3W87A

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-103
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
314
structure length
314
Chain Sequence
SMCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with SH-1-103
rcsb
source organism Trypanosoma cruzi
total genus 104
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w87A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w87A01
3UWVA 3L5MA 5K9DA 3EWWA 5DLCA 3HGSA 2J27A 5CPNA 4R33A 2QCFA 4WZHA 3HG2A 1F73A 2A0NA 1OYBA 1K03A 3KVKA 3GDMA 5FEZA 3M5YA 4O18A 4X9SA 3S5YA 2WKJA 1DBTA 1XC4A 3UWUA 2ZZ6A 3LHWA 3T44A 5HJLA 1R2TA 1XBZA 3DU0A 1EEPA 3W7GA 2ABBA 1TJRA 1H1YA 2Z0IA 5J5RA 1SZGA 3JS3A 1GOXA 3UZ5A 3STEA 5DBTA 1UUOA 2GJNA 5BNKA 1ZHAA 3W7HA 2QJGA 4A21A 5MHBA 2GQ8A 3DHDA 4K7VA 3MI3A 4IX0A 1KW1A 1WBHA 4FNUA 3EKLA 2ZBTA 4JTGA 1H7PA 4GUHA 2CLIA 4JN6A 3G1DA 3F4NA 1SU5A 4ZL1A 1A50A 3P7YA 1D9EA 4WX2A 3S6DA 2UV8G 4S2BA 3RU6A 4FNQA 5EL1A 3W2UA 1PCWA 5D04C 3WJSA 1KM5A 5G2HA 5BMXA 1LYXA 3BW3A 3G1HA 5D32A 1TMHA 4WY0F 1BKSA 2GOUA 3KX6A 3LX9A 5E93A 1T99A 2V2DA 3W23A 1T0OA 1LBLA 2JBMA 4X2RA 2RKXA 3TQKA 5LGXA 3TA6A 4GNJA 3W2KA 1VC4A 4AHQA 3L0GA 3BLFA 3T7VA 3BW4A 4DBDA 4JX6A 2H3DA 3FKKA 3SFKA 1OYCA 1FXPA 3OVRA 3C6CA 1NF0A 1TO3A 3B03A 3M6YA 3S0CA 1AW2A 3INPA 5TBOA 2B4GA 1VHNA 1YDNA 2Z2UA 1T8XA 4UFHA 3NQMA 4O13A 4M19A 3HG5A 1TV5A 1J4EA 2HS8A 4MYAA 2QCMA 1KM1A 2V0TA 4RLIA 3P60A 2F84A 4KFPA 1OK6A 4MZYA 3LI0A 1OFRA 4IJBA 1RPXA 2PRMA 1G4SA 5BOOA 2BWGA 1K7EA 3G1AA 4LS1A 5LHFA 3E49A 4PL1A 1H7NA 2QJIA 4IMCA 4IXHA 1TYGA 2I14A 3LCFA 3C4UA 5EPDA 3G8EA 2R94A 3CC1A 2KZHA 3OHIA 2VFGA 4UNKA 3W7EA 2W6RA 2HMCA 2HTMA 3EKZA 1FBAA 1VR6A 3UWQA 4N9CA 3LBMA 3QJAA 1IGSA 4UFIA 4A22A 3NQ8A 3P81A 2CFFA 3HGJA 1OFEA 5K9CA 4AF0B 1JUKA 2ALDA 4JEQA 1FCUA 1LM1A 2QCLA 1SPQA 3AO0A 2YFOA 2GVLA 4LVFA 4N6EA 1RQHA 4UFJA 5KZEA 4DO4A 1HO1A 3G8RA 1VRDA 1TV8A 4HNVA 2OT1A 2ZZ1A 4OQVA 1GG0A 4FIRA 2Y6ZA 2NXHA 1IXNA 3UWWA 5I3GA 1DKWA 2NX1A 3GAYA 4ORIA 5FEWA 3PR2A 1TTQA 1U5JA 5DCDA 3G0SA 4MJZA 3WFAA 2BLEA 4FX8A 5K4ZA 1RQEA 1LROA 3W7RA 4AHOA 5K7JA 2VC6A 2QDGA 1TRIA 3LCGA 3WK2A 5HWMA 4WY0A 4O4WA 1HTIA 3B4UA 1RV8A 3I68A 1SR9A 3DXIA 3HJZA 2C16A 3TQVA 3OEXA 2BXVA 5K2ZA 2YYUA 4XKYB 1VYRA 4NXKA 4KWVA 3UWZA 4EOUA 1NFBA 1WYIA 1ME8A 3DAQA 4HT3A 1QO5A 1DHPA 1XL9A 1MSSA 5D09A 3TXZA 3L67A 3L5AA 2CLHA 3VFLA 3NL5A 4DXVA 1GVFA 3LOTA 4MJMA 2FQIA 4TR9A 3TW6A 4IXXA 3KOFA 1NVMA 3L2IA 1H7OA 3OG3A 5G4WA 4JYDA 3P8IA 2X1SA 3FS2A 3IIZA 3SIZA 4O0KA 1R47A 1OG0A 1GQNA 3EX6A 1QPRA 2FB3A 1ALDA 3OBKA 2ZTKA 2TPSA 3NYZA 3W74A 5ABTA 3N2MA 1E51A 2NUWA 4JIPA 1WOBA 3EEGA 1KLZA 5HMSA 3S8HA 1V5XA 3WJZA 3NA8A 2J24A 2VFEA 2PE4A 3CPRA 1I45A 3LV5A 3O06A 1JR1A 4JY8A 4N9DA 4UMAA 2B7OA 3RFAA 3BARA 4DELA 2XN2A 2QCHA 1I2OA 3W1QA 2V5LA 2PCQA 5G1TA 1P1XA 1KTBA 4O28A 1LLWA 1TPEA 2V5BA 1I2QA 5K3VA 3KAOA 3C3NA 1EB3A 2ZZ2A 1QR7A 2GQAA 3P82A 1TV7A 1MEWA 2H3BA 4MZ1A 3ATYA 2Q8ZA 5LKYA 5DXXA 1XBXA 4ZQPA 3KVJA 5F2IA 1ZCOA 4YMZA 3NZ1A 5HQEA 1SZFA 1KM4A 3C2EA 3IVUA 4O4VA 1H63A 3W75A 3GXTA 3CEPA 3GR8A 1LOLA 4TIMA 3Q37A 4O1AA 4O16A 3UY7A 5E1QA 3LV6A 1QOPA 1SO6A 3MI6A 5G4EA 2ABAA 3P84A 3HF3A 3SJ3A 1NF7A 4WOQA 4MVAA 2VFFA 3N73A 3W07A 2DJXA 1X7FA 4O52A 1KTCA 2QKFA 1KM6A 4LC6A 1L9WA 5DCEA 5EY5A 4Z0JA 3THAA 2X30A 5F2LA 2VFIA 2D73A 1M6JA 5LSMA 1ADOA 2QR6A 3TMLA 1X1OA 3USBA 2RH9A 1S5TA 1O95A 3TAOA 5DY2A 2B0MA 4IOTA 4OWGA 2O7QA 1G4PA 1PV8A 4DPQA 4FXSA 3L0NA 4FNRA 4XUGA 1I2RA 2PC4A 3W3OA 1BEUA 4RR4A 5D2YA 4GBUA 4ZMGA 5AHLA 2QCEA 5G5IA 3O6YX 5AHEA 4MYXA 4AWUA 1OX4B 3OVQA 5CG7A 3HOJA 3QF0A 2NX3A 3WK0A 1VS1A 1XDLA 3DGRA 3CWNA 4P61A 2RFGA 1GEQA 1TPDA 3TNOA 4TX9A 1AL7A 1GVQA 4H4IA 4LUIA 3L65A 5DN1A 4N9BA 1Q3NA 4MZ8A 1FWWA 3NQGA 1B57A 2H90A 4NXSA 4UXDA 1IF2A 2ZZ5A 3W7CA 2A6NA 1P0NA 4UR7A 4GJ1A 4RX0A 5KTLA 1O4UA 3UYCA 5F1UA 3VE7A 2G5WA 1THFD 4MY1A 1F74A 3LTPA 3FOKA 1S3HA 2EF9A 3KRSA 4GE8A 4DBEA 2B7PA 4O0ZA 3NEVA 1EA0A 5A8GA 5F1VA 4FNTA 1G4EA 1XBYA 5HWNA 3N34A 4DPPA 1SW0A 1EWDA 1QDSA 2QCDA 4Z1AA 1M7OA 3G1VA 4WUIA 2ZRZA 3PG9A 1H7XA 3TV8A 3C2VA 3CEUA 4TU1A 1ZENA 1Q45A 4NNCA 2OJPA 4XBKA 4AVFA 4OHQA 1DQXA 3TAKA 2ZQ0A 2O7SA 3TSDA 2ZRYA 4M6VA 1WOAA 2NXIA 1JULA 4OT7A 3BLEA 4O19A 3GXNA 1JQXA 2GVGA 1EWEA 3A5VA 2W79A 3DFTA 1Z48A 4Z1DA 2V30A 1D3HA 2CZEA 2I1OA 3I65A 5C2XA 5E0KA 1S5VA 3WJWA 1TTIA 4FX6M 1JRCA 5D2TA 5AOUA 3TSBA 2P10A 4FXRA 4HPJA 2QUVA 3NM1A 3NXFA 2DP3A 2GVJA 1VZWA 1EIXA 2FJKA 2E1DA 3TC6A 2C3ZA 1EP3A 4HN4A 1HG3A 2VEIA 3RLUA 2X1UA 4JTFA 1I2PA 1VPXA 3TSMA 3BO9A 1N7KA 4YL2A 3M5XA 2YSWA 1F6PA 2E6FA 3JRKA 3V1PA 3W76A 5D02A 8TIMA 1FWRA 4O11A 2YR1A 5LNUA 2A1YA 7TIMA 1L6SA 4NNBA 1W8SA 5FEPA 1FCVA 4A2SA 3KVLA 3YPIA 3TCEA 2H8ZA 1H50A 5CZJA 1R30A 4N6FA 4NJIA 4YCPA 3E9AA 3NR0A 3W1PA 3UD6A 4TMCA 4LVGA 1ZAIA 3LCHA 3NQVA 4BWLA 1Q6LA 3CQ0A 3A5FA 2QUTA 3LHUA 4LNYA 1A5AA 1B4EA 2BX7A 1KA9F 4OGZA 3LCWA 5KZDA 2R8WA 3VCRA 2CLEA 4O12A 2YDAA 3QH2A 4JTSA 3GAKA 1TPFA 3R13A 3H54A 3UXAA 4XWUA 1ICPA 1N8FA 2CZFA 1OK4A 3TXVA 3LI1A 4CLMA 3GNNA 4ZQCA 3W1AA 5D03A 5DBUA 2WNQA 2ZTJA 1GVRA 2JGYA 3SI9A 3VNDA 1GVSA 2ZRXA 2VEKA 