4NHVA

Crystal structure of b. anthracis dhps with interfacial compound 4: 5-(trifluoromethyl)-1,2-benzoxazol-3-amine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Identification and characterization of an allosteric inhibitory site on dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
total genus 104
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4nhvA00
4DJFD 2YCLB 4C1NA 1F6YA 4PZVA 3V5OA 4C1NB 4NIRA 3TYCA 3H26A 2DZBA 3TZFA 1EYEA 1Q7ZA 1TWZA 4DJDA 3TYAA 4S3FA 1TWWA 2H9AA 1AJ0A 2BMBA 4S39A 3TYDA 3TYZA 1TWSA 3H2OA 4DJDC 1AJ2A 4DJED 2DQWA 3H22A 2YCJA 1Q8AA 2DZAA 4S3AA 4S3EA 4DAFA 2Y5SA 4D8AA 4DAIA 3TYBA 2YCKX 4MWAA 2Y0FA 4MWAB 2H9AB 4S3DA 4O1EA 3NOYA 4MWAC 2YCIX 2VP8A 1Q7QA 4S38A 1AD1A 4O1FA 3TYUA 3H2FA 4DJDD 3H2NA 3TZNA 1AJZA 1AD4A 3H2EA 1TX0A 4DJFA 2E7FA 3MCMA 1Q7MA 5JQ9A 4NHVA 3MCOA 4NILA 2VEFA 3BOFA 4DJFC 3K13A 3H2MA 4S3BA 3TR9A 2YCLA 1Q8JA 4CCZA 3MCNA 3H2CA 4G9PA 1Q85A 3BOLA 4HB7A 4DJEA 3H2AA 3H24A 4MWAE 4MWAD 4O0QA 1TX2A 3H23A 4D8ZA 4D9PA 4NL1A 2OGYA 3TYEA 4DJEC 3H21A 4DB7A 2VEGA 4S3CA 4S23A 2Y5JA
chains in the Genus database with same CATH superfamily
5AN7A 2DGAA 4U31A 1MNSA 1F2JA 3K8LA 5AHMA 5LNUA 2GYIA 2WWDA 1UB3A 3KZPA 1B4KA 2HVNA 1GQNA 3A21A 4GQBA 1NWTA 2QJIA 2VELA 1BYDA 1Z48A 1TWSA 3EWZA 5LIUX 5G5IA 3DECA 3AC0A 4E3VA 2IPFA 4O1BA 2DU2A 5FAGA 3WO8A 5CBIA 1SO5A 1JYVA 3LTSA 2EPKX 2X7WA 1CLVA 2HJPA 2OO0A 2QZRA 1KTCA 3EMQA 3W1MA 2QF8A 4Z2GA 3WD2A 1CWYA 2Y70A 3BUVA 1L2QA 1P0DA 3W1NA 1NH6A 3ZLFA 4Y96A 2EG8A 3EB3A 2X41A 4BEUA 4C6JA 3ATZA 1KWGA 3AMCA 3LI1A 1OX6A 1FHLA 1V6WA 4QS6A 1WXYA 3VE7A 2A6NA 3TNOA 3GWQA 3GG8A 1JULA 3RK8A 2PWVA 3G1VA 3IIVA 4KWUA 4JHMA 4N0RA 3WEZA 3DG7A 3AWNA 3F4DA 4U4MA 3KS5A 2FJKA 4LPCA 3VZZA 4PRTA 3PTKA 2CLEA 3U4AA 3V75A 1US3A 1EWDA 1RCOB 3P61A 3P5YA 4ZMGA 2B7QA 3OZMA 3ZLGA 3IIPA 3LY0A 1V3IA 2WJDA 3SEPA 4D6GA 3WELA 1X8CA 3UY8A 1Q6GA 2BASA 4HOZA 1UKTA 4J3ZA 1TWWA 2P88A 3UXKA 4PRRA 4ICMA 3PZVA 4LH8A 3H6OA 4HZMA 3BVJA 3D6NA 4YU1A 4GE8A 1CGWA 3NXFA 4GIEA 2PDXA 2A79A 1EGVA 2XN0A 3TJIA 1A0CA 3PZ9A 4O18A 4D6IA 2HRWA 2DW7A 3C0SA 5ABHA 4R5EA 2D0FA 3TA6A 4O1FA 4Q8MA 3HN3A 3AXIA 4O8AA 3JRKA 1O6IA 2PTXA 4HN4A 3TDFA 3WUEA 2AKZA 1Q63A 1VFMA 4GA8A 2DT1A 2VCAA 1F3TA 4LUIA 3HFTA 4GACA 1HJWA 1QNRA 4R33A 1ZJHA 4MPQA 3QJAA 1U5JA 4AZ7A 2BY2A 2XN1A 4PMVA 3H12A 4HSOA 1OCNA 4ORIA 4MWAE 5BRQA 3TN6A 2BS9A 4I90A 3CK5A 2DIEA 3TMLA 4EAMA 1J0HA 4TTUA 2DV0A 2WJEA 1S2WA 5DFAA 4G8TA 2BZNA 3KVJA 3WQCA 5EMYA 4C1KA 1TV4A 5I7GA 4B15A 4BFAA 1WDQA 5T91A 2PD5A 1OCBA 2BFGA 3KCJA 5AC6A 1W9BM 3CZLA 5F2LA 1ESWA 5HATA 1XV8A 3C0JA 1DJQA 4LAOA 4G1NA 3H8AA 3LGDA 2DSWA 1JNEA 2DPEA 4GYKA 3U3HA 3LHYA 1SFSA 2QEZA 3UETA 2CIPA 3BICA 3LQGA 3ARSA 3QXBA 3ICJA 3MP5A 1J11A 1ICQA 3VUPA 1OY0A 3BXWA 1JCXA 