3W87A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-103
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-103
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 104
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w87A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w87A01
2ZA3A 2CLKA 3A5VA 2PE4A 3KVLA 4RXGA 4ML9A 1R2TA 5CZJA 4FB7A 3WJWA 2HMCA 3BLEA 3NQMA 3NA8A 3P74A 3STGA 2JGQA 1A5CA 1WXJA 3CLMA 1O4UA 1QOQA 3G3MA 3MI2A 1H7WA 1AG1O 1GYLA 2JGYA 2XN2A 4JX6A 3C2FA 1IF2A 2YDAA 3INPA 3DFNA 3B0UX 3VFLA 1JQVA 1S5WA 1QMLA 3LRMA 2DP3A 2RHGA 4LNYA 1K8YA 5KMYA 3CHVA 4MZ8A 4JDYA 1SSDA 1VCVA 4ZZ9A 2ZRVA 3GKAA 3UZ5A 3IV3A 1QWGA 2QCDA 1KFEA 1SZGA 4YL2A 3E02A 3STEA 4Y8FA 5CZ0A 2H3DA 3N3MA 1IGSA 1CX9A 5AFDA 1B4EA 1ME8A 2HTMA 3UWUA 2E1DA 1QPOA 4MZ1A 2NZLA 3UNDA 3BARA 3CC1A 2PURA 3P8IA 1W54A 3FA5A 4O0ZA 3MBFA 4WY0B 1YXCA 4OU1A 3LI0A 1UASA 2ISWA 4GUHA 1E51A 5LSMA 1VYPX 5HR6A 2NUYA 1VGAA 4O28A 4QITA 1ADOA 3LV5A 4IX0A 1I45A 3L66A 5G1YA 3FKRA 4EVZA 2PRHA 1RQEA 4O4VA 1IXPA 3TR2A 4BK9A 2VELA 3OEXA 3W7MA 5DY3A 3THAA 3EWUA 5IBXA 2C6QA 1TPH1 5KINA 3L21A 1W31A 3G3DA 4AHQA 2G96A 1P0KA 2GVLA 3EWZA 3Q58A 3FJ6A 5BRBA 5I3JA 4ADUA 3G1FA 3M43A 4MYXA 1LBMA 2FIQA 4UNLA 3C6CA 1VHNA 3LB0A 5F4WA 3NL2A 5FF7A 2XFWA 1MXSA 2C16A 5K9XA 1GG1A 1ZCOA 3HOJA 3UY8A 1OX4B 1G4PA 3MHGA 1PCKA 4Z08A 3UPWA 3QSTA 3MYPA 2BX7A 5CZSA 3TW7A 2ALDA 3GDMA 1P1XA 1NF0A 4NJIA 3BW3A 5U4NA 2NXHA 3JRKA 3LXAA 2I14A 5E93A 2B7NA 4OV4A 3NVTA 4DEFA 3ANYA 1QPQA 1D3GA 4MPQA 1RR2A 3E9AA 4O13A 1JUKA 4P61A 4JIPA 1QAPA 3MJYA 2NWRA 3W2JA 1GQNA 4M6VA 2R91A 5LNSA 2JKPA 1DVJA 2ZTJA 1IXOA 2Y85A 3TC6A 4AWTA 1H63A 2QAPA 1MSSA 2B7PA 2YYTA 2YR1A 1A50A 3GNDA 3W1LA 1TJPA 4XQ6A 3SW6A 4JTGA 2X1SA 4Y9AA 4UFLA 1WOAA 5AHIA 2QEZA 1OFPA 1N7KA 3TXVA 1YXYA 4O53A 2ZA2A 4HSNA 3V75A 1Q3NA 1HL2A 1LTDA 2W79A 4WD0A 1SZEA 1VS1A 1LBLA 3LOTA 2E6DA 4NNCA 5C55A 3T44A 3ELFA 4PA8A 1MEWA 3P82A 3I7QA 3IIOA 3PB0A 3IEBA 2QCGA 1OABA 3LCIA 3F1QA 1SZNA 2VFHA 1AW1A 3BGGA 4JEQA 4YMZA 4RZ6A 4N02A 1DORA 4FEZA 3E12A 1K8ZA 1LRNA 4HPXA 3NOEA 2GOUA 3C2EA 2Z2UA 2A6LA 3W86A 5U7SA 1VQTA 1KA9F 5HMSA 4N6EA 1UUOA 3WK2A 3GKFA 4TX9A 4ZVJA 4R33A 4IJBA 3GK0A 3ABOA 3TFXA 2BLEA 4UR7A 3YPIA 1Q6OA 2A7PA 4UIOA 1IIGA 5CGQA 4LUJA 4NVTA 5L6UA 1TCDA 2DZPA 4O4WA 4RCXA 2VEPA 3S1VA 3NQEA 1TPEA 3N9SA 4ADTA 1GOXA 1Q6LA 1SO3A 2Q3OA 2XN1A 4KFOA 2VXNA 2NX3A 5KZMA 1P4CA 1J2WA 1I2QA 1TB3A 3QMRA 3MI6A 4JTLA 4LV4A 2JKAA 5A5WA 3S1XA 1ICPA 1DJNA 1QFEA 3U2OA 3G1DA 2J9ZA 4NUWA 1TJRA 5HUOA 3LHTA 5KTLA 4OBTA 3P8JA 4O54A 5AC7A 5D09A 1ZNNA 4PL2A 3RU6A 2WKJA 2ZRUA 3BVJA 1KM5A 1EP1A 3IGUA 2J6XA 4NX5A 1L2UA 2V5BA 5HR7A 4IOTA 4TO8A 3LLFA 1F5ZA 5G2WA 2AAMA 1A5BA 2W6RA 3L5MA 1A53A 2YSWA 3DKJA 4XTIA 2GUUA 4UTUA 1H7XA 3N2MA 4HN4A 1Z42A 3HG2A 1PHWA 4IMFA 3P61A 4NNBA 3P84A 3LHYA 4LS2A 2ZTKA 3SSJA 4FF7A 2H6RA 3FS2A 2QJGA 3U6WA 2H3BA 2IQTA 4CQ8A 2NXGA 3IVTA 1KM2A 1HO4A 3R5EA 1TV5A 1KBJA 1QPRA 1FCVA 1B57A 2VFGA 2DZUA 4MFEA 3TC7A 1I2RA 3MHFA 3GDLA 1FCQA 1W5NA 1W3IA 3DKLA 4IMEA 4BWLC 3CPRA 1I2OA 1SU5A 4E38A 2QCFA 2W0UA 4S2BA 5D2WA 5D33A 4IWWA 4JIQA 2QR6A 4NXKA 3PBWA 1FX6A 2C14A 1HG3A 3QJAA 3M16A 3NGJA 3G8RA 2VKZG 1SFLA 1ZAHA 3I7SA 4OT7A 2Y7DA 2E09A 2O7SA 5BOOA 3QFEA 3W22A 3HPSA 3NG3A 3S5NA 1WAUA 3WK1A 5F2MA 2V2HA 1LORA 2J27A 4UTLA 1H7OA 3P62A 2GPTA 1M5WA 1G67A 3SR7A 3W7IA 3UWZA 1EIXA 4IMGA 5BNKA 2YW3A 3M0ZA 4QIUA 4EWND 1H7RA 3PY2A 1YLVA 2CLMA 2B7QA 3G1HA 3EWWA 2KZHA 4AWUA 4A21A 2A85A 4A2RA 4N9BA 1F05A 4D2JA 2BZNA 2OT1A 2YZRA 1F2JA 1K02A 4LW7A 4MZYA 4QQ3A 4RV8A 3GAKA 1JQXA 3C56A 4WY0F 3CWOX 3I68A 3S9YA 3LGEA 4O50A 2NWSA 3W83A 3P5ZA 1FQ0A 4OE7A 4UTWC 3M41A 1TPWA 4Z0JA 3ZR4A 3QQ1A 1EX5A 4KFPA 4UTHA 4A3UA 4AB4A 1SO5A 2CLIA 3OBKA 4IGHA 3TW6A 2F7FA 4K37A 4IXHA 5CKSA 4U4MA 2P1FA 2VEMA 4O10A 2FLIA 4JYFA 3MMTA 8TIMA 5LNVA 3FFSA 3NDOA 3WJYA 3IVSA 1EA0A 4CNOA 1YTEA 3GXNA 3IIPA 1TPUA 3T78A 1FBAA 2WO5A 3S5ZA 1W56A 3LHWA 3FYPA 2QKFA 1SW7A 4LT9A 2Z0IA 1WX0A 2Y89A 1OG0A 4Y6GA 1FCUA 1W3TA 2ZFAA 1KM0A 1KTCA 4HKPA 4DPPA 1TV7A 1T8XA 1TTPA 2CZDA 3W7OA 1XM3A 4X9SA 4G1KA 5H2ZA 1ZALA 3FEMA 2RDWA 3DU0A 4BR1A 2DZVA 2DJXA 3W2MA 1TIMA 4JTJA 3B0VC 2Q3RA 4QSHA 3EWYA 4HNNA 2EF9A 3LRKA 4ADSA 5CZTA 3MUXA 1Q45A 5CPMA 5AYYA 1TPFA 4IXXA 3GXPA 1L6SA 4S2CA 5MHBA 1W3NA 3HGRA 2X16A 2E5DA 5F2IA 4AVFA 3MP3A 2FPYA 4E2DA 2OJPA 1FWSA 3W3OA 3DFQA 3KHJA 2O7QA 2NX1A 1XBXA 1JVNA 2C1HA 3P81A 1XBVA 3UZJA 4QNEA 5FEZA 4IMCA 1EEPA 5GVJA 4DBDA 4E2BA 1OYCA 4JTFA 1Q6RA 1VRDA 3W07A 1EWEA 1KFJA 4FIQA 4BI6A 4O57A 4WXYA 4JTUA 4LY8A 4RZ4A 5EBUA 1J5TA 2QCEA 4AH7A 5EY5A 2Z1BA 5ABTA 4ZMGA 4CCEA 2E77A 2GJNA 2JBMA 1VHCA 2J9YA 1K7FA 1OFOA 2QUUA 4JGDA 4DBEA 3DI0A 3PSVA 1PV8A 5HWJA 5D37A 1X8FA 4LC8A 3W87A 3B04A 2V8ZA 1WDWA 2ZYFA 4QM1A 5FEPA 3ZS4A 1MZHA 3HB9A 1JCJA 3C52A 3LX9A 4CNNA 3H54A 3FJLA 3O6YX 4NT0A 2QCHA 2GQAA 2EHHA 1DV7A 5AOUA 4DF1A 3KFTA 1ZAJA 1JCNA 2V9DA 3NPUA 1OK6A 2E5BA 3KVJA 4ALDA 1KFBA 4FHAA 3W1PA 3GYEA 4MKNA 4LWWA 3BW4A 4RZ5A 5DN1A 1ALDA 4KFNA 4PCFA 3PM6A 1WBJA 3QW4B 3PUEA 1Z44A 3HG3A 4DF2A 1A5SA 4AXKA 2ZRZA 