2C0AA 4UTMA 3W7JA 4QSHA 1QPQA 1GPWA 4BR1A 4LY8A 1NSJA 4BF9A 3CTLA 3NQ6A 3EWXA 1SO3A 4H3DA 4WXZA 3QMTA 3BK0A 4NJJA 3TX9A 3KVMA 4N9EA 3GYEA 5K9XA 1HO4A 4NJGA 3ATZA 2HSAA 4JNMA 4ADTA 5KSWA 1YXDA 3QC3A 1LZOA 1OFDA 3T4CA 2YPIA 2Z1BA 1QPOA 3L9CA 3FKRA 3UWYA 3S1XA 1J2WA 3W70A 3TU9A 1YYAA 3QFEA 1K02A 1ML1A 4LOCA 4FIQA 3NVTA 3WJXA 4JR5A 2R91A 3TFXA 2VEMA 2QAPA 4CCEA 1UJPA 4IWWA 4ZQRA 5TIMA 1JUBA 3MMTA 4RK8A 1LRTA 3M43A 5IM51 5AC8A 3NL3A 5AYYA 1C9DA 1DV7A 3TUUA 2OT0A 3MBFA 1F76A 2CLKA 4HSOA 3UZJA 1L6YA 1KV8A 4BI6A 4OV9A 1K7FA 3UXDA 4AHPA 4HSNA 3NG3A 3TE9A 2Y7FA 3G1XA 4FNSA 5D38A 1A5SA 1I4NA 3I7SA 5FF0A 1W0MA 4WJEA 4HIBA 1PHWA 4NUWA 4A3UA 3QEZA 4G1KA 2YGYA 3MBDA 3DENA 4AMAA 3LBCA 3HPXA 5AB3A 5KINA 2FPVA 2C15A 3R89A 5CZ0A 1ME7A 4D2JA 2DORA 3G24A 3B04A 3QSRA 2J88A 1XUUA 1XDMA 1EP1A 4I9AA 1GYLA 2WOQA 4BK9A 4ORMA 4R34A 3R8RA 3TJXA 1VLIA 3RNDA 4GXMA 2C6QA 4WOZA 2QEZA 4ADUA 3V75A 5GVJA 4GRSA 1TPUA 4GUJA 4TMBA 2E5DA 4WQ6A 3Q58A 4XZ9A 2ZA2A 2G96A 3EX3A 5SWUA 1QFEA 1GG1A 1DJQA 1P0KA 2DZXA 1R2SA 2DZPA 5LGZA 3C61A 1L6WA 2AGKA 1FDZA 2EPHA 2FPTA 1W5MA 5C55A 5C6MA 3U6WA 5I3JA 4Y9AA 4ADSA 1W5QA 4O50A 5HINA 3Q94A 3NO5A 1KFJA 1XM3A 4JTKA 1HL2A 1LBFA 2NZLA 5H91A 2A7RA 4YWIA 3EXTA 1O94A 1JRBA 2TMDA 4JDBA 1AMKA 4K8EA 4OBTA 4K38A 3LCLA 5CSRA 1DL3A 1DVJA 2ZZ4A 2H8XA 1V7YA 3HO8A 3SGZA 3PUEA 4ICNA 3TKFA 3NL2A 3EX2A 3I7QA 1M7PA 3LRKA 1IXQA 1XXXA 3EXRA 2W0UA 1ZAJA 3KXQA 4MY9A 1FCBA 2YXGA 2YZRA 3JR2A 4DQWA 4HPXA 3TK7A 1TPC1 1GWJA 1H1ZA 2GPTA 3HG4A 4Q32A 4UIOA 3FIGA 2VFDA 4MKNA 3S1UA 3G18A 3UY8A 4DF0A 2F7FA 3RF9A 2JKAA 3OVPA 3GLCA 3ABSA 1QOQA 5CZTA 3IGUA 1SQ7A 5HNRA 1JCYA 1XKYA 3QPYA 5CPOA 3DBPA 3UQNA 1A5CA 1K8XA 3SECA 1KFLA 4A2RA 2Y7EA 1R46A 1AG1O 4JIQA 4CQ9A 1OYAA 5KITA 3HGRA 4UTHA 3W7LA 2VXNA 3L5LA 3W71A 3N9RA 5FF3A 1LTDA 1F5ZA 3R12A 1QPNA 3TH6A 4PC8A 4AXKA 1YXYA 3G3MA 5AC6A 3BG9A 3DFSA 3PVFA 5LNRA 2A85A 2JK2A 3O6CA 4JTUA 3W1MA 3W6YA 3BVJA 4FNPA 4Z08A 1GYNA 1TSIA 2J9YA 4R53A 4Z1BA 2WNNA 1QNVA 2C1HA 3NPWA 2RDUA 2WSQA 2EGZA 2BZNA 4UTLA 3ZFHA 2V81A 3UPBA 1QMLA 1MEIA 5KMYA 3QRHA 4L4MA 4LVDA 3M16A 3O6DA 3IGSA 3LHVA 3LHYA 1EUNA 3IRDA 1Z44A 4Y6GA 3LB0A 3DH7A 5G2IA 2FIQA 2FLIA 3IGXA 4WD0A 5I3IA 4DO6A 4WY0B 1KM3A 2LLEA 1M5WA 4N4PA 3W83A 2E5CA 4LWWA 3L66A 3S5NA 1YXCA 4JY9A 3KHJA 4W9TA 1LP6A 1VH7A 1PHQA 4BWLC 4CNOA 3NPXA 4NU7A 2FFCA 3MP4A 4DF1A 1EPXA 3NQDA 3BGJA 5LHEA 2AAMA 2X2GA 5CKSA 5A5WA 1IXOA 2GUUA 4QQ3A 3WJYA 1MZHA 2WJZA 3NQAA 3W2JA 1FY6A 1G4TA 3I7RA 1R2RA 1HUVA 4IX2A 5KZMA 1L2UA 2BTMA 4IPIA 1KBJA 1KFEA 1RZMA 3M44A 2PRLA 1LLZA 3BPWA 1XFBA 1GTHA 3DI1A 3GNDA 5F4SA 3PWAA 3HPSA 5DXYA 4MIMA 2E77A 1F2JA 2WV8A 4QIUA 1K3UA 1KM2A 5EA9A 4RKAA 5AC7A 3R2GA 3W7MA 3ZR4A 1QO2A 3TR2A 3W7PA 3PM6A 5I3KA 4EF9A 5D33A 4JXCA 1TRDA 3QQ0A 3BV4A 3TJLA 3VKJA 3Q2DA 4K7YA 2Y88A 4RZ6A 1XCFA 1OFBA 3FJLA 1NAL1 4Y8FA 4ZQNA 4IGHA 1KM0A 5BRBA 1OVDA 4UNLA 4ONVA 1I2NA 3LCXA 4Z0SA 4MLJA 1S5WA 2AQWA 2NWRA 1KLYA 3P5YA 1FWNA 4R7JA 3M1ZA 2RDTA 4TO8A 3QW4B 1OHLA 4FB7A 3W1UA 2X16A 2Z6JA 3FYPA 2B7QA 3BLIA 4LVBA 3ZS4A 4QM1A 2XN1A 1VLWA 2I9EA 4O14A 5J5DA 1P5BA 4RXFA 2OMAA 3W1LA 3B0UX 5F4XA 3STCA 1AL8A 2CLOA 4CCDA 3NDOA 3OA3A 1TJPA 3G22A 5AYXA 3B0VC 4QISA 3LXBA 2ZZ3A 1ONRA 3N14A 1TTPA 3C2OA 3W84A 2OZ0A 2ZRWA 1W37A 2Z6IA 3IIVA 2VELA 3P80A 3NL6A 1W3NA 3TDFA 4QITA 4RJEA 4LVAA 3E0IA 5F4WA 1XUZA 1GTEA 1Q6OA 4NJHA 1SUXA 3O07A 4Q33A 2Q3OA 4LT9A 1JUEA 4X22A 1Z41A 1PL9A 2ZZ7A 4JS3A 4RZ5A 1UCWA 3MI2A 1SO4A 3LRMA 3EXSA 1OF8A 3MYPA 3T55A 2ZA3A 2C18A 4DEFA 1FX6A 3MUXA 2NV2A 5LNWA 1H62A 2A2IA 2G97A 4UTIA 3THQA 1PVNA 3MO7A 3GVGA 3M41A 3OIXA 4LC8A 3T78A 3LGEA 4JX4A 4LU0A 5AN7A 3MP5A 1SO5A 4JYEA 1QCWA 2CW6A 3CHVA 3W9ZA 3ELFA 4EVZA 3QW3A 2DZWA 1PIIA 1VCGA 3MWAA 3LLDA 2HS6A 1A5BA 3GKFA 3S1VA 3MYOA 5F2MA 1UUMA 4NZFA 4I7WA 1TPH1 1H60A 2C19A 4PL2A 3VE9A 1OF6A 1F6KA 5HUPA 1MO0A 4JTHA 2X1TA 1KFBA 2PURA 3O05A 3W85A 6ALDA 2J6XA 3C8FA 3HQ1A 3M9YA 3A22A 4RZ4A 3S9YA 4IMDA 2RHGA 5EKYA 1TTJA 3CIXA 3SR7A 3N19B 3HG3A 1K8YA 3FJ6A 1UASA 2QCDB 3IVSA 4NNAA 1PCKA 3A21A 3HB9A 1OFPA 2V9DA 1WXJA 2GQ9A 3NQ2A 5FESA 3PSVA 2NV1A 4GC4A 4Y90A 3NPVA 5LZLA 3A23A 3QQ1A 1SZNA 1CW2A 4JTLA 1TPB1 3TROA 3M5VA 1W56A 3G0XA 5U7SA 2WQPA 2J9ZA 1WA3A 4PCFA 3NQCA 5T26A 1FDYA 4LS2A 5DCBA 4ZZ9A 1YTEA 1H51A 4JTIA 4RXGA 2JKEA 3GDLA 1H61A 3EX4A 1Z42A 1G6CA 5LNSA 4O53A 1EUAA 4U4MA 3W2NA 1SSGA 2QF7A 2ISWA 1BTMA 3BGGA 3HMJG 2G95A 3LRLA 1OX5A 5K4XA 4N2YA 5CZSA 3AJXA 4MFDA 4DF2A 3KFTA 5U4NA 5HUOA 3GDRA 3G1YA 4RV8A 4CNPA 5AHFA 1IIHA 1ME9A 3O16A 2ZRUA 3W73A 3H53A 4XTIA 4NT0A 1KBIA 5CSSA 1SFLA 3B8DA 3ZWSA 1JCLA 1ZJIA 2YW4A 1YPFA 2CZ5A 5EMUA 2EAWA 4EIVA 3A9IA 3P62A 4JGDA 1X8FA 3EWBX 2Y7GA 5C5YA 1OFOA 3PULA 3UPWA 2BSLA 2V82A 4O8RA 3DFNA 3NOEA 3QMSA 4M6QA 3VI2A 3STGA 3ABQA 4HHPA 4C1LA 2QCNA 2NUYA 4O17A 5DY3A 1YDVA 2X1RA 2C13A 1ZNNA 3DKLA 2Y85A 4M7SA 4UTTA 2E6DA 3W72A 4PEKA 4C1KA 1WX0A 4O15A 1O5XA 1F05A 2DZSA 1K7XA 1G7UA 3GR7A 1P4CA 1JCNA 3S42A 5LNVA 3E96A 1TCDA 2CZDA 3R5EA 4UTWA 2ATMA 2OCZA 3P5ZA 4UTUA 3NQ7A 4M5PA 3NGJA 1O5KA 2WO5A 2Y61A 3H55A 3NQEA 4A29A 1FDJA 4LRTA 