4NHVA

Crystal structure of b. anthracis dhps with interfacial compound 4: 5-(trifluoromethyl)-1,2-benzoxazol-3-amine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and characterization of an allosteric inhibitory site on dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 104
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4nhvA00
4MWAB 4NIRA 1AJ2A 3BOFA 5JQ9A 1TWSA 2Y5JA 4DJFD 3H2FA 3H26A 2E7FA 1Q85A 3H22A 4D8ZA 1F6YA 1AD4A 3TYCA 4DAIA 3NOYA 3TYEA 1EYEA 3H2OA 3H2EA 1AJZA 3H23A 4S3DA 4NHVA 4O1FA 1Q7MA 2VP8A 4DB7A 3TYAA 4DJEA 3H2NA 4S3AA 4D9PA 3H21A 1Q8JA 2H9AA 4MWAD 4C1NB 3TYBA 3MCOA 4DAFA 2VEGA 4S38A 1AD1A 3TZFA 4NILA 4DJFA 1Q7QA 3MCNA 4D8AA 2YCLB 4DJDD 3H2AA 3TR9A 4PZVA 4O1EA 2BMBA 3H2CA 4G9PA 4S23A 4S39A 3TYZA 4DJEC 3K13A 4HB7A 4DJDC 1TWWA 1TWZA 4S3CA 1TX0A 2YCIX 3H2MA 4MWAC 2H9AB 3V5OA 4DJDA 4DJFC 4S3EA 4O0QA 3MCMA 2VEFA 2YCKX 3TYUA 2YCJA 2Y0FA 3TYDA 4C1NA 4CCZA 4DJED 4S3FA 4MWAE 2DZAA 3H24A 2DZBA 4S3BA 2Y5SA 4MWAA 1Q8AA 3BOLA 2OGYA 4NL1A 3TZNA 1AJ0A 2DQWA 2YCLA 1Q7ZA 1TX2A
chains in the Genus database with same CATH superfamily
4I7VA 3OHIA 5LA1A 3M46A 1HVXA 3TV8A 1TPWA 1PWMA 2A7NA 2DW6A 4QHRA 4PTMA 4A2RA 4WDXA 4MNMA 3MI3A 2PZNA 1GEQA 2D69A 3NFUA 4DF1A 4XVEA 3QVQA 3H54A 1I8JA 1PDZA 4C6LA 1NU5A 1ME8A 2QXWA 4WDTA 4XAZA 1TE6A 5FI8A 4B9ZA 3RR1A 1D8CA 3QY7A 4L65A 4U4MA 2NX9A 3CB8A 3BG5A 2PDMA 3WJZA 5XIAA 3RM8A 5A6BD 3CQHA 5FSEC 2JF6A 4W9TA 3LBMA 2WJEA 1MXGA 1XBVA 4PCPA 1L6FA 1OX6A 3THDA 4IP5A 1H63A 1K8CA 1PPIA 2ZA2A 3TIMA 2O9RA 5JBEA 1B3OA 2I16A 3BLLA 3LMYA 2FVMA 3NDOA 5BMWA 1JQVA 3SM0A 4KCUA 1LUCB 1BG9A 1ZSXA 2ZDRA 3SJ3A 4C6QA 2PU0A 1HJQA 3L0NA 1K4GA 5FJPA 3GDMA 1F6PA 2PRLA 1CEOA 5G2IA 3KOXA 1KC7A 2BHYA 3GQYA 1EX5A 4H8UA 2Q8LA 1EKOA 1TJ1A 4F79A 3SCNA 3MKKA 3L4UA 3QOKA 2WMKA 3A6OA 1A5BA 4IIEA 3PG8A 4OZOA 2PD9A 5AYYA 4Q4MA 3N6JA 2J25A 1CGTA 2J7DA 4PMOA 1GKPA 3WCZA 5HBFA 3S2JA 4E2BA 1M41A 1Z42A 5GNZA 3BW4A 1DVJA 1OFAA 5F1UA 1XLHA 3NQAA 1MFVA 4UQ9A 5AECA 4ZZ9A 4TXEA 4XTDA 4MVAA 2QF7A 1SM9A 5A3HA 2J24A 1GOXA 4PH6A 3UYIA 4XVDA 3OB8A 1J10A 1R9YA 1YHTA 1KFCA 1R0MA 2AKZA 1ZJHA 3U4AA 3TWBA 3ZT7A 4O1EA 2G97A 2ZVIA 1EIBA 1E3ZA 4DJDC 1F05A 3PPCA 3UT0A 3CT7A 4CQBA 4QEHA 3BGJA 1YDOA 1PZ3A 5JUVA 5C6MA 1W6TA 3GR8A 1PHWA 3CK5A 2PLMA 3SBFA 2NWSA 1ZHAA 3LY0A 4OFCA 5HATA 5M03A 3QV7A 1R2TA 2P8CA 4QR6A 3W29A 1GOIA 2FTYA 3NXLA 5DY2A 2CHOA 3CTLA 3GU2A 4C65A 1XS2A 2CCRA 3MYPA 3CHVA 1BYAA 2VZTA 2B7QA 1KWKA 4IMFA 1PEZA 1DJIA 1XICA 5EBUA 1M68A 1VBRA 3G77A 1HUVA 1HN1A 1WUEA 2X8RA 4GQQA 5J8LA 5BU9A 1FKWA 2CBJA 3N9SA 1VFSA 4LX4A 3TYEA 4ADTA 3BDKA 3CAKA 5E6ZA 3T2OA 4FXJA 3NQFA 1SQ7A 3ONCA 1KLZA 4NVTA 2YA1A 3DBNA 4US5D 5JVLA 2P76A 4O52A 5AC8A 1HW6A 1QUMA 3W7LA 1FXPA 3K1DA 2CITA 4J3WA 4OVXA 4NILA 3FSTA 3FSUA 1O5QA 3C5QA 1XISA 4ZQCA 1UBSA 4QP0A 4L5ZA 4UTKA 1P7TB 4S39A 3RGTA 1C8XA 1E9YB 5AHIA 1J96A 3SCPA 1JI1A 1L8NA 2EPNA 4GQ0A 2YDAA 5CBJA 4FZIA 4S3EA 1GK8A 1W9UA 3T8QA 4ERIA 5CZJA 4UQAA 2FDMA 3NURA 3CO8A 3MJMA 1Q6OA 1UB3A 2VEFA 4GVIA 5AB3A 4HK6A 4NJIA 5HMFA 1BWKA 2ZZ2A 4KBXA 3GYEA 1UWQA 4HCDA 2ALDA 1GVFA 4XAYA 3VGFA 2Z1BA 1OIFA 1QNVA 3LSBA 2NXIA 1Q2SA 4HNCA 3TAKA 3EZ4A 2X1RA 3AU6A 1LLWA 4WUIA 3KWSA 3SRKA 4XO7A 1QTWA 2PZ0A 2HSAA 3KOZA 4KQNA 3IIZA 5DLCA 3O6AA 1LBMA 2MNRA 1MZHA 1VJIA 1YNQA 1OM0A 1Z3NA 2EAWA 3WLIA 4KCVA 3IVUA 4XSLA 1MDLA 2DW7A 5EYWA 2JGQA 4ZO6A 2QS8A 2WJFA 3VDCA 2EPLX 3AMKA 5M17A 5CGMA 1NJJA 3LDVA 3BZGA 1MUMA 3U9IA 2ZKMX 5D33A 3JVAA 1XKYA 3PULA 8TIMA 4GK8A 1J4EA 1L6WA 2BMBA 4MOZA 3TH6A 4KWSA 2ACSA 2JKAA 3OOQA 5U4NA 4WSJA 4NZCA 1YLVA 5G4EA 4ZXLA 4S3CA 3PVFA 1J9YA 4X2RA 1U2YA 5EBAA 3RPDA 3WKZA 4FNUA 4OIFA 2NT0A 3DHUA 2W63A 2V3DA 1HJSA 5DMMA 3LD5A 5CAKA 1U83A 4JDYA 1GZ1A 1YDVA 3VM7A 4FAMA 4M6QA 4EPBC 1W3TA 3PPHA 4F0SA 1Q6GA 4NNCA 1WKYA 4LUTB 4W84A 5AHFA 3WJXA 3OZMA 2YFOA 4FLQA 1XYFA 4YMZA 3T9PA 2PWDA 3G6MA 5JBDA 1JDCA 5DBUA 4HTYA 5AZ0A 2Y85A 4WY0A 2ACRA 4DO4A 3OVGA 3A9IA 3NOYA 3SCSA 1I2PA 3GU1A 2VC6A 3AXXA 4JZ5A 4EIVA 1GVYA 5BROA 2YL5A 3CGTA 2PRHA 3LCHA 4HA0A 3MDUA 5DFAA 2YB4A 3GHTA 1T99A 1FHLA 4E4PA 2G3JA 3VNMA 3WYZA 4RPQA 2Y7DA 2WYSA 4XAFA 4AQLA 3WQ4A 3LGGA 3W2MA 3B9NA 4TTUA 1UZDA 5A8GA 4IIHA 4RW3A 4FMVA 2XIMA 2E8YA 1EYWA 2CNCA 1Q66A 2QYGA 3LQLA 3E0VA 4Q8UA 4UWMA 4EKJA 3URAA 2ZE0A 3V5OA 4GXWA 4DWSB 3OBEA 3H55A 1UWTA 2FGZA 2V3EA 2ZRUA 1UZHA 1O60A 3I3BA 1MQPA 2ZXBA 4IPPA 4YJ5A 1G0CA 1UR3M 3W83A 1MW0A 4GI9A 4CNNA 2ZTJA 4PUJA 5DCBA 1PTGA 1OY0A 3M5ZA 1AW5A 3N11A 1OGGA 3WQ8A 3OVQA 3CIVA 1UD3A 2ZX6A 4WGHA 4FHAA 3MW7A 1EXPA 4AD5A 2NT1A 1CWYA 1MW1A 4H6RA 4QFUA 4Y96A 4X61A 1BVNP 5LNRA 1XDMA 4RR4A 4LOCA 1J0HA 3TYCA 4L6HA 4G2DA 3KBMA 4Z17A 4CD4A 3F4VA 3FEQA 5HUPA 1VJZA 4JKLA 1L9WA 4TQTA 3FGCA 2J7BA 2O9PA 4GACA 1XCWA 4N4PA 3WDHA 3JRKA 4Q7IA 1MQQA 2VD8A 2VI0A 2A85A 1EO7A 4QCEA 5TIMA 5I3HA 4XSMA 1HGWA 2PWEA 1BSIA 3VUSA 2QZRA 3VDGA 4M6UA 1BGGA 2EGZA 2Y8UA 1JUKA 4LT9A 1QASA 3CWOX 4POCA 3L5AA 2HWGA 3FVMA 1H1ZA 1U30A 3BO9A 4WIWA 3WK3A 5HQMA 1XRFA 3FXGA 4LRSA 2E0PA 1XLIA 3WDPP 5AC5A 3NZQA 4LXFA 4HZ7A 2O4MA 5KZEA 4WOZA 3NIYA 2VX6A 