1LYXA 4AEOA 3UY7A 4A29A 4O0KA 1MEHA 3DENA 1L9WA 3TCEA 3W1TA 2WSQA 2QF7A 1O5XA 4MFDA 2GQ8A 3SY5A 2X1TA 3G1YA 4O17A 5HJLA 3DGRA 5KITA 3QZEA 4O14A 3PAJA 5SWUA 3MP4A 3TQKA 3IVUA 5I3GA 5KZDA 3S1WA 3LI1A 1JRBA 3RNDA 5CSSA 3PG9A 4HNTA 3ABRA 4N6FA 1FCBA 3ZFHA 1I4NA 5AC8A 2H90A 5I3IA 4HIBA 1SFJA 4UTJA 1ZAIA 2ZRWA 5EKYA 4X3ZA 1D3HA 5DBUA 4NX0A 1FDZA 2RH9A 3SFKA 3KVKA 1QPNA 4AF0B 3GZ3A 4ZQMA 3R8RA 2HSAA 4FNSA 1F74A 3PSWA 3IIVA 4R53A 2RDTA 3S0CA 4TMBA 3FIGA 3R89A 1NSJA 5E1QA 2CZEA 3TK7A 3F4NA 3EWXA 1X1OA 1ZY9A 4FNQA 3C2RA 1JRCA 4O1CA 2CLLA 4UTMA 5D04C 1TPB1 1FWNA 1XDMA 3CIWA 2OT0A 4CCDA 3TMQA 2NXIA 1JUBA 4CLMA 2Y6ZA 5K9DA 3W7JA 2Y63A 1HUVA 3AJXA 4JTTA 3TROA 3R2GA 4UUIA 3HPXA 3USBA 3RMJA 3PBYA 1FWTA 3EKLA 4BI7A 3NPWA 4X2RA 2C13A 3TU9A 5HULA 3PULA 3P60A 3B4UA 4JY9A 4JTHA 4O8RA 5CPNA 3C3NA 4XKYA 5G4WA 3ABSA 2I9EA 3W2KA 1VH7A 2NV1A 2ZQ0A 3O1NA 3CQ0A 4JR5A 2QAFA 4OQVA 1QNVA 1P0NA 1HO1A 4AAJA 2Z6IA 2V2CA 2FB3A 4WOZA 1AMKA 3MP5A 3NL3A 3M47A 3W7EA 4NJGA 1U83A 1LOSA 3OVPA 2DZSA 3KOFA 1PL9A 1UB3A 4JTKA 1WBHA 3HG5A 2DJLA 2BWGA 3LHZA 4FNPA 2Y7GA 3CM4A 3TE9A 3VI2A 2WQPA 3DZ1A 3THQA 1TTJA 2GVGA 1XC4A 3EXSA 2VOMA 2ZRXA 4RXFA 3LBMA 4Z1AA 1H61A 1KM4A 2TRSA 2QUVA 1W5OA 1TPDA 1T99A 1VCGA 4RK8A 1XXXA 3CEUA 3W1QA 2Y62A 1TV8A 4XWUA 2X2GA 4H6KA 4I9AA 4PEKA 1GYNA 1YPIA 1G4SA 2CU0A 1K7EA 4PFMA 4GUJA 2ZZ7A 3S5OA 1BTMA 1UUMA 4LVGA 3WK0A 1FDJA 3P7YA 4FX6M 5K9CA 3BGJA 2RFGA 4W9TA 1G7VA 2QCMA 3NQVA 2WOQA 3TIMA 3HBLA 2V0TA 3W7CA 3M5XA 4NJHA 1F6KA 1IIHA 2ZZ6A 5DELA 3SZ8A 3T55A 1YDNA 3TNOA 4TMCA 3RLVA 1VLIA 2P0OA 3L2IA 5K3VA 4MIMA 3LERA 1FDYA 3DXIA 5K2ZA 4JYDA 3TJLA 4O12A 3WJSA 5BW6A 2D73A 1AK5A 2V5LA 3UWQA 2CLHA 1SQ7A 2YW4A 4Y96A 1H50A 2OX1A 1EP2A 5HNRA 5EMUA 4UFIA 1R30A 2VFEA 1LLWA 4BF9A 4M6QA 4ONVA 4Z0SA 3LHUA 3TUUA 2J88A 1I2NA 3R13A 3PS7A 1ML1A 1K03A 2ISSA 5HINA 2OMAA 1W8SA 3LM7A 4A2SA 3W88A 1SR9A 2AQWA 3RFAA 3ABQA 1SW0A 3OVQA 2E6FA 5FF3A 4I7WA 2C19A 1SO6A 3O6CA 1O94A 2QDHA 1EWDA 2R8WA 4FX8A 4ZQCA 2B7OA 1DJQA 1F73A 3S42A 3LCXA 2QCDB 3PG8A 3C2OA 4MY8A 4YCPA 4N9DA 1M7PA 3RK8A 1QDSA 1GPWA 3D0CA 3VE9A 3T7VA 2FFCA 2QCLA 3NQCA 1KFLA 3NM3A 3HQ1A 1PCWA 3EX6A 1Z41A 4MY1A 1XL9A 3W72A 1K8XA 4DO4A 3L0GA 1MEIA 1S3HA 1SSGA 4LTSA 3L5AA 2CZ5A 2H8XA 1XI3A 4MVAA 4B5NA 3GLCA 2RKXA 1DBTA 3W7NA 2QJHA 5C6MA 1BWLA 3A21A 3DFTA 3GNNA 2OCZA 3W74A 4Y90A 3LTSA 1UJPA 1KLYA 2ATMA 3HIJA 4R7JA 4UFHA 4XTDA 3LCLA 4N2YA 5AHEA 4QJ1A 1FXPA 4LV9A 4ICNA 2ABAA 4M7TA 4JTIA 3G18A 1ME9A 2J9XA 5I3HA 5AYXA 2QJIA 4YWIA 2R14A 2YFNA 3WJZA 4WXZA 4ZQPA 1TQJA 1X6UA 2PRMA 5CPLA 4JNMA 4MUZA 3GIYA 2XN0A 4C1KA 3BK0A 1VC4A 4XUGA 2LLEA 4IUOA 4NXSA 1LLZA 5HWNA 1NAL1 1OFQA 4Z1DA 4GNJA 1OX5A 4Q32A 3B03A 5G2IA 3W84A 3LTPA 3GB6A 5AB3A 5LHEA 3QM3A 3G8EA 4HHPA 4R34A 5AYZA 1XUZA 2WNZA 3OG3A 3DFSA 3W1NA 2BXVA 3W1MA 4ZQRA 5LNUA 1W5MA 3W7DA 3TV8A 4UTIA 2FDSA 3KX6A 4FNRA 1AW2A 1WV2A 1F6PA 2A7RA 3SGUA 2CW6A 4EOUA 1B4KA 1SW3A 2Q8ZA 2Y70A 5I3FA 3A24A 3CEPA 3E49A 1NFBA 3NYZA 4WQ6A 5FEXA 2TPSA 3QSRA 2FPTA 3UXAA 3TH6A 1KLZA 1SO4A 4PC8A 4JX4A 3NEVA 4O19A 2WPBA 4K8EA 4TR9A 1G6CA 5K4XA 3IGSA 1TSIA 1ONRA 4JD4A 5KZEA 4CCCA 2JK2A 3VCRA 5H91A 3TFCA 5AHMA 3BLIA 3N14A 3MW7A 3PC0A 1VZWA 3PUOA 1XBYA 3QYQA 4UCGA 3EX2A 4WZHA 5F1VA 1QR7A 5F4XA 5F1UA 3O15A 3TSDA 1Q6QA 3HMJG 3W23A 2BSLA 3DFPA 1VPXA 4FXSA 1BKSA 5FF0A 3W1AA 3FLUA 2TSYA 1OFEA 3QC3A 3L67A 1DOSA 4NJKA 4NQ1A 3HF3A 3H55A 3TQ0A 1AL8A 2YCEA 2FB2A 4KKXA 4UXDA 1Y0EA 4LRTA 4OWGA 1B9BA 4O52A 1X7FA 3Q2DA 1OYAA 2ABBA 5DBTA 5AHLA 2YGYA 3L0KA 2PRLA 4O18A 4DO6A 3I7RA 5G5IA 3NQAA 3IIXA 4GC4A 5D38A 4PODA 5EL1A 2A6NA 3SJ3A 2E6YA 3N2XA 4WY0A 5L9FA 1PHQA 3MBDA 4ZQNA 1SZFA 4FNTA 1HTIA 1U5JA 1OFAA 2Y7FA 1H7PA 1RQBA 4M6PA 1PS9A 3I65A 1LROA 2CZFA 3H53A 3W1XA 3W6YA 1H51A 2G95A 2ZZ2A 2GVJA 4LS1A 4UTTC 2OZ0A 2EGZA 4LVDA 1DQXA 3HPZA 3W70A 1DL3A 3UXDA 2I1OA 1QCWA 3EB2A 5DXXA 1GJPA 1C9DA 2TYSA 4MJZA 2B4GA 1ZENA 1K3UA 2A5HA 4HNVA 4MOZA 4LC6A 3TJXA 3M5VA 2G97A 4ZQOA 4K7YA 1W5QA 4QNWA 1BEUA 1GVSA 2WV8A 2Y88A 1TTQA 4JS3A 4A22A 4K6AA 4X22A 1ICSA 3K30A 1W37A 3CB8A 1K7XA 1GWJA 3I6RA 4IMDA 3E0IA 3R12A 1D9EA 2HS8A 1TPVA 1R2SA 1XCFA 4IQLA 3W2NA 4O1DA 3VE7A 3CTLA 2R94A 2Y61A 3KVMA 3N9RA 4UTWA 1B3OA 3W2LA 3LCWA 3LRLA 5A8GA 1RZMA 4UNKA 1LRTA 3L68A 3GDKA 3LDVA 3W1UA 1GVRA 1H60A 5J5RA 1KV5A 2HS6A 5CPOA 1THFD 1G4TA 4CNPA 3SECA 1LOQA 5D32A 4OHQA 3O16A 4Z1BA 3GDRA 1OFRA 1VR6A 2EAWA 1QO5A 1TRIA 3VNDA 1TO3A 4K36A 3EX1A 3TKFA 1JUEA 3P67A 2Q8LA 1KM6A 3NZRA 1I2PA 4E0CA 3G1XA 4MLRA 2ZDRA 3GXTA 3SGZA 1DHPA 3WK3A 3SIZA 1J4EA 3W7GA 3QH2A 4UMAA 1EUAA 1W0MA 3PUDA 4FNUA 3S1UA 5K7JA 4GJ1A 4NZFA 4UFMA 2X1UA 1KBIA 3V1PA 1SPQA 1PVNA 2VEIA 4MY9A 3EXRA 4JICA 5I3KA 3LBCA 1OFBA 3TX9A 3C61A 5FF2A 1F7BA 4FIRA 2QCNA 1EB3A 3PWAA 3ATYA 2DZWA 3DI1A 1YDOA 5D02A 1RV8A 5TQLA 1LBFA 3L0NA 4LS0A 3N19B 3NL6A 2UV8G 4P2VA 1XFBA 3G1VA 3NPVA 1QOPA 3IGXA 1OHLA 2VEKA 3M5YA 2V81A 3E96A 1OX4A 1PIIA 3A9IA 3NAVA 5LZLA 4C1LA 4HSOA 3W7QA 4EIVA 4XZ9A 5D2XA 2FTPA 1TREA 1GZGA 2VFFA 1LOLA 4KWWA 4GUFA 3W7KA 1EPXA 2WNQA 3PVFA 3EX4A 4ZL1A 1OF6A 5LGXA 2ZRYA 