3W87A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-103
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-103
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 104
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w87A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w87A01
3BVJA 2OT1A 4DO4A 4BK9A 4JYFA 2V82A 4GUIA 2TPSA 4FO4A 2GOUA 3TQKA 4DELA 4Y8FA 3PBYA 3A21A 4X22A 1WOBA 4JTUA 2LLEA 3KRUA 5FESA 1CI1A 4EWND 1YLVA 3HGSA 3A5FA 3NQFA 5EBUA 1JUBA 2CLLA 3UY8A 1V5XA 2E6YA 3EKZA 3NQ2A 3HGJA 1VYSX 2I1OA 1M6JA 4N4PA 4GUFA 4DEFA 3BG9A 2Y7FA 1IXNA 1XDLA 1QPRA 4UMAA 5I3KA 3ATZA 5F2GA 1JQVA 3T44A 4LS2A 4RZ5A 3EWXA 1CX9A 4CQAA 2G95A 2C15A 4JYEA 5AYXA 1XFBA 4LNYA 3KVMA 1BKSA 2CLEA 3B03A 3WK3A 1TYGA 5FF2A 3O16A 4E2BA 5FEXA 3O1NA 3MP3A 1OFRA 2WSQA 2Y61A 3KAOA 3QEZA 3E9AA 1L2UA 4MY9A 1LOSA 3KOFA 3O6DA 4NNAA 4YLWA 3CEPA 5AFDA 2ZQ0A 2C6QA 2CZEA 1NAL1 1KM6A 3TW6A 3P74A 4QISA 1HTIA 1XBZA 2JKPA 3H55A 3LHVA 3MBDA 1L6YA 2QDHA 4H4IA 2FIQA 3EWUA 4FNQA 4O14A 2TMDA 3VE9A 1N7KA 4UXDA 2ZRWA 2QAPA 1VLWA 3LOTA 5DY2A 3IGSA 4GWEA 2Z6JA 4M19A 4S1FA 3ANYA 1UBSA 1MXSA 1H60A 5U4NA 3SGUA 3TQVA 1JCLA 5EMUA 3V75A 5HUPA 2WNNA 5D37A 4Q32A 4A2RA 2CWNA 2P10A 2DZXA 1OYCA 4J9JA 3BLEA 4UFIA 4Z08A 3C8FA 1H1YA 1Q45A 1SW3A 2C1HA 2VFFA 1ZJIA 3U8GA 4BI5A 1ZNNA 3W7DA 2CW6A 1OYAA 2TSYA 4Y6GA 5IBXA 3DKLA 1YPIA 5D32A 3N2MA 3W6YA 5C54A 1KTCA 4IOTA 4WOZA 4PFMA 4IJBA 1H7OA 4UNLA 4JX6A 4N9DA 3YPIA 1WV2A 1OFEA 5CPLA 3NNTA 2CLHA 3LXAA 3O06A 1P4CA 2A7NA 4DO6A 3DHDA 1SFJA 3SI9A 4EOUA 3TA6A 3S0CA 4YWIA 1MSSA 4QSHA 4HNTA 4WZHA 2GJLA 3EKLA 4IUOA 4CCCA 3C3NA 4DXVA 2FDSA 4JTSA 5AB3A 3E02A 3W7IA 1IIHA 3A22A 3W2LA 1VRDA 1NSJA 3ABRA 4RXGA 3DGRA 1LRNA 1YTEA 1JJKA 3ABSA 1AMKA 2HS6A 3NZ1A 4TO8A 4IMDA 3LCWA 3NQEA 5AHNA 4G1KA 2E6AA 1VS1A 5LNUA 4JYDA 3LBCA 3QYQA 2F7FA 3W2NA 1UJPA 2A0NA 3KRSA 1L6SA 1M5WA 3OG3A 1VCFA 4ZL1A 1I2RA 5LNWA 2CLIA 1UASA 3G0XA 3QQ0A 1QO2A 4BI7A 3UWZA 3L68A 4OV4A 2V0TA 2BTMA 1NEYA 2GQ8A 2FTPA 3P80A 4NX5A 2JGQA 2ZCGA 5G4EA 4DPQA 2Y6ZA 2ZZ3A 3I65A 4O1AA 1XUUA 2FLIA 4HN4A 4AHQA 3IIOA 4HKPA 3TUUA 4AXKA 3THAA 2UV8G 1U5JA 3KFTA 5I3GA 3TE9A 3W1TA 1LP6A 3W7HA 2NWRA 3IVUA 1KV8A 3MI6A 4JY8A 1TTPA 5HNRA 3L5AA 2WKJA 3C2EA 1X6UA 5AHMA 1FWSA 1LRTA 4O1DA 2V9DA 3N14A 3S5YA 1PE1A 3PBWA 4FX8A 3W83A 4CNNA 1EIXA 1HO1A 4LRTA 1JRCA 5K7JA 1ML1A 3UQNA 3W72A 3D0CA 3QH2A 4FNUA 5K9CA 4LTSA 1Q3NA 1ALDA 5F4SA 3M5VA 3JRKA 1I2PA 3W7OA 3DXIA 3QJAA 2QF7A 5DY3A 5I3FA 3ATYA 1JUKA 1LDCA 3INPA 3W1LA 4ZQCA 1Z48A 2R94A 2G97A 3HOJA 3H53A 2Y7EA 3CB8A 2J27A 4GNJA 4M6QA 1C8VA 1MEHA 4MJMA 1DL3A 6ALDA 4O10A 3LV6A 5AC8A 4UFMA 2BX7A 2ZRVA 5AHLA 2QCFA 1R46A 1SW7A 4UTKA 3W75A 2W0UA 3QQ1A 3LTPA 3T4CA 2YSWA 3EX4A 4ML9A 4POCA 3M47A 1VYRA 1TPDA 4LV9A 3E49A 1TTIA 4MLJA 3P67A 3GNNA 3G1HA 1GPWA 1W5NA 3LRLA 3PS7A 5CG7A 3PF3A 3TDFA 4NQ1A 1F2JA 4ZQRA 3EEGA 1G69A 4NXSA 4PC8A 5TIMA 1KA9F 2BXVA 3O8AA 1VQTA 2TYSA 3JS3A 1EEPA 5D02A 1EUAA 1PV8A 5K3VA 4QNWA 1OF6A 2Q8ZA 3NL2A 1W3IA 4MOZA 4UIOA 2RFGA 1SW0A 1MZHA 3G1DA 5CSRA 1AG1O 4WD0A 1W37A 3QFEA 4EVZA 1TSIA 2YR1A 4E2DA 3FLUA 1QFEA 3A5VA 1PCKA 3TMQA 5FI8A 2ZRXA 3MP5A 1YDOA 4JEQA 3UXAA 3HG3A 4FNSA 3RK8A 4IPIA 2GVJA 2CLMA 1F6PA 3STCA 4K6AA 1OFAA 1EP1A 2DZPA 3B0VC 1FXPA 1SZFA 2A5HA 5I3JA 3UYCA 2ZRUA 3LCFA 4FHAA 1QMLA 3S6DA 3N34A 3G1XA 2V2DA 4IXXA 3C2FA 3G8RA 4LC8A 3CEUA 1B3OA 3L65A 1XBXA 4ADSA 2BWGA 3NR0A 1GG0A 3NPWA 3RLUA 4UTWC 1KV5A 3W7NA 5DELA 2E6FA 4FF7A 4K8HA 3G18A 1Z42A 3NQ8A 1NVMA 3WK2A 5F2MA 3B06A 3HPZA 2R91A 1D9EA 3BW4A 3BPWA 2QR6A 4GC4A 3EX1A 1XL9A 3O6YX 1XXXA 4UUIA 3O6CA 1YTKA 1TPB1 3DFTA 2HS8A 4O4VA 3HPSA 2Y62A 1RQHA 4GJ1A 1JCYA 4K36A 5DLCA 1FBAA 2NXIA 5HWNA 4JTGA 3ELFA 3ZWSA 4FB7A 4IMCA 1YYAA 4U28A 2WOQA 4XTIA 1JULA 1LTDA 1G7UA 1B57A 3ABOA 2DZTA 3LB0A 2QCEA 4O13A 2Q3OA 4LVAA 2OJPA 2DZSA 3ZR4A 3L2IA 1ZAHA 2QAFA 4OWGA 1YXDA 1S5VA 2CLFA 3GR7A 1AW5A 1PL9A 4CCDA 2PRLA 1XI3A 1ZALA 4HIBA 1LRQA 7TIMA 3PWAA 2B7OA 1KM4A 3PB2A 3SSJA 3G1YA 1A50A 4AWSA 1QNVA 3P82A 4LT9A 5LNSA 3E12A 3Q94A 3FFSA 3EXTA 4BFAA 3NL5A 4JR5A 1RQEA 5TBOA 3RMJA 3OVRA 2B4GA 1DV7A 1KW1A 1TPEA 2AQWA 4UTIA 3NGJA 4ZZ9A 1PS9A 5HUOA 3LHWA 3QPZA 5BMWA 4NJKA 1RD5A 1TPWA 1KFKA 1WX0A 4A3UA 3UWVA 5I3HA 1FCUA 3P5ZA 3W87A 1OK4A 2NX3A 2OCZA 3LLFA 3BG3A 2J24A 2PURA 1JQXA 2AGKA 2RKXA 3UZ5A 4GXMA 1P5BA 2Y85A 4O1CA 4PTNA 5HINA 4LUJA 1JRBA 3MHFA 1C9DA 3DFQA 1Q6QA 1P0NA 2PC4A 1ICSA 3L5LA 1RQBA 2A6NA 4FIQA 5G5IA 1T96A 4OV9A 1SO3A 3TAOA 4RR4A 1H50A 1DHPA 3UXDA 4WJEA 4RK8A 2NZLA 3CIWA 2XFWA 1KM5A 3C52A 3F4NA 1KLZA 3W2KA 1GVQA 1W5MA 2TRSA 3L66A 5H2ZA 2CLKA 1HO4A 4YL2A 3TAKA 5FF7A 3UNDA 3PC0A 4QITA 3M5YA 3OIXA 1MEIA 1LORA 2PCQA 2FQIA 3IIPA 3WFAA 5D2YA 2VFIA 2EHHA 4JN6A 3TJLA 1M7OA 1RZMA 5G2HA 4NJHA 4PODA 2B7NA 1ICQA 2G5WA 1FWRA 2PRHA 3CLMA 3NQAA 4PH6A 1FDZA 3QSTA 3SJ3A 2X1SA 4OGZA 5G4WA 3OBKA 3U6WA 5D09A 1GOXA 5KTLA 1W0MA 2ZFAA 3H54A 1I8JA 1L9WA 1SSGA 3IVTA 5KSWA 5CKSA 3TR2A 1F05A 1F76A 1AW2A 2XN1A 4Z1BA 5EA9A 3NQDA 4XBSA 1EPXA 1PHWA 1TREA 2H6RA 3W1XA 4UNKA 5AYZA 3SR7A 4AVFA 1LBMA 1VCVA 3LCLA 5HR6A 