2V0TA 4DQWA 1ADOA 3NOEA 3KP1A 1GVIA 1UH4A 3W7QA 2ZKMX 3E6EA 3NQ2A 2JK2A 1M03A 1PAMA 2HROA 2NVCA 1MQPA 3FJ6A 2HQAA 1J0KA 5HBFA 1E0XA 4FNRA 1T8QA 4RX0A 3IIZA 4HA0A 3DHUA 3W24A 6CGTA 1R3VA 2BHYA 2P1FA 4B5WA 1XCXA 3BWWA 3S9IA 2C7FA 1KR1A 3LV5A 3GS6A 2CZEA 4UZSA 3KVMA 2YL9A 5E5CA 3AMGA 1VC4A 2VXNA 3P80A 2A21A 4GH1A 2WM1A 2VFEA 4W93A 3P67A 4DPQA 2R1LA 3WK3A 5DRCA 1REQB 4O57A 1Z69A 4KIEA 3UNTA 2AKMA 1CGXA 3NM1A 3I6TA 5I03A 3TWAA 2DZBA 3BLLA 3O15A 2W61A 2FDSA 4XZIA 5CPOA 3WD3A 1NOFA 2YBUA 2YXOA 2E8YA 4C7FA 3SADA 3U2EA 2J7BA 1QI5A 1FWCC 3KWXA 3IGUA 3W1AA 2WLZA 1JCNA 4DWDA 3UA3A 5H1WA 1E6SM 3LHZA 3MT1A 4QCFA 5CJNA 2YCKX 4LOCA 1L6FA 5AHIA 3PBWA 5K4ZA 4N6FA 3WJZA 3AZRA 1JJKA 4WOQA 4X63A 1WPCA 5J5RA 4KWSA 1Z3NA 1KGWA 3QHOA 3BW4A 5GJNA 1OZMA 3D3AA 3GD6A 2E7FA 4C91A 1LWJA 1TPC1 1P6BA 1ZBCA 3E0VA 4GYPA 3C2RA 2Q09A 1UP2A 4LVGA 4D1IA 3WMSA 3FGCB 2ZWYA 9XIAA 3UWZA 2BXYA 4PUNA 3VMOA 1QPNA 3B9NA 2VFDA 4Q4OA 3W87A 2ZRWA 3GIPA 2VWTA 2VEMA 2OGJA 4CKQA 2VRJA 1OWQA 1E1CA 2WWCA 4F40A 4F3HA 2WVSA 1NARA 1XDJA 5EMLA 1SYTA 2DH2A 1QRQA 4IFRA 2ISFA 2P8BA 1FY6A 2NQJA 1RQEA 1SUXA 1Z9AA 4OOZA 1U1HA 3MMUA 1BKSA 3AS0A 2JGYA 1G4EA 5PTDA 3VDGA 3N3MA 1FWIC 4HZ8A 3H2OA 8XIAA 3IK2A 3RM8A 3G0XA 2WOQA 1G01A 4B90A 2Y85A 3DHDA 4IMDA 5IOBA 1EC8A 1VJIA 2BY3A 2BGNE 4J7RA 4FI4A 3WH9A 4H6KA 4IIHA 7REQA 1TJ0A 4TR9A 3CO8A 2FYMA 3AQUA 1JGMA 4ZOBA 3CASA 3RLVA 1GEQA 1R3RA 2J7FA 4IGMA 4JX4A 2ZUNA 3P84A 3MUY1 1UP3A 1SW3A 2JEPA 1V02E 3S6DA 2VEFA 1R3QA 3EEZA 4HOXA 2REQA 6ALDA 3FKRA 1IV8A 1EBGA 1JPDX 8TIMA 1FBAA 2VX7A 3BJTA 2PZNA 2H3BA 1TRDA 6REQA 4A21A 1XW8A 1IWAA 1QPRA 5BOEA 1BXCA 1GOIA 1IQ8A 3L66A 2WC3A 2GVJA 1CGTA 4RR4A 5HUOA 4XZMX 3TXZA 1ISWA 3MJYA 3SFKA 1S2UA 2UY4A 2ISVA 3BLIA 3CAWA 4EPDC 4JFUA 5CLWA 3W70A 3H7RA 4RL3A 4IL2A 4DYEA 1XIDA 2VRKA 3ZOAA 1QW7A 1LM1A 1TPWA 3LCFA 5G2HA 1EJ7L 5FF7A 2UBPC 3M46A 3AJXA 4M1BA 4S3EA 3UR8A 4J1OA 1PZ1A 1EEXA 3TV8A 4O8RA 3TLLA 3EEGA 2H90A 4JIPA 3S5NA 5C9UA 3TJ4A 5I2UA 1OEPA 1QHOA 5LYRA 3L0GA 1SW7A 1PUDA 3CAKA 4GO8A 1G4SA 2H6RA 4GIAA 3ANVA 2CBIA 3E2RA 1FWRA 3WLKX 4EPKA 1WZKA 4V28A 4BY3A 1FKXA 3FGCA 3WD4A 2X30A 1XLDA 1KC7A 3W9ZA 2VDHA 2W66A 1BSIA 1DWJM 5FEZA 3FHAA 2V8ZA 2C8NA 2OSWA 4IISA 3MBDA 1BF6A 2GQ8A 1TV3A 3OW1A 1O1ZA 2J6VA 3WUFA 3KWSA 1DXFA 4P7QA 3QKEA 1G4TA 4XISA 3JZUA 3OP2A 1VBJA 5KEZA 3U2ZA 4DJFD 2FFCA 3WQDA 2GGIA 4BF9A 1GG0A 1PZ2A 2VZOA 3JS3A 3WNOA 4PTWA 3M0VA 1ZBWA 1U83A 3W1XA 1LRNA 5LA1A 1C3FA 1TKKA 1YW1A 1M04A 4K8HA 5DBUA 4R7WA 2WNWA 4UQCA 4GZ7A 4Q6XA 3U48A 4NY2A 2HCVA 1YDOA 3PUOA 4L9YA 2WZMA 4DI8A 3DC0A 1S3HA 4MFDA 1XPYA 4L6DA 2CNCA 1P48A 4C60A 1TZ7A 3QMTA 1FUYA 1QHZA 3DIPA 1JDEA 5EFDA 3GBEA 5JXQA 1G9HA 3F03K 3TCSA 4CLMA 3TMQA 1FWSA 4D6DA 4ZZ9A 2EF9A 1EQCA 3EAUA 3SY8A 5I3IA 2AQVA 4K7VA 1V0LA 1P1XA 