3AO0A 2CLEA 3HGSA 3UWVA 4PL1A 3M6YA 2NUXA 4CQ9A 5DCEA 7TIMA 3W7HA 3UQNA 4QISA 1TPC1 2ATSA 3MO7A 1LM1A 3KRUA 3BLFA 3UPBA 1OYBA 2TMDA 5K4ZA 2CWNA 1ME7A 3G0XA 3RF9A 1YTKA 3TMLA 4UTKA 1JCMP 3MI3A 1YPFA 2A0NA 3DH7A 1O5KA 4MJMA 1M6JA 3TSMA 5IM51 3QQ0A 3W9ZA 3F4WA 3B05A 2VC6A 1GT8A 4JX5A 1JR1A 3M5ZA 4DO5A 3ATZA 3B0PA 1FUYA 2EKCA 3LCFA 3W1RA 5F4SA 4FX7A 1GTEA 3M1ZA 5EA9A 1KTNA 2FJKA 1BWKA 1G7UA 1ICQA 3LXBA 3QRHA 3TQVA 1ZJIA 4QAIA 3W71A 4POCA 1JJKA 1JULA 2VFDA 2H8ZA 1VLWA 1YXDA 5C5YA 5G4EA 1YDVA 1TQXA 3DHDA 2QDGA 2WSRA 4UFKA 5FEWA 1HFBA 1T0OA 4O1AA 1GEQA 3OHIA 4RKAA 3QMTA 1KW1A 2ZZ3A 1X1ZA 1EP3A 2A1YA 2V2DA 3BW2A 4J9JA 3VKJA 3WJXA 3S8HA 1YYAA 4K8HA 3CWNA 4JDBA 4IPIA 1JCXA 1KFCA 4Z1CA 1PE1A 5G2HA 2ZA1A 1VYSX 2X1RA 3JR2A 4LRSA 3TA6A 5LGZA 4S1FA 5CSRA 3C8FA 1O60A 2ISVA 1S5TA 4WUIA 2NLIA 4OGZA 4OV9A 1UBSA 2EPHA 4HNUA 1QO2A 4NZJA 3W2UA 1EUNA 5DCBA 3TAKA 1L6YA 4NJJA 3FYOA 3L5LA 4GUIA 5F2GA 5KSWA 3UWWA 3EX3A 1NVMA 3LHVA 3OVRA 3T4CA 6ALDA 1Z48A 4M19A 1RPXA 3O8AA 3S5YA 3L9CA 4Q33A 2QUTA 3DHFA 3C4UA 3DFOA 4I7UA 4N9CA 5BMXA 5FESA 4YCOA 3M44A 5D05A 4L4MA 1IXQA 1FXQA 2A4AA 5FI8A 2JKEA 2CLFA 1VYRA 5AC6A 3GR8A 5D2VA 4O15A 3LCGA 2P10A 2E68A 2YFOA 4AMAA 4UFJA 3OA3A 3W85A 3N34A 3GAYA 3DBPA 1OF8A 3NR0A 4JXCA 5T26A 3O63A 4RLIA 4LOCA 4MLJA 5CG7A 3IIZA 3BO9A 3TAOA 4K39A 3G0UA 4JTEA 3G24A 1FWRA 5DLCA 1RQHA 1IXNA 3OIXA 2RDUA 2WNNA 4IPJA 4H3DA 2PCQA 3PBUA 4WJEA 1V7YA 3CT7A 1LDCA 3RLUA 4GE8A 3G22A 4XBKA 4RR4A 2DZTA 4LVAA 2F84A 2ZZ5A 4EF8A 4JTSA 3G1AA 3U8GA 3BV4A 4RX0A 2YPIA 5EPDA 4MYAA 3EWBX 5D2YA 1O95A 1GVFA 1TRDA 3KRSA 2E5CA 4UMCA 3BG5A 2FQIA 4GRSA 3KXQA 3BG9A 1N55A 5EYWA 4HT3A 2A2IA 3NL5A 3LCHA 3UWYA 3MYOA 4JY8A 1DQWA 3W7LA 6TIMA 1KFKA 2V30A 1AW5A 5J5DA 2WSYA 4IX2A 1JCLA 1S5VA 1OVDA 3C0JA 4LUIA 1LCOA 2GQ9A 5HQEA 2C0AA 3N73A 3UYCA 5DXYA 1CW2A 4GWEA 4GXMA 2NV2A 5TBOA 3GX9A 2C15A 3A5FA 2YXGA 3EEGA 4O16A 4PTNA 3EKZA 2ZCGA 1G4EA 3NQ6A 1LP6A 2WJZA 4GFSA 2DORA 1P5BA 1WYIA 4N4PA 1ZFJA 3GR7A 4LVFA 1NEYA 1WOBA 3IRDA 4DF0A 3O05A 4I7VA 3FOKA 3W7RA 4XBSA 1OX6A 4FXRA 4RJEA 4LVBA 3LTYA 4M7SA 1L6WA 3P5YA 1GVQA 1A5AA 1GVOA 5TIMA 3O06A 3HGJA 2VENA 1NF7A 4H4IA 5C2XA 3NM1A 3PB2A 3NO5A 4K7VA 5DY2A 5C54A 4K38A 4O11A 4NNAA 4UTTA 1W1ZA 3O6DA 3STCA 3CU2A 3HGOA 1RVGA 3ZWTA 3LV6A 2CFFA 1FY6A 3L65A 4AWSA 2A21A 2ZZ4A 4ORIA 3S6DA 3EXTA 4L4LA 5D30A 1OK4A 3NQGA 4U28A 3QW3A 4NU7A 4TU1A 4UMBA 5DCDA 1H62A 4YXGA 1VCFA 4PH6A 2AGKA 3GVGA 2VFIA 2PC4A 1UCWA 3PBVA 2NUWA 1R46A 1RD5A 3DAQA 4JYEA 4BWLA 1DKWA 2J24A 2Z6JA 2Y7EA 1YADA 5BMWA 1I8JA 1VJIA 3QEZA 4N9EA 3MWAA 2G5WA 1H1YA 2DZXA 5LKYA 3M7WA 3BG3A 5AHFA 3W73A 1GG0A 5IBXC 1WQ5A 2CLOA 3Q94A 3UD6A 3F03K 3NPXA 3NNTA 4BFAA 4WX2A 4DPQA 4UR8A 1C29A 3A22A 4WOQA 2C3ZA 3HO8A 3G1SA 3T40A 1H5YA 1OJXA 1WA3A 1C8VA 3TDFA 3O07A 5F2LA 5D03A 3LXCA 4XKYB 1N8FA 3NQDA 5FF4A 1SUXA 3W7PA 3G0SA 3TXZA 2ZZ1A 2C18A 3NZ1A 3QPYA 3SI9A 4AHOA 3CIXA 1TMHA 1G69A 2ZBTA 3B06A 4FO4A 3QPZA 3GDTA 1GTHA 4M5PA 1XKYA 4GUGA 4HPJA 1MO0A 3LLDA 1TTIA 4UC5A 3QMSA 1YTDA 1CI1A 4AHPA 1T96A 1KM1A 1FWWA 4CQAA 3NQ8A 1TYGA 1M7OA 4YLWA 2FPVA 5D2TA 2YX0A 5LNRA 3A23A 3NQFA 4O1BA 1AL7A 1LZOA 3M9YA 2YYUA 2V82A 1OFDA 3NQ2A 4BI5A 1F76A 4DQWA 4ORMA 3FKKA 3QF0A 2A7NA 3KAOA 1LRQA 5LNWA 2B0MA 3Q37A 4DELA 3WFAA 5HWMA 5AN7A 2DU2A 2QCCA 1V5XA 4Q4KA 4N4QA 5HUPA 3NXFA 4LU0A 1KM3A 1JCYA 3BPWA 3STFA 3PR2A 1KTBA 2E6AA 4TIMA 4AF0A 3HG4A 3NQ7A 5E0KA 3P80A 1XBZA 4EF9A 3MHUA 3KRZA 4KWVA 1H7NA 1KV8A 3PF3A 3HJZA 1XUUA 3TSBA 1XDLA 3B8DA 1H1ZA 1R2RA 3ZWSA 5AHNA 3W75A 3W76A 1W5PA 4DXVA 2X30A 5G1TA 1ZHAA 2GJLA 2NX9A 3C2VA 3JS3A 4JN6A 5LHFA 1R47A 2BTMA 4GBUA
chains in the Genus database with same CATH superfamily
3OZPA 4GKTA 3KVLA 4FB7A 2E4TA 4GXPA 3BLEA 4JPGA 3R7MA 2VP8A 1MXGA 3GNOA 3LMYA 1WXJA 3OGSA 3LSBA 1O4UA 2FVMA 4EXBA 5IDIA 2XN2A 5IHSA 4WVXA 3B0UX 2DFAA 3AIVA 4PUJA 4LGXA 3EPNA 4GCAA 3PPCA 4MZ8A 3TYZA 3BAYA 1VKFA 3ARYA 4QLKA 1SSDA 1VCVA 3UZ5A 3IJDA 2I9UA 1QWGA 2QCDA 4ECLA 4YL2A 1UC4A 4Y7EA 9XIMA 1B4EA 1ME8A 4WSJA 3WFZA 2NZLA 4B4HA 3CC1A 1K9FA 3UZXA 4E6MA 4AD1A 3FA5A 4O0ZA 4DJEC 4KBXA 3NQBA 5LSMA 4HCHA 3VPLA 1VGAA 1E0WA 2PDJA 1LG2A 1XF0A 3ISIX 4XO7A 3FKRA 4PTDA 1RQEA 4O4VA 4MADA 4Y2WA 3TR2A 4J5NA 3BICA 3OEXA 3W7MA 3VIOA 1JGMA 3THAA 1S2AA 3MKVA 3GHRA 5IBXA 1FKXA 3MA8A 2C6QA 1R86A 3L21A 1W31A 1NWRA 4U2YA 3ZSSA 3EWZA 3CB3A 1TE6A 2ZX8A 2Y0FA 3T2OA 3BCDA 4DX3A 3LB0A 3GNPA 2WBGA 3NL2A 4RNIA 1QU4A 5GJNA 1TFVA 2Z1SA 3GIPA 5K9XA 3AHXA 4KEVA 4I9JA 4GD0A 3HOJA 1KXHA 2PDQA 1OX4B 7A3HA 2R24A 1PCKA 2AOSA 2O92A 4I3GA 4HPNA 3MYPA 2ACUA 2INFA 5CZSA 4QE4A 1HIZA 1RCOB 1ZLPA 2A3CA 5J8LA 5LA0A 1P1XA 3BW3A 3LXAA 2I14A 4XAFA 3DUGA 4DEFA 3TYEA 1CLKA 3DERA 3TCSA 2XVGA 1AZ1A 1MYRA 2PGFA 1A0CA 2R91A 5EGRA 2JKPA 2ZTJA 2OU4A 2X0SA 1MSSA 5FACA 4JTGA 4UFLA 8XIAA 2QEZA 1EZ2A 1J18A 2ZA2A 4REQA 3IUIA 4E3VA 1FFRA 5D9NA 4QJ5B 4YHEA 1LTDA 2W79A 1VS1A 1JYWA 3EZ4A 3C0LA 4HYVA 1XINA 4PA8A 1LJYA 4DZIA 2VEFA 1Y65A 3USZA 2WNWA 3I7QA 3IEBA 4ZR8A 2QCGA 1OABA 4WLCA 2BVWA 3SRKA 3U4AA 4G56A 1AJ2A 2Z26A 4Q7NA 1K8ZA 4PMVA 4H6QA 2OR2A 1FHUA 