4H6EA 3NZ1A 3NM3A 1BSLA 1DIKA 1CTNA 1MNSA 1K9DA 2AQWA 3ITYA 1Q3NA 4QE5A 5CG7A 1R3RA 5G1TA 4O14A 1IWPA 2GJNA 4UTUA 3B0PA 1ECEA 3W1LA 5EGRA 1QDSA 1TPVA 1E1FA 3FDKA 2W79A 3KOFA 3BAIA 2E9MA 2C3ZA 2X42A 4RNFA 2XN2A 1ZAJA 3HPAA 4KT2A 3AXKA 3CV7A 3VIHA 1A53A 3WEOA 3TA6A 3GNXA 3YPIA 5D09A 1VFHA 5AFDA 3VGEA 2PDFA 1VFLA 3VIFA 4K39A 1KFWA 3UJRA 1ADSA 4FIRA 1V3IA 4C5YA 2J8GA 3D5HA 1J8VA 3M4HA 3WMSA 3OQ8A 1H4PA 4NJGA 1DXFA 1W1YA 3BICA 5XINA 1DHKA 4G9PA 3TWAA 3MUCA 2FTPA 4CUCA 1OF8A 4QLKA 4LAZA 4GUGA 4HNOA 5IXEA 5I78A 3DHPA 1HZYA 1T41A 1JZ5A 2GK1A 2ZUWA 5EKYA 3K8LA 5XIMA 1I75A 2QW5A 2CLEA 1H09A 1ZBCA 3E5BA 3AYSA 3ENLA 4KETA 4KFOA 3W9ZA 1IV8A 2PGWA 5HA7A 3M7SA 3W1XA 5HUOA 4PMNA 4LH8A 1SMAA 1DTNA 4JQ1A 2Q71A 2R9RA 3FW6A 2VJXA 4R7JA 3KS6A 3H7VA 4TTGA 3BAXA 4BQ4A 1FRBA 1E6XM 3W01A 4LYKA 2V82A 4HSHA 1D7FA 3D0CA 3KBNA 3SUWA 2QULA 1RBLA 1F6YA 1AD4A 3CPUA 4ZB2A 4EACA 3ZJ8A 2GL5A 3P60A 1QOPA 1HO4A 2PDQA 2E25A 1OZQA 1W9VA 1XLEA 1AD1A 1UOZA 4XISA 4OHQA 3N2TA 4K37A 3BAJA 5BXRA 4HU3A 5F7UA 4NX0A 2UWFA 4ZO7A 3PPFA 4IISA 3SCTA 4B3LA 4LB3A 3WLSA 4D6GA 5H2ZA 4QEEA 2ZWZA 1NQKA 4B5UA 1Z32X 3D3FA 2RUSA 1SW7A 4NU7A 4DYJA 3BK0A 1NP2A 1GOMA 1SW0A 2WC3A 3G0XA 2OB3A 1NH6A 3S2CA 1HXJA 4QG9A 2QCHA 4OE7A 4GGHA 4B9YA 1D2KA 3KRBA 7REQA 2WHKA 2ZE3A 1IWAA 1LBFA 3E1F1 5T26A 1W1ZA 1V77A 3S42A 4B3KA 3DAQA 1XLCA 4BF7A 1RH9A 2YA2A 1GG0A 2Z6JA 5DO8A 2HK0A 4HVXA 4FPSA 3LQGA 3CEUA 3UEQA 3W7NA 1J79A 4XIMA 4XZBA 2X0SA 4JTEA 4UNKA 2QUTA 4LEQA 4EOUA 3HMCA 1YXDA 3WN6A 2DZVA 1SFSA 3BLEA 1S39A 1ECQA 4S1FA 1VRDA 2A1YA 4NG3A 4RPPA 4ZR8A 3GVRA 1NOUA 3H2NA 2CWXA 1I2NA 2H9AA 4UCFA 5HNTA 1YQ2A 1OK6A 3WLJA 1WDDA 3E12A 1JI2A 4XD6A 1F3XA 3SR7A 5LHFA 2YCLB 4BR1A 3VTRA 4RK8A 1E1CA 2IUZA 3ITVA 4GZEA 5LNUA 1F8IA 4O15A 5IBXC 1S5WA 4JEJA 4GWEA 1QBBA 2EKGA 1L0PA 1OK4A 3WL1A 1FY6A 3KX6A 1VP5A 3NVTA 1QNSA 5EU9A 3DYPA 3RRXA 1W9XA 4C91A 4HZ6A 1NAL1 4B5SA 1R38A 1PHQA 1M9HA 1UP3A 2W0UA 2XN1A 3WFAA 4WD0A 4KIRA 2ISFA 3GU9A 3N2CA 4H2HA 1B3XA 4H41A 4O53A 4O50A 1W5OA 4MUZA 4JQ2A 3A9BA 1JAEA 2ZC1A 5IFPA 2F38A 3GZ3A 1OFBA 2J9XA 1Y5VA 1CX9A 3BOFA 1UD5A 4WJXA 2TRSA 3PB2A 2XYLA 3TMLA 4YTUA 3SGUA 4A8LA 4Q8QA 4DBSA 3QC3A 1RUSA 4UB9A 5LA0A 1E9ZB 3WD0A 3LLFA 3QGVA 3HPZA 2HRWA 2VP8A 3ITXA 1NOWA 4U5KA 4X9YA 2CLHA 4N02A 3P82A 3N6QA 3NSNA 1KGXA 3G0UA 2X7WA 5CC5A 3L65A 1EUNA 5I7GA 4WX2A 3LM7A 2FH6A 3HG3A 5TBOA 3WUFA 3W02A 3LK6A 3UETA 3PF3A 4OT7A 3N9KA 1R3QA 3VNDA 2X1SA 3U6WA 4ZA0A 1TELA 4NNAA 3S1GA 1DJGA 1UKPA 4Q7NA 4CEXC 3DDMA 4AZCA 2OEKA 3KZPA 3AZSA 4BS0A 1LL4A 1ONRA 4XB3A 1H49A 4TMBA 3SZ8A 1JR1A 2W62A 7TAAA 3L2IA 3D6NA 4AYSA 3NZRA 4BJHA 1O6IA 4XZMX 3TFCA 1HX0A 4GE8A 3ARUA 2DH3A 1XQKA 1V08A 4GUHA 4TO8A 3I3DA 3VNYA 4Z2HA 3POCA 4D8LA 3R13A 3VIPA 2XWEA 1KFLA 1BAGA 4Z1CA 1ADDA 3B04A 4PTVA 1BKHA 2GOUA 3QZAA 4J5NA 1X7IA 4D6IA 2QGHA 3L12A 5HDRA 3W7EA 3WLOA 4GOAA 1BF2A 3P5ZA 2CLKA 2OODA 4O1DA 1LWJA 4U3AA 4B5XA 3MUZ1 4L6OA 4AY7A 3UGVA 1X6UA 3GIYA 2YZ5A 4L7ZA 1OINA 3I68A 4QE4A 5I0DA 1GYNA 2C71A 3B3DA 3WQ6A 3PS7A 2QCCA 4KPLA 3XISA 1JXJA 1JPDX 1XUZA 2QCDA 3RNDA 3OLEA 4N7QA 3RITA 3NYDA 2R6OA 4K38A 4GYKA 2JIWA 3UCQA 2VC7A 1LOQA 4AAJA 2NV9A 4RZ5A 3VD3A 1FWIC 3U2CA 1J2WA 4Y9OA 3IJQA 1WXYA 5K7JA 2HE5A 3ORWA 3GTXA 2OLAA 4GFSA 5CLTA 3QFWA 3RU8X 5MKGB 3M0MA 5A8QA 3O3RA 4XUGA 3AXHA 4NNBA 4Q8TA 3NPWA 2DT0A 3W2KA 4UTJA 4ILSA 3WK2A 3UWVA 4Y90A 4GQBA 1G01A 1TRDA 5JIWA 2E5CA 3VNKA 5EMLA 2RJGA 1Z48A 3MMDA 3T1GA 4GKLA 4O1AA 4JY8A 2XSXA 4D6JA 5LIXX 4E0CA 5I23A 1VPXA 2VX4A 4GXPA 1OSEA 1HP4A 2V3GA 4AEOA 2ATMA 3W7PA 4Z2JA 1VFFA 1PO9A 1BF6A 1K6AA 5FL0A 4JYDA 2B7PA 2FTWA 1WDWA 3VIGA 3REQB 4V27A 3WQFA 2ZX9A 1B1YA 2Z1KA 2R24A 5I2UA 3ID7A 4KF1A 4W93A 4Z1AA 5K3VA 3CPRA 1UJPA 3OYZA 1PKMA 5DRIA 4J1OA 1XUUA 5LXXA 4DWSC 1JPKA 3TN5A 2X2GA 3C3NA 1E1CB 3AS0A 3AS2A 1Q63A 3P5YA 1JULA 1SYTA 3CH9A 3URBA 3VKDA 3G5EA 1W9PA 3WH7A 3OGVA 1RV8A 3W7GA 1G67A 1MXSA 3QV6A 3EWYA 1J5SA 1E1EA 3SIMA 3THAA 2CHNA 2YXGA 3UY8A 1BGAA 1YXYA 4AZGA 3BAKA 1YNYA 3R11A 1OIMA 3PZGA 2WV8A 1F74A 3PZNA 4MFEA 3FNDA 1EXBA 2PP3A 1A5LC 3BOLA 1TKKA 4GQRA 3WNOA 2J7GA 1O95A 3QZ6A 3F4WA 3TC7A 1CNVA 3GXIA 2HEJA 2IPGA 1FDYA 3R10A 4J28A 5REQB 1XF0A 3G1XA 3APTA 2HK1A 4MGGA 2ZRWA 3T0BA 1K4HA 1UQZA 1J93A 4M0XA 3FA5A 5BRBA 1MZRA 3K30A 3EGJA 4LFYA 1OYCA 4O1FA 5H8MA 4ENLA 2P3ZA 3SN4A 4RV8A 2QJNA 2BZNA 3L4XA 3TJ4A 4CQDA 2XG9A 4O18A 5FEPA 5K4XA 3WJWA 3HFYA 2O0TA 3OZPA 3BJTA 4A29A 1F9CA 2WZIA 4HA4A 2BS9A 1W8GA 4Q8MA 5T9BG 1R86A 4HOXA 4TIMA 3T44A 3DFNA 3AAMA 3KDOA 4DPQA 3EOUA 3P3BA 4E8CA 1UOKA 4Z42C 4XZIA 1DJNA 4LQ1A 3GHRA 1ZQ5A 4D71A 2R1MA 4DUOA 1NOFA 4I5RA 1QK2A 2PDCA 1XIIA 1RCOB 4K2SA 4KRZA 2FDSA 1QW9A 3QSRA 3GXFA 4DNHA 3LV6A 3HGRA 3NSXA 3HZ3A 4LYPA 4Z1BA 9RUBA 2ZDSA 4FIQA 3VCCA 1PIGA 1PZ2A 5CJNA 2XH2A 1KKRA 4ACZB 1VKFA 3PJXA 1K77A 4FB7A 3BAYA 3STCA 2NUYA 5EPDA 4QAWA 5CQ1A 1JCJA 1E5JA 4YHGA 3NQ7A 3COTA 3N4EA 1V3HA 3DX5A 3A64A 2CIPA 3H2OA 1GJPA 5EMJA 3DIPA 5A6TC 5CSRA 4XD4A 4ZFMA 4IMAA 3MSRA 1J01A 2VM8A 4IT1A 2BWGA 3PNZA 1FCUA 2AL2A 1SU5A 1ITXA 4ONVA 3W1NA 2ZUVA 2OGJA 4LBRA 1OFOA 4PZVA 1ISXA 3OZYA 