4LS0A 3LM7A 1VYSX 1AK5A 3PBUA 4BI7A 3E12A 4NX0A 1FUYA 1YDOA 5L6UA 3ANYA 1F7BA 1BWKA 1CX9A 4YCOA 1LOQA 3C52A 4E2BA 4UCGA 4HNNA 3PF3A 3O15A 1IXPA 2JGQA 3TW7A 1GVOA 3W7QA 2ZFAA 3DFPA 4NJKA 4N02A 3STFA 4HNTA 2V2CA 4JX5A 3F03K 4POCA 1WBJA 5G2WA 4H6KA 3PAJA 5HR7A 4KWWA 3SSJA 3LHZA 4K37A 3FLUA 2WNZA 3MJYA 2CLLA 5D05A 3LTYA 4GUIA 1XBVA 3EWZA 1G7VA 1WAUA 3O1NA 4AF0A 2QUUA 4QJ1A 2DZVA 1TQXA 2P0OA 4OV4A 1JCXA 3DHFA 3C56A 3PC0A 2A7PA 1C29A 4ZQOA 2CU0A 5FF7A 1X1ZA 4UFMA 1VYPX 5AHIA 5CGQA 3G3DA 4MOZA 4O54A 3PBVA 1MXSA 2Q8LA 1VJIA 1ICSA 3NNTA 2J9XA 4AB4A 5BMWA 4B5NA 4NQ1A 3CLMA 4PTNA 1YPIA 1ZY9A 1W31A 4XQ6A 4UTJA 4UFLA 5FEXA 4OU1A 4IMEA 5CPMA 4LRSA 3PUDA 4IQLA 4MLRA 1LRQA 4KFOA 1WQ5A 1JVNA 4M7TA 5EBUA 4AWSA 1YTDA 4ML9A 3EWUA 3T40A 2FDSA 5IBXA 1H5YA 4S2CA 5I3HA 4O1CA 4GUGA 3W1RA 4XKYA 3BW2A 3CIWA 3FA5A 3LDVA 2A21A 1TB3A 1YLVA 2RDWA 3B06A 4X3ZA 5D2XA 1FWTA 3IIXA 3DI0A 3N9SA 1YTKA 3W87A 1KV5A 1J5TA 4QNWA 2E5BA 1Y0EA 1Q6QA 4JD4A 3W2MA 4UUIA 1VQTA 3CB8A 3PSWA 3M47A 4O57A 4K36A 2WPBA 2DJLA 1B4KA 1KFKA 4JDYA 3LCIA 2ZDRA 2NWSA 1OJXA 1DJNA 1OFAA 4IMGA 2CLFA 3D0CA 1GZGA 2R14A 1X6UA 5F2GA 3GDTA 3UNDA 1VHCA 4KFNA 4K39A 3TC7A 1UBSA 4FHAA 1H7RA 2ZYFA 3K30A 1TREA 1B3OA 4BI5A 3IEBA 2FTPA 1WDWA 4JTTA 1N55A 1AW5A 1O60A 3FEMA 3TIMA 1FCQA 3B05A 6TIMA 1H7WA 4J9JA 4AH7A 3P74A 4Z1CA 4KKXA 3PG8A 3HBLA 3EB2A 1VGAA 3NZRA 4YXGA 5C54A 2YW3A 2A4AA 1OX6A 5BW6A 3W88A 5AHNA 3TMQA 4MY8A 3O8AA 3IIOA 3WK1A 2VOMA 1RVGA 1RQBA 3MP3A 1I8JA 4CNNA 3DFOA 2Y63A 3WK3A 3W7DA 3NM3A 4EWND 5G1YA 3CM4A 3QMRA 4QAIA 1UB3A 2Y7DA 1JJKA 4GWEA 4FF7A 4L4LA 1JCMP 3W7OA 1SFJA 1D3GA 4HKPA 3W7KA 3G0UA 4CCCA 2DZTA 4HNUA 1VCVA 4JTJA 3RMJA 4YLWA 2CWNA 3G1SA 2EHHA 1DOSA 1IIGA 2Q3RA 3EX1A 1LCOA 4E2DA 2OX1A 3M7WA 4I7VA 1XI3A 1A53A 2VENA 4GUFA 4LTSA 5D30A 1SW3A 1SW7A 3PY2A 4NZJA 5FF4A 1W1ZA 1W5PA 3PUOA 5HULA 1W54A 5D37A 2QAFA 2WSRA 2B7NA 2YCEA 3TFCA 5D2VA 4UMBA 4AAJA 3W1TA 1ZFJA 1TPVA 4JICA 2ZA1A 2E6AA 5FF2A 1GJPA 4CQAA 4E38A 2H6RA 4ZQMA 3QM3A 2NUXA 4DO5A 2E68A 3N3MA 2V2HA 3GKAA 3IV3A 4LW7A 5TQLA 1OABA 1OX4A 3M0ZA 4IPJA 5H2ZA 1QAPA 1TPWA 4FO4A 4XBSA 3W86A 3P61A 1RD5A 1TQJA 2VEPA 3S5ZA 3GXPA 4M6PA 2VKZG 3E02A 3F4WA 4PODA 4CQ8A 3PBYA 4UTTC 3ZWTA 3NQFA 3G1FA 3I6RA 1HFBA 4ALDA 1DORA 4JYFA 3HGOA 1LBMA 1YADA 4Y96A 3CT7A 4QNEA 2E6YA 4E0CA 3C2RA 1JCJA 3P8JA 4UR8A 3GX9A 4Q4KA 2CLMA 4FX7A 2A5HA 5DELA 1LORA 4OE7A 4MPQA 1KTNA 1VCFA 3C0JA 4UTWC 1ZAHA 4XTDA 4BFAA 1EP2A 3QYQA 3C2FA 2TSYA 3SW6A 3SGUA 4MUZA 4IMFA 3BG3A 5AFDA 3KRZA 4AEOA 2P1FA 2ISVA 3EWYA 3IVTA 1FXQA 2FB2A 4I7UA 4LV9A 1QWGA 3SZ8A 3FYOA 2FPYA 2PRHA 2WSYA 1SZEA 5HR6A 4LV4A 3S1WA 3LHTA 5EYWA 1OFQA 3PB0A 2YYTA 3W1NA 1PE1A 4O1DA 2Y70A 2TRSA 2E09A 1B9BA 3PBWA 1GT8A 2A7NA 4JTEA 2YFNA 3W2LA 3LTSA 2JKPA 2Y62A 1DQWA 5FI8A 1LRNA 3KRUA 5L9FA 4U28A 3IIPA 3N2XA 2VFHA 1W5OA 2ATSA 1SSDA 4PH6A 5D2WA 3LLFA 1U83A 1BWLA 1W3TA 1G67A 2TYSA 2DU2A 3W22A 1FWSA 2IQTA 1KFCA 4NX5A 3M5ZA 1K8ZA 2QDHA 3GB6A 3W7NA 2XFWA 3QSTA 2NLIA 4IUOA 3RLVA 3S5OA 3QZEA 3W7IA 4O10A 4WXYA 3FFSA 4UC5A 3L68A 4O1BA 3QPZA 2QJHA 2Y89A 2ZRVA 3PB2A 4MFEA 1AW1A 1LOSA 1EX5A 3B0PA 1JQVA 1Q6RA 4GFSA 1CI1A 4RCXA 1MEHA 3DZ1A 3LERA 4K8HA 1W3IA 2A6LA 3ABOA 3W1XA 3L21A 5CPLA 5I3FA 1RR2A 2EKCA 3A24A 1TIMA 2DZUA 3F1QA 4N4QA 5IBXC 3U2OA 3P67A 2GJLA 1ICQA 3MHFA 2QCCA 2NXGA 4ZVJA 3MHGA 3HPZA 3DKJA 3HIJA 3NPUA 1C8VA 3NAVA 1LDCA 3TQ0A 2V8ZA 4LUJA 1W5NA 2ZCGA 4FEZA 3U8GA 1T96A 1ZALA 3SY5A 4PFMA 3O63A 2YX0A 4PA8A 3GDKA 3RK8A 3ABRA 5AHMA 3PS7A 4UTKA 5AYZA 4K6AA 1PS9A 3LXAA 3GK0A 4S1FA 3MW7A 1NEYA 3DFQA 3LXCA 3L0KA 4AWTA 3MHUA 3BG5A 4EF8A 4UFKA 1FQ0A 2QCGA 3GZ3A 2ISSA 4P2VA 3CU2A 3GIYA 4UMCA 1WV2A 5HWJA 2NX9A 1G69A 3CWOX 2C14A 4NVTA 2XN0A
chains in the Genus database with same CATH superfamily
1FH7A 3Q45A 2OGYA 1J6OA 2W62A 4BKNA 2Z27A 3FSUA 1CXKA 4B5UA 5GQBA 1K03A 2D69A 4R85A 4X9SA 1X8CA 5I7GA 1DBTA 1XC4A 2PU0A 3UWUA 4HN8A 3NDZA 3T0AA 4EP8C 2ZZ6A 2VRKA 4F66A 2Z29A 5HJLA 1AJZA 3CBWA 1CIUA 2OQYA 3KL5A 1MUWA 2Z0IA 5J5RA 5FJPA 3JS3A 1GOXA 5D9NA 3STEA 2PLKA 3DN5A 1OINA 3QVQA 2GJNA 5BNKA 1ZHAA 2ZOXA 5MHBA 3MI3A 3DYPA 5JH2A 4RDZA 4Y9MA 2WWDA 1XINA 4JTGA 4WJ8A 2GWGA 4PRWA 2OLAA 1H7PA 4DIAA 2R1MA 3ITVA 3SCNA 4C6PA 3GUGA 2D22A 4JN6A 5I07A 1RCQA 3F5LA 5FOOA 1EBHA 4TQTA 3IANA 4GY0A 2C1GA 5C70A 4LSBA 2VC5A 3WMSA 2OSXA 4S2BA 4NASA 4QG8A 3PN8A 3W2UA 5D04C 3WJSA 3P0XA 1LYXA 5D32A 1ZS2A 3KX6A 1E0UA 1T99A 3WFZA 2V2DA 4N7QA 5REQB 2J8GA 2RKXA 2J77A 2XFYA 4GNJA 3W2KA 3BLOA 1UH4A 4XSLA 3BLFA 3ES8A 3AALA 3BW4A 1PB0A 3NO1A 1FXPA 3H12A 1O1ZA 1UOZA 3C6CA 1J0YA 3B03A 1QNSA 3N2CA 2B4GA 3MPGA 3GS6A 4MB3A 3MS8A 2Z2UA 4UFHA 3NQMA 4IM4A 1K9TA 4MYAA 4NI3A 2J8TA 3C0QA 4RLIA 4D6HA 4K2SA 1OC7A 1UIPA 1QI3A 4QE4A 2QPUA 2BB0A 2Y8VA 4IGSA 2BWGA 2E40A 3G1AA 1LT8A 4H7VA 1J79A 2DVXA 2Z26A 3NJ3A 3SO7A 4IISA 2J75A 4AZBA 3BMVA 4GKLA 4Q4PA 3SCQA 2I14A 3LCFA 3C4UA 2BGQA 5EPDA 2CETA 2V69A 3H2EA 1OCJA 3M0VA 2E8YA 1FBAA 1S39A 1SFTA 3SGGA 4UFIA 2CFFA 1A49A 1T7LA 1XLBA 4QJ3B 4AD0A 4J2PA 2HXUA 1CXEA 1SPQA 2QCLA 4IP5A 4LVFA 1RQHA 3V5FA 1AJ0A 2OYMA 3RN6A 2VQTA 4DO4A 