5HBFA 3K5XA 4LYRA 3M64A 4OBSA 4ZVJA 4IJBA 3M0LA 1F9CA 3ABOA 1PZ0A 3YPIA 3QKZA 4NVTA 1XQKA 4X2PA 4O4WA 1DWGM 4X60A 1KD0A 4LFYA 1ADDA 1EJUC 4L64A 1US3A 3SCVA 3VTRA 1GOXA 1WDSA 2YDQA 3WG6A 1E0XA 2J7GA 1RCQA 3H7RA 4FK9A 1J2WA 1QNSA 3MI6A 4WF7A 2JKAA 5BU9A 3RRAA 1DJNA 4DJFA 3G1DA 1UH3A 1QI2A 2J9ZA 4NUWA 1TJRA 5HUOA 4NRSA 5CPTA 3LHTA 4HTYA 5AC7A 5CG0A 3QLLA 2F38A 1Z6KA 2WKJA 3ITGA 3BVJA 4RE2A 3TP4A 1GJWA 4GQ0A 1L2UA 5HR7A 1MW2A 1WZLA 1YBQA 1PB0A 4XTIA 1SJDA 1H7XA 1NQKA 1PHWA 1Y8BA 4QAWA 1HW6A 2UY4A 2H3BA 2OVLA 2IQTA 4P5UA 4PMNA 4L9ZA 3C5QA 3IVTA 1KM2A 1QNPA 1TV5A 4HYWA 1XSIA 4PSRA 1FA2A 5RUBA 2UBPC 4LPCA 1QPRA 1E1EA 4Q7BA 3TC7A 1RA0A 1W5NA 3IUHA 3DKLA 2ADAA 1SU5A 4HA3A 3N6JA 2VR4A 3PK7A 2J79A 2I56A 1FX6A 4XG1A 3GH4A 3KL0A 4RDWA 1QXLA 4B90A 3NGJA 4F0KA 2HJPA 3C86A 4JQ1A 1SFLA 2CXGA 4XSMA 2DH2A 5BU6A 2E09A 3AS0A 3QFEA 2X41A 3W22A 4GGHA 3NG3A 3S5NA 1WAUA 3GTNA 3WK1A 1DJGA 1LORA 4PRTA 4PTXA 2WLYA 3EOUA 3M46A 3W7IA 4L1WA 5E9AA 3H6OA 4B2DA 1EIXA 3TTSA 2YW3A 3M0ZA 4QIUA 2XGZA 2OOGA 3B8IA 3PWIA 1UWAA 1V3IA 1YLVA 3H26A 3EWWA 2QXWA 2BHZA 4ZODA 2YL9A 3R8HA 4N9BA 2HCVA 2QUMA 4D2JA 3QLDA 4GO9A 5A6TC 4C6IA 3MPGA 1GKQA 4LW7A 4RV8A 3ZOAA 3QHOA 2OQHA 5A8NA 3AOFA 2WM1A 4WY0F 4GLEA 1JF5A 4L56A 5E70A 1W9VA 1FQ0A 2XFFA 4W8LA 2BB0A 3RPMA 3QQ1A 4Z2JA 2IPGA 1K4GA 5LIUX 1X6LA 4C60A 4UTHA 4A3UA 4AB4A 1SO5A 2CLIA 3KS5A 4AQLA 1MW3A 5CKSA 2JIEA 4GYPC 3MMTA 2ZX9A 5LNVA 4RDVA 3FFSA 1WDRA 1WO2A 1YTEA 1FBAA 3GBEA 4BS0A 3NZGA 3LHWA 2PWFA 1DTNA 1E15A 2VDHA 2NQ5A 1OG0A 4Y6GA 1FCUA 3MZNA 3G5EA 2CHOA 4PMJA 3QR1A 3A64A 4MSSA 1ZALA 5C9UA 3FEMA 2FH8A 1NWUA 3I10A 4IT1A 3LRKA 1VPQA 3CL6A 4ZB2A 4KIEA 1TKKA 4JIRA 5AYYA 1TPFA 5JIWA 4S2CA 5MHBA 3HGRA 2E5DA 3GTFA 2FPYA 1FWGC 1J5SA 4QLLA 2O7QA 1XBXA 2C1HA 3UZJA 4YN5A 1P7TA 1VJSA 1ZP4A 1EEPA 4HSHA 1L8NA 2OB3A 1OYCA 3LD5A 1VRDA 1TE1A 1EWEA 2B81A 1KFJA 4LEFA 4RZ4A 3RO8A 2QCEA 4GGBA 1KBBA 4FAMA 4D6IA 5ABTA 2E77A 3FSTA 2EPNA 2J9YA 1OCJA 1ZRQA 2QUUA 3WL1A 1B31A 1DTUA 4MB5A 5D37A 2VD8A 4FPSA 4A3HA 3II1A 1HJWA 2V8ZA 1NP0A 2ZYFA 1CXKA 3KTCA 1MZHA 4CNNA 3WQCA 2PWVA 4NT0A 4ILSA 4DF1A 1JCNA 3NPUA 4ALDA 2BHYA 3BOXA 3W1PA 4J2PA 4GJJA 4R88A 4RZBA 3PM6A 3EMZA 3PUEA 1B3WA 4DF2A 4C65A 4A29A 2PDFA 3DENA 3QZAA 1EJRC 3KBWA 4HD5A 2WSQA 2QF7A 4MFDA 4DI9A 3MSRA 3FXGA 1UIOA 3DGRA 2D69A 5I5RA 1E6PA 5I00A 5I2UA 3S46A 1G1YA 4ZTXA 3GG0A 3W53A 3RNDA 2X0HA 1CGVA 1W3JA 1Q66A 1CBGA 1FWBC 3ABRA 3KTSA 2FZBA 3PJXA 1FCBA 1I4NA 1B54A 2DUXA 4GO8A 4LB3A 2WJFA 2ZRWA 1D3HA 3T42A 1PZ3A 4JTAA 1FDZA 2RH9A 3WLKX 3SFKA 5LIKX 4CKQA 2WKGA 1Y7VA 1F74A 2DH3A 3V18A 5IXEA 4R53A 4NZCA 1BVZA 4QCFA 3TK7A 2I17A 2DT0A 3F4NA 2WVUA 5D9MA 4Q6XA 2QGHA 3AXMA 4GZ7A 4PB4A 4FNQA 1EJXC 4D6FA 2CITA 4AZ7A 4Q4SA 2CLLA 3K4AA 4J7RA 1WDQA 1TPB1 2NXIA 5K9DA 4JTTA 3WQ4A 4J35A 1B90A 3N2OA 4M1RA 3RMJA 3W6MA 3BLDA 3SJNA 1GOIA 1UP3A 2OSWA 1V8EA 3IACA 3AMKA 3BQ6A 5FD0A 5HULA 3PULA 2WZTA 1MXDA 2ZX6A 4ZCWA 4Z2GA 4JY9A 4JTHA 3C3NA 4XKYA 2FGBA 1C9WA 3ABSA 5I24A 4XZIA 3W2KA 1VH7A 5FJPA 2ZQ0A 1DJYA 1QNVA 3CQHA 1MDLA 2O9TA 4AAJA 2V2CA 3IK2A 2FB3A 1GW9A 4B3KA 3N6QA 3M47A 3COTA 1LOSA 3OVPA 1UPPA 1PL9A 2ZUNA 2XIMA 5AYBA 4MNKA 1F4HA 1VFMA 2DJLA 4QDMA 2Y7GA 3FGCA 4PTVA 3TE9A 2WQPA 4GIRA 1AFSA 1XC4A 3EXSA 1NELA 2V3DA 3KCJA 6REQA 4ICCX 3LBMA 1YNQA 6ENLA 4ICMA 2ZXAA 2WYSA 1KM4A 2TRSA 4IM4A 3TYAA 3W1QA 4XWUA 4W7VA 2GJRA 1PTDA 4PEKA 4HCDA 4M6UA 2D2JA 5HQLA 1TVPA 2VRQA 1YPIA 2DW7A 1G4SA 2CU0A 1K7EA 4DM1A 1BTMA 1JDDA 4LX4A 4LVGA 1UWUA 1V03A 3UETA 3LPFA 2PC8A 3BGJA 1MZRA 3MMUA 3UR5A 2WOQA 1FWEC 4NJHA 4GH3A 1NFPA 3T55A 3T0AA 4H01A 1YDNA 2PTWA 2INEA 1VLIA 2VR2A 3BZGA 4GVGA 3ALFA 2BG5A 1I60A 3W38A 2E8ZA 3TN4A 1AK5A 3UJFA 4WDUA 3R58A 2V5LA 1XIMA 1H50A 2OX1A 3HU7A 5C7VA 1A5UA 1V6XA 1QI0A 4R7OA 4UQ9A 5HNRA 3DYMA 3FGCB 1LLWA 3W28A 3T09A 2J8TA 4J3UA 2VNCA 2V3GA 3KDNA 3R13A 1VFUA 5CBJA 3VK5A 1UR8A 2PD9A 2OMAA 1DWAM 1XLIA 4J3VA 4N42A 2PDUA 3OVQA 4I7WA 1GNXA 3O6CA 4IL0A 4Q8UA 4JTRA 2J47A 3OQ8A 4LAUA 4FX8A 4ZQCA 4ZE5A 1JDEA 4LH8A 1ITUA 2QCDB 2NVCA 4YVPA 2CKRA 2PTXA 1CENA 2P3EA 2I5GA 1OY0A 3OLIA 1GQIA 1QDSA 2VZVA 1QK0A 2FFCA 2QCLA 1KFLA 1DP0A 3VCCA 3WEMA 3VOHA 4MY1A 1QWKA 4EAYA 1SSGA 3L5AA 4K1GA 3BMXA 1XI3A 3QZ6A 3GLCA 2RKXA 9RUBA 1DBTA 2OWCA 1UIPA 3GNNA 4MF4A 3W74A 4GNKB 2J8FA 3LTSA 3R94A 4YTRA 3W81A 2CETA 4UFHA 3DHUA 4QJ1A 3CTTA 2EG8A 4ICNA 4DWDA 4JTIA 5A6KA 2J9XA 4DXKA 3E6EA 2R14A 4URIA 2YFNA 2WHJA 3CUZA 1JGIA 4AIBA 4NZ3A 1X6UA 1XIJA 1DXFA 3GIYA 4NAFB 4C1KA 1VC4A 3OB8A 4IUOA 4I6VA 1OFQA 1KCKA 5G2IA 2IPJA 3KP1A 4A35A 1RALA 3HZ3A 3FEQA 3T81A 2RGMA 2WHMA 4ZQRA 5LNUA 2Y8KA 1W5MA 1W1TA 5A8MA 1AW2A 3AMCA 1HKWA 2OZ8A 5HAOA 1UD5A 2PLJA 2Z00A 2A7RA 3SGUA 5JBFA 1A0EA 4EOUA 2Q8ZA 3A24A 3CEPA 3BWWA 7REQA 3NYZA 3QSRA 2FPTA 1UKPA 1KLZA 3ITCA 3AMGA 3U5YA 2WPBA 4AZCA 3WMBA 1TSIA 4WRHA 1V0KA 1WKYA 2IW0A 4XAZA 1E9LA 4CCCA 5PTDA 4AXNA 1FWDC 1J8VA 2XWEA 3B9OA 2XIIA 1XPYA 3PC0A 4HHMA 3PUOA 3EX2A 3PZUA 3ZJ6A 2VYOA 5F1UA 1Q6QA 1GW1A 3HMJG 2BSLA 2QV5A 4YHGA 4FXSA 3T8QA 1YDYA 3W1AA 4MTVA 3FLUA 5HPCA 2TSYA 1OFEA 3W26A 2EJ1A 3H55A 4M0XA 