3HIJA 2D20A 4RE0A 4EOUA 4FX7A 5CZSA 4DLFA 2XSAA 4GLEA 2OSXA 1BG9A 1P0BA 2FZ9A 4DBWA 1QTWA 2BLEA 1TRIA 1P0NA 4CQ8A 1GKRA 4OBTA 1W1YA 2WMJA 5FF0A 2YLLA 1O1HA 5A69A 2FVLA 1OT1A 4NNBA 4CNNA 4F2BA 3P2VA 4Q4SA 3SO7A 5KETA 3PC0A 3QQ1A 3GG7A 1JUBA 3VIFA 2ZE3A 2Q02A 5XINA 3R0UA 3NL2A 4QDWA 4AHPA 4GO9A 4DRSA 5CH9A 3UWUA 4JTSA 1HTIA 3POCA 3IACA 4Q7NA 1QWGA 4AD4A 4Y9OA 3MZNA 3W2MA 4Y8FA 1GKQA 4DYKA 4K68A 5BZAA 4PMRA 2AL1A 2HE5A 3U57A 1GZGA 2VR5A 1OJXA 3U9IA 3UZ5A 3GO2A 3LRMA 3HOJA 4MKVA 1X7IA 4JTHA 4FXFA 5HR7A 3FSUA 3MHUA 2QCCA 4LS0A 1LBMA 3GVWA 4Q8VA 2BHZA 2B4GA 2W9MA 4QE4A 1S2AA 3IJ7A 5CC5A 4TTGA 4PA8A 3D47A 1GCYA 4AW7A 4QNEA 2CHRA 1VYRA 4XVEA 3FJLA 1C9DA 4S3CA 4L56A 3SGZA 4WEVX 2VOTA 2R94A 2NX1A 1KQYA 2PDHA 2EBNA 1AW2A 3ZS4A 3PBYA 2I5QA 3O0FA 4RUBA 3W88A 2Y61A 2Z4GA 1X96A 1XLLA 4IZGA 2I16A 1BWLA 2J6XA 1H5VA 2Y8UA 1G6CA 3PWIA 5HMDA 5CGTA 2DQWA 3V0TA 1I75A 4EAYA 2D2GA 3ABRA 3I6EA 4K7YA 5I77A 4JNMA 1GNXA 1E4MM 3CPGA 2OT1A 1B3WA 3DYPA 2WHMA 3PZMA 3TP4A 2FDMA 4RZBA 3VOFA 3TXVA 4IQLA 2PC8A 5BNKA 3M9YA 2VRQA 3DFHA 1JQXA 3T44A 1VRDA 3APGA 4JKKA 2J74A 2WKLA 3BANA 3PTQA 4O16A 3MYOA 1CXFA 1CGUA 4DM2A 2DUAA 1R38A 5A2BA 3F7JA 4NAEA 4LC6A 5XIMA 4ZO6A 1E15A 2D23A 3PBGA 3VK5A 2XN2A 1SMDA 4G9PA 3QHMA 1KCZA 4QS5A 4ERAA 1EHNA 2W27A 4JTCA 3OYXA 4KKXA 4TVDA 1V4YA 1F3WA 4DBUA 3TYEA 3WSUA 1Z8AA 3UXLA 2PLKA 5I79A 2OKOA 1HN1A 3IEBA 4AX7A 3N4AA 3G24A 5TF0A 1GJUA 5K9DA 1Y5XA 4UQ9A 4NP7A 2WPGA 3V4BA 1UWIA 2C14A 1XFCA 5IFTA 1GEHA 3CTLA 1VFLA 2XIMA 4PL2A 3TZFA 3FW6A 1UROA 4OHQA 1IZJA 1PIFA 4GMEA 4PMDA 1UCWA 1XYLA 2IKHA 3VZXA 2X7VA 4OJYA 1MDLA 3EMCA 1Q8AA 2WMIB 5FJUA 1CB7B 1EUAA 5ABTA 1K77A 2A85A 1GVSA 4WD0A 2Y5SA 4KWWA 1X98A 2QDEA 4MNMA 2CWXA 3MKKA 4C90A 1OVDA 2ZX8A 3LPOA 4FXJA 3PBVA 1NWUA 3QVQA 3W0KA 3C0QA 3PZIA 3BW2A 3G1YA 4MDOA 2YA2A 1Q7MA 1S5VA 1RP9A 2QCLA 3S2NA 2Y7GA 2PDKA 4YPJA 3LGGA 5A6MA 5K2ZA 3SGGA 3MMTA 2PWFA 3DFPA 3BMXA 2V3GA 3WCZA 4TU1A 4AWEA 4DB7A 3AS1A 4JIHA 3FDKA 1KB3A 3LCLA 1WP6A 1Q6CA 4NI3A 3SQMA 2NSOA 4MYXA 4R34A 3WF4A 4G2DA 1OABA 3TJLA 1QI0A 3CUGA 4NYYA 3BURA 2QGHA 4D6FA 3T7VA 2QVNA 3LSCA 4A05A 3ZT7A 4AZHA 1R7OA 1UIPA 1NJJA 1ECEA 1Q3NA 1X6UA 1QVBA 4LW7A 4GXMA 3RJXA 4HGXA 3GKFA 5D9PA 1TPDA 5CC3A 4Z2JA 2VI0A 3OODA 4DO7A 1B30A 3VC5A 1VYPX 5C9WA 2YCEA 1XD0A 3GU9A 4JTTA 4X2PA 2E6FA 1F7BA 1RA5A 1UD4A 3MI2A 2QUVA 2IMRA 4S3DA 3T9PA 4K8EA 3PK7A 1LROA 3N6QA 2QVHA 1NF7A 4ZO8A 1XYZA 2A7NA 3WJWA 1ICPA 1KRCC 3EXRA 2IUZA 1IE7C 3KFTA 1IT0A 2IXVA 3NZQA 4GUIA 2VDGA 2ZOXA 3MTWA 5DMMA 2QF7A 3ABQA 4LC8A 3UZJA 1HKJA 2VUYA 2G3JA 5BXRA 2WQDA 1YEYA 3L4ZA 4CVUA 3KS6A 2NXHA 4AF0A 3C61A 4D9PA 1HO1A 2P76A 2A3CA 3F4CA 3KZSA 2NQHA 3CS2A 3AIBA 3PZQA 4EF9A 4HJFA 3DG6A 4BKNA 4FLSA 1UUOA 1C8XA 3RPMA 4PMOA 4U3AA 2BVYA 2GVYA 5AC7A 5AYBA 1SR9A 