4NHVA

Crystal structure of b. anthracis dhps with interfacial compound 4: 5-(trifluoromethyl)-1,2-benzoxazol-3-amine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and characterization of an allosteric inhibitory site on dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
total genus 104
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4nhvA00
2YCLA 2BMBA 4MWAB 3H2OA 4S3FA 4D9PA 4S39A 3H2CA 3MCOA 1TWWA 1F6YA 3TYEA 3H24A 3TYUA 2YCLB 4PZVA 4C1NA 3TYZA 3H2AA 4MWAA 4O1EA 2DZBA 3MCMA 2VEFA 4MWAE 4O0QA 4D8ZA 2Y0FA 4NHVA 2Y5SA 3BOFA 3TZFA 1TX0A 3H26A 3TYCA 4O1FA 4S3BA 2YCKX 4DAIA 2H9AB 1Q7MA 4HB7A 1EYEA 3TZNA 1AD4A 3H2EA 3TYBA 1AJ0A 4G9PA 4DJED 2VP8A 4S3AA 3H22A 1AD1A 3H23A 2E7FA 2H9AA 4DJEC 2DQWA 4DJFA 4NIRA 4S38A 4DJDD 4DAFA 4S23A 1Q7ZA 1TWZA 4DJDC 2YCIX 3H2FA 1TWSA 3TYAA 4S3CA 2DZAA 1Q8AA 3H21A 4NL1A 1AJZA 4DJDA 4S3DA 4DB7A 2YCJA 3V5OA 4MWAC 3H2NA 3K13A 1Q85A 3TYDA 3TR9A 4MWAD 4CCZA 1TX2A 3MCNA 1Q8JA 4DJFD 3H2MA 4S3EA 2OGYA 1AJ2A 4D8AA 5JQ9A 1Q7QA 2VEGA 3BOLA 2Y5JA 4NILA 4DJFC 4DJEA 3NOYA 4C1NB
chains in the Genus database with same CATH superfamily
3CYJA 4RW3A 4C6CA 2OODA 4LY8A 1U33A 1VRXA 2G3NA 4JDYA 1B3OA 2ZZ5A 3AZRA 1M68A 4O12A 4RZ5A 2VDHA 4U5IA 1ITXA 5LIYX 2J8TA 4AY8A 3QC3A 4H9MA 1NY1A 2WNZA 3BOFA 4MJ4A 4IIBA 4AH7A 1B1YA 1XXXA 2JEQA 4JNMA 4QISA 2IPJA 3MJMA 3IIVA 5A6JA 1QWGA 5DELA 3B8IA 3UF9A 1PEZA 3ANUA 1D3HA 3ZLGA 3WQFA 1OVDA 3UERA 3XINA 2F9RA 1HJQA 3WL0A 3WJSA 3V5CA 3N2TA 4C90A 3DUGA 4Y7EA 4UBPC 3SCOA 3DG3A 5CJ5A 4AZHA 3N34A 2XVGA 4PODA 1KM3A 5D8WA 4V28A 1E5NA 1KR0A 1BRLB 2YOCA 4KESA 1VFUA 5EMMA 3SUTA 4K68A 4PTNA 3WIJA 3PWAA 2VFHA 3N15A 4NT0A 3R7MA 2RHGA 4LV4A 4D6CA 4PE8A 4PUEA 2QV4A 1Q85A 1WDSA 1RLCL 3BXWA 3KFTA 6TAAA 4KWSA 3PJWA 4HQVA 3B4YA 1PUDA 3TC6A 3EA3A 3PY2A 5PTDA 1J2BA 4FNUA 2Q8ZA 1Q6LA 2PPGA 2XIMA 2WJEA 2CLMA 3RIKA 4J3VA 1H7PA 3KL5A 4F4RA 4I8YA 1LQAA 5REQA 4EWND 4EANA 2NVAA 3HGRA 5LA2A 4K36A 3RO6A 4ADTA 1XSJA 1PL9A 4J2PA 3G0SA 1SMAA 3OGRA 3E3HA 1F05A 3EB3A 4GH3A 4M6QA 3VDAA 3DYPA 3TUUA 2QDGA 1ITQA 3TNOA 1EA9C 3OU8A 7REQB 3NQDA 3UWQA 3ARRA 2W91A 1FWAC 1V51A 3A47A 2AL2A 3GXPA 4A8LA 2NWRA 4W88A 3S5ZA 2ACRA 2GVEA 2QCFA 2J66A 4QQ3A 1OK4A 4JOMA 1MEIA 3GKAA 4Z2IA 2ANUA 2NW0A 3ABZA 4O11A 2ESCA 1BD0A 2BZNA 3PBVA 4JL1A 1V0KA 1QW9A 5IOBA 3VOFA 3CUZA 1JQXA 3W53A 3E49A 2GVGA 2VGBA 3THDA 1I2QA 3SCWA 2C14A 3VIJA 4WLCA 1EDTA 3EX2A 2ZXAA 3K8MA 5T26A 4GLEA 2XN1A 4GYFA 3M1ZA 4ATLA 4AD5A 2NQLA 5FJIA 5HXMA 3NQVA 1CTNA 3B9NA 3L65A 2VZSA 2ZA1A 4DO7A 3NO1A 4RR4A 3IVSA 3NCOA 3TJXA 3AMLA 3O07A 3CAWA 5I3HA 3UW6A 3BJFA 2G95A 4C1NB 1OCBA 1HJWA 2PI6A 2ZC1A 3DC8A 1I4NA 3APYA 1FHLA 2ZZ1A 4S3JA 4H6QA 3NTYA 3BL3A 1R8LA 3OA5A 3RFAA 3WLIA 4WDUA 3E0VA 3O63A 4M1BA 3WQWA 3ZT6A 2GQAA 1HKMA 4WCJA 1LG2A 3NQBA 3W22A 4PMDA 3G6MA 2GQ9A 3AALA 1R3VA 1IZKA 4ZSUA 2WNWA 3OYZA 3G6LA 4JTJA 4QSFA 4QQUA 3FVMA 4AC7C 3FJ4A 2ZUTA 1PTDA 4WOQA 1UJPA 3EMQA 3KWXA 5CSSA 1BTCA 4AYSA 2BDQA 2BWGA 4OUIA 5AY7A 3STPA 3ZIZA 2E40A 2VX6A 4A6GA 5EMUA 3M5VA 5DCBA 4UZSA 1W5PA 3MMDA 4QG9A 3R0DA 5ABFA 3TW7A 4PUNA 2YCJA 5AYXA 4ATDA 4F3HA 2WM1A 2VDIA 2CWXA 3SSJA 1EP2A 3LLXA 2X2GA 1E4LA 1QW7A 3ARPA 1KV5A 2PDYA 1XIDA 3W2JA 2GOUA 5C70A 2JE8A 3M6DA 2PSNA 4HPJA 1W3LA 1E0WA 2YFOA 4WOZA 3EWDA 1HKJA 3MDWA 1XGEA 3RLUA 4UFHA 2XFYA 1EWDA 3S1GA 1E9ZB 3RGTA 1NELA 4RNIA 4Q8VA 2HMCA 3W76A 4W5ZA 4CD5A 3ZSSA 3D3FA 5BCAA 3W7JA 4MWAE 4X22A 3GX9A 4DF1A 5CJMA 2DQXA 6A3HA 4ERIA 1EPXA 1LM1A 4DAIA 3C8FA 2CBVA 3WQOA 1P43A 5D37A 1JCLA 3MKCA 2DZSA 1KD0A 4JR5A 2XIBA 1DE5A 2VVNA 3VVGA 3DG7A 4JIPA 5D9NA 3L67A 2W67A 1OYBA 1Y5XA 3CHFA 1Q6OA 4P7OA 1IEXA 5BXRA 2FQIA 3DFHA 2HVOA 3WMCA 3MZ2A 4YL2A 3PB0A 5CGTA 1UBSA 2C16A 3W25A 3P3BA 1FXPA 1UWUA 1FWJC 4QS5A 2Y8VA 1EKOA 2QIWA 3MANA 2GSJA 1CNVA 4Z08A 2BHZA 4UTFA 4R27A 3BANA 4D6IA 4UTJA 1SO3A 1GJPA 4JYFA 1LWIA 2E5CA 1EO7A 1F8IA 3WELA 1DWJM 3UR5A 1C8XA 1K6WA 3PHAA 1S38A 3EA1A 1YDNA 4KGJA 4U10A 4WGXA 1JULA 1W8SA 4Z2JA 3QY6A 3QBUA 3PSWA 4AYGA 3T9PA 3U2CA 4QR6A 1MRQA 4RZBA 3SN1A 4GISA 4AF0B 4C6EA 4F79A 3TDFA 1SJAA 4ZSTA 3S6OA 3ZYZA 2BFGA 1TE1A 1W1PA 3HG4A 4C6DA 3ABQA 3W2MA 4EPKA 2YA1A 2ZUNA 2B0MA 3F4DA 4UFIA 1CGVA 1IIGA 3PZUA 3MDUA 3WK2A 3PFRA 2HCVA 1AUSL 2H3DA 1EJRC 4AZCB 3S1WA 1XC6A 1JRCA 2VM8A 5CJNA 3M0LA 3B9DA 5CBIA 3GSMA 4MHBA 1KBIA 4IL0A 4JTCA 1WBHA 1DQXA 4UFKA 3SGGA 1TUFA 4LVBA 2YCEA 1XD1A 4GQBA 2YFNA 1Q7ZA 2GGEA 1NVMA 5FJPA 3WH6A 4UQBA 3G1YA 1R0MA 1R7AA 3UJEA 3SB0A 1IEQA 5G4EA 1SZGA 1TPB1 5A69A 1MEHA 3GR8A 3W73A 2YIHA 2DIKA 3CAKA 1UROA 3UWEA 3OTRA 1HIZA 1XLBA 3BMVA 4QJ4B 4H1ZA 5ABFB 3GB6A 4Y9OA 1E0VA 2XISA 1WCGA 1YKWA 1MDRA 3CU2A 4HN8A 2AKZA 1YDYA 4CNUA 1YIXA 1CCWB 2D0FA 2LLEA 1J5TA 1GEHA 4S39A 1F4HA 2YBTA 2WZIA 5AC5A 4FF7A 1XLEA 4WSKA 3PZTA 1TYGA 5EKYA 2XGZA 1SW3A 1X6NA 3G1RA 4CN6A 5LXEA 5HK4A 2FZ9A 1CLKA 4FX6M 1X1OA 2PGFA 1H60A 4NY2A 4EPEC 3VDBA 3MZNA 2V3GA 3QR0A 1JR1A 2IW0A 4DBWA 1OBAA 1VR6A 2NXHA 3WENA 5E6YA 1A3WA 3RPDA 1OT1A 4QLLA 4PUKA 1I1WA 4NASA 4V15A 3T2PA 4KWVA 4AZBA 3NXFA 3WNLA 3EMZA 2PRHA 1XLHA 3WLQA 4L61A 3B0VC 2QEZA 3ITXA 5BMWA 