1IEIA 1U5VA 4TX8A 4CKQA 2Y6ZA 2NXHA 3UWWA 5I3GA 1WDPA 2D0HA 5FEWA 3GZAA 5A6LA 2BLEA 5K4ZA 1RQEA 2NSXA 2QPXA 4FOUA 2YJQA 3R79A 3U7VA 2W9MA 4ACZA 5FIPA 4D8AA 3QGKC 2P5NA 3K4DA 3ANVA 3CK5A 4GIEA 2QNEA 3LD5A 1HTIA 3H4GA 1Y65A 4W7UA 1ZP4A 2C16A 2QUNA 3RHGA 2A79A 3UWZA 1NFBA 4RNHA 3SM0A 1JNEA 4LUTA 1MXGA 3R10A 4MB4A 1ME8A 1S2WA 3RRXA 1EYWA 2Q01A 2BODX 4H7CA 5ABFA 2BNJA 2UY2A 3KP0A 3TXZA 1KFWA 2XIBA 4HMNA 4TR9A 1E4MM 2YL5A 2HVOA 4PCTA 4JQAA 5BU9A 2CKRA 3KOFA 1NVMA 2ACSA 4OZOA 2R24A 3SIZA 4HJWA 5A6AA 1GQNA 3TYDA 5BU6A 2TPSA 4ACZB 1JDDA 3W74A 1HF6A 2G50A 3N2MA 2YB4A 5BZAA 1EYEA 3SURA 4JIPA 1WOBA 1KLZA 5HMSA 3NA8A 2J24A 3UFYA 3CPRA 1J0ZA 2VL4A 5KZ6A 4UMAA 3VC6A 3ZYZA 4IFOA 4EXAA 2QCHA 2J47A 2GUBA 4S3BA 3AIRA 5DT7A 1A5KC 4O28A 2POTA 4OBSA 2OWXA 3KAOA 3BZGA 1DIKA 1Z32X 2GQAA 4YVVA 4PB5A 3EA2A 1MEWA 2BOFX 2H3BA 4O0QA 4X63A 1FP8A 1A47A 1UH2A 1NM9A 4HU0A 3NZ1A 5HQEA 1KM4A 1PZ0A 4TOQA 3IVUA 4CNSA 1E4IA 4HTBA 3W75A 3WUEA 3NXLA 3APTA 3QXBA 3UY7A 1ZSXA 3LV6A 3VOJA 1P0BA 3OVGA 1NF7A 3PBMA 3R8GA 4MWAC 4O52A 4GI4A 5C9RA 1KTCA 2QKFA 4LC6A 4RE0A 3H21A 2VDIA 1LWJA 3IS4A 1EJWC 1AQFA 2NLYA 1VJSA 2FGZA 2RH9A 3CL7A 3CUFA 4ZE4A 3L0NA 1PYMA 1P6CA 1TR9A 2PC4A 4NIRA 1BEUA 4RR4A 1PZ3A 2XGZA 4IPPA 2J7GA 2QCEA 4LAOA 3O6YX 3H2CA 4L9ZA 4QP0A 5CG7A 3HOJA 1RVKA 1EXPA 3MANA 1QU4A 1R9ZA 1XDLA 2PDGA 3CWNA 2CHRA 4P61A 2RFGA 1JYXA 4AY7A 1AL7A 1GVQA 2OEJA 4JFWA 3P14A 3WG6A 1FWWA 9XIAA 5CGMA 4NXSA 2AL2A 4J5NA 4PMVA 4ICMA 1E9IA 1FA2A 4DYEA 1J0KA 4UR7A 1X98A 2O56A 3TN4A 2CYGA 3UYCA 2G5WA 3H7RA 1F74A 3KRSA 4NRSA 4ZE5A 4AZGA 1RPKA 5A8GA 3VDBA 5F1VA 5FD0A 4C6OA 2YL9A 4Z1AA 1BGGA 4CCZA 4QCEA 1US2A 2ZRZA 3PG9A 1H7XA 3TV8A 3C2VA 1BF6A 4L56A 3QGVA 4IGNA 2OJPA 3ARSA 4XBKA 4AVFA 4OHQA 1DQXA 1M7JA 4AZ5A 2WM0A 2ZQ0A 2ZDSA 2O7SA 1RJRA 2ZRYA 3MV11 5CG0A 4U31A 3VNJA 4PBFA 3T81A 2IKJA 4O19A 2Y8UA 3GXNA 1XLLA 2PTZA 3VDAA 3RM9A 1KD0A 3SCUA 3NIYA 5LIUX 2Q6ZA 2CZEA 2I1OA 3I65A 2AGTA 5C9UA 1CGVA 1R3YA 1TV2A 3ZIZA 1TTIA 2OSYA 1JRCA 4FX6M 2OLSA 4HPJA 5BRQA 3CZEA 3NM1A 3NXFA 4Z2HA 3V36A 1E73M 1VZWA 1EIXA 2QDDA 2PDHA 1BKHA 1UZHA 3TC6A 2C3ZA 2P8CA 3HA1A 4QDPA 2X1UA 2XGBA 3ITGA 3TSMA 3M5XA 1F6PA 3CAWA 1XHGA 1CEOA 1UG6A 4AVNA 3V1PA 3W76A 2AMXA 4O11A 4JNYA 2VDGA 5LNUA 5FJUA 1W8SA 1BHGA 1GZJA 4XKMA 3OBAA 4NKCA 1S5NA 1F3XA 4ZTXA 2X7VA 4BWLA 4MPKA 1Q6LA 3CQ0A 1B3WA 3LHUA 4LNYA 2QJMA 3LCWA 5KZDA 4IIFA 4AIEA 3VCRA 2CLEA 4O12A 4M80A 5J8LA 2X42A 3P93A 4JTSA 2HVNA 1ICPA 3FA3A 2OQHA 4DZHA 3WLPA 3TC3A 4ZQCA 3W1AA 5D03A 5DBUA 3WL0A 1GVSA 4Q7BA 4AD3A 3V1HA 2JFEX 3NURA 3EWXA 2YKKA 3B9AA 5I5RA 1MFUA 3FA4A 1LZOA 5DMNA 3GNPA 1DWFM 1QPOA 3L9CA 1UYQA 3O9NA 1J2WA 3W70A 1YYAA 2WQDA 3U4FA 3UG3A 1EXBA 1T5AA 4I6KA 2PMQA 2VEMA 5B7ZA 4CCEA 1HKJA 4IWWA 4JOMA 4TX6A 1JUBA 1XQKA 3DYMA 4RK8A 2YL8A 3EOEA 3E5PA 5IM51 4A35A 5AC8A 3NL3A 1XIIA 3V16A 4B90A 1DV7A 1BAGA 3MBFA 2VD9A 1MI3A 1F76A 1TWWA 3AS0A 1FWCC 1K7FA 4RDVA 3UXDA 4DJDA 1Z89A 1UWSA 1X6NA 3G1XA 1OD8A 5C2GA 2VT0A 3I7SA 3I3DA 1W0MA 1F6YA 4E4PA 1J0HA 4HZMA 2PWFA 4A3UA 3R7MA 2YGYA 3DENA 4DNMA 5KINA 2FPVA 2C15A 3R89A 1XDJA 3WELA 2PD9A 3WQ8A 2OB3A 4KESA 3G24A 3B04A 3AXMA 3OJGA 4O1FA 1XDMA 4I9AA 1GYLA 4J2MA 4JZ5A 4HOWA 3RNDA 4WOZA 2WWCA 4TTGA 2QMJA 3V75A 2WBKA 1P43A 4PMZA 4Q4MA 2HK0A 4XZ9A 1AQHA 2ZA2A 2G96A 2IPFA 4AC1X 5SWUA 1QFEA 3B40A 3PP7A 1XLCA 5CQ1A 3T0DA 2PEVA 5LGZA 2GGIA 1PTGA 8XIMA 2AGKA 1C93A 2FPTA 4DZ5A 3S1GA 3VOHA 2YBVA 2ZE3A 3U6WA 1UD8A 2I57A 5LA0A 1U33A 4X60A 1H5VA 3LQGA 1QRQA 1W5QA 4C6DA 3BSMA 3A4AA 4Q8MA 1LBFA 4CVUA 1GHRA 1JRBA 3EXTA 4K8EA 3L2LA 3VU2A 5JIPA 2Z1VA 3MMWA 1DL3A 1XISA 2HXTA 5EU9A 3MUZ1 3QGAC 3TKFA 3BL3A 3KHDA 3OU8A 1IXQA 2VNCA 2XZ9A 1F4AA 4MM1A 1FCBA 3CIVA 4D6FA 1A0DA 2XFFA 3AXHA 4HU4A 3TK7A 1EEXA 1TPC1 4QG9A 5DRIA 3M0YA 3ITXA 2OO0A 3HG4A 3VA8A 4MKNA 3UY8A 2WKLA 3EOSA 1TUFA 4DF0A 5CPSA 2F7FA 2OTDA 3M0MA 4F40A 5CZTA 1NDVA 3RCNA 4Y7EA 5IRPA 1H2JA 5FSDC 1IT8A 2CHOA 4DLMA 1CCWB 2O0TA 5CPOA 3OW1A 3UQNA 3AMDA 3AUJA 3LNPA 3L5LA 2G3MA 3W71A 4WEVX 3N9RA 2WNWA 5FJJA 1QPNA 2RGMA 2CXGA 4AXKA 3QN3A 5AC6A 3BG9A 4Q8NA 3PUGA 3DFSA 3WLQA 2A85A 1VP5A 3O6CA 1CYGA 4GI6A 2PUZA 2J9YA 3FXGA 4R53A 2DH3A 1QNVA 3NPWA 1QVBA 4YU1A 2EGZA 1QI2A 4UTLA 1XG4A 2V81A 5KMYA 4L4MA 3O6DA 4KF1A 3I6EA 3LHVA 1EUNA 1JGMA 1Z44A 3WLSA 2FIQA 2FLIA 2HK1A 3IGXA 5I3IA 2J66A 3UZZA 1MYRA 1M5WA 1XYBA 2FZ8A 4N4PA 4LWWA 2YDSA 3WD4A 2XG9A 1SZRA 4PGLA 5AZ1A 4GVGA 2ZXDA 3KHJA 3R0KA 1C92A 1PZ1A 3MP4A 4QQUA 1EPXA 2YIHA 5CKSA 4R5EA 4LUSA 4Z2IA 3OLEA 2XUCA 4IX2A 1LG1A 4JTAA 3ZLGA 1XC6A 4IPIA 5A8NA 3TONA 1RZMA 2V5JA 3PNUA 4BQ2A 3GNDA 4JIIX 3HPSA 3M46A 4NYUA 4I8YA 5HOSA 1WZKA 3ZVHA 1BYDA 4RKAA 2A3BA 2PDWA 5A8QA 3ZSTA 5C2CA 5I3KA 3B0XA 1TRDA 3ANUA 3BV4A 3TJLA 1XSIA 4B5VA 1XLHA 1PWLA 2V63A 2Y88A 1KRCC 3FJLA 1OFBA 1NAL1 4DUXA 3AZSA 3WBYA 1KM0A 3T1GA 1CWYA 4JEJA 4ONVA 1UWIA 1UWTA 2NWRA 1CGUA 1KLYA 2ZVIA 4LUSB 2XIMA 1SMAA 2PA6A 2RDTA 3W1UA 4KEMA 2CWXA 4HNCA 1F07A 2WHKA 3WUFA 2Z6JA 3IAPA 3TYAA 1A5LC 3FYPA 3BLIA 2XN1A 4HHMA 4B5XA 2VGGA 4O14A 4KCTA 2OMAA 5H8PA 3W1LA 2EPKX 1EC9A 3BAKA 3STCA 2CLOA 4NP7A 3AMKA 