3MVTA 4LAKA 1OHLA 3MUCA 4DBSA 2OODA 3VX1A 3ZWTA 2YIHA 2ZA3A 4WF7A 3FSTA 1BG4A 2HTMA 4QEHA 4H9MA 2ZZ7A 4TIMA 2YLAA 1O95A 5AZ0A 1KFBA 2V2HA 3BE7A 3ZSTA 4Z2KA 4UOZA 2BSLA 4JDYA 2ZXAA 2W79A 3UJ2A 1UD5A 4JCMA 3MV01 4ERIA 2C91A 2ZX5A 2XZ7A 3BOXA 3LB0A 3N6JA 3BSMA 2V67A 5C6MA 1ME9A 1WAUA 3FA5A 1KW1A 5AY7A 2Z7KA 3DFNA 1JQVA 2V5LA 1KCLA 3DKLA 1K8XA 1UR8A 3CV7A 1NWSA 4KWOA 2WHLA 2OVLA 3KBJA 3H70A 4ZOAA 1W9XA 4XZNX 4HBKA 3SI9A 1W3IA 1UD8A 3XINA 3L4XA 4LUTA 1E3ZA 4GY0A 3TCEA 1F76A 1ZP4A 4C6NA 4E0CA 4F79A 1VRXA 2IXUA 5AOUA 1JI2A 1OD0A 4OOUA 3C2YA 5FD0A 1RSCA 4ICCX 1K6AA 4HMDA 1PKNA 2I14A 5JMUA 1QUMA 1N8FA 2Y62A 1LQ0A 3UYCA 1K70A 3THCA 1ZPTA 1A4LA 3VYLA 2F8QA 1SVDA 1V8EA 4WDXA 1ZJAA 1Y8BA 4ORMA 3RIKA 4IP4A 1C93A 1RBAA 2FB3A 4WOZA 1VBRA 2GUYA 4DAFA 3VO0A 3PG9A 3G1FA 1N82A 4QDMA 2Z29A 2IPWA 5C9RA 3S5YA 3I4KA 3W2UA 1CW2A 1ZGDA 2YCIX 4KFOA 1QNPA 4L1XA 3WNKA 4UIOA 4Z17A 1TX0A 4WJXA 2C1HA 1K8YA 1CLXA 1UWTA 4PUEA 3HQNA 3G2GA 4LV4A 3A64A 4GZIA 1UOKA 4DZHA 3G0UA 2J47A 4FAMA 3R0DA 1UZ1A 4MFEA 3WLSA 3WYZA 3EOEA 2G4FA 4YVXA 2YPIA 3CQKA 1A49A 2VENA 3TVAA 5F4XA 3PJWA 3N25A 3TONA 1W9UA 1KXTA 3BLEA 2PP1A 4DBDA 3CWOX 3LXCA 2NWSA 4KGJA 1KV8A 1W5QA 1E9IA 1X1ZA 1X97A 3MI3A 1VH7A 2AAMA 1FDYA 4U3CA 4LYKA 1M3UA 3M64A 1P4CA 2YW4A 1F3EA 2E9MA 2PTYA 3YPIA 2DEPA 3N15A 3DOPA 4OBSA 1OK4A 1O66A 3WH5A 4ACZA 1OF8A 1R3YA 4U5IA 4LEFA 2D24A 2ZX7A 3QLDA 4AHOA 1UKQA 2DQXA 4M29A 4HU4A 4YTQA 1S46A 4DO5A 1BGGA 4R27A 3MSRA 1BPLB 2X40A 1RHCA 2YDSA 2XIOA 2NVDA 4EPEC 1J79A 3WF3A 1VBUA 3W01A 2PWEA 3UBPC 3DDMA 2JQXA 4Q4RA 4H83A 4FNTA 2P50A 4W9TA 2WW5A 1PX4A 4AZ5A 3CJPA 1EHAA 3NGJA 3QMSA 3CMJA 1YNQA 3P6LA 4M7SA 3WJYA 5FJTA 3A5VA 4IQJA 1F07A 1UZHA 5H8PA 5EMJA 3OIXA 5FL1A 3PJUA 1TA3B 3TQVA 3DHPA 2GWGA 4GVGA 4CD4A 3FDGA 2BNJA 2DT3A 1RZMA 3QW4B 4FLRA 3W7IA 3VILA 1HUVA 1WKDA 3C86A 3GNOA 2NT1A 4RZ4A 3NL6A 3B8DA 4GCAA 3LMYA 2A3AA 4KRUA 4R9OA 4PMXA 1IWBA 4GVHA 3CZ8A 3K5XA 3T07A 3NPUA 4H41A 1RD5A 1NDYA 2JKEA 4CD8A 1LLOA 1KKRA 4A29A 1D8WA 3CT7A 3GH7A 1W3JA 4H00A 4Y9MA 3QPZA 2DIKA 1R46A 1W56A 1KKOA 4FXRA 3B8IA 3DENA 3LHTA 4B3ZA 4YVVA 3BAKA 1CZ1A 3URQA 1R85A 3A5FA 1XINA 1W5MA 4GGHA 1E70M 3ZQ9A 3NQ7A 3R12A 1TFVA 1IGWA 3ARYA 1FWJC 2C6QA 1AW5A 3AUJA 4WDUA 5C2XA 3AU2A 5C70A 9XIMA 3QKZA 4W85A 4LUJA 5BWAA 4LUSB 2H8XA 3CHDA 5CSSA 4UZUA 3CZJA 3UF9A 2JGQA 2ZRVA 4PB3A 2D0GA 4YHEA 1PX8A 1LORA 4MMWA 3SUWA 1YE6A 3TFCA 4KESA 3I6RA 4QGCA 1MDRA 1TREA 3SSZA 2CZVA 3K4WA 3R94A 3BAXA 3ITTA 3NQMA 1ZJBA 2H8ZA 5LKYA 4JTLA 2EO7A 2DIJA 3QYSA 1LL4A 3GNPA 4IIGA 1PPIA 3GHRA 3L67A 3VU2A 2CITA 2CCRA 3VIKA 3QF0A 3JUGA 4ZTXA 2ZIDA 1Z42A 3M5XA 1TVPA 4Q8UA 5GPRA 4QEEA 2XVGA 1CDGA 2GVGA 3CZEA 5L9FA 1GTHA 4JKMA 4RNHA 3LBOA 4AD2A 1CPUA 2X0SA 3TYAA 2ZUTA 1XH1A 4U5KA 1V93A 4LSBA 3G1AA 4I9AA 3CC1A 