4XZ9A 1EL3A 2NX1A 1ODUA 2ZYFA 4RE0A 3VMPA 4XSLA 3TR9A 1M7JA 1V02A 4JIQA 3TAOA 2OEJA 3PZIA 4CD7A 3CLWA 2I5QA 5FF2A 5K9DA 4GIEA 4GNJA 2OCZA 1PKNA 4H6EA 4NUWA 1FCBA 2G4JA 4PA8A 3AHXA 1K8XA 1ZJBA 4K1GA 3RM8A 1XS2A 1HFBA 1QW8A 4GIAA 2OPJA 3MY9A 2OOGA 4JN8A 2WPGA 4HOXA 1TPFA 4NJGA 1HKKA 3LQGA 4ZEPA 2DPEA 1CIUA 4XAYA 1KCKA 4L9XA 4HNTA 3MCMA 3LCIA 1X39A 2J79A 4GY0A 4IICA 1VFOA 2JEPA 3NQAA 2Z29A 3SM0A 3AFBA 2O92A 2AMGA 3BC9A 1RV8A 3MUXA 3V7PA 5BRQA 3ZVHB 1H4PA 4ZE5A 2V5CA 3UVIA 3A24A 2G50A 3ARZA 1JCJA 3WLOA 3II1A 2E9MA 4GZIA 2TMDA 3WBWA 3BPWA 4FXRA 5GNYA 2PF0A 4NIRA 2ZRZA 4LVFA 1GUVA 1RR2A 2C1HA 4PTVA 4DUXA 1BSIA 2G0WA 3M0JA 3UA3A 1C8YA 3VZXA 4YVXA 3TNBA 1Q6GA 1B3ZA 1XICA 1P7TB 5MHBA 1XH1A 3S6TA 4S3DA 4OT7A 4E8GA 1ML1A 4JIIX 5KMYA 2V67A 1LDCA 1ME8A 4J1OA 4RV3A 2R91A 3UJ2A 1LTDA 4HVXA 4TX9A 3CQJA 2D2HA 2FPVA 4IGSA 1TJ0A 3QV7A 2ZE0A 4P8UA 4NJJA 1WV2A 4P7RA 1V02E 1W54A 1DWGM 4JFWA 2W66A 2J7DA 3HU7A 1K9FA 1U83A 1ISYA 5KZEA 1XQKA 3MP5A 5B7ZA 3LPPA 2WVVB 1TR9A 3LMZA 3ITYA 4IIHA 3ELFA 1JXKA 3R2GA 3PNZA 1UUOA 4NU7A 5M17A 2B31A 5J8LA 3VD3A 1QNSA 4LU0A 2QF8A 3VNLA 4U28A 4GBDA 2F2HA 2YGYA 2VP8A 3MUIA 4WY0A 2PUZA 5D9PA 1QCWA 3WMLA 1VCFA 3HPXA 3TJIA 1QVBA 2ICSA 1UD5A 1VFMA 2V6AA 2FVKA 4H7CA 1Q66A 3AMCA 2B7NA 2Z2UA 2VD9A 4Y9PA 1A0EA 4PEEA 4K1WA 5AYYA 3W23A 1JYWA 2O0TA 3MU7A 3BMXA 3LHZA 2Z2AA 5AHMA 4IF2A 1EJ7L 4JZ5A 3TP4A 3KVMA 4DX3A 5IFTA 3U4AA 4IJCA 1MUCA 3WEOA 3ITCA 3BLFA 2ACQA 2EXOA 1IE7C 2XH0A 3M0KA 3W1QA 4ZVJA 3ZSTA 4WJXA 3S2JA 3HN3A 2Y5JA 1QNOA 4AXNA 1XGDA 5E0FA 4LALA 1CXFA 3N2XA 3ARXA 2D73A 4X9SA 3F2DA 1F2JA 1HGWA 3FNDA 2YKKA 1W9UA 3LNMA 3MBDA 4HT3A 1H1YA 1KGWA 2BOGX 3UPMA 1V4YA 1BQCA 1M7PA 2GJXB 1US3A 1S2TA 3HQ1A 4JTLA 3EEGA 5FOOA 3IK4A 1PDYA 2QGHA 1XIJA 1H11A 3ZWTA 5CAKA 2XINA 2D2OA 1D2KA 2W62A 4YLWA 1ZUAX 4NZJA 4WIWA 1LROA 4E2OA 4A8RA 4E2VA 1OCQA 2ZVIA 3T08A 4PMNA 4HP5A 4GK8A 4XO7A 2J7BA 1M6JA 1MQQA 2GLKA 4NZCA 4I9JA 3H8AA 4DO6A 2VO5A 4QAWA 4XD4A 2HK1A 2GYIA 2GJNA 3K4WA 4Z42C 3F5JA 3UXAA 3BLOA 1AL7A 3EKZA 1XLGA 4PR4A 3GYCA 5FL0A 4FLSA 2FFCA 2ATMA 4HGXA 3AZTA 3KRZA 4QS6A 4GYKA 2BHUA 3SY8A 3CQIA 3NVTA 1J0KA 4N9EA 2QKFA 5KSWA 4U3CA 5BWFA 1E4NA 3PG8A 1VFLA 3CV6A 3WLTA 1HT6A 1T41A 3GXTA 1U1UA 4MPKA 4DZIA 3UESA 5A8QA 1KFCA 3GU2A 4Z0SA 2Y6ZA 2BHYA 3N11A 2UV8G 5LNVA 4H83A 2ZZ2A 4HZ8A 4LAOA 1LLWA 4N9DA 4TTGA 2PC8A 3VIPA 1QWKA 2BBFA 2MANA 2P76A 2W0UA 4IQLA 3HB9A 3AIEA 2UY4A 3WEZA 4DBUA 4AVOA 3EWYA 3A3HA 4DY1A 4NZ4A 1PCKA 5CPLA 4JQAA 4YYFA 3PJTA 2VZVA 1JF5A 5D2YA 2D24A 2JIWA 4GC3A 4W7UA 3LBMA 1XKYA 3W1UA 4TV5A 3TCEA 3NURA 3E9AA 3OIXA 1C7TA 1A5MC 3RLVA 2I9UA 2WVTA 2AL1A 1IR1A 3LBCA 2CZEA 5MKGB 3WQ4A 4O1CA 3H70A 4H41A 1JI2A 4GUHA 5CC7A 3BOLA 1E72M 1EJXC 2W6RA 5I3IA 3IJLA 3SDOA 3O6CA 3LV5A 3TTQA 5GVJA 2DSWA 4KRUA 1SM9A 3BGGA 1IXNA 1UG6A 1S46A 4QJ1A 1NQ6A 1H0IA 2PTZA 5CGMA 3TYEA 4AEOA 1LYXA 3AYRA 4CU6A 4NAFA 5KEZA 2XTKA 1EB3A 1DIDA 1LF1A 3SCPA 4AFYA 2F84A 1K02A 4DXKA 4UOQA 2DUAA 3C0JA 4FF5A 5I3DA 3FA4A 3KP1A 3PUDA 6XIAA 2POZA 4WGHA 2VUYA 3KBNA 2H3BA 3RCMA 3AIUA 2I14A 4TMBA 4HHLA 4L4OA 5AZ1A 3LEPA 2H9AA 5E9AA 3CAQA 1H5YA 1US2A 1E6PA 3GDTA 1NF7A 5CSYA 3T40A 4CD8A 3FFSA 1BYBA 4FAMA 3R12A 3QN3A 2GDQA 2CHOA 4KQNA 3OZYA 3PAJA 2HBVA 3TYAA 3ZO9A 2YYUA 1ISXA 1Q8AA 3UG3A 3B0UX 3CHEA 3MJYA 4ZZ9A 1E1CA 3CC1A 1RXOB 3G3DA 1QATA 4LBSA 9XIMA 1IHIA 2XZ9A 3WF2A 1EX5A 3AU2A 3QZ6A 5AC4A 3N2OA 3KLLA 4GWEA 2B7OA 4S3EA 3LS9A 1A0DA 5EMKA 4Z2KA 3WMBA 4NZFA 1H09A 1XBZA 4AMCA 1IXOA 1XLFA 2VFFA 4HA3A 2BMBA 1GVIA 4S3FA 3ITLA 5FEWA 2VEIA 3N18A 2UY5A 4G1KA 4XKYB 3W0KA 1GGOA 5F1VA 3CV7A 5K4ZA 4ZB2A 5CPQA 3WJWA 2DZBA 1OD8A 5J5DA 2FMOA 4E4UA 1TX0A 2P3EA 2YDRA 2PRLA 2WMJA 3MSYA 2TRSA 5C6MA 3SUUA 3NZQA 5D9OA 1Y5WA 1C29A 3E1F1 4DF0A 3UXLA 3RMEA 1YMYA 4F2TA 1MNZA 3DBNA 3PUEA 3L0KA 1JDEA 3WLPA 4KCWA 4ACZB 3HFTA 3BO9A 3WUEA 1P1XA 1CGYA 2QCDA 3HGOA 3O3RA 4K37A 5HUOA 3TXVA 4FLOA 4RPPA 4XBSA 3AAMA 2QJMA 1JNDA 1BWLA 2IQDA 4IMEA 5JH1A 2PA6A 3LXBA 1RZMA 4I7UA 1U5VA 4B3ZA 2V38A 3VX0A 1ZENA 5A6BA 4ACYA 2NQHA 4G7EA 3CUIA 3C8NA 4DI9A 1P7TA 2D0HA 3WLSA 1QNRA 3T0TA 1PJ9A 4BI5A 5BMXA 5FACA 4L56A 3S2LA 1AG1O 2OZTA 2DVUA 2A3EA 2PU1A 3NR0A 4UCGA 3ARWA 1SFJA 4PUMA 4WDTA 2VENA 3COTA 1SGJA 3QOMA 4HK7A 4YS1A 5LIKX 2BGQA 3DENA 3CB3A 3MQTA 3ZWSA 4FNSA 2C91A 1FWRA 1QOXA 2F6XA 2BTMA 4TX8A 1TJPA 4NHVA 4Z0JA 4OOZA 1LRTA 3OZPA 4HCHA 2P5NA 1XGZA 1WDDA 3VCRA 4UUIA 4C91A 4NYUA 3OODA 4Z1DA 3MMTA 1LRNA 3AUOA 5HR7A 5B80A 3WF4A 1VRDA 3TKFA 2SFPA 3LZ5A 5F7UA 3RRAA 4RNFA 3MB9A 3NQCA 2B7QA 2ZIDA 4JTQA 2EBNA 1CGWA 3DHDA 3G0XA 1HJXA 4PSPA 4HNLA 1VJZA 1WA3A 1UR3M 5LA0A 1FHDA 4R7OA 3TFXA 1Q6CA 3B05A 5T9CE 1JXJA 1XISA 3M0YA 1TREA 1M1BA 1UJQA 4HNNA 4D8LA 5H8MA 3DHUA 4GGBA 4MY9A 4MF4A 5D04C 1Q65A 3VM7A 3EKGA 2YDAA 3A21A 1V3JA 3C2YA 6PTDA 3QMSA 5FF0A 2AMXA 3B9OA 4FMVA 2ABBA 2BVDA 4XZWA 3H2OA 2A21A 4QX4A 2O55A 4RNJA 2NXGA 3AMDA 4KFNA 4Q4MA 1C92A 3EDDA 4O19A 4R7JA 4WJ8A 1SSDA 2C1IA 1R38A 2E4TA 5H1WA 3DC0A 1AL8A 3N6QA 1JJKA 2Y8KA 1W56A 3TSMA 4O0KA 3FIGA 3PJUA 3VGDA 1PHWA 4UOZA 1I60A 4RW5A 2EG8A 5AHIA 4BQ5A 1UP2A 1BLIA 