1GOKA 3B0YA 3G22A 5AYXA 4QISA 3LXBA 2IS7A 3UG4A 4HYWA 1EDGA 2ZRWA 1W37A 3DGBA 4QS5A 3IIVA 5C0QA 5CJ5A 4C1NA 3N2OA 1GTEA 4DLFA 3SQLA 2VJXA 2YCKX 1KNWA 2YA2A 3MY9A 2ACRA 4AY8A 3NFUA 3XISA 2ZZ7A 1J9YA 4DWSC 3HM7A 3MKVA 1SO4A 4MWAE 1CGWA 2C18A 5LNWA 2NV2A 4RW3A 1LUCA 2A2IA 2G97A 2YCIX 1PVNA 4HOZA 4NAEB 4M24A 3MO7A 1JFHA 3RIKA 3TJ4A 5IFPA 1TFVA 2WSPA 3FY1A 3ARPA 3V18A 2J8FA 4GYFA 4FR1A 3LGEA 3SAZA 1K9FA 2YCJA 3TLLA 4LU0A 3CNYA 2WCSA 2DT0A 1FP9A 3A4JA 1B0IA 3D6NA 4C1NB 2QHAA 1PIIA 4B2DD 1CGXA 2HS6A 1WE5A 2WZIA 3S2NA 3LZ3A 2I5QA 4RE2A 1UUMA 4NZFA 5F2MA 1A5MC 3UA3A 3VE9A 1GOQA 5BCAA 3GTNA 1XRFA 5JVLA 3FGCB 3S46A 1ZTVA 3CZKA 3PK7A 3TZFA 3HQ1A 3M9YA 4HZ7A 3S9YA 5EKYA 1EJSC 2AKMA 4IT1A 3N19B 4J3VA 4U10A 1QNOA 1FKXA 3M0XA 3S9ZA 1K8YA 4AYSA 4DX3A 2BV9A 5DMMA 2GJXB 1PO9A 1GVIA 1W1VA 4UCFA 1WXJA 2GQ9A 3VGFA 5FESA 4IIDA 4GPNA 3VDCA 3U3HA 5HBFA 3A23A 4JTLA 1BVNP 4C65A 1TPB1 3M5VA 1WPCA 2HBVA 3A9BA 3NQCA 1FDYA 2INFA 4JTIA 2PD5A 2ACQA 4NSBA 3W2NA 3ITOA 2WANA 2ISWA 3BGGA 1VBUA 3ZR6A 1OX5A 3LRLA 5K4XA 3CZLA 4N2YA 1BXNA 1E1EA 5CC3A 2X05A 3SY1A 2WHJA 1E0WA 1MRQA 4HB7A 4B16A 1IIHA 1HJUA 2GSHA 4HP5A 1QI5A 4D6IA 4LUYA 3CMFA 3DCPA 5I06A 2FTYA 4YPJA 1M3UA 2ISDA 3AMCA 3P62A 4JGDA 3FHQA 3DHPA 3BLPX 1TIWA 4KRZA 2E28A 2EJAA 4O8RA 2INZA 3MMUA 1MFVA 1R7AA 1HX0A 3STGA 3ABQA 4J3ZA 4HHPA 4C1LA 4OUEA 3B9EA 4O17A 4ZSUA 5A6MA 1S3TC 2C13A 2ZKMX 3DKLA 4HA3A 3TEVA 1BVZA 2GUYA 2E6DA 1MWOA 4F2TA 3PWGA 1BD0A 3C3UA 4C1KA 1WX0A 3F2DA 1G7UA 4S3GA 2Z24A 2IPWA 5ABEA 5LNVA 2G8ZA 1TCDA 1CT5A 2CZDA 4UTUA 4C6QA 1TE1A 3NGJA 5C9WA 1O5KA 5E5CA 3FXYA 3CS2A 2CBUA 4A29A 1FDJA 2DUZA 2OKTA 4LRTA 3LM7A 4BI7A 1ZQ5A 4Y9PA 3ANYA 2BP1A 1CX9A 2BDQA 3LENA 1GPFA 3LPOA 4GVHA 4UCGA 1RJQA 3WMLA 4JCLA 1FH8A 1IXPA 1EJUC 3CO4A 4AD4A 1ZBVA 4MNKA 3A4WA 4F2UA 2ZFAA 2ADAA 4NJKA 2YCLA 5HR7A 2O4QA 4KWWA 4S3CA 4K37A 4J3XA 3FLUA 5BROA 1VPQA 5D05A 1ELSA 1XBVA 4REQB 5CC6A 3WLIA 2O4MA 4KBXA 4AX6A 2WHMA 2VUYA 4OV4A 2P0OA 3GHRA 4YTSA 3PC0A 4EPKA 3FK4A 2YBUA 2CU0A 3F4VA 2WAGA 5A6TC 1PX8A 1VB9A 3LYEA 1FWBC 3HV8A 1UR8A 4H9VA 3CLMA 4XQ6A 4UFLA 3U57A 4GQQA 3QV8A 4OU1A 1TMQA 4IMEA 4IUGA 3S2LA 4LRSA 4CNTA 4MLRA 4KFOA 1PYFA 3ECQA 5BWAA 4DWSB 2E9LA 1YTDA 1E0XA 1SGJA 2C71A 1ODZA 3BDKA 3KZSA 2ZXBA 4O1CA 2X0HA 3W1RA 3AROA 1P0DA 2ZVRA 2WCAA 4Q8PA 1TB3A 4JFUA 3PPGA 1U30A 2ESCA 1MW1A 3GRIA 3GY1A 5LXXA 4U3AA 1E6RA 1LJYA 2Y5JA 3W87A 3GG0A 1JF6A 3IGHX 4JD4A 3HQNA 3W2MA 3PSWA 5C7VA 3M47A 3CHEA 3WMBA 4C6NA 1V77A 4LX4A 4JDYA 1NOFA 2ZDRA 1BFNA 2NWSA 4IHCA 3NVDA 4IMGA 3A3HA 1RY8A 1R5YA 3WNNA 3AHTA 4DUVA 2BXZA 1NJJA 5I0DA 3GDTA 1VHCA 1HKKA 1F9CA 1RXOB 1UBSA 4BI5A 1JAKA 2GSJA 2KX9A 2FTPA 1WDWA 4JTTA 1N55A 1O60A 3FEMA 4Q8UA 1UD2A 5TD4A 3OOQA 2YDRA 4Z1CA 3PG8A 1AZ2A 3NZRA 3WNKA 2EQDA 3TMQA 1UZ4A 4MY8A 1VBJA 3T8QA 3IIOA 5HQMA 3RPDA 1T40A 4YJ5A 3MT1A 3Q67A 3MP3A 3TN6A 1I8JA 1GOOA 1S2UA 5HNUA 1F3EA 4QAIA 2P76A 1UB3A 3U9IA 1JJKA 4L1WA 1QNRA 1UP2A 4KGJA 3RAOA 3CL8A 3ABXA 4HCLA 4F9DA 1MNSA 3GXIA 1ZL1A 2DZTA 4HNUA 2QGHA 2DW6A 3U7BA 3AC0A 5IOBA 4YLWA 2CWNA 1IIGA 5CH9A 1NWSA 3PZNA 4FMVA 4G1NA 1XI3A 4C7FA 5BXTA 5D30A 1ISZA 1SW7A 3ZXWA 1FWAC 7A3HA 1H09A 3ISIX 4XK2A 1R9YA 2DIKA 5CEWA 1P6BA 1W1ZA 1A5UA 3AIEA 1UQZA 1UKQA 4ZB2A 5D37A 1BWVA 2GVEA 3SUUA 4UMBA 4AAJA 2ZUNA 4P5UA 3VX0A 4JTRA 4LCRA 4LY4A 2ZA1A 2E6AA 3WF1A 4E38A 2H6RA 4ZQMA 4UOZA 3QM3A 4ZO9A 4DO5A 3GKAA 1D3CA 4MMWA 4IPJA 4HK7A 4XBSA 1RD5A 1TQJA 2V67A 2VEPA 4KWUA 2J62A 5HPCA 1HJSA 2VKZG 6CGTA 3E02A 3F4WA 1XLJA 3CQHA 1RUSA 2WMKA 3G77A 1OD0A 3HGOA 1YADA 3HPAA 3HURA 4Q4RA 1GKQA 4UR8A 5IDIA 4XZMX 3VD9A 5DELA 4OBRA 3OGSA 1LORA 1VCFA 3C0JA 1ZZMA 3C2FA 3A64A 3SW6A 3VGEA 4MUZA 4XZHA 3UPMA 1UA7A 4AEOA 1XV8A 3UGRA 4G9PA 1DTNA 2OO6A 3EWYA 2FB2A 4I7UA 2VDHA 1UD3A 2DV0A 2FPYA 2PRHA 1SZEA 5EYWA 5BXSA 2YYTA 3SCSA 2Y70A 2VEFA 3H6OA 2JF7A 1YBQB 2YFNA 4RNFA 1EOKA 1DQWA 5FI8A 1LRNA 7ODCA 4YN5A 4U28A 1ZPTA 3A3XA 4A6GA 1ENUA 1W5OA 2C1IA 1DJIA 1U83A 1GW9A 1XP3A 3LNMA 1G67A 3UT0A 2F2HA 1FWSA 1RK6A 4JQ3A 2FZNA 3M5ZA 3GB6A 3W7NA 1UKSA 1H0GA 3QSTA 2NLIA 3TYBA 1V3JA 3S5OA 4W5ZA 3QZEA 2HJPA 3L68A 4O1BA 2VUNA 5C9XA 3PB2A 3DIPA 1JZ7A 4HU8A 1CI1A 1FWGC 4QX4A 3GWQA 4XISA 2A6LA 3ABOA 3W1XA 2HV5A 4Q22A 3UXIA 5I3FA 4WLCA 1CBGA 3A24A 3XINA 1TA3B 3F1QA 2J7HA 3CGTA 2GJLA 3B9NA 3MHFA 2NXGA 1GQLA 4GY1A 3WLRA 1L8NA 3LMYA 1LDCA 3IJ9A 3TQ0A 3WDRA 2DGAA 2XIJA 1E6QM 1JPDX 3AYSA 3U8GA 3WQDA 3ZJKA 4X0VA 4UQDA 1ZGDA 1MDRA 2BOEX 1EC7A 2DPEA 2I9UA 3ABRA 5FSEC 2PDMA 3VIKA 2DT2A 1NEYA 4GJIA 3DFQA 4UBPC 3WEMA 1E56A 2BHYA 4XD3A 2QV4A 3BG5A 1OQFA 4EF8A 4IIEA 4UFKA 3EZ4A 4P2VA 1IYXA 4H6QA 1J10A 3GIYA 5DT5A 3GYCA 3EMCA 3GVWA 9XIMA 4P7NA 1G69A 2IKHA 1ONEA 4NVTA 4L4OA 2X2YA 3UWVA 3VGDA 3M7SA 5K9DA 3WH9A 5DLCA 4E3VA 4JL1A 2J27A 1JXJA 5FJTA 1F73A 1JNDA 1GZ1A 1OYBA 4KRTA 3M5YA 4QTGA 2WKJA 1TE6A 2XWEA 1W3KA 1EIBA 3F4CA 3AMGA 4RE4A 1DTUA 2GJRA 1R2TA 3DU0A 5LXEA 4XAYA 3VAVA 1GQKA 2ABBA 2HWGA 1TJRA 1XS2A 3RDKA 1NQKA 4DJDD 2YB1A 1UUOA 4ZENA 2QJGA 2Z2AA 3DHDA 3N2BA 4IX0A 1ISYA 4FNUA 3EKLA 4XV0A 1VD6A 1IWBA 1DXEA 1UWUA 2ZBTA 4IMAA 4GUHA 1XLGA 2EPNA 5FAJA 1IEVA 1PXGA 2VRJA 3I3EA 4ZBCA 3GR4A 5E09A 1SU5A 2XH2A 1NU5A 3NUKA 1A50A 3ZJ6A 1Z9AA 2UV8G 1HL9A 3G1RA 3C0SA 4FNQA 5EL1A 1U22A 1KM5A 1VPYA 5BMXA 3JVAA 3G1HA 1BKSA 4ZR8A 3LX9A 1XYLA 3W23A 3BGAA 1LBLA 6REQB 5LIKX 5LGXA 1ONXA 1VC4A 3L0GA 5JXQA 4GLEA 4DBDA 2H3DA 4AZCA 3OVRA 4GMEA 2YA0A 1LT7A 3QKEA 3GD6A 1A3XA 5HQLA 1L2QA 1LQ2A 2HZGA 2EPLX 3UG5A 3NOYA 4O13A 1GJWA 4D6GA 4M6UA 2HS8A 2QCMA 2ZUWA 3ITCA 1KM1A 2EBNA 4JBRA 5GJPA 1OK6A 4MZYA 1G94A 1M01A 1RPXA 3AHYA 4B4FA 5BOOA 3L4YA 1JYWA 2Q09A 2E9BA 4Q4OA 5LHFA 3E49A 2GGHA 4LQ1A 2QJIA 4JTQA 4IXHA 3F5KA 4QBXA 2J78A 5MF5A 1F8IA 4PTMA 4H1ZA 1IZJA 2D2OA 4Z2GA 4JFTA 1ZCCA 2KZHA 2B31A 3GFXA 4EXQA 4UNKA 3W7EA 3EKZA 2HTMA 1KR0A 4FLSA 4PUMA 3QHOA 1V3LA 1J11A 4C6KA 1LM1A 1XYAA 3W24A 3OLIA 2PBOA 3ARYA 2YFOA 2H9AB 1VRXA 2GVLA 3B9OA 4YWSA 4N6EA 4UFJA 2WMIB 5KZEA 1W32A 4IZGA 4JQ2A 4DO7A 1HO1A 1VRDA 1TV8A 3NWRA 4HNVA 2ZZ1A 4OQVA 1WDSA 3OB8A 3MCNA 1NOWA 3N12A 3G0SA 3WFAA 3QZ6A 1VFTA 4F0RA 1LROA 3W7RA 1XR2A 4PMOA 2VC6A 3RX4A 3QV9A 1MW0A 3UEQA 3LEPA 3WK2A 4RZBA 2I56A 2RUSA 3I68A 3EMQA 4U2YA 1YRRA 4EACA 3HJZA 3AIQA 3WKZA 2OU4A 4Q6XA 4XKYB 3PZUA 3RX3A 1VYRA 3HU7A 4HYVA 2PAJA 4EOUA 1QXLA 5CAHA 4HT3A 1QO5A 3AIUA 4P7QA 2VMFA 3GC4A 5D09A 3GVQA 1HIZA 3L5AA 3WY1A 3CL6A 1GVFA 3LOTA 2FQIA 3TW6A 4IXXA 2I5GA 4LALA 3L2IA 2QUMA 1T6MA 1H7OA 7REQA 4W87A 3WD3A 1IGWA 1CECA 1NDYA 2G0WA 1R47A 2XJ7A 3UVIA 1JPIA 1QPRA 1ALDA 3EB4A 3OBKA 1E0VA 2QJJA 2ZTKA 5D4YA 2XSAA 3L4ZA 5H8MA 2NUWA 4GYPA 2QW5A 3W82A 2CCRA 1QW7A 2PE4A 1I45A 1EKOA 3WLMA 4N9DA 3BARA 2BASA 2XN2A 4J40A 2GK1B 4NILA 3TR9A 5HMFA 4DJFC 3FJ4A 3ITLA 4EKJA 3VGBA 1E4LA 1LLWA 1TPEA 1I2QA 5K3VA 3C3NA 2CNCA 4XAPA 3IJLA 3AQUA 1QR7A 2XIQA 2A3HA 1AMYA 1S38A 4MZ1A 4AD5A 1AZ1A 1Y5WA 4URIA 3CUJA 5DXXA 3W81A 3AXIA 4PB4A 5F2IA 4PMQA 4YMZA 2FHFA 1UMLA 2O55A 1IWPA 5H1WA 4N42A 4UWMA 2D0FA 4O1AA 4L6HA 1SO6A 5G4EA 2VHLA 4TUFA 5C71A 2YZ5A 5B7YA 3ARXA 2VFFA 3DYOA 1CLXA 1L9WA 1LQ0A 1W6TA 3THAA 4OOZA 4WGXA 5T91A 2X30A 2Z28A 1F61A 4FPSA 5F2LA 2VFIA 2D73A 4QS6A 2AAAA 1ADOA 1K4HA 2C79A 5F7UA 1M65A 3USBA 1S5TA 1O95A 3O6AA 2B0MA 1A80A 4IFRA 2O7QA 4AZHA 4MKSA 4DPQA 2OODA 4C6JA 4FNRA 4XUGA 3VOFA 1I2RA 4XD4A 3ARRA 3WH5A 4B3LA 3CV2A 5D2YA 1BSLA 4B3KA 1WO2A 4AIUA 5LYRA 1OC6A 4MYXA 1OX4B 3OVQA 3GO2A 3QF0A 4XO6A 4HBKA 5JMUA 2DQXA 3WK0A 1VS1A 2P3ZA 3TYEA 3TNOA 4ZA0A 4KCWA 2NW0A 4LAUA 1WZMA 1Q3NA 1M9HA 1W1B1 3NQGA 1B57A 3K13A 4IPNB 2GSEA 4CU7A 2ZZ5A 5M2FX 4GABA 2A6NA 4GJ1A 3OYXA 4RX0A 5KTLA 4MAZA 3GNXA 1THFD 1QI0A 3KBNA 4DXXA 4ZFMA 3R0DA 3LTPA 3Q4DA 3T2QA 4DBEA 2QIWA 3MVTA 4O0ZA 2PU1A 1DE6A 3VYLA 1S1RA 3QZAA 2QJNA 1U1HA 1G4EA 2DEPA 3K8LA 4DPPA 1QDSA 3CZ8A 4U33A 1HKMA 1ZENA 1Q45A 3JZUA 1SYTA 1DWIM 4I5UA 4W7VA 3NCOA 1YMYA 5I78A 3TAKA 3GU1A 3TSDA 3FW6A 3RO6A 1C90A 4GZ7A 4HHHA 1WOAA 1JULA 1UR0A 1XRTA 3EDEA 4YYFA 3NZQA 1JQXA 2XTKA 2X0SA 2W79A 2HISA 1D3HA 4YHGA 3F4DA 3R8HA 1DIOA 1S5VA 2WVUA 3EWCA 1OCQA 1XLKA 2QUVA 2VC7A 4M1BA 4FR6A 1RY0A 2FJKA 2XWDA 4H8HA 4AZ7A 2WBGA 4JTFA 1I2PA 1W2PA 1N7KA 4YL2A 4H7ZA 2E6FA 3OZOA 3JRKA 2VO5A 1ITQA 4NNBA 3GXMA 4H19A 3WCZA 2H8ZA 1ZJAA 3WIJA 1H50A 5CSYA 1V6YA 5CZJA 1KWKA 1WKDA 4YCPA 4TMCA 4LVGA 3GNOA 1XGZA 2PDJA 3E1F1 3QR3A 3A5FA 4P8UA 1B4EA 4ZOBA 3WBXA 1KA9F 5FKYA 4AG0A 1V93A 1VBHA 1TPFA 3WNLA 3MWCA 2Y1HA 4QHRA 3IJQA 5FL1A 1ADDA 1DJWA 3SI9A 2PGWA 4HD5A 3GHTA 1RSCA 1WAWA 4UTMA 1VFUA 4QSHA 1NSJA 2QZRA 3UJSA 5A2BA 2OZ3A 4NI8A 4NJJA 2OG9A 3TX9A 3BJTA 5K9XA 3KRBA 4NJGA 3ATZA 4Q4SA 3QC3A 1DXIA 4GQ0A 3S1XA 4G8TA 3QFEA 1A3WA 3T08A 1J18A 3GW3A 3H2FA 5CBIA 3G6LA 4JR5A 2R91A 5C7HA 3TFXA 3SDOA 4HK6A 2F9RA 1UR3M 3THCA 3WD1A 4LF1A 3MCMA 1W1PA 5AYYA 5IHSA 2CLKA 3UZJA 1KV8A 4OV9A 4AHPA 2GOKA 1YE4A 1KO0A 2Y7FA 2OELA 4FNSA 3V7PA 5FF0A 5JQ9A 4WJEA 4HIBA 4HCHA 1PHWA 3QEZA 2D3NA 4Z2LA 1R3WA 1E55A 2EO7A 4AMAA 2CZVA 1CTNA 4JHZA 2VCBA 1R3TA 1ME7A 3VIOA 4D2JA 1NARA 4AWEA 2J88A 1EP1A 2WOQA 1K77A 1VLIA 4GXMA 1S2TA 2C6QA 1JZ8A 3DBNA 1MMFA 5GVJA 1TPUA 4GUJA 2E5DA 4WQ6A 3Q58A 3VK5A 3EX3A 2Z1KA 4P7RA 1R2SA 4UQAA 1L6WA 3WQWA 4MG4A 1JPMA 1FDZA 3SCVA 5C55A 4DI8A 1J2BA 2VGBA 2I5IA 3CT2A 5HINA 3NO5A 1XM3A 4US6A 1E5NA 1B3VA 3AXXA 1WNOA 1HL2A 1EFZA 5EMMA 1GOMA 4YWIA 2TMDA 1AMKA 4K38A 4LEQA 4IG2A 2H8XA 5LA1A 4MJ2A 2BXYA 3SGZA 3PUEA 2I16A 1E15A 1M7PA 3LRKA 4V2XA 1W9UA 1XIFA 1XXXA 3EXRA 3SQMA 2VC9A 3KXQA 3EAUA 3M07A 4DQWA 3APGA 4HPXA 2VEGA 1H1ZA 2VZSA 2VR5A 4UIOA 4Q32A 3FIGA 4A8NA 2ON3A 3TP4A 3O7UA 3OODA 2WSKA 4M51A 3RF9A 3FAXA 1QOQA 4GXWA 3B8VA 4UB9A 1ITCA 3ERPA 1HKWA 3EA1A 3CB3A 1SM9A 2PF0A 5GNYA 1MRAA 3CJPA 3DBPA 4ZFCA 1O1HA 2UZ9A 2JIWA 3SUVA 1A5CA 1DWGM 1K8XA 1KFLA 4GYJA 3VZXA 1OYAA 1S2VA 2VXNA 1QJWA 4QXIA 2RJGA 3TN5A 5FF3A 3O0FA 1LTDA 2ZUVA 2VZUA 1Z8AA 4PC8A 3FVMA 3S6OA 1E71M 4Y9OA 3G3MA 5T9BG 2EKGA 3KBJA 4B9YA 4TV5A 5LNRA 4FLOA 2J13A 3W1MA 4FNPA 4Z08A 4PTWA 5D9OA 2ZWYA 1GYNA 1TSIA 2O9PA 3WLKX 4Z1BA 2Y24A 2CITA 2C1HA 1LL6A 2BZNA 3SCPA 1K70A 1IQ8A 1ZUAX 3QRHA 3LHYA 4Y6GA 3G6MA 6TAAA 1S2AA 3DH7A 1W1TA 2ZX9A 1J93A 3GXFA 4DO6A 3AIVA 4WY0B 3H2MA 1GONA 1JZ5A 2E5CA 3LA4A 1YEYA 2FHBA 3CPUA 4W9TA 1LP6A 1V3HA 4CNOA 4NU7A 4DF1A 1WKFA 5LHEA 9RUBA 2X2GA 3ORWA 4QQ3A 3WJYA 3TWAA 3NQAA 3W2JA 1FHDA 1FY6A 1TV4A 2OOFA 1R2RA 2WHLA 2YLAA 1Q8JA 2G4FA 3U2ZA 1L2UA 3REQA 2PDBA 3DDMA 1KFEA 1R8LA 4LCQA 3M44A 2R1NA 4FF5A 3DI1A 5F4SA 3QY7A 5DX7A 4MIMA 2VX5A 1KM2A 3W7MA 3BICA 4PMJA 1QO2A 3GIQA 4RDYA 3KLLA 2VWTA 3PM6A 4XG1A 1UWRA 5D33A 1QW9A 4JXCA 3H8AA 5BOEA 2JEQA 1L0PA 3VKJA 4KERA 1WZLA 3Q2DA 1UR2A 4K7YA 4AW7A 3SFWA 4S3JA 5HNNA 2D0GA 3B9DA 2ZE0A 5BRBA 1OVDA 4JFSA 2OWCA 1Q2RA 4Z0SA 2GDUA 4N0RA 3IACA 3SUWA 1FWNA 1Z69A 3QW4B 1OHLA 4FB7A 2X16A 3URAA 3ZJ7A 4PE8A 3B8WA 4J3WA 1KXVA 1VLWA 2I9EA 3ALFA 1IZCA 4JN7A 1PX4A 3B0UX 5F4XA 3N6HA 3DERA 3KOXA 2WZEA 4F0HA 2ZZ3A 3CUGA 5CJMA 1ONRA 4WSKA 3NSMA 4LB4A 3IUHA 1HGWA 1W3NA 2XISA 4QITA 1MW3A 3TDFA 5F4WA 4AX7A 3VDHA 2Q3OA 1WXYA 2Y0FA 1OG6A 5AVHA 1PL9A 3BSGA 4JS3A 5RUBA 1XH0A 4TVUA 1UCWA 1R3SA 4ZB5A 3EXSA 3MYPA 3T55A 2O9RA 2ZA3A 1RBAA 1HZYA 1O7AA 3E38A 5IDZA 4PUEA 3CASA 1AQ0A 1QK2A 2C7FA 3GVGA 3M41A 1MW2A 3J7HA 4KIEA 2BVYA 1XIMA 4JX4A 3BCFA 3MP5A 3WDJA 3PTMA 4JYEA 1RD6A 4U5IA 1A0EA 1DWAM 1Q13A 2P3EA 3QW3A 2DZWA 2ZIDA 4AD1A 1XGEA 3W4RA 4L65A 1TPH1 3E0LA 1OF6A 2HCVA 1F6KA 1MO0A 4ZCWA 2REQA 4YVXA 2X1TA 2WVVA 1EDTA 1CNVA 4PUNA 1K8CA 4RZ4A 4IMDA 1TTJA 1YHTA 1M7XA 3CIXA 3TNBA 1R3RA 1Z3NA 3HG3A 5G4HC 3AHZA 5FCZA 1IEQA 2QCDB 5I2UA 1PCKA 4B2DA 3UJEA 4RW5A 3GC2A 1TWZA 2W91A 3PZMA 2QT3A 3RUBL 4GC4A 1F3TA 4JAWA 2PDYA 4Y90A 1W3HA 2WVSA 2CERA 3QQ1A 1VF8A 1SZNA 3URBA 1GK8A 1HT6A 1IHIA 2W4XA 3D5HA 1V02A 2WQPA 2J9ZA 3VILA 4ZZ9A 3UYIA 2YXXA 4J1OA 2JKEA 3EX4A 3XIMA 4JFVA 3R11A 3A6OA 3ONBA 4WDWA 1GEHA 1QBAA 1H4PA 3HMJG 1CGYA 2G95A 2ZX7A 4KWSA 5CZSA 1H11A 4M29A 4MFDA 3WF3A 1TMLA 4P8XA 1QNQA 4HZ6A 3LS9A 5AHFA 5ABGA 3T2PA 1SJBA 3H53A 1W9VA 1XH1A 4QGCA 2CESA 1SFLA 1REQB 4HA0A 1JCLA 2VRQA 2GDQA 2EAWA 5XIAA 2BOGX 3OLDA 4EIVA 5E0CA 1X8FA 1CGTA 4HA4A 4RPQA 2V82A 1VFHA 4C7DA 5AKQA 5REQA 1BRLB 4P7OA 1D8CA 2F6UA 3N11A 2VX4A 2QS8A 1YDVA 1G1YA 2Y85A 3HMCA 4M7SA 4UTTA 4HK5A 2DVUA 4O1EA 1DP0A 4O15A 4PTVA 1O5XA 2KAUC 4W86A 1K7XA 3KCOA 3BAJA 3GR7A 4GG9A 3S42A 2ZUUA 3GSMA 2XVLA 3AWOA 2ATMA 2F61A 3P5ZA 3NQ7A 1XFCA 3LQLA 3VNKA 2QQ6A 3H55A 4GNVA 1EC8A 5A6JA 1XH2A 3AIBA 4NX0A 4GQGA 4C6IA 1DEDA 3ID7A 1FUYA 2POZA 2QULA 3BAXA 2A3LA 4UQBA 4M1RA 4DN1A 2ZUSA 3VNLA 4PYSA 3O0KA 3O15A 1O68A 4F0MA 2JGQA 3LPPA 3BSHA 3W7QA 3VVGA 3ZT7A 2V2CA 4HNTA 3PAJA 4PMXA 1IT7A 1EGZA 3LHZA 1W91A 4J3SA 1E9YB 2CLLA 3EWZA 1G7VA 2E4TA 1KQYA 4S38A 3T07A 4DVOA 3VIJA 2QUUA 2HPIA 2I17A 1QK0A 1TQXA 2R82A 3DHFA 3C56A 1C29A 2ZUTA 4NZCA 3WD0A 4GD0A 1GQJA 4D6DA 1X1ZA 4H8UA 5AHIA 2FH6A 4O54A 3PBVA 4M3PA 1MXSA 2Q8LA 1GYMA 1VJIA 2ZX6A 1ICSA 4H04A 1JDAA 4B5NA 1OM0A 4XBJA 2VTFA 1YPIA 1W31A 4UTJA 2X0YA 4OVXA 5FEXA 5CPMA 3IV8A 2OEKA 3PUDA 1XIBA 1UROA 2PDUA 2XSBA 4EAMA 1JVNA 4GVIA 4M7TA 5EBUA 4AWSA 1ONWA 3N6QA 1CLVA 3EWUA 3SN4A 1I75A 4CU8A 4J4KA 2WCGA 1C7TA 3N2TA 3EDDA 1UQYA 3BW2A 3PANA 2OXNA 2PC8A 3CIWA 3FA5A 5BXPA 3LDVA 5CAKA 4G6CA 1E6XM 2RDWA 1WUEA 4X3ZA 2BY1A 3FN9A 5D2XA 1FWTA 2RGLA 4YTRA 4B9ZA 5E9AA 1YTKA 3OPSA 1J5TA 4L9YA 4QNWA 3PBGA 1Q6QA 2EJ1A 1VQTA 4FOKA 3E3HA 3DESA 4HJFA 4O57A 1W9PA 2RJHA 2WPBA 3SY8A 3VUPA 3H7UA 3KL3A 2WK2A 3UCQA 1OFAA 5DRCA 3UR2A 3PFRA 1X6UA 4NZ4A 3MZNA 5F2GA 1X38A 2VGIA 4ACYA 3VIFA 1DHKA 4K39A 3TC7A 3UWEA 3K30A 2DQWA 2VQUA 1JI2A 2QDEA 3IEBA 2PODA 2HDJA 3K5XA 2BG5A 3TIMA 1FCQA 5E6ZA 3B05A 3P74A 3W27A 2FMNA 2VP8A 1OSEA 3HBLA 3QOKA 3GG1A 1VGAA 4H2CA 4YXGA 2YW3A 3V3WA 3AMLA 5AHNA 4HCDA 1V6UA 3NO3A 1W17A 3GBDA 3O8AA 3MKKA 5JBFA 2F6KA 2D2GA 3PJXA 2VOMA 3SCWA 4MB5A 1LG2A 3W7DA 3NM3A 3B8UA 3AHVA 1UP3A 4C6BA 4L4LA 3W7OA 3W7KA 4JKLA 1B3ZA 2V3GA 4AISA 1NFPA 2YOCA 4IFKB 4CEXC 4JTJA 1KKOA 2B81A 3RMJA 3NZPA 2EHHA 1DOSA 4S3DA 3SQSA 1XPYA 1R3QA 1W9DM 2VENA 4GUFA 1XYMA 1A3HA 3VNIA 2CBVA 4GH3A 4HPGA 2QGYA 2BVWA 2OZTA 2V38A 2O92A 4I9TA 3WUBA 3PUOA 3FAWA 4NZ1A 1HN1A 4PRRA 2YCEA 3TFCA 1L8PA 4PFHA 4UTFA 2AOSA 2V3FA 4PRTA 1TPVA 4YVPA 2WMJA 4B5TA 1GJPA 1RA5A 3N3MA 2V2HA 4LW7A 5H2ZA 3A4XA 3OBEA 1QAPA 1JL8A 3GXPA 2FMOA 4AXNA 1J0JA 3OQ8A 2F38A 3R94A 3NQFA 4W93A 4G7EB 3OP2A 4ALDA 1DORA 4INFA 1BLIA 3KWXA 3WO8A 3R58A 4QNEA 2WM1A 2E6YA 4FX7A 4NZ5A 1OT2A 3PFMA 1CXIA 4UTWC 1TELA 1ZAHA 3GC5A 4BFAA 3MUY1 3CQJA 3ZZ1A 3QYQA 1M03A 1OB0A 5AFDA 5A95A 1R38A 5ABHA 1X7IA 3WLHA 1FXQA 4KT2A 4V27A 5HR6A 4LV4A 2P0IA 1OFQA 4O1DA 1UIOA 2E09A 1B9BA 3PBWA 4TTUA 2A7NA 1KCKA 3PWIA 4QLLA 2JKPA 2Y62A 5IXEA 3BLDA 3ITTA 3TA9A 3W29A 4PEEA 3IJ6A 2EXOA 3N2XA 1QNPA 2VFHA 3GNRA 4GZIA 2DSWA 1XKJA 5D2WA 3M0JA 4LBSA 2BVTA 2TYSA 3ITYA 3CH9A 2IQTA 2PB1A 4ICCX 1KFCA 4NX5A 2QDHA 4D8ZA 2OR2A 3RLVA 3W38A 3RLHA 5AZ0A 4LAMA 4I9MA 3QHNA 1KGWA 2QJHA 2ZRVA 4MFEA 1LOSA 4GFSA 1FFRA 1JYVA 4A3QA 3DZ1A 1ECQA 3L21A 4UOQA 3QYSA 1OIFA 4E6MA 2DZUA 3I6TA 4HPNA 1X97A 4CD6A 5IBXC 4DY1A 3P67A 3ICJA 3QLLA 1ICQA 4R88A 2VOTA 3M0KA 1GW1A 1N82A 4QLJA 4ZVJA 3HPZA 1YNQA 3NAVA 4E4UA 4ZOEA 3RXZA 4C60A 5HA7A 4KIRA 4DM2A 3UXKA 1NDWA 3AIWA 3DG7A 4FEZA 1T96A 1VFSA 3SY5A 1JI1A 3E2RA 4PA8A 1E4NA 3CWHA 1QHPA 4PR4A 5XIMA 1PS9A 2ANUA 3MW7A 3AYVA 2PGRA 4IJRA 3L0KA 4HMEA 2PP3A 1RHCA 1GQIA 2QCGA 3V0UA 2OVLA 4OUIA 1XLFA 4ZGYA 3WZ0E 3WBWA 2Z1WA 1EA9C 3LLXA 3FVDA 1FWEC 2V6AA 5HWJA 2C14A 1OGGA 3GG8A 3EWWA 2GGJA 3HGSA 5CPNA 4R33A 4HNOA 1CENA 2GLKA 4IIHA 4LAKA 4HHLA 1AA1B 1Q2SA 1VBRA 1KRAC 4O18A 1OC5A 3S5YA 4CVWA 1TWDA 2CBJA 2PTDA 5JBEA 1B30A 1NQ6A 3RPTA 3PTQA 3LK6A 4DXKA 1PPIA 4XZIA 3LHWA 4Q3MA 3T44A 3BMXA 1XBZA 2CBIA 3FDKA 3VCNA 4GNKB 1EX1A 2W66A 1H1YA 5I3DA 3UZ5A 5DBTA 4XAZA 1ZLPA 4PUWA 4OECA 1X96A 1CDGA 1KW1A 1QWKA 4K1WA 1FWJC 3UZXA 3C8NA 4ILSA 1QT1A 3KOYA 3BAWA 1OGSA 3IK2A 1TWIA 4G7FA 4GACA 2PSNA 4ML4A 1XIHA 4KCVA 3UW6A 3IUIA 3LM3A 4RUBA 2WMGA 4ZL1A 3W02A 4FXFA 1WKYA 3P7YA 3R1ZA 2GGEA 1D9EA 4WX2A 3S6DA 3VGGA 3RCMA 3WQ6A 2FVLA 1ODUA 1PCWA 4WY0F 1KBBA 1YPXA 1MDLA 4QRNA 3LG3A 1RLCL 4X2RA 3VIMA 4AZ6A 4L64A 3KTXA 3TA6A 3MV01 3T7VA 1OYCA 3HPFA 1NF0A 1TO3A 3M6YA 3S0CA 1AW2A 3INPA 5CSUA 4EPDC 2WLYA 5A8MA 3WL1A 4MWAB 1VHNA 1T8XA 4PUKA 3F5JA 4ZO6A 3HG5A 1TV5A 1OIMA 4C6EA 1W3JA 2F84A 3UG8A 1OFRA 2Y5EA 4IJBA 3RM4A 3QTPA 4D72A 3R43A 3SCTA 1HNYA 3N4FA 3D3FA 4P8VA 1UR1A 1V3KA 1H7NA 5LIWX 3AZTA 3GTIA 1US0A 4AIOA 4QJ4B 1JEZA 2PTXA 1SVDA 4B4HA 3G8EA 2R94A 4PN2A 3TJIA 4HYRA 1E1CA 3OHIA 2VFGA 4IF2A 2W6RA 2HMCA 3UWQA 3WNPA 1POKA 4N9CA 3LBMA 3QJAA 3WQPA 1Q66A 1ISXA 3NQ8A 3P81A 4NY2A 3TZNA 4H9TA 1R3VA 3HGJA 4L1XA 3N6JA 5K9CA 4AF0B 1JUKA 2ALDA 5LIYX 1FCUA 3OTRA 4XO7A 5E70A 3MCOA 2V3EA 5HK4A 5KEZA 1DKWA 4ORIA 2HRWA 3PR2A 1U5JA 2WZTA 5DCDA 3AYTA 1JDEA 5AYIA 4FX8A 2NVCA 4F8XA 1KRMA 4Y9NA 5C9ZA 4AHOA 6PTDA 5K7JA 4LH8A 3WF0A 1E1CB 3LCGA 3MTWA 5HWMA 5CCZA 4O4WA 3WEOA 2IMRA 3NTYA 3WX7A 3B4UA 1RV8A 2E25A 2BY2A 1CZ1A 3DXIA 3U4AA 1Q6CA 2BXVA 3G5EA 2YYUA 3T0TA 3EB3A 5HPOA 2XZ7A 4NXKA 4KWVA 4RPPA 3N29A 3TWBA 1IEWA 1DHPA 4TV6A 2NQ5A 1XL9A 1MSSA 3UVAA 3QY8A 3L67A 2CLHA 4DXVA 4UR9A 5MKGB 2HEJA 2OEMA 1CXFA 1NY1A 4JNZA 3WFLA 3OG3A 5G4WA 2V5KA 4I5XA 4EXBA 4X0NA 3L4VA 4O0KA 4FALA 3EPOA 3EX6A 2FB3A 4JHMA 3AWNA 3NYZA 4KEUA 1JZ6A 2WC4A 3TN3A 4DUOA 4EK7A 3EEGA 3QV7A 3WQGA 3S8HA 3LU2A 4PTDA 2OSWA 3S9IA 1B1YA 5CC7A 2IUZA 1B5TA 2FZ9A 1WB0A 2B7OA 3RFAA 1TCMA 3BWWA 3KL0A 1E6PA 4DELA 1HKIA 3CZJA 2BHZA 3VINA 2DH2A 3I4KA 1P0EA 3VPLA 4AU0A 1EF3A 1KTBA 2DIEA 3R25A 1EZ2A 1P7TB 1EB3A 3TYUA 2ZZ2A 4HGXA 3TCSA 4C6FA 5HATA 1TV7A 2NSOA 2Q8ZA 1GVYA 5LKYA 3M0IA 4FLQA 1BPLB 1B3YA 3BV7A 3IJ8A 1WP6A 1ZCOA 1JGIA 4Q7IA 3QTGA 1SZFA 2R1KA 3KTCA 1GORA 4PTXA 2ZX5A 4FP1A 2HBXA 2IPGA 3CEPA 3WF2A 2Y2WA 3GR8A 4QCFA 5ECUA 3GH4A 4O16A 1TZ7A 4NZ3A 2XFRA 3W00A 3GXDA 3HF3A 3MDWA 1QBBA 4WOQA 4MVAA 2CKSA 2DJXA 1X7FA 4BY3A 3GBEA 3DG3A 1UPPA 5EY5A 3QOMA 4MHBA 5ECVA 1OWQA 3LSCA 3MA8A 3TLQA 3POHA 4DUWA 3RM8A 1E43A 3CHFA 5LSMA 2QR6A 3TMLA 2WW5A 1X1OA 5ENLA 4PUUA 4GIRA 5BXRA 3BE7A 3TAOA 1YDYA 5DY2A 4IOTA 4OWGA 3THUA 1PV8A 4AMCA 4FXSA 1EJ7L 3W3OA 4QLKA 1OT1A 2EG7A 4NAEA 4ZMGA 1O12A 3GHUA 5AHEA 1AH3A 1JFXA 4UNIA 4CQCA 3TQPA 4HNLA 3S3GA 3DGRA 5JH1A 4DB7A 4TX9A 1JZ3A 4G2DA 4H4IA 4LUIA 5DN1A 1NDZA 4N9BA 1VIWA 1E6NA 1B31A 3H2NA 1UKPA 2H90A 5HXMA 2OX4A 1U1UA 3LY0A 1P0NA 4C5YA 4EPBC 4I9JA 3H24A 3FGCA 5F1UA 4XUYA 3VE7A 1YE6A 1E3XA 4GE8A 4NAFB 5G1MA 4M8UA 1EA0A 2RAGA 2IKGA 4IGMA 5HWNA 6XIAA 1EWDA 2GJXA 4WUIA 3G1VA 4AYGA 1V79A 3CEUA 1Z7AA 5A6KA 3QFWA 4NNCA 4CNUA 1NWRA 3JU2A 4W8LA 3GE7A 3QKZA 3DC8A 4M6VA 5CXPA 5I00A 1EOMA 4GZJA 5BYWA 1ECEA 3SUSA 3QQWA 1EWEA 1X6LA 1GJUA 3K1GA 1Z48A 1V6TA 4Z1DA 2V30A 5C2XA 3WJWA 2QVNA 1OCBA 5AOUA 3TSBA 1RBOB 5D2TA 3PPHA 2P10A 4LFYA 2PPGA 1FHVA 4CN1A 4U5KA 1B9ZA 3CUXA 4H9UA 2DP3A 2GVJA 1I1XA 2IQ0A 1QASA 1HJWA 4HN4A 1HG3A 2VEIA 3RLUA 3OHMB 1VPXA 3WF4A 1RALA 2YSWA 3VD4A 3BUVA 4HOXA 2D20A 1FWRA 3VOCA 1EJVC 3EDFA 3BOFA 5FEPA 4A2SA 3FSTA 4HMDA 4W4QA 1NIUA 1BXCA 5E6YA 3NR0A 3UR5A 3LCHA 3OZYA 2QUTA 1A5AA 3IUDA 2BX7A 2PLJA 1DIDA 3PZIA 3QH2A 4GC3A 3WMCA 3R13A 3UXAA 4WIWA 5AVNA 3WDIA 1OK4A 3TXVA 1UW9A 3LI1A 2ZTJA 1GVRA 2JGYA 4CQDA 2VX7A 2ZRXA 2VEKA 2C0AA 2EG6A 1QPQA 4H8NA 4BF9A 5AY7A 2V5CA 1SO3A 4H3DA 3D47A 4XSMA 3QMTA 3BK0A 1EQPA 3T4WA 3GYEA 4DYKA 1HO4A 1Q7MA 5EGRA 3W6LA 2HSAA 4JNMA 4CU6A 4E2VA 1OFDA 3T4CA 3PJUA 3UWYA 1XICA 3TU9A 1K02A 1P6WA 1QHOA 1TUXA 4L4PA 1ML1A 4LOCA 4FIQA 1L6FA 4PB3A 2XGIA 3WJXA 1HKVA 5DFAA 2QAPA 3VMNA 5AYBA 5GNXA 4J35A 1AQMA 1LRTA 3M43A 3K46A 1C9DA 4XIAA 3VMPA 2OT0A 3RILA 1Y5XA 1L6YA 3AU2A 4BI6A 3OGRA 3M0HA 3WLNA 4REQA 2EG8A 4DJED 3STPA 2VVNA 4K68A 4LBUA 4E5TA 1J96A 4M81A 3QBUA 3PTDA 4NUWA 3E6EA 4F0LA 2FKPA 4G1KA 2J6VA 4M0XA 3WN6A 3MBDA 2W92A 3GW0A 2JF6A 5AB3A 1G01A 3VD7A 4DYJA 2QV5A 2DORA 1W9BM 4C6LA 4GCXA 3QSRA 2D3LA 1ZBWA 2Y4SA 4BK9A 4ORMA 3R8RA 4B3ZA 3TJXA 2G41A 2QEZA 2Z7KA 4GRSA 1GHSA 1W1IE 4TMBA 4DWSA 3V0SA 1P0KA 5HMDA 4FS9A 3E2QA 4GA8A 3JZEA 2DZPA 3C61A 5IFTA 1DPMA 1XD1A 4C90A 4IQJA 1BVWA 2EPHA 1C91A 3CH0A 3POCA 7PTDA 1W5MA 5C6MA 2GJPA 4Y9AA 4W88A 4PCPA 4NYYA 3VKBA 1K6AA 3W6MA 1KFJA 2DUXA 4GINA 4KH2A 4JDBA 1UHVA 2PP1A 2NVAA 3HQPA 4X61A 1H1NA 4LCSA 4ICNA 3NL2A 3PPFA 4UQEA 2IXUA 2F6XA 2W0UA 4DBWA 5GNZA 4AD2A 1ZAJA 4MY9A 2YZRA 4GGHA 2AL1A 2P8BA 2VZOA 2GPTA 1OCNA 4GCAA 3TW9A 5D8ZA 4KRUA 2Z7GA 3M6DA 3H2OA 2VFDA