4H6RA 1JF5A 3PTMA 3MDWA 5C71A 7CGTA 4S3JA 3AHXA 4XUYA 3HPSA 1NDZA 4IGSA 4AYGA 2QIWA 5CG0A 4H04A 3WLOA 3MUZ1 4AVNA 3OVQA 4C5YA 1UWSA 3KRUA 2QPXA 4J4KA 4MAVA 5EBUA 2YBTA 1XGEA 1HQTA 2BB0A 2E67A 3O07A 3WDRA 4RZ5A 1GOQA 4CQDA 1UMLA 1AQFA 4A35A 3SCTA 2RDWA 5DMYA 3V1PA 4AEEA 3IJ8A 1XLAA 3HJZA 4JQ1A 3GSMA 2GJNA 1OFQA 2XVNA 3CWHA 3THUA 1DPMA 3L21A 2FHFA 3N2CA 2OCZA 5L6UA 4DJEC 4AH7A 5ABEA 2QR6A 4TO8A 1DWGM 5K3VA 2GQ3A 1MZRA 3ELFA 5TD4A 5FF3A 4DM1A 3SJNA 1PJ9A 1XSKA 3C4UA 3C3UA 3O6AA 3NVTA 3VNJA 2VEPA 4HYRA 5T26A 3QC0A 3O16A 1XISA 5C8BB 1UR9A 1SZGA 3A4XA 1VFUA 3S6OA 5RUBA 1DJGA 3B4YA 3ZJKA 1PYMA 1DHPA 1FWBC 2QJNA 3NM3A 1I0BA 1UWAA 5DRIA 2BOEX 4QBXA 3GDBA 1HX0A 5AYYA 2VGGA 3LCGA 4JFTA 4GGBA 3AIQA 4BEQA 4ZQOA 1LWIA 1Q6FA 1PIIA 4H8UA 2A2IA 4H8VA 1R0MA 4JYFA 3WLMA 1SZNA 2A0NA 4TMBA 3WUGA 5KINA 5A6TC 3RLGA 1UUQA 3CUJA 3VOHA 2R1KA 3VABA 1ZSXA 2ISWA 3WQOA 4GWEA 3B0PA 5I3GA 2Z2BA 4KFPA 4NJHA 1T40A 3ARRA 4DWSB 1MFVA 3HO8A 4D6EA 2PZ0A 3WLJA 1IIHA 1SSGA 3RFAA 3AMDA 4YL2A 1E4IA 3NWRA 5G1YA 4JFVA 1WOAA 1XH0A 4WKAA 4HZ7A 2PSNA 3GH4A 2VJXA 1WBJA 5AVNA 1KFLA 1RVGA 4RV3A 4OIFA 3UP8A 1YTEA 4OBRA 1KO0A 1HW6A 3ID7A 3E2SA 4GX9A 5I06A 3VIMA 5EYWA 4DJDA 1UJQA 5FSEC 2NQLA 1EP1A 2I57A 3TYZA 3RJYA 3M07A 1ML1A 1E6RA 1OFDA 1EDQA 4MSSA 3VNKA 3TTQA 4MNJA 1KBJA 3WQEA 1EX5A 1UA7A 4NI8A 2QW5A 1JIBA 3WQPA 3FVMA 4JGDA 4LGXA 1E73M 4PTDA 2PI6A 3JZEA 3NZ1A 1GOWA 4H7CA 4M6UA 3T2QA 4FX6M 4E6MA 3TFXA 1OF6A 4LUYA 2CBVA 3VIGA 1KRBC 4MM1A 4DN1A 4XO6A 3DN5A 2WMFA 2ZXDA 4ZENA 2PE4A 3U2CA 1XH2A 2EG7A 1MQQA 2JALA 1YYAA 1W3TA 3RCMA 4REQB 1JCJA 1RK5A 2XH7A 3GC2A 2OZ8A 3HMJG 2G95A 4JQ4A 1UHVA 3UGRA 4XVDA 4H8HA 1J5TA 2NLIA 5I00A 4GUHA 3GTHA 4LANA 3HGSA 1FHUA 2VX6A 1VQTA 3EGJA 1WDDA 4IFKA 1OFBA 1Q7ZA 4MPKA 3IPWA 3N29A 1AQMA 3DHFA 2DVUA 2F6XA 3QQ0A 3URBA 4FPSA 4S1FA 4L64A 4PMNA 1OYCA 2WCAA 2V9DA 3S9ZA 5BRBA 1C8QA 1M53A 3COTA 1QI2A 2P3EA 1EWEA 2VD9A 2XFRA 1PTAA 4MJ2A 3LA4A 3H54A 2BY1A 2H3DA 1NTHA 1NDWA 1PZ0A 3OA5A 4O50A 4L80A 2CXEA 3LQLA 2X42A 2ZZ1A 2GJRA 4HNNA 5FEPA 3QHNA 1SJAA 2I7GA 3RU6A 4ZBCA 4RDZA 5DLCA 3C2OA 3U5YA 1XBYA 3MMWA 3UT0A 3E5PA 3CYVA 4R9XA 3ZT6A 4D72A 1IEQA 3XIMA 1K9TA 5I3KA 3O1NA 3N34A 1L6WA 1NIUA 3CH0A 4QROA 4UOJA 4AD0A 4WIWA 2F61A 5DCDA 1HKMA 3IIXA 3DI0A 3PFMA 1AZ1A 1PVNA 3EDKA 4ZXLA 1BWKA 4GQRA 1BLIA 1G94A 1E9ZB 1UG6A 4CN4A 1VCVA 1TX2A 5EMMA 3B0UX 3LCIA 2CXGA 2W6RA 4RPQA 1B3YA 5EKYA 3GRIA 3VIOA 4PZVA 2VCBA 2J7HA 2G8ZA 5I24A 1AA1B 3THDA 4JTKA 1F6KA 4TV5A 1Y65A 3N2XA 4A3RA 3UG5A 3BZGA 3G22A 4IMCA 4YXGA 1EJUC 1ZAJA 3L0NA 3TQPA 5LXEA 4JZ5A 3B9EA 2IPJA 2FFIA 3SCWA 2CZDA 3B8UA 2V38A 1ONRA 2NX3A 3WQVA 3V0SA 3BG5A 3RRAA 3L5AA 5AHNA 1XSJA 3PZGA 3WK1A 5H91A 1PDYA 4JTJA 4JIEA 5CSRA 1HL9A 2E5BA 3GC5A 4Q8WA 4G6CA 3WJSA 2A3EA 3T0DA 2WC7A 3V3WA 2V30A 