EWCA 2HJPA 3GXPA 1PKNA 3NZGA 4U3AA 4C6BA 4YJ5A 1ME7A 5CEWA 4RNHA 2A5HA 2IPWA 5EB8A 2OYLA 5HANA 1MUCA 3OIHA 3N12A 4JYDA 4EWJA 5TBOA 3T4CA 1UWAA 3RDKA 5D30A 3N34A 4KCTA 2FTPA 3GUWA 2ISWA 1LWHA 4EOUA 2WMFA 3E38A 1HKJA 4ZOEA 4P7OA 3WLNA 3NQGA 4G7EA 2PC4A 2FGBA 3UCCA 1US3A 3HFTA 4FNPA 2GL5A 1KBIA 4Q4RA 2OQLA 4UQEA 2VZVA 4DX3A 4QXIA 2Y0FA 5I23A 5ABHA 3CL7A 3N6HA 1CXIA 3V0TA 4IP4A 3ZS4A 2I1OA 3GY1A 1PS9A 2CPUA 3WLLA 3LY0A 1R2SA 3CYVA 3ZLHA 1M7OA 1A4LA 2BHUA 5FF2A 1GVYA 2YB4A 3ARRA 3UBPC 1TPEA 1W31A 2WSRA 1QU4A 4B5SA 2VOTA 1FCVA 3NDOA 4C6FA 4CD6A 3UWVA 1JRBA 1MVYA 1XIDA 4HZ6A 1ZJHA 3ID7A 1GPFA 4GX8A 1FVPA 4GO9A 1R87A 4NNBA 4LY4A 3N17A 2PEVA 4IMCA 4JTLA 3AXHA 1HP5A 3PTMA 3PPCA 3CHVA 4E4FA 1VIZA 1V0MA 2PP1A 3GS6A 2OYMA 5FSDC 3CIWA 1G4EA 1VEMA 1W9XA 1BHGA 2VKZG 3ZMRA 3FVMA 2BXZA 3GDKA 5DN1A 5AOUA 1SGJA 2BTMA 3A12A 1JUKA 1OFAA 2I9EA 2QQ6A 2WPBA 1BGGA 2PGFA 2HNHA 4NZCA 4HSHA 4ZQRA 1W1IE 2PODA 1NFBA 2A3EA 4F0SA 4JQ4A 1O12A 3OBKA 4XZWA 2GVLA 2F6KA 3IRSA 3ATZA 2XWEA 2GUYA 1RLDA 1K3UA 3NOEA 4A8NA 2W61A 4KGLA 3EB3A 2BB0A 4UTTA 2NVDA 1LBLA 3GG1A 1JPMA 2Y85A 1OC7A 1Q5MA 2YFNA 1J0KA 1PO9A 3RMEA 2CWNA 4FX6M 4DJDC 1M65A 1X1NA 1FKXA 4PBEA 3KVJA 4TVDA 5T91A 2V30A 2QUTA 1ESWA 3IK4A 2J79A 3R89A 3L68A 3QYSA 5HAOA 1EDTA 1GK8A 3PWAA 1HX0A 3HURA 3RX4A 4DIAA 5BRPA 2DZTA 3U9IA 1GTEA 4HOZA 2FLIA 3G1SA 1J0JA 4RKAA 1AQHA 3L12A 3WD2A 1VJSA 3CLMA 3W27A 3VYLA 3C0JA 3GC4A 5EMLA 4W86A 2JKEA 3R0DA 4LTSA 1CWYA 2VC9A 3GU1A 5CLTA 4RW3A 3ZT6A 4ZFMA 3W1QA 4JX4A 2P88A 3RR4A 2DVUA 1XLFA 4DO5A 1N82A 5FEXA 5D9MA 2OZ3A 1RH9A 3UA4A 5XIAA 3H22A 4W7UA 4PL1A 1D7KA 2PDLA 1TB3A 5F4WA 1B3WA 4FLQA 2A1YA 3DHUA 3DBPA 1FWHC 2P3ZA 3BJFA 4DAIA 3CM4A 3XISA 1XS2A 2ZZ6A 2AKMA 2QYGA 3MKKA 2ZX6A 3N2XA 4X0VA 3QH2A 3QXBA 1MXDA 2Y8KA 2Z7GA 1RY8A 2QCGA 4GCAA 3BK0A 3THUA 3HPSA 2CLIA 3W75A 4FLRA 1TELA 1XR2A 2TODA 1RD6A 4MF4A 1EWDA 4PUDA 1V6YA 1LWJA 4Q32A 5BRQA 4H6RA 5FJJA 4GQBA 1B3XA 