2YL8A 3ALGA 1LWIA 4ZEPA 3BMXA 3N9RA 4MZ1A 4L9ZA 1P48A 2O55A 4RW5A 2BASA 2CZ5A 2EEXA 2ESCA 1GVEA 3O2LA 2INEA 3VOIA 1IXQA 3P2VA 3BW3A 3ZVHB 2HE8A 2DY3A 2OEJA 3PUOA 4R85A 1U33A 4GXMA 5CZ0A 1GOKA 4EF9A 4O8AA 3QEZA 4UOJA 3WDIA 4DI9A 2VC5A 3SQLA 1CXLA 1H50A 3B9DA 3DG6A 4QJ1A 4S3GA 1BRLB 1BPLB 1QK0A 5CSYA 3TJLA 4FK9A 3WELA 1I2OA 3FAXA 2WZHA 4ZQRA 3ITTA 4FF7A 3UXLA 4IL0A 3W6LA 3FGCB 2GLKA 3TTQA 3LM3A 4JTHA 3I6TA 3BG9A 1OCNA 3DFPA 1RLCL 5FJTA 3PSVA 4D9PA 3CUZA 4Q4KA 4J3XA 3I10A 1JJKA 3WUBA 4Y8FA 3SSZA 2QPXA 3VKKA 2G3MA 4NYYA 2J7HA 3ABQA 4KEVA 3LS9A 4C6DA 4HZMA 2YGYA 4HNUA 6TAAA 1K3UA 2GVJA 3CL8A 2E4TA 2E3ZA 2CBVA 2VGBA 4GJ1A 1C29A 4GUFA 2BXVA 2X2YA 1ZAIA 4EWJA 1V79A 3ANVA 4OV4A 2WMIB 3EPMA 4W4QA 3Q2DA 1X97A 3P0XA 4P2VA 5E0FA 5TF0A 5G2HA 4UTIA 3C8NA 4LUYA 3KBSA 3MPGA 3VCNA 3OIHA 1IWBA 3NM1A 5KMYA 5C9XA 4IX0A 2E28A 2Q09A 1V6TA 1W17A 4AZ6A 4C1NA 3QN3A 3WDJA 2W91A 4M19A 4AWUA 1UYQA 1FFRA 4ATDA 4DM1A 2BVYA 4JCLA 4GY7A 3G22A 4DY1A 5BZAA 2Q3RA 1ODZA 3W1QA 2FB2A 3ZLFA 1MUWA 1HTIA 2GVLA 4ECLA 1GCYA 2EPKX 1X8CA 3NPVA 3RX2A 1GZGA 1U5JA 1PSCA 1FWNA 3ZXWA 1DXEA 1T8XA 5C70A 1XG4A 2Y24A 4B90A 2OYMA 1IR2A 1KA9F 3RLGA 2V8ZA 5I3GA 1OABA 4L61A 1XYBA 3TNOA 4DXKA 3MVIA 2BGQA 4F0RA 2HTMA 2VC9A 4A21A 1H7RA 2CESA 3W1PA 2C15A 2AOSA 4UR9A 1OFRA 5BWFA 3LPOA 4IJRA 4OBTA 3KW3A 1KRAC 4GMEA 3WFZA 4R53A 3DG7A 3H4WA 2OZ8A 5HMEA 3E5PA 1I2RA 3FN9A 1VCVA 4MB5A 2GGGA 2FQIA 4GYPC 3PPGA 4B2DA 3C2FA 1H7WA 3DC0A 3IARA 4P7NA 5FEXA 5HJLA 2R1PA 1YNPA 1M7JA 2J75A 3O6YX 1H7OA 1HVQA 2VX7A 5HJYA 2BVDA 5E09A 1RZMA 4PMRA 1FFQA 3F4NA 2V2CA 3EA3A 3W3OA 4OV9A 4WVXA 4JFVA 4CQCA 1GOOA 2HISA 4NL1A 3AI0A 1OX4B 5I02A 2HBXA 3V7PA 5FAGA 3E02A 3Q94A 4M7SA 3RYSA 2Z1WA 4LVAA 4LU0A 1W2PA 3GD6A 3H2FA 3HB9A 2VRJA 3QW3A 3I7RA 3DYOA 1JCMP 2JF7A 3GE7A 3UCDA 2O7SA 5G1MA 1P1XA 4ALDA 1TWDA 1DL3A 1CW2A 3WQEA 1E6ZA 4S3AA 3H21A 2VOTA 2VGIA 1W54A 1FH9A 2WLZA 1N7KA 2VFEA 3REQA 1ZL1A 1US2A 4WDWA 3W28A 1EO5A 4B16A 2I9EA 3ZSTA 4QS6A 2Z7KA 5AHNA 4JNZA 1JL8A 3GS6A 4CU6A 1TB3A 2WM1A 1UWIA 3AMLA 3C0JA 3R89A 3ZO9A 3TQVA 4WKFA 4W7UA 4LNYA 2WKJA 4HSNA 3UQNA 2YA0A 1JFXA 3EX1A 4YTQA 3LI0A 5FSDC 1JZ7A 4RE0A 1W5QA 2VEMA 4FA3A 4UTFA 3GVGA 1ALDA 1V7AA 1X39A 1KLYA 1KW1A 3BW2A 4JICA 4G8TA 2YLLA 6XIMA 2IQDA 3WF0A 2YSWA 1TCDA 2CEQA 3AYVA 3INPA 3RG6A 4Q4PA 5K9CA 3KE0A 2WXDM 3E96A 4O57A 1SZRA 4HPXA 4IPLA 4H6QA 4PB3A 3WH8A 3VKAA 4Q7BA 4C6EA 1I2QA 4M56A 1TE1A 3ELFA 4NI8A 3WK1A 3VC5A 1POJA 3PJUA 3EWUA 1VBHA 4GCXA 4BF9A 3C2VA 5HNNA 1YKWA 3PC0A 2BV9A 2ZXQA 4R34A 4ZL1A 3USZA 1AJZA 1W56A 3KTCA 3C52A 2DJXA 1GVQA 4RJEA 3IK2A 3TYAA 1Q8JA 4WXYA 2GVEA 4DF2A 1W3IA 1RPXA 4I6KA 3NPUA 2PPGA 4RZ4A 1LQ2A 4PODA 2NLYA 1P7TA 3AJ7A 1ZU8A 1OX4A 3SUTA 3QJAA 1UQYA 1DYSA 4DF0A 3LRLA 4C6NA 3IEBA 4AD1A 3I6RA 2WSQA 3M0JA 4KCTA 2VWTA 4HB7A 3ARWA 1EJWC 4LS1A 2BY2A 1EF2A 4O4VA 3E2SA 1QVBA 3M9YA 4FX7A 7ODCA 3PR2A 2WKLA 2W3ZA 2CXGA 1UP0A 4DJFC 3NOEA 2IMRA 3G2GA 4JIRA 3UR5A 1CXFA 4GYPA 2PWGA 1G69A 1DJHA 2ALRA 3GNRA 4O0QA 4CD6A 3M44A 4M6VA 1JIBA 5T9CE 3QGKC 1DQWA 3TN6A 1J12A 1RQBA 1VFUA 5KETA 2Y6ZA 3MANA 1RCQA 3GM8A 2QCEA 1XRSA 4DZHA 1GGOA 1KCZA 2G5WA 2FLIA 4JDBA 5GQBA 2WW5A 1W5PA 4C1KA 4O1BA 2YL6A 4RX0A 1TIMA 4WSKA 5LNWA 3L2MA 4NZ3A 4JPGA 4KRUA 3DKLA 3MV11 3GAKA 5C2CA 2FZMA 2W27A 1AVAA 3PZUA 1K7XA 3H6OA 5D2WA 4UFJA 2EG6A 4CKQA 1ZP4A 4O10A 5D37A 3VE9A 4PMDA 4H8HA 2DT1A 3HOJA 2NSXA 1C92A 1CXKA 1AMKA 1UA7A 1UCWA 3ERPA 1Q5MA 3UW6A 1BTMA 1FWGC 1EIXA 1LYXA 1R3TA 3ZZ1A 1TWWA 1W5MA 2WCAA 3WQVA 1ZNNA 2P1FA 3AIBA 3UZJA 1LOSA 3RX4A 3VABA 2QAFA 2OMAA 3AIWA 2DH2A 3R0UA 4D1JA 1PCKA 1ITUA 2VDHA 4HK5A 1GVOA 2A3BA 3IV3A 3CBWA 3CQJA 2BHUA 3C61A 5AKQA 4HMCA 2XVGA 3RPMA 1E5NA 1MVYA 2OWXA 1JFHA 4P8XA 3S1UA 3SADA 4UQDA 2OZ3A 2IXUA 2O92A 5DANA 3UG3A 3LNMA 4AW7A 3BARA 3QHOA 3P8JA 4IPNB 2A0NA 2TPSA 3G6LA 1V7YA 1AFSA 2OO0A 2HVMA 3WH6A 5I09A 5KTLA 1F8MA 4L4LA 3A5FA 3E0FA 3WMCA 1XH1A 3FLUA 1TYGA 1QI4A 3LMZA 2O56A 1WNOA 2VUYA 3BANA 4QS5A 3ZSSA 1UKOA 4DJFA 1EJTC 3PHAA 2D0FA 3QOMA 1R47A 5E6YA 2YDSA 1XYZA 3TAOA 3KL3A 4LB4A 2HPIA 1TPH1 3W4RA 3PZTA 1WKEA 2NV1A 4HKPA 3MKVA 3S6DA 4LAMA 2OO6A 4JAWA 1W37A 2CXEA 1GWJA 4TR9A 3QV8A 2A6LA 1QT1A 2X1UA 4ZTXA 3P80A 4LBUA 3GTNA 2QR6A 1TPDA 4UQEA 1E0UA 1ESWA 4KEMA 5CG0A 1EP2A 1SJCA 1M7PA 2E68A 1OYAA 3APGA 1HJVA 4LVBA 1KTCA 2HVNA 4JIIX 1TPEA 4LNCA 4NJKA 3MP3A 1U1UA 2FJKA 3EOSA 1B30A 1FHVA 5DN1A 3PK7A 3I65A 2BGSA 4DWSD 3EDKA 3NQ6A 2Q3OA 1P0KA 1J0KA 3UZ5A 3LTPA 2J62A 3QC0A 3MSYA 3QY8A 1PKYA 5DXXA 1M53A 5CJ5A 1QPRA 3DN5A 3WEMA 1H60A 4PUNA 1XLKA 3P93A 5BNKA 1JDFA 5T91A 6REQA 5FJUA 5EL1A 4C90A 1AW2A 3UXKA 1E6RA 1MO0A 1QCWA 4DZAA 4YNGA 4YYFA 3N15A 2R94A 1EJRC 4GCAA 2BB0A 2XN0A 1KFEA 1R2RA 4XG1A 3GWQA 3ZJ7A 3SRFA 3IVTA 2KAUC 4M5PA 3IGSA 4JR5A 4LANA 3WIJA 5HPCA 4R27A 4E8DA 1S5TA 1DJXA 3U0HA 4FALA 1FP9A 4HQVA 3MC5A 2WQDA 3VOCA 2FVLA 4GFIA 4I5UA 4CEUC 1TR1A 4MSSA 3HG5A 3ZR5A 5AHLA 3WD1A 4X0NA 3LERA 5DMLA 4MZYA 1JCNA 1CB7B 2PWUA 4NQ1A 3CWHA 4UOQA 4C6KA 2DSZA 2DSKA 1KBIA 1WZMA 4JX5A 4H1ZA 2ZUNA 4DX3A 2F6KA 1CI1A 1U5VA 3F1QA 5EFFA 5G2WA 3V0TA 3WUGA 2WNWA 