2QULA 3H2EA 2EPNA 5BW6A 4IFOA 2UV8G 1DWAM 1UD3A 3GNNA 1Q6LA 3IVUA 4REQA 4AD3A 3B05A 2FH6A 1TB3A 4W8AA 5KITA 3OVRA 2ZUWA 5HWMA 1TR1A 2FZBA 4FLQA 4DPPA 3Q58A 1BVNP 1PE1A 1VKFA 3PPFA 1OADA 2Y7DA 4CEXC 1LLZA 4NXSA 5MKGB 3QLLA 2WKJA 3IGHX 1S39A 1TQXA 3EOLA 4E5TA 1V3MA 2V2CA 1D8CA 1H7RA 3SCUA 4DI9A 2ZDSA 3TYCA 4BR1A 1W5OA 1GVOA 4V27A 2C1GA 4LRSA 1J0JA 4WJEA 3CQJA 4FOKA 3T08A 1E0UA 3VVGA 4IPLA 1HL2A 2Q8LA 2Y5EA 3G1HA 1KBLA 2E3ZA 1A53A 4K36A 1MRAA 1FWAC 3SW6A 3T2PA 3M0MA 4V1YA 4TMCA 1V77A 4PGLA 3LXAA 2EPHA 4O17A 2GJXB 2QV4A 2INZA 1IEXA 2PCEA 2GK1B 2GZXA 3K8MA 3T55A 2OWWA 1GVRA 3WDQA 5CC6A 4L6HA 2VNCA 4U2ZA 1XP3A 4XB3A 1XBZA 4E2BA 4KW2A 5I09A 2E5CA 5E0FA 5D2YA 3LI0A 4HKPA 3KCOA 4S3KA 1BXNA 1A80A 1L6GA 4QG8A 4WSKA 1LG1A 1NFPA 1AL7A 3N12A 4K2SA 3K1DA 4HHLA 1UUMA 4EWND 1E1EA 1XL9A 3SECA 3M16A 4KMQA 2WO5A 4G56A 2XVKA 2V63A 4S2CA 1KWKA 5D9OA 3AFBA 4P7RA 1KGUA 1F05A 4QJ4B 1TE1A 3PAOA 3NPWA 1CIUA 2CLLA 2VOMA 3BSGA 3STFA 1DJZA 3NQVA 3TN5A 4KGLA 4UQBA 3IRDA 3MA8A 3TX9A 2PD9A 1V79A 4J2PA 1Y0EA 4ROPA 1X7FA 4H7VA 3ITGA 3CIVA 3PANA 3BMWA 3BGAA 4H9XA 3GTFA 2Z00A 1JDDA 2DZPA 4OE7A 3PAJA 1SJBA 4XWUA 4ZTYA 3S5ZA 3PJXA 5I0DA 3BDKA 4A2SA 3R0KA 2VX4A 4W5UA 2QDGA 2VQUA 4OECA 1JZ4A 3UWQA 6XIMA 1P7TA 2CHOA 3VOGA 3OLDA 3T09A 3N1AA 5HOSA 1XPGA 4P7LA 1XGDA 1XCFA 2GVEA 3DFYA 1BGAA 1H41A 3O6DA 2DZUA 4UBPC 4N9CA 3EPOA 4O1DA 4DUVA 2PPGA 3ZMRA 1XCWA 4H6QA 5JBDA 3G6MA 2FGBA 1XICA 3WL0A 4O11A 1JGIA 2CWNA 3GUGA 1MXSA 1W31A 3F2CA 3T2OA 1XG3A 2FH8A 2Y63A 3HV9A 4ZQCA 4LVDA 3TAOA 1FCVA 3R8HA 4ZOEA 5TBOA 3L23A 3WF0A 3F4NA 3DAQA 3VFCA 4WX2A 2FGLA 3ALFA 3ARXA 5E93A 5T9BG 1J0YA 3MANA 4KEVA 1F5ZA 2O9RA 1TPB1 2ABAA 1C7TA 4GVIA 2XVPA 1IEWA 2ZE0A 4Z2IA 3RN6A 1E4LA 4UMAA 3LS9A 3WDIA 3SCSA 1D3CA 2YDRA 3A22A 3GU2A 4JEQA 2F6UA 3ZVHB 4N9BA 2Q01A 4AY7A 4J27A 5A6AA 3B0VC 4KCWA 4XD6A 3WJXA 4HJWA 4FA3A 1MQRA 1I1WA 2EJ1A 3L5LA 1EJVC 1YKWA 4IGNA 3QYQA 3UZWA 1JVNA 2TYSA 4RCXA 5DELA 3HGOA 2GK1A 4JQ2A 3PG8A 3KBSA 5A8OA 2J77A 1CGVA 4WQ6A 5HNTA 3PULA 3T78A 5I3JA 1R2SA 2DJLA 1E1FA 3VGEA 3EWUA 4FS9A 4GBDA 1CECA 1CXIA 3M0XA 3E0LA 4C6PA 2Y7FA 1ZTVA 3MBFA 3Q94A 3VOCA 4IXHA 4D8LA 3QV7A 1ISYA 3W02A 1R3SA 2XG9A 3WLHA 2HZGA 3ANUA 1JYNA 2X8RA 2QJMA 1OFAA 1WA3A 5CG7A 1GZJA 3PZOA 3SGUA 1LOSA 3I7QA 1M7JA 1DBTA 1OC7A 2WVTA 3H26A 4ZODA 4DYJA 5HK4A 1THFD 3W7OA 1C29A 3WL1A 3WNNA 1W1IE 1HJUA 2OMAA 1UZ4A 2BMBA 1YTDA 3GVRA 3CMGA 4G1KA 1EGMA 1KD0A 3AYVA 3PJTA 3P7YA 3AIVA 3V5FA 1DTUA 1RJQA 5A6BA 3BH4A 1MFUA 3W7KA 1XDLA 3A4AA 4CU7A 5LNVA 3HF3A 4XKYB 1VHNA 3CB3A 1RLCL 5LNWA 1J5SA 3WQ5A 2KAUC 1XYFA 3AIUA 3L7RA 3QV9A 3WLPA 4TVCA 4ALDA 4S38A 1FWFC 4DZAA 2O9OA 3R11A 3LUTA 2E5DA 2OYLA 1HJXA 4KCUA 4E4PA 4E8DA 1GQIA 1K03A 3EWYA 5E6YA 4W5ZA 3UERA 2O9PA 3CV2A 4NHVA 4PR4A 1RUSA 1IXQA 4S3GA 