4KKXA 4JHOA 3WNPA 1Y0EA 7PTDA 4OWGA 3AHTA 3LQLA 2OPJA 2REQA 1KGWA 2FKPA 1OYAA 2HRWA 5DT5A 2A3HA 3RG6A 1XIDA 4LUTB 3OBEA 3GW0A 4GC4A 1DEDA 3LENA 5EL1A 2JFEX 1FOBA 2ZUSA 3CUFA 2O0TA 3SJ3A 5HDRA 1JDCA 1PHQA 1EJTC 3PANA 4FNTA 3ZT6A 3WMCA 2PBGA 2Y7FA 1J0KA 1HL8A 4GI6A 2OYMA 1QJWA 4M6PA 3KWSA 1J0IA 2CZFA 2PGWA 3UJ2A 5FKYA 4E8GA 3RPTA 3W1XA 2ZZ2A 3OBAA 2OZ0A 3M7SA 4LBUA 3HPZA 5IFTA 1QRQA 1NARA 4Z2KA 1HVXA 4ZXOA 2I1OA 1GJPA 3QBUA 4KCUA 2X7VA 3QQWA 3LZ3A 2Q09A 3PN8A 1NIUA 1POKA 2B4GA 1ZENA 1K3UA 4IJCA 3W27A 2IXVA 3M5VA 5JH2A 3NSNA 1BKHA 4ZQOA 1W1A1 4QNWA 1BRLA 1BEUA 1XH0A 4A22A 4K6AA 3WBYA 1IGWA 3CB8A 2REQB 1ZBCA 1GWJA 3I6RA 3EOEA 4IMDA 3E0IA 3EDKA 3R12A 5CPSA 1R3YA 1TPVA 1R5YA 5LIWX 1CGXA 4CUCA 4O1DA 3VD4A 3CTLA 3KVMA 3N9RA 3WLHA 3W2LA 3LRLA 1HXJA 4Z1YA 4S3JA 2OQYA 1KV5A 2QPXA 4AZIA 4OHQA 4AIOA 4A3QA 2PEVA 3VMPA 2NSXA 5BOEA 4K36A 1XRVA 3M6DA 2C1IA 2Q71A 3P67A 4C6LA 4XIAA 1G5AA 5CSYA 1Z7AA 2J75A 4EX4A 3WK3A 3BL3A 3W7GA 1W0MA 3M0IA 4YWSA 3CUXA 4UFMA 1KBIA 4CU7A 1PVNA 4MY9A 2IPFA 7ODCA 1ONEA 1O5RA 5I3KA 3LBCA 1PKLA 3TX9A 2HK1A 2C79A 1AODA 2HVMA 4S3EA 1EB3A 3ATYA 4DB7A 1VBUA 1YDOA 3WBAA 5D02A 1S1RA 5TQLA 1LBFA 3L0NA 2YKKA 2PFHA 1HJSA 3W01A 2F2HA 3N4AA 1Q4WA 1CZ1A 1F3EA 1ZSXA 4C1LA 2FZNA 3KE0A 3U57A 3K1GA 3UEQA 2HPMA 4FLOA 1TREA 2X1IA 2VFFA 2VGGA 4KWWA 4GUFA 3W7KA 1XIGA 1BXCA 2WNQA 3QTPA 1YNYA 4A3RA 1OF6A 2DSUA 1I75A 2R1LA 5LGXA 2C71A 2FJUB 3IGHX 3GDBA 1FHLA 3BSGA 2YB4A 3RXZA 2D20A 3ZM8A 1ODZA 1DE6A 3MO7A 2HVNA 1OYBA 5K4ZA 3KBVA 4H9TA 1QVBA 4KWSA 3DH7A 5M3WA 3VIKA 1S5MA 4U5KA 3BSHA 2DZBA 3QGVA 1UH2A 4DAIA 8CGTA 5MKGA 4JX5A 1JR1A 3EA3A 1V3KA 3PZOA 3FJNA 2FJKA 4V27A 3LXBA 1XYBA 3QRHA 4QAIA 3B8VA 2BVYA 4R27A 2NW0A 2QDEA 3WD2A 4W5ZA 1YXDA 4CEXC 2QPSA 4F0LA 1YDVA 1MMFA 1HFBA 3KHDA 3FW6A 4J3SA 2HEJA 1EP3A 3BW2A 1B30A 3VDAA 3GXFA 3WUBA 3S4TA 2JEPA 2WZIA 3WBEA 1QBBA 4CN6A 2X1RA 3ARPA 3TA6A 1A5LC 1O60A 2ISVA 2D2OA 2NLIA 2EPHA 4HNUA 1UH4A 3TAKA 1GOMA 3LHVA 5CBIA 3HQPA 3ITXA 4V28A 1OIFA 1D2KA 1UKSA 1CGYA 3S5YA 5DMYA 5KZ6A 4Q33A 2DVTA 2PDIA 4CD7A 1XC6A 1VEOA 3DHFA 4F4RA 4I7UA 5BMXA 3AHYA 4NAFA 1IHIA 1IXQA 1JZ8A 2A4AA 4IZGA 1H09A 2E40A 4C5ZA 4DUXA 3R8GA 4G7EA 1E56A 3MCOA 4O15A 4OOZA 3CZJA 2YFOA 3W85A 3B9AA 1OF8A 2DT1A 5A95A 4LOCA 5CG7A 4P7NA 3BO9A 4JTEA 1FWRA 3KL3A 1RQHA 4JFUA 1XYMA 3SGGA 1E6RA 3PP7A 2OZ3A 2RDUA 4H3DA 2XU2A 3BAIA 1XGDA 3SAZA 1AJ0A 1LDCA 1Q4NX 2AKMA 4GE8A 3G22A 5AVNA 1X1NA 5DQPA 4LVAA 3AYVA 4D8LA 5TAOA 4AY8A 2GGIA 4RX0A 1HKVA 3QY7A 2XGBA 4GVHA 3WH8A 5FSEC 1GVFA 1TRDA 2PP1A 1C8YA 3BG5A 4Y9MA 2NVDA 1L6FA 1J93A 3WLTA 4Z17A 4Z2HA 3KXQA 1N55A 1E6NA 5EYWA 2A2IA 3NCOA 3NL5A 3AIWA 3LCHA 1DQWA 6TIMA 1SFTA 3GNXA 1RCXB 1RBAA 2OLSA 4A3YA 1UJQA 3BJSA 2V30A 3F4VA 3SO7A 1S5VA 1UYQA 4IJRA 3ITLA 2C0AA 3N73A 3UYCA 3V5FA 2YA0A 5BROA 1MVYA 2VGIA 4O16A 4PTNA 3S83A 5FJRA 4PCSA 2WJZA 1WYIA 3VU2A 5LXEA 3GR7A 1MRQA 4DF0A 1ITQA 3WYZA 4FXRA 1V93A 3FX4A 4M7SA 3CV7A 3P5YA 4MAZA 2WSPA 3QV8A 5DFAA 1PIGA 3ARUA 5TIMA 3O06A 3HGJA 3NUKA 4H4IA 3BLLA 3NM1A 3TN5A 3T05A 4K7VA 5DY2A 4PYSA 1J0YA 4K38A 2VZUA 4NNAA 3STCA 3O6DA 4JBRA 5GPRA 1KCXA 1RVGA 2DSKA 1FY6A 4AWSA 2ZZ4A 2VX7A 3EXTA 4IIDA 1OK4A 2DW6A 2HE8A 3CT2A 4QCEA 4NU7A 4TU1A 1Z89A 3CYVA 4IG2B 3O0FA 4YXGA 3ZVHA 4KIRA 2EBNA 4PH6A 2J7FA 2NUWA 3PBVA 1RD5A 1KXTA 3QGAC 3A6OA 2VUNA 2Y7EA 2E8YA 1W2PA 5KETA 3F4DA 1CGTA 3BG3A 5I03A 3UZYA 5IBXC 3MMWA 4HZ6A 3G77A 2C3ZA 3HO8A 3G1SA 2X42A 3NEHA 3CXOA 2Z7GA 3NQDA 4AVOA 3W7PA 5H8UA 3G0SA 4U2ZA 2ZZ1A 2C18A 3MWCA 3QPYA 3SI9A 4RW5A 1G69A 3GDTA 2OKOA 2UZ9A 4M5PA 1V6UA 1XKYA 3KBSA 5E0CA 1PIFA 3EOLA 2XG9A 4IPNB 5CC7A 1T96A 2FH6A 3EBVA 4XVEA 4CQAA 1V3MA 1W9UA 4D6CA 3A23A 1LZOA 4I9TA 5B7ZA 1K6WA 4S39A 1UD3A 2VJXA 4I9MA 3GVQA 4BI5A 2X05A 5CQ1A 3KWXA 3KAOA 2B0MA 1W91A 4HYRA 3Q37A 3TNBA 2QPUA 5AN7A 2XVPA 5HUPA 2J6VA 3NJ3A 4QX4A 3TZNA 5M2FX 3PR2A 2E6AA 4TIMA 4XV0A 5E0KA 4FXFA 3LGGA 4EF9A 1UROA 3KRZA 3VUSA 3E74A 2HXTA 5ABGA 1KV8A 5JBEA 5EB8A 3DG6A 1V08A 2HBVA 1XDLA 4JAWA 1H1ZA 3TWBA 3W76A 1JFHA 3OLGA 1RP8A 3LMZA 1ITXA 3C2VA 5CC6A 2W27A 2E0PA 3GRIA 4IGNA 4GVFA 4HBKA 1PO9A 4R85A 3G2GA 5FAGA 1DWHM 4RXGA 4GYPA 3H4GA 1R2TA 3RCYA 5CZJA 5CXPA 4Y8EA 3NQMA 4D6DA 5GNZA 3MO4A 1RAKA 4LF2A 2J7BA 3E2SA 2JGQA 5EFDA 3CLMA 1SM9A 3G3MA 1H0GA 1H7WA 1LQAA 3O9NA 2ZOXA 4YTUA 1GYLA 2ZKMX 3AC0A 1IF2A 2YDAA 3INPA 5HNTA 3VFLA 1JQVA 3SQSA 4W7WA 3AIEA 3AAMA 1K8YA 2GYIA 3CHVA 2VZOA 1VPYA 1QATA 2ZRVA 3GKAA 4UB9A 5BXSA 4K8GA 1KFEA 1TR1A 1SZGA 2FZDA 1TZ9A 4EPDC 1CX9A 5AFDA 2HTMA 4IQDA 1TJ2A 1QPOA 4JIIX 4MZ1A 1QHZA 2OZTA 3LPOA 3P8IA 2W66A 3ENLA 4WY0B 1XLMA 5B7YA 4DWSA 1YXCA 4OU1A 1UASA 1XW8A 4NZ4A 1XKJA 1OC6A 2NUYA 4O28A 4QITA 4PMRA 5DT7A 4F2UA 5CJ5A 2PRHA 1V0NA 3UZZA 2YLAA 1LQ0A 2EG6A 4LSBA 5DY3A 3CBWA 4HP5A 2JF6A 1JPHA 4B92A 2AL2B 3TC3A 4AHQA 2WAGA 2G96A 1P0KA 2VCCA 1CYGA 1F3XA 3Q58A 5BRBA 5JU6A 5I3JA 4P8UA 3PZVA 3G1FA 4INFA 4HMDA 4MYXA 5B80A 1LBMA 3C6CA 3GG8A 4LXFA 4I5RA 4LYQA 1EHAA 4IQEA 2XFWA 1XHGA 9CGTA 2C16A 2XIBA 2O9RA 4F9JA 1ZCOA 5LA2A 3UY8A 1UD8A 1G4PA 3E0LA 2V3EA 3WQOA 3ARTA 1TUFA 1T40A 1EIBA 5G4HC 4NJIA 3XIMA 1BLIA 5U4NA 4Q8QA 2NXHA 3KTXA 4AD4A 3WLOA 5E93A 2B7NA 4D1IA 1YKWA 1OB0A 1F4AA 1D3GA 4MPQA 1RR2A 5IOBA 3E9AA 2QMJA 4GQRA 4DBUA 3MJYA 2NWRA 4NZ1A 1GQNA 4M6VA 4H7VA 4MB4A 4US6A 3TC6A 4ROQA 2QAPA 3LN3A 2YR1A 1JAKA 2HVOA 1E9YB 1OWQA 3DESA 3OZMA 1WKDA 3SW6A 1P7TB 1CDGA 1OFPA 1QT1A 1N7KA 3M0MA 1YXYA 4Q8PA 4PB3A 1RJRA 2OEJA 1SZEA 3GFXA 1KCLA 3WF2A 3CASA 4NNCA 5C55A 3SRDA 3RX2A 1C8XA 1FTXA 4RE4A 4Z2LA 1X38A 2HK0A 3F1QA 4A4AA 1AW1A 4RZ6A 3E12A 4F0MA 5FJIA 1LRNA 3NOEA 2A6LA 4Q8OA 3W86A 1VQTA 3ARWA 3IJ8A 5EBAA 1KA9F 5HMSA 5REQA 4P7RA 3GKFA 3JU2A 3KM8A 4TX9A 1E55A 3TFXA 2VM8A 4DHGA 2XUCA 2PLKA 5JXQA 1MI3A 3GO2A 3N1AA 1GKPA 2A7PA 3THUA 5I77A 5GNXA 1K77A 1GUVA 3ZO9A 3S1VA 3WEZA 1ELSA 3VZYA 3W25A 4ADTA 1EGMA 2YLLA 3L12A 3TOYA 2XN1A 4KFOA 1P4CA 3LA4A 1TB3A 4G7FA 4GY0A 4EPBC 3TR9A 1ICPA 3A4JA 5D9OA 1JF6A 3KZSA 4L80A 1GZ1A 1R0MA 4OBTA 4U10A 3P8JA 4O54A 3APYA 4AFYA 2O4MA 3RU6A 3MTWA 4AC7C 3CH9A 2ZRUA 1KM5A 2FVLA 1EP1A 3SB0A 1TZZA 4OUEA 4DJDD 4IOTA 3LLFA 1F5ZA 3UF9A 3S1GA 2AAMA 3WELA 1A5BA 2VWSA 3L5MA 2GL5A 1X96A 4M8UA 2QIIA 1PZ2A 2GUUA 4UTUA 4PMQA 4E4FA 3WLQA 2E9LA 3HG2A 3P84A 3NDYA 5CAKA 4FF7A 3FS2A 2QJGA 4RW3A 3GQYA 2G4FA 4JHMA 1A5MC 1ISWA 3ZR5A 4B2DD 3SCQA 1KBJA 2RAGA 2HISA 4B9ZA 2VFGA 2DZUA 2NQHA 4M3PA 2IUZA 1EL3A 2EPOA 2VVSA 1W3IA 1L0PA 2QCFA 5D33A 2QR6A 1AUSL 4GX8A 4NXKA 1HG3A 4OECA 4O1FA 5EU9A 2O9PA 3G8RA 3HM7A 3NURA 2FHFA 3EOOA 1K8CA 2O7SA 5BOOA 2PODA 4QFUA 1F61A 2CHNA 2FTYA 1FWCC 2V2HA 2CPUA 2PP3A 2ZE3A 1H7OA 2GPTA 3SR7A 2DUAA 3UWZA 1RSCA 1TWSA 4IMGA 1Z9AA 4EWND 4AEFA 1H0IA 2CLMA 1FFQA 2B7QA 3G1HA 3U2ZA 3V5OA 1BF2A 2D3LA 1XV8A 3SUSA 1EYWA 4J4KA 2A85A 1MW1A 1F05A 1HJQA 4MWAA 4BY3A 2YZRA 4MZYA 3CZ8A 3D46A 3L7RA 3QTGA 3C56A 1EGVA 4JHZA 3I68A 1ADSA 3VMOA 4V33A 4PUWA 4O50A 2NWSA 4JN7A 3FYYA 3S2MA 5IDZA 3P5ZA 2PP0A 1PZ1A 5ABFB 3CV6A 4B5VA 1TPWA 4CNSA 4Z0JA 1UR4A 1EX5A 3VGGA 3JVAA 1XG4A 2G50A 3OBKA 4IGHA 4GI8A 1XYAA 3FHAA 4TTUA 4K37A 4J3WA 4OIFA 2VC9A 3SSZA 1TA3B 4AZGA 4C6FA 1QHOA 1XR2A 4WSKA 3RILA 3IVSA 1EA0A 2DY3A 5DEZA 3CV2A 3S6OA 2R1PA 3T78A 3RLHA 3FYPA 1XYZA 1SW7A 2F6UA 3GU1A 1WX0A 3WN6A 1O7AA 1CB2A 1KM0A 3MDWA 5AECA 5A6AA 1T8XA 1FH8A 4IFKA 1TTPA 2CZDA 1EJSC 2ESCA 1XM3A 4X9SA 4G1KA 4Y9NA 4IIEA 2DZVA 2DJXA 4JTJA 5FOOA 3CS2A 4QSHA 1Y5VA 4HNNA 1ZCCA 1V51A 1NWSA 2XFRA 3GVRA 3MUXA 1Q45A 1W3HA 4YYCA 2GGGA 4MMWA 4GY7A 1W3NA 3RM8A 5F2IA 5ABFA 1DIEA 4E2DA 1FWSA 5J04A 3DFQA 3KHJA 1XLFA 1Q7QA 4QNEA 4HU4A 5MF5A 3VD7A 3MCMA 3NDZA 1XIIA 4NY2A 2ZADA 1E40A 1K70A 1BHGA 3AU2A 1P6WA 4DBDA 2CIPA 1U22A 3GS6A 3W07A 5I09A 3EB3A 3VILA 1RJQA 3E5PA 4FIQA 4WXYA 3UA4A 3RR4A 4LY8A 1BXNA 4AH7A 1J5TA 2P3ZA 3VC5A 1PX3A 4DXXA 1GOWA 3PZIA 3PZQA 3EDEA 4CVWA 4XD3A 1EX1A 1UZHA 2PDCA 3NO1A 2Z1WA 4EXAA 2RGLA 1K7FA 4ACZA 1Z8AA 4JCLA 4JGDA 4DBEA 3DI0A 3PSVA 2J8GA 2DUZA 1PV8A 2D0HA 4B3ZA 3ZQ9A 4LC8A 3W87A 4IPPA 3ZS4A 4DRSA 5GJPA 4C6DA 4QDPA 2E1WA 3CO8A 3KS6A 3FJLA 2QCHA 1IZCA 2EHHA 1DV7A 5CGMA 1E70M 1IWPA 4H1ZA 4X61A 3KFTA 1V3HA 2E5BA 4YIWA 1WUEA 3GYCA 1A3XA 1MFVA 3IAQA 4EXQA 1IEQA 2EO7A 5DN1A 1ALDA 4O1EA 1ODUA 3QW4B 3WD0A 2GWNA 1GOKA 5CBBA 3WQ6A 1EQPA 2BOFX 2QZRA 3HPAA 4Q6JA 3VO0A 4U33A 2V5KA 3TCEA 3WLNA 1RBLA 4ZXLA 4UQAA 1O5XA 3SY5A 4Q8NA 2X1TA 3G1YA 4LNCA 1Q2SA 1ECEA 4C1NA 1BPLB 3QZEA 3F7JA 4NI3A 3HN3A 4YNGA 2DVXA 5I3GA 4RV3A 1JRBA 5CSSA 4HNTA 1J2BA 3AS2A 1FWAC 4N6FA 1T41A 1EC9A 3RJXA 3ARXA 3H2OA 4NIRA 3VCNA 2H90A 3KOWA 4HIBA 1ZAIA 1KR0A 5EKYA 4X3ZA 3SCOA 3BURA 4OJYA 1XISA 4NX0A 3VX0A 4QTGA 2QIWA 2D22A 3TYBA 1QPNA 5DO8A 4AF0B 5BWAA 4K2SA 1LL6A 3R8RA 4FNSA 2PAJA 2VL4A 1SR0A 3ARSA 3FIGA 3R89A 4Q8TA 3AS3A 3CUIA 2D0GA 5E1QA 2CZEA 3L4YA 1PBGA 2EXOA 3ARZA 2J7EA 1A5NC 1V0MA 3KLLA 3ANVA 3T0TA 4AISA 4HCLA 1FP8A 4GQQA 5D04C 1FWNA 1XDMA 3CIWA 2OT0A 4CCDA 1JUBA 4H8UA 1X39A 3W7JA 1HUVA 1EC7A 4WGXA 1JDAA 1FWTA 3EKLA 4BI7A 4DVOA 4LBRA 4WKFA 4AEEA 1F3TA 4J3ZA 3B4UA 1BYBA 4H6EA 4HJFA 2OELA 3D6NA 5G4WA 1OGGA 2I9EA 3AZTA 3EYPA 1S39A 3R0UA 3O1NA 4JR5A 2QAFA 1P0NA 3I3BA 3VNYA 4WOZA 3BH4A 4LYPA 4WEVX 1E5JA 1AMKA 3NL3A 3K4WA 4Q4QA 2BXYA 3W7EA 3PBGA 4IQJA 3KBJA 2DZSA 3KOFA 3N17A 3GTXA 5E6YA 5JBDA 3SBFA 3N13A 4PMYA 3CM4A 1TTJA 3AISA 4RXFA 2NSOA 1UKTA 3NTYA 4Z1AA 1IWAA 4YJ5A 2QUNA 1TPDA 1T99A 1VCGA 4RK8A 1P0EA 3CEUA 1TV8A 3VC6A 3VOCA 1QW8A 2HNHA 5FCZA 1JZ6A 4GUJA 1VFTA 2ZZ7A 4FALA 3U48A 5BRQA 1LF1A 4PBEA 4Q7IA 4H6RA 3P7YA 4FX6M 4W9TA 5H6HA 1WZKA 1GYMA 3TIMA 4TVCA 3HBLA 4DJDA 4C6NA 3W7CA 3AIBA 1XLGA 3GC5A 3GR4A 5E09A 3E2VA 4IP4A 5AC4A 3SCWA 1CXEA 4MDPA 3TNOA 4CVUA 4BF5A 2P0OA 3UW6A 5K3VA 3BQ5A 4LF1A 3LERA 1FDYA 2ANUA 3V16A 5K2ZA 2EPLX 5BW6A 1HJVA 1V6YA 2D73A 5F7UA 2ZC8A 1U5VA 1O6IA 3E5BA 4QEEA 3UPMA 3UWQA 1N8WA 3WUGA 3FJ4A 3QV9A 1R30A 2VFEA 1DJIA 1BQCA 2YCLB 3LHUA 2Z27A 4IG2A 1PTGA 1K03A 1Q2RA 4A2SA 2VHLA 2ODOA 3OA5A 2GJXA 2P76A 1XRFA 2R8WA 1NP2A 3UFYA 2KAUC 4IGMA 1BG9A 3LCXA 1VJZA 3CIVA 3F5JA 2NQ9A 4FXJA 4HJWA 4L6OA 4YCPA 2UY2A 4XD6A 1VIZA 3RK8A 1GPWA 4JQAA 3VE9A 4C7GA 1KR1A 4L9YA 3EX6A 1V6WA 4DNHA 3L0GA 1MEIA 4HQVA 2GDUA 1KQYA 1VFHA 3E0WA 1J10A 4QRNA 1DIKA 2QJHA 5C6MA 3DFTA 4PCPA 4Y90A 1G94A 3F2DA 1W9XA 1XIEA 2YA2A 1HVQA 1H11A 1KLYA 1WXZA 4PRRA 4R7JA 3LCLA 3R4IA 3IJ6A 3PZGA 3ZZ1A 4LV9A 2ABAA 1TZ7A 4HMNA 5I3HA 4LY4A 4PUNA 1XH1A 4R9XA 3NSMA 1EH9A 3WJZA 4WXZA 2VRJA 3TW9A 3CHDA 1UKOA 4XZNX 5CPLA 2XN0A 2LLEA 3WDQA 4NXSA 1LLZA 2W67A 4GNJA 1QBAA 1OX5A 3B03A 3LTPA 3GB6A 4IFOA 3TTOA 5AB3A 5LHEA 3QM3A 3G8EA 4LYKA 4R34A 3RPDA 5TF0A 1YNPA 5C8BB 1EF2A 1JZ5A 1LLOA 3A12A 4FP1A 2VZSA 1B1YA 4QP0A 1F6PA 2PZNA 2DVUA 3B9EA 3F4CA 4YTTA 5FEXA 4GIYA 2OODA 1X8CA 4KWOA 3BUVA 4UNIA 3TH6A 1LT8A 2XIOA 1SO4A 2HBXA 4DAFA 3NEVA 2G0WA 4TR9A 1G6CA 5XIMA 5CC3A 3U2CA 5KZEA 1OEPA 1CTNA 3VCRA 3S3GA 2VO5A 1VZWA 1P48A 3CZGA 1XBYA 3WDHA 1KRCC 4TVDA 1E71M 5F1VA 1QR7A 3TSDA 1A3HA 3W23A 3VGFA 1R3RA 1BKSA 2VGFA 1XIBA 3O6AA 3DX5A 3VXGA 2A3LA 3L67A 1XLEA 4NJKA 2ZVIA 3HF3A 3TQ0A 4ROPA 5DRCA 2G3JA 3WKZA 4UXDA 1V3LA 4LRTA 1B9BA 3VVGA 4GI4A 1AQ0A 1X7FA 5AHLA 3WQ8A 3NQAA 3BCFA 3E2QA 4D9PA 2WC3A 4O0QA 1MNSA 2E6YA 3RHGA 4CGTA 1JYNA 4DWSD 2GLKA 3MBDA 3LNPA 1DPMA 2IKJA 1OFAA 3Q67A 3IJLA 2DDXA 2ZX7A 1RQBA 2V5JA 4J1OA 1PS9A 2EG7A 4QGCA 1AQHA 3I65A 3VIMA 1DJWA 4GPNA 5DX7A 1H51A 1X6NA 2OEKA 3MSGA 3ME3A 2V38A 3N18A 4I5XA 1R87A 4HU0A 4LAZA 1OM0A 4KMQA 4IIFA 1Q8AA 1O1HA 3HFYA 3UP8A 5DXXA 5T9BG 1E3ZA 1EHNA 1C9DA 2CEQA 7TAAA 4LC6A 2G97A 3CZKA 4K7YA 1W5QA 1GVSA 2YXOA 4E4PA 1CECA 2Y88A 3TTQA 4X22A 3K30A 4E4UA 2H9AB 1ENUA 2V5DA 1D9EA 2HS8A 3VINA 1R2SA 1QOXA 3W2NA 4GIEA 1POJA 4UTWA 1YIXA 3NSXA 1RZMA 1LRTA 1MUWA 1E4IA 3W1UA 1GVRA 5J5RA 1QHPA 1XDJA 2G3MA 3N4EA 1FWFC 3FCPA 3SECA 1LOQA 3AROA 4DBWA 3DDMA 4L65A 3MQTA 3GDRA 4Y9PA 1OFRA 3ECQA 2EAWA 2P8CA 4X9YA 1QO5A 3VNDA 4P8VA 3EX1A 1JUEA 2BFGA 1KBKA 1KM6A 4GBDA 1E43A 3OG2A 4JEJA 4FOJA 4E0CA 1VBRA 3TONA 3W4RA 2ZDRA 3SGZA 4GOAA 1M65A 1J4EA 3GNRA 1ZJAA 3UJEA 1EUAA 3PUDA 3P0XA 3PJWA 4FNUA 3S1UA 5K7JA 2J7CA 4GJ1A 1B3YA 4NZFA 4C6JA 3DOPA 1RY0A 1NY1A 3WL0A 4JICA 1S38A 1BWVA 1OFBA 4AWEA 4LCRA 1XLDA 2QCNA 2MNRA 1P0BA 1W3KA 3H12A 4ERAA 3DI1A 2P53A 3B8SA 3LK6A 4GMEA 1FP9A 3N19B 3NL6A 5EMYA 4P2VA 1ZL1A 3SCPA 1XFBA 3G1VA 3LPPA 2VEKA 3E96A 1JL8A 1PIIA 1XJBA 1C7TA 3A9IA 5LZLA 1G0CA 2WMIA 3BTNA 4HSOA 3W7QA 1R3SA 4EIVA 3ZYZA 2FTPA 4HZ7A 1GZGA 3S5SA 1TWZA 3SIMA 3TN3A 2GSEA 3GG1A 3TA9A 2ZRYA 3AO0A 5DRIA 2CLEA 2WVTA 3SURA 3BAJA 3UQNA 1VD6A 1TPC1 3AQUA 1E4NA 3KRUA 1KGUA 2YBTA 5HANA 3OZOA 1ME7A 3G0XA 3VNKA 1WUFA 4HA4A 3VM7A 4H9ZA 4UWMA 1V0LA 1YPFA 1CLVA 2A0NA 2E28A 3QOMA 1M6JA 1PUDA 4HVXA 1OBAA 3CMJA 1EO7A 3QQ0A 1U30A 3RO6A 3W9ZA 3EWCA 4ZO9A 4F0RA 1EA9C 1GT8A 4M51A 1QTWA 4B4FA 3ATZA 3LCFA 1FUYA 2EKCA 5ECUA 4FX7A 1GTEA 1XSJA 3M1ZA 5EA9A 1DE5A 1BWKA 1ICQA 3TQVA 1ZJIA 4D8ZA 3U7BA 3W71A 3IWPA 3GH5A 3OYZA 4POCA 4C6CA 1JJKA 3T0BA 3ES7A 1VLWA 2WMIB 5HMEA 4FI4A 1UPMB 3CQJA 3WNNA 1REQA 1TQXA 2QDGA 2WSRA 4UFKA 5FEWA 1W6TA 1T0OA 4W93A 4UZUA 3GVWA 4KGJA 3IV8A 3QHNA 4UOZA 4S3BA 2ZZ3A 1U2YA 3QYSA 4J9JA 4I90A 3CPUA 3VKJA 4K8HA 4XISA 3CAVA 9XIAA 1IQ8A 1PE1A 1RH9A 3FVMA 3VIHA 4F0SA 3C0QA 4LRSA 1NDVA 4S1FA 5CSRA 4KPLA 4WUIA 5A1AA 2ACSA 4NZJA 3RITA 3LUTA 4PMZA 4XIMA 3L5LA 4GUIA 2CLPA 2YL6A 5KSWA 3LU2A 2W61A 3DC0A 1DWIM 1Z48A 1RPXA 4DJDC 3VDBA 4HHLA 1VFFA 1OGSA 4A8IA 3C4UA 3DFOA 4XVDA 3URAA 3H21A 2VEGA 3R79A 1LUCA 1WKEA 4W89A 4QJ4B 5D05A 3REQA 8XIMA 1SJCA 2ZUUA 5D2VA 3GR8A 1OCBA 4D6JA 4S3GA 2P10A 2E68A 4AMAA 4UFJA 3OA3A 3N34A 2G3IA 4S3AA 3IJQA 3NWRA 1B3XA 4LAOA 4RLIA 2PDKA 3LM3A 3IARA 5CPQA 3TAOA 5M5DA 3OIXA 4HK6A 3PBUA 3ITVA 3AMLA 2HXUA 4AVNA 4WJEA 3HV9A 4KRZA 3CT7A 1WXYA 1DHKA 4PUUA 2DZTA 3G1AA 4PMDA 1JZ2A 3TLQA 1PAMA 1TX0A 4JKKA 5EPDA 4MYAA 2JEQA 5D2YA 1VFOA 4Q4PA 3EMCA 3KRSA 4N7QA 1ZQ5A 2AMXA 3PTQA 5A69A 3NGFA 3SRFA 2YIHA 3MUZ1 3VIIA 3MVIA 1KNWA 5A6MA 1R9ZA 3W7LA 1KFKA 1ISZA 4Q4OA 4NG3A 3J7HA 2WM0A 2WSYA 4IX2A 4QBXA 4F9DA 3ZSTA 5HQEA 3R0DA 4KETA 2IQDA 2PDWA 3QVQA 3VDGA 4XX6A 4ZGYA 2AGTA 4JQ4A 4MB1A 1JPIA 1G4EA 1R7OA 1V7AA 4DJFC 2XTKA 3T0DA 2BP1A 2DORA 4PCNA 1XD1A 3I6EA 1NEYA 1WOBA 4C6EA 3KUMA 5CZKA 2FGLA 3OIHA 3PTMA 1ISYA 2ONEA 2YJQA 4XO6A 1US0A 2YOCA 2UY3A 2V69A 3WLPA 3ZJ8A 3VYLA 4AC1X 1NF7A 2FTWA 3HPFA 5JVLA 5HQMA 3PPFA 4O11A 4WSHA 2Z25A 3HGOA 3ZWTA 2CFFA 3L65A 3NFUA 1UWTA 4JTCA 4L4LA 4ACZB 3CLWA 3NQGA 1H62A 4PR4A 5I06A 4GQBA 2AGKA 2DV0A 3GVGA 2PC4A 2Z24A 3UWEA 4HOWA 1R46A 3DAQA 4JYEA 3GFZA 4HOXA 3V0SA 5BMWA 1YADA 1I8JA 1AZ2A 1VJIA 2IMRA 1EGZA 4M81A 1H1YA 1JNDA 3ONBA 1S5NA 2WC7A 3W73A 2CLOA 3Q94A 3F03K 1S2TA 4S3FA 4WX2A 1C29A 2FGZA 1OJXA 4RE0A 1XGZA 1C8VA 3TDFA 1F3WA 5F2LA 3LXCA 4XKYB 5FF4A 1SUXA 4K3ZA 2OLHA 2Z4GA 3AALA 4AHOA 1ZGDA 3JZEA 1DWJM 4FO4A 4LUSB 2X8RA 3F5LA 3PTKA 3E38A 3AZSA 3LLDA 1HQTA 5BZAA 4UC5A 3QMSA 3VABA 1PXGA 1CI1A 4L4OA 1VENA 4AHPA 2VCBA 3DG3A 1KM1A 1FWWA 3B3DA 3NQ8A 4Q4RA 1TYGA 4RNJA 1QNRA 2WB5A 4DYEA 3DGBA 4O1BA 1TMLA 2QYGA 3UZWA 4CNUA 5A8OA 1GPFA 3M9YA 4AZ6A 1XLJA 4PBFA 1DJXA 1F76A 4L4PA 3LBOA 4XZBA 5ABHA 1C90A 3D5HA 3ZIZA 4FS9A 3FKKA 1LRQA 4PTWA 3WFAA 1V5XA 4Q4KA 4QS5A 2CHRA 4LU0A 1JCYA 3VOFA 1XWYA 2DIJA 3CWHA 3P80A 1XBZA 3QOKA 4H83A 3MHUA 2VX4A 3IJ9A 5I6SA 1IWBA 1OT2A 3H7UA 1B3VA 3B8TA 3HJZA 1OSEA 2YL8A 2VC7A 4A8RA 1HNYA 4YTSA 3B8DA 3ZWSA 4XK2A 4DXVA 1F07A 2WJEA 3MKKA 1ZHAA 2GJLA 3RYSA 3JS3A 1R47A 2ZC1A 4GBUA 3R25A 2ZA3A 2CLKA 1E0VA 1WPCA 2PE4A 5EFFA 3PZ9A 4ML9A 4GX9A 5A2AA 4EK7A 2V68A 4X63A 3WJWA 4DNMA 3B4YA 3M0KA 4CQDA 3GM8A 4PB5A 3NA8A 3SRHA 1U1JA 3P74A 4JZ5A 1D8CA 1A5CA 1BTCA 3W0KA 2G3NA 5CJMA 1QOQA 1D7FA 3CZLA 3WD4A 3N15A 2JGYA 4MG4A 1S5WA 3T08A 4D72A 1QMLA 2FMNA 2RHGA 4LNYA 4F8XA 4C7FA 4JDYA 1XD0A 3AIRA 4L61A 3STEA 4ZOCA 2E25A 2E1DA 2DQWA 1ZS2A 3U0HA 2ACRA 3OLDA 4FZIA 1W54A 3H7VA 1I0BA 4FR6A 3MKCA 3GXMA 4GISA 5TD4A 3LI0A 8RUCA 3NZPA 2ISWA 1E51A 1VYPX 1JI2A 3DECA 5HR6A 3DIPA 1ADOA 3L66A 3WQFA 1V6VA 1IXPA 4BK9A 2DZAA 5LIXX 2VELA 3MVTA 3S2NA 3VMNA 3EWUA 3WH9A 1VRXA 2G8ZA 1S2VA 1PSCA 5KINA 3DYPA 2DIKA 3E3HA 3FJ6A 4PEEA 3CJPA 4EPKA 4UTFA 4DO7A 4UNLA 1IT7A 4H8NA 4DUWA 5FF7A 1F8MA 1MXSA 1RJPA 1XQLA 4ATDA 4EANA 1GG1A 5T91A 1Q8JA 3MCNA 3MHGA 4JNYA 1XRSA 3H70A 4J3XA 2BX7A 3TW7A 3N11A 3UA3A 4JL2A 1E6SM 4HN8A 3GDMA 3CO4A 2IKGA 3C0SA 3NVTA 3H4WA 2XINA 8A3HA 1QPQA 5BXPA 2QVHA 4CD6A 1JUKA 4P61A 3RM9A 4JIPA 4GG9A 1DIOA 4H9VA 3BOLA 1IXOA 2Y85A 4AWTA 4EP8C 2B7PA 2YYTA 1SYTA 3WUFA 1A50A 2GUYA 3W1LA 4XQ6A 3VIJA 2X1SA 1B3ZA 4P7OA 3SQMA 5AHIA 1CXFA 3GG7A 3R6IA 3V75A 4WD0A 1V79A 2V6AA 3WF0A 3WNMA 2E6DA 1XRTA 2Y1HA 1W9BM 1MEWA 3P82A 1A47A 4PZVA 4IGSA 4C91A 3LCIA 1SZNA 3FA3A 1ONXA 3BGGA 4N02A 1PJ9A 3UGVA 1DORA 4FEZA 2PPGA 4W86A 4HPXA 2GOUA 4FLQA 3C2EA 2Z2UA 5AZ1A 5U7SA 2F2KA 3VAVA 1UUOA 4M24A 3PNZA 1UMLA 2Q01A 4R33A 4GH1A 3SCSA 4J28A 4GQGA 2FHCA 5I78A 3LQGA 4UR7A 1IIGA 5L6UA 1TCDA 2DZPA 1EJ7L 1MNZA 4CEUC 3POHA 3NQEA 1DQUA 5HXMA 1EYEA 2X09A 4ZBCA 1SO3A 2RDXA 1K1DA 1KFWA 3BLKA 3H2MA 2VXNA 5C9RA 5KZMA 2GDQA 3UCCA 3N2TA 4OUIA 3GU2A 4REQB 3QMRA 1WKFA 5A5WA 3S1XA 3UVAA 1T6MA 2NV9A 3N9KA 1OINA 3GTHA 1ZNNA 3SUVA 1PYFA 1XIHA 3GHSA 3IGUA 3ALGA 2J6XA 4NX5A 1DWFM 2V5BA 3K8KA 3HTWA 4O8AA 2WQDA 5D4YA 1Q5MA 2W6RA 1M9HA 3DKJA 1OC7A 2BVTA 3VGHA 2GVYA 2BY2A 2WMHA 5DMMA 3EPOA 4HN4A 4C6OA 4IMFA 2DEPA 3LHYA 1VBJA 2ZTKA 3SSJA 4F2BA 3QR3A 4ERGA 4H9XA 4CQ8A 4YTQA 1HO4A 3AZRA 3MC5A 4CNTA 1FCVA 1B57A 2RJGA 2Y4SA 3K13A 4MFEA 2Q8XA 1Q63A 3RCNA 3MDUA 2XIJA 3GDLA 1FCQA 3L2LA 4V1XA 4IMEA 1FHDA 4E38A 2W0UA 5D2WA 1OZQA 1CXLA 2I7GA 4NI8A 2XSAA 1RY8A 2VKZG 1ZAHA 3EEZA 2Y7DA 1S1PA 4MDOA 4JL1A 1FWJC 1FKWA 4XZLX 2D24A 4TOQA 5F2MA 3VDHA 1CT5A 1V02E 3P62A 3K8LA 1M5WA 4OBRA 1QUMA 4LAMA 1E1FA 1H7RA 2JQXA 2XH2A 2KZHA 1XYLA 3MV01 4A21A 4A2RA 1Q6EA 3BLOA 6XIAA 4LUYA 2BZNA 2OT1A 4UR9A 3VNZA 3I3EA 1F2JA 2DSZA 4CU8A 3BAWA 4GJIA 3CWOX 3S9YA 2JALA 3W83A 4B3LA 2ICSA 1CCWB 4KEUA 4YVXA 2QV4A 3M41A 3MUAA 2BV9A 3ITOA 1R9XA 3ARVA 4AIUA 2CKSA 4KFPA 1B5TA 3KBNA 4W84A 3CHCA 4R3UA 2F7FA 1QI4A 3S9ZA 3SUUA 4ZFMA 4U4MA 4O10A 8TIMA 3KBMA 1AQFA 3WH7A 5HMFA 4CNOA 3GXNA 3UT0A 3WZ0E 2WO5A 3S5ZA 2R9RA 5FIPA 5T8GA 2DT2A 2Z0IA 1ISXA 1GEHA 4GI9A 5E0FA 4B5TA 1W3TA 2JE8A 2ZFAA 3IPWA 3BGAA 3TYDA 3P2VA 1NJJA 3PPGA 1FH7A 3WSUA 2BY1A 3E2RA 4IIGA 3PWGA 4ZSTA 3SADA 2RDWA 3DU0A 2OLAA 2Y24A 4AD3A 1TIMA 3OW1A 4W4QA 3B0VC 5CLTA 2Q3RA 3HQNA 3EWYA 2EF9A 2I57A 5CZTA 3H22A 4IPLA 2HZGA 1ISVA 1L6SA 2BGSA 2X16A 4AVFA 3MP3A 2PS2A 2OJPA 3W24A 4HZMA 5A94A 3W3OA 2NX1A 3B9DA 4WIWA 3P81A 1XBVA 2IPWA 5FEZA 1V6TA 3RDKA 3KCOA 4QLJA 1G9HA 3U7VA 2QNEA 5GVJA 4E2BA 4TVUA 1Q6RA 3UERA 4PFHA 2WXDM 4BI6A 1XFCA 4O57A 4HA1A 4JTUA 3GIQA 2OOFA 2Z1BA 4GACA 2GJNA 3K2GA 1VHCA 4TXEA 1UOZA 3UR8A 3ERPA 3WH5A 2XIQA 2Z7KA 2FYMA 2QS8A 3CMGA 1TCMA 5HWJA 1HN1A 1X8FA 4ZENA 3B04A 4QM1A 5FEPA 4H2HA 4KS0A 1AD4A 1JCJA 4PBGA 1OD8A 3TQPA 3O6YX 5REQB 4ZEPA 1IEXA 4DZAA 5AOUA 3GW3A 3WMLA 2V9DA 4LEQA 2D2GA 3OU8A 3UBPC 3KEHA 1OK6A 2QVNA 2V3FA 3JW7A 3LPGA 3KVJA 1KFBA 1YMYA 3GYEA 3WQVA 4MKNA 4LWWA 3BW4A 1J6OA 1UR9A 4DYKA 4KFNA 3TTYA 4PCFA 2RJHA 1WBJA 3WNOA 1HZYA 3HG3A 1A5SA 4AXKA 2ZRZA 4O0KA 1MEHA 1L9WA 3FNDA 1ZTVA 2C91A 2WJDA 1QNOA 1A0DA 4P7QA 3P14A 1IEVA 4PN2A 1BG4A 3O2LA 2D2HA 3ORWA 2Y5JA 6XIMA 4O14A 1E9IA 1WCGA 1QW7A 3AWNA 3TQKA 5A2CA 3IVUA 1Q6FA 2WMKA 4L7ZA 1UZDA 5IRPA 1VB9A 2VUYA 3O3RA 4AY1A 4F0HA 1RBOB 3CH0A 4UTJA 2YCIX 3UESA 3UCDA 3W00A 1M53A 5T9CE 3M0YA 5DBUA 4WHBA 3KVKA 4RDZA 3GZ3A 1GOOA 2OXNA 2HSAA 1E1CB 3IIVA 3URNA 4ERIA 3HJEA 4TMBA 4NAEA 3OYXA 1NSJA 3DFYA 1TELA 5CGTA 4U3CA 1QI3A 4ZOBA 1JRCA 4O1CA 5JQ9A 3U3HA 4ZE4A 1LUCB 3TMQA 4XZWA 2Y63A 2AAAA 1SVDA 4XZHA 3QN3A 3AHVA 3HPXA 3USBA 1O68A 4KF1A 4MJ4A 3IAPA 3N29A 4GKLA 4ACYA 3NPWA 2VD9A 3V0TA 3V4BA 5GNYA 3S2JA 3OPSA 4JIHA 4H04A 4G6CA 3MT1A 3RAOA 3AXHA 2J78A 4RDYA 2C7FA 4E3TA 1R38A 4Z42C 3W37A 2NV1A 3CQ0A 4DYJA 4OQVA 4MWAB 4KWUA 5C71A 3MP5A 2Z29A 2VTFA 2CBIA 2XHYA 1U83A 4C5YA 5AC5A 3MUCA 2XFYA 4ENLA 3HG5A 4Q4MA 2Q6ZA 2BWGA 1BQGA 2CNCA 2OWWA 1H1NA 3THQA 1HT6A 3BAXA 2YBUA 2ZRXA 1J6PA 1PEZA 1EDQA 3GC4A 3N3TA 1H61A 2P50A 1W5OA 3BSMA 1XXXA 2Y62A 1UR2A 4LQ1A 2X2GA 4H6KA 4I9AA 3BXWA 3JUGA 3G6MA 3W02A 3KLKA 3MUIA 3CGTA 4PFMA 3GUGA 3WQDA 3WK0A 5IHRA 2OTDA 2ZXDA 4NRRA 1XLCA 2RFGA 4B16A 4G1NA 1GORA 1XPGA 3SY1A 1G7VA 2QCMA 1Q6CA 3NQVA 4GINA 5ENLA 1F6KA 4BQ5A 1OT1A 1IIHA