4O16A 1KTNA 2GUUA 3HBLA 4DF1A 3W7EA 3EXRA 3LGEA 4XQ6A 2V8ZA 3L9CA 2C0AA 4PEKA 3UWYA 4A29A 5LHFA 1HFBA 1YPFA 5D2TA 3WJSA 4JGDA 3GXPA 2V5BA 3L0NA 4JTIA 3RLVA 1OG0A 2OMAA 1KFBA 4KWVA 4NXKA 1KFLA 2YW3A 3LTSA 4M7TA 4O15A 4U4MA 3NA8A 3IGUA 2F84A 1H63A 3VKJA 4RJEA 4WY0F 3QW3A 5G2IA 2X1RA 3S1VA 3SGZA 2OT0A 2ISWA 5CZTA 3VE7A 3FYOA 4NZFA 3TQ0A 2NWSA 3GDMA 3TJXA 3PR2A 4O18A 4R33A 4ZQMA 3GLCA 4NU7A 2HMCA 1TPH1 1UUOA 4GUHA 4CNOA 2B7QA 1VC4A 2OX1A 1FCVA 4JTTA 5BRBA 4IPJA 3T40A 5LKYA 2VENA 4GUJA 1K7FA 2J9YA 5D30A 4O8RA 1G4TA 3VI2A 4LUIA 1K8XA 1KFCA 3PSWA 4JX5A 1AW1A 1O60A 3PG8A 4AF0B 1TRIA 1QR7A 2Q8LA 3BW2A 3W7KA 2KZHA 4Z1CA 3IGXA 4LC6A 3W1AA 3Q37A 1PIIA 1HL2A 2A4AA 3W2MA 1TCDA 5SWUA 3M6YA 5T26A 3STFA 2ZYFA 4TX9A 1OX6A 2VFEA 1J2WA 3MW7A 4ZVJA 3F4WA 4AWUA 1W56A 1O94A 2QKFA 2YPIA 2CZ5A 3W1UA 3S5OA 3WJZA 1AL7A 1H62A 3M7WA 4RXFA 3PM6A 1QOPA 3N19B 4MZ1A 1GTHA 2NV2A 3MI2A 1LBFA 1OFDA 2ISVA 3IRDA 2VEPA 3A24A 1FX6A 1A5CA 4XKYB 1Z41A 2H3DA 1QPQA 2J88A 4ORIA 3R89A 2FPYA 1PVNA 3I7SA 2Z2UA 3THQA 3GKFA 4UTHA 5EL1A 4NNBA 4Y90A 1TTQA 1ZENA 4M6VA 1SZGA 2H8XA 3B04A 4O53A 2A21A 1DBTA 1GZGA 1ME7A 4UFKA 5EY5A 3SFKA 5D2WA 4WY0A 4MYAA 2NUWA 3P84A 4M6PA 3KHJA 3MUXA 5KZMA 4XUGA 3W1QA 2YZRA 2C16A 2WSRA 2VKZG 4LV4A 1W3TA 3M16A 3A23A 1B4EA 1LROA 2QUTA 4CNPA 4S2BA 4EF9A 3N73A 3CM4A 3DFNA 3QPYA 3N2XA 1I2NA 4A21A 3JR2A 2VFDA 1SUXA 5HULA 5A8GA 3OVPA 1OYBA 3L67A 5BNKA 4Z1AA 1KTBA 5KZEA 5D04C 1TV5A 3STGA 3MWAA 4XBKA 3PY2A 4OQVA 2WV8A 3HG4A 3NEVA 1Y0EA 3EXSA 3M44A 4LOCA 5AYYA 5D03A 5J5DA 5K4XA 3BO9A 5EKYA 1WOAA 3IV3A 3GKAA 4NJGA 1H51A 5D38A 4PL2A 1N55A 4QAIA 3S5ZA 2B7PA 4MLRA 3FIGA 3BK0A 3G0UA 4HSOA 3LERA 1X1OA 1O5KA 3O63A 4O28A 3PB0A 3WJYA 4LS0A 4Y96A 5D2VA 1A5SA 4PL1A 4XTDA 2WSYA 1OK6A 3G0SA 1C29A 4HNUA 3HGOA 3LI1A 3FYPA 3TROA 2E5CA 1LCOA 2P1FA 3MJYA 1EB3A 3G8EA 1FWNA 3DI1A 1FCQA 1SZEA 2ZBTA 2NXHA 1K8ZA 1W3NA 4ADTA 4K38A 3HQ1A 1KFEA 3G24A 1W5OA 4M7SA 4M5PA 3TU9A 2QCGA 3DHFA 1S3HA 5E93A 1G7VA 3DKJA 3I6RA 2ZZ4A 3TH6A 3NQVA 3L0GA 1H7PA 4W9TA 2YXGA 4EF8A 4RX0A 3FKRA 4O57A 1VZWA 4FIRA 4OHQA 4UTMA 3SECA 3VFLA 5DCEA 1TV7A 3GIYA 1VR6A 1R2RA 3S5NA 1TB3A 5L6UA 1LOQA 3BGGA 4D2JA 4MVAA 2DZVA 4MY8A 3SIZA 2EF9A 3P5YA 4OE7A 5DCBA 1P1XA 1LZOA 1W5PA 1H5YA 5AHIA 3MP4A 3TC6A 4ZMGA 4AAJA 4NNCA 1DORA 1K7EA 1JCNA 1G4PA 3HGRA 3SW6A 2AAMA 4NT0A 1FWTA 4RV8A 4JTFA 1P0KA 3LHTA 3LDVA 1WBJA 3AO0A 3G3DA 3L21A 2DZWA 5FEPA 1R2TA 3MBFA 1VHNA 1QWGA 4DBEA 1GVFA 2Y63A 1TJPA 2CZFA 4LWWA 3GXTA 3G3MA 1OFBA 4LS1A 2ZZ7A 3HB9A 2E1DA 3ZWTA 1QOQA 3S1UA 2QJIA 3GDLA 2ZTKA 4KWWA 3I7QA 3CWOX 3N9SA 1DQXA 4QNEA 2X16A 3CTLA 3S9YA 3CHVA 1K02A 4NJJA 4RCXA 3TIMA 3PG9A 4CQ9A 3B4UA 4QQ3A 4UFHA 3G1FA 4Y9AA 5CZJA 1KBIA 1TV8A 1BWKA 4I7VA 1JVNA 2B0MA 4UTTA 4DF2A 3BG5A 5LGXA 3T55A 1TPVA 3W7GA 1BTMA 3FJLA 4BF9A 3KRZA 2QDGA 1TPFA 4HT3A 1FXQA 1OHLA 5AHEA 1ONRA 1GEQA 2I9EA 2ISSA 5AHFA 3LRKA 4DBDA 4L4LA 1W1ZA 4E38A 4O54A 1PHQA 3HIJA 4O17A 1TQXA 3W7JA 2A85A 3NPXA 4MFEA 1LOLA 2X30A 2D73A 3LI0A 4AH7A 3R8RA 3P8IA 1X8FA 2NX1A 3QW4B 5F2IA 4AHOA 5DBUA 2YW4A 4JTLA 4QIUA 3UPWA 4WOQA 2WJZA 1KLYA 3R5EA 1JCJA 1SO6A 1VHCA 4OBTA 2YGYA 1A5BA 3P81A 1EP2A 1ZY9A 1SU5A 1ZAJA 3NPVA 4N02A 1R2SA 4OT7A 3ZS4A 2NLIA 3PUOA 3HMJG 2WO5A 3NM1A 3LHYA 4TIMA 2V5LA 2VFGA 4TMCA 3EWWA 3TC7A 3E96A 5I3IA 2FPVA 4KFOA 5DCDA 4N4QA 1FQ0A 3EX2A 4XWUA 5FEWA 2V2CA 4GE8A 1W8SA 3GXNA 3O07A 3PULA 4NUWA 2V2HA 3L5MA 3NYZA 1K3UA 3EX6A 3BGJA 1WYIA 5HQEA 1SFLA 1GG1A 4DO5A 3W3OA 5K4ZA 3QZEA 4WXYA 3TXZA 3W9ZA 5AC7A 2CFFA 3GX9A 5F1VA 2V81A 2Z0IA 2WQPA 4HHPA 1T0OA 1T99A 5CPNA 2ATSA 1H61A 5TQLA 3GK0A 2V30A 2R14A 4YMZA 5LHEA 2JKAA 3QMTA 3GDRA 1DVJA 2FJKA 5C55A 4O12A 4IXHA 4JDYA 5MHBA 1SR9A 1THFD 2J6XA 5AC6A 4BWLC 1TPUA 1H7WA 5J5RA 1ZAIA 4NZJA 4ICNA 4WY0B 4IMEA 3NDOA 3NL6A 4BWLA 4NVTA 4LU0A 1LM1A 2BSLA 4LVBA 3L0KA 3QF0A 1KM0A 4AMAA 3W7PA 1VPXA 3CPRA 3DFOA 1TO3A 4P2VA 1I45A 3FS2A 3LHZA 4FXRA 4CQ8A 4MKNA 2GVLA 1K03A 2DP3A 2Q3RA 3CT7A 4O19A 3B0PA 3NM3A 5FF0A 1OJXA 2QCHA 4IWWA 4Q4KA 2VEIA 1OFQA 3TX9A 3HG5A 3M41A 2JBMA 1EWDA 2YDAA 3N3MA 5K9XA 3W74A 2A2IA 4N6FA 1YDVA 2VC6A 1Q6OA 4KFPA 5DXYA 3C2VA 1VH7A 3KVKA 2QJHA 4O1BA 1WDWA 5G1YA 3W1NA 4X3ZA 1GTEA 5KMYA 2E09A 3MMTA 1QAPA 5G2WA 2X2GA 4OU1A 4C1KA 3CQ0A 3OA3A 2DJLA 3W7LA 2NX9A 3E0IA 1O5XA 1QDSA 1EWEA 4HSNA 4FXSA 4GRSA 4FX7A 3RU6A 2Y89A 3UWWA 2GQAA 3TFCA 5LGZA 1H1ZA 3HF3A 3P8JA 1SPQA 3KXQA 1ME8A 2E5DA 2DZUA 2DORA 3QSRA 4AB4A 2Y88A 4NJIA 1TPC1 1QO5A 1QCWA 3S42A 2WPBA 2H90A 3G1SA 2O7QA 4X9SA 3EB2A 8TIMA 4O11A 3LBMA 3MHUA 3I68A 4P61A 3S1XA 1OFOA 3NAVA 1RV8A 5KZDA 4UTLA 4JICA 1IXPA 2DJXA 2RDWA 1BWLA 5LSMA 1Z44A 3DU0A 5F2LA 2W6RA 3W86A 1L6WA 3GR8A 3IIXA 4O50A 3TMLA 4UTTC 1TIMA 4K8EA 4GFSA 3TSMA 1OF8A 4Q33A 3LXCA 4N2YA 4IX2A 3DFPA 2C3ZA 3F1QA 3TV8A 3NOEA 3ZFHA 1VJIA 3GVGA 5L9FA 4K39A 1I2QA 1LBLA 3P7YA 1OVDA 2J9ZA 3BLIA 3R12A 1NF7A 2JGYA 1O95A 4JD4A 3W71A 1YTDA 3CC1A 2EKCA 4MY1A 4RZ6A 1X1ZA 2CZDA 1K7XA 3NVTA 2VOMA 5CZ0A 3KX6A 2YX0A 3DI0A 3LRMA 3UY7A 4X2RA 1I2OA 1KM1A 5H91A 3GDTA 2ZA3A 4UFLA 4ZQNA 3TCEA 3UPBA 5D33A 3R2GA 4MUZA 