4DNMA 3E9AA 1QBAA 3WBEA 2INFA 4AWSA 4UZUA 1F3EA 4IPIA 4RZ6A 4MDOA 1N82A 3UWEA 1J18A 3W38A 4QQ3A 1M7OA 2XIJA 1ZFJA 1XPGA 3V36A 2D2GA 3S1VA 4IICA 3QPYA 4A3QA 5D9MA 5DXYA 3G8EA 4IUGA 1A5CA 1P5BA 3VFCA 2XWDA 3QQ1A 1LG1A 5FA5A 4TVUA 1DIEA 3IAQA 3N34A 4GUIA 2CLOA 5LXEA 2CHRA 4JQ4A 7ENLA 3EPOA 1TA3B 1WAUA 3F4DA 3GVQA 3VGBA 4HGXA 1XFBA 2VCBA 2PURA 1UC5A 3GVWA 4LBSA 3GXPA 2RFGA 3N25A 3CHDA 3LX9A 2C1GA 1KM2A 2YXXA 3OP2A 3AO0A 3O7UA 4IL2A 4ZXOA 3RIKA 4H7ZA 4QITA 1XSIA 4S3FA 1EJUC 1DQUA 1M04A 4ADSA 2X0YA 3MQTA 3V5FA 3BWWA 4H3DA 3DGRA 4MNJA 1PCWA 1B4KA 2QIWA 1Q65A 4HBKA 2V2HA 4LV9A 2PP1A 2I7GA 2XISA 3W24A 1ZJIA 3QR3A 5A2CA 1KM3A 3BAWA 1K9TA 3WD2A 4DIAA 4IHCA 5E0KA 1X96A 3KVKA 2Z1SA 2UY2A 3HGOA 3CZGA 2RJHA 2PSNA 4FXSA 1ZGDA 1NP0A 1FCBA 3KWXA 3CO4A 3DFTA 4G7FA 1IEVA 2XIIA 4G56A 2YYTA 3RF9A 5D9OA 1GW1A 3W86A 1A80A 2YW4A 5C7VA 4J7RA 3DKJA 3M64A 2YB1A 2WANA 2OEMA 2GWGA 1YPFA 3DXIA 5BXPA 3ICJA 4DI8A 5I3JA 2ZTKA 3G1YA 1JF5A 3JUGA 3R12A 4MB1A 4O0KA 1SZEA 1SW3A 3B9EA 3JZEA 2VENA 3RMJA 4IIDA 3FX4A 3UZZA 1CPUA 3OG3A 4IG2A 1DWAM 3UJEA 1WKFA 3KCLA 4LUSA 4Y8EA 3GXNA 4N9EA 2Z2BA 5BU6A 5L6UA 3TSBA 2CLPA 1IQ8A 2F61A 3W1UA 1W32A 4DBUA 1SJAA 4F0MA 4J2MA 3HBLA 4JCMA 1QFEA 2QJMA 2VZUA 4HYRA 3IGXA 1GUVA 3VZYA 2ACUA 1CYGA 2DDXA 3WG6A 2EO7A 3L23A 4FXFA 1PE1A 1NDWA 2ABAA 3WLNA 1IEXA 1ZCCA 4G1KA 3ABZA 4KWVA 4TUFA 3SFWA 4OU1A 2FH8A 1A50A 1GHRA 3G24A 1PX8A 2PGRA 4C1NB 5E1QA 1A4MA 4HN8A 2V3FA 1Q6RA 4RE4A 4W8AA 3FJLA 3R0DA 2H6RA 4HNTA 1J5TA 5K2ZA 3G1RA 3QMSA 1YTEA 1SFJA 4ZE4A 5CPLA 2LLEA 3S4TA 4Q8VA 3WQWA 3N18A 1UUOA 2H8ZA 2WM0A 2A3CA 1BG4A 4GIEA 1E6NA 1E6SM 1H7XA 3KBJA 1MRAA 1ZCOA 2XGZA 1S1RA 4Y9NA 1FBAA 1Z9AA 5A6BA 2V5CA 3BV7A 1OCJA 3M7WA 1QW7A 2ZXDA 3S2LA 3FHAA 2QMKA 1JZ6A 1HT6A 4WZHA 4MF4A 5A5WA 4TV5A 2DT3A 3CT2A 4HPGA 1V3KA 3SJNA 4YTSA 4U2ZA 2ZWYA 2VURA 2ZC8A 1KGUA 1C8YA 4PE8A 4JX4A 4F0KA 4LC8A 2IPWA 3NQGA 3S5ZA 3GDTA 4TX9A 3N73A 2L5HA 1EDGA 1FCVA 2YBVA 2AQVA 3B06A 2XH7A 1RQHA 4DWDA 4ZQOA 2WVUA 1NFBA 3DHFA 4YLWA 3UXDA 4NASA 3F4CA 1GTHA 2P8BA 4PUEA 3VKJA 4MY1A 1VEOA 4YVPA 1K70A 4UTWA 3P14A 3RM9A 2WZMA 4BEQA 3QY6A 2I57A 4J3TA 3HQNA 2Y5EA 3VUPA 3T05A 1OD0A 4FLRA 3A12A 1XXXA 2VGFA 1EJXC 4GX9A 4I6VA 1SZFA 2G4FA 3B8SA 1G7VA 1QOXA 5FJOA 4L6DA 1QNRA 4DBDA 1IZKA 4WJ8A 2OWCA 1HIZA 3WFLA 3R43A 5C0QA 4WCJA 1ELSA 2B7NA 2DFAA 1UW9A 2PU1A 4AHOA 4HJFA 1MUCA 2WHLA 4HTBA 5AZ1A 3UXAA 4BI5A 4WJEA 2GWNA 1Y65A 4Q22A 5H91A 1TVLA 3S1WA 4QE1A 4D72A 1XPYA 3W37A 1AH3A 1P1MA 5K4ZA 4GLEA 2AAMA 1GQKA 1JYNA 2CZFA 1PTDA 3LBOA 2SFPA 3WD4A 4C7GA 3UU0A 2AL2B 2PS2A 4F2TA 3QHNA 3K8KA 1JPIA 3F5LA 2WMIA 1KM0A 3TOYA 4ORIA 1T0OA 1WDRA 1JQXA 3IJ9A 5D2XA 3TW9A 2H3BA 8A3HA 4PMVA 4KIEA 3W1MA 3GVVA 1YXCA 3MI2A 1L6GA 2ISWA 4Z1DA 2VHLA 2E1WA 1YBQA 2JALA 1A5MC 3W2NA 2QHAA 1UR1A 1MNZA 2HXTA 1EPVA 1J11A 3T0AA 3U5YA 1E4NA 4MB4A 2P53A 1LP6A 2YZRA 3BLPX 4HYVA 4PTWA 4U33A 1B3YA 1UKSA 4C6IA 1WDSA 3OPSA 3QZEA 4QTGA 2ZOXA 4Z0JA 1V93A 3PTMA 3TOPA 3LV5A 1JGIA 4KWWA 4AH7A 4H7VA 3VD5A 2QT3A 5TNVA 4JEQA 1Y7VA 2JGYA 1LRQA 3RJYA 1XG3A 4XBKA 3GC2A 3NCOA 1BVZA 4CN6A 1A49A 3UJ2A 5I06A 3A21A 3HM7A 2E67A 1H2JA 3B8WA 1KBKA 2F2HA 2J7CA 2VL4A 2XM1A 4IQDA 3R79A 5HWJA 2YJQA 4PR4A 1LQAA 4AZIA 4LVFA 4LUIA 2P5NA 1UZ4A 4K1GA 3BMWA 4W5ZA 3VX0A 1PS9A 4GIAA 5CZTA 5F2IA 6PTDA 2VQTA 1LJYA 3VGHA 1D3HA 1H0IA 2JIEA 2NVDA 4FX6M 3PWGA 4R5EA 2WWCA 4ZO9A 1XIHA 3IJ7A 3UJSA 1MXDA 5E70A 3MO7A 4IZGA 2G3FA 1PB0A 5DBTA 3VNIA 1IXOA 2Z2AA 3O8AA 3ZWSA 3FIGA 4BEUA 3LB0A 1SJDA 2AKMA 2PDKA 2BY3A 3RK8A 3ZR4A 2WLYA 3NDZA 1NIUA 4PA8A 1GTEA 4W7VA 5I07A 2CKRA 3T0DA 4D1IA 4WKHA 1SSDA 4J2PA 1HFBA 5A6LA 1WB0A 3ZVIA 4EPDC 3I3EA 2OVLA 3IIVA 3U7VA 3VKCA 3CZLA 1TSIA 2A3LA 1E51A 3EMCA 4ROQA 4AF0B 5CPTA 1ZTVA 4CCCA 3M6YA 3ABRA 1UD6A 2QJHA 1E72M 4UR7A 4QQUA 5G4HC 3GUGA 3P67A 3JZUA 4MYXA 3HO8A 2JFEX 3N29A 4F3HA 4BQ2A 4UTTC 3UA4A 3GIQA 4URIA 3UESA 6REQB 3RMEA 3LNPA 4NYUA 4RDZA 1VPYA 8RUCA 8XIMA 3CQIA 4P7OA 2BX7A 3HQOA 5AVHA 4H04A 2H90A 3VINA 4DBWA 2VEIA 1BEUA 1UPPA 2PRMA 3GW0A 4GI4A 1M5WA 1QRQA 1HL2A 2WMFA 3KLLA 4KERA 3W88A 1QMLA 3VIOA 1VF8A 4R7OA 3TU9A 5D8WA 3L4TA 2W67A 1ISVA 4GZ7A 3LHWA 4US5A 1FVPA 3SN1A 3GDKA 1ITQA 3W26A 2RDXA 1EGZA 3MWAA 4KESA 7PTDA 5E9XA 1JCTA 3O0FA 1M6JA 5CH9A 2CLLA 4UQCA 3EEZA 3TW6A 1XX1A 1IR1A 2V2DA 3A5VA 1TJ2A 2NUWA 3AHYA 3VAVA 1XLLA 3ZM8A 3VVGA 4FR1A 2F2KA 3ITOA 4TU1A 3LGEA 2JE8A 4J40A 1RXOB 1UC4A 3EWWA 2PODA 4L1WA 3W81A 4LJ3A 1XW8A 4IX2A 2ZZ3A 1CENA 1US0A 2A6NA 1WKDA 2RDWA 2CETA 4HHMA 5BRQA 3UF9A 1HL8A 3G3MA 1S2CA 3PFMA 1S3HA 2GSJA 3AFBA 3E0WA 3PP7A 5LIKX 3Q65A 3KCJA 1I9CB 3R58A 2P3EA 1O1ZA 4JTJA 2Y89A 3VXGA 2CU0A 3UJFA 3MUXA 2A5HA 3SY1A 3GG0A 1OCBA 3OBKA 2ZA3A 2OPJA 2YDQA 5CLWA 2A2IA 4W88A 3ECQA 3NQDA 4WQ6A 3D46A 4PULA 4Z0SA 5D32A 4FO4A 3Q37A 4OBRA 1J0YA 4DLMA 3BV4A 4ZB0A 4UTMA 1G4SA 3AXMA 3ANYA 1R5YA 2AMXA 1B0IA 4CNTA 3W1TA 3BGGA 3BLFA 1Q4WA 4GIYA 3GG1A 1T5AA 1W2VA 1XIEA 2ZCGA 1UD2A 3NUKA 4AUBA 3N2XA 2REQA 4NJJA 4XIAA 5BW6A 3WLLA 5CZSA 2FZ8A 4R3UA 3PBUA 1JDDA 5D8ZA 4PTNA 2QMJA 1ZZMA 3WNMA 5BWAA 3ARVA 3DH7A 2XPKA 4M24A 4DRSA 4PSRA 2ZVRA 2G0WA 4NXKA 4ZOEA 3IACA 1T7LA 4YWSA 4IQEA 4Q8OA 3KAOA 1XYLA 5CGTA 2EPHA 1QAPA 1YBQB 1W5NA 1XIBA 1TWZA 2XU2A 1JZ2A 2XZ9A 5HOSA 5E0CA 3H4GA 1QPQA 3LLXA 4JYFA 2V5KA 4XZWA 4JKMA 3LCGA 2NWRA 3DECA 3V0SA 2JKPA 3CHEA 3BE7A 3TYDA 4PFMA 2C16A 3NQ8A 1ZP3A 3KL5A 5IDIA 2PA6A 1GQIA 3SFKA 3MUAA 3BTNA 4AEEA 5F4XA 3OYXA 2NX3A 5BOOA 1FWHC 4TMCA 3E0LA 4AVNA 3U2ZA 3NAVA 3UR7A 3TDFA 1TWSA 1JZ8A 5TD4A 1MW2A 3VNZA 4KFPA 1I4NA 3O1NA 2INZA 2WK2A 2XZ7A 1XCFA 3R4IA 1A5KC 1VFMA 5GNXA 1XLFA 2R1NA 4DB7A 3MHFA 1JCYA 1CLXA 1QJWA 3CHCA 3EB2A 1AH4A 3ARQA 4HD5A 3VOJA 2ZRZA 2TAAA 2ABBA 2GUYA 1P4CA 1OX5A 2A3EA 2A21A 4D2JA 2OXNA 4UQBA 1TPUA 1TJ0A 6ALDA 1V5XA 4YHEA 1FWJC 4BHYA 1GG1A 2ZUUA 1FWBC 2AGTA 4DJEC 3G18A 4UOZA 1E15A 4V15A 4FNRA 4XKYB 1YRRA 2ZQ0A 3T4WA 2A4AA 2FGBA 3CUXA 4RNIA 1P6CA 1V0NA 3FJ4A 1GQJA 5F4WA 2GQ9A 5D2YA 4ORMA 4AZCB 1FP8A 1V6VA 3UWYA 2E5BA 5FF4A 3HQ1A 3FY1A 1NDVA 4PMUA 3AIQA 1FDJA 1XLDA 2PB1A 4MPKA 4X63A 4XWUA 3VMNA 3A13A 2MANA 2DU2A 5BOFA 1W3LA 3TSMA 4PUUA 3HIJA 5KSWA 2PEVA 3VILA 4OKDA 4U2YA 1OC7A 3II1A 1PKNA 3W7KA 4FS9A 5ABTA 3WLPA 1GONA 2WSRA 3N19B 4HT3A 1TA3A 4LAKA 4DAIA 1DWGM 3ZFHA 2D2HA 3EX6A 2QUMA 1M7XA 1UR9A 3OA3A 4OGZA 3TMQA 3TCSA 3GBEA 3NDYA 2PCQA 2QGYA 1R85A 1V0MA 4MIMA 2QCDB 1P0DA 2VFFA 3SCVA 4PC8A 3HQPA 2Z1XA 1JZ4A 3HV8A 3QKZA 1A3WA 3H53A 3EKLA 5AC4A 1YDNA 4HCHA 3KM8A 2PLCA 3QH2A 4L56A 1DJQA 5DRCA 1GJWA 1KGWA 3FYPA 3SO7A 4MFDA 1WCGA 2V0TA 4IWWA 4JTTA 1OB0A 3MWCA 3BPWA 3T0CA 3KHJA 3V1PA 3GNNA 2WCSA 3PBYA 3TLQA 1CBGA 5J5DA 1ONEA 3B8VA 4PMQA 3MV01 5BOEA 3BH4A 4H4IA 2QF8A 2BFGA 2WBGA 4UNLA 5CC6A 3TXZA 3SUVA 1PX4A 4HPJA 3TQKA 3VO0A 2YCLA 4IJBA 3W1RA 1X98A 1C93A 2XH4A 5D05A 2PDJA 1ZS2A 3T09A 2GGHA 5A6SA 4PTXA 1UR2A 1D3GA 7A3HA 1R46A 1YADA 2IKIA 3WUEA 5IOBA 5A8PA 2GDVA 2HPMA 1H61A 2ATSA 1CECA 3EXRA 3K1GA 4R88A 3P6LA 4M1BA 1D3CA 2Y70A 5BRPA 3TYBA 3ISIX 2C6QA 2BP1A 5FAJA 2C14A 3PBGA 5DX7A 3PM6A 1R3SA 4XZNX 2OFJA 4S2BA 3IVSA 3DESA 3AYRA 1AZ2A 4ZOCA 1ZPTA 4QG6A 3PFRA 4NXSA 3IANA 3NQBA 1QATA 1HQTA 2PE4A 4I9AA 3IV8A 3HA1A 5C8BB 4A35A 4YVVA 4W85A 1AQFA 3MJYA 4GYFA 2NV2A 5A2AA 2X0HA 1JAKA 3W85A 4ADUA 2GJXA 1TO3A 4IMEA 3L2LA 4GZJA 3Q67A 3RO8A 1HKVA 2PF0A 1D8WA 2YFNA 3ARXA 3TW7A 1Q6EA 5KZDA 2DZBA 1FA2A 1DWIM 1F2JA 4ICCX 3EWBX 3VK5A 3UG5A 4ZODA 4MKNA 3IIPA 2FFIA 2VVSA 3HG4A 3GFXA 4MWAB 4HPHA 2WVVA 3B0YA 1RK6A 3IJ8A 1O12A 4QROA 4QRNA 1BQGA 1EWDA 3KDNA 4AY8A 3H22A 4UXDA 3MKCA 3LHTA 4QG8A 1C7TA 1G4TA 1SR9A 4Q4QA 2CW6A 2FVKA 1EDQA 5FJJA 1Z89A 1EQCA 4CCDA 2VR5A 4W5UA 1LTDA 1BYBA 5FJRA 1FQ0A 1KFKA 4REQB 4A05A 4I7WA 1ZBVA 1SPQA 1WXJA 1ONXA 2IKGA 3WDRA 3WF2A 1CDGA 3V35A 4U31A 4HHPA 3LHUA 2W9MA 3BCJA 3L0KA 1DJYA 1AW1A 2D3LA 1F7BA 2JBMA 1PDYA 2ZZ4A 5MHBA 1XIMA 2YR1A 4Q3MA 3QTPA 2Y2WA 3OBAA 3BMVA 5LGZA 3E2QA 1DOSA 1LWHA 4W8LA 1CLKA 1GHSA 3SCRA 4E2OA 4L9XA 3CV2A 3NO3A 3VI2A 1R7OA 1A0DA 1QO2A 4UBPC 3TE9A 1WO2A 3N12A 3G3DA 4U5IA 1UJQA 2XIQA 5EA9A 5FOOA 3W7CA 3JU2A 4C60A 4V28A 1S46A 1E0WA 3N13A 1DPMA 4B5NA 3DFHA 3CUJA 1LG2A 3TZNA 2WSKA 2XM2A 1XGDA 1IXNA 1OFEA 3MHGA 2PTXA 1B90A 3FVDA 3MYOA 2OOFA 3QGAC 4Y6GA 2Z0IA 3RLHA 4EPEC 4HJWA 1FWAC 3LLDA 5CC3A 1TUXA 4B2DD 5C9ZA 2Y61A 3W72A 4UMAA 3PSWA 1UPMB 1P0BA 1OF6A 4O4WA 2BTMA 2ZUMA 4GBUA 2V69A 1I45A 3LXBA 1BRLA 1KRCC 3BLDA 3T78A 3USBA 3OIXA 5EMYA 3EOLA 3I7SA 2GJLA 5FIPA 4Q6XA 3WDQA 4NAEB 3W7RA 4EANA 3QQ0A 1W1PA 1L2QA 4E2VA 3HGJA 3KRSA 3QQWA 4BCEA 4GNVA 5CPNA 2VZVA 1LCOA 4GYJA 1YPIA 2UY3A 3AHTA 4I7UA 4AU0A 5M3WA 1XIGA 4RZBA 1O66A 1KCKA 3MZNA 3F2BA 3VIKA 2ISVA 1W3KA 4PRWA 3BUVA 4BWLA 1C3FA 3SRHA 4GI8A 1RD6A 1BLIA 5BMXA 4MMWA 5HULA 4NP7A 2J9YA 2Y62A 2J78A 5AYIA 4H00A 2NVAA 1QPKA 3TN4A 1H7NA 4ZE5A 4TOQA 3CZEA 1WPCA 3NJ3A 4D6CA 2I17A 3A24A 3H8AA 3C2EA 5CBIA 3E6EA 1TPC1 1SMDA 4FNQA 1SUXA 2EHHA 4JTQA 1ISZA 1OT1A 3FJNA 5DMYA 3ATYA 3WBXA 1XLMA 3ARTA 2WC4A 3OLIA 4AMAA 5C55A 1EYEA 3T07A 3CQKA 1VRXA 5D2TA 4A8NA 1X38A 1I0DA 2PP0A 3ARYA 4GHRA 1BWLA 2QV5A 3K46A 4OWGA 4OUIA 3WF1A 3RJXA 1NSJA 1RP8A 1JNEA 5FF3A 2Z2UA 3GBDA 1PIFA 1XJBA 3SGGA 3UZWA 1MEWA 2FHBA 4NAFA 5RUBA 2PLJA 5A1AA 4LC6A 1LM1A 1TX0A 3B8IA 1OC6A 5TAOA 4DELA 2RDTA 3GUWA 4FP1A 1G5AA 2P0OA 1KM1A 3A4WA 4C6BA 3P81A 1WE5A 3FA3A 1ME9A 1U5HA 3CL7A 4J3UA 3TYUA 5D30A 2ZYFA 1UUQA 4X22A 1JCXA 2H8XA 2ZRYA 3OW1A 4O8RA 4JTFA 3NL3A 2D2JA 3KP1A 1V02A 2GGJA 3SY5A 5LKYA 2E77A 1Z41A 5TQLA 2HCVA 3NWRA 1AG1O 3AICA 2FIQA 5C54A 1GW9A 4FSAA 2F8QA 1V0KA 4KMQA 1FWWA 4K7YA 4TVCA 3WD3A 1K7FA 1HGYA 5I5RA 3QM3A 1A5UA 2J74A 5D38A 4HIBA 4JNYA 3HPXA 5DQPA 3CMJA 4S38A 2XIBA 3T2QA 3O6DA 5D9PA 1QXLA 4WR3A 4BQ5A 4MY8A 3SSJA 2CYGA 3R8GA 1TVNA 2X7VA 2Y63A 3W00A 2WPBA 3GG7A 2W4XA 2OCZA 2JQXA 1E56A 3B97A 4WHBA 2CERA 1QR7A 4YL2A 1UWUA 1V6WA 3QPZA 1R3WA 3S9YA 3GAYA 2DZWA 3LHYA 5G4WA 4O17A 3V4BA 3LSCA 5KEZA 1QI2A 3M5VA 1GEHA 5KZ6A 3C2YA 3G1DA 1DQXA 3GDLA 4G5DA 5I3FA 3URNA 1NF7A 3BLOA 4Q4OA 1H1YA 4FNTA 3THCA 5LZLA 3C8FA 2GUBA 1V3JA 3CWNA 1IIHA 4IPJA 3SAZA 3ARRA 1NY1A 1EC9A 4Y9AA 3FA4A 2JEPA 1XWYA 2OYLA 4C5ZA 3VOGA 2ZA1A 3GRIA 1XIJA 1TV8A 1K7EA 3LHVA 4AVOA 3MTWA 5F2LA 1ADOA 3G1AA 1Z6KA 1UWAA 1U22A 3CNYA 3I7QA 4HHHA 3G1SA 1J6PA 1X8FA 1ICQA 3IGUA 1EA9C 3CS2A 3F7JA 2UZ9A 1MFUA 1NF0A 1WBJA 5K9XA 4EXBA 3MCOA 4NI3A 3G8RA 3RILA 2XJ7A 5C9WA 2J13A 3VYLA 4GA8A 4BF5A 1G1YA 1R30A 1Z44A 5J5RA 3HTWA 5IRPA 5C9UA 4PCTA 3ZWTA 2TMDA 3LTSA 2Z29A 4MHBA 2WNNA 3SUSA 3VIJA 1VZWA 4HU4A 4PL1A 3GC5A 3GC4A 2YCIX 3NGFA 3VZZA 4PGLA 4LAOA 1V3MA 3NQEA 3PBVA 3UA3A 1MEHA 1RR2A 3RRAA 3A22A 2X16A 1THFD 1KO0A 5HINA 1AQHA 4BWLC 2DSVA 3KUMA 1FHUA 2YCKX 3C2RA 4QISA 2DEPA 4S2CA 2PGEA 3VIMA 3BCDA 4P7LA 4WRHA 2QCLA 1ML1A 3GY1A 4H19A 4QGCA 3TTSA 4EF8A 3LG3A 3LOTA 3AXIA 4G1NA 1GPWA 3RAOA 1NARA 3ZT6A 4ROPA 3HU7A 2OSXA 1XI3A 3QR0A 3WH5A 1HKIA 3UWUA 4ZGYA 1UH4A 4C6CA 1N55A 4LWWA 5I6SA 1JYVA 2YIHA 3OU8A 1SO3A 3WNPA 3ALFA 6A3HA 3E0IA 3WQPA 4EAYA 1F76A 1XR2A 4L1XA 4DAFA 4F4RA 1O7AA 1M01A 4DQWA 1R9ZA 4ZTYA 3RXZA 3U57A 3PUGA 4CN4A 2FJUB 1AQMA 1ICPA 2PTYA 1VEMA 2DIKA 4Z1YA 3UY7A 1CIUA 2PWFA 4FOUA 4C6OA 4W86A 2C1HA 3E74A 1EFZA 4OQVA 2QVHA 1W3JA 2B81A 5BYWA 2BOFX 4LAUA 3O15A 2OR2A 1MW3A 1FKXA 4L4PA 1B9BA 3DC8A 1KM4A 2WHJA 4GISA 3NQVA 1OCQA 1YX1A 6CGTA 1EP1A 1KM5A 5AHMA 1TV2A 5M1TA 3OG2A 2FZ9A 2VCCA 3TFXA 4W8BA 4ES4A 2NVCA 4LCQA 1PV8A 3RCMA 1TJRA 1NQ6A 3WX7A 4JHZA 4JTCA 1VHCA 3LUTA 1XP3A 4W89A 5D02A 2V5JA 3ZLGA 3B4UA 1LRNA 4H9VA 3DEQA 1MYRA 1FOBA 1WXZA 2Y88A 3K5XA 2QAPA 3P84A 1LQ0A 2Y7GA 3SIZA 4YWIA 2JK2A 3OTRA 5MF5A 4PFHA 1KBLA 1RP9A 1RQEA 3VNLA 3A4XA 2OTDA 4P8UA 4Q8PA 3B9AA 4V33A 2AQOA 1C90A 3KOWA 4LYRA 4QDWA 3VGGA 4OUEA 4MG4A 3MA8A 3M5YA 4NSBA 2FPTA 3ZS4A 5B7ZA 4MNKA 3NQ2A 5DCDA 1GVRA 4UTLA 1EL3A 1DTUA 1MRQA 3F5KA 5HPOA 4H9YA 5E93A 2V6AA 3N3TA 3M0YA 4ZB5A 2BGNE 3VZXA 2QPUA 3KL0A 3R25A 1WOBA 3EDDA 1VB9A 3CTTA 3CLMA 2VFIA 2OQYA 2CZEA 2REQB 3KZSA 1TQJA 4IIFA 3S6TA 2QDEA 4JN7A 2BOGX 2E40A 1XYCA 1NFGA 2W6RA 2ZXAA 1UUMA 4XZ9A 4L80A 1L6SA 3CV1A 5LIYX 1RSCA 4N9CA 3L5MA 3TA9A 5HNRA 2EPMX 1VEPA 4FR6A 3BG3A 5D9NA 4JN6A 3V5CA 3W7IA 3LGDA 3IGHX 4IF2A 1Q2RA 2R1LA 1PIIA 1VCFA 2PCEA 4E6MA 4CCEA 3NVDA 3OEXA 3TTYA 3EXTA 4IXXA 1TG7A 3AMGA 4GO9A 2J7FA 3N2MA 1EOMA 4ACZA 4ATWA 4QDMA 3T8LA 3TQPA 2DORA 5B80A 4M8UA 1E43A 4JIHA 4NIRA 1E55A 2HNEA 2H3DA 5JXQA 4AX6A 1G4PA 5A6KA 5L9FA 3ITLA 5CKSA 2YYUA 3L5LA 5CGQA 4HYWA 1E73M 3HJZA 3LPFA 1W8SA 3L9CA 5E5CA 4M29A 2VX5A 2E1DA 5AC6A 3R2GA 1KCLA 2OG9A 1R2SA 5C7HA 3WLMA 1DORA 1OFPA 1OT2A 2R1KA 4S3KA 2DQXA 3GHUA 1JUBA 1JGMA 2WMJA 2CZDA 3GO2A 3OGRA 3PJTA 3C86A 4WK9A 1PBGA 4D8AA 1KD0A 4Q6JA 1A5OC 3EDFA 1S2VA 2DZUA 4K8GA 2WKGA 4IUOA 2VNCA 2ZICA 1WZLA 3STEA 4A3YA 2B31A 1JD7A 1E9LA 2V63A 4MB3A 4EP8C 1DIOA 2QUNA 3IJLA 3CIWA 4XTIA 4H9TA 4Q8WA 2PGFA 4UNIA 2NQJA 2X1TA 2EG8A 1H51A 3QW4B 3NSMA 1EEPA 4YYCA 3CL6A 3LXAA 3P0WA 1B54A 3LZ5A 3WF4A 1LROA 4PYSA 3W07A 4KWUA 2B0MA 3A4JA 1AJ0A 3SECA 4H83A 3FCPA 1SGJA 4XZLX 4I8YA 1XC6A 4ZSTA 2A7RA 2TYSA 2QLYA 4HU8A 3GK0A 1W3HA 1I60A 3EWCA 4GO8A 3LCFA 4GH3A 1LT7A 3WMLA 4UFMA 3FK4A 4IH3A 4PB5A 2NQ5A 2CBUA 2UV8G 2RAGA 1WZAA 3H2AA 3N17A 2OQLA 4X2PA 2D24A 1BYCA 1O1HA 2C18A 3CMGA 3IWPA 3SI9A 4B3ZA 1IZCA 3F03K 3XINA 2EJAA 1IEWA 4GJJA 1MMFA 4FOJA 1G94A 4YIWA 2DUAA 3ITGA 4PUKA 3W23A 2VR2A 3RM4A 2YKKA 3E3HA 2WNQA 2E6DA 1WX0A 3KVJA 3M0KA 4Y9PA 4P61A 2OSYA 3L66A 1F73A 2YX0A 4JBRA 1XYAA 3Q58A 2HMCA 1IEIA 1QO5A 5BXTA 4JFUA 4C6JA 2FFCA 2O7QA 1Y8BA 4CQ9A 3AUOA 1CT5A 3WLHA 3KCOA 2VD9A 5JH1A 3CXOA 3LI1A 4AIEA 2P10A 1RJQA 3VDBA 2G95A 2GJRA 1E70M 3AJXA 4Q8NA 4DUWA 1K03A 2NXGA 1Q6CA 1YW1A 4J3SA 3QYQA 1XIFA 2PDBA 1UP2A 5HWMA 3RN6A 3PBWA 3ZT5A 2VTFA 2ZRXA 3ZJ6A 5SWUA 3PY2A 1X6NA 4I9JA 5LA2A 4ATLA 2WMHA 4QSFA 3S5SA 4IM4A 4MWAD 4U10A 4MAZA 3ZIZA 3VGDA 2C8NA 4PMXA 4HHLA 1FWTA 4QJ4B 2CPUA 3OZOA 3NO5A 4QBXA 1WDPA 1JF6A 4GABA 3HG2A 5REQA 3C4UA 1V51A 2D22A 4IOTA 1UWSA 4ERGA 1EJSC 2VT0A 2C13A 3W53A 1E71M 4NAFB 3IJ6A 2PWVA 5ECVA 1A5NC 3GKFA 4AX7A 3WLTA 3GSMA 3RDKA 1K8XA 4NRRA 1TV5A 4NZJA 1E4LA 5D2VA 2QNEA 1S2WA 2GVGA 4DVOA 4GG9A 1FXQA 3POHA 3ZR6A 2I9UA 4J3VA 1MEIA 4QM1A 3UZYA 3S2NA 4A3HA 3AHXA 1W1TA 4X3ZA 2QCMA 3SCOA 2RH9A 1KV8A 3FYYA 4XO6A 3CHFA 3L21A 1TCMA 4XAGA 3UWZA 1W1B1 3HPFA 3CJPA 3RX3A 1RJRA 2O9OA 2VXNA 4RCXA 3M16A 4TX8A 3PBMA 4K3ZA 4GJIA 4YTRA 3WH9A 1VBJA 1IEQA 1GYMA 3L7RA 4DJEA 1PZ0A 2WCGA 3P8IA 4XKYA 2WMGA 2O9TA 1XFCA 3GDRA 3R8HA 7TIMA 3QMTA 4B4HA 3D47A 2F9RA 2Q8ZA 1S5NA 4D6HA 4AD4A 1BYDA 4GVHA 1YYAA 2BSLA 5FESA 1R3VA 3W7DA 4DO6A 2PC8A 2E09A 4UCGA 3T55A 1VCGA 3PJWA 4K36A 3BC9A 2QJIA 1TZ7A 4WY0B 3WQCA 1FDZA 4GRSA 4WSHA 3CZJA 5C9RA 2DIJA 2HZGA 4N9BA 2OJPA 3EKZA 5FEWA 3LCWA 3QHMA 2VRKA 3NL6A 3CEPA 5FF2A 1QI3A 4V2XA 4CLMA 3NNTA 2ANUA 3W87A 5AYXA 4H9XA 3UG8A 2XVPA 2XH0A 4ZOBA 3WBYA 1M03A 1P6WA 4AZ5A 3CUGA 1KFJA 3OVRA 3O07A 3KVLA 4FXRA 2IKJA 3H26A 3WLKX 3LTYA 2FZNA 3W2JA 1N2VA 1L6YA 2PDYA 2GGIA 1EC8A 4BI7A 1VHNA 1ZB5A 4N42A 2PFHA 5DT7A 3IJIA 3S47A 3GNOA 3NZPA 1R3YA 3GH4A 4MKSA 4CVWA 3GB6A 3TZFA 3SCQA 1NTHA 2QPSA 4DJDD 4L9YA 3SCWA 1F5ZA 2FGLA 4O11A 1LRTA 1XRVA 2D20A 1EX1A 4WOQA 3FS2A 3H12A 1DWHM 3VOFA 1OC5A 5CBBA 5U7SA 1CZ1A 1HP5A 3T42A 5I00A 1BTCA 1JPMA 4JIEA 1QNOA 3VDHA 3EOOA 5DEZA 1NVMA 3AISA 1ISYA 1E0TA 3B8TA 4AXNA 3GTFA 