2QS8A 3ZOAA 1OFDA 1R87A 3K4AA 4IGMA 5M2FX 4AVFA 3U2OA 2YB4A 3H6OA 5CGQA 3OHIA 3UPWA 1MQRA 2Y88A 3HO8A 2D1ZA 4B92A 1KGXA 2PDPA 2ZRXA 2W63A 4MUZA 5K2ZA 5HR6A 1BAGA 4OBRA 1F4AA 1ONRA 2WHKA 3C3UA 3R1ZA 1JZ8A 2YL9A 4NL1A 1KKOA 4JHMA 2J4GA 4BWLA 4XAFA 1QPKA 4P5UA 4MDPA 2E28A 1ZP4A 2WSQA 4BCEA 4Q8OA 2CBIA 2IPFA 2V30A 4UXDA 2EF9A 2YYTA 1DJNA 1GQJA 5DEZA 3G1VA 1XDJA 1W6TA 3IGUA 1TA3B 2YA0A 4AHQA 4YIWA 2WMGA 4Y9MA 1LP6A 1SJDA 4PH6A 2XIQA 4LRSA 5FKYA 1OFOA 5C9RA 3LSCA 2HXUA 2DW6A 3HZ3A 1E4IA 5LHFA 1MW3A 4GZEA 1GTEA 3WDJA 3N6HA 1PPIA 1H50A 4UR7A 2L5HA 4S3KA 3ZFHA 2Z27A 5D09A 5HBFA 4H9VA 3AC0A 1I75A 4EK7A 5I79A 2ZA3A 1R5YA 1WXYA 3R58A 1ECEA 3CT2A 1HUVA 4JTEA 1LLOA 1PHQA 3VE7A 4MM1A 4OIFA 2WMHA 4JEQA 1LLZA 3GD6A 4YHEA 4GX8A 3VGBA 3VO0A 2UY2A 1PZ1A 2GDUA 1E51A 1WOAA 2Z2BA 3OQ8A 3NQEA 4FK9A 1TB3A 4GD0A 2WCAA 1SO6A 1BWVA 3KVLA 5FEPA 2HRWA 3VPLA 1L9WA 1ZS2A 2GSEA 3W88A 2Y85A 3FHQA 3HURA 3M5XA 5CAHA 3A3WA 1TELA 3ARTA 1DVJA 2WYSA 2BASA 4R85A 2GQ8A 4JAWA 2Q01A 5EA9A 3AJ7A 5GJNA 2V3FA 2ZXBA 3GG0A 4E4FA 2OQHA 3C0SA 1KRAC 4MB5A 1T0OA 1XH2A 1EP3A 3V16A 4GXWA 3QHOA 6ALDA 1VLIA 5IDIA 1HO4A 4IJRA 1H62A 3IAQA 2J74A 1UH3A 4QSHA 3PZNA 2RFGA 4KMQA 4HHHA 1O6IA 3BW3A 6ENLA 5F2MA 4US6A 1M9HA 1B4KA 1E56A 3H2EA 2OFJA 1F8MA 3W7RA 3LPFA 3PZMA 3NSXA 4RPQA 3NL3A 1V77A 3KBJA 1V6XA 3VOGA 3DZ1A 4TR9A 1JEZA 3GDRA 3GXIA 3B3DA 1EF2A 3JUGA 3GBDA 3E0FA 1KM5A 1OFPA 4US5A 1XHGA 3VDCA 1BSLA 1TTPA 4MYAA 1KWKA 3C2EA 3ISIX 5LGZA 2FTPA 1SFTA 1KXVA 4Q3MA 3AS0A 4AWEA 1M7XA 4QITA 4W5UA 3ABXA 1XPGA 3ME3A 4GMEA 1F07A 4PMUA 2XH4A 1E0TA 4IIGA 1JCXA 3P60A 5A5WA 4R53A 1A5AA 3ITGA 3ZR6A 5CBBA 4RDVA 2XIIA 3BDKA 2VT0A 3CUJA 4R5EA 2EPMX 1UR1A 2J7HA 3UCDA 2NV2A 3LV6A 2CLLA 1KCLA 1NP2A 3DKLA 2W92A 1J93A 3WNMA 4MDOA 3AHZA 4L4PA 5HNNA 2J6VA 1L8PA 1V5XA 2E6DA 3L0GA 3U6WA 4PN2A 1E6QM 4DLFA 1UWTA 2VR5A 4PTDA 2V5KA 1DPMA 3DGRA 1JPIA 4NNBA 3PBUA 1UC5A 5FJTA 1TRDA 9RUBA 1OM0A 4J9JA 3CTLA 2J13A 2E0PA 4TXEA 2G5WA 2C13A 3MSGA 1WDWA 3DG6A 3POCA 3QQWA 2WBKA 1H41A 2VKZG 4RNHA 4PCFA 2VC5A 3ABRA 2WNQA 3EGJA 1FCVA 1AODA 4JFVA 1FBAA 1SW0A 2NUXA 4GZJA 2DDXA 5AYIA 3NUKA 4LX4A 4DHGA 4B5SA 2PCEA 1B5TA 2A2IA 4ZA0A 3PBGA 2QHAA 4L4LA 3F4WA 1QUMA 2G3IA 4PB4A 3CL7A 4MWAD 4LC8A 4G7FA 4N4PA 3N17A 4FB7A 2G37A 3KX6A 2V82A 4QHRA 5AVNA 3GDLA 4HPGA 1BWKA 1WAWA 2OR2A 1SJCA 1N8FA 4JTFA 3VCNA 1KXQA 2VHLA 3K5XA 4B4FA 1XCXA 3MPGA 4GE8A 5CLTA 1TUXA 2A6NA 2DGAA 4M5PA 1FWFC 4FHAA 2GJRA 4UNIA 3NJ3A 4FI4A 3L4VA 4KCTA 3UR8A 3FYOA 4GA8A 2OX4A 1NH6A 3N12A 2IQ0A 1AVAA 1Y5VA 3KTXA 1ZPTA 1P48A 3IRSA 1JD9A 1E1EA 4EE9A 3H23A 5I24A 2WWCA 1UW9A 2WW5A 3CZEA 3QQ1A 3O1NA 4QGCA 3GIQA 3LD5A 2XU2A 3NPWA 3S46A 1D7FA 2FTWA 1TPWA 3RX2A 3GHUA 4A8NA 1W1B1 4ES4A 1NFPA 4B2DA 2GPTA 2PWEA 4FO4A 2BOFX 1HVXA 1XD0A 3PS7A 2QGYA 1ZAIA 2VFIA 4L5ZA 3WL1A 5KITA 4CVUA 4NNCA 1L6GA 3UP8A 2W79A 3I4EA 1YEYA 2HNEA 1ZLPA 3IGXA 3GXDA 3AYVA 4K8GA 3LGDA 1X38A 1AMYA 3IS4A 5I03A 1RJRA 1MYRA 3KDOA 4IMGA 2PDMA 1AH0A 1XYMA 3L23A 4I8DA 1XRFA 3VILA 4IPIA 2FHBA 1T8XA 1JRBA 4KWOA 4DUOA 3CZJA 1IIHA 4O8RA 1ZRQA 3FOKA 1HGYA 3RXZA 2RDUA 1VC4A 7PTDA 2WJZA 2E8ZA 3UJRA 4MAZA 2VUNA 3HPAA 1XLKA 1RK5A 3PULA 3I4KA 1OFBA 4K7VA 1JZ2A 4NSBA 4GUJA 5DRCA 3G22A 3I7RA 4ML9A 2P8BA 3BLEA 3AIBA 1GHRA 2P0IA 3TVAA 1VFTA 5AZ0A 5IHRA 2CEQA 2ZDSA 2BXVA 1VD6A 3CK5A 2ZCGA 3TA9A 3UY8A 3NQFA 1NJJA 1YXYA 3GWQA 2OTDA 3PFMA 1XLAA 1EIBA 1XQLA 3LDVA 1L0PA 1R9YA 1V3KA 2FIQA 1S1PA 1W5MA 2A1YA 2Z0IA 4J3SA 7TAAA 3SGUA 3FW6A 3NQ6A 1VBRA 3W72A 3P2VA 3SR7A 4AZCA 2Z1XA 2V81A 3A5VA 4MKVA 1H49A 4UQCA 4B9ZA 3LXCA 3NIYA 3U57A 1NF0A 1A47A 2C19A 2FHFA 5DY3A 4M1RA 1H61A 4YMZA 2WJDA 4UR9A 3EBVA 3BG9A 4EAMA 2XVPA 4ICNA 3QJAA 4W89A 3D6NA 1XYFA 2NUYA 1C91A 1SMDA 3EWUA 2TODA 1RQHA 1MNSA 2PDFA 5A2BA 4ZXLA 3S42A 3WZ0E 3OG2A 3UT0A 2VX4A 1TJ2A 2GVYA 1VFSA 3WYZA 3HOJA 3QF0A 4GVFA 4OVXA 4XBKA 1GVOA 3H55A 4AG0A 2VWTA 2DT1A 4C6PA 3IV3A 3DHPA 4KEUA 4HHMA 3STFA 2UY3A 2XN0A 3ABOA 3MYOA 2O9PA 2VWSA 5HNTA 3LCWA 1SZRA 2YCKX 3GS6A 1U1JA 3H7VA 4IP7A 3VNYA 2V3EA 3DH7A 1XRVA 3HIJA 2TSYA 1CENA 2HZGA 3W26A 3CTTA 1Q63A 1V93A 4M80A 5AYBA 4XUYA 3UCCA 3GIYA 7XIMA 4CQ9A 4F2BA 5RUBA 1N7KA 3OZMA 2OWWA 2YCIX 3SO7A 3E2QA 2BLEA 3GVRA 4PULA 3CPRA 4Z1YA 3OQEA 4KEVA 4GHRA 3GH7A 2G41A 4E3VA 3ICJA 1RPKA 1J79A 4HIBA 4BQ2A 3SCQA 3EOOA 1VFFA 2EJAA 3E5BA 4DYKA 1W9BM 4LSBA 1ZBVA 3M5ZA 3FA5A 4GYJA 3AXHA 2PODA 3P84A 4Y9AA 1JZ7A 1MW0A 3O05A 3POHA 3RK8A 3VNKA 4JX5A 2XFRA 1REQA 1TVPA 3V36A 4GNVA 1YBQB 5U7SA 1V0LA 2CLEA 4IP4A 4Z1BA 1GVRA 5M5DA 3N6JA 4TVCA 3GXNA 5KINA 5A8PA 4LFYA 1Z69A 3EEZA 3IGHX 1GW9A 1CT5A 1OC7A 3L0NA 2Z26A 5DQPA 1XW8A 3WLJA 2YL6A 2HV5A 5CSUA 3GNDA 4LQ1A 3W00A 2R1MA 5HMEA 4US5D 1MSSA 3IAPA 1W3JA 2NQJA 3RM4A 3QV8A 1YE4A 1MI3A 5I6SA 2OWCA 3GTNA 2PP1A 4GQRA 2GJXA 1UA3A 1K7EA 3W1AA 2GVLA 2BV9A 2OG9A 1VZWA 4N6EA 3VZYA 1TCDA 5F1UA 3VDGA 3HMJG 2V3DA 1K1DA 4HPHA 2Y24A 3NAVA 1CBGA 1WZKA 3VD7A 4B15A 3QR1A 4DBDA 3NO3A 4QDPA 2WC7A 4LYPA 3KS6A 2GVJA 3SIMA 4DYEA 1OHLA 2BOEX 2POTA 3N9RA 3CIVA 3BZJA 1EFZA 2Z24A 1OABA 5JBEA 3C5QA 4POCA 2VI0A 1JVNA 3FYYA 1OIFA 