4R53A 4LRSA 4O0KA 3RNDA 4H3DA 4LVGA 2BLEA 4RZ4A 1SO5A 3C2OA 2C14A 5E0KA 4FX6M 3MHGA 1RPXA 1V7YA 2CLOA 3M5XA 4I7WA 2A1YA 2ZZ5A 1TRDA 2YCEA 1G4SA 4I9AA 4YCOA 3NZRA 5DXXA 5FF3A 1IXOA 2ZDRA 2GPTA 4KFNA 1GVOA 4HPXA 4I7UA 2GVGA 4JTKA 3B0UX 1EP3A 1SZNA 3TSDA 5BW6A 4XZ9A 5C6MA 2XN0A 1BEUA 1U83A 3G1VA 3W84A 1W5QA 1E51A 1W54A 1AK5A 3IIZA 2C19A 1I4NA 1GQNA 2J9XA 2I14A 4JNMA 2VELA 1TTJA 2ZZ6A 3W7RA 2ZA1A 1J4EA 5A5WA 4AHPA 3GDKA 3S1WA 1JR1A 4K7YA 3O15A 5BMXA 2ZRZA 4CCEA 3HG2A 5CSSA 1S5WA 1W31A 1XCFA 3W7QA 5AOUA 3F03K 1VGAA 3M1ZA 2QCDB 5HMSA 1ADOA 3QC3A 3TW7A 1D3HA 2VEMA 2FB2A 5LNVA 5U7SA 1QPOA 3CIXA 3IIVA 4MJZA 3RF9A 1DJNA 3P62A 1OFPA 4JIQA 3UD6A 1DKWA 3ABQA 4IGHA 4FNPA 2H8ZA 4IQLA 3W73A 4O52A 1N8FA 3NQ7A 3BLFA 1SQ7A 4UTJA 4MIMA 3GB6A 3VNDA 3W2JA 2QCLA 6TIMA 3NPUA 2P0OA 1R47A 2QCDA 1AL8A 1YDNA 4UR7A 3QM3A 1KM3A 4TU1A 5G1TA 1YADA 3CU2A 4IMGA 3MYPA 5EPDA 1EUNA 2CU0A 2G96A 1S5TA 5FEZA 1WQ5A 3G1AA 1YXYA 1A5AA 2DU2A 4MZYA 3OEXA 2A7PA 4ZQOA 3LCIA 2NV1A 3QRHA 3R13A 4FNRA 4KKXA 1JCMP 1EX5A 1XBVA 2QCMA 3OHIA 4FEZA 1RR2A 4UTUA 2YYTA 2ZZ2A 2NUYA 1FUYA 3MI3A 3NO5A 4C1LA 4IMFA 1MO0A 5K2ZA 2X1TA 2ABAA 2XN2A 1IXQA 1XC4A 3LV5A 2Z1BA 4WUIA 3PUDA 4MPQA 5CZSA 4TR9A 2QCNA 5HR7A 1OX4B 3FA5A 3P60A 2Z6IA 4N9EA 3UZJA 3TNOA 4Z0SA 2W79A 2EGZA 1MEWA 3W76A 3WK0A 2R8WA 4HNNA 3PAJA 5F4WA 1M7PA 3T7VA 4JIPA 4ALDA 1JCXA 3WK1A 1VCGA 2A6LA 3GNDA 4JTJA 4UCGA 1TJRA 3C4UA 3W7CA 3LHUA 3KVJA 3UWQA 1LYXA 2NUXA 2WNZA 5HJLA 1F73A 1OX4A 1Q6LA 3I7RA 3TXVA 1G4EA 1ICPA 4A2SA 2QUUA 1J5TA 3Q2DA 4A22A 3C2RA 4N6EA 1LLZA 1EA0A 3EWYA 4YXGA 4JX4A 4UC5A 1KBJA 1X7FA 1UCWA 1LLWA 5BOOA 3IEBA 1OABA 4JDBA 1PCWA 4UTWA 3HJZA 3FKKA 3M43A 3BARA 4BR1A 1T8XA 1F74A 3LCGA 4QM1A 1XUZA 1VLIA 1F5ZA 4UMCA 5CPOA 4MZ8A 3W7MA 3QMSA 4AF0A 1GYLA 3OVQA 3A9IA 2IQTA 5HWJA 5AN7A 3VCRA 4DQWA 3W70A 2ZRYA 3W85A 1WXJA 3NQ6A 3W07A 2GQ9A 3DFSA 4LVFA 2JKEA 3C61A 1H7RA 3C6CA 3EWBX 2Y70A 4BI6A 1B4KA 1GYNA 1XM3A 1XDMA 3LTYA 3W1MA 4GUGA 1IF2A 3SY5A 1KFJA 1HUVA 2QCCA 2WNQA 4MYXA 4MFDA 5DBTA 1SO4A 3WJWA 3LXBA 4AEOA 2ZA2A 1HG3A 4WQ6A 2HSAA 3PSVA 5GVJA 2FB3A 4IX0A 3C56A 5ABTA 1G67A 3P61A 4B5NA 5DN1A 3W2UA 4YCPA 1O4UA 4JXCA 4UR8A 2Y7DA 3STEA 4EIVA 2ZZ1A 2A7RA 2YFOA 2H3BA 3PBVA 1IIGA 5EYWA 5E1QA 3GZ3A 3NG3A 2ABBA 5C2XA 3SZ8A 3S8HA 3TFXA 3UWUA 1VYPX 1K8YA 1WA3A 2RHGA 1GJPA 3DH7A 3BW3A 2VFHA 3W1PA 1WBHA 4WX2A 1XKYA 4L4MA 2RH9A 1H7XA 4R34A 4JTHA 1FDYA 2VEKA 2E6DA 3B8DA 4O0ZA 3O05A 4PA8A 3W1RA 1CW2A 2FPTA 1RVGA 4CLMA 1UB3A 4N9CA 4K37A 2NXGA 2PRMA 3EWZA 4RKAA 3Q58A 4R7JA 3DZ1A 3V1PA 1OX5A 2RDUA 1DJQA 2C18A 1ZFJA 3DBPA 4O4WA 1D3GA 3LCHA 1FCBA 3K30A 3MYOA 3TSBA 2C13A 3TKFA 2EPHA 3LLDA 2GJNA 4K7VA 2JK2A 2ATMA 1XBYA 5FF4A 4ORMA 2EAWA 5LNRA 4ONVA 1FDJA 4TMBA 4LY8A 1YXCA 1KM2A 3HO8A 3QMRA 3LX9A 3W23A 3GAKA 1GVRA 4UFJA 3GAYA 4AWTA 2RDTA 3GYEA 4DPPA 2QJGA 5CPMA 4QJ1A 3LM7A 5IBXC 1ZHAA 1DOSA 3FOKA 2BZNA 3BV4A 1Q6RA 4JTEA 4LW7A 3FEMA 4UMBA 5D2XA 1F6KA 2YFNA 4DF0A 1FWWA 5C5YA 1NFBA 3G22A 3FJ6A 4LVDA 5CGQA 1TMHA 3NQMA 3USBA 3PUEA 1A53A 1FY6A 5KINA 4JS3A 5LZLA 3KVLA 1GWJA 3M9YA 3N9RA 3NQGA 3M0ZA 5IM51 1ME9A 4FNTA 3LCXA 4ADUA 4E0CA 4PCFA 1SSDA 1QPNA 3NQCA 1ZCOA 3T78A 3C0JA 2O7SA 2FFCA 1NF0A 2E77A 4S2CA 2Y7GA 4JY9A 2X1UA 3NL3A 5K9DA 4HNVA 3MO7A 2YYUA 2VXNA 3M5ZA 3WJXA 3TK7A 1DQWA 3AJXA 3NXFA 1H7NA 1JUEA 3U2OA 2QUVA 2E68A 3DAQA 4XKYA 3EX3A 3IVSA 2ZTJA 1GT8A 1IGSA 2HTMA 4GBUA 5D05A 1UUMA 4Z0JA 1G6CA 3W88A 1WAUA 4H6KA 4N9BA 1F7BA 5F4XA 5F1UA 4ZQPA 5KITA 4RLIA 3W22A 3B05A 3CWNA 2E5BA 4WXZA 4HPJA 3DENA 1TQJA 1GVSA 1B9BA 2OZ0A 2PE4A 3PBUA 3RFAA 5HWMA 2ALDA 1R30A 4Z1DA 3HPXA 2QEZA 3PVFA 4NX0A
chains in the Genus database with same CATH superfamily
2O4QA 1CB7B 4BK9A 4GUIA 3W82A 2XYLA 2XZ7A 3PPGA 1J6PA 4JKMA 3H2AA 4X22A 1WOBA 4JTUA 4Z42C 5CGTA 1TR9A 1CI1A 1RUSA 1BVNP 1UKOA 3TN5A 4P8UA 3MDUA 1YLVA 3NQFA 3A5FA 2XTKA 3O0KA 5EBUA 2CLLA 2XPKA 1NDZA 4AW7A 2VVNA 4DEFA 1X6NA 1IXNA 1UJQA 1BYBA 3IJ6A 2GFTA 1C93A 5C7VA 4NASA 3QOKA 1EF2A 4M81A 1S39A 4IPPA 1Z3NA 2PDLA 3CHDA 4CQAA 1HKJA 3MMDA 2VQTA 3SGGA 3M0MA 4LNYA 4G7EB 3AICA 1ELSA 1XJBA 3DG3A 5FF2A 4MADA 2BXYA 4H9TA 4QQUA 2WMGA 4L5ZA 1H11A 5I3DA 3KCLA 1MW1A 2V6AA 2R24A 1XYMA 4YLWA 4Q7BA 3RJYA 5AFDA 4I6KA 4RNIA 2VRQA 3TYUA 3P74A 3K4WA 1VBGA 3T08A 4XZWA 4XUYA 1O66A 3MBDA 2VCBA 1VBJA 4TOQA 3CQHA 1VLWA 3LOTA 2Z6JA 2Y8KA 5IDZA 3I3DA 3SCWA 1MXSA 3OO2A 5U4NA 1CCWB 5EMUA 1JYWA 1ZP4A 3CQIA 1EQPA 2CWNA 1DWFM 4F0KA 3N15A 4KRTA 3DHUA 3R4IA 1H1YA 3N1AA 1XP3A 5LIXX 1NH6A 2XFFA 3U8GA 2CZVA 1GCYA 2CW6A 1XYLA 2TSYA 1PTDA 1YPIA 1EHNA 4H7VA 2F9RA 3COTA 1KTCA 4MDPA 2WSKA 3MKVA 3CGTA 1H7OA 4UNLA 5HATA 4N9DA 3YPIA 4HU0A 1WV2A 3S4TA 3NNTA 2CLHA 3EPMA 3ZYZA 1ISVA 1P4CA 3UCDA 2A3CA 4DO6A 1VRXA 1MSSA 4HNTA 3CS2A 4IUOA 3EKGA 4JTSA 1OIMA 2DH3A 3ABRA 4GOAA 3DGRA 3F4VA 1L6FA 2HS6A 3WBXA 4IMDA 4DAIA 5E5CA 1Q7ZA 1W3LA 4BKNA 1TX0A 2F7FA 3W2NA 3VD3A 3WQGA 1XYFA 4ZL1A 2RGLA 1I2RA 3FA3A 5LNWA 2CLIA 1GQJA 1UASA 1J9YA 1QO2A 4AZ7A 3C86A 3E2QA 3UR2A 4NX5A 3UNTA 2ZCGA 3RPMA 1FP8A 4NILA 3W37A 2Y6ZA 3L4ZA 3I65A 3N6QA 2FLIA 4AHQA 3IIOA 2OLSA 2YCJA 2WHJA 4V1XA 2PDXA 1UR1A 4H2CA 5DMLA 3IVUA 1DWJM 1PTGA 5HNRA 1EF3A 3L5AA 2HPIA 3KBNA 3KBVA 1X6UA 5AHMA 1PE1A 5HXMA 3U5YA 3W83A 4W4QA 3A3XA 1F4AA 1GVIA 4GMEA 4LRTA 1UP3A 1TCMA 1RLDA 2XIJA 3DG7A 1QI4A 4AUBA 5CAHA 3T0TA 1NARA 3FJNA 2WVUA 3WD3A 3LMYA 2JEQA 2OLHA 6XIAA 5FJRA 3K4AA 3B40A 5I3FA 5DY3A 2PGWA 5EMJA 3MS8A 3TYAA 4FR1A 3INPA 3PN8A 3FDGA 1FRBA 2R94A 3H53A 2B81A 1Q85A 4GNJA 1C8VA 5H1WA 1MEHA 4B92A 3IUDA 3UG8A 3NVDA 4O10A 4UFMA 3UJEA 2QCFA 3LSBA 2OSYA 3UR8A 1SW7A 4PULA 2W0UA 4WKAA 3QQ1A 1EGZA 2PD5A 5CC6A 4F2BA 2WWCA 1D8CA 4ML9A 4C7FA 1VYRA 1X97A 4I5UA 4LV9A 2YDRA 2Z1WA 1E6RA 3EDEA 4JIEA 3GNNA 3G1HA 4M29A 1GQKA 2PWEA 4NQ1A 1ZRQA 4ZQRA 3LQGA 1G69A 4LUSA 4PC8A 4WK9A 3WQ5A 3EA1A 2BXVA 4W85A 2TYSA 1EBGA 3JS3A 4U3AA 4C7DA 2WC4A 3GRIA 4QNWA 2Q8ZA 3QR1A 4X63A 3KTXA 1MZHA 4XX6A 3G1DA 3EOEA 3O9NA 5CSRA 3IJ8A 2YR1A 3FLUA 1QFEA 4JTQA 3MP5A 5A6AA 3HG3A 3PZTA 3RK8A 4IPIA 1C91A 1M68A 4Q4QA 4X0NA 4D8AA 2WVSA 1EP1A 1SZFA 1V93A 3UVIA 3UYCA 3LCFA 4FHAA 3CTTA 3N34A 2E9MA 3JUGA 1FFQA 4YS1A 2BWGA 1XG3A 3NR0A 4QE4A 3RLUA 5A3HA 3RCNA 3A4AA 3OLDA 1Z42A 3ES8A 4YVPA 4D8LA 2PDBA 2AQOA 4YVXA 3D3AA 2NW0A 1NY1A 1JZ2A 3BW4A 4XZHA 4GC4A 3CLWA 4UUIA 3QV8A 1W1YA 6CGTA 3GW0A 2REQA 1RQHA 4H9ZA 3WLNA 4K36A 2PLMA 1IEVA 1FBAA 2NXIA 5HWNA 3VOJA 4WF7A 1JULA 1LTDA 1G7UA 1B57A 2DV0A 5CSUA 2SFPA 2RDXA 3QR3A 5EFDA 2CLFA 3GU9A 5A2AA 4QBXA 1FVPA 1PL9A 3LK6A 4YTTA 1TE1A 3N11A 4HIBA 4HB7A 3OVGA 3VOIA 5LNSA 3ICJA 2CHOA 2C71A 1R3TA 1TZ9A 3Q94A 4E6MA 1PZ1A 3AUOA 4MWAC 1RSCA 3QY7A 4XG1A 3AHYA 2V69A 1KQYA 2B4GA 1KW1A 1PS9A 3KZSA 5HUOA 1DIDA 3QPZA 4CN1A 2P8CA 3N04A 4A3UA 3AWNA 3MSGA 5I3HA 1W1IE 3EEZA 3JZUA 1OK4A 2NX3A 4GCXA 4GY0A 3LLFA 3QGVA 4I8DA 2RKXA 1JF6A 3UZ5A 4HK5A 5HPOA 2G0WA 1JRBA 2BASA 3MHFA 2PC4A 3NQBA 1ICSA 2DIKA 4QROA 2WBKA 4FIQA 5G5IA 1XKJA 1T96A 3ECQA 1DJWA 1H50A 2WCSA 4WJEA 3WH6A 8XIMA 2XFWA 3C52A 3F4NA 3W2KA 3BC9A 4UOQA 1UKQA 4F66A 1HO4A 3TAKA 5FF7A 4QITA 2IPJA 4B3ZA 1LORA 1XYZA 4Q4SA 2Z1VA 3ME3A 4JN6A 4MG4A 3ANVA 1M7OA 2OWCA 5G2HA 2XH2A 1ICQA 3VNMA 3H26A 1A47A 1PXGA 1MMFA 4LEFA 1E6PA 2OLAA 2ZFAA 1Q8AA 2XVGA 3H54A 4GY7A 3WLJA 3RM9A 4H7CA 3MJMA 1Y5VA 1F05A 3MB9A 3TOYA 4Z1BA 5EA9A 1IEQA 1TREA 2H6RA 3W1XA 2CYGA 3C8NA 3SR7A 2XSAA 4O16A 2BHYA 3HBLA 4DF1A 3HTWA 3OYZA 3I10A 3ARSA 1XG4A 4A29A 2G3FA 5LHFA 3ZSTA 3VIGA 3FDKA 1C8YA 2PGRA 3UT0A 1JZ5A 3WLSA 2OMAA 3NJ3A 1GOQA 4LXFA 4AXNA 2F84A 1EZ2A 1H63A 3VKJA 1QNQA 2BOGX 3D47A 2VGBA 3TQ0A 4F2UA 3AXMA 4O18A 1TELA 4YN5A 1TPH1 1VC4A 4G5DA 5EMMA 4JTTA 5DEZA 3T40A 5LKYA 1YMYA 2D2JA 2PLCA 1D8WA 4TUFA 4ZODA 4O8RA 4IQEA 2Z7GA 1KFCA 1UD5A 5EGRA 3VM7A 4JX5A 1AW1A 1O60A 3PG8A 1TRIA 5T9BG 4AY7A 4RDVA 1F3EA 4Y9PA 3K5XA 4LC6A 1E0TA 3M6YA 4XZIA 3S47A 3SCSA 2VFEA 1J2WA 3MW7A 1UR9A 4AWUA 3VIMA 1O94A 4W5UA 2Y2WA 2CZ5A 5FAGA 3URBA 4Q4OA 3S5OA 3SY8A 3WJZA 3WQ4A 3U4FA 3M7WA 1PYMA 4WRHA 1DYSA 3LLXA 1QOPA 3U48A 1Q7QA 5E0CA 4MZ1A 1GTHA 5M17A 4JBRA 1DHKA 4MHBA 5AKQA 5XIAA 1V6VA 4ORIA 4BQ2A 4DXXA 4P7OA 5EL1A 2QVNA 3WBEA 4NNBA 3U4AA 1SZGA 1XD0A 3B04A 3AIEA 4J3WA 1DBTA 4MJ4A 4H6RA 3MVIA 2VZOA 4CU7A 2FFIA 4QR6A 3VX1A 4PMDA 2P8BA 3M0VA 3MUXA 5KZMA 2WC7A 4LV4A 3FV9A 1TKKA 3A23A 4UOZA 3QV7A 1XS2A 1LROA 2EEXA 2QUTA 4HYWA 4QDWA 3N73A 4XO7A 3DFNA 1GK8A 2J74A 3JR2A 2VFDA 4A8LA 1OYBA 3L67A 5A6JA 4Z1AA 3AS1A 5KZEA 4R27A 4GHRA 2IKGA 3QFWA 3WLPA 4XBKA 1EHAA 4YVVA 3PY2A 1OIFA 1POJA 1UQZA 5GNXA 1B3ZA 3FHQA 5AYYA 1KCLA 5K4XA 3BO9A 3TP4A 3KM8A 4L7ZA 1HX0A 3IV3A 5D38A 4ERGA 4QAIA 2B7PA 1R3WA 3DECA 4DBSA 1RD6A 1XC6A 3O63A 3WJYA 3CL6A 4Y96A 5D2VA 1A5SA 4XTDA 1O5RA 1OK6A 4PUKA 3ITLA 3HGOA 3KBWA 3TROA 1BRLB 1TA3A 2E5CA 4A35A 1FCQA 1SZEA 4REQA 4V1YA 2VWTA 4ZXOA 3HQ1A 2IPFA 1ONWA 3EOUA 2BMBA 2GWGA 1E56A 4GO8A 2WKGA 3AMDA 1R9ZA 3MUIA 2QCGA 3TCSA 2VTFA 1OINA 4DUVA 3PZIA 2NQ9A 1H7PA 2D20A 3ITVA 4RX0A 2YXXA 3XISA 2OO6A 1V6XA 3KL5A 4UTMA 4REQB 3SECA 1A0CA 2CEQA 3GXMA 3R0UA 5HJXA 1QHZA 2QGHA 1HL9A 1UH3A 3ZR6A 4MVAA 3SIZA 4OE7A 4NZ4A 5DCBA 3D3FA 1P1XA 1UR0A 3ITCA 1LG2A 1LZOA 3VGFA 1W5PA 5AHIA 3O2LA 2DUZA 4RE2A 4TTUA 1WO2A 1K7EA 1JCNA 3SRFA 2AAMA 1GKPA 1R86A 4RV8A 2ZUVA 4QHRA 3UG5A 1WBJA 3OBEA 5HNNA 4OZOA 3EAUA 4K68A 4A3RA 3G3DA 5FSDC 2E0PA 4JNZA 3PZ9A 2CETA 4GIEA 2J7EA 2NQLA 3L4WA 1TJPA 4H2HA 1UKTA 3GXTA 2F61A 4ZO8A 1O7AA 4IFKB 2JFEX 1QOQA 1WZLA 4PMJA 3GDLA 3SM0A 1RJQA 4IHCA 2PPGA 4B90A 3CHVA 4QFUA 4J3ZA 4U10A 3G1FA 5CZJA 2XVNA 1W3JA 5BZAA 1XQKA 4GPNA 4ATLA 1SZRA 4XAFA 2OSXA 2QDGA 3OTRA 3DYMA 2I9EA 2ISSA 5AHFA 3FN9A 1HN1A 2W91A 4O54A 4JN8A 1PHQA 5A6LA 2A85A 3UVAA 4GYFA 2PP1A 2HXTA 2X30A 2D73A 1R3QA 4AH7A 1Q4NX 1F61A 3FSTA 3RG6A 1E73M 3P8IA 2HROA 2BVTA 3ALFA 3PJTA 1Y5XA 3QC0A 6ENLA 1QK2A 5DBUA 4KESA 1GVEA 2YW4A 4JTLA 2FZNA 3RR4A 4QIUA 1RA5A 1J11A 3R5EA 3OHMB 1JCJA 2YL8A 3N2BA 1VHCA 4OBTA 1A5BA 2QLYA 1DIOA 2XISA 1ZY9A 4U33A 4N02A 1AJ0A 1R2SA 2GJXA 3ARVA 2NLIA 3VFCA 1SJBA 2CITA 4GVIA 4TIMA 5IXEA 4PMVA 1Q13A 2FGBA 3T6CA 5I3IA 2XH0A 5DCDA 4N4QA 3F5JA 3IJIA 1MUWA 2DUAA 1OY0A 1YKWA 3WLHA 3L4YA 1W8SA 2FYMA 2IKIA 3PULA 2YKKA 3EX6A 4L64A 1GG1A 4DAFA 2WVVA 4DO5A 4DUOA 3TJ4A 1BWVA 2WW5A 1OC5A 2PDQA 4WXYA 3TXZA 1AODA 1W2PA 3GX9A 3VPLA 3H7UA 2Z0IA 1N8IA 3OLEA 1H61A 5I24A 4HMNA 2CXGA 3GK0A 4JEJA 1R9XA 4Q8TA 4GX9A 1DWHM 1W9VA 1E1CB 1BXNA 3GDRA 4D6FA 4DZAA 1K1DA 5AC6A 1KGXA 2J66A 1H7WA 1IZJA 3MKKA 4WY0B 1ADSA 3WBYA 4NVTA 4LU0A 4AZCA 3H2MA 1TJ1A 4LVBA 2PDWA 3AIVA 5G1MA 4XZLX 1TO3A 3AXXA 1OBAA 2GJPA 1I45A 3PAOA 2DP3A 2Q3RA 2J7HA 3PFRA 3B0PA 3NM3A 1YEYA 3BAIA 3CB3A 4EK7A 2QCHA 4IWWA 1OFQA 3N6HA 1Q6DA 3M41A 1EWDA 4GLEA 4IPLA 3W74A 2DH2A 2OOFA 1YDVA 2VC6A 2VDHA 4Y8EA 2RAGA 4H9UA 2QJHA 4O1BA 3R58A 1PSCA 1WDWA 2EPLX 4PMQA 4W7VA 3W1NA 3VDBA 5HNTA 4TXEA 3WEOA 1QAPA 3SUWA 4C1KA 4HHHA 1HL8A 3CQ0A 3W7LA 1O5XA 1QDSA 3VUPA 2OU4A 4H8HA 3VOHA 1FWGC 5LIYX 1EJTC 3IV8A 1V3MA 4FX7A 2Y89A 4WJ8A 2DIEA 3B97A 2X7WA 3W27A 1KD0A 1O5QA 3P8JA 4D6DA 3GH5A 4AB4A 1QO5A 1P6BA 2G3JA 3E2VA 6A3HA 8TIMA 3LPFA 3MHUA 1RY0A 3RAOA 1VB9A 1W3KA 2BVYA 4YTUA 2XFYA 2VNCA 4LF2A 3ZO9A 5KZDA 2PWGA 4UTLA 1IXPA 2DJXA 4W84A 5LSMA 1Z44A 3VU2A 2PDIA 3BZGA 2FVMA 1CGXA 3IIXA 3M6DA 3IJDA 2BGSA 3TSMA 3NOEA 2X05A 1HJQA 3LM3A 3CWHA 1I2QA 1XYBA 4ZEPA 2G50A 2CERA 3MCNA 3OGRA 3A4WA 4ZO7A 5D9NA 3PTMA 3VDCA 2EKCA 3C0LA 1X1ZA 1XW8A 4OBSA 3QKZA 1K7XA 4EPBC 4F48A 1KCXA 5M5DA 2F2KA 2PLKA 2YX0A 3LRMA 4R85A 3WNLA 1AQ0A 1TIWA 2CNCA 3BJFA 1ZU8A 4JQ1A 2NQJA 4B2DD 2ISDA 3DYPA 4S23A 3EDJA 5CBBA 4QJ4B 3SIMA 4RZ4A 3C2OA 1MRAA 1PBGA 3LN3A 1T5AA 3MHGA 1UC4A 1V7YA 4KRUA 3M5XA 2A1YA 5JMUA 2ZZ5A 3MV11 1XIBA 2WNWA 5FACA 4I9AA 1F07A 1E6ZA 4IP5A 2VX7A 3AS3A 2GPTA 1EDQA 4HPXA 3AZRA 4I7UA 3UXIA 3CO4A 3HJEA 1EP3A 3B0UX 1SZNA 1KFWA 4RW3A 2XN0A 4Q4RA 2GWNA 1Y65A 1WNOA 2J9XA 3VKDA 4JNMA 4IT1A 2ZA1A 2CXEA 5A5WA 4AHPA 8RUCA 1YPXA 1K77A 1GHSA 3KW3A 3O15A 5FJPA 1V03A 2V3FA 2ZRZA 2OODA 3BCDA 1XCFA 3ZVHA 3F03K 3TYBA 2D2GA 5HMSA 4HNCA 1SJCA 4H9MA 4HHMA 1D3HA 5U7SA 1QPOA 3AXIA 3MZNA 4H83A 3CIXA 3CPUA 2Y0FA 4HMEA 3UD6A 1DKWA 4WSKA 2ASHA 2H8ZA 3B8TA 4O52A 3NQ7A 4C6LA 1V0LA 4UTJA 4U3CA 1NFPA 4KEMA 3VNDA 3FK4A 4UB9A 1YDNA 4RPQA 4QGCA 3GVRA 1YADA 4BQ4A 5EPDA 1H5VA 2XH4A 3G1AA 4ZE5A 4KW2A 3QTPA 2DT1A 3ZLGA 2A7PA 3DUGA 3CO8A 1F4HA 3W00A 3V3WA 4A8IA 1EYEA 3R13A 1EJVC 1O1ZA 3CJPA 4DBWA 1K9FA 2EPOA 2YYTA 4TX8A 2YA0A 3IGHX 4JIHA 3FCPA 4O0QA 1Z9AA 4ROPA 3MUCA 4IMFA 2ZUMA 1FWJC 4GISA 1JF5A 2X1TA 2GSHA 2OWWA 1OGGA 3BMWA 2GDVA 1JGMA 1CDGA 3NGFA 3KZPA 4DM2A 1HZYA 4TR9A 6REQB 5HR7A 2QMJA 4EXQA 3FA5A 5LIUX 2J7BA 4N9EA 3UZJA 4PUDA 3TNOA 1F9CA 2W79A 3UW6A 2WANA 1RJPA 3WK0A 4PUJA 2R8WA 3PAJA 1NTHA 1M7PA 3RGTA 3U57A 4AFYA 4XK2A 1JCXA 2J7DA 4D1JA 2HWGA 2PBOA 3LHUA 5KETA 5J04A 5FL0A 1LYXA 3I7RA 1SJAA 1BSIA 3E0LA 3QHNA 1ICPA 1TVLA 1ZTVA 2JE8A 4XSMA 2QUUA 1J5TA 3Q2DA 4QE1A 3C2RA 3WMSA 2ZVIA 1EA0A 3EWYA 4GNVA 4YXGA 4YPJA 3UCCA 4KEZA 4OOZA 1BYCA 2PEVA 1OABA 4JDBA 1UD2A 3GDBA 1R3SA 3M0KA 4PUWA 3WD2A 3BARA 3WQCA 3PTQA 2CBUA 5EMKA 3LCGA 1QNPA 1UZDA 3UYIA 1F5ZA 4KBXA 4JFUA 4UMCA 1MDLA 3DCPA 3GYCA 1GYLA 1W9PA 4ACZB 1FOBA 2AMXA 2IQTA 5AN7A 4LF1A 3VCRA 4ES4A 3W70A 3CASA 5B80A 1WXJA 4S38A 1U2YA 4LYRA 5I0DA 4LVFA 3R1ZA 1H1NA 4P8WA 3LTYA 2DSKA 1L8NA 4GUGA 2UY4A 5A8PA 4WKFA 2X7VA 2QCCA 2XVLA 3R11A 1XLCA 1R3RA 4D6CA 1VBRA 1XLAA 3NSNA 4AEOA 2Z28A 3BURA 3HQNA 3TTSA 2Q71A 4LAUA 1S3TC 1JPIA 2GOKA 3W2UA 3CPGA 3VVGA 4M6UA 4Q3MA 4AY1A 3MCOA 4M0XA 4E8CA 4Q8UA 3DEQA 3NG3A 2ABBA 3TFXA 4DLFA 4DRSA 4MWAE 3FX4A 5T8GA 1C8QA 3W1PA 3RMEA 4L4MA 4DWSA 1FDYA 4J40A 2E6DA 4O0ZA 4PA8A 1CW2A 1RVGA 3HV8A 3U3HA 4K37A 2NXGA 1QBBA 4RKAA 4UCFA 4R7JA 4RNHA 3CZJA 3II1A 1DJQA 2P3EA 1B0IA 3LPGA 4O4WA 5A1AA 1D3GA 4NZ5A 3GM8A 3K30A 1MUMA 4H6QA 4L61A 5H8UA 1OADA 3TSBA 2OOGA 2PGEA 1XLBA 2C13A 2EPHA 5LYRA 2GJNA 2PTYA 2JK2A 1XBYA 4HK6A 3BL3A 3BQ6A 5M03A 1UKPA 1KM2A 3FAXA 1R5YA 4J3XA 2ZXAA 1AZ2A 2HK0A 2RDTA 4DPPA 4QJ1A 2KX9A 2WHMA 1PJ9A 5IBXC 5DQPA 3FOKA 1A5LC 1J6OA 4C6BA 1EO7A 1F6KA 4DF0A 4QJ5B 1NFBA 3G22A 1IR1A 5CGQA 2QGYA 1Y8BA 3NQMA 3USBA 1A53A 4BA0A 4QDPA 3GH4A 1FY6A 5KINA 1BXBA 5LZLA 2PCEA 3KVLA 3M9YA 3N9RA 3NQGA 5IM51 1EXPA 4FNTA 4ADUA 1NP2A 1XH2A 2BODX 3WQWA 4IZGA 4E0CA 3E5PA 4J1OA 1SSDA 3NQCA 3GNPA 2Y7GA 2ZC8A 1AD4A 5DX7A 1C9WA 3QBUA 5K9DA 3MO7A 4BQ5A 3DDMA 3AJXA 5I6SA 1SMDA 4DLMA 1UUQA 4B3LA 3IVSA 2ZTJA 4HMDA 1UUMA 4FMVA 2O9OA 3UG3A 1Q6EA 1WAUA 4H6KA 5F4XA 5F1UA 4ZQPA 5KITA 3HA1A 3TYCA 3AYSA 2XFRA 4HPJA 3QHMA 3T05A 4XO6A 3ERPA 4PB3A 3NZQA 2UY3A 3VIJA 2PE4A 3PBUA 1UH2A 3N9KA 2WMKA 4Z1DA 2GVYA 3PVFA 4KETA 1E43A 1XLGA 5JBEA 5A2CA 4XZMX 2GOUA 2Y24A 2J75A 1JAEA 1Q5MA 4WCJA 2GK1A 1E9ZB 4LBSA 4GQGA 3KRUA 2F6KA 3KLKA 4YJ5A 1JZ4A 3OA5A 4EWND 4LGXA 3XIMA 3HGSA 1RBOB 3GZAA 2ALRA 4UQCA 4L6OA 4EXAA 3NQ2A 2FZDA 1EEXA 1VYSX 2I1OA 4GH3A 3RX3A 1HVQA 1RCXB 1QPRA 5I3KA 5I23A 1JQVA 2XIBA 3T44A 4XD6A 4RZ5A 3EWXA 1H09A 1CX9A 4XAGA 4UQAA 1UZHA 2G95A 2B31A 4JYEA 1XFBA 1FTXA 4PB5A 1WCGA 4KCUA 2CLEA 5EMYA 3B03A 4E2BA 3TWAA 2WSQA 3QEZA 3E9AA 2AQVA 2FHCA 3WH9A 5XIMA 2Y8UA 3CEPA 2ZQ0A 1F8IA 2CZEA 4IIFA 3T8QA 2X1IA 2EJAA 3USZA 4FOKA 1L6YA 3K1DA 3H2FA 4H4IA 1XWYA 4U5IA 3EWUA 1CXEA 4FNQA 3HQPA 1JDEA 3ZSSA 4LFYA 3IGSA 1B1YA 3AWOA 4M19A 1OM0A 1UBSA 2ACRA 1KRCC 1H60A 3SGUA 1XRSA 4WSJA 4CD6A 1JCLA 2WNNA 5D37A 4ZTXA 4CD7A 3RXZA 4BJHA 2DZXA 1OYCA 3BLEA 4JZ5A 1GUVA 1ZLPA 4HK7A 4Z08A 1SW3A 3S2MA 3L2MA 3DOPA 5D32A 4AD5A 3W6YA 5C54A 4WOZA 2IXUA 4JX6A 3MUZ1 4W89A 3TLLA 3SO7A 3S0CA 1SFJA 1NM9A 3SI9A 4YWIA 2GJLA 4CCCA 3C3NA 4DXVA 4OBRA 2CHRA 3W7IA 1IIHA 3W2LA 1NSJA 4L9XA 4G7EA 4RXGA 1LRNA 3ABSA 4IL0A 3HM7A 1DXIA 1AMKA 1JL8A 3NZ1A 1G0CA 4TO8A 4P8VA 5AHNA 4G1KA 2E6AA 2E8YA 5LNUA 3BLDA 3LBCA 5HANA 3QYQA 2PD9A 2A0NA 3SQSA 4IM4A 4F3HA 4W93A 3G0XA 1BYAA 1J2BA 2VRKA 4BI7A 3UWZA 4MTVA 2Y5JA 5G4EA 4DPQA 2ZZ3A 3THUA 4O1AA 4HN4A 1GZ1A 3THAA 3AXHA 3PWIA 3KFTA 3AIBA 1KKRA 2D2HA 2VHLA 3W1TA 2AL2B 4NAFA 4Y2WA 1EJUC 5EFFA 1ZSXA 1ODUA 4B15A 3C2EA 1FWSA 4GYKA 3B0XA 2V9DA 3N14A 3S5YA 3BMXA 4FX8A 1NIUA 1EIXA 4PCNA 1JPMA 5K7JA 2HNEA 2CBJA 4ZB5A 2FZMA 3UQNA 3W72A 3D0CA 2OEKA 2D0HA 1OCBA 5FD0A 3WQEA 2GUBA 4XD5A 3M5VA 3W7OA 3DXIA 5FL1A 2QF7A 1M03A 5E9AA 4FS9A 3ATYA 1OEPA 4AX6A 2UY2A 3THDA 1Q66A 4GGHA 1KBKA 1OGBA 9XIAA 2Y7EA 3W4RA 3CB8A 1AH0A 2NQ5A 1J0ZA 1DL3A 3LNMA 6ALDA 3FGCB 2BX7A 2ZRVA 4KEVA 2D0GA 1R46A 2IXVA 5D9PA 3W75A 2JALA 3AMKA 1I6NA 2YSWA 1ECEA 4FAMA 4YWSA 1A5OC 4H04A 4HNOA 3LRLA 3SCPA 3EMCA 3EMQA 2AOSA 1BHGA 3A47A 1F2JA 2BV9A 3EEGA 4HJWA 1JPKA 2Z00A 1QNRA 4W8BA 2PODA 1ZGDA 1EJRC 3O8AA 4PSRA 3VABA 1GOWA 3CYVA 1UWIA 2OTDA 3JVAA 3VNKA 5D02A 3L12A 1OF6A 3ABZA 3SUVA 1W3IA 4UIOA 3UXKA 3FW6A 3VZZA 1AG1O 4WD0A 5GJMA 1TSIA 4Q4PA 1G01A 3DIPA 3TMQA 2VR4A 1OG6A 1GPFA 4JEQA 3EB4A 4FNSA 4F0MA 4AWEA 2CLMA 3V1HA 4LY4A 4TQTA 1L8PA 7XIMA 1OFAA 5I3JA 2ZRUA 3S6DA 3G1XA 2XJ7A 2V2DA 3C2FA 3G8RA 3L65A 1LUCB 4ADSA 3V5CA 3NPWA 4UTWC 1J93A 5A6KA 2E6FA 4FF7A 3R7MA 1HJUA 1ZJHA 4MM1A 1NVMA 4AD0A 4H7ZA 4FA3A 3B06A 5TNVA 3HPZA 4X9YA 3BPWA 4RE4A 1JI2A 1V0KA 1YTKA 2HS8A 4O4VA 4AZGA 3ALGA 4XZNX 1JCYA 4KCVA 1BD0A 5DLCA 4JTGA 1IT7A 3QY8A 3ELFA 4IISA 4FB7A 4QG8A 3WG6A 1AVAA 4XTIA 2OKTA 2VRJA 2DZTA 4LYKA 2H9AA 4P7QA 2GVEA 1P7TA 4JQ4A 3ZR4A 5C8BB 4JN7A 3APYA 4PCPA 4E2VA 2QMKA 1RBAA 4CCZA 4QXIA 1S5VA 2QJMA 1OGSA 3GR7A 5E6YA 1RP9A 2B7OA 1KM4A 2C79A 3PB2A 1HKKA 1A50A 1UW9A 3IACA 4AWSA 4GYJA 3B3DA 4J4KA 4UQDA 3FFSA 3NL5A 1RHCA 7ENLA 1RQEA 2EG6A 4DNMA 1DV7A 8XIAA 3GG0A 2AQWA 4UTIA 3NGJA 3SCVA 3OU8A 5FJOA 3WQPA 3F4CA 1WX0A 1MI3A 3WDRA 1FCUA 3APGA 1Z32X 2OCZA 2D24A 3BG3A 2J24A 2PURA 1FHLA 4JQAA 2AGKA 4AC7C 2YDQA 4GXMA 3BTNA 1P5BA 5BWFA 1PKLA 4J2PA 4H8NA 4O1CA 4AIEA 3I6TA 5TAOA 3R8HA 3DFQA 4Q8VA 1NWSA 3GVVA 1V02E 3L5LA 3ONCA 4M80A 1Z8AA 2YL5A 5JBDA 1RQBA 5B7YA 3KL3A 3CAQA 4DWSD 4OV9A 2VC7A 5I03A 4AMCA 4RK8A 3L4XA 1KLZA 5IRPA 4X2PA 3UEQA 2CLKA 3MPGA 3PC0A 3WZ0E 2PCQA 3WSUA 1QASA 1C7TA 2FQIA 5CXPA 2HDJA 2C1GA 2BY1A 5F7UA 2EHHA 2NQZA 1TV3A 2POTA 1ISWA 4PODA 2B7NA 2G5WA 4TV5A 1FWRA 3I3BA 4PEEA 4H9VA 3WEZA 4PN2A 3OBKA 1GOXA 4DX3A 1XLFA 1D7FA 4GACA 1H4PA 4NAEA 1J0YA 1I8JA 1BAGA 1SSGA 2OELA 1IT0A 3TR2A 1A5UA 1FH8A 3BDKA 1B54A 2HV5A 3KOYA 2ZDSA 3VOGA 4AVFA 1LBMA 3WF2A 1UC5A 1KTNA 2GUUA 3W7EA 4XQ6A 3LGEA 3B0YA 2V8ZA 2PWFA 3CZEA 1R7OA 1Y7VA 3UWYA 1YPFA 4DZ5A 3DG6A 5CEWA 4JGDA 4XIAA 2VX6A 4AEFA 3AIRA 2V5BA 3OLGA 4PE8A 1TVPA 1ZQ5A 3SCUA 5CLWA 1KFBA 4Q6JA 4DJFD 4B5WA 4WIWA 4L9ZA 4A3HA 3NA8A 2XIQA 1WUEA 3WIJA 4LYQA 3SN1A 2V5KA 5XINA 4RJEA 1E71M 4LANA 4O1FA 3T81A 1XD1A 2OT0A 5CZTA 3W81A 7PTDA 3PR2A 3WH7A 5MKGB 3ZR5A 4GUHA 4CNOA 4CKQA 1R0MA 2OX1A 1FCVA 3VK5A 5BRBA 4IPJA 3BCJA 1CTNA 1K7FA 1JXJA 3BJTA 1IV8A 1QR7A 2Q8LA 2PS2A 4Z1CA 1PIIA 3WLQA 3W2MA 4IFOA 1TCDA 1JG9A 5T26A 2FZ8A 5J8LA 3WF0A 1VBUA 3G2GA 3IARA 4GKTA 3GUGA 4M1RA 1VEMA 4MAZA 3B9AA 4KGLA 3F4WA 3T4WA 2HK1A 4HU3A 5CQ1A 2QKFA 2YB1A 1H62A 1ZBWA 4RXFA 3VDAA 4PYSA 3N19B 2VT0A 3MI2A 1LBFA 2ISVA 3VUSA 4F0LA 2H3DA 1QPQA 2J88A 3R89A 2WVTA 2YB4A 3GTFA 4ROQA 2Z2UA 4UOJA 3THQA 3PZQA 3W28A 1EC9A 1TTQA 4DUWA 2H8XA 4O53A 3RLGA 5EY5A 3SFKA 2CHNA 3A3HA 4M6PA 1RJRA 3KHJA 4Q22A 1V6UA 2PZNA 2VKZG 2OXNA 5C2GA 1VF8A 1KC7A 2FZBA 4GVGA 3B8UA 1CYGA 1AMYA 1JNEA 2VX5A 1UD8A 3N2XA 3L4TA 4ZB2A 1EOKA 2Y8VA 5HULA 1QI2A 4PCSA 4PR4A 4LEQA 4E8DA 1Z6KA 1KTBA 4Z2LA 5AECA 3AQUA 4OQVA 4S3CA 3HG4A 2BBFA 1N8WA 3JU2A 4J3VA 3TYDA 3WX7A 5EKYA 1J0HA 6PTDA 2NT0A 3WQOA 5JQ9A 3RN6A 1NWRA 4HSOA 3G0UA 3LERA 3WCZA 1UBPC 2Y1HA 4O28A 1XV8A 3WF4A 4ZO6A 5DO8A 1C29A 4HNUA 1XLEA 9XIMA 4S3DA 2P1FA 3MJYA 1SFSA 1EB3A 3G8EA 2DW6A 3D6NA 1ITXA 1V02A 3WO8A 1OC6A 2A3EA 3OOQA 3WD4A 4ADTA 1N82A 3G24A 3PTKA 1J0KA 1WXYA 1V3HA 3TU9A 3DHFA 3VCNA 5GPRA 1S3HA 3URAA 3LU2A 4W9TA 3TZNA 2OQLA 4EF8A 2YXGA 3VAVA 4O57A 1X38A 4FIRA 1REQA 4OHQA 2IPWA 3VFLA 5DCEA 1TV7A 3GIYA 1VR6A 3S5NA 5CC3A 1LOQA 5LA1A 1B5TA 3LG3A 1PX3A 4IIGA 2PDFA 2EF9A 2HJPA 4MF4A 3SCRA 3RDKA 2XGIA 3SRHA 3I3EA 3RM8A 3T0BA 4NZ1A 3ZOAA 3S6OA 1DORA 2GGJA 3GHTA 4E4FA 3KWSA 2VI0A 3SW6A 4PUUA 3WBAA 1G5AA 2WQDA 2O56A 2I9UA 2W9MA 3ABXA 2XHYA 3CAWA 1IT8A 3AO0A 3MQTA 2DZWA 3MBFA 3K2GA 3BE7A 4NRRA 1GVFA 2Y63A 1KRBC 3UETA 3GD6A 2E1WA 3PZNA 2E8ZA 1OFBA 5GNZA 2ZZ7A 2E1DA 2QJIA 1MQQA 4ZOEA 4KWWA 3I7QA 1IWPA 2GSJA 4FF5A 4QNEA 1DQXA 1GYMA 3CTLA 3S9YA 4NJJA 3EDKA 1X96A 3PG9A 4CQ9A 3B4UA 4UFHA 2GZXA 4Y9AA 2OR2A 4YU1A 4DF2A 3MA8A 2DT3A 1XGEA 4RNFA 1TPFA 2V3EA 1FXQA 1ONRA 3VGEA 3LRKA 4DBDA 4E3VA 3KCOA 4ZXLA 3P93A 1V3LA 4FALA 4C6CA 1H0IA 1E1CA 3W7JA 2YA2A 3HN3A 2ACUA 4MFEA 1LOLA 1PIGA 3LI0A 4M8UA 1KBLA 3R8RA 1CEOA 2WLYA 1PKYA 1B3VA 4KWUA 2WWDA 4AHOA 3SJNA 4GQBA 1VIWA 3LEPA 4V27A 3UPWA 3VD4A 1HIZA 1YDYA 3V0TA 2DQWA 2YGYA 4AZIA 1XF0A 1SU5A 3AHXA 4PBEA 1HP5A 3F5KA 4LAOA 1U5VA 2OWXA 1XIMA 4PTDA 2V5LA 2VFGA 3WMLA 3EWWA 2E9BA 3TC7A 4NSBA 3E96A 3UG4A 4KFOA 1JEZA 3WDJA 3ZJ6A 3TN3A 4HCHA 2V2CA 3WENA 3GXNA 3CQJA 1UZ1A 2I5GA 4V28A 3BGJA 3WFLA 2J7CA 3CMJA 3AIQA 1UWQA 3L4UA 1T6MA 2VZSA 4NKCA 5K4ZA 1OT2A 2EXOA 3XINA 2GSEA 2V3GA 2V81A 2PDMA 3TWBA 1T99A 5CPNA 1ZBCA 2V30A 2EJ1A 1LT7A 1S2WA 2Z26A 4XD4A 2JKAA 4B4HA 3NIYA 2W4XA 5EMLA 3AI0A 1AJZA 4IXHA 4JDYA 4EAMA 3PBGA 1SR9A 3OQEA 6TAAA 4LUYA 4BWLC 5J5RA 4ICNA 4IMEA 3NDOA 3H22A 1CLVA 2VL4A 2G37A 3N2CA 4R88A 2YLLA 3CL8A 3M07A 3QLDA 1O68A 4P8XA 2ESCA 3V4BA 1VPXA 3EDFA 4PUMA 3FVMA 4MKNA 2I5QA 3MO4A 3GG7A 3OB8A 5ECUA 3UFYA 3PP7A 2VEIA 3DGBA 4QG9A 3OW1A 4GA8A 4D6EA 3ARXA 1HF6A 2JBMA 2RJGA 2WHKA 1KRAC 6REQA 3N3MA 2DZBA 4N6FA 1Q6OA 4WGXA 4KFPA 1X1NA 3C2VA 2OG9A 1CZ1A 4ZA0A 2G3MA 1MVYA 1UWSA 4CEXC 2E09A 3N2TA 3MMUA 4OU1A 4FLRA 4R5EA 3W6LA 1J96A 1J01A 3VKKA 4HOZA 1YNYA 4HSNA 3Q65A 4FXSA 3UWWA 2GQAA 3ZT6A 1DP0A 1XRVA 3W26A 3KXQA 3VGBA 4EE9A 2DZUA 2W67A 3S1GA 3QSRA 4NJIA 2GLKA 4Z2GA 3NZGA 3S42A 1XINA 3B9NA 3G1SA 3GH7A 4YYCA 3LZ3A 1NWTA 2D23A 3M0IA 4HOWA 4IQJA 3SN0A 3I68A 2F2HA 3NAVA 1RV8A 4DB7A 1I9CB 1S1PA 1L0PA 2W6RA 4LCQA 5HNUA 3GR8A 3VMOA 4GO9A 1RCOB 3H2CA 5LXXA 2F38A 1XSKA 3LBOA 4GFSA 4CEUC 4Y7EA 3P0XA 4GZEA 3UJSA 3GG8A 3LXCA 4DO7A 4N2YA 1VAHA 4IX2A 2C3ZA 3AUJA 3F1QA 3CV7A 5HAOA 3Q4DA 4V15A 4ICMA 3GXIA 4DJFA 1OVDA 4DJEA 1YQ2A 1TWDA 1NF7A 2JGYA 4JD4A 3UZWA 3BJSA 2QULA 2FKPA 1YRRA 2YCIX 2NQHA 1OWQA 3CZKA 3NTYA 1LJYA 4X2RA 1I2OA 1KM1A 1FWAC 5H91A 1U33A 4UZUA 2ZA3A 4UFLA 3TCEA 3UPBA 1LL7A 3TVAA 5E09A 4R53A 2HVOA 4LRSA 1ZS2A 4H3DA 4CD4A 1SO5A 1RBLA 5TD4A 1CXHA 4CUCA 5MKGA 3RO8A 4FX6M 1E0VA 1RPXA 3PHAA 4GVHA 1RK5A 1TRDA 5JUVA 1POKA 3MV01 2BXZA 2XM1A 2UZ9A 1JGIA 2ZWZA 1W9DM 3PZMA 4C6OA 2HBVA 2XU2A 1UR4A 4KFNA 2WJDA 3DHPA 4MPKA 5BW6A 4K2SA 4G6CA 1U83A 1AA1B 1E51A 5D9OA 2HVMA 2G3IA 2ONEA 1I4NA 3WQ8A 5JIWA 4JPGA 1ZPTA 3H24A 4B4FA 1IZKA 2ZZ6A 1KGWA 3CUFA 1XQLA 2X41A 1UOZA 1NOUA 3PFMA 5I07A 4L1XA 2VUYA 2DVUA 3BAKA 1MFUA 4F40A 3WEMA 1S5WA 3W53A 4HTYA 1P6CA 3W7QA 5AOUA 3FA4A 3K1GA 2BHZA 1M41A 3ARTA 3TW7A 3UJ2A 4NYYA 5LNVA 3FAWA 4MJZA 2F8QA 4I3GA 1UIOA 1S2UA 1OFPA 1KRMA 1V6YA 4KT2A 4IQLA 1EL3A 3AROA 1SR0A 2PTDA 1SQ7A 2INEA 1EOMA 4MIMA 4MWAA 4HPHA 5HJYA 3W2JA 3SAZA 2QCLA 3NO3A 3NPUA 1AL8A 4UR7A 1T8QA 1EGVA 3H7VA 4CD8A 1KM3A 3W29A 2TAAA 1U1UA 3MYPA 3H12A 4I8YA 4HPNA 4DNHA 1S5TA 3RPDA 1KWKA 4MZYA 1CT5A 3LCIA 2NV1A 1DXEA 1HP4A 1GW1A 3QRHA 2J4GA 1EX5A 2IS7A 2QCMA 3W0KA 3KLLA 1RR2A 4JTAA 2OKOA 2JIEA 3NO5A 1EFZA 4AG0A 1MO0A 5K2ZA 4RW5A 1XGZA 4US6A 3M0JA 3OODA 1IXQA 4H8VA 2Z1BA 1REQB 2W92A 4MPQA 1KXTA 5CZSA 4NYUA 2QCNA 1WZAA 1N2VA 2Z6IA 2QVHA 5DRCA 3LYEA 4Z0SA 1DQUA 3GR4A 5A8QA 4C6KA 1Q8JA 3T7VA 2A6LA 3GNDA 4JTJA 2C7FA 2GK1B 3C4UA 3W7CA 2Z1KA 2OYKA 3UWQA 1YNQA 4P5UA 5CCZA 1E4NA 3TXVA 1G4EA 4ERAA 1KQZA 5I06A 1LF1A 1LLZA 4WHBA 4MNMA 3H4XA 1CGTA 1ITQA 1C3FA 4JX4A 4IF2A 5EBAA 1X7FA 5E70A 1LLWA 3PZGA 1WDSA 2ZC1A 3WNNA 3G6MA 3M43A 3DERA 3OPSA 1W3HA 1XFCA 1JYVA 1XUZA 3ANUA 4P7NA 4FOJA 1VEOA 4IQDA 3U7BA 1TUXA 3GVQA 1KCZA 3W7MA 1FP9A 4AF0A 3QTGA 4M24A 1CBGA 4ENLA 4MNKA 4KEUA 3W85A 3NURA 3B8SA 2PP3A 1V51A 3AIUA 3W07A 1BSLA 1M1BA 5M1TA 2PDUA 2PDCA 4C60A 3GUWA 1QNSA 1B4KA 1GVYA 3VD5A 3KRBA 4NI8A 3N25A 1XM3A 5FJIA 1A3HA 1BG9A 1LG1A 4OJYA 3W1MA 4GY1A 4IP7A 3WQVA 1KFJA 2Z24A 3VM5A 1HUVA 2ZOXA 1K6WA 1XCWA 4N0RA 3PNUA 4MFDA 3KCJA 4ATWA 3WJWA 3WD0A 4QSFA 2BY0A 2QJNA 1X39A 4WQ6A 3H70A 2NVAA 3PSVA 3AOFA 3LA4A 4DIAA 1E9LA 4LJ3A 1G67A 4QEHA 3P61A 2HZGA 1LQAA 4AD3A 1GKRA 5DN1A 3RX2A 3V0SA 4YCPA 1Q6CA 2Y7DA 3BLLA 1KXHA 3STEA 2YFOA 4G7FA 3FHAA 3P2VA 4HVXA 1KR0A 1KB3A 5EYWA 3GZ3A 1HNYA 4Q8QA 2WMHA 2EG7A 2ACQA 4GYPC 1WA3A 2RHGA 2REQB 3DH7A 3BW3A 2VFHA 4QAWA 4URIA 3KTCA 1V79A 1XKYA 2VX4A 3ONBA 1FWHC 1UPMB 1FFRA 4S3FA 4W5ZA 4PFHA 4V33A 1E1FA 2PAJA 3OIHA 4GBDA 3UJFA 1UB3A 1XLDA 1E6XM 1PWMA 2PRMA 1K6AA 3GTNA 1M7XA 5CC7A 4ZFMA 3VMPA 1KO0A 1K70A 4C6FA 3O3RA 1ZFJA 1EBHA 2NT1A 1NQKA 4U5KA 1FCBA 3DFYA 4HQVA 2OEJA 1M3UA 4KQNA 3BOLA 4XAZA 2WB5A 3LLDA 2HVNA 5FF4A 4IIBA 2EAWA 2VP8A 5C7HA 3S2JA 4TMBA 4LY8A 3Q67A 3QMRA 4YTRA 2VC5A 4MDOA 3WLIA 3GAYA 4AWTA 5HMEA 5KZ6A 1VBHA 2QJGA 5CPMA 4PMXA 3BCFA 4G2DA 3WKZA 2V67A 4JTEA 4Q8OA 3FEMA 1VJSA 4I6VA 5BXPA 4W8AA 1FWWA 3QPEA 3ID7A 3FJ6A 4LVDA 1FWBC 2J25A 2X42A 1TJ0A 3M0ZA 1ME9A 4PCFA 1B90A 4PB4A 2R9RA 1QPNA 2YXOA 1IQ8A 1NF0A 3WNMA 1AJ2A 4JY9A 2O55A 4HTBA 3NL3A 3GU2A 1A5NC 2DGAA 3T2PA 4CN6A 2YYUA 2VXNA 3AJ7A 3M5ZA 3RYSA 2E3ZA 2QUVA 2OZ8A 2E68A 3DAQA 4XKYA 2HTMA 4Z0JA 1G6CA 3W88A 3KBJA 3VGHA 5C9XA 4N9BA 1F7BA 5GJNA 2QW5A 3W22A 1OCJA 5REQA 3N3TA 2OYLA 4LBUA 1TQJA 1GVSA 2OZ0A 3W24A 5HWMA 4YTQA 