4IFKB 2VELA 2J8FA 2GQ3A 3ATZA 1S2TA 3ES8A 1BXNA 2Y7EA 4F66A 4A3UA 4MWAE 5I3DA 2DP3A 4BZYA 2OT0A 3MO4A 3FV9A 4UFHA 1J0JA 1XKJA 1KV5A 4PMYA 4BK9A 5A8NA 2BVTA 4TX6A 1I1WA 3ZQ9A 3GR4A 4AIUA 2PI6A 3CUIA 3NZGA 4KFNA 1TV3A 2EQDA 4MJ2A 5IHSA 4PMZA 3B0UX 3N14A 4O28A 4QXIA 2IQTA 4D8ZA 3MY9A 3ABXA 3NA8A 3LXCA 3QLDA 1W9BM 5EMMA 3N6HA 1HG3A 4LW7A 3VX1A 4MJZA 3M6DA 5I03A 1TV7A 4B5WA 3ZYZA 3UCCA 4HNNA 4FEZA 2ZZ1A 3PNUA 3WNLA 3L4WA 1LDCA 4KS0A 4R33A 3TQ0A 1TMQA 1XHGA 4K6AA 4PCFA 1EEXA 4WY0F 1V8EA 4J4KA 1W9DM 3GFZA 4QCFA 1K9FA 2D2OA 4DJDA 1K9EA 1EDTA 4C6PA 4DO7A 2NX1A 2QEZA 3SQSA 1UD4A 3AC0A 1QI0A 3F2DA 2DPEA 2PTWA 4HMEA 2J66A 4GQGA 1KQZA 3G1VA 4JQAA 3RU6A 3LZ3A 4HOZA 2HNHA 4HZ8A 2VMFA 1H5YA 3ARSA 3VE7A 1EJVC 4AC1X 1JDAA 4PBEA 3TUUA 4NZ1A 1WBHA 1XLJA 4AD3A 3KRZA 3GXTA 1VC4A 1M3UA 1GQLA 1MDRA 3BJFA 2RGMA 4I3GA 3TONA 4CU8A 2C91A 2J7EA 1PWLA 4DEFA 1RA5A 4REQA 5AYZA 2E9LA 4HPNA 4AYGA 3K8MA 3BXWA 4LVDA 3WBWA 3AS3A 3ABSA 2CLMA 3EB3A 3W0KA 1LUCA 3GLCA 3STGA 5GJNA 2DV0A 3E2VA 3EX4A 1UR0A 2POZA 4AC7C 1GT8A 4DXXA 1E40A 1VJSA 4WKAA 4P8VA 3W7QA 3VC6A 1RAKA 2QQ6A 3A3HA 3WY1A 4ZQMA 3TR9A 4MJMA 4UFIA 1YE6A 4K68A 5A95A 1B57A 1VQTA 4AXKA 4NJHA 4EPKA 3RFAA 3SN0A 3FKRA 3M47A 1DWFM 3BOXA 1B9ZA 2OSWA 5EMUA 4AG0A 5IBXA 4ASTA 4IQLA 1ZUAX 4XAPA 3WJSA 1SO4A 3KXQA 1AZ1A 1QPNA 2Z26A 2DSWA 3HF3A 4HMNA 2I5GA 3MCMA 3CUFA 2G3NA 5BXSA 3SW6A 3UVIA 5FL1A 3GX9A 1Q6QA 3WEZA 4MY9A 4DJED 1O5RA 4N4QA 5DCEA 1GYLA 3T81A 2FKPA 1WYIA 5ABFA 3AIVA 1J0ZA 5CC7A 1NDZA 4LRTA 3VA8A 3L4VA 4IFOA 4GY0A 2XTKA 4E3VA 2WVTA 3DUGA 4QJ5B 1DIDA 4FLOA 4AZ7A 4PN2A 1E0XA 4B15A 2V81A 4FF5A 2Q6ZA 5JH2A 3DOPA 2OYKA 3W7MA 1KR1A 1W1A1 3E49A 1REQA 4MAVA 4MKVA 1JRBA 2GJPA 2NQLA 4NKCA 1L8PA 2PTDA 2J9ZA 3WQOA 3IRDA 3EWZA 3A3WA 2YPIA 3MVTA 1VYSX 3AWOA 3PZ9A 4HSOA 3VOHA 3EA2A 1H5VA 2YXOA 3UBPC 1T6MA 1HO1A 1IT0A 3UR2A 3WLRA 1UH3A 1CB2A 2RGLA 3NQMA 3SUUA 1JDEA 5CXPA 3L4YA 2C0HA 1ME7A 4GPNA 4N6FA 1H62A 3WF3A 2FB3A 2WB5A 1UIOA 5A6JA 2WAGA 3BLKA 3K13A 2GOKA 1Y5XA 4V1XA 1KR0A 2UBPC 4QAIA 3F5JA 1U1HA 4NZFA 3TROA 3HMJG 1E0VA 1KXHA 4E2DA 4PL2A 1OBAA 3E38A 1DJZA 3LENA 1M65A 4HOWA 4CGTA 3AOFA 3AUJA 5CAHA 1B3VA 4A8IA 4YTTA 1V3LA 4CCZA 2GK1B 1LOLA 2HS6A 1C8QA 3V1HA 4HNLA 2GDUA 1AA1B 3UXIA 2R82A 3AZRA 4WGXA 3W73A 4GI6A 1RVGA 2ZZ6A 5HJXA 1E4MM 4ML9A 4M6PA 5A6AA 3DFQA 4GINA 2FPYA 4AEFA 1WQ5A 3VU2A 1A3XA 3GTHA 2XSAA 2PAJA 3CZ8A 4N2YA 4CQAA 5HMDA 3GTIA 2HBVA 1OADA 4ACYA 2ZRVA 1V6XA 4EX4A 4H9MA 1PAMA 1KRMA 2VOMA 4FLSA 1C9DA 4AB4A 1ONWA 3G1FA 3VNJA 1O4UA 4LALA 4F2BA 5H8PA 4DN1A 3M0ZA 3PG9A 1V0LA 4O16A 2RKXA 3W70A 4AMCA 2DZTA 2PUZA 3TSDA 3EMZA 2OX1A 4IMCA 1TR9A 4UTTA 1UROA 4JL1A 4P8WA 1Q7QA 1HL9A 2G4JA 2ZUTA 3MT1A 1CGUA 4PUWA 3S9ZA 5HXMA 1V4YA 1W1IE 2DGAA 4GC3A 1RHCA 1NWSA 3RCNA 5FEZA 1BVWA 4KKXA 2V38A 2VO5A 4GY1A 5DELA 1BXBA 3HV9A 3XIMA 2BXZA 3IRSA 2XUCA 3OO2A 3PTQA 4YVXA 4J9JA 2WVSA 6TIMA 1XLAA 5JIPA 1VIWA 2W92A 4N0RA 3RR4A 4IFKA 1JEZA 2Y0FA 2PTZA 1B31A 5EY5A 4O12A 3O06A 1OHLA 1UA3A 3W22A 1L2UA 4S3BA 4UIOA 4F0HA 1EP3A 3I4KA 3LRKA 1YIXA 1Q7ZA 1TX2A 2GQAA 3VIIA 1Q4NX 2Z25A 2G41A 1PL9A 2D3NA 1Y5WA 3AIUA 5F1VA 1XM3A 1R9XA 1P0EA 1BXCA 4P7QA 2J6VA 5AYBA 4WEVX 4UMBA 1RPKA 3PB0A 4B5VA 4NHVA 4F48A 3LU2A 3WL0A 1F4AA 3S5YA 1U1JA 3NYZA 4U3CA 2DVUA 2D73A 1K8ZA 2J88A 3W1AA 4RNJA 2DZXA 5A8MA 4IGSA 4JHMA 2QCGA 2FPVA 3KLKA 4YCPA 1JD9A 1EBHA 3FYOA 5LNSA 3S6OA 5MKGA 1VFOA 4DWSA 3W7JA 5E9AA 1VYPX 2CBIA 3QRHA 1LBLA 2UY5A 4EXAA 3EWDA 3WQGA 2YW3A 3P61A 4Z2KA 3W6MA 2PDGA 1FUYA 1G7UA 4F40A 3AYTA 3U48A 3GXDA 4EAMA 2YCEA 4IIGA 4IG2B 3O05A 4ZO8A 5IFTA 4PRRA 2F7FA 3E2RA 3U8GA 3U2OA 4IP4A 1QPOA 3A47A 3QYSA 4NF7A 2J6XA 3N04A 4JTIA 2FZDA 3LCXA 1LLOA 3DI1A 3SB0A 3TP4A 5A69A 4H8VA 3VPLA 3MHUA 3LCIA 2A7PA 8XIAA 4BY3A 2Z24A 2Z6IA 4V1YA 3RHGA 3VCRA 4PCSA 3T40A 1XLGA 4DJFD 4Z2GA 4C1LA 1NM9A 1IXPA 4H01A 3CYJA 3LPGA 3VM5A 1G6CA 2Z27A 3TK7A 2WC7A 4NRSA 2I56A 1OG0A 3LN3A 4H6KA 1Q45A 3EDEA 3ARPA 4Y2WA 5KZMA 1RLDA 5AVNA 1EH9A 1H0GA 3R7MA 1TZZA 4U28A 4GH1A 3HGSA 3TC6A 1JZ3A 3N2OA 4DYKA 1P6BA 5CCZA 2WBKA 2W5FA 3A4AA 5FJIA 1QNPA 3WBAA 3DI0A 4XKMA 1HKKA 3CV6A 2GSEA 1YE4A 3OQEA 3AU2A 2VFDA 2B4GA 3IIOA 4ICNA 3KTXA 4ZOAA 4LUTA 4LY8A 4RDWA 2NZLA 1BKSA 3GKAA 3QV9A 3IS4A 4JX6A 4UZSA 3PZIA 2B7OA 4A4AA 1D9EA 3MDWA 3LYEA 2VUNA 4Z08A 2PDUA 3NTYA 1M1BA 1IGSA 1EQPA 1UHVA 2P50A 4LY4A 1MQRA 2C7FA 3TVAA 5KITA 1RBAA 2PDWA 3W74A 3W7OA 1XGEA 2X41A 4ZBCA 1XBYA 4AD2A 3C0LA 1F3TA 3WZ0E 1E3XA 3MMTA 4Y7EA 5GVJA 4O19A 1EZ2A 4GUJA 2WSPA 5I3IA 2IXVA 3WMBA 5BCAA 1NWUA 3EYPA 2XHYA 2Y8KA 9XIAA 1AQ0A 2HDJA 1Q85A 1TTPA 3AHZA 1WUFA 2CLIA 2JEQA 1E4IA 2BXYA 5LYRA 4RV3A 2GGEA 4ZMGA 1Q7MA 3F2CA 3M0IA 1B3WA 1RBOB 3K2GA 1AL8A 4M3PA 2XGBA 2QCNA 4DBEA 1X1NA 3B03A 4LUSB 3M0VA 4K8EA 1J2BA 2HJPA 2OZ0A 2QJGA 1W0MA 1XH2A 3GXMA 2Z1VA 1TTQA 1KCXA 3LHZA 3PZMA 1GOWA 1XL9A 3NEVA 1E9IA 3LA4A 4IQJA 4AZBA 3LBCA 4PBGA 3NO1A 3OA5A 3MU7A 4QLLA 1TPB1 3PANA 1XBZA 1KTNA 4XBSA 1NWTA 1A3HA 4G7EB 2X1IA 1K6WA 2QDHA 3K4DA 1VLWA 2XFYA 1XYMA 1XSJA 3M0LA 4FNSA 1Z69A 2ODOA 3FJ6A 3HPSA 4RL3A 5D03A 3H4XA 5I24A 4QJ3B 4LTSA 3CUHA 4DLFA 4FX8A 3C3UA 1IIGA 4LS0A 1EWEA 1UIPA 1WV2A 4JFTA 3AIRA 3QR1A 1CGYA 3CAWA 3KEHA 4Q4RA 4HK7A 1CCWB 1D7KA 2BLEA 4G6CA 5HR6A 1VGAA 2V5LA 4QSHA 3HN3A 2IPJA 4RXFA 1H41A 1OGBA 4H7CA 2E9BA 5FACA 1QNQA 3UG4A 4MPQA 1B5TA 3TTOA 3ANUA 3B0VC 3I6EA 3L68A 2DIEA 3TR2A 2XFWA 2BOEX 3C0SA 4ML4A 4F2UA 2Y4SA 1UWRA 2X09A 4M80A 3KBVA 1RJPA 2GUUA 1KBJA 4NX5A 2WWDA 1WDQA 1XV8A 1S2AA 4IXHA 4HP5A 3MSDA 4LSBA 1F4HA 2A3HA 3EBVA 4Q33A 1LL6A 4A2SA 4MDPA 5JBFA 4J27A 1FWDC 5H1WA 3W75A 3LCLA 3PUEA 1DWJM 3QLLA 3CIXA 5T8GA 2QUVA 3MP5A 1KXTA 3MSGA 1YTKA 2FHCA 1JG9A 1NDYA 2QUUA 1H1NA 4MM1A 4AD0A 2J77A 3AROA 2CKSA 4A8RA 2Y5SA 1X7FA 1ICSA 4MWAA 1XIDA 1VBUA 3QPEA 4GD0A 3KVMA 1S38A 5HMSA 5C5YA 4JTGA 1GKQA 2FMNA 1HKWA 3FAWA 1OFDA 4GNKB 4MLJA 1NFPA 2VCAA 5M5DA 2I1OA 3CAVA 4M81A 1VYRA 1XD0A 3PWIA 4DUXA 1HKMA 1TREA 3P7YA 1UASA 3KBWA 1Q6DA 4BQ3A 1SO5A 2F6UA 3BGAA 2ZZ5A 4R7WA 1T96A 2D0HA 1YTDA 2GVYA 5J04A 1ZY9A 4JTSA 2VZSA 1FWCC 3M1ZA 2HS8A 1HF6A 1RALA 2TSYA 4IJCA 3N4AA 4JD4A 4GVFA 2ASHA 2E6YA 4F0LA 3DU0A 5HWNA 3SQMA 1OVDA 2VDGA 3GH7A 1DP0A 9XIMA 4MZ8A 2DZSA 3EOEA 1K02A 3UWWA 2AGKA 3C2OA 4WLCA 5JU6A 4XQ6A 1PJ9A 3VD9A 2YL9A 1K8YA 1GZJA 3EWXA 3HFTA 5ABFB 3BJSA 2W61A 2XVNA 1BWVA 2OOGA 1LL7A 3KRUA 3BZJA 2X30A 1OGSA 1WA3A 3UPMA 3R1ZA 3B4YA 5F4SA 3RCYA 1TQXA 1IHIA 5JMUA 4K7VA 4QNWA 3NPXA 1GNXA 3WO8A 2G96A 3EMQA 2V30A 4PCNA 2EJ1A 3GDBA 4JN8A 1P43A 3S9IA 1OJXA 1SFLA 3L0GA 1TTIA 1LLZA 4DZ5A 3S8HA 1EPXA 4LPCA 1XBXA 4E38A 2FHFA 3N4FA 4L64A 5FF7A 4AFYA 2G8ZA 4JTLA 3MP4A 4AISA 4FNPA 3RLUA 1GOQA 1FCQA 2OT1A 1TV4A 5HAOA 3MMWA 2BG5A 1MI3A 1AUSL 2NW0A 3R6IA 3MZ2A 1POKA 1JCLA 1JYWA 4QIUA 1GVSA 4DM2A 4QLJA 1TMHA 3BL3A 5A94A 4MWAC 3AS1A 2W66A 1TRIA 1EC7A 3ME3A 4BI6A 1VR6A 5I77A 3DFOA 3EXSA 3CMFA 3W84A 4DXVA 2WOQA 4A22A 3C6CA 4JNMA 1EHNA 1SSGA 2GSHA 3BSMA 1ZALA 4J35A 1PVNA 4LEFA 4L4OA 3U5UA 3IUHA 3O0KA 2BY0A 3V75A 3UPBA 5I79A 3U7BA 1EA0A 1I1XA 4JXCA 4NZ5A 3B9OA 3PWAA 5GJPA 1WZKA 5LNVA 4RDYA 2R14A 1G4EA 1SJBA 2QV4A 5EB8A 1A0EA 3O16A 5C2GA 3IIXA 1Z8AA 3DCPA 3UGRA 3VFLA 1RVKA 5AHEA 3CASA 2GYIA 5CPOA 3D3AA 1DKWA 1T40A 2XIOA 3GIPA 1VENA 3TTEA 4KWOA 1W91A 4NUWA 1B3ZA 3EA1A 1ISWA 2R91A 4HCLA 3NG3A 1KRBC 1RY0A 4M82A 5HNUA 4Y9MA 1YEYA 2J27A 1FH7A 3UZXA 3PZOA 1FWFC 2QDGA 2I5IA 4MLRA 3R8RA 1SFTA 1UZ1A 1YDYA 3MUIA 4OOUA 3H70A 2VR4A 3GG8A 5CJMA 3PTDA 2HROA 3V18A 1W31A 3CAQA 1XDLA 2AMGA 1SZGA 4NY2A 3S0CA 4JOMA 1Z7AA 5M2FX 1RCXB 3GFYA 4LCSA 2NXHA 2OWWA 4CNUA 4IP7A 4YU1A 1WAWA 3J7HA 2CZVA 2PDPA 1Q6LA 3PZQA 4Q4SA 4H2CA 1GPFA 1WOAA 1PTAA 4E3TA 3EDJA 1TJPA 3VD7A 2GDQA 2VFGA 1LORA 4CU7A 1JUEA 4OBSA 4IMGA 2VFHA 2VWSA 1SR0A 1B4EA 2A79A 3B8DA 4CNSA 4UR8A 5B7YA 4PUMA 4IMDA 1EGMA 4MNLA 4X60A 3EB4A 3TN3A 1G9HA 3AHVA 1KXVA 1ZJAA 1V6UA 4FOKA 4Q32A 3MB9A 2HQAA 3I4EA 1FHDA 2P88A 3LPPA 4AIBA 3ZMRA 1SZNA 3C56A 1VIZA 3FOKA 5LGXA 2XFFA 3R0KA 3OHMB 1VPQA 4KW2A 5GNYA 1HKJA 3QMRA 1UH2A 2YOCA 3L67A 3WJYA 5CPMA 1Q13A 2CFFA 1RA0A 4GNJA 5H6HA 1XQLA 4BA0A 1X6LA 2F6XA 2VKZG 3W7HA 4EK7A 3QKEA 1UKQA 3S2MA 1S2UA 3LEPA 3A23A 5LIWX 2ZX7A 4UFLA 4DZIA 4PBFA 2IW0A 4JYEA 1KWGA 4GBDA 2PLKA 1O5KA 2EG7A 1DE6A 4GVGA 1Q8AA 4TVDA 4D6FA 4PSPA 4AWTA 2GZXA 4WDUA 3VKBA 3W2LA 4WF7A 1OEPA 3OLGA 1ENUA 1QWKA 3LRMA 3N1AA 1E6QM 3ES7A 4UTWC 5C2XA 4LVGA 3UVAA 4CNPA 4J3ZA 4IFRA 3N3MA 3TJIA 3B8UA 3RLVA 2X40A 5AN7A 4A3RA 4WXZA 4KGJA 2DUXA 2QIIA 3CLWA 3WK0A 1HJWA 3ITCA 4OTKA 1OD8A 3KFTA 5I3KA 3U4FA 4JS3A 4HN4A 1EOKA 3RPTA 2ON3A 2I14A 2V68A 4HU0A 1KM6A 4F9JA 5F2MA 2J4GA 4BKNA 1UD8A 1JRCA 1XDJA 1C8VA 1ITCA 1IE7C 2DSUA 4NZ4A 3W25A 3WQDA 4AHQA 2DVTA 5CSSA 4C7DA 2OU4A 2PBOA 1IGWA 4O1CA 3UERA 3TJXA 2Z7GA 2WJDA 4MJ4A 5D4YA 1PXGA 4MTVA 1KXQA 4RE3A 1KTBA 3UNTA 1J0IA 3B05A 3PUDA 1XINA 2EF9A 3AIEA 4I9TA 1DHPA 3CPGA 3EKGA 2DZAA 2PDIA 5CZKA 3DBPA 2NUXA 6ENLA 5CPQA 4KEUA 3SEPA 5AC7A 2CWNA 5DT5A 1FTXA 3TCEA 4D6EA 2DQWA 3BSHA 2CLFA 2BVWA 5G1YA 5HQEA 4O0ZA 3H7UA 4I5XA 4JIQA 4LF2A 2WZEA 3C0QA 4B4FA 4PRTA 1Q6FA 3CH0A 4H9ZA 4PUDA 1UR8A 3KOYA 3BQ6A 3MUY1 1CGXA 5A6MA 2J8TA 1E6PA 3Q4DA 1X1OA 4K1WA 1BD0A 2QDDA 2OX4A 3KHDA 3THUA 2FMOA 4E4UA 4C6MA 3S5NA 3K4AA 1TIWA 3AWNA 1OZMA 4CD7A 3GZAA 1UBPC 1S1PA 4ZENA 1X1ZA 3AZTA 2PF8A 3DFSA 2NLIA 1AH0A 1DJWA 4HA3A 3KP0A 2V67A 3IAPA 4AF0A 4KH2A 4JFWA 2UY4A 1UMYA 4GIRA 2YDRA 3O9NA 1NEYA 1OQFA 3MI6A 2ZADA 3W27A 4PTDA 4EWND 2Q02A 5CSUA 2H9AB 4P5UA 3W71A 4R9OA 3AMDA 1BHGA 1ODUA 6XIAA 3DERA 1LZOA 1KFBA 1AK5A 1R87A 1GJUA 4RE2A 3R94A 1HJUA 4Z2IA 3T6CA 5IM51 2PDLA 4GGBA 3VD4A 1ZBKA 1GQNA 1KB3A 1O94A 3BLIA 3S83A 2Q8XA 2GQ8A 3STPA 1J6OA 1TWIA 3AMCA 3G0SA 1A4LA 3BVJA 2JKEA 1K1DA 1TZ9A 1CXEA 2PDNA 4KEZA 1F3WA 4FI4A 1OFQA 1I0BA 5ECUA 5HK4A 4JL2A 3DHDA 3H2EA 4GZIA 2E5DA 1XD1A 2POTA 1OWQA 9CGTA 3GNDA 3L4ZA 2VGGA 4XK2A 2WHMA 4X9SA 2Y8VA 4CVUA 4INFA 3SGZA 2IQ0A 2PC4A 3FXYA 4ZFCA 5H8UA 4JTKA 7XIMA 4N9DA 3OODA 3BSGA 1TVPA 3H2CA 2C0AA 4DO5A 1UR4A 4YPJA 1CXHA 2ISDA 1SO6A 2XINA 2Y1HA 2BY1A 3TX9A 4AIOA 3G1HA 2KX9A 3WNNA 1NELA 2FZBA 4L1GA 4CD5A 1WP6A 3TXVA 2F84A 3CM4A 3S5OA 2MUCA 4JY9A 4YS1A 3BQ5A 2VYOA 1KKOA 3IJDA 3B0XA 1IT8A 4GKTA 3TC3A 2HVO<