1WXJA 2JF7A 3WENA 1VPYA 2YCLA 4RLIA 4BZYA 1UR1A 3W4RA 1ONWA 1YXYA 4LQ1A 4XZBA 2CW6A 3VMPA 1XG4A 1GHRA 1ZU8A 3PTDA 5FF2A 1ZRQA 3BMVA 5LZLA 1J4EA 1VGAA 3BARA 4GIYA 3APTA 4DVOA 4JTIA 2OO6A 3RR1A 3FFSA 2C1IA 3A6OA 3TW6A 3CHFA 3REQB 3LLXA 1XF0A 1FRBA 4LBUA 3KLLA 1JFXA 2GDUA 2VWSA 2YDQA 2ZRZA 2QCHA 1ZS2A 1RBLA 4B2DA 2B7PA 1AVAA 1NAL1 1QMLA 3NO1A 3GTNA 3VKAA 2VMFA 1ECQA 4NF7A 4IP7A 1J2WA 4TX6A 3CL7A 3E96A 4RK8A 1WYIA 1J6PA 2QDHA 5AHFA 5CZTA 1GOMA 1SFLA 4F9JA 5AYIA 1HP5A 1RV8A 4QJ5B 4JIIX 3CUZA 2QHAA 4LB4A 3UWVA 1YTKA 1H51A 3QBUA 1FFQA 3IAPA 1ODZA 2UY5A 2WJFA 3ABSA 3WBXA 1VYSX 3B9DA 4DWSC 2RHGA 2WV8A 1GYLA 4PCNA 4BQ3A 2WZEA 1LT7A 1FH9A 1ZL1A 1YRRA 3QEZA 2VURA 5CXPA 4F2TA 2VUNA 3EOOA 4GIRA 2J9XA 3ITOA 4QNWA 3BGJA 3RMJA 1J9YA 3LCWA 3UXDA 5IHRA 2PA6A 4PUWA 3ITYA 4PTMA 4AY1A 5G4EA 3N11A 3H2AA 1WAWA 4JHZA 1MW1A 2F2KA 4FF5A 5I5RA 5FL0A 3W82A 4A3QA 1LUCB 1CYGA 2NV9A 4ZOCA 3M7WA 5KTLA 4F0KA 3CTTA 4NG3A 2BOGX 2AAAA 1XIHA 2AQOA 1EOKA 1PBGA 4UXDA 3EA1A 2ZRXA 1TPVA 2PDJA 3WFAA 3PPHA 3I3EA 1U1JA 2J4GA 4UTJA 3ZZ1A 3FCPA 4WXZA 4Y7EA 2OT0A 4EPBC 2J13A 3ITXA 1DJXA 4ATWA 1M1BA 3T1GA 2G3NA 2OJPA 4KFNA 5EFFA 4OUEA 3EX1A 1I0DA 2CKSA 3AI0A 1MRQA 3VTRA 3BLFA 4GC3A 2FTPA 3I68A 2UY3A 3CL8A 1FWTA 5D02A 5M2FX 1XLBA 4ZFMA 2WB5A 4I7VA 1JCLA 3MHGA 2B31A 1R30A 3OA3A 1IYXA 1RAKA 1JNDA 2Z6IA 1OSEA 4N7QA 4TQTA 1JPIA 3U2OA 5CZKA 1Y7VA 4M6QA 1KXVA 2EPOA 1EZWA 4UTFA 5FJRA 2F7FA 3DFQA 1VFOA 5MF5A 2GGGA 4ADSA 1QPKA 3PF3A 3UVAA 2ACQA 1NP2A 2F6KA 2JF6A 3HMCA 4G7EB 3GXIA 3GG0A 4V1XA 2IKJA 2OWCA 4V2XA 3R10A 1NOUA 5AC4A 4TVUA 1SZFA 3IGSA 3M7SA 1NWRA 4IP5A 1QW8A 4CUCA 5FIPA 2I56A 1R47A 3NSXA 3KX6A 2HVOA 4R7JA 2ZTKA 2WZHA 4QSHA 5G2WA 2BVWA 4AIUA 1WKEA 2YJQA 2PU1A 4Q4PA 1VFFA 3HU7A 1UMYA 5C0QA 4ZQPA 1SO4A 3B97A 3WX7A 2L5HA 2PTWA 3MO7A 5HXMA 4EF8A 4OTKA 3ZIZA 4O1CA 3LPFA 3GIYA 2PMQA 2D3LA 1M7PA 3DEQA 5HAOA 4Q8QA 4UMBA 4JOMA 4AWUA 3H4XA 1ZJIA 3KBNA 1V6TA 1OC5A 3GFZA 1ZAHA 4GNVA 3ZO9A 2XDFA 2XGIA 1JZ3A 2FQIA 2E9BA 2C3ZA 3U6WA 4OT7A 5CSYA 4M56A 1YDYA 3OYZA 3WQ6A 3OHIA 3WF2A 1D7KA 1UOZA 1HF6A 1LP6A 4A8NA 2DT0A 2E68A 5D4YA 1MI3A 3STPA 1AMKA 4PMJA 4UB9A 4QQUA 7ODCA 2XISA 1JDFA 5CLTA 3LHVA 4L1WA 1V6YA 3C2FA 1QO2A 2XIBA 4OWGA 1OIFA 3F1QA 4IPPA 4FIQA 3II1A 5AVHA 4J35A 4DHGA 2VQTA 1H7NA 4QLJA 1IZKA 4B92A 4QAIA 2ZUUA 1B2YA 3UA4A 4MF4A 2W91A 1Q5MA 1V6UA 5HMFA 3QC3A 4HVXA 2RGMA 5XIAA 3VFLA 5LIWX 4LCSA 1PZ3A 2TPSA 3L4VA 3BLKA 2NVAA 4HN8A 3DBPA 2BGSA 3FYYA 4AIEA 5DANA 3UW6A 1QU4A 3AROA 5CJMA 3CIWA 1IHIA 3LZ3A 1EZ2A 1PV8A 1W1TA 3SCOA 1BD0A 2A1YA 2G50A 1UASA 3DXIA 4QFUA 4W84A 4I9MA 3AXKA 4XBKA 3SN1A 4Q22A 5F1UA 1UD2A 1HT6A 3M0IA 1ZBKA 2BXZA 3OZOA 3S1GA 4XSLA 4HSHA 3GDLA 3S5SA 2WVVB 1H60A 1UKOA 2C71A 2FZ8A 4PE8A 3T81A 3W7CA 3GVVA 2OXNA 4H2CA 4MB5A 1GVEA 5BXSA 1C90A 3E02A 2J27A 4WY0F 4DJDD 2Y6ZA 3UJFA 1H1NA 5F4WA 2WYSA 4XKMA 3OPSA 3TIMA 1AZ2A 3RPDA 3O63A 2OOGA 1GJPA 1YADA 4GUJA 3UEQA 1VZWA 4KF1A 4I8DA 5IBXC 1O5XA 5HNNA 4EE9A 1YBQB 5D03A 3O0KA 5FEWA 2AQWA 4NAFA 3ZM8A 1O5QA 2MNRA 4L61A 4BQ4A 2PB1A 1M65A 4LRTA 4H3DA 3I3DA 4HMEA 5A95A 3LEPA 2BGQA 2OWXA 1WO2A 2XHYA 4GI6A 2HMCA 3RX3A 3TWBA 2FJUB 2P8CA 2VGBA 3VCRA 3N2OA 4IG2A 1KBKA 4B5UA 2AL2A 3MUIA 1TTIA 4C1NB 1ZAIA 3KOYA 3L65A 4PFMA 5LIXX 4JY9A 2VGIA 1P6WA 2ZZ6A 1O5KA 3W86A 3TR2A 1JD7A 1E43A 2H9AA 4P8XA 2OG9A 4KQNA 4GX8A 2WBKA 1AFSA 1X6LA 2D2JA 5HPOA 1T0OA 1DP0A 1EYWA 4UFJA 3KBVA 4YTRA 1XJBA 3TN4A 3A9IA 3KLKA 3UQNA 2P53A 5FJIA 3E49A 2GPTA 1FWGC 3O6YX 3H4GA 1W1PA 4HSNA 2NV1A 4UNKA 2V5CA 2WSPA 4GYJA 5HJYA 3STEA 4FB7A 5REQB 1W3KA 5ECVA 1BRLA 4M5PA 1C7SA 4OUIA 1F6PA 2Z7GA 3JW7A 1H0GA 1CLKA 1XUZA 2FMOA 3EB4A 3VD3A 2PLCA 1NOWA 4US5A 1OCJA 4DO6A 2Q6ZA 1PS9A 4C1LA 2E09A 4WY0A 3K46A 4O4WA 5A94A 3MJMA 1JUKA 3CQ0A 4ATDA 4JTDA 4M6VA 4ZFCA 4Q32A 2POZA 1J0IA 1SGJA 1U22A 4Q3MA 2DZVA 4PSRA 1PSCA 1BYCA 1ONEA 3ZR5A 7XIMA 2Z2UA 4FF7A 1KM5A 1CEOA 2WMGA 2G0WA 4GY1A 4A22A 4B4FA 4CD6A 4I7WA 1ITUA 5CPNA 3GVQA 4E8CA 3S83A 4H9UA 3EB2A 2X16A 4GABA 1JZ8A 4KBXA 1KFKA 1K7EA 3R58A 3UYIA 5B7YA 1VJZA 2WHJA 3VI2A 4FNSA 3C8FA 3NL5A 3O06A 2GGHA 1KCKA 4CVWA 1O12A 5KZEA 1EC9A 1TJ2A 1FCBA 3W2NA 2AMXA 5LHFA 3RF9A 3E3HA 1UH3A 3BPWA 3QY8A 4P8VA 3CPUA 1MSSA 4LBSA 1BHGA 1QNQA 3PWGA 4XX6A 3QTGA 4ZEPA 5D05A 3N14A 1W91A 3BOFA 1W8SA 3W7MA 1SO3A 1EPXA 2EPLX 3V18A 1I6NA 4MGGA 2X0HA 3LBCA 3Q4DA 2OB3A 1IT8A 2WBGA 1EIXA 3C8NA 3GX9A 4ZR8A 2VM8A 5A6JA 3R1ZA 3ZWSA 1QR7A 3EXSA 4S23A 4IICA 5D8ZA 1QATA 3W76A 5A8PA 3W22A 2HS8A 5A5WA 4C1NA 3NJ3A 1UR2A 2WMKA 1RCQA 4MTVA 2DT2A 3QGAC 1H7WA 1K6WA 2GGJA 1MUMA 3CEUA 3UVIA 4AZCB 1UD6A 4PBEA 4W4QA 3SY5A 4Z0JA 2ATSA 1GQJA 2QCDB 4PYSA 3GXNA 2YCJA 3BJSA 1PKLA 3DFSA 3W83A 3N9SA 3MSYA 3S2MA 3NR0A 3W2KA 3TYBA 1TUXA 3LYEA 5HQLA 1A5AA 4E2OA 4N9EA 3EA2A 1JYXA 3BSHA 4LX4A 1UYQA 3N9RA 2WHKA 1E55A 1L8NA 1QNSA 2PGFA 2D2HA 4LNYA 3TZNA 5C7VA 1TVLA 2ASHA 3G0SA 3W2LA 1PKYA 3NQGA 3MCMA 2NQ5A 5K4XA 2Z25A 4GFSA 4LY8A 1G4PA 2GSJA 2OYMA 3WMLA 3MB9A 4LVAA 4MUPA 1MW0A 4FSAA 4Q33A 1PHQA 2E9LA 1V3JA 2E1DA 3IJDA 4AMCA 2OEJA 1A5KC 3AHTA 2DZTA 3B8SA 4N9DA 3G18A 4H19A 3URNA 2ALDA 1OK6A 2E6AA 4Y9PA 3N2TA 1ZQ5A 2BXVA 3WD1A 2YXXA 2XFWA 3OEXA 4B9ZA 4MKSA 3HBLA 2RDXA 4QISA 4RNIA 1EC7A 5LNRA 1EJSC 2BY0A 4DUXA 2F84A 3MU7A 4JD4A 1QFEA 4CGTA 1SFTA 3PPCA 4PTVA 3RMEA 4HPJA 1DE6A 3OZYA 2NUWA 4FNPA 1I2OA 1NF0A 4HNUA 1TV7A 3VGFA 4K8GA 4S3AA 3OGVA 5DBTA 4IUGA 1SR0A 1DJHA 3AMKA 4M80A 5D2VA 1ITXA 1UKPA 4WJ8A 2GOKA 1ZALA 1RJRA 2J8FA 5GVJA 7ENLA 3S47A 1QI3A 1VHCA 4IMEA 1AD1A 3P0XA 3S5OA 2ZYFA 4NSBA 2RAGA 4HYWA 1TYGA 1RQHA 1VD6A 2CLMA 2C0AA 1R9ZA 3IJ6A 3PHAA 3MCOