3W87A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-103
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
b'SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-103
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 104
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w87A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w87A01
3M5VA 1H7WA 5HINA 1F6PA 4UIOA 3P5ZA 4UC5A 1XBZA 1V7YA 4WQ6A 5F2IA 2GVJA 1F76A 2E6FA 4O1CA 2NV1A 2ZRYA 1PV8A 1RVGA 5F1UA 2TMDA 3SR7A 1O95A 4HSOA 4GWEA 3B04A 3EX2A 5AB3A 3F4NA 1HO4A 1PCKA 1WQ5A 3LBMA 2G5WA 2DJXA 2DZUA 3MUXA 2Z6IA 4A29A 3ZR4A 1FWSA 3LV5A 3ZFHA 3KAOA 1AW5A 2G95A 4YCOA 3RMJA 1ME8A 1LRQA 1IXQA 3UXAA 1TPB1 2FPVA 4O52A 4PA8A 4PL1A 4JXCA 3BGGA 3E9AA 4JTHA 1JRBA 1XC4A 5CZ0A 4GUHA 2Y7DA 1O5KA 4RJEA 4EIVA 4FB7A 3CEPA 4NNCA 4CCDA 1OG0A 1LCOA 1KTBA 4M7TA 2ABBA 1HTIA 5AHMA 3DFQA 3FJ6A 2YYUA 4NXKA 1Z44A 3M44A 3SECA 1KM0A 3GDTA 3KRUA 1TTPA 2V0TA 4ZQRA 3BG9A 3GDMA 5GVJA 1DORA 4BK9A 3TIMA 2QDGA 4LVAA 3UNDA 4NT0A 3R89A 3G1XA 3WJZA 5C6MA 1SZGA 1XI3A 1P5BA 2XFWA 4JTLA 1R2RA 2VEMA 4D2JA 2NV2A 4ZMGA 4IX0A 3QQ0A 3E0IA 3LXBA 3NXFA 4GE8A 3NM1A 1WAUA 1ZAIA 5TBOA 4M19A 5BNKA 3TFCA 1QWGA 2A6LA 4JTTA 4I7WA 1H1YA 3GR8A 3VNDA 1RV8A 1VCVA 1H7XA 4LVBA 5D30A 4AHPA 4MFDA 5HQEA 4Z1AA 5K4XA 4XTIA 1T99A 1PL9A 1KM2A 2CFFA 3MYPA 4JR5A 1JULA 1GYLA 1TO3A 3HGJA 4NX5A 1VH7A 3AO0A 4CCCA 5CSSA 5LNRA 1WA3A 4P2VA 2QAPA 1Y0EA 3PM6A 3WK2A 1TPVA 1JQVA 4LS2A 3W7PA 3TNOA 2KZHA 4O28A 5KZEA 2B7PA 2FQIA 3E96A 3STEA 3DENA 1WOBA 2V9DA 3JS3A 3W9ZA 5AYZA 3YPIA 4NUWA 1JUBA 3NL5A 2ZTKA 2V30A 3PSWA 4FNQA 4MLRA 4DXVA 1KLYA 1FCBA 5EYWA 4EWND 4DQWA 3G1AA 1DJNA 2W0UA 3C8FA 5D09A 2PRLA 3CWNA 4XBKA 3PF3A 4P61A 3W1AA 3ANYA 5MHBA 3O6YX 3OVPA 1M6JA 3SFKA 4UR7A 4DO5A 3P81A 1VRDA 1XCFA 4R7JA 3NL6A 3B06A 1O94A 2DJLA 5D38A 3SY5A 4WZHA 2E6AA 2TPSA 3HQ1A 5C5YA 1LP6A 5EL1A 1P4CA 3NG3A 1BKSA 2AQWA 1YXDA 3EWWA 2X30A 1QPOA 5D2TA 5AHFA 1Q6RA 4FX6M 1WOAA 3W70A 3WK3A 3MI6A 3AJXA 3TC7A 3UQNA 3UWWA 1QO5A 3INPA 3O8AA 4MJMA 4WXYA 4JTFA 4QQ3A 3B0PA 4UXDA 3FOKA 5HWJA 3NVTA 2C0AA 4Y96A 1YADA 4Y90A 3L65A 4TR9A 5IBXA 2FFCA 4FNUA 5CPOA 4GUJA 1IXOA 2RFGA 2E5DA 1GVOA 1JCMP 3LCXA 5HUPA 4BWLA 2EAWA 4MLJA 4JYDA 1EEPA 4E2BA 1SW0A 2V5BA 3G18A 1KFEA 3BGJA 3HG5A 4NJIA 1OF8A 2RDUA 3THQA 4C1LA 2A21A 4JEQA 4FNSA 2A6NA 3H55A 4N9CA 3NQAA 2QR6A 2JBMA 2C14A 3PR2A 2J27A 1VJIA 2I1OA 3PS7A 3K30A 3N3MA 3NPUA 5AC8A 1YYAA 3B0VC 2B4GA 4UFMA 4IMGA 3L0NA 1ADOA 1VLWA 1X8FA 3LX9A 3W7RA 1BWKA 1QDSA 3A9IA 2XN2A 3W7NA 1X7FA 1F7BA 1AL7A 3B4UA 4NZFA 1GG0A 3LCHA 3DFNA 2FPTA 3KXQA 1UUOA 3FJLA 4DF2A 1M5WA 4NJHA 3GXTA 3R12A 3S42A 3IIXA 3QFEA 1EB3A 4O11A 4UTMA 2OZ0A 2D73A 4DEFA 5ABTA 1ML1A 2IQTA 2Y61A 2J9ZA 4WOZA 1M7OA 2ZRUA 6TIMA 3TSDA 2WQPA 3QJAA 1SO4A 4JTJA 3LOTA 3PVFA 1LOLA 2WNNA 3W7QA 1EIXA 1W1ZA 1SZNA 3G0SA 3GNDA 1K7EA 5D03A 1ZALA 4FNRA 3CPRA 3P8IA 3H53A 5EMUA 2I9EA 1TQXA 2FJKA 3C2FA 3STCA 1D9EA 3OG3A 3W74A 4ZQPA 1C9DA 5SWUA 5AHNA 1YXYA 1GTEA 4RX0A 2GVLA 1LRTA 1OJXA 2Y7FA 5DELA 3RLVA 3VKJA 2FLIA 1LROA 1TPWA 2VFFA 4O14A 1XUUA 1TRIA 1BTMA 4RK8A 3NO5A 3SI9A 2C3ZA 1OX4A 2YW4A 1NEYA 4N9DA 1DBTA 3ATZA 4RZ6A 3TSMA 4BI5A 2FDSA 4OQVA 3EXRA 1R47A 3RFAA 3W7CA 3G1YA 4OE7A 1D3GA 1XL9A 3EWUA 4HHPA 4NZJA 2GQ9A 2A4AA 4POCA 2YGYA 3LHWA 2X1TA 4AXKA 3Q2DA 5LZLA 3QEZA 2E6YA 1SZEA 1LBLA 3NQCA 5TIMA 3NZ1A 3L66A 3FKKA 3SZ8A 2NUXA 4JTEA 4AF0B 1KFCA 3PB0A 2GQAA 2Y6ZA 2YW3A 4IXHA 5CZTA 3TMQA 4LTSA 4EOUA 4IMDA 1CW2A 1KM3A 4XZ9A 2RDTA 1FCQA 3OEXA 2NX3A 3DH7A 4UMBA 2X2GA 4K36A 4Y6GA 4TMBA 1VYSX 3F1QA 5IM51 3PBUA 3OVQA 3N14A 3UWVA 3NR0A 5K9XA 4QM1A 1PCWA 2VXNA 1ZAHA 1I2RA 1WYIA 1O60A 1TIMA 1W3IA 3MYOA 3FA5A 1PE1A 2H90A 1G67A 1QPRA 3PAJA 1OFDA 2Y7EA 1TV7A 5J5RA 4WY0A 5DXXA 3KVJA 3P61A 5LKYA 1JQXA 1I2NA 3NYZA 1PS9A 3RNDA 1JJKA 1NFBA 3L5AA 4WJEA 5G1YA 4ADTA 1GVSA 4AWUA 2NLIA 2ZA2A 4FX7A 1VQTA 3NQMA 1TQJA 3G24A 2FIQA 1DHPA 1OHLA 3I7RA 4WY0B 4JTKA 2VENA 3TFXA 3C4UA 1WXJA 1OF6A 3PY2A 4UTIA 1OFPA 5I3KA 4IUOA 4MIMA 3G1VA 3RK8A 3M9YA 5F4WA 3HG2A 1W5NA 2J9YA 4WX2A 3O05A 2CZDA 1F5ZA 1VR6A 2YXGA 2V81A 5HNRA 5KTLA 4JD4A 3W6YA 3W7MA 4MY9A 3EXTA 1JUKA 3NPVA 1UCWA 5KMYA 4J9JA 1KV8A 2CWNA 4NJKA 4OBTA 2NUYA 2VFDA 1FY6A 2WKJA 4JYEA 4ZQMA 2BZNA 2YX0A 1J2WA 3QM3A 3DKLA 3GIYA 1EP1A 4IPJA 4WD0A 4IQLA 4ZQNA 2VKZG 2CU0A 4YXGA 2TSYA 1IGSA 1C29A 3MI3A 4RR4A 3BPWA 3L9CA 5AFDA 4RV8A 4OWGA 1OFQA 2ZQ0A 5LHFA 3IVUA 1YTDA 2NWSA 3GDKA 3R2GA 4HIBA 1W3NA 3G3MA 3LHUA 4IGHA 1H1ZA 1SUXA 2X16A 4PH6A 1B57A 3P62A 4Z1CA 1VCGA 5D05A 1SFJA 4GFSA 3NPXA 2DORA 1O4UA 2GJLA 3S5ZA 3QPZA 3A24A 3GVGA 1PHQA 1W5PA 4BR1A 2G96A 1AL8A 4JYFA 2CLIA 4IJBA 3GZ3A 1OFBA 4NVTA 3I7QA 4MZ1A 1FQ0A 2A0NA 5TQLA 2TRSA 3C2OA 4Z0SA 4PL2A 3PUOA 4DELA 2AAMA 1H7RA 1YTEA 4QJ1A 3DI0A 3DZ1A 1H5YA 3LHYA 3LRMA 3UZJA 4YMZA 1DVJA 3W7JA 1WBHA 1OX6A 4JDYA 3P67A 3DU0A 3HPZA 5LHEA 4GC4A 3NQ8A 5AYYA 3MBFA 3IVSA 4A2RA 3QPYA 2FB2A 1G4PA 2BXVA 2CZEA 3W2NA 3P84A 4UR8A 3NQEA 1LDCA 3T55A 4O53A 5FF4A 4ALDA 4LVGA 3S1UA 4JICA 2ISWA 5F4XA 2QCLA 4UMCA 1W3TA 2QJHA 3BARA 4JTSA 1S3HA 5AOUA 1G4EA 2FTPA 3M1ZA 4QSHA 3W7KA 4FHAA 3EEGA 2V82A 3VFLA 2C19A 2YPIA 4QNWA 3P74A 3W7EA 2Y7GA 1YTKA 1H61A 2V5LA 4ZZ9A 1KA9F 1X6UA 1XDMA 1YPFA 4UTWC 2VFIA 3LLDA 4MJZA 4K6AA 4PODA 3TKFA 5HMSA 4FXRA 4EVZA 4PTNA 1GVFA 4JGDA 4LUJA 2E68A 3FKRA 3TAOA 3GDLA 1KM5A 3D0CA 3QMTA 1NAL1 1YDNA 3UWQA 3GAKA 3TK7A 3W2MA 3NZRA 4AAJA 4Z08A 4ZL1A 2BTMA 2DP3A 2QCCA 3N19B 3TCEA 4KFPA 3NQ6A 1A50A 2Q8ZA 1Q45A 3WFAA 4DO4A 5LNWA 5HUOA 1BWLA 3NAVA 2Z1BA 4LOCA 2CW6A 1Z42A 3TV8A 1THFD 3UY8A 1H60A 3NOEA 3S9YA 3W76A 2ZA1A 1KTCA 4IOTA 2DZSA 3B05A 2NXHA 3KHJA 3NQ7A 1S5WA 3MHGA 1LORA 3EX4A 1QOPA 1HUVA 2E09A 4WUIA 2CLFA 3BG5A 4WXZA 1P0KA 4GJ1A 4FXSA 3SW6A 2ZRXA 2B7NA 4IMEA 2H3DA 2LLEA 4UTJA 1H63A 2ZBTA 3LHZA 5E1QA 3S1XA 3G0UA 2QCDA 2DZTA 1G4TA 1X1ZA 1G7UA 3TU9A 3DXIA 4JTUA 4KWVA 5DXYA 2CLOA 4XQ6A 1GVRA 3M47A 1TRDA 2GPTA 2H3BA 4FF7A 2Q3OA 5CG7A 3ZWTA 4E0CA 3NQVA 1H50A 5U4NA 2QCDB 2QJIA 5EPDA 4S2CA 3DFTA 3G0XA 2CLEA 1ZENA 1TB3A 5L6UA 3W1LA 2O7SA 3IGXA 3W2UA 1OFRA 2VFGA 2X1SA 4FIRA 1MZHA 3VI2A 2JK2A 3W7DA 3A22A 2QAFA 4AHOA 4RLIA 2B7OA 1XDLA 4NNBA 3U2OA 4MYAA 1EA0A 3MJYA 4PCFA 4CNNA 3NEVA 1LZOA 1XBXA 4X2RA 1N7KA 1A5SA 1TCDA 4N9BA 4PC8A 2DZPA 1AG1O 4C1KA 2EPHA 3PSVA 4UTLA 3LCFA 5D2WA 4Y8FA 5K3VA 1FWNA 4TIMA 5BRBA 4O18A 5F2MA 4O12A 1XFBA 3ABOA 4Z1BA 3WJYA 1UBSA 5K7JA 4XUGA 1T8XA 4ZQOA 1GTHA 5D04C 1ZY9A 1XBVA 3QMRA 3TC6A 3USBA 4UTTC 1QPQA 1HG3A 1ZNNA 1F05A 1RPXA 1QCWA 3C56A 5FF2A 1TREA 1TJRA 3UXDA 3TA6A 2QF7A 1UB3A 4GUIA 1GZGA 1UASA 4AWTA 1KM4A 1JR1A 1P0NA 1SSGA 4TO8A 3HGOA 5F4SA 4EF8A 1LBFA 1U5JA 5DY2A 4AWSA 2R94A 5HULA 4FEZA 1LYXA 4UFIA 4QAIA 4CLMA 3NPWA 4PFMA 4WY0F 1KM1A 3IV3A 1DQWA 4LRTA 3W7HA 3M7WA 4BI6A 1ICSA 3E02A 3KX6A 5AHEA 1H7OA 3GNNA 3IIOA 3CT7A 3TX9A 2X1RA 3BW3A 3STFA 1D3HA 4DF1A 4UTHA 4UNKA 3MI2A 1XXXA 2GJNA 1ICQA 3GK0A 2R8WA 2J9XA 5I3HA 4X3ZA 3TSBA 1F6KA 2CZFA 3BW4A 2C15A 1FUYA 1KFKA 3LDVA 3NL2A 1IF2A 3QF0A 3P60A 1FDJA 4N4PA 4NNAA 1MXSA 3O1NA 2PRHA 1H62A 4O4WA 5D32A 5G1TA 3P7YA 1TPC1 3M43A 1Z48A 3W1XA 3HB9A 4NU7A 1JCJA 2P10A 3OBKA 4MFEA 1PVNA 4O1AA 4AB4A 4IPIA 5LSMA 1G69A 4O10A 3GB6A 2GUUA 3LB0A 4HPXA 3MW7A 4UTTA 1GOXA 3CIXA 1YXCA 4HSNA 4LS1A 4HNUA 1UJPA 4ONVA 4CNPA 1LBMA 4AEOA 3HPXA 3IIVA 3PWAA 4ORIA 1RQHA 3CQ0A 4UMAA 2R91A 1EPXA 3BO9A 5A5WA 3SSJA 5H2ZA 2H8XA 2BX7A 4M6PA 4LS0A 3M5XA 2EHHA 1H7PA 3W86A 3BVJA 3C0JA 3EWXA 5CPNA 2EGZA 1I2PA 3EWZA 2ATMA 3P5YA 1XBYA 3FFSA 3SGUA 3ABRA 2B7QA 2VOMA 3QW4B 5KSWA 3N73A 1IXNA 3PC0A 2RDWA 2J6XA 3HIJA 1OX4B 3W23A 4JX6A 4LC8A 1BEUA 1YDOA 4HPJA 3MO7A 2HTMA 3CM4A 2ZZ4A 2F7FA 4A3UA 4UTKA 3IRDA 2V8ZA 5LNVA 2Y88A 3WK0A 2NWRA 3CC1A 3IEBA 4X22A 1GYNA 5DCEA 2QUUA 3QMSA 5I3GA 2ZZ2A 5KZDA 1MEWA 2F84A 4UFHA 1GWJA 1KV5A 3S1WA 3O07A 4DPPA 5FF3A 1H51A 3T4CA 4CQAA 3NGJA 4RKAA 2H8ZA 2QJGA 5G2IA 3DFSA 4GNJA 3GAYA 3I6RA 2A5HA 2YR1A 3L68A 1DKWA 5DCBA 3HGSA 5CZSA 5T26A 5FF0A 3Q58A 4Z0JA 4Q4KA 4S1FA 3G1SA 1EX5A 2DZXA 1VGAA 1W5QA 2E6DA 1OX5A 1I45A 2P1FA 3QRHA 4MVAA 4HNVA 1W8SA 5H91A 3Q37A 3GDRA 2P0OA 3EX6A 3FEMA 3NM3A 5LNUA 1VC4A 4ZVJA 2WSYA 1V5XA 4M5PA 2NXIA 4A21A 2GOUA 3TXZA 4AH7A 1W31A 3ABQA 5HWMA 4QNEA 1SU5A 1OABA 2QCEA 4O17A 1X1OA 2EKCA 2YFNA 4OU1A 3QC3A 1JCNA 4NX0A 1K8YA 1WBJA 2PE4A 2WSRA 3W1NA 4MYXA 2QUVA 1KW1A 3LCWA 2OX1A 3W7LA 4O15A 1VHNA 3B03A 3NQGA 3LCLA 1FBAA 1W5OA 4O1DA 1Q6OA 3TQKA 1GVQA 5LGZA 4H6KA 3LTSA 3W7IA 3H54A 4GRSA 3O16A 4MKNA 3LHTA 3WJXA 2ZDRA 4DO6A 1KBIA 5K2ZA 3HGRA 3KOFA 4JX5A 3MHUA 2RH9A 3QW3A 1N55A 2JKAA 1B4EA 1A5CA 2GQ8A 5CZJA 1TSIA 3A21A 1LLWA 1A5BA 1RD5A 4O16A 1R2TA 1I2OA 3OA3A 2VC6A 3VE7A 1FDZA 4JTIA 2CLHA 3TDFA 5DY3A 5C55A 2QDHA 2A7PA 2V2CA 3DAQA 4N9EA 1J4EA 3FYPA 1RR2A 4HNNA 4X9SA 3KVKA 1R30A 1CI1A 3M5YA 3P82A 4HNTA 5G2WA 4FIQA 1IXPA 1K8XA 3N34A 3BV4A 3DI1A 3LHVA 3LXCA 3DHFA 1OFEA 5C2XA 1WV2A 4K39A 4K38A 2ISSA 3NQDA 4FNPA 5EY5A 3IIPA 3NQFA 4XWUA 5D37A 2ALDA 2ZZ1A 4CCEA 4GUFA 5EKYA 3EWBX 4RZ4A 2HS6A 2QKFA 4O19A 4FNTA 3SGZA 4LNYA 2C6QA 1MO0A 3W85A 3A23A 4DF0A 3LI1A 3HJZA 4LVDA 3BLIA 3G1DA 2QCGA 3ELFA 2OCZA 1SO3A 2YDAA 3BW2A 1QMLA 4O1BA 4N2YA 3TQ0A 2WO5A 4MY1A 3QZEA 3N9SA 4N6EA 1QFEA 2DZVA 1FDYA 1VS1A 2E5BA 2BWGA 5FEXA 1QAPA 1DJQA 3CWOX 4U28A 4OGZA 4LC6A 3LRKA 5BOOA 2HMCA 2WV8A 3L0KA 3OIXA 1Q6QA 4LUIA 3I7SA 1RQBA 2YZRA 3FS2A 3LV6A 4N6FA 2VFHA 3G8EA 3EX3A 1TPFA 4YL2A 1GG1A 5EBUA 4NJGA 3C2EA 5FEWA 1AW2A 5AC6A 2A2IA 1G6CA 1K7FA 2NX1A 2ZZ6A 3R8RA 4LW7A 5F1VA 4L4LA 3LM7A 4E2DA 1K7XA 3W1TA 1KFBA 1W54A 2WJZA 3GKAA 3KVMA 2ZYFA 5F2LA 2ZTJA 5A8GA 1SW3A 4JY8A 3G22A 3KVLA 3F4WA 4AHQA 3G1FA 4IWWA 1ZJIA 5F2GA 3W1QA 2C1HA 4LU0A 4E38A 4JS3A 1ZCOA 4LY8A 4XTDA 4TMCA 1FWRA 2A1YA 2BSLA 3LBCA 3W72A 3Q94A 1TYGA 1SW7A 1ZHAA 2PC4A 2VEKA 3NDOA 2EF9A 2Z2UA 2AGKA 1VHCA 4LV4A 1C8VA 1TPUA 1JCLA 2DU2A 4UUIA 5D33A 4WOQA 3PUDA 2W6RA 3JR2A 3NNTA 1FCUA 5KITA 2PRMA 3L21A 1A53A 2C18A 1L2UA 3SIZA 1QR7A 1TPDA 2OT0A 3HF3A 5I3IA 1QNVA 3MWAA 4Q32A 3T40A 5E93A 3C6CA 3S0CA 3VCRA 1NVMA 2R14A 4FO4A 1VLIA 1G7VA 4K7YA 3W2LA 1OK6A 5HR6A 1MEIA 3DGRA 4MUZA 1ALDA 4R33A 2Y62A 3TXVA 1N8FA 4XKYA 4YCPA 3MP3A 5K9CA 1SSDA 1FCVA 4CQ9A 4H4IA 4A2SA 4OV9A 3TJXA 1OYAA 3UYCA 5IBXC 2DZWA 1DV7A 5DCDA 3IGUA 3LGEA 5U7SA 5DBUA 1SPQA 4R53A 2YCEA 4LRSA 4YLWA 3FYOA 3W3OA 1XUZA 1SFLA 1VYRA 1LOSA 3M16A 3O15A 4BWLC 1JUEA 1AW1A 3U8GA 1MEHA 3I68A 4M6QA 4XKYB 5HR7A 5DBTA 1WX0A 2ATSA 2V2DA 5G5IA 4H3DA 2ABAA 1EWDA 1Z41A 2NZLA 4JN6A 4LWWA 1ONRA 2PURA 4AVFA 4OHQA 3M5ZA 1JCXA 4Q33A 3JRKA 3TUUA 3KRSA 4DBEA 3W87A 3W1RA 4UTWA 2E5CA 4AMAA 1EWEA 1IIHA 2XN1A 3O6CA 1FXPA 2Z6JA 2H6RA 1FWWA 2YYTA 4LVFA 3PBYA 3W73A 3TH6A 3G3DA 1KBJA 3STGA 4NJJA 3WJSA 4ML9A 5CGQA 3TE9A 3C61A 4MY8A 4IMFA 4MPQA 5HJLA 2QCMA 4IX2A 3T78A 3LXAA 1R46A 3S8HA 3OVRA 3UD6A 3S5OA 4IMCA 2ZCGA 1TPEA 1L6SA 5G4EA 5LNSA 2GVGA 4NQ1A 2RHGA 4O57A 4ADUA 3TW6A 4O13A 2ZZ7A 1PIIA 2J88A 1Q3NA 1GJPA 3HG4A 4MZ8A 3DFOA 1SO5A 5LGXA 1JCYA 1DL3A 5FI8A 5FESA 7TIMA 2W79A 1HO1A 1L6YA 5K9DA 4I7VA 2A7NA 3HPSA 1NF0A 3PG8A 1EUNA 1S5VA 2WNZA 1SZFA 2YFOA 2Y85A 1YDVA 1B4KA 1GPWA 1CX9A 3TROA 4K37A 3FLUA 3UWYA 3EWYA 4RCXA 3EKZA 2QCNA 1L9WA 1F2JA 4GXMA 4ADSA 1YPIA 3G1HA 1I2QA 1H7NA 4UTUA 3LLFA 5AHLA 5I3FA 4O50A 1U83A 4ORMA 3LCIA 2G97A 3ZWSA 3W75A 1QPNA 1B9BA 5AC7A 2WSQA 4W9TA 3TW7A 3O6DA 4RZ5A 5J5DA 4JIQA 3CU2A 4EF9A 3TMLA 2CLKA 1UUMA 2FB3A 5D2VA 3TJLA 3S1VA 2J24A 1SO6A 3VE9A 3HMJG 4UFJA 3ATYA 3IIZA 3CB8A 1PHWA 5EA9A 1ME7A 5K4ZA 2ZZ5A 3IGSA 4S2BA 6ALDA 2JKPA 3LTPA 1DOSA 4JY9A 3KRZA 2ZRWA 3PBWA 4MOZA 1I4NA 3GX9A 4JIPA 5G2HA 5BMXA 2XN0A 1KFLA 3CLMA 1E51A 2OMAA 3BK0A 3BLFA 4N4QA 5FF7A 1A5AA 3N2MA 2ZRZA 2NUWA 3UWUA 4K7VA 3E49A 1W5MA 2C16A 1TTIA 3TR2A 3O63A 3S5YA 2BLEA 3A5FA 1K02A 4I9AA 4ZQCA 2JGQA 3NL3A 5L9FA 3E12A 2FPYA 3HG3A 1AK5A 5BW6A 1HL2A 3W1MA 1B3OA 5AHIA 3PG9A 3GXPA 5D02A 1TTQA 4G1KA 3N9RA 4O54A 2E1DA 1M7PA 1QOQA 4JNMA 3HBLA 4MZYA 3C3NA 4BI7A 3G8RA 3LERA 4KFOA 4ICNA 4K8HA 3M41A 4CQ8A 4Y9AA 1KFJA 3R13A 1LOQA 2Y63A 2RKXA 4LV9A 3IVTA 1LM1A 1VCFA 2ISVA 4O4VA 1W37A 2A7RA 3C2VA 1GT8A 4N02A 5BMWA 1ME9A 4BFAA 2ZA3A 3QH2A 2ZZ3A 4TX9A 3U6WA 1S5TA 2OT1A 1ICPA 3QYQA 1XKYA 1AMKA 3M6YA 3S5NA 1XM3A 4QIUA 2Z0IA 3CIWA 4XBSA 1NF7A 4PEKA 3DBPA 3PBVA 4M6VA 3WK1A 1K03A 3FIGA 2UV8G 5D2YA 2WOQA 3C52A 3CHVA 2CLMA 4HN4A 3T7VA 1W56A 4DPQA 1OFOA 1OYCA 2I14A 2O7QA 4O0KA 3F03K 4GBUA 4O8RA 3EB2A 4LT9A 2ZFAA 4OT7A 3BG3A 4HT3A 1F74A 2WPBA 3I65A 3C2RA 2ZRVA 5C54A 3W22A 4R34A 4OV4A 3W7OA 4Z1DA 4HKPA 3W88A 4NXSA 3M0ZA 5CPLA 4AF0A 3QSTA 1KLZA 3CTLA 4JDBA 2TYSA 3MBDA 4M7SA 1K8ZA 2NXGA 3W2JA 4I7UA 4UNLA 2YSWA 3L5LA 1R2SA 1RZMA 2QCHA 3RF9A 1WDWA 1G4SA 1JVNA 3EKLA 4B5NA 3UPWA 3QSRA 1F73A 3W1PA 2OJPA 4IXXA 4UCGA 5FEZA 2WNQA 1ZAJA 3HOJA 1IIGA 2JGYA 3UY7A 3LRLA 1FWTA 4L4MA 4BF9A 2JKEA 2Q8LA 1ZFJA 2Q3RA 3EX1A 2E77A 3W1UA 3MMTA 1LLZA 3W7GA 1FX6A 1VZWA 2VEPA 4DBDA 1I8JA 3MP4A 1TMHA 1YLVA 3KFTA 4KKXA 3UPBA 1J5TA 1SR9A 4K8EA 4QITA 4FX8A 3ZS4A 1TV5A 2HS8A 1FXQA 1KTNA 2X1UA 3BLEA 3S6DA 5HWNA 3DHDA 1LTDA 3UZ5A 2VELA 3LCGA 2QUTA 3OHIA 5FEPA 1EP3A 1K3UA 3LI0A 5D2XA 2QEZA 3CEUA 4U4MA 3RLUA 3GXNA 1QO2A 4KWWA 3PUEA 5AYXA 4O0ZA 1T96A 3EXSA 1MSSA 3W07A 3QQ1A 3RU6A 2C13A 3UWZA 1Q6LA 4JTGA 3PB2A 2VEIA 4JX4A 5KINA 3THAA 3TAKA 2PCQA 3L67A 3V75A 3B0UX 3MHFA 5I3JA 1NSJA 4QISA 5E0KA 5G4WA 1EUAA 4UFLA 1DQXA 1GQNA 3L2IA 1L6WA 3B8DA 3L0GA 3W71A 2V2HA 1W0MA 3T44A 2Y70A 1OVDA 3L5MA 3ABSA 1OK4A 1GEQA 3GR7A 1P1XA 4TU1A 1KM6A 3O06A 5CPMA 2B0MA 1EP2A 2HSAA 5DLCA 2QCFA 4GUGA 3DFPA 2Y89A 3N2XA 4UFKA 5CSRA 4KFNA 3P8JA 4RXGA 2CLLA 1VYPX 2A85A 3LTYA 3GKFA 3GYEA 3W83A 5CKSA 2NX9A 1TTJA 5AN7A 4A22A 3R5EA 3A5VA 1T0OA 3W84A 1OFAA 2CZ5A 3NQ2A 3PULA 3V1PA 3P80A 1RQEA 1VPXA 3DKJA 5KZMA 3HO8A 3SJ3A 2VFEA 3MP5A 3WJWA 3GLCA 3TQVA 1TJPA 1O5XA 1HFBA 1TV8A 3W2KA 4CNOA 4YWIA 5DN1A 1JRCA 1LRNA 3NA8A 1SQ7A 8TIMA 1TPH1 4RXFA 1OYBA
chains in the Genus database with same CATH superfamily
3M5VA 1PWMA 1EC8A 1SJAA 3RILA 3UXIA 3WDPP 4UIOA 4IHCA 4GFIA 3QY7A 3MSDA 4UCFA 1VFLA 4UQBA 2NV1A 3B8IA 3LY0A 2ZRYA 1PV8A 2C8NA 4MDPA 2PDPA 3FK4A 3C5QA 2TMDA 4RE4A 4QROA 1KGUA 3EX2A 5A8OA 1R3TA 3GY1A 1PCKA 1UOKA 3E1F1 2DJXA 1P7TB 3MUXA 4OUEA 1GJWA 1V6UA 5H6HA 3KAOA 4YCOA 1LRQA 1TUFA 4LYQA 2HZGA 4S3BA 4S3JA 2D3NA 1R38A 3PZQA 1UZ4A 1R0MA 4RJEA 3WQ5A 4FLQA 4NNCA 4CCDA 1KTBA 4M7TA 2CKSA 1HTIA 1ONEA 2ESCA 3DFQA 2ZX9A 4ZFCA 3JZUA 1KM0A 4X61A 3NUKA 1TTPA 4QDPA 4GVFA 5IFTA 2GDVA 1GOIA 3UCCA 1DORA 3VGBA 3S83A 1E6ZA 2QXWA 3UNDA 4NT0A 3G1XA 2E28A 5DRCA 1XG4A 3S9IA 5C6MA 1P5BA 3CAWA 4AZCB 3EDJA 1WAUA 1E0UA 3GYCA 3ZT5A 2YDSA 2A6LA 4JTTA 4I7WA 5BOEA 3MV11 1H1YA 4QRNA 2OO6A 1RV8A 3ZZ1A 5C9WA 1YDYA 4Z1AA 3T0AA 3XINA 1A47A 4EKJA 3BAKA 3MYPA 2NVDA 3AIRA 1XLKA 4AUBA 1GYLA 1BPLB 1TO3A 2J8FA 3GBEA 1SR0A 1IR1A 5E6YA 3QV7A 1R9YA 1KD0A 1P0DA 5LNRA 2PGRA 4P2VA 2QAPA 4K1GA 5C2GA 1IHIA 3WK2A 4GINA 1MQQA 1VFTA 3TNOA 4O28A 5FIPA 3RM4A 4XZMX 3E96A 3STEA 4EXAA 3V4BA 3JS3A 2ZX8A 2VD8A 4BEUA 3YPIA 3NL5A 3MVIA 3UR2A 1GW9A 2V30A 3V0SA 1KLYA 3LMYA 5EYWA 1OZMA 3BDKA 4GZJA 2FTWA 2W0UA 2PRLA 3CO8A 4PTMA 4YPJA 3EPMA 2W63A 1XP3A 3OVPA 4UR7A 1P6CA 3RPTA 1XCFA 4R7JA 2C71A 1WCGA 1GONA 3SY5A 2E6AA 3BOFA 2CHRA 4HB7A 4F0KA 1AMYA 3NG3A 1QWKA 1A3XA 2X30A 3I6EA 2F2KA 5AHFA 2OQHA 4FX6M 1WOAA 3W70A 3MI6A 4AD0A 1BWVA 4HPHA 3M0IA 4DZIA 3O9NA 4Z2IA 2BHYA 4GOAA 2CWXA 1FWDC 3W81A 2FFCA 3KZSA 4AVNA 2J47A 3R6IA 3EOSA 4C65A 5HUPA 3RR1A 4MLJA 4E2BA 2INZA 3HG5A 4NJIA 3SCOA 3THQA 2R1KA 2PDFA 4JEQA 5CC5A 2Z27A 4Y7EA 1ZBCA 4FNSA 2A6NA 4PUEA 1KGWA 1Z6KA 2WHJA 3MA8A 3ONCA 3NPUA 4AZ7A 1I0BA 1RY0A 1JGMA 1VPQA 3L0NA 3W7RA 3LX9A 4LYKA 1F7BA 2VURA 3WF3A 2GSHA 3B4UA 2ZXQA 4V27A 3LCHA 4MNMA 4YNGA 3DFNA 3K46A 5I2UA 3GW3A 2DSKA 3VC6A 2CNCA 4B5WA 1XKJA 4NJHA 8RUCA 4I6KA 3NIYA 3QFEA 3UVIA 3QPEA 1JPHA 2QUMA 3R25A 2Y61A 1E6QM 1NOWA 2O9TA 1U5HA 1NDVA 2BVYA 3AIQA 1KWGA 1EJXC 1UC5A 3QHOA 3TSDA 3QJAA 1SO4A 1DEDA 1RPKA 3W7QA 2DVTA 4G7FA 5D03A 3VD3A 3KWXA 2OZ8A 3S2NA 3TNBA 3H53A 1YNQA 3EDDA 3IJ6A 2W62A 2VRKA 3ZLHA 4AY7A 4QLKA 4B3ZA 1F4AA 4IFRA 5SWUA 3PPFA 4B5SA 4HU0A 3FDKA 3WNOA 5DELA 2EPLX 3FX4A 2FLIA 4KEVA 1P6BA 5A6BD 3UJFA 3GS6A 3NO5A 3EGJA 1OX4A 1IWAA 4LBUA 2ZUUA 5I00A 2Z1XA 1Y5XA 1DBTA 1OG6A 3ATZA 4BS0A 3CV2A 4RZ6A 2AQOA 3RFAA 1UP0A 1Q7QA 1C8YA 3QKEA 1Y5WA 1CGXA 3LSCA 4QEHA 1XL9A 4HHPA 3HURA 3IJLA 2WW5A 4TVCA 2X1TA 2ISFA 5FOOA 2IKHA 1A49A 2E6YA 2FGBA 1SZEA 1LBLA 2QW5A 1EXPA 1AH4A 3SZ8A 1KFCA 2TODA 4TQTA 2YW3A 5CZTA 2DQWA 4IMDA 3G77A 5AVHA 5H8PA 1CCWB 1CW2A 4YTRA 1ZP4A 1UG6A 2HBVA 2P8CA 3URBA 1FCQA 1B0IA 3DH7A 5DT5A 4TMBA 2Q6ZA 3URQA 1VYSX 3RRXA 4Q3MA 2CHOA 3PZGA 3OVQA 2XG9A 4PCPA 3N14A 3CPGA 4CU8A 3UWVA 5K9XA 4QM1A 4J35A 1ZAHA 5BU9A 3H2NA 1Y5VA 2PGWA 3KCJA 4KBXA 3S5SA 3V5OA 3VGEA 3WQGA 1B90A 1QPRA 1OFDA 5J5RA 4WY0A 5HAOA 2OWXA 1W1A1 3AC0A 1JQXA 2J77A 1K77A 3T0CA 1HVXA 3LZ5A 1PS9A 3K4DA 1JJKA 1NFBA 3L5AA 3NYZA 4WJEA 2PDCA 4AWUA 4GI6A 2ZA2A 1JI1A 4ZB0A 4ZO6A 3NQMA 3LM3A 4I9MA 4ZOCA 1R3RA 3THUA 1TIWA 1FA2A 3I7RA 4D1IA 3M0KA 3SSZA 2DGAA 3PY2A 3A3HA 2A3LA 2GSJA 1OFPA 1UYQA 1SJCA 1GCYA 3HG2A 5A69A 2AL2B 2CZDA 3ZO9A 3IV8A 4NZ3A 2YXGA 2O0TA 2V81A 3TTEA 3EWDA 1TMLA 3L12A 3W7MA 3SRFA 4ZE5A 3EXTA 1UCWA 5E0FA 5KMYA 2FFIA 4J9JA 3KTXA 2WKJA 2XWDA 4H8NA 1E6SM 1J2WA 3QM3A 1EP1A 1PTAA 5G4HC 2VKZG 3E0LA 4CVWA 4Q8PA 3UR8A 4HYVA 4E8CA 2XISA 2O9OA 3L9CA 4RV8A 1CGTA 2XIJA 4HNLA 3P2VA 4HYRA 2WMKA 3RU8X 3BCFA 3LUTA 3R2GA 2POTA 3G3MA 1OB0A 3F2CA 4IGHA 3WD4A 1SUXA 2X16A 3DFHA 4PH6A 1B57A 1VCGA 4GFSA 2DORA 1UROA 3QPZA 3K8LA 1TE6A 5A6AA 3IJ7A 3CZLA 3PTKA 4QLJA 2XM2A 5TQLA 4M29A 4AZ5A 3PZVA 2AAMA 3GDBA 1HKJA 3M0YA 1H5YA 4DNMA 4YMZA 1E0VA 3K1DA 1PDZA 3BXWA 4DX3A 1XLJA 3DU0A 4F9JA 3AIUA 5H8MA 5LHEA 2ANUA 4A2RA 1UP3A 1RALA 2Y5SA 1KXTA 2YCLB 1LDCA 3EOUA 3EYPA 3F2BA 4QDMA 3CB3A 3ZMRA 3BARA 4JTSA 5PTDA 1S2VA 2FTPA 3B97A 4KCTA 3HTWA 1JG9A 2V82A 3VFLA 4QR6A 4YU1A 3P74A 2EKGA 1YTKA 1H61A 2V5LA 1Q65A 1KA9F 1X38A 3FYYA 3LLDA 3DN5A 2J7HA 3TKFA 2F9RA 6TAAA 3V0TA 1W91A 3GAKA 3TK7A 3LZ3A 4AAJA 2PZ0A 3VOCA 3N19B 3TCEA 1QBAA 4QSFA 1BFNA 1A50A 2Q8ZA 4W8LA 5CLTA 4XD6A 3NDZA 2VC7A 2D3LA 2DY3A 1DWIM 1RVKA 3TV8A 1BG4A 1H60A 2QV5A 6REQA 2IW0A 3I4EA 2P5NA 2PFHA 4G7EB 3VIIA 4IG2A 1G5AA 3DBNA 3WL0A 1CGYA 4A35A 4NL1A 3MU7A 5AZ0A 3LHZA 3MKKA 5E1QA 2QCDA 4L5ZA 1S38A 1G7UA 4H2CA 4KWVA 7REQB 3IACA 1GHRA 5DXYA 2QGHA 2CLOA 2GPTA 2H3BA 4FF7A 1QNQA 4IQEA 3NQVA 4PCSA 3ITLA 3JVAA 2HK0A 4CNSA 1O7AA 4DJED 2CLEA 1MUCA 1NTHA 1KR0A 1ZENA 3H2MA 4B2DA 2ZOXA 5CC7A 2X7WA 2O7SA 3H2OA 3IGXA 5BWFA 3MMUA 3WD0A 1US2A 1MZHA 4NHVA 4CEUC 4KWOA 2JK2A 4DJEA 1FH8A 4AHOA 4WHBA 3MMDA 3GM8A 3U2OA 4HCLA 2XIQA 5I77A 4PCFA 4X2RA 2XHYA 4A3HA 3VIFA 1A5SA 3CAKA 3IWPA 4N9BA 4PC8A 1VD6A 2DZPA 4LALA 1AG1O 4C1KA 3PSVA 4UTLA 1DE6A 4H04A 3BCDA 4O12A 3WLJA 3ABOA 1U5VA 4WIWA 3K13A 4OFCA 3UG3A 4NF7A 4ZQOA 3MPGA 1ZY9A 3OBEA 2P3ZA 4JFVA 4QFUA 1HG3A 1W1B1 1F05A 1ZNNA 4FALA 1REQB 4D8ZA 3QTPA 4ZXOA 4NZ1A 1US0A 3MQTA 2AKZA 4UZSA 1GOMA 2HXUA 4GACA 1JCTA 2GK1A 3DFYA 5DY2A 3GC5A 4GLEA 4O8AA 3I3EA 5HULA 5A8PA 4XBJA 2JIEA 3NPWA 3IV3A 2DDXA 4BI6A 3KX6A 1LQAA 1VAHA 3C0SA 2X1RA 3TZNA 3T2OA 4DF1A 3GK0A 3MWCA 1TWWA 4NAFA 1KKOA 2R8WA 2Q71A 2EJ1A 4JL2A 1PKYA 1F6KA 2G3NA 2C15A 3BLPX 3D3AA 1FUYA 1KFKA 3LDVA 3NL2A 1ZSXA 3P60A 1HP5A 1JFHA 1ODUA 4NNAA 1MXSA 2ZADA 2HISA 1OQFA 1A3HA 4H7VA 2RJHA 4FZIA 2HEJA 1TPC1 3M43A 5GNXA 3OBKA 4RPPA 1CLVA 1ZBVA 3OQ8A 3P14A 4MFEA 1LLOA 4IPIA 4UWMA 1O5QA 3CIXA 4PMUA 1UJPA 1PTGA 2I16A 1J01A 1XQLA 5ECVA 3GVQA 2WSPA 3CXOA 1XLHA 4ORIA 1RQHA 4UZUA 4MG4A 4UMAA 4G2DA 2DFAA 5A5WA 3SSJA 1UKQA 2PDHA 4PFHA 4GHRA 4LAUA 3NTYA 2EHHA 3W86A 3BVJA 3C0JA 5CPNA 3CUZA 1PEZA 1I2PA 2ATMA 4QBXA 3BOXA 3SGUA 3ABRA 5KSWA 4FF5A 3N73A 2ZIDA 2DZBA 3IUDA 3CZJA 4S3CA 2JE8A 2J6VA 1FH7A 4H7ZA 4JX6A 1ZGDA 4LC8A 3TYCA 1JF5A 3R1ZA 1YDOA 3GU9A 2KAUC 2ZUTA 3TYAA 2ZZ4A 3FDGA 4A3UA 4UTKA 2WM0A 2NWRA 3CC1A 4IMAA 1DTNA 3GXDA 1MFVA 1MEWA 5KZDA 4TV6A 1BYAA 2Q09A 1QK0A 4JHZA 4L9XA 2XZ7A 1H51A 4PRWA 5G2IA 4GNJA 3I6RA 3UERA 3BURA 1MMFA 1DKWA 3H24A 4WSJA 3OP2A 4X2PA 3HGSA 1EF2A 1OEPA 2VX4A 4S1FA 4FR1A 2DZXA 3QC0A 2W92A 1W1VA 2E6DA 2RAGA 5I3DA 4B3KA 3WL1A 3Q37A 1AFSA 5LNUA 4U33A 4ZVJA 3FGCA 1V5XA 1TJ1A 1XRVA 3GXMA 4PE8A 3ABQA 4DJFA 4UQ9A 3L4XA 1MZRA 1MNZA 4UNIA 5LIUX 2YFNA 3QC3A 4TX6A 2D20A 2PE4A 3W1NA 1AZ1A 4YVVA 1M3UA 1SMAA 3W7LA 1XLLA 4O15A 1VHNA 4HZ8A 3LPPA 2YBTA 2XFFA 3AMKA 3NQGA 1W5OA 3AXMA 4O1DA 2BODX 3PK7A 1Q6FA 1RH9A 2ZDRA 4JX5A 3AMDA 3QW3A 1LL4A 3VX1A 3VDCA 3BC9A 5CZJA 1TSIA 2FVLA 1RD5A 2J7BA 4QP0A 2PMQA 1CTNA 1CB7B 4HA1A 4YTQA 4ERGA 1JNDA 2QDHA 2A7PA 2V2CA 4N9EA 3WBXA 1UWUA 4US6A 2PDGA 4GIRA 5BRQA 4MPKA 1DJXA 5G2WA 1CLKA 3N34A 2WC7A 3BV4A 1E71M 1VRXA 4H00A 3LXCA 3L4VA 1WV2A 3VUSA 2PGEA 4K39A 1R9ZA 3EWBX 1UQZA 1Q85A 4RZ4A 4NZCA 4O19A 4FNTA 4X0VA 4LVDA 3O0FA 3ELFA 4H83A 2ZC8A 1EZWA 4B15A 3HJEA 4O1BA 4MM1A 1WKDA 2XH7A 4N6EA 1L6GA 1QFEA 3E74A 3CWHA 2F6UA 1VS1A 2E5BA 3A12A 2AOSA 4OGZA 4OVXA 4IIHA 4KRTA 2F8QA 3AQUA 4BF7A 3FS2A 1SYTA 3TP4A 2VFHA 3H2EA 5EBUA 3GFZA 5REQB 4NJGA 3C2EA 4TVUA 5CSUA 1G6CA 1EIBA 2NX1A 5D9OA 3R8RA 1K70A 3AZSA 5F1VA 4E2DA 1K7XA 3W1TA 1W54A 3KVMA 3E2RA 3ECQA 1Y7VA 1Q63A 3IJDA 4ZO7A 3QV9A 4C6KA 1KRCC 3GU2A 3G22A 4AZCA 1WO2A 3G1FA 3P93A 4F2TA 4MB3A 4ATWA 3W1QA 1AA1B 3OHMB 2C1HA 2Z1VA 4LFYA 2PWFA 1V6XA 4KCUA 4OJYA 1ZCOA 1DHKA 2J74A 4LY8A 4XTDA 1R7OA 1FWRA 1F9CA 1E0XA 2FZNA 4AMCA 2WC3A 1TPUA 4UUIA 2W6RA 5KITA 1FWCC 1TPDA 4IIBA 3HF3A 5CXPA 1OD0A 3QY6A 3MWAA 4NKCA 4Q32A 5E93A 3SUWA 3VCRA 2UBPC 1O6IA 4FO4A 4UQAA 3QOMA 1G7VA 4K7YA 3W2LA 4AWEA 5I09A 1OK6A 3T0DA 5M3WA 3WIJA 4R33A 5EMMA 1NWTA 1M53A 1TWZA 4HYWA 4C6BA 1HN1A 5I06A 1TCMA 1TR1A 3MP3A 5K9CA 3M6DA 3H21A 3RDKA 1FCVA 4NI8A 4U10A 4A2SA 4OV9A 3DG6A 1DV7A 3RRAA 4A3QA 3GRIA 3LGEA 5U7SA 3FCPA 5DBUA 3W3OA 1XUZA 3VK5A 1MEHA 4M6QA 4WCJA 2WZHA 4PMYA 2V2DA 3U7VA 2ZC1A 4CN1A 1IWBA 1EWDA 4JN6A 4AVFA 3M5ZA 1EH9A 3O7UA 4D6HA 4GX9A 3KRSA 4DBEA 1M68A 3ARTA 4GH3A 1TELA 1EWEA 1IIHA 4E2OA 1CXFA 2ZUMA 2YYTA 1CT5A 3GNRA 1TZ9A 4W8BA 1G01A 1XIHA 3WKZA 4ILSA 2I17A 1XYFA 3LA4A 1VB9A 5T9CE 3WJSA 5EFFA 1J2BA 4PCNA 3T78A 3VMOA 1F61A 4PMVA 1E9ZB 3SADA 3UD6A 4WJ8A 1O12A 5CZKA 1TPEA 3BSGA 1L6SA 5LNSA 2RHGA 4ADUA 4BHYA 4AFYA 2ZZ7A 3RLGA 1PIIA 1ZBKA 4RE3A 1GJPA 1HW6A 3K8MA 4JTDA 3AAMA 5LGXA 1JCYA 4EACA 4WKAA 2A7NA 4NZ4A 1KKRA 1HGYA 2QF8A 1HKKA 5TAOA 4C6MA 2Y85A 3S46A 1UMYA 1YDVA 1B4KA 2XVKA 2VJXA 1CX9A 3KHDA 2GLKA 3EKZA 3VAVA 2JALA 4GXMA 3GO2A 1I2QA 1H7NA 4UTUA 5I3FA 3JU2A 4GQQA 3UG5A 4PYSA 4ORMA 1JDDA 4IPLA 3LCIA 2G97A 3ZWSA 2NQJA 1QPNA 3DUGA 1NQ6A 3GIPA 3RPDA 1KCKA 1DYSA 3O6DA 4RZ5A 4BCEA 5J5DA 3EKGA 4S3KA 4EF9A 3TMLA 1UH3A 3BZGA 2FB3A 5D2VA 1S1PA 3VE9A 4GYJA 3IIZA 4GO8A 4H41A 3CQHA 3AICA 1HJXA 1HZYA 1XLCA 1VFUA 2W66A 1V6TA 2XH2A 1T5AA 4XV0A 3PANA 3CLMA 3CHEA 2Z7GA 4MTVA 3TLLA 3O63A 2ZWZA 5BXPA 5L9FA 7CGTA 5E70A 4JNYA 2J79A 5CPTA 3B9EA 5D02A 3OG2A 4JKMA 4ZOBA 1QW8A 2E67A 4V1YA 1JEZA 3AYSA 2OWCA 1OT2A 1LOQA 3IVTA 4Q4QA 2ISVA 3HN3A 1GOKA 4W84A 1W37A 3THDA 1HGWA 2CBUA 3FVDA 1IEWA 1O66A 3BH4A 2ZA3A 3DYOA 1E6NA 2OT1A 1POJA 2DPEA 1QBBA 1MFUA 3M6YA 2YJQA 2H9AB 3CIWA 4PEKA 3DBPA 4WSKA 5HMDA 1K03A 3FIGA 3SCTA 3TOPA 4LXFA 3L4TA 4MF4A 1BYBA 3LBOA 4DPQA 1ZP3A 1K6WA 1OYCA 1X96A 3FHAA 2PDXA 3MUCA 3FAWA 2ZFAA 3BAXA 3BG3A 4HT3A 4A6GA 4DWSD 1O1ZA 3VIHA 4R34A 5LA2A 3P6LA 2NQ9A 3AU6A 4IQJA 4FOUA 1KCLA 3CTLA 2TYSA 1J0KA 4CD4A 1AVAA 3MV01 1KQZA 4I7UA 4UNLA 2QCHA 4XZLX 2OQYA 3FW6A 5ABEA 3EMQA 1MUWA 2DIEA 5ECUA 1DXIA 1XSJA 3TN5A 1RLDA 2WQDA 1NOUA 3LRLA 3H70A 2JKEA 3ARZA 1V6YA 1V0KA 3UJEA 3W7GA 4KMQA 1AJZA 4OBRA 1YLVA 3PFRA 2P88A 4P7RA 1J5TA 4J28A 3IJQA 4QITA 3CZEA 2JFEX 1W1YA 3DHDA 5IFPA 5FEPA 3KUMA 3OPSA 3CEUA 4KQNA 4C5YA 3TQPA 4JZ5A 1SJDA 4O0ZA 2WZTA 1MSSA 4ZCWA 1J5SA 3QQ1A 3W07A 3UWZA 1YKWA 2DT3A 4C60A 2GJXB 3VOJA 3BV7A 3THAA 3TAKA 3NOYA 2PCQA 5FACA 3V75A 1YBQB 3IARA 4EP8C 2X09A 1VFOA 3VD9A 3GBDA 4RE0A 5M2FX 4DLFA 3VKBA 3W71A 1PO9A 5JXQA 2NT1A 1VIWA 2GFTA 2VR5A 3O6AA 1B3YA 4UTFA 4C6PA 3AYTA 3ABSA 3N25A 1PJ9A 3WX7A 4AZHA 2ZDSA 3I4KA 2XTKA 2MNRA 5DLCA 2QCFA 3DFPA 2O4MA 2Y89A 4B3LA 2Q02A 1HIZA 1QW9A 3P8JA 4HHLA 4H19A 4OZOA 1SZRA 3N9KA 1U2YA 2DZAA 1TTJA 3PULA 5HPCA 7A3HA 3H4GA 3H8AA 2PWGA 3DKJA 4ERIA 3MP5A 3WJWA 4AD1A 4Q8MA 3II1A 4QQUA 3TQVA 1M7JA 2PF0A 1HFBA 5BXSA 3W2KA 1OSEA 2PUZA 4BZYA 3NA8A 1R87A 2X41A 1WKYA 5HMEA 3P5ZA 4UC5A 3FA3A 5F2IA 1ZBWA 1CENA 1E1CA 2E6FA 4F79A 1SJBA 3U0HA 2ZUSA 3W6MA 3ZJKA 4IIGA 1RBLA 3TTSA 1WQ5A 2BS9A 1EJRC 3LV5A 2YCLA 3UXAA 3RN6A 1TPB1 4O52A 4PA8A 1ZUAX 3SQMA 3BGGA 1HL8A 5CZ0A 1CGUA 1O5KA 3OW1A 4FLOA 4FB7A 4KERA 1OG0A 2E9LA 4QTGA 2ABBA 1H11A 3GTHA 2EG7A 2HQAA 3FJ6A 1JDFA 2JEPA 1W3JA 1UJQA 3M44A 4CNUA 1PDYA 3WQDA 3GDTA 3RITA 3SQLA 2G8ZA 2V0TA 1RSCA 4ZQRA 3BG9A 3KOWA 5GVJA 8XIMA 1Z8AA 4PEEA 1UP2A 3TIMA 2QDGA 4QCEA 4GY1A 3R89A 4PMDA 4V33A 4INFA 1RCQA 1SZGA 3SN4A 2XFWA 4JTLA 1BGGA 1P1MA 2VEMA 4D2JA 4IX0A 4NAEA 3BJFA 1KXVA 3NSMA 4M19A 4XD5A 5BNKA 3TFCA 4PUJA 1LWJA 3UCQA 1UIOA 1VCVA 4AY8A 3KP1A 4G7EA 1DWGM 1I75A 4PN2A 4AHPA 4DJEC 4MFDA 4Z2KA 4HU4A 5K4XA 1PX4A 4XTIA 1T99A 5C2CA 1PL9A 1KM2A 4JR5A 3N6JA 1ISZA 3UETA 2FHCA 1VH7A 3AO0A 3DDMA 4HOZA 1QATA 3VOGA 2D23A 4B4FA 1CXHA 1GK8A 4AC7C 3RX4A 3W01A 1NP2A 2WYSA 3E2VA 3RJYA 2GGIA 2D2JA 5GQBA 1POKA 1D7KA 4OUIA 3ITTA 5CC6A 3L23A 3OQEA 1NELA 4A8LA 2OODA 4GVHA 3GU1A 1KXHA 3W9ZA 4PSPA 4FS9A 1JUBA 1QOXA 4FNQA 3WLQA 3C2YA 4MLRA 5EMKA 2WVVA 1XICA 4JTCA 1C8XA 3QR0A 4DQWA 1WP6A 2VOTA 1DJNA 3C8FA 5D09A 1ADDA 4DUXA 3MANA 3EA2A 3PF3A 2PWHA 3WNLA 1J8VA 5MHBA 3O6YX 1NIUA 1O94A 1F3EA 1E5JA 3SFWA 5EL1A 1JZ4A 1V8EA 1BKSA 2GDUA 2AQWA 4AX6A 1EQPA 4ZODA 4GQRA 1QPOA 3CMGA 1Q6RA 4K1WA 4GPNA 3VIJA 3GD6A 4NILA 3DHUA 5HOSA 4WXYA 4JTFA 1C93A 2OZ3A 4Y96A 1YADA 1KR1A 5KZ6A 5LA1A 2NQLA 1CXLA 4GQBA 1IXOA 2RFGA 1GVOA 3M07A 4HMNA 4BWLA 3EPNA 1EEPA 1RAKA 3BGJA 4X60A 2ICSA 2NQHA 1OF8A 2RDUA 1NDZA 1RP9A 1PZ1A 1VEPA 3H55A 2OB3A 2QR6A 2JBMA 3BQ6A 4H9XA 4MMWA 1J0JA 2WPGA 1JZ3A 1Y65A 2WWCA 1YYAA 2HNHA 3B0VC 3ORWA 4UFMA 4IMGA 1VLWA 2J75A 1WDDA 1Z32X 2GJRA 1S2AA 1YQ2A 2OKTA 1B9ZA 5I23A 1FWGC 4NZFA 1X6NA 2W61A 4JTRA 4M56A 3KXQA 3F4DA 3MC5A 3NDYA 3FJLA 4WKFA 1M5WA 4DXXA 2FHFA 4HCDA 1XIJA 2HRWA 3SY1A 1OT1A 1XRTA 1SFSA 3R79A 2BFGA 3MJMA 4KWSA 2XJ7A 1J11A 2O4QA 4JFTA 3MCMA 3OZMA 6TIMA 4GX8A 2WQPA 2FYMA 3KWSA 3BZJA 3LOTA 3ZSTA 2O55A 3G0SA 1W1ZA 2CYGA 4FNRA 4GABA 1E43A 3PWGA 3WUGA 1TQXA 2FJKA 3C2FA 3R0UA 4LCQA 1D9EA 3MUZ1 4AIOA 2JF7A 2J25A 1YXYA 3ARVA 2HE5A 3A9BA 1GTEA 4YYFA 4RX0A 2GVLA 1LRTA 2W5FA 2VDIA 4K2SA 1UR3M 3PPCA 2BASA 1BF6A 3SM0A 1S1RA 4HZMA 2J13A 3ITYA 3OIHA 2CEQA 1HKMA 3H7VA 5JIPA 2D2GA 3ERPA 4E2VA 1XUUA 1TRIA 4RK8A 3CUJA 3VINA 2C0HA 3SAZA 4DJFC 3TTQA 3PAOA 4N9DA 1OC6A 4HU3A 1EJVC 1XDJA 4FR6A 1ZL1A 3TSMA 4AZ6A 4BI5A 2FDSA 4OQVA 3EXRA 3PTDA 4H9UA 3H4XA 3W7CA 3G1YA 1TKKA 4F4RA 1EJ7L 3M0MA 4I6VA 4NZJA 3EWUA 3AHXA 2GZXA 5JQ9A 2PWUA 2YGYA 3Q2DA 3CHDA 1KC7A 3WLNA 3ARYA 1IZKA 3L4WA 4H8HA 1OZQA 3T9PA 2G3FA 1UIPA 4CD8A 2ASHA 5TIMA 3L66A 2VHLA 3R8GA 4WRHA 1M04A 1UD8A 2GQAA 1ONWA 4EOUA 4LTSA 1ZU8A 4Q22A 1KM3A 2XU2A 2ACUA 2RDTA 3MS8A 4CCZA 4NRSA 3VA8A 2X2GA 1B54A 1JZ8A 3PBUA 1B3ZA 4S3DA 4TUFA 3NR0A 1MRAA 1PCWA 2V3DA 3UJSA 2INFA 1I2RA 4KRUA 1WYIA 1O60A 3AIBA 1JFXA 2VTFA 3KBJA 1E55A 3FA5A 3AZRA 1BVNP 1GQJA 4GY0A 1OM0A 1XIGA 4PCTA 2Y7EA 1XWYA 5HJXA 1PTDA 1T7LA 4DO7A 2NLIA 1VQTA 1XLIA 1DE5A 1PUDA 1TQJA 4H8VA 2FIQA 4IISA 1HF6A 3SRDA 1OHLA 1E9IA 3GUGA 4WY0B 2VENA 2SFPA 1WXJA 4UTIA 4A3RA 3GWQA 3G1VA 4Q7IA 2ALRA 1W5NA 3APGA 2FTYA 3KP0A 1F5ZA 4KESA 1R5YA 3JUGA 1EDGA 2WVSA 3NGFA 1DIKA 2B31A 3GG7A 1CGVA 3W6YA 2PLJA 1XYCA 3NPVA 3FJNA 5CG0A 4IIFA 4L4PA 4LBSA 4R7OA 3WN6A 2BZNA 2G0WA 3PWIA 2YOCA 3QHNA 3DKLA 2P0IA 4E6MA 3EMCA 3REQA 3CYVA 1UR2A 1QRQA 2VX6A 3CQIA 4IQLA 2CU0A 3W00A 4YXGA 2PU0A 5IHRA 4RR4A 3NXLA 5AFDA 2CHNA 4OWGA 4CD5A 2WMHA 3IVUA 4XIAA 2NWSA 3GDKA 3DEQA 2C7FA 5CJNA 3HMCA 3ENLA 1AH3A 3OO2A 4W5ZA 4AD3A 1X1NA 3CAQA 2PTYA 4O1FA 4HK7A 3A24A 2E7FA 1PHQA 1WDSA 5HXMA 4JYFA 2CLIA 4IJBA 1OFBA 1E4LA 4WDUA 1FQ0A 3GVVA 4Z0SA 5A2CA 3VO0A 4M1BA 4PL2A 1XR2A 2DSUA 1FWJC 1GJUA 1VFHA 1YTEA 1V7AA 4LBRA 3LHYA 3LRMA 1EO5A 1AJ0A 3S2LA 1DVJA 3W7JA 5AC5A 1KRBC 1PYFA 4GC4A 3E0VA 3NQ8A 1L8PA 2PDYA 2EPKX 1UR8A 3UFYA 3WMLA 4DJDD 3KLLA 3WEOA 3UYIA 4ALDA 3OZOA 4LVGA 3S1UA 4JICA 2D22A 5F4XA 2QVNA 3TZFA 4DAFA 1W3TA 5M5DA 3IJ8A 2QGYA 1W9XA 5AOUA 3M1ZA 2RJGA 2IQDA 5FL1A 4IIDA 2YPIA 4QNWA 3BMWA 1X6UA 1XDMA 3FHQA 1VENA 5J04A 4MJZA 5HMSA 4PTNA 3VKKA 1SGJA 2VQUA 1V0LA 2E68A 1NAL1 1NOFA 3NZRA 4M8UA 2QCCA 1DJHA 4P7OA 4K68A 4J3WA 4LUYA 1MUMA 3NQ6A 3PNZA 2OWWA 1Q45A 2ZWYA 3WFAA 4XAFA 2PDMA 5HUOA 3WH7A 2Z1BA 1THFD 3NOEA 1UR0A 2DV0A 3S9YA 3W76A 2BOFX 3NQ7A 2NXHA 3KOYA 4WJXA 1E3ZA 1N2VA 2ZX5A 2QHAA 1HUVA 4M3PA 1EDTA 4F8XA 1T8QA 2B7NA 2H3DA 6REQB 4UTJA 4YN5A 3S1XA 4DZHA 3G0UA 4IG2B 1X1ZA 1CDGA 2WB5A 4U5KA 1QNSA 3TU9A 1C7TA 5CGTA 2PS2A 1WZMA 1TVNA 3VC5A 1XLBA 4FP1A 3M47A 2PCEA 3GTIA 1A0CA 1DQUA 5A6MA 2Q3OA 4E0CA 1H50A 1MXGA 5U4NA 2HPMA 4LPCA 2QCDB 2PLCA 2QJIA 3O3RA 3G0XA 3ITGA 1OCJA 1JYVA 3W1LA 1P6WA 3HPAA 2X1SA 2XVLA 4QE5A 4IGSA 4U3AA 2VEGA 3A22A 1HJVA 3UP8A 2B7OA 1PSCA 1EA0A 3H4WA 4CNNA 4EWJA 4C6IA 1UWRA 3AIVA 4GCAA 1LZOA 1V6WA 2E8YA 4UOQA 1XYLA 2HVMA 3LCFA 4K3ZA 5D2WA 4Y8FA 1V3IA 5K3VA 4TIMA 1ITCA 3JW7A 5BRBA 1GKRA 4J3SA 4JHOA 4G56A 1YRRA 3OGSA 1PBGA 3WH5A 2Z1KA 3QV6A 3KS6A 4Y9NA 4IL0A 3BE7A 2G4FA 4P8XA 4ES4A 1GTHA 4D6FA 3MMWA 2R1LA 4UTTC 1QPQA 3UEQA 4HA0A 1QCWA 3O2LA 4MAZA 3ZR5A 2BY1A 1GZGA 1RK6A 4TTGA 1TZZA 3EWCA 1YW1A 3HQPA 2DW7A 4RL3A 4MKSA 4OOUA 1U5JA 3AS1A 1W1TA 4D72A 4QAIA 4CLMA 4MJ4A 1FHUA 1DQWA 4LRTA 3W7HA 1ICSA 2P76A 3TR9A 3SUVA 3VM5A 1KCZA 3VIMA 2D24A 3STFA 4Q8WA 2GK1B 4UTHA 3MI2A 3WD3A 1V3MA 1ICQA 4DXKA 1H5VA 2QIIA 3KEHA 4I5XA 2J9XA 5I3HA 4F0MA 1RD6A 4FI4A 4L9YA 3N6QA 3QF0A 1W3HA 1FDJA 1H62A 1CYGA 4LQ1A 4IJCA 4Z2GA 3P7YA 5T9BG 1UD6A 4U2YA 4XZNX 1EBGA 1ELSA 2P10A 3WLTA 4NAFB 3BOLA 1F4HA 3U2CA 4O1AA 4O10A 1KQYA 1HP4A 3LB0A 1WXYA 3MW7A 2V5CA 1GOXA 4LS1A 4HSNA 3TN3A 3VKAA 3GHUA 1XS2A 1J0IA 3AXIA 3NSXA 4CNPA 1NFGA 1RJQA 3HPXA 3QV8A 3PWAA 1EPXA 5H2ZA 2H8XA 4M6PA 1AODA 1PKNA 3WQ8A 4LS0A 2V5DA 1H7PA 1IR2A 2EGZA 1TR9A 2YDRA 4C7DA 3L2LA 4D1JA 4D6DA 3FFSA 1KB3A 1FP8A 4F0SA 3AMGA 3QW4B 3BWWA 2XUCA 4HN8A 2RDWA 1HT6A 2BVDA 3NFUA 5CPSA 1AQFA 4HPJA 4MWAD 3MO7A 3CM4A 2F7FA 3IRDA 2V8ZA 3MVTA 5LNVA 3WK0A 1V0NA 2ZVRA 1MYRA 4X22A 1SMDA 4X63A 4XO6A 5DCEA 7PTDA 2F84A 1ZLPA 2E25A 1GWJA 2GUYA 2FZ9A 3O07A 5D8WA 4V2XA 3NGJA 4RKAA 4Q4MA 2QJGA 4WR3A 3GAYA 2A5HA 3GC2A 2NVAA 5T26A 3GNOA 3V3WA 3Q58A 1Q7ZA 1EX5A 1W32A 3W37A 1UD2A 1BTCA 1WDPA 3BUVA 3EX6A 3NM3A 1VC4A 3B8UA 4Y9MA 4M5PA 2NXIA 4A21A 3KDNA 3TXZA 4AH7A 2ZUWA 1YBQA 3A4AA 3EOEA 4JCMA 1SU5A 1OABA 3PPGA 4JIEA 2ON3A 3LGGA 1XF0A 4OU1A 4Z17A 2FKPA 1EOKA 2WMGA 4XZBA 1RJPA 1QNRA 2WSRA 3CHCA 3PTQA 4FLRA 4D6IA 4Q6XA 2V67A 4H01A 1W8GA 1VFFA 4GBDA 2BHZA 2YA0A 4DBWA 3WF2A 3B03A 4M51A 3P3BA 2E3ZA 3LCLA 4BQ3A 1FBAA 1Q6OA 3ES8A 1AQHA 3QXBA 4H6KA 3W7IA 3H54A 4Q8OA 1EJWC 4ZO9A 1IEIA 3VIGA 5HDRA 4WGXA 4FOKA 2DT1A 3GFXA 3HGRA 3KOFA 3MHUA 4CQCA 1N55A 1FTXA 1B4EA 4DYJA 2GQ8A 4ZEPA 1PPIA 3A21A 1LLWA 5DO8A 4OECA 1X97A 3SBFA 2WVUA 1I2OA 4XISA 3VE7A 1J0ZA 2Z4GA 3OBAA 1P0BA 4QX4A 2V5KA 3FYPA 1RR2A 4X9SA 1XLAA 2YB1A 3KVKA 4XKMA 2PAJA 3JZEA 1FWIC 3P82A 2P50A 3TTYA 4FIQA 2OSXA 1K8XA 3A4WA 1DP0A 1DWJM 3DI1A 2OLSA 3ZQ9A 2OFJA 2BGNE 4TV5A 1OFEA 2VRJA 5C2XA 1R3QA 1JZ6A 4YWSA 4PUUA 3VCNA 3ICJA 4XWUA 2VGGA 3GHSA 2ALDA 3VIKA 4CCEA 5EKYA 4S39A 3URNA 1QXLA 4DAIA 3T42A 4UBPC 1MO0A 3W85A 4DF0A 2G3IA 3RO8A 1D8CA 2I56A 2OCZA 2YDAA 5E09A 5J8LA 3FXYA 5E9AA 4N2YA 4MY1A 3W53A 3GIQA 3M7SA 4CN6A 3AHVA 2GOKA 2B81A 1CXEA 1FDYA 5C9ZA 3IUHA 2BWGA 3H6OA 2QPSA 3WFZA 3OIXA 4W7UA 3I7SA 4Q8QA 1UPMB 5M1TA 5A2BA 4N6FA 5C9RA 3G8EA 4YL2A 1GG1A 3RCNA 1NP0A 1K9FA 1V77A 5AC6A 2A2IA 1XINA 4W88A 4LW7A 4CEXC 2VMFA 3ABXA 1JPDX 1KFBA 3GKAA 1WKFA 4PULA 5FA5A 2ZTJA 1BQCA 1SW3A 2IPFA 2VO5A 3GW0A 3WLOA 4IWWA 1MW2A 5BXTA 3T4WA 3G6MA 4Q6JA 1FWEC 4E38A 4JS3A 4EE9A 4TMCA 1GUVA 3LBCA 5M17A 1YNPA 4Q4SA 2HROA 3FSUA 1SW7A 1ZHAA 2PC4A 3NDOA 1FHVA 2EF9A 1JYXA 2Z2UA 3LEPA 1VHCA 2QULA 3N18A 4Q7BA 2INEA 1JCLA 2DU2A 3GH4A 2XVPA 4WOQA 4DNHA 1E6RA 1XD0A 4YTTA 2DUZA 1A53A 3L21A 2VZTA 3H22A 4HMDA 3ZM8A 1L2UA 5I3IA 1V6VA 1ZCCA 2X05A 3WFLA 3T40A 1V79A 2VWSA 1NVMA 3BICA 4V1XA 1C90A 1MEIA 3HA1A 3T0BA 3GC4A 4PRRA 2A3BA 1ISXA 3CK5A 1ALDA 4RW5A 1N8FA 2QVHA 4XKYA 4YCPA 1J9YA 3NZPA 4AIUA 1SSDA 3EB4A 2W3ZA 3IJIA 4JN7A 4H4IA 4D8AA 2DVUA 2PBGA 4S3AA 3TJXA 3A47A 3UYCA 2DZWA 2XVGA 3WQ6A 3WMCA 3R11A 3FYOA 1G9HA 3QR1A 1VYRA 1LOSA 3M16A 4BWLC 1AW1A 3MKCA 2CETA 3K1GA 1JDEA 1HKVA 1EC9A 5DBTA 2ATSA 2O9PA 4B9ZA 4H3DA 5EB8A 1Z41A 4LWWA 2PURA 4GGHA 4OIFA 3KS5A 1ENUA 3ITVA 4Q33A 4XZHA 4EK7A 2PLMA 1XH1A 4AMAA 2XN1A 2VM8A 2FDMA 3E5PA 3AI0A 4GIYA 2Z6JA 3OLDA 1WNOA 3SCQA 4Z2HA 3W0KA 1MW3A 1ESWA 4NJJA 2PTZA 5DX7A 5CGQA 3TE9A 4MY8A 4MPQA 1UKPA 2QCMA 3QZAA 3LXAA 4CUCA 5I6SA 2XH4A 3V5CA 1MXDA 5G4EA 4O57A 5LIKX 1TA3A 4BQ2A 3AS3A 4O13A 3N12A 2XFYA 1ZJHA 1W3KA 2Z24A 3TJ4A 3DFOA 3WF1A 3DYMA 5GPRA 4LF1A 3AOFA 4GIAA 1DL3A 5FI8A 1XYAA 4GI8A 3E2QA 5BRPA 4AY1A 4DM2A 1EUNA 1S5VA 3LPFA 1SZFA 3CZKA 1GPWA 3QYSA 3VABA 1HKIA 4BKNA 3EWYA 2XGBA 1Q4WA 1L9WA 1V51A 3G1HA 5JBEA 3LLFA 1WB0A 5AHLA 3UG8A 4O50A 3O0KA 3ZLGA 2HWGA 1B9BA 3CS2A 3SEPA 1JD7A 4XAGA 2J8GA 1JYNA 3CMJA 1V3HA 2IQ0A 3SCUA 5A3HA 1UUMA 2BVWA 3TJLA 3S1VA 1SO6A 3HMJG 2WJFA 4UFJA 3ATYA 3CB8A 1PHWA 1ME7A 2WKLA 5K4ZA 2JKPA 3LTPA 4JY9A 4UR9A 3PBWA 1KBLA 3CH0A 3GX9A 4JIPA 3TVAA 2X40A 1B5TA 1E51A 3AU2A 3BLFA 3MUAA 3N2MA 4RUBA 3UWUA 1C9WA 1GQKA 1W5MA 1BXCA 1I6NA 3GVRA 2D0FA 3KZPA 4AD5A 1EJSC 2JGQA 1MW1A 3BGAA 3F4CA 1L6FA 1AK5A 1LJYA 1XGDA 3AMCA 1HX0A 3W1MA 4Q4RA 5AHIA 3GXPA 2WMIB 3WH9A 2GSEA 4G1KA 1GVEA 4Y2WA 4O54A 2E1DA 2R6OA 4MZYA 3C3NA 3G8RA 2PP3A 5FAJA 4ICNA 3IK2A 2VRQA 1EOMA 3SCPA 2RKXA 4U31A 3NURA 2PDWA 1OINA 1FP9A 1XFCA 1NDWA 3OA5A 2GYIA 3T09A 4BFAA 2VC9A 1OCBA 1AH0A 3QYQA 2FMNA 4WF7A 3ZJ7A 1XM3A 2Z0IA 3GXIA 3M0VA 1NF7A 5C9UA 4M6VA 3WK1A 4MNJA 4DLMA 4F0LA 3C52A 1B30A 4HN4A 2CLMA 4J3ZA 3T7VA 3V7PA 1W56A 1OFOA 4DY1A 2ZX7A 3WBWA 2VZVA 1MNSA 3V16A 4E8DA 3STPA 1F74A 1QTWA 3I65A 3C2RA 5C54A 1Q6CA 2XGIA 4MKVA 3WQFA 4OV4A 3W7OA 4Z1DA 4HKPA 5A6BA 3D3FA 4NXSA 2DT0A 2NSXA 5CPLA 1G94A 4RNJA 5ABHA 4JDBA 1XYMA 3MBDA 4R27A 4OOZA 2NXGA 7XIMA 3W2JA 2QV4A 3U3HA 4PMJA 1R2SA 1RZMA 2BP1A 2CLPA 4ROQA 3RF9A 3T2QA 3B40A 2XWEA 1JVNA 3IPWA 2DH2A 4G6CA 5I24A 1CIUA 1QPKA 3W1PA 3WDQA 4IXXA 4WK9A 5FEZA 2WNQA 3HOJA 3CV1A 1IIGA 2JGYA 4BF9A 3QGKC 2REQB 5D9MA 3HQNA 3W1UA 3MMTA 4AC1X 1FX6A 2GGGA 3K8KA 4DBDA 1I8JA 3MP4A 1XQKA 1SR9A 2OYKA 4L1XA 4NSBA 1MDLA 1MI3A 3ZS4A 1TV5A 2HS8A 1FXQA 2X1UA 1ISYA 4FAMA 5HWNA 1ZS2A 1ITUA 1WDRA 4FPSA 1JAKA 1ADSA 3OHIA 1EP3A 3LI0A 3LNMA 5D2XA 1I1WA 3RLUA 4B5TA 4FLSA 3GXNA 3MUIA 3QBUA 4KWWA 3PUEA 1T96A 1MVYA 3RU6A 3LD5A 3P0XA 3PB2A 1DTUA 4WDWA 2RGMA 5KINA 3BL3A 3ABZA 3GFYA 3MHFA 1NSJA 5CAKA 4UFLA 3SCVA 1DQXA 1GQNA 3B8DA 4ZSUA 3L0GA 4PBEA 2V2HA 4ECLA 1W0MA 1JXKA 1OD8A 3WF4A 2Y0FA 3C3UA 2Y70A 3IANA 1T40A 1GPFA 1OVDA 3L5MA 4US5D 5EFDA 1F07A 4PUDA 3WQOA 2DSZA 1B3VA 3PZIA 2B0MA 1EP2A 4AG0A 4L9ZA 5C8BB 4JL1A 3IRSA 4MJ2A 3AS0A 5BZAA 4DUWA 3U9IA 2R24A 4RXGA 3WUEA 3LTYA 3GKFA 1H49A 4LSBA 2NX9A 3GR4A 5AN7A 4A22A 1T0OA 2CZ5A 1OFAA 3NQ2A 3LYEA 4ZSTA 1HXJA 3M0JA 1VPXA 2KX9A 1CBGA 3MDWA 2PBOA 3AHZA 3BJSA 1ZQ5A 1BF2A 1TJPA 1AD1A 3DERA 1XYBA 1GVIA 1M41A 3CMFA 2PDIA 4YWIA 3BANA 3FSTA 1YHTA 4NP7A 5IOBA 3OTRA 3RJXA 3PZOA 3POHA 1F6PA 2Z1WA 1V7YA 4WQ6A 2GVJA 4JEJA 1LQ0A 2BGSA 1RVGA 5F1UA 3SR7A 5FJOA 1EL3A 3EB3A 1O95A 4GC3A 3BTNA 5AB3A 1HO4A 1GOOA 2G5WA 2DZUA 5IXEA 4PGLA 3ZR4A 1FWSA 3F5KA 1E1CB 1AW5A 4QCFA 1VBHA 1UH2A 1VJSA 2FPVA 5IHSA 4JXCA 5B7YA 3E9AA 4JTHA 4BF5A 1H41A 2CBIA 2VP8A 4A8IA 2OEJA 2J7CA 3CEPA 5AY7A 1XW8A 1E0WA 4N7QA 4Q8VA 4F3HA 1V0MA 1BG9A 2C1GA 2YYUA 9RUBA 3SRHA 4LB4A 1J0HA 5CC3A 3GDMA 4EXQA 3WJZA 4DB7A 3CH9A 4O0QA 1UR4A 1XI3A 9XIMA 4DWDA 1R8LA 1R2RA 1ISWA 1D3CA 3QQ0A 2GJPA 4GE8A 1WZAA 3NM1A 1ZAIA 1UUQA 3DC0A 1KO0A 5TBOA 4QEEA 4NYUA 1BVZA 1QWGA 1TX2A 1W17A 3WLHA 3VNDA 3GNPA 3TONA 2IPGA 3KCOA 2VT0A 2XYLA 5D30A 4DI8A 5ENLA 4JFSA 4NAEB 3CNYA 3A3WA 4LEFA 3EDFA 4CCCA 5CSSA 3T05A 4I5UA 4OKDA 3HV9A 4AYGA 2HPIA 2O56A 4DYKA 1Y0EA 4PSRA 3PM6A 3S2JA 2GGHA 4J7RA 1TPVA 2O92A 1Q2SA 1JQVA 3VNIA 4IP7A 1FWAC 3C0QA 4BQ5A 2KZHA 5KZEA 5XINA 3W25A 2BB0A 1J18A 2BG5A 3NVDA 4BA0A 4OBSA 2VGBA 2V9DA 4E4UA 3RX2A 4XVDA 4LAZA 3RM8A 4NUWA 2VX5A 2CXGA 4DXVA 5EMJA 2JEQA 3VNJA 3LENA 1QW7A 2PWVA 3CWNA 3EEZA 3J7HA 3VDGA 3W1AA 2OO0A 3E0FA 4B16A 4Q4OA 4DO5A 2J7EA 2E9MA 3P81A 3KBMA 3RR4A 4FA3A 1LF1A 2WVVB 2DJLA 3H12A 5D38A 1UOZA 4MB1A 3USZA 1FWHC 2TPSA 1QHOA 3B8SA 5C5YA 5GNZA 5I78A 3EWWA 2VCBA 4G9PA 3MT1A 1UWSA 1G0CA 2HJPA 3B0XA 3E6EA 3UQNA 1VBGA 4AIBA 3D46A 3UWWA 2DH3A 2FGLA 3V18A 3UZYA 3INPA 3O8AA 3B0PA 3FOKA 3CLWA 5HWJA 2C0AA 1CWYA 2FHBA 3L65A 5DT7A 3R0DA 5CPOA 1H0GA 4GUJA 4IT1A 1CLXA 3URAA 3GHRA 3LCXA 1WKEA 3SUSA 4JYDA 1LG1A 2E0PA 1J6OA 1EF3A 4RV3A 3G18A 1MDRA 4PB4A 4QS5A 1GOQA 4C1LA 4E4PA 4N9CA 4U5IA 3QTGA 2J27A 2W9MA 2I1OA 2Z00A 3PS7A 1B3XA 3K30A 3N3MA 1PZ0A 3I3DA 3N11A 1ADOA 2CITA 1BWKA 1SVDA 2Z7KA 4GNVA 2XN2A 1X7FA 2ZICA 2XIIA 4TXEA 1S2UA 2YCJA 5JH2A 4MSSA 1GG0A 5A8MA 3ZOAA 4EPDC 3RLHA 1ZZMA 3B9DA 3GXTA 3S42A 4JNZA 1KFWA 4PUKA 2EPMX 5FJIA 4O11A 3GG0A 1US3A 4XK2A 4QE4A 4DEFA 5ABTA 1VPYA 3CAVA 3TYDA 2J9ZA 1V3KA 2ZRUA 3G1RA 4PMRA 2OEKA 1X39A 2C91A 1XHGA 4D6JA 3PVFA 1LOLA 3CBWA 4MWAC 1EIXA 2V6AA 1EJUC 1BQGA 1YPXA 5AYBA 3DC8A 3P8IA 3WNMA 3EPOA 5D9PA 3STCA 2WKGA 2PSNA 3OG3A 3CZGA 3W74A 4ZQPA 3T1GA 1C9DA 1RCOB 3WLSA 4AX7A 4G8TA 3NJ3A 4HP5A 5BXRA 5JVLA 1QI5A 1A5MC 3SCWA 4EPKA 1FWFC 3RLVA 3GVWA 4K8GA 2OPJA 1TPWA 5LXXA 1J0YA 4FMVA 1EGMA 4JQAA 2IUZA 2YB4A 3SI9A 2C3ZA 2HBXA 4JQ4A 2YW4A 4D71A 1OWQA 1IZCA 4AEEA 4QG9A 4FOJA 3CUIA 3R4IA 3BLKA 2VVSA 2FZMA 2XZ9A 4QJ5B 1KRAC 1D3GA 2OLHA 3IAPA 3LHWA 3L4UA 3WNPA 3EMZA 5LZLA 2OOFA 1QHZA 2XDFA 1S2CA 3C86A 3K2GA 3WNKA 3FKKA 3TWAA 2FZDA 2OZTA 3IK4A 5I02A 1DWHM 2Y6ZA 4IXHA 4YS1A 3TMQA 3ZSSA 3UNTA 2AAAA 3WCZA 3QGVA 3WQCA 1MQRA 4L80A 2NX3A 4UMBA 1TFVA 1W2PA 4K36A 4MGGA 4Y6GA 3UJ2A 5IM51 3LNPA 2VZOA 3KL0A 4YVXA 4H9ZA 3S6TA 4MB5A 1W3IA 3MYOA 4MB4A 1KGXA 2UY3A 1R86A 3UJRA 5IRPA 4B5XA 2H90A 1G67A 3SN0A 3PAJA 2YCIX 1KBKA 4WLCA 4H9MA 3ES7A 4J5NA 5BU6A 4AIEA 4GJJA 3P61A 5LKYA 2VL4A 4JTAA 3AHTA 1I2NA 3RNDA 5G1YA 2D69A 4W93A 4FX7A 3HV8A 1E4NA 2OGJA 3K4WA 4M80A 3VD4A 1EX1A 5C71A 2F6KA 5C7VA 4GYFA 5DEZA 3ZVHB 6PTDA 1FWBC 4GI4A 4QE1A 4JTKA 4GYPA 3T07A 3TFXA 3C4UA 1OF6A 3THCA 3NEHA 2PTWA 2WSKA 1XRFA 5I3KA 2WWDA 2CESA 5H8UA 3M9YA 4HOXA 2IKGA 4GNKB 4WX2A 3O05A 3RUBL 3WLMA 4EPBC 2A3AA 4ZB5A 1W3LA 4Z1YA 2V63A 2NQ5A 5HNRA 4JD4A 4B92A 2E4TA 2VI0A 4MY9A 1BRLA 1JUKA 1XLMA 3RX3A 2CWNA 1E4MM 4NJKA 4OBTA 1UBPC 2NUYA 2VFDA 1FY6A 3LU2A 4DYEA 4H6QA 3B9NA 1RY8A 2Z29A 3GIYA 2CBJA 4F40A 3U5YA 1UWIA 3GTFA 4WD0A 1CZ1A 2Z26A 3N2TA 1IGSA 1A0EA 3MI3A 3BPWA 2V68A 5CPQA 1BYCA 4MHBA 5T8GA 1S2WA 2EPNA 5LHFA 1AQMA 4Z42C 1E73M 3IAQA 4TTUA 4NZ5A 3REQB 3HZ3A 3LHUA 1H0IA 3N4FA 3UGRA 3H7UA 1H1ZA 3P62A 1SFJA 3S5ZA 2OOGA 4LAMA 4XD3A 1W5PA 3H26A 3RPMA 2QNEA 3GZ3A 4NVTA 3I7QA 2Y4SA 2A0NA 2TRSA 2Y8VA 3PUOA 4DELA 5HQLA 1F8MA 4TOQA 4QJ1A 3DI0A 3DZ1A 2DEPA 3T8LA 2QPXA 3UZJA 4HA3A 4L64A 4LUSA 1TV2A 1OX6A 4JDYA 2ODOA 3LPOA 3S2MA 3MBFA 2OLAA 3QPYA 2CZEA 3P84A 5CBIA 3T55A 4O53A 4A8NA 3SRKA 2CXEA 2QCLA 2QJHA 3R58A 2GWNA 2J4GA 4QSHA 3MZ2A 4FHAA 3RCMA 4ACZA 5A8QA 3WLPA 3W7EA 3HFYA 2PC8A 2Y7GA 5DRIA 1YPFA 1TUXA 2XSXA 4M81A 4EVZA 3B3DA 1GVFA 4GI9A 4JGDA 4LUJA 3FKRA 3TAOA 3GDLA 6CGTA 2DSWA 1YDNA 4GA8A 1DIEA 4QDWA 3W2MA 5MF5A 4LF2A 4Z08A 4ZL1A 1FKWA 2DP3A 4D9PA 4KFPA 1Q7MA 2FH8A 1Y8BA 2PU1A 1BWLA 3NAVA 4J3VA 2I7GA 2ZUNA 4LOCA 2CW6A 1Z42A 3MCOA 3UY8A 4D8LA 2ZA1A 1UKTA 3KHJA 1S5WA 3MHGA 2XPKA 2X42A 3LSBA 4WUIA 4Y9PA 4A4AA 1N82A 2CIPA 3BG5A 1P0KA 4GJ1A 5FSDC 3SW6A 2ZRXA 2LLEA 3L2MA 1H63A 1GNXA 4NRRA 2ZBTA 3TC3A 5CBJA 2G41A 3DXIA 4J3TA 1N8WA 1ZRQA 3BLOA 4XQ6A 3W02A 3APTA 2UY5A 2PWDA 5XIAA 2Z1SA 2PDQA 4RE2A 5CG7A 3UCDA 3M0HA 3PZUA 1HJSA 3HU7A 2Y8UA 1OIMA 4S2CA 2HK1A 4REQB 3DFTA 1RXOB 1R6WA 1TB3A 4HMCA 3WD2A 3B8VA 3UPMA 4IFOA 2DUXA 3AMLA 3W2UA 1OFRA 2VFGA 4FIRA 4J4KA 1E1FA 5JH1A 3DG3A 1NWSA 3W7DA 1XDLA 4NNBA 1DJZA 3NEVA 3C0LA 4M0XA 1XBXA 1TCDA 5HMFA 2JIWA 4EXBA 2EPHA 1RCXB 2J7DA 1FWNA 4F0HA 1BSLA 5F2MA 1UD3A 5CGMA 1IV8A 1OY0A 3VTRA 2PTXA 3AISA 1EFZA 2YL5A 3TLQA 1UBSA 1EC7A 4XUGA 1T8XA 3DG7A 1E1EA 4DBSA 3RM9A 4LH8A 3QMRA 3USBA 1RJRA 3VNLA 5CLWA 4CVUA 1RPXA 5GNYA 3LS9A 2FGZA 3C56A 2V38A 1P43A 1TJRA 2G4JA 3UXDA 2QF7A 4ZOAA 4GUIA 4UQCA 2AQVA 1MWOA 1EHAA 2HE8A 2ADAA 1UASA 4LAOA 1KM4A 1JR1A 1P0NA 4IF2A