1AW1A 1GVRA 2FPTA 1PTGA 4ASTA 2C18A 9CGTA 1PDZA 1FWIC 1FCQA 1P0BA 2QIWA 1JXJA 4CN4A 3T2QA 2XH7A 1QMLA 3K4WA 4MUZA 4MSSA 2EPMX 5F2IA 1BXNA 4IMGA 4L5ZA 3PJWA 4LF2A 4M80A 4IPPA 2PMQA 5U7SA 3MBFA 2NX9A 2VTFA 4AG0A 4KS0A 4DJEA 1BF6A 1KXVA 3TW7A 3PM6A 2D20A 3RO6A 3U5UA 1WAUA 2FH6A 2J8FA 1GHSA 3C0QA 2WWDA 3M44A 5AYYA 3A5FA 1OF6A 2R14A 4WX2A 2WM1A 1CIUA 3VO0A 1HL8A 5I07A 3S2CA 3MCOA 2XM2A 1ZJAA 1XLKA 3TAOA 1K9FA 3GZAA 2EF9A 2ZC8A 1K4GA 4JDBA 1H7NA 1FDJA 1G5AA 1I2OA 4W89A 1XYZA 1ECQA 4S3AA 4PCTA 3G8EA 2ZICA 2ZXBA 1JZ5A 1BWVA 5EKYA 2PE4A 5DELA 1TYGA 1NOWA 2WSPA 1IGWA 2WHMA 3CTLA 4ATWA 2R9RA 4O1DA 2ISVA 4F0RA 4GBDA 1TWWA 3UGVA 2X41A 3G6LA 5TNVA 4KEVA 4W85A 4GLEA 1ISVA 5FF3A 4MPQA 3G8RA 4QBXA 5A1AA 2DSUA 1H3GA 2FHFA 4ONVA 4Q8TA 1RV8A 1UCWA 3VIIA 1IEWA 2VVNA 1XLEA 1D3HA 3W7LA 4K39A 3CV6A 3EDKA 5G4WA 3L5AA 3E0WA 2W0UA 3CAQA 1I60A 4NJJA 5A8QA 2X1TA 2YW3A 2OO6A 1VFOA 4AD4A 3VDHA 3K46A 3VIOA 2OR2A 3SY1A 4W8AA 3TYDA 1WBHA 2Y70A 4QLJA 3TQ0A 4JN6A 4NASA 4AEEA 2DU2A 3IAQA 2GWGA 2WNQA 4UMCA 2Z1XA 3KOZA 2ZVIA 5I09A 3G0XA 3KVMA 4WOZA 1EJUC 3BLLA 3QKZA 2XPKA 4BK9A 1X1OA 4ENLA 1LRNA 1NWRA 2PD5A 3KFTA 3VD7A 3P5YA 4KQNA 1GKPA 2QCMA 1OD8A 4UZSA 4FOKA 4FPSA 1EJXC 1KWKA 3MANA 2DT0A 3EXRA 4K7VA 3W2MA 4F8XA 2O9OA 5TIMA 3LSCA 3S2NA 3QV9A 3WY1A 1S3TC 2EGZA 3F4NA 2F6UA 1NFPA 2VL4A 3NZPA 3MVIA 1LYXA 1NELA 3UR2A 2Z7KA 3LCXA 1E9ZB 1OYBA 1A47A 1ZNNA 1SO3A 3CZKA 3STCA 1ICSA 1P0KA 4GIAA 2G3IA 4S3CA 4G6CA 4WZHA 2D2GA 2OB3A 2ZDRA 3S1UA 2D2OA 1B9ZA 4IMAA 3P93A 2Z2BA 5HK4A 1X6NA 1TR1A 3ONBA 4B5XA 4YTSA 4O54A 3SEPA 1QPOA 3B9DA 4GJJA 4KESA 5BMWA 3W73A 3B4UA 4PMUA 3BAWA 1M9HA 3MP4A 4P61A 4MFEA 2XH0A 2HTMA 3WQVA 4GRSA 3ARWA 3EPMA 3QN3A 4KCUA 5LIWX 3HMJG 4YIWA 5D9NA 3W7EA 1SM9A 3P0XA 3TSDA 1UR2A 4J3XA 1IZCA 4LXFA 4ZENA 4TMCA 3SN0A 1VCVA 1XQLA 4YL2A 4B5WA 1P48A 2XIMA 4AX7A 4AY8A 1JCYA 2D3LA 3BMVA 1GYLA 4REQA 3A5VA 4M7SA 5FF4A 1UH4A 2ZUNA 3UZXA 1TWDA 1KM0A 1SJCA 2XHYA 2FDSA 3O1NA 4JTGA 3NR0A 1ISXA 5A8NA 3FYPA 1ZY9A 3BV4A 4RJEA 3LHZA 4UTJA 1WYIA 3APTA 4N0RA 5IHSA 3L7RA 4JTDA 2VURA 1ZUAX 3DKJA 3IGXA 3B0YA 2J6VA 2FJKA 1A5BA 1E4IA 3OYXA 1VEOA 3TOPA 3NPXA 4NZ3A 2I16A 3KBSA 4W7WA 3DYPA 5HWJA 3BV7A 4QAWA 4F79A 3KWSA 4I5XA 1IT7A 4MJ4A 1GOOA 4A3HA 1M7XA 4MNMA 1P7TB 1OC5A 2V6AA 3IJ7A 1WZAA 1T5AA 3GVRA 3VGHA 1Q2RA 2G97A 3GNOA 3KRBA 2E77A 5D03A 2OGJA 5HOSA 3NQ6A 2H8XA 3HGRA 5K4XA 3VD4A 1GVQA 1QHZA 1SVDA 5EA9A 3PG9A 1FXQA 3GNRA 4ZTXA 4J3VA 4UR7A 4H04A 2WKJA 1XCWA 2BGQA 3MUAA 3A4WA 1D8CA 1V6WA 1US2A 4DWSA 3EPNA 1W37A 1K77A 3LLXA 2ZDSA 4OT7A 1DJQA 3DN5A 2YLLA 4AHOA 4W4QA 3RIKA 3BSGA 1TCMA 2Y4SA 3O6AA 1HJUA 3M5YA 3O6YX 1AW5A 1R5YA 3CUHA 1B90A 1QOQA 3K4DA 2W66A 1E9YB 4WK9A 5LXEA 1UJPA 5A2BA 3WQEA 2J7GA 3JZEA 3OG3A 3CHFA 3O15A 1P4CA 4D6CA 4AWEA 3F4WA 5LA2A 4XZHA 5C9UA 5I02A 1MDRA 5JVLA 1FWEC 1DORA 4FB7A 3PB2A 2YLAA 1FUYA 4XD3A 2E4TA 3ISIX 1JQVA 4JIHA 3UG3A 3NSNA 2WXDM 3U5YA 3R79A 3W2KA 3WG6A 2D0HA 2ATMA 2CHNA 5MKGB 1FX6A 3W1TA 1L6WA 2PWFA 4MWAC 3LERA 1T0OA 3U7VA 5HNTA 1VFUA 2WANA 1JJKA 1KO0A 1A0CA 3SADA 4O17A 3PP7A 3IS4A 4CGTA 4R85A 4JQ3A 2CHOA 2GK1A 2OELA 4ICMA 1ZS2A 2PTXA 3N15A 4B3ZA 3NGJA 5TD4A 3BG9A 3LK6A 4HNVA 3MWAA 4NZFA 1GT8A 1K4HA 3T0AA 3GFYA 1H41A 3B9OA 3S4TA 2YB1A 4C6JA 1QDSA 2GQ3A 2ZX5A 1E56A 2V5KA 2Y7EA 4IICA 4H6QA 3LTPA 4O10A 3IARA 1XIGA 4MADA 3RCYA 1GG0A 4J7RA 3LHUA 3LI0A 1V08A 1ZTVA 4MAVA 4GI4A 1J0ZA 1RP8A 4DJED 4PZVA 3D5HA 2ZUSA 3TTOA 4MB4A 2HBXA 1UROA 1MXSA 5CPSA 4QCFA 1W3HA 4UMBA 3V36A 4ATDA 4NYYA 3RR1A 3NUKA 4AX6A 2YBTA 1ZAHA 3CBWA 4WDTA 5FOOA 3HOJA 3OOQA 3WDRA 3HU7A 1BYDA 3T8QA 4JYFA 3S3GA 7ENLA 1YRRA 4JTTA 1B30A 2QCDA 3LZ5A 4MJZA 6XIMA 3H2MA 3UCDA 3G1AA 2WWCA 2EG7A 4DM1A 1HF6A 4HPHA 4IX2A 2JKPA 4HTBA 4F2UA 4IGHA 3VD9A 1KRAC 2J8GA 2QLYA 1EUNA 1QBBA 1X7IA 2J75A 4EPDC 2OU4A 4FS9A 1BF2A 1SZNA 2ZTJA 2Y7GA 3S6OA 3WF3A 2YBUA 1KFJA 1OC6A 4O1FA 1RLCL 1W0MA 1KM3A 3DBNA 1E71M 4G2DA 1NWUA 4HYVA 3WH9A 1V93A 4ZE5A 2QJJA 4HOWA 1X7FA 2HPMA 3AYRA 4Z2HA 2Y1HA 2HE8A 3V5CA 2G0WA 5MHBA 4O52A 3LCFA 1BG9A 1CGXA 3BW2A 3WLMA 4DO4A 1EEXA 4AVNA 3EEGA 4TTUA 1AZ1A 1DJNA 2CEQA 5A8PA 5EMYA 1JPHA 4LVAA 1MEHA 1BWKA 4O4WA 1BLIA 3P60A 3IJIA 1J10A 5JU6A 2ODOA 2E8ZA 3WIJA 2EKCA 3MJYA 4IIHA 1JZ7A 1EIXA 1I1WA 3WX7A 1XF0A 1KV5A 5IBXA 3R58A 1W54A 5CKSA 4GVIA 3WLHA 1A3HA 4H9ZA 3S42A 4QJ4B 5IFPA 1YDYA 4D6GA 1HJXA 1K8ZA 2Y5EA 1IV8A 5CG0A 5LA1A 2P0IA 3NURA 1GQLA 1G69A 1XICA 3NSMA 5CPTA 4JFSA 4AIEA 4GYPC 1S1RA 4EANA 5E0CA 5BRBA 1TA3B 2J8TA 1XLJA 1Q6DA 1HW6A 2PDKA 2YPIA 5T9BG 3DG6A 4A8LA 2J6XA 5AYXA 3NDZA 1XW8A 4K8HA 2W62A 2GGEA 1SZGA 4C5ZA 4JTSA 4K38A 4CNOA 1RUSA 1EOKA 1E73M 2Y6ZA 3IJ6A 2INEA 3PAJA 4XBJA 4QM1A 3QR1A 5ECUA 4BWLA 5AKQA 1CLXA 3GW0A 5DQPA 3BOXA 1DJZA 1ZGDA 3N2BA 3S9IA 2DVXA 5AYBA 3WFAA 3WBXA 1V02E 1KCKA 4L6OA 3MJMA 4CCDA 2CESA 4DVOA 2PWDA 1K7FA 1OSEA 2VCBA 2QDHA 3CQ0A 4S3GA 3WNLA 4ZQOA 3TJ4A 3DFSA 3P3BA 5D04C 3FGCA 3QR0A 2PDPA 5D8WA 5BOFA 2GWNA 1WXYA 2C14A 2WNWA 3IACA 4RZBA 1JCLA 4DWDA 2E6YA 3B8DA 1W5MA 3VNZA 3KCOA 4L6HA 4LOCA 5CG7A 1H5VA 3O07A 3P67A 2CLPA 2FZNA 5CGMA 3MMWA 4UQ9A 2WB5A 2ZKMX 1QVBA 1RP9A 4QGCA 3PZ9A 3AS3A 3QHNA 4L56A 5AC4A 3WEZA 3VOJA 1JDEA 5G1YA 3QQ1A 3CUJA 1HO4A 1GTHA 1PWLA 2R1PA 4NRRA 3S83A 5A3HA 3WUEA 3MUCA 1JPDX 4AAJA 3LUTA 1JCTA 1T6MA 2CKRA 2VDIA 1P43A 3U3HA 1VPQA 4LYQA 3HG5A 2ZQ0A 2WYSA 4MM1A 4AHQA 2WLZA 3DERA 1DOSA 1F4AA 1KC7A 5L9FA 2QKFA 1PYFA 4IF2A 1YDOA 1CI1A 2YCLB 5BOEA 5DRIA 1V5XA 2PLJA 4DXVA 3QQ0A 1BSIA 3A21A 4E0CA 4LU0A 1M6JA 4JD4A 3VGEA 2ZXDA 4LV4A 5FAGA 1QRQA 1H1NA 1XBVA 3NQVA 1Q8AA 1XJBA 5K7JA 4ATLA 4GJ1A 4J3UA 3AUJA 3FHQA 3RLHA 4UTWA 3MBDA 4H9TA 3T81A 3RLUA 1YKWA 1XDMA 3CUGA 3QSRA 1QPNA 2FTYA 1OD0A 1GCYA 3BGAA 2Z26A 4GJIA 3CMGA 2V5CA 3UVAA 1NH6A 1KKRA 2V2CA 3OVRA 3LSBA 1IEXA 3ZQ9A 1GVOA 3S1VA 2WZMA 3UW6A 2BY2A 4I8DA 1I6NA 4V28A 3R8GA 3HPZA 3M47A 5U4NA 2EKGA 1J5SA 2CLEA 1FFQA 1LROA 1UP3A 4X3ZA 4H9MA 2PDUA 3MDWA 2TPSA 1Z7AA 1HN1A 4XTIA 1YBQA 3P2VA 1LJYA 1WDPA 3WYZA 1I2RA 1ZBCA 3CPRA 2E9MA 2DQWA 2O7QA 3GYEA 4HPJA 4NVTA 4HSNA 1FXPA 3CMFA 3O7UA 1S3HA 1P6BA 1UD6A 2QJIA 4PTVA 4UC5A 2RJHA 1E1CA 4S1FA 1GQIA 3UG4A 4N2YA 3TN5A 2CXGA 3G0UA 3MA8A 2VFDA 3QY7A 1OABA 4F2TA 3UZ5A 1ITXA 3SUUA 3ARTA 7REQA 3OZYA 3S6DA 4UQDA 8XIMA 5I3JA 2DUZA 2UY3A 1J8VA 1EJ7L 1LBMA 4AFYA 3PZGA 4MZYA 2F9RA 3UXKA 2GGJA 2GLKA 2GUBA 3P6LA 1B31A 3ZT5A 2VEFA 3GSMA 5I3HA 3KOWA 4JKLA 1D9EA 4HYRA 3MHUA 3LQGA 3HQNA 4Y96A 5AYIA 1W5QA 3UWZA 4KWOA 3UU0A 3ANYA 3TA6A 1Q6GA 3PULA 3TKFA 2XIBA 4IG2A 1WDRA 2VR2A 4FNUA 1UZ4A 2PURA 4DBSA 1H61A 2NT0A 2BVYA 2XVGA 4LEQA 1PZ3A 2PTYA 4ILSA 1OGGA 2WLYA 4ERGA 4WIWA 1VGAA 4JIQA 1S2WA 4AEFA 4C7GA 3P61A 1EXBA 1C93A 3HPXA 1AJ2A 4UFKA 4L4OA 3A9IA 3NO1A 4BEUA 1UQZA 2QUUA 2NUXA 1W1PA 4HU0A 4M6PA 2FB2A 3QSTA 4FOJA 3PFRA 3TNBA 3OGRA 3JVAA 4WOQA 4WJXA 1E5JA 1B9BA 4Q7IA 2ZIDA 5DMNA 2NT1A 1F8IA 1CT5A 4IFKB 3F5KA 1UWUA 3IANA 4FI4A 1S39A 1ONRA 1NOFA 4MPKA 4DBWA 3B0XA 1YXDA 3BAXA 2FHCA 3PSVA 3CH9A 3UZJA 2X8RA 3IIVA 3B8TA 1YPFA 1V3MA 2CETA 5DLCA 4GYFA 3ZXWA 2YDQA 3VIHA 1F4HA 1U5HA 3NL2A 2BLEA 1S5VA 4MB1A 3NFUA 2POTA 4Q4KA 1I4NA 5GNYA 4PUMA 5HWNA 3EZ4A 3VNJA 1MUMA 4UFJA 1Y8BA 5A69A 3HF3A 1H51A 4OWGA 2QIIA 1TJRA 1JPKA 4Q8QA 3AALA 1VIWA 3UZYA 3TH6A 1UZHA 3H26A 1E4NA 1VJIA 4W8BA 1LQ0A 4QSFA 3E96A 3DCPA 2BX7A 1ZENA 4C7DA 3K1GA 5HMSA 2FDMA 1XLHA 3CZ8A 1TRIA 1EF3A 3VINA 5F4SA 4PL2A 2PGWA 3BLDA 2BVDA 2PDBA 3CT2A 4D71A 4S2BA 4W84A 3P82A 1H1ZA 4DO6A 3LPGA 3UJ2A 3I3BA 3NDYA 1CPUA 3R5EA 2VWTA 3L5MA 3PUGA 4NIRA 1DJWA 1FCBA 4PMRA 1DXFA 1W32A 3GNXA 3BCFA 5M1TA 3E6EA 2IQTA 1IT8A 3GHRA 2PCQA 1EJWC 1TTQA 4W88A 1R2RA 4MJMA 2KZHA 2Y7DA 1K9DA 3OIXA 1KTBA 2GSHA 4CVWA 3M0XA 3M43A 4MMWA 3LHYA 1XLCA 5HUPA 1R0MA 4F9DA 1R38A 2RFGA 1FWBC 3UJRA 4ZE4A 4O4VA 3GDMA 3EB2A 4FMVA 4EVZA 2DQXA 1VLWA 3FYYA 2NZLA 4X2RA 1FH9A 1HJVA 3DESA 3U7BA 1F05A 3V35A 4N6EA 4FXRA 4GXPA 1RVKA 5K4ZA 1W9PA 4QITA 3VTRA 1C9DA 4JFUA 2D2JA 1ZCCA 3LLFA 3W0KA 4BA0A 4UFHA 3BANA 4RNIA 2HK1A 3WLJA 4OECA 5C54A 1UR0A 1FKWA 3A22A 4IZGA 2NV9A 3BH4A 3T1GA 1GQJA 3OO2A 1E6ZA 4XVDA 3UEQA 5EFFA 3RN6A 1VHNA 3A47A 4UQAA 2EJ1A 4LAZA 4GY7A 1UG6A 5AECA 3HG2A 2NSXA 2VRJA 2QZRA 3H53A 4UNKA 2IPJA 4DF2A 4PE8A 3PSWA 1MNSA 3QMSA 4WY0A 3ZJ8A 1OJXA 1OM0A 2XVKA 1WP6A 3OTRA 2VC6A 2BOEX 4C60A 4GOAA 4O18A 1JG9A 2PDQA 1LF1A 2HBVA 2PLKA 1S2VA 2G41A 1SO4A 3QLLA 4REQB 4RK8A 4B4HA 4AQLA 2EJAA 3TJXA 4CUCA 4O14A 1KLYA 1B57A 3H2OA 1KBJA 1EQPA 4C6DA 3SUVA 1S5TA 3W1PA 3NVTA 1BYCA 1BVZA 3L65A 4U4MA 4DY1A 3TOYA 4W5ZA 1FWTA 2V3DA 3UR8A 3Q45A 2WHJA 2J74A 1RJQA 3D3AA 3BCDA 5G4EA 2OSWA 1UKQA 3LXCA 1JAKA 2IUZA 4IH3A 5D2XA 2W9MA 4J3ZA 3VOGA 4UIOA 3AIEA 4QG6A 1GPWA 5FF7A 4GINA 3HN3A 4R7OA 2XGZA 5EGRA 3AC0A 1E6SM 4FXFA 1YE4A 3VA8A 8A3HA 1BAGA 2GSJA 4I5RA 1GQKA 1E72M 1NDVA 2A6LA 4PMQA 2NQHA 1IXQA 2XISA 4H9UA 4IIEA 4PYSA 1EB3A 1W9UA 4S2CA 3V0UA 3MI3A 5GNZA 5FJIA 6REQA 3QY6A 3LQLA 3HGJA 4YLWA 1XINA 3WDQA 3EOEA 1SZEA 4DAFA 3ZR5A 4Z42C 4B5VA 1IWPA 4OBRA 1UWQA 2JF6A 3C4UA 1UD3A 1SJDA 2VFIA 3UESA 3CWHA 2X40A 5CLWA 2AMXA 3CV7A 5I3DA 1TPFA 3KTXA 4NRSA 3NO5A 3GYCA 3N6QA 1GNXA 1UP2A 3MWCA 4HJFA 4GIRA 2YBVA 3O16A 2Q71A 4GY1A 4L1WA 5GQBA 4FX8A 4DWSB 3OLEA 4Y9MA 4D6FA 3HJEA 3LBOA 1X96A 4HPXA 2FZ8A 2WC7A 3VGGA 1EPVA 2YOCA 3UPMA 1KQYA 4UQBA 3UWWA 4WXYA 1LUCA 3SO7A 5A6MA 4URIA 1CGTA 3WUBA 2FPYA 4C6EA 2PPGA 3VC5A 3AISA 1HNYA 4OZOA 1PBGA 2YZRA 3OHIA 4RPPA 4JHZA 2BGNE 4N4QA 4L9XA 4YMZA 3GDBA 4EXAA 2OTDA 1PJ9A 2I17A 3U4FA 4AWSA 4CCZA 4WLCA 3WK0A 3CO4A 1SFTA 4DJEC 4B5NA 3BLEA 3TVAA 4XWUA 1MUWA 2YX0A 1A5SA 1KD0A 3NXLA 5BXTA 1UD2A 4A21A 2GVYA 2IQ0A 3STEA 3D3FA 3DGBA 1YDVA 2G3MA 3KLLA 3WH7A 5CJ5A 3ARYA 1Y0EA 3AAMA 3PWGA 3LGDA 3L0NA 2AL1A 1EFZA 4L6DA 4JHOA 2XFWA 4ICNA 1IEVA 2C91A 1QUMA 1S38A 1J0YA 4PRRA 2QPXA 3L4TA 1GQNA 5BROA 2GOKA 4XKYA 3RHGA 1M41A 1NVMA 2HROA 2JGQA 1TPDA 3T6CA 1XKYA 1UH3A 3WLPA 3E49A 2FVLA 4YHEA 3AU6A 5JQ9A 2G4FA 3NEVA 3VILA 3PZIA 4PSRA 1P6WA 4A2SA 3BG5A 4HCLA 1ZP3A 2XVNA 3AU2A 1DQUA 2A4AA 2FH8A 1FWGC 3TFXA 3XINA 2XIQA 1F3TA 1VCGA 2NV2A 4J2MA 4WUIA 2OWWA 3R8HA 1FTXA 4GKLA 1BKHA 2VYOA 3KRUA 3PZOA 1CYGA 3PN8A 3EWYA 4NJGA 2FZBA 1HKIA 4EACA 4H8UA 3PJTA 4DUXA 3GO2A 3RJXA 5IDZA 5C9XA 2E5DA 4RX0A 1VFLA 1Q7ZA 1UKPA 6A3HA 3MUY1 1CGUA 2BVWA 3T09A 3TTYA 4KF1A 3VUSA 3CNYA 3SR7A 1A49A 4DZHA 2R24A 1S46A 3ABXA 4IXXA 2ZUUA 3MPGA 4LPCA 2PZ0A 4GUFA 1FHVA 4GD0A 4XIAA 3UJFA 4QEHA 5A6TC 3N25A 2PBGA 3W2NA 3GKFA 2E40A 1QATA 1FOBA 2WZHA 3G1HA 3LU2A 4E5TA 2TYSA 3EMCA 1E1EA 3RX2A 1HKVA 3TC7A 3DEQA 2I56A 2RDTA 3W7NA 4FR1A 5BXPA 2YXOA 2YDRA 4W7VA 2FJUB 4FNTA 5A6LA 1MDLA 4CNNA 1FWRA 1BRLB 1KM5A 1PIIA 3RRXA 3TJIA 3Q37A 4DXXA 1JUEA 3DFOA 5DANA 2QXWA 2X1RA 3GE7A 4TXEA 3BMWA 1WKYA 3DFQA 5HXMA 1I2QA 2VHLA 1UBPC 4BHYA 1RSCA 3R7MA 3CQKA 1ME8A 2HS8A 1Q63A 3ALGA 1RK6A 1T40A 2XSAA 5LXXA 4D2JA 2Q6ZA 4PCSA 3UJSA 4CD4A 2NXHA 1SFSA 1P1MA 4R5EA 4GPNA 3FS2A 4EAYA 1CBGA 2ACRA 4DYJA 3OG2A 3WBAA 1SZRA 2PDFA 3O3RA 1UIPA 4QAIA 1DJIA 1W2VA 4AD1A 3POHA 5G2IA 3M1ZA 3GB6A 4Z08A 1ITUA 4JZ5A 1QPQA 4LH8A 2CZDA 1K1DA 3CV2A 2OPJA 1TZ7A 5BU6A 3WQPA 2CZFA 2J62A 3DHDA 4B5UA 5D2TA 4IX0A 4F48A 5CJNA 2QVHA 4WJ8A 4Z1BA 3GH4A 3URNA 5DCDA 3CEPA 3MSGA 3VX0A 4RNJA 1V02A 3WNNA 5GPRA 3Q58A 3IJDA 4JQ2A 1DIKA 2YCIX 3DDMA 3WUGA 4A6GA 3WMBA 4DZIA 3F2BA 2QCNA 5I3FA 2PS2A 3W2JA 5CC5A 1DJGA 1LRTA 3C5QA 4V1YA 3F2CA 3W1RA 1U5JA 2YW4A 1RY0A 4PSPA 1HQTA 4QLLA 2Y5JA 4EF8A 4I9AA 1Q6LA 3QF0A 3ZO9A 4LVFA 4XAGA 2EBNA 1VYRA 4YTUA 3H2FA 5B7ZA 2OX4A 4HU3A 1AW2A 3SCQA 3ARSA 3FJNA 2VR5A 3KW3A 4W87A 1P1XA 4H19A 4XV0A 4WKFA 1Q7QA 4WEVX 2PLCA 3W74A 4QS6A 4LBRA 1I0BA 2CLKA 4JR5A 2HVOA 1G01A 4BF9A 1TMLA 5BOOA 3R43A 2WJEA 3THCA 4IQJA 2NVCA 4HSOA 5KZDA 4LYPA 4L61A 3LV5A 5FI8A 3DIPA 1TE6A 2NX3A 2W79A 2ZZ4A 4CKQA 3QC3A 4ECLA 1UOKA 3I6TA 1O7AA 5AZ1A 3AS2A 3HQPA 4ORIA 4OBSA 3G2GA 2WQPA 2IKIA 3K13A 2W92A 3TJLA 5C2CA 5H6HA 4IP5A 2C71A 1Z41A 1KV8A 1DIOA 3KLKA 4O0KA 4PMVA 2X2YA 4ZO9A 3F5JA 2Z29A 4NAEB 2XN2A 2C1GA 4JFVA 4MNLA 1E55A 1VH7A 4XD4A 4WCJA 2CZEA 2POZA 3AJXA 2WK2A 1TPWA 3ZFHA 3RF9A 3VDBA 2XVPA 3CZEA 4HHPA 5FCZA 4BS0A 1VYPX 4Y9NA 3IEBA 1GWJA 3H4XA 3QM3A 2DT3A 4I5UA 3S8HA 5A6BA 1MEIA 4E8GA 5AVHA 7TAAA 5IM51 3TAKA 1JYNA 3CB8A 1PIFA 4MLRA 3VPLA 4H7VA 3VIGA 2Q3OA 1O1ZA 5CBIA 3EDEA 1ZU8A 4ZB5A 3MQTA 2BP1A 3W1MA 5A8MA 1E0WA 4JTIA 2BWGA 1ZB5A 5CBJA 2OKOA 3L9CA 4Q4OA 1QI3A 2V67A 2PI6A 1QT1A 2EAWA 2D0GA 4HOXA 4IFRA 1XLBA 1KFEA 3THQA 4B16A 3OODA 3OJGA 2J9YA 3BLOA 3GC5A 4MY8A 1QASA 5KZ6A 2OLHA 3SUWA 3MY9A 1V4YA 2FQIA 1NQ6A 1XDLA 1XDJA 1UR9A 5AC8A 1EJVC 4RDZA 1FQ0A 4IPJA 4M24A 3WLKX 1FH7A 2QCHA 3W7KA 3E0LA 1E4MM 2INFA 4QFUA 2O4QA 1NWTA 1S2CA 3TA9A 3EDDA 3KOFA 4KBXA 3ARPA 1JZ6A 3UYIA 1F6PA 2PBOA 4DM2A 1P6CA 4GK8A 4IMFA 4JKMA 4J3WA 4BY3A 3LRKA 1PIGA 1MW3A 3LV6A 2A3HA 5CZTA 4YHGA 4HN8A 3EXSA 1TPVA 3PZTA 4JKKA 2WV8A 1XX1A 4W5UA 1PL9A 3ABQA 4KKXA 1YBQB 4HJWA 3UQNA 2Z2UA 3TW6A 3FCPA 3ZR4A 4P8XA 3QGVA 2ZA2A 3IJ8A 3PHAA 2ZWZA 1UKSA 3GDRA 1XG4A 2CLOA 2GFTA 5G5IA 4KWWA 4QE5A 3W24A 4RE2A 1E1CB 2QCFA 4MWAE 2ZUTA 3T40A 1JAEA 4INFA 1LCOA 4NF7A 4R3UA 4F9JA 4IPNB 3WMLA 2H90A 3EA2A 7REQB 3OVPA 4LRTA 1AODA 4F3HA 1J6PA 1DWHM 2VEIA 2J7CA 1FDYA 1KB3A 1V3JA 4DJFA 3N3TA 1R3TA 3WENA 3M4HA 3W6YA 1UD4A 1PWMA 1U33A 1TV8A 3BGJA 4ZBCA 2Q09A 1ZJBA 4QR6A 3VE7A 1BQCA 1NF0A 3PNUA 2YDAA 4JYEA 2Z1VA 4Y8EA 3V7PA 3IUIA 2ZRWA 2P76A 4MIMA 4KPLA 2NXGA 3ZJ6A 4LAMA 3GWQA 4ADSA 4OTKA 3W86A 3EOOA 5T9CE 4NP7A 3SGZA 1SFJA 2NWSA 3KL3A 2H9AB 3GIYA 2FVMA 1E5NA 3M0MA 1DHPA 1BTCA 1Q7MA 1A80A 1XYMA 3EMZA 4QG8A 1PX8A 3BURA 4HT3A 3QYQA 5M2FX 3F03K 1UD5A 3TYBA 1B5TA 1L8PA 1OYCA 2XTKA 1D8WA 1OFQA 1EGZA 3UWUA 3NZ1A 1K8CA 2VC5A 3W6LA 1W17A 4HGXA 2XDFA 3FEMA 3U57A 2NV1A 1JEZA 1FHUA