3PSVA 3QH2A 4EAYA 4QIUA 2VZTA 2R1NA 1YDVA 3URAA 3RCYA 3PTQA 4XAGA 3W1MA 1WZMA 1Z3NA 3V0SA 5BRPA 4QCEA 4JTUA 4UTKA 1EJTC 4GFSA 1KRMA 3Q2DA 2NLYA 5C0QA 1TQJA 1XRSA 7CGTA 1E15A 1SQ7A 4OUEA 3MI6A 3ITVA 1E6XM 4R3UA 4J7RA 3VAVA 2OT1A 3HPFA 4HU3A 5LIWX 4PMYA 4XV0A 1PWLA 2NZLA 4Z1CA 2DZUA 1K03A 2C71A 1EUNA 3P7YA 5E5CA 1EZ2A 3MT1A 4PC8A 4PRRA 4QEEA 3KP0A 4YNGA 3BWWA 1H7XA 4L9ZA 1YNQA 3F1QA 2RJHA 2HTMA 1LBLA 1MWOA 3W7GA 4LUJA 2FJKA 3ONCA 3SUVA 3VUPA 3LTYA 4UTWA 2X40A 4HSHA 3MCNA 1NWRA 4YTRA 5DX7A 3KBVA 2QCHA 2PB1A 3ANYA 4LUTA 2OYKA 3CAVA 3WJZA 4NI3A 2W27A 1FFQA 4K39A 3WD0A 1WXJA 3BCJA 4N7QA 4Y96A 4EX4A 1ADDA 1QHOA 1Q6DA 4RUBA 3W9ZA 3W7OA 4IFKA 2DFAA 1H51A 1JF6A 4RDZA 3BLLA 5A6AA 3TFCA 1CXHA 1E5JA 3AU6A 4DWSB 4GJIA 4JL2A 3N2CA 2WV8A 2DVXA 5D2TA 2DV0A 1V3MA 4LUSA 3W6MA 3ZJKA 4X0NA 3UR7A 4J40A 3B8SA 4ZQPA 5CG7A 3T8LA 4U5KA 4OV4A 1DL3A 4BFAA 3W2LA 1VPXA 4R33A 2OJPA 3LBOA 2Y62A 3U4FA 3NL2A 5EFFA 1LOLA 1K8ZA 1WOBA 4RLIA 1GVSA 1VIZA 4XVDA 3U5UA 4DRSA 1UYQA 2OO0A 4H00A 1UWRA 4JIEA 4KIEA 4LBUA 5TIMA 3C6CA 1IQ8A 2ASHA 4N42A 3L68A 1G7UA 1YE6A 2DW7A 3WDIA 2YA2A 1ADSA 1JL8A 1F73A 1XV8A 2V2DA 2GUYA 5EL1A 3TTOA 4CEUC 4MJMA 2QUMA 3W27A 4HYRA 2I56A 3IEBA 3L9CA 2MNRA 1W31A 1VGAA 3IIPA 1UWAA 5DMLA 1MFUA 4BWLC 4Z17A 2H6RA 3W6YA 4GCXA 4YYCA 4AX7A 5HA7A 1TMQA 1DXIA 1PX4A 1O12A 4QXIA 3UZYA 1A5LC 4ICCX 3WD3A 3FK4A 1LOSA 2ZC8A 5CH9A 1XYAA 3E5PA 4WHBA 1KFJA 1W3NA 1XM3A 3CUHA 3I68A 4DJED 2CETA 2E7FA 2XSAA 1GOKA 2JQXA 3SN4A 3E96A 3PZVA 3S6DA 3OW1A 5BU6A 2BX7A 4LS1A 1F6KA 2WZEA 4KCUA 1OCNA 4I3GA 1OY0A 4CU8A 5M03A 2I17A 2UBPC 5BXPA 4LJ3A 1ZHAA 2QUVA 1V6TA 1BYAA 4OGZA 3P8JA 3G8EA 1K7XA 4IFKB 3S1UA 3HMCA 4O1AA 2H8ZA 4MJZA 1ZY9A 2JGYA 2NQZA 1XF0A 1S5VA 3UD6A 5E9XA 2KZHA 4B9YA 1SVDA 2PAJA 4ZQNA 1GZ1A 3GNOA 4M29A 1NEYA 1VS1A 2PTWA 3CT7A 1G4EA 5FF3A 1QI4A 1YYAA 1IWAA 4MWAB 1XFCA 4IG2A 1UZ4A 5FEZA 1ICQA 2RJGA 4DWSC 2KX9A 3TE9A 3W85A 3QPZA 1LRQA 1VFHA 1VYRA 4OBSA 3EPOA 1EBHA 4UIOA 2VCCA 1EC8A 3GVGA 3AXIA 3BGAA 2DP3A 4BK9A 1J5SA 3C86A 3R94A 5IDZA 5JBDA 3RM9A 1XCWA 3QMTA 2FJUB 1AD4A 3REQB 3EYPA 1MUMA 1XLJA 5A94A 3CUFA 3WQCA 4DJDD 3GIPA 2ZZ7A 1H2JA 2X30A 3LHUA 3WFLA 1B3WA 4ZBCA 3M5YA 3H2FA 3IJIA 2J27A 4MAVA 1YTKA 3VGGA 4HK5A 3SSZA 4XZIA 4WSJA 4DJDA 2EPOA 4HNOA 4C65A 3SFWA 3G1AA 3KHDA 4B5UA 3UWZA 4FNTA 4C1KA 2GWGA 1BKHA 1OX4B 1Q8JA 4M3PA 1KRCC 1WUEA 3AWOA 2WCGA 3HA1A 1EHNA 1TSIA 1OADA 2WKJA 3BCDA 2CWNA 3AROA 5AKQA 2ACUA 4EXAA 1ONEA 1JZ5A 3T2QA 4JTAA 3WF1A 2PD5A 3F2BA 2NSXA 5MKGA 2QYGA 3CZGA 2WC3A 1NIUA 5EBAA 3VE9A 2V5LA 2QT3A 4QNEA 2ZXQA 1ALDA 3AMGA 3MA8A 3VIIA 1FWIC 3PZOA 1PIGA 4N4QA 3IACA 2YXXA 2ALRA 3W7KA 1DJHA 3ABSA 4LB3A 3NM1A 1UD2A 3AIVA 2AQOA 3PNUA 2VQUA 3GH5A 4MKNA 5HWMA 4O57A 3WMSA 2Z28A 2BNJA 2HPIA 1GWJA 3S8HA 1UMYA 2QUUA 5LNSA 4LF1A 2FLIA 3AMKA 3WF3A 4I90A 2VR4A 4KBXA 4UTUA 2ISVA 2P8CA 3BAWA 5BU9A 3ZJ7A 3WCZA 1BYDA 3QM3A 1QMLA 1TV4A 5FESA 1SW7A 3VA8A 1R3QA 3EMCA 3T07A 3LGGA 1QPRA 5E09A 1B3VA 1TRIA 7ODCA 4PL2A 1X8CA 1TWSA 3BAIA 2FGLA 5G5IA 1YPXA 4CD6A 4KRTA 2YBUA 1GG0A 4W8LA 4PCNA 3AHTA 3WQPA 4UFLA 4IMAA 1L2UA 3NFUA 4LRTA 3JZUA 4FXJA 2PDXA 3QY7A 4CD4A 1PDZA 1H7RA 5EY5A 1WZLA 3TQ0A 1F76A 4IJBA 1AH4A 4M6UA 5CBJA 4AIBA 3SCVA 3OVPA 4JFSA 2ZRYA 4MJ2A 3GDBA 4NILA 3VKJA 2QJNA 3O16A 1LWHA 4EVZA 2QPXA 4BF5A 2YCLA 1E3XA 3KTSA 1A50A 1W1IE 2VTFA 3PPGA 4FXSA 2CBUA 2NVDA 2WB5A 3TYUA 3VC5A 2YL5A 8XIAA 4KCVA 3HM7A 2Z7KA 3P5YA 5DCDA 4NAEB 3I3EA 4RX0A 2GOKA 1JAKA 2JF6A 3L2MA 4W85A 1MW1A 3M0HA 1POJA 4KRZA 2G97A 4Q32A 2INZA 2CKRA 3N3TA 3TC7A 4X3ZA 5SWUA 4GUGA 4IHCA 4Q7IA 4KH2A 2PGEA 1V3LA 1MXGA 2CXEA 3LI0A 2CERA 3F4CA 4MOZA 5XIAA 4ZR8A 2AGTA 3R89A 1LL7A 4NJHA 4ZOBA 3KVKA 4DJDC 5LA1A 1R9ZA 1EOKA 3LMYA 3C61A 1GG1A 4O10A 4KF1A 1TPC1 6REQA 2OO6A 3BW2A 3P74A 5AVHA 2HNHA 1MVYA 1YLVA 4DZHA 2OXNA 3U2ZA 5CC5A 3QPEA 3WLHA 1RA5A 3K8LA 2FGBA 3FGCB 3EWCA 3AUJA 4HK6A 1LT7A 4JHOA 3CMGA 3LCLA 5BRBA 3MUY1 4I5RA 3FSTA 1EP1A 4ZQRA 3A4AA 2QVNA 1Z6KA 4A3UA 2ZDRA 1GJUA 3IIXA 9CGTA 2EJ1A 2J77A 1H0GA 1YDOA 1GHSA 3APGA 3NEVA 1RQBA 4GG9A 1QI2A 3R5EA 3NOEA 1MQPA 3KBWA 1NDZA 5GJPA 3VKBA 1OGSA 2EG7A 4KT2A 1CGXA 2IKHA 1ZP3A 2CPUA 5DMMA 4IQJA 3EX4A 3P67A 4NRRA 4CQBA 4OOUA 1AD1A 2WMIA 1JCNA 4YXGA 4Z1AA 1R86A 4GIRA 2HEJA 1ZBKA 4L4MA 1MW2A 3W87A 1VPQA 1GOMA 3MI3A 1EGZA 4F0MA 3WF0A 1EDGA 2A3LA 4R7WA 2VGFA 2PZ0A 3TEVA 2JF7A 4OECA 4BQ3A 4YTUA 2QIIA 3CZKA 2AGKA 2HE8A 1R46A 4O1DA 3FEMA 1CECA 1A80A 4M19A 2PDIA 4FOUA 4XQ6A 4WKHA 2VZUA 1HF6A 4MPQA 3L12A 2W61A 2QMJA 3K2GA 5TAOA 4C1LA 2OQLA 3B4UA 1LOQA 1L6FA 1F9CA 3UXDA 1NAL1 3ZLHA 3S3GA 3S5YA 4ZQMA 2Z1SA 4QLJA 3EWZA 1QTWA 1NOWA 1YNPA 2QXWA 1EEPA 3HTWA 3LK6A 5AECA 5IXEA 3NDYA 2WZTA 2PEVA 1S39A 4DZ5A 1VBJA 4V33A 5BW6A 3AHYA 4D1IA 3TWBA 2PDUA 2WBGA 1KNWA 1FDJA 4P2VA 1Q7MA 1C3FA 1KC7A 4C7FA 3MVTA 3VIKA 2WLYA 3BVJA 4F9DA 2ZBTA 4FS9A 2QCEA 4M6VA 4HD5A 4H7VA 4XZNX 2DUXA 4J4KA 1W3KA 1XBXA 4RXGA 3FDKA 4MY8A 4BS0A 3OLGA 3SAZA 2P10A 3LU2A 5J5RA 3K1DA 1RVGA 1CWYA 3CGTA 1IT8A 3N9SA 4PTMA 4J28A 3A5FA 3D5HA 5C2GA 4JQ1A 2C0AA 1P5BA 3BLKA 3T55A 1YNYA 3N04A 1SUXA 3W02A 3HG2A 4QDMA 4B5TA 2ZFAA 1K70A 3P93A 5LNRA 3WNNA 1SZNA 1KXTA 1TV2A 3N73A 1AQHA 3VOCA 5D30A 1VYPX 1XJBA 3L21A 3S4TA 2OSYA 3Q65A 2VX5A 3HGJA 2V63A 1W1TA 1MZRA 1IEWA 5CSRA 3B8TA 3AIRA 2PMQA 3UQNA 1M04A 4MWAA 4U2YA 3CZ8A 3THUA 1ZZMA 4IMDA 3VIHA 1PYFA 4LANA 1ICSA 4PBFA 5CZ0A 1QNVA 1QBAA 3GTFA 2O9OA 3QW3A 1PTAA 3FXGA 1F3XA 4K7YA 5DY2A 1RCXB 1SFSA 5I2UA 3QW4B 1CX9A 3CYVA 4IWWA 2GJLA 3EOUA 1M5WA 2E1WA 4TIMA 3TIMA 3MV01 1ZAJA 3RF9A 1F7BA 4HTBA 1G01A 3NSNA 4PMJA 1W5QA 1YBQA 3VNIA 4MG4A 2QDHA 1RLDA 4R9XA 4QJ3B 3CXOA 4MY1A 3E2VA 3LZ3A 4XZBA 2EG6A 4ZL1A 3CWOX 1K4HA 1ZGDA 3ZQ9A 2ZVRA 1TPVA 4LXFA 4CQAA 1FWGC 1DYSA 1J10A 3PWIA 4NI8A 3W37A 3RRXA 4UMCA 3WQEA 1UUMA 1R47A 5KTLA 2VFDA 4AIEA 4Q7NA 1XIMA 4D6DA 4JPGA 3LCGA 1THFD 3T0BA 1W2PA 2XUCA 1KGUA 1ISVA 1OEPA 3BK0A 1DIKA 2V69A 3Q4DA 2ZX8A 4UMBA 4RE4A 3H2AA 1WXZA 1J18A 1QT1A 1FP9A 1DHPA 4PB5A 3TYCA 2EPNA 4K6AA 1XIHA 4UTTC 1IZCA 7ENLA 4O17A 2WKLA 1ZTVA 1N8IA 4AHOA 1FY6A 1J9YA 2G3JA 3BG5A 3IJ7A 2JALA 1E9YB 2Z7GA 3U7BA 3UPBA 1TZ9A 1HL8A 4JICA 1XG3A 3G2GA 3M0XA 3RDKA 1XFBA 4DBEA 1I2NA 2IPGA 3R8RA 2ZUSA 1EF3A 4Q33A 4W4QA 3ID7A 1DJQA 2BVYA 3NZRA 2O7QA 3CQKA 2G3FA 1AW1A 3IJQA 3URNA 4AB4A 1RSCA 1A5BA 3SQLA 4HMDA 3LYEA 1P0DA 4ZENA 4WUIA 3PJXA 5HQEA 4XTIA 4ZFMA 4V1YA 3AS2A 4WZHA 4W93A 1AQ0A 4HHPA 4UFMA 4ZE4A 1XSKA 3ZXWA 5I07A 3URQA 1J0ZA 4D9PA 2PDKA 4IIFA 1XSIA 1Q2SA 4E6MA 1XH0A 2YSWA 1W17A 4Q8MA 3EXTA 4F0KA 2Z6IA 3MBFA 3Q67A 1CB2A 5EYWA 1HG3A 1KM4A 1UWSA 1KR1A 3V75A 4U4MA 3RAOA 2E8YA 3DFPA 4X9YA 4JTIA 3ZT5A 3G1SA 3W7HA 1OYCA 2CCRA 3IGSA 1W5NA 4A2SA 4XSMA 3L66A 1UH4A 1JUKA 5I78A 3BQ6A 5HMFA 1V6YA 1DE6A 2RGLA 1YX1A 3W7MA 2D3NA 2V8ZA 1T8QA 1SPQA 3I3BA 8RUCA 1OFAA 2H90A 3BV7A 3VKAA 1RP9A 4JKKA 1GTHA 4B2DD 5BNKA 1CPUA 2Q6ZA 4B5VA 3MVIA 3RU6A 4PFHA 2PURA 3QKEA 1JYNA 1EGMA 1O4UA 5C9WA 3MO4A 4TTUA 1LCOA 1GYNA 1N2VA 2VEPA 3HQPA 5TQLA 4C60A 3THAA 3M4HA 3MHUA 1EEXA 2DSUA 4HSNA 4YHGA 2PU0A 2PDCA 2QUNA 3QC0A 3WO8A 1JCTA 1I1XA 1JUEA 1J6PA 3VOHA 1JD7A 1JAEA 2ZWZA 5FSDC 1VPYA 2QQ6A 1GOXA 2J24A 2PDQA 3W83A 5JH2A 1W1VA 4JQ2A 4LVDA 1JZ6A 1D8WA 3TTYA 3GDKA 1WDQA 4JBRA 2IMRA 4XO6A 2BY0A 4HYVA 3H2CA 1ZFJA 3KZSA 1TWWA 1F6YA 5AHNA 2V9DA 5L6UA 3JU2A 3UGVA 1H7NA 3SCSA 4MNMA 2REQB 2G96A 1OYAA 1Q3NA 1XYLA 3EZ4A 3ZT7A 1W1YA 2JGQA 3C52A 4QBXA 3B03A 1BRLA 1KRBC 3EDKA 1G4TA 1S2AA 4DQWA 3JRKA 1E43A 4HMCA 2E5DA 3FV9A 3E2RA 1FWSA 5HMSA 1GW1A 1Z89A 1DXEA 1AW2A 1HKVA 1Q6FA 4O18A 1IZJA 4ZO7A 1E0UA 4UR8A 2WSYA 1ISWA 3CEPA 1W9VA 3FGCA 2YW3A 2Z1VA 3LHYA 3N9KA 3OYXA 1LUCA 4X60A 4W87A 4KPLA 1O94A 2Q71A 4ZQCA 5F2IA 1Q2RA 1YXCA 2DH3A 5CPMA 1E6NA 4IT1A 2YJQA 2XIJA 4LUYA 3LA4A 2D20A 1LZOA 1HXJA 1E6SM 5HMDA 4C7DA 3GDMA 5C71A 5I3KA 1AQMA 4GI8A 5D2WA 4CQ8A 2X8RA 7TIMA 3QFEA 4DNMA 3TXZA 1YHTA 1ENUA 1FX6A 1A4MA 4LS0A 2I57A 4IUGA 1UPPA 1FWHC 3MCOA 1XP3A 1L6WA 4MIMA 1NFBA 2YCLB 4PUJA 1WDPA 4NRSA 1PBGA 4O54A 3C0LA 3U8GA 4GY1A 4O1EA 3IUIA 2WZMA 2R24A 2ON3A 2YX0A 4IFRA 1B2YA 2J75A 2QW5A 4GJJA 2PGWA 2BVTA 1GQLA 4AY1A 4NAEA 2F6UA 3NL5A 4IH3A 4CNSA 1WE5A 3PP7A 2QPSA 5L9FA 4C6MA 5LYRA 4H9TA 1BVWA 4D6EA 3LCFA 3DYOA 3L4WA 2Y8UA 1OZQA 3I10A 4AQLA 1EJVC 1PVNA 4PRWA 2A7PA 5CPOA 3W75A 4BI6A 3DHFA 3I6RA 5HULA 3ALGA 3C4UA 4XKMA 4JKMA 3QMRA 2D23A 3NSMA 4B5NA 3BTNA 2TAAA 3TH6A 1HKIA 4JNYA 3D47A 3SI9A 3AIWA 1PS9A 4AX6A 4UTLA 4IIDA 2CIPA 3KS5A 2ISFA 4JTRA 3UG4A 5ABTA 3N14A 4CCEA 4NP7A 3GBEA 2OWXA 4O1BA 1QASA 5DANA 5B7YA 1PXGA 1IV8A 4GJ1A 3OJGA 1FCUA 3W86A 1FWEC 1RPXA 6XIMA 1R9XA 3CV1A 4H9ZA 8TIMA 3S5NA 4BEQA 3M9YA 5CZKA 3QR3A 1JPMA 3NPUA 3VK5A 4JQ3A 1A5SA 4J3TA 5KZDA 3PBWA 4GIYA 2AOSA 3R8HA 3PTDA 5D33A 4D8ZA 1KXHA 4BA0A 4LH8A 5A6BD 4A3HA 1P4CA 3BARA 1ZJIA 3CS2A 3LPGA 5I3FA 2Z00A 2AKMA 2XDFA 2I9EA 1XRTA 4NX0A 3JS3A 1FTXA 2YZRA 3VXGA 4MTVA 4TVDA 1B3YA 1DWAM 1O5RA 2PC4A 3KZPA 1BXCA 4GUIA 4C6FA 1J01A 2QNEA 5C7VA 4OKDA 2DT2A 3STEA 2Q02A 1B30A 3TN3A 1VEPA 1HX0A 4ZB0A 3GTHA 1RY0A 3KCJA 3ATYA 3H2MA 3TX9A 2VC7A 5T91A 3WBYA 2IKJA 2P0OA 3W7CA 2E6FA 4K38A 5FAGA 1AH3A 2W9MA 3F03K 3JVAA 3TQPA 2CLKA 1V6VA 2PBGA 3FY1A 2F7FA 3UR2A 3FEQA 4LT9A 5F4SA 3PG9A 3SUSA 2J9ZA 2QV5A 1PCWA 4ROPA 3S9IA 2ODOA 5ECUA 1X7IA 3DERA 3VNJA 3WX7A 3GC5A 5D38A 4RDYA 2PDHA 3TYZA 1F61A 1KM2A 1RBOB 1XBVA 3NGFA 4WSHA 4B5XA 3W07A 3H7RA 2FZMA 4OWGA 4W9TA 1H63A 3T8QA 1Q5MA 1FDYA 2HDJA 4YTTA 5I77A 4C6LA 1TA3A 1I0DA 1K4GA 4JFUA 3EB2A 2J47A 2H9AB 1KB3A 2ABAA 3TOPA 2ZOXA 1CGUA 1UHVA 4MYXA 1AJ0A 4NZ3A 4XB3A 4IM4A 2IS7A 1UC4A 1W91A 1Z41A 3SJ3A 1AZ2A 1UCWA 3VFLA 1IT7A 1SYTA 2NQ9A 2QVHA 2D0GA 4KWWA 1HW6A 2E9LA 2INFA 3M64A 2NLIA 5TD4A 5G2IA 3CMFA 4I6VA 3KOFA 2ISSA 5LKYA 2PCQA 1REQB 1OX4A 1QPQA 3VU2A 2Z25A 1UQZA 4UTTA 1PZ0A 1K9DA 3W2KA 3A9BA 3ALFA 2PFHA 5HDRA 1VP5A 2OLHA 4OHQA 1BVNP 1LT8A 3P62A 1GKQA 2NQ5A 2X1TA 2GUUA 4ONVA 4DJFD 2H8XA 2C6QA 5EMLA 1ZJAA 2NV9A 4LEFA 3QLLA 1A3XA 3KHJA 1PSCA 1UKPA 3AYTA 3MUAA 3LG3A 4BF7A 3HFYA 1N55A 3FSUA 4DM2A 3CHVA 1ZU8A 4E5TA 2Z1KA 1BHGA 2WSKA 4ZMGA 2XWDA 1FH7A 3WUGA 2QDEA 1E55A 4UB9A 4H3DA 3RNDA 2HSAA 1NM9A 4G56A 3GFXA 3WH7A 3QV6A 1AZ1A 1T7LA 1O66A 4E2BA 3TQVA 1A3HA 4CVWA 1X6UA 5DO8A 1S2VA 1ZBCA 5D2XA 3EXRA 4HTYA 1DWFM 3R43A 1HP5A 1KM0A 1DXFA 2GK1A 3VABA 1Q6EA 3IJ8A 3THCA 2X2YA 4MZ8A 1TTQA 3U7VA 4GQGA 3VX1A 2WANA 1Y8BA 2C3ZA 1CXLA 4M0XA 1K6AA 3HPSA 4URIA 2CW6A 1B31A 4DUWA 1NP0A 1O68A 3W1NA 4FLQA 5BWAA 5CKSA 3KBMA 4GO8A 2C15A 3GR7A 2V68A 2IPWA 4GVGA 3SCNA 4Q7BA 4ZQOA 5CZJA 4PB3A 1PYMA 3I7SA 4L1GA 3KW3A 3GTXA 1J0JA 2XJ7A 3BAYA 1ITCA 3VKDA 4NXSA 2XFFA 4PCTA 1UWIA 4HMEA 3NQ8A 3F4NA 4R34A 3WDPP 4BEUA 5BOFA 4F48A 3IVUA 2DJLA 3W7LA 3HV8A 4BI7A 3V1HA 5AC6A 2R1PA 5A2AA 1KFEA 4RK8A 2WOQA 4PZVA 3G1FA 4JGDA 5XINA 2WPBA 4TX6A 4AD1A 3P6LA 4H9UA 5EBUA 4DEFA 5A6KA 1MZHA 4GABA 1NSJA 1G7VA 1V0MA 3TCSA 1SZEA 1TPEA 4WY0B 3OA3A 3TN5A 2Y7FA 1C8QA 2WMKA 3HQNA 4DWSD 5C5YA 2C18A 2ZADA 3VD9A 3KRBA 3RR4A 4XG1A 4ZODA 1RCQA 1ZALA 3A9IA 3AS1A 4EXBA 4ERAA 2OEMA 2XFWA 1DBTA 1Q45A 2O4QA 3ONBA 4NNAA 1X8FA 4BY3A 3OVRA 4DELA 1AMKA 2YDSA 1QBBA 4MZYA 4JTTA 1O5QA 3W74A 1IF2A 2WMIB 1MEWA 4A29A 1GORA 2YXOA 1LBFA 3C2OA 3DFYA 3NA8A 4PTWA 3QRHA 1J0YA 4IUOA 3OGVA 4G7EB 4NYYA 2RDWA 3UXIA 2VEMA 1AA1B 1JGMA 5HQMA 1GZJA 2VEGA 3QHNA 1Q4NX 4IX2A 3CMJA 3MC5A 4DM1A 4Q6JA 4I9MA 3IVTA 4RV8A 2DSVA 3UWYA 4NVTA 3FKRA 4JTKA 4ZO9A 1EIXA 1UOZA 4O53A 4XUGA 3SBFA 3GHTA 2ZRVA 1SFLA 2B4GA 5IM51 5C2XA 1XLCA 5CQ1A 4ZFCA 1LORA 1E6ZA 3PUOA 3W1TA 3HBLA 1GVEA 1IXQA 5LHEA 1Q13A 1QK0A 1JDAA 4Q8QA 3VD4A 3RMJA 2J62A 3WLNA 2VELA 3GVWA 3FN9A 3DECA 3BZGA 1XX1A 2GWNA 1KFBA 1OFQA 1YQ2A 3ORWA 3B8UA 4UNKA 2VOMA 1OC5A 2G8ZA 2DIEA 4IGNA 4PMVA 3NGJA 2GSHA 2P88A 1VBGA 1ZSXA 1O7AA 4LWWA 4MADA 3CHDA 4W8BA 3IUHA 1RAKA 4GH1A 4CCZA 4WF7A 1W3IA 3MP4A 3W7EA 2DUZA 1NU5A 1JNEA 3L5MA 4B16A 2DT0A 2BS9A 3TJ4A 5DBTA 3BGJA 3SN0A 5HWNA 3VIFA 1U1HA 4RL3A 1GNXA 3MWCA 3TN4A 4HZ7A 3TOYA 4DZAA 4UTHA 2PWUA 1VHNA 1P6BA 1CEOA 5FJOA 3N2MA 1W9PA 4REQB 4H2CA 3TN6A 1VF8A 3OVQA 4C1NA 2FB3A 4TQTA 3BQ5A 4N02A 4DF2A 1V3HA 5CPNA 3PPHA 3PZGA 2WC4A 5KETA 3IJ9A 4DIAA 5M3WA 1RVKA 3BLPX 1JCMP 4PEKA 1QK2A 2FZBA 5E0CA 2BGNE 3QSTA 4BJHA 2GUBA 1ZL1A 1QHZA 2DVTA 3LLDA 2X0HA 2X1SA 3UWVA 2HJPA 2A79A 3RN6A 1JCYA 2QJHA 2FVLA 1HL9A 4G6CA 5GJMA 5U4NA 1QHPA 1SZFA 1OIMA 2XVNA 1OSEA 2EPKX 1U5HA 4KW2A 5D05A 2A85A 3ZMRA 1V03A 3GC2A 4B4HA 3WN6A 3GNRA 2IXVA 2I5IA 3GUWA 4R88A 1JYVA 3DFOA 2ZUVA 1YW1A 4GO9A 3R11A 1WZAA 1E4MM 3O6YX 8A3HA 4Q8PA 4E2DA 1I8JA 1GOOA 5CC3A 4J3WA 4JKLA 1Z48A 2CNCA 4JN7A 2HBXA 1QOPA 3F2CA 4HA1A 4HNUA 2VD8A 1VKFA 3BJSA 4DJFC 2Y7EA 2YPIA 4L9YA 2AQVA 3G8RA 5JU6A 3L4XA 4X61A 4M51A 3SRHA 4GUFA 2WHLA 3V18A 3UZWA 5GNZA 4ROQA 1UP3A 4K2SA 4U33A 3OB8A 4HOWA 3GVQA 1KFLA 4QLKA 4GQQA 3N13A 2NT1A 3BAJA 4JIRA 4PMXA 2PF8A 3DGBA 1D7KA 2OVLA 3U3HA 3CV2A 1DORA 4JX4A 4JTSA 3KM8A 4O4WA 4L7ZA 3WG6A 3B06A 3MUZ1 3OGSA 5GQBA 5EFDA 4MB1A 3ZR5A 4CKQA 1J96A 3MMWA 4DAFA 1J8VA 2ZUUA 2PWFA 1OFRA 1KBJA 2DZXA 4FR6A 4OBTA 3BJTA 5A3HA 3E0WA 3QYQA 4KFPA 3Q37A 1EX1A 3DAQA 3JR2A 4ACZA 2Y5EA 4FNRA 1DIEA 4FP1A 1BKSA 2HISA 3KRSA 3G5EA 1UOKA 1PZ3A 3M16A 3NNTA 3VCCA 4GNKB 4GKLA 5ABEA 2QJGA 3RLHA 3PBYA 2XN2A 1AW5A 4HKPA 1WP6A 1KBBA 1GQKA 8XIMA 4NF7A 3UGRA 1XYBA 3ARUA 4LVGA 2XGIA 1LUCB 4P8VA 2X0SA 2A3BA 3K46A 3UZXA 2HPMA 3L4YA 3FJNA 2GFTA 1VEMA 2QCCA 5HJXA 4QG6A 3S1VA 1TPH1 1IEIA 1OF6A 3G24A 1W0MA 2FTYA 1ZB5A 2XM1A 3DKJA 3HJZA 3WNKA 1B54A 1EYEA 3A4JA 5A6TC 2VRJA 1KWGA 4EIVA 3SZ8A 2V2CA 2DY3A 3PF3A 1G5AA 3T7VA 1TV8A 1QPOA 1QDSA 3M44A 3HQOA 4DI8A 4DJFA 4PSRA 2R1LA 1ZQ5A 4LPCA 3IJDA 1MDLA 2QCNA 4LTSA 3ECQA 3W1RA 1RY8A 3A4WA 4XAZA 2HVNA 2Y70A 1WUFA 4X2RA 2BXYA 2J25A 1XLDA 3QEZA 3W1LA 4ZOAA 3A6OA 5H2ZA 1RJQA 3ZLFA 3OPSA 4AXKA 4HZMA 3ARYA 2PTYA 4MNKA 4GC4A 2CESA 1CB7B 4MWAC 2XSBA 1QXLA 4FALA 4KETA 3VI2A 3VGEA 3SY1A 4H04A 3WQDA 1W2VA 5FI8A 2CBJA 1R30A 1M7OA 1P6CA 3M41A 4UTIA 3B9EA 4FZIA 2AAMA 1J0HA 5A8MA 3ANVA 4UMAA 4JCLA 2FH6A 1RCOB 4K8EA 2OQYA 3GG1A 2CHNA 1NOFA 2VVSA 2INEA 1UQYA 2VOTA 1RD6A 2JIEA 4BF9A 4Q4QA 3LN3A 3ITTA 3BCFA 3T0AA 4S3BA 1A5CA 3KOYA 4J35A 4PMQA 1EO5A 3USZA 4H01A 1WKDA 4M82A 2O9TA 4Z2HA 4FNPA 4EOUA 3CASA 4JCMA 1VH7A 3LRMA 3GE7A 3W7PA 3CH0A 4H19A 1K8YA 2WVVA 3G18A 3A12A 1Z7AA 4JY8A 4W84A 1PKLA 3CPGA 1VAHA 3R10A 1OF8A 2X16A 4F0LA 2EHHA 3HPZA 2ZUWA 4P8XA 3QKZA 3A64A 1YRRA 1AJZA 3I3DA 4DNHA 1G4PA 2ZX9A 5AC7A 4INFA 2EO7A 3SURA 5JVLA 1YPFA 4UCFA 1HJVA 3H4WA 3RO8A 3BH4A 2OSWA 6CGTA 1GQIA 1D3CA 4CN1A 3BSMA 1RHCA 3W7NA 4WKFA 1JPKA 3RCNA 3GUGA 2Z1BA 1S5WA 3S0CA 2CLPA 5DCEA 2R8WA 2PBOA 3SY5A 4LAUA 4CNTA 2V2HA 3VUSA 4O50A 2PE4A 2QAFA 3FHAA 4B3KA 3BICA 2VX7A 3STCA 2BXZA 2BB0A 5FCZA 1NQKA 4IIEA 3ARSA 3T44A 1GT8A 3QFWA 1K77A 3MKKA 4K3ZA 3UVAA 4JFTA 1TIWA 2FZDA 4MSSA 4B5WA 1WO2A 3IUDA 1UH2A 3O2LA 4IMFA 4GFIA 3PR2A 3GNPA 4PCSA 3VOJA 1MRAA 2DJXA 3VZZA 1Q6QA 5HAOA 3WK1A 3OO2A 3F5LA 1R3SA 1C8VA 2EEXA 5TBOA 3W71A 2O4MA 4HB7A 2OEKA 1DOSA 2WK2A 4LY4A 1HNYA 4H8VA 1B3XA 3EKLA 3EX1A 4LS2A 3RUBL 2GGGA 4C6IA 2OYLA 4E8CA 1M03A 2E09A 1HO1A 2PWDA 1XIFA 3M0VA 2ONEA 4A3YA 1PB0A 1OJXA 3OLDA 3DFSA 1HQTA 5D02A 1KFKA 4LCQA 1DJXA 3CHCA 4N9CA 1EPVA 4H6KA 3NXLA 3BMWA 2OZ3A 4L6HA 4Q8WA 1E6RA 1GPWA 2YLAA 1DIOA 4C6BA 4HNVA 3GZ3A 2CFFA 2J7CA 5F2LA 1NFGA 3WBAA 3LB0A 2TYSA 3AXKA 3AS3A 2PLJA 1UIPA 2DSZA 1TVNA 3T09A 4C6QA 1CXEA 2HROA 1CLXA 5G1MA 5FIPA 4A4AA 1BXBA 4UTWC 4ORIA 1FHVA 3LOTA 1CZ1A 4CQCA 1DJIA 2ZUMA 4DN1A 3VMNA 3NDZA 4JN6A 4CUCA 1S3HA 3I65A 1HTIA 2BP1A 3LHVA 3DESA 2WVSA 2GL5A 1CI1A 1EJUC 3MYPA 1UKSA 3GZAA 3O06A 1U22A 4J3XA 1TWIA 5DXYA 2QULA 3GFYA 4RZ6A 1K9TA 3AO0A 5T9BG 4OE7A 1UZHA 2WXDM 2NSOA 4UTMA 4HU4A 2OELA 3SQMA 4LVAA 3WBEA 4PFMA 5E1QA 1M65A 4IXXA 2NT0A 5A6MA 4KEMA 3RG6A 2DT3A 3FX4A 3AYSA 1E71M 2G4FA 5D2VA 5G2HA 4WK9A 2PP0A 3LXAA 3YPIA 2WWDA 1OT2A 2CZFA 3R0KA 3LY0A 1PIIA 2HK0A 3UZJA 4HU0A 2P3ZA 2JBMA 4IQEA 3NPXA 1X97A 3PWGA 2P1FA 2WVUA 4J3ZA 1UZDA 1DQWA 1R2RA 3LCXA 1EC7A 1GVYA 1TX2A 4A35A 1UUQA 4W7WA 4H4IA 5HUPA 1G69A 2FMNA 5D32A 2I1OA 3LERA 1SO4A 1A0CA 1FOBA 5E6ZA 1QNQA 4JQ4A 3V4BA 1S2CA 1TV3A 1OG6A 1TZ7A 2B7PA 3O8AA 3NM3A 1OGGA 5I5RA 5CZTA 3B97A 3IRDA 4Q8NA 2R82A 3VYLA 1TFVA 2PRMA 4LYQA 5I02A 1KFWA 3T4WA 4PMOA 2PDNA 4L1XA 1ME7A 4MMWA 4GBUA 1K8CA 4ZGYA 1WNOA 1CXKA 5DLCA 4HBKA 1G9HA 1S2WA 1XR2A 3E02A 3VNMA 4WX2A 1R85A 1Q6RA 3NPVA 3DCPA 1QR7A 2XWEA 5F4WA 3VKCA 2J88A 4LAZA 4ENLA 1QRQA 5C9XA 3JZEA 2VGGA 2RAGA 3H22A 4MNLA 4A21A 1U2YA 3ERPA 5ABHA 1R6WA 1UKQA 4NZ5A 4ILSA 5IFPA 4O28A 1VBUA 4I7WA 1PKYA 2DZTA 4RZ4A 1CGTA 3RITA 4A3QA 3AOFA 2WJFA 4P7QA 4YCOA 1RUSA 3R13A 1B4EA 5BZAA 4PBGA 3WD2A 4B91A 3SUWA 4A2RA 1I2PA 2EAWA 2FZ8A 1GKPA 4J27A 3S9YA 1O5XA 3NL6A 3GYEA 3AICA 1GCYA 3GW0A 2ZZ4A 3W7DA 1R7OA 3RYSA 3RILA 3V0TA 4XD3A 2ZRUA 2D2JA 4MFDA 1XI3A 2QCMA 3QZAA 4F2UA 2J9YA 1J0IA 1VIWA 4Y8EA 3NQ2A 2VC9A 3EOLA 2A3HA 2J7EA 4A8IA 4HA0A 4JS3A 3R6IA 4DYJA 2CITA 4QCFA 4D6GA 5IBXA 4U2ZA 1GVFA 3FVDA 2REQA 1O60A 1XINA 2CZVA 3E0LA 8CGTA 2RUSA 3DN5A 3GNNA 1IWBA 3W7QA 1TPDA 1PV8A 4IQDA 2RKXA 3BLIA 5FSEC 3RLGA 2FPTA 4E38A 2I5GA 3TZNA 2CLHA 1TTJA 1VHCA 3UZ5A 1KTCA 2NVCA 4XZLX 2GGHA 5K9CA 2XYLA 4YWSA 3HF3A 4LYRA 1FHUA 3WDRA 5A8GA 4IP5A 2VQTA 4UZUA 3A23A 2VMFA 4AISA 5G1YA 2ISDA 2RDTA 1EUAA 3O7UA 2DZAA 4XZMX 5GPRA 3GKFA 3N1AA 1JFXA 3NWRA 1D9EA 1RK6A 3LHWA 2FGZA 5H8UA 1HZYA 1GZGA 5CZSA 2PS2A 3UYCA 1S1RA 4RCXA 2NX3A 3GW3A 4JEJA 3UCQA 2I16A 2F2KA 3WJXA 3TMQA 4M81A 3W2NA 3T2OA 3CUGA 3R0UA 4F66A 2YXGA 5DN1A 4AY7A 1RQEA 1YADA 3VGFA 1LWJA 2YB1A 5AB3A 3GTIA 4DLMA 5CG0A 3BSHA 2JKEA 3QTGA 3UG8A 1ZAHA 3WJYA 4AEEA 3EOEA 1EJWC 5EB8A 4MNJA 2AQWA 3C56A 1UWQA 2VURA 9XIAA 1NWUA 1BF2A 3VMOA 4W8AA 2CLIA 3PTKA 4F0RA 2EKGA 4F9JA 4UQAA 4B3LA 4GI9A 3O6AA 4UC5A 3CB8A 3TZFA 3MHFA 3SIZA 1WX0A 3KRUA 3A13A 4AMAA 4JX6A 3OIHA 1JQVA 4E3TA 3LRLA 1XYZA 1UP0A 3I7QA 4S3GA 4S3AA 1O1HA 1EXPA 4JYDA 4DXVA 1HKWA 4IPNB 4L1WA 1KTBA 3STGA 2BGSA 1NOUA 3WSUA 2Q8XA 1X7FA 1TJRA 4AHPA 4LUIA 4FEZA 3MMUA 4OZOA 2ZZ6A 3OP2A 1TKKA 2WM0A 1TO3A 5ABGA 2YLLA 4CNOA 4DB7A 1JDDA 4O4VA 3N4FA 4XWUA 5A6LA 3K30A 4UQDA 4KERA 3QV9A 4W86A 1UKOA 1B57A 1X1ZA 5HWJA 1FWWA 2Y2WA 1ISZA 5CPSA 3OEXA 4DPQA 3CLMA 2HXTA 1R3RA 1DWHM 2FPYA 1RJPA 3OZOA 3OBAA 3ES7A 5LNWA 3ARQA 4WDWA 5HPCA 4P61A 2W5FA 3H12A 3SCRA 1KLYA 4ZB5A 5HQLA 5IRPA 4GI6A 3PBMA 4PBEA 4V2XA 1XIEA 4IL2A 5HANA 4E8DA 3OBEA 1BGGA 4YN5A 4I6KA 4NJIA 4XISA 3DFQA 2FVMA 2RGMA 1XLLA 4Z2GA 7REQA 4FR1A 3WNPA 3H4GA 4PGLA 5A8NA 5EMJA 1CW2A 4LAMA 4N0RA 2V0TA 4Q4OA 2PZNA 2YW4A 3TTSA 4C7GA 1WKEA 4EPDC 3E2SA 4FIQA 1TWZA 4HMNA 1JPHA 1FVPA 3P81A 4M6PA 2Y4SA 5LIUX 2BSLA 2P53A 3AXMA 2PLCA 4UOJA 2ZX5A 4QE1A 4UQEA 3OBKA 5DBUA 4AVNA 3P0WA 4BR1A 3M7WA 3VINA 3TSDA 3W4RA 2WSRA 4MZ1A 5H6HA 3QZEA 3L5AA 3G1HA 1FXQA 1R3TA 4PTXA 4Q22A 3WLMA 1LG1A 5G4HC 1AJ2A 4KFOA 1M01A 5DMNA 3SECA 2IQTA 3EDJA 3ZZ1A 1BG4A 4QJ5B 2R6OA 1IYXA 2QLYA 3W1XA 5CC6A 3BAKA 1TCMA 3H54A 3O0FA 3WLRA 3MSDA 2ZX6A 3DDMA 5E70A 4IGHA 2Y7DA 4FSAA 3SRDA 3MKVA 2Z6JA 2F38A 1Z42A 4J3UA 4JTHA 1NWSA 1FUYA 2D2GA 1PO9A 3B8VA 4FNQA 3ZVHA 3REQA 3OOQA 4E0CA 2AAAA 3S47A 3FCPA 2QCLA 2J8GA 2X1UA 4FXFA 2J7GA 1K9EA 3OLIA 1FKXA 3C2VA 2OMAA 3FLUA 1FFRA 3NYZA 1RA0A 2O7SA 3LNPA 1RH9A 2A4AA 5AYZA 4QM1A 2ALDA 2QUTA 3GXFA 3V35A 3IWPA 2QMKA 3VNDA 1ESWA 3WD1A 5D9MA 4ORMA 2YBVA 1Z32X 2PWHA 2O9RA 3KE0A 1UR9A 2NV1A 4ML4A 5K7JA 1JUBA 1S5NA 1XUZA 1JDCA 2BG5A 4AZIA 1KCZA 4HSOA 4JTDA 3TW6A 4CLMA 3PAOA 1F3WA 4TVUA 1FDZA 1Z9AA 4TUFA 1UD3A 4RXFA 4DO4A 4WD0A 3NEHA 4BHYA 1VYSX 2OT0A 2OX1A 1C90A 4CCCA 3TU9A 1RALA 1NDWA 3O15A 2ZXDA 3B0YA 4JNZA 2DZWA 3TK7A 1TR1A 1XLMA 3BE7A 3B8WA 3F5KA 2PTXA 4XTDA 4ECLA 1R3WA 4FOKA 1KBKA 1V0NA 4Q4SA 3SRFA 2CLOA 3W24A 1WPCA 5FJJA 3LRKA 3QLDA 4J2MA 3B0XA 5IHSA 2E1DA 1W37A 2NX9A 3N4EA 3O9NA 1TVLA 1UIOA 1XIIA 2F61A 2J6XA 2NXIA 5DXXA 5K4XA 2Y0FA 2Y5SA 3P61A 3WLKX 3OVGA 1PTGA 1L8NA 2J8FA 4LUSB 3UWUA 2WQPA 1HP4A 3V0UA 5IBXC 1D3GA 1KQYA 3TLLA 3VKKA 2C7FA 2VFGA 3LENA 3ATZA 5C8BB 4FA3A 3WUFA 1UD4A 5AN7A 3GK0A 1FWTA 5C55A 1H1ZA 5DFAA 5FAJA 1F3TA 3AHVA 3TONA 3G1DA 4Q8UA 3QOKA 1XL9A 1TJ1A 4XZHA 4QE5A 3EPNA 4Z2LA 4KKXA 3GAYA 3V5OA 1R2SA 2A7NA 4ZO8A 1FWBC 3QQ0A 4R9OA 4TU1A 2GK1B 3RX3A 3TYDA 2X1IA 1XBYA 5DT5A 3IIZA 2V5BA 1NDVA 5EU9A 4YU1A 3CL6A 4PRTA 4M24A 3DIPA 4IFOA 2OOFA 1KW1A 3DFTA 3HJEA 4AC1X 5ENLA 1BGAA 1NTHA 4WEVX 1XC4A 3C0QA 3JW7A 3EOSA 4HPXA 1JYXA 2OKTA 4HJFA 2W3ZA 1KA9F 3M47A 5DT7A 1V7YA 2WKGA 1P0NA 3ZJ8A 1S5MA 3MUCA 5FD0A 2WHMA 4ATWA 4KEZA 3EX3A 4WRHA 4GZ7A 2WSPA 4H8UA 2QJJA 1OD0A 3GAKA 4RE2A 1KCXA 3MP3A 3N2BA 1UR8A 3LM7A 4AEFA 4QROA 3KCLA 2WLZA 4A3RA 5J04A 4HCDA 5CPTA 1A5NC 5A1AA 2E6AA 2F6KA 5JIWA 3TAKA 1SR0A 4AIOA 4WXYA 4ZXOA 1RBAA 4DJEC 4QAIA 5LXXA 4M7SA 4O13A 3UY7A 3UG5A 3MI2A 2P50A 3M46A 2BVWA 3QSRA 4REQA 3TROA 4D6FA 1G94A 1XIBA 4QDWA 4E4PA 4WVXA 1VBHA 3T4CA 1EXBA 1WYIA 5C9ZA 5DF0A 3CH9A 4XIAA 1H5VA 2HWGA 4LUTB 1PKMA 1VCGA 1Y0EA 1R2TA 4NZ1A 1T6MA 3HV9A 4AUBA 3C3NA 1SR9A 5EPDA 1FA2A 3RR1A 4Y2WA 2OB3A 3UXKA 3PTMA 4LC6A 4GGHA 5M1TA 1Q7QA 5TF0A 3LQLA 3G0UA 4HJWA 3NOYA 3W6LA 4HU8A 4MUPA 4YPJA 2DEPA 1X1NA 1EC9A 1T99A 3APTA 5AC8A 2CLFA 2C1GA 4IG2B 3UJFA 1P0EA 3P14A 1U5JA 4IXHA 1H3GA 4OQVA 2WMFA 4O0QA 1TV7A 3SGZA 3N29A 1HVQA 1Z44A 3FAXA 3PB2A 3K1GA 4AD4A 2XPKA 1LQ2A 1W9XA 2FKPA 1U30A 3S5OA 5EMYA 4M8UA 3PC0A 4G9PA 4PUDA 1X98A 1PAMA 3GRIA 4A22A 2PTDA 4HOZA 1KTNA 2E67A 5G1TA 2ZQ0A 5HNRA 3CPUA 2X0YA 2WAGA 3DYMA 2BY1A 1OZMA 3T1GA 1V6WA 4BZYA 1EHAA 2NUWA 4QEHA 1DJYA 2X09A 2ATSA 1W1ZA 2HQAA 3FXYA 2OKOA 5G2WA 4ADUA 1W5OA 1OC6A 4XKYA 4C6JA 4PL1A 3SFKA 3CZLA 2F8QA 2E25A 3AISA 1W9DM 4IZGA 3T78A 2XH7A 3K13A 5A2CA 4AZ5A 4H9XA 1GQNA 1TG7A 2ZRWA 4YJ5A 5DMYA 1CDGA 2B81A 4YVVA 3WQ8A 1HJUA 4MKSA 2Y7GA 4WXZA 3ZVIA 3M0MA 1ZCCA 3USBA 1BTMA 3VDHA 1ODZA 1KLZA 3IIOA 4KIRA 4DPPA 5I00A 4G2DA 4JDBA 4CNPA 2HVMA 4HNCA 1FCQA 1K7FA 5XIMA 2GQ3A 3E74A 2J9XA 1O95A 1FH8A 3VIMA 5A8OA 2VEFA 5JUVA 4F0SA 1EWEA 4QP0A 1T40A 3U2EA 1GOIA 5AFDA 5EGRA 2Y1HA 4YCPA 1WKFA 3TYBA 2WQDA 1UZ1A 4AD0A 1VJSA 4ERGA 4OV9A 1E1CB 1SO5A 1IWPA 1XG4A 5LSMA 3TJLA 4EWJA 4QRNA 3TMLA 1QAPA 3QGKC 2QCGA 3GFZA 1QOQA 3V3WA 3MSRA 1PX3A 1V6UA 3VC6A 2EPLX 1E70M 4FOJA 4G8TA 1VLWA 5CCZA 2E68A 5LZLA 2QZRA 3G1XA 4D71A 3XISA 1GEQA 4RKAA 3H21A 1XUUA 1JGIA 4PUWA 4NG3A 4DXXA 3K4DA 5DRIA 1B9BA 3QPYA 3CWHA 2FZNA 2VFEA 3B8DA 3GO2A 3KLKA 2YR1A 4YWIA 3PVFA 3U48A 1R3YA 4OJYA 2ZTKA 3M43A 4OTKA 1ECQA 4O16A 3PPCA 4DJEA 3J7HA 3EX6A 4QG8A 3K8KA 1EOMA 1GK8A 1X96A 2VDGA 3LTPA 2D22A 2XM2A 3F7JA 1A4LA 4HPNA 4J5NA 5D4YA 3WBXA 4GACA 3WQVA 4LYKA 2VNCA 3PZ9A 3ES8A 5K9XA 1FWDC 4XD6A 1J2WA 2NWSA 4QTGA 1G6CA 1UR4A 4UQ9A 3NZGA 3KXQA 3FDGA 1JPDX 2GGIA 2X1RA 2VEKA 4GINA 4WR3A 1IGSA 3KWSA 2XVLA 2Y63A 3CO4A 1XDMA 1VENA 1E9LA 1VJIA 3WY1A 2XH2A 3S5SA 1UA7A 4EACA 1WKYA 2GJPA 4AWSA 4O14A 2V5DA 2VGIA 1QFEA 5I23A 3AIQA 3DI1A 3TTEA 1F74A 3S2NA 1EDQA 2ZE3A 1GJWA 4KS0A 4GQ0A 2CC0A 4B90A 1BYCA 4CNNA 1HL2A 3SRKA 4AIUA 2R94A 4I9TA 5BOEA 5D8ZA 5I09A 2DZPA 3GG8A 2XVKA 2DIJA 3W70A 3UFYA 3N3MA 1KO0A 4L80A 5CLWA 1KKRA 3T81A 5HOSA 4P8WA 4MVAA 1CYGA 1E1FA 1OX6A 3CQHA 2IKGA 3KTCA 1BFNA 1QI0A 4O15A 4P7LA 7A3HA 4WQ6A 3UJSA 3KOXA 2GDVA 1J11A 2DSKA 3AJXA 3CJPA 5E0KA 1EA0A 3LCHA 1C9DA 2QJIA 4WDXA 3EDFA 2W4XA 3H53A 1PZ2A 2ZICA 2VCBA 4NXKA 4UFJA 1EH9A 2PWGA 3M0IA 4WKAA 1XKJA 4H7ZA 2CU0A 4ICMA 3G77A 1PE1A 2PWVA 1QJWA 3P0XA 2R14A 2X42A 1HJSA 2E3ZA 4EF9A 3H4XA 4LBRA 2G3MA 4UWMA 3DI0A 3UNTA 4V1XA 1NDYA 1T5AA 2UWFA 4IOTA 1GKRA 3BLDA 6REQB 5I3JA 3WFAA 3B9AA 3C2RA 3ZM8A 4GKTA 3W81A 1GVQA 4PUUA 4HA4A 3RX4A 2WZHA 3GVVA 3UNDA 1MUWA 1AFSA 4FPSA 1LJYA 3KOWA 1V7AA 3NDOA 3QYSA 4I5UA 2I7GA 1IT0A 4GX9A 1P6WA 3W38A 1I2RA 3A4XA 2ZZ3A 3S9ZA 1DJWA 3GY1A 2WNNA 3GM8A 5G4WA 2EQDA 2QDDA 3QTPA 2VJXA 5FL1A 2VC6A 4D8AA 4EPBC 5JQ9A 1NARA 4D6JA 4N2YA 1Y65A 4F8XA 3G3MA 2QAPA 5I0DA 1OINA 1G1YA 3KL3A 4MB3A 3O0KA 2HE5A 4GOAA 1IGWA 4IPLA 2OSXA 4IMCA 4GXPA 3KDNA 4EF8A 3P82A 1GPFA 3M7SA 3W1PA 4FLRA 1UD6A 3NZPA 2YL8A 3UU0A 1EQCA 3RU8X 4ZTYA 3FAWA 3NO5A 1OB0A 4DWDA 2HS6A 2DORA 1UBPC 1DJGA 3SQSA 4X63A 3SCTA 1I45A 3WNOA 4HN4A 1EBGA 2VR2A 3HG5A 4XAPA 1MXDA 2D3LA 4F0HA 1DKWA 2J7FA 2DQWA 1C9WA 3C2FA 4PYSA 1V79A 4EXQA 3FA3A 1L6SA 2ADAA 3S2CA 1P0KA 2ZWYA 3U9IA 1FKWA 4JD4A 1YPIA 4KWUA 1RP8A 2A0NA 5ECVA 3M0ZA 5I06A 1YTEA 1DWIM 3R25A 3ARVA 3I6TA 4AU0A 4LV9A 5FF4A 2V5JA 4Q4PA 2Q8LA 3S1XA 2PGRA 3BUVA 5JXQA 3EB4A 4AAJA 3KL0A 4W7VA 1A5UA 1KM6A 4FX7A 3AZSA 1FWNA 4A05A 1QNPA 1QO5A 4HYWA 4GYPC 1XWYA 3U5YA 3BV4A 4GVIA 4DVOA 1P0BA 5CXPA 3P8IA 1G0CA 2O56A 1OQFA 2FFIA 2IUZA 4L6DA 5JIPA 2MUCA 3WDQA 3L4ZA 4DBSA 3EWWA 2IXUA 4Y6GA 2PLKA 2FDSA 3MV11 4OFCA 5K3VA 1A49A 5C9UA 3EWXA 2PDWA 1QI3A 2X7VA 4O52A 1SU5A 3URBA 1LL6A 1FRBA 2UZ9A 3MTWA 2FYMA 2Q09A 3QXBA 1AQFA 2XHYA 3BOXA 3U0HA 3RJYA 4XVEA 2A5HA 3PK7A 3FJ6A 2ZX7A 1VB9A 1S2UA 4L6OA 5KZMA 3B0PA 2DU2A 4S2BA 4HZ6A 1FQ0A 4AD3A 3CL8A 1L6YA 2PLMA 3I6EA 4MGGA 3WUBA 2CXGA 4LW7A 3VD5A 3W2UA 1AK5A 4Q8TA 2EKCA 3MWAA 2Q3OA 4S3CA 1MFVA 3WFZA 1XCFA 4LCRA 3ZR4A 1WDRA 3UA4A 1YTDA 3B40A 4QE4A 1UMLA 1C93A 2JFEX 4C6NA 3MS8A 3ZJ6A 4D2JA 1W1A1 2PD9A 4CGTA 1YXDA 1M53A 1E3ZA 4D6HA 1B0IA 3GHSA 4LAKA 2IKIA 3GNXA 3VNZA 1M41A 2J78A 2TPSA 3R79A 1DHKA 3IARA 4GI4A 2OZ8A 1SSGA 2DH2A 3LHTA 4X0VA 2OZ0A 1IEVA 3Q94A 4C6OA 1BF6A 3IANA 3OLEA 4K8HA 3CM4A 1N82A 4LNYA 5JBFA 3PUGA 3SJNA 4H6RA 5F2GA 5C2CA 1L2QA 2GGJA 4TOQA 4ADSA 3FKKA 3NQGA 3PN8A 5AHFA 3NQMA 1SJBA 3TSBA 3KBSA 3W3OA 2AL2B 2GZXA 2WO5A 1ZCOA 1DJZA 2VYOA 3LUTA 3CEUA 1N8WA 3VIGA 4D72A 3DX5A 1H7WA 1WBJA 4QFUA 5A6S<