2QEZA 2C0HA 4NX0A 3BVJA 2OT1A 1AD1A 2V82A 4S39A 3V0UA 4DELA 4Y8FA 3HFYA 1HKMA 2FVKA 3QXBA 3VC6A 4B5VA 2NVDA 5CLTA 1JUBA 3P0WA 1WDRA 2WC3A 2E6YA 1E9YB 3HGJA 1M6JA 3MY9A 4ZOAA 4GUFA 3WDHA 3BG9A 4RPPA 2Y7FA 3SADA 3EPOA 3ATZA 1VFUA 3QGAC 4MNLA 1A3WA 5CZKA 4PGLA 1WPCA 3WH8A 2QJJA 4L4OA 2AL2A 4WR3A 1XPGA 2C15A 2D3NA 5AYXA 2XGZA 2AKMA 4J35A 4ACZA 3KVMA 1BKSA 3MDWA 1US3A 3SCNA 3WK3A 3NCOA 3O16A 2YJQA 1UWAA 3MP3A 1O12A 1OFRA 4MY9A 1LOSA 3KOFA 3O7UA 3O6DA 4IIDA 2UWFA 4MB5A 2XG9A 4XVDA 5DT5A 1KKOA 3N6JA 5HMDA 1NAL1 1KM6A 1XLHA 2MUCA 1WDPA 4QISA 3TW6A 1HTIA 1XBZA 2AKZA 4EPDC 4LUTB 3WH5A 1DWAM 4E5TA 2QDHA 3F4DA 3ZMRA 1ONEA 2FIQA 4O14A 4PMNA 3T2OA 5C71A 1C8XA 1NOFA 4UXDA 2QAPA 2DDXA 3HFTA 3VZYA 4QS5A 4S1FA 4KIEA 1UQYA 2GUYA 3VX0A 2G3NA 4Q32A 3KE0A 4A2RA 3H2EA 2P10A 4AIOA 4J9JA 4Z2KA 1Q45A 3GVWA 1ZJIA 1R85A 3EA2A 1ZNNA 3W7DA 1OYAA 3CUXA 1OCNA 4Y6GA 2R6OA 3MWCA 3WLLA 4XAPA 4I9TA 4PMYA 1VPQA 1GOMA 5CPLA 1EJWC 1YBQB 3LXAA 1EO5A 4EOUA 2HPMA 4WZHA 5HBFA 3EWCA 1A4MA 3EKLA 2FDSA 1NJJA 3E02A 5BOEA 3QV6A 1XH0A 3VIFA 1VRDA 3KBMA 3IJLA 1KNWA 3T9PA 4DJFC 3LCWA 1VS1A 4BF7A 1F8MA 1UJPA 2O9TA 1VCFA 1PWLA 2GJRA 4ERIA 4AYGA 3BOXA 2BTMA 4XKMA 4RE0A 2FTPA 4I90A 3ZVIA 1EXBA 2E67A 2ZUTA 1XUUA 5A6TC 2ZVRA 3I6EA 4AZ6A 2UV8G 2OGYA 4FLOA 5I3GA 3TE9A 2IKJA 4YHEA 2ZUWA 4J27A 1LP6A 3GIPA 2RGMA 2XWEA 2PDJA 1KV8A 3BAYA 3QOMA 1GOKA 2I56A 1GHRA 2WKJA 3DC0A 4O1DA 3PBWA 2Q02A 4UR9A 2YBTA 4AX7A 4JHOA 1BGAA 1HO1A 1JRCA 4HOXA 3ITYA 3REQA 4CQCA 3QH2A 1E72M 3FEQA 5K9CA 1RY8A 4LTSA 4HCLA 3TTQA 1Q3NA 4BEUA 1Q7MA 3BAXA 1V6TA 2G8ZA 1PIFA 1PYFA 3QJAA 5I79A 4N42A 2J8TA 4H9XA 1JUKA 4LCSA 1LDCA 2PWHA 2PDGA 3EOOA 4GK8A 4ZQCA 1EC7A 4IPNB 2G97A 4GIYA 2BOFX 4M6QA 4QCEA 4MJ2A 2ZUNA 4MJMA 3NFUA 4AU0A 2D2OA 5AC8A 3GY1A 3HV9A 4KERA 1ISZA 4PRRA 3TYEA 3VNZA 3EDDA 3RCMA 4QTGA 4UTKA 4AD2A 3EYPA 3R94A 3LTPA 3SB0A 3KS5A 4CNSA 4POCA 4D8ZA 1MWOA 3E49A 4HA0A 4MLJA 3F2BA 3P67A 1GPWA 1W5NA 2MNRA 2EQDA 5CG7A 2ODOA 4MNJA 1E1EA 4NXSA 1UA3A 3NO1A 4HZ6A 1U30A 3WQFA 3RPTA 4W7WA 2WPGA 1RLCL 4GJIA 4EACA 1NFGA 4BY3A 3PJXA 1IHIA 5PTDA 3NEHA 2FH8A 1QI5A 4ZR8A 1WB0A 2G41A 4Z17A 1PCKA 5DFAA 2ZRXA 1R9YA 2D0FA 2VZTA 2GVJA 1P0DA 3UGVA 2DZPA 3B0VC 2QNEA 3WNPA 1XIHA 3T07A 4IXXA 3IRSA 4LC8A 4Q6XA 1TWWA 3CEUA 4HA4A 3OP2A 3WMBA 2V5DA 3B8WA 4A4AA 1HW6A 2R1KA 3UGRA 1KV5A 3W7NA 5DELA 1I1XA 4K8HA 3G18A 4H19A 3VDGA 4UQBA 3AHZA 3WK2A 2POZA 1BVZA 2R91A 1QRQA 4IIEA 1D9EA 3B9EA 4IP4A 1LL4A 3S5SA 3AXKA 4NAFB 2QR6A 3EX1A 3UWEA 1SJDA 4C90A 1XXXA 3SEPA 3O6CA 1TPB1 2L5HA 1UG6A 2I5IA 4GJ1A 4LUSB 3NXLA 5JH1A 2C91A 1YX1A 1JYNA 3ARZA 4X61A 4GJJA 3ZWSA 2DFAA 3N18A 3N2OA 3M0LA 1LWIA 2OJPA 2QUNA 1ENUA 2QAFA 3CZLA 2BS9A 3TN6A 1ISYA 1XI3A 4CCDA 1ZALA 7TIMA 3PWAA 3U9IA 2OGJA 1S2CA 3G1YA 3CHEA 1QNVA 2VM8A 3P82A 1PDYA 3OQ8A 1ZZMA 4LT9A 1DJIA 3VXGA 3POHA 3SUSA 3CHCA 1E3XA 1P0BA 3D46A 4IG2A 1QI0A 1OQFA 3ARWA 2J62A 4PTWA 4LX4A 5DT7A 3AZTA 2YCLA 1RP8A 2OZTA 2V3DA 5TBOA 1I0DA 3WBWA 3SQLA 4OTKA 3LHWA 4PRWA 2DUXA 5BMWA 4EPEC 3N13A 4NJKA 4Y9MA 3VDHA 1RD5A 1KFKA 3P5ZA 3W87A 3WNKA 4WEVX 1HQTA 4BF5A 1UPPA 2OFJA 1JQXA 2OB3A 3PPFA 4OKDA 2QT3A 5FCZA 1MXGA 1Z7AA 2Y85A 4GI6A 2BGNE 4HYRA 3VOFA 1C9DA 1W6TA 1W8GA 3G1RA 5AYBA 4ZCWA 4DWSC 1FH7A 4K1WA 2A3AA 2YA1A 5AY7A 2A6NA 1E5NA 1BTCA 1VFOA 1SO3A 3TAOA 4RR4A 4HZ8A 3CIWA 2AAAA 5IOBA 3H23A 2QPSA 3D5HA 3L66A 1RXOB 2DSWA 3M5YA 1MEIA 3C0QA 2J8GA 5AZ1A 3IIPA 3QV9A 5D2YA 2IMRA 3TJLA 4E8GA 1GEHA 2PRHA 3NQAA 4S3BA 3QSTA 1MRQA 3SJ3A 2X1SA 1NP0A 4H00A 4OGZA 1Q65A 5D09A 2CPUA 4J3TA 4PUEA 3PZOA 1FA2A 1O1HA 2PDPA 1CXKA 4KCTA 2NLYA 1W0MA 4IJRA 1PEZA 3SBFA 2WZHA 2DVXA 3U2EA 1EC8A 4XIMA 1J12A 1VFLA 2XN1A 3NQDA 2OSWA 1PHWA 2OVLA 1XLLA 4UNKA 1VCVA 3LCLA 5HR6A 2I16A 4MWAB 3S6TA 5AVNA 3EXRA 2P3ZA 1X98A 3M64A 1A49A 2Y5SA 1FWCC 1HFBA 3BZJA 1LUCA 2BOEX 5D2TA 1DE6A 2V68A 1VFHA 1AH3A 1OC7A 3ITTA 3L0NA 3RLVA 3PJWA 1DPMA 1XIGA 5M2FX 4YHGA 4KWVA 1KFLA 4M7TA 3BSHA 4U4MA 3VKBA 3OGVA 4HP5A 4WY0F 1A80A 3QW3A 5G2IA 2X1RA 3S1VA 4QG6A 3SGZA 1J0IA 2ISWA 3VE7A 3FYOA 4NZFA 4DUXA 4B91A 2NWSA 3TJXA 4R33A 4E4PA 4B5TA 4NU7A 1AFSA 2HMCA 3TZFA 2B7QA 1QVBA 4PBGA 4E2OA 1MQPA 5KEZA 1NU5A 1GOIA 3O6AA 3VIOA 4ZGYA 1EJXC 5D30A 1B3YA 3VI2A 4LUIA 1K8XA 4D1IA 3PSWA 4AF0B 1IWBA 4FPSA 5LXEA 4LYPA 2XH7A 3IGXA 5FIPA 3WF3A 3W1AA 1DJHA 2A4AA 4ZE4A 5SWUA 3H8AA 2ZYFA 4TX9A 1XH1A 5DRIA 1OX6A 5ABFA 1HGWA 2XINA 4YTSA 4US5D 4JFVA 2DSUA 4C6QA 5CJ5A 2PDKA 1W56A 1XISA 4QDMA 4U2YA 2P76A 3R8GA 2YPIA 1SM9A 3W1UA 1AL7A 1UWRA 3OZMA 3GTIA 2EPNA 2NV2A 4PTMA 5I7GA 4MSSA 3IRDA 2PGFA 3WDPP 4CNTA 1QNOA 3A24A 1A5CA 5CPTA 1ZBVA 1A5KC 1QOXA 2FPYA 4HU8A 1PVNA 2DY3A 4AZHA 3I7SA 1M01A 3GKFA 4UTHA 4Y90A 1J79A 1ZENA 4M6VA 2A21A 1GZGA 1ME7A 4Y9OA 1UROA 1RAKA 3URQA 1A3XA 4MYAA 1UR8A 7A3HA 2IQ0A 3W1QA 1W3TA 5LA0A 1UHVA 3MT1A 3VZXA 4CNPA 2OQHA 3AS2A 1MNZA 1WP6A 2KAUC 4B16A 3QPYA 3ZT7A 3FXGA 1QXLA 1I2NA 4A21A 1FHUA 4C65A 1LL6A 1C7SA 3CH9A 4Q8NA 5A8GA 1WKEA 3OVPA 1ITUA 1WKFA 3MVTA 3BMVA 3P6LA 1YIXA 3VD7A 1XIJA 4US5A 2IW0A 3OZOA 3EXSA 3M44A 5J5DA 3PJUA 4C6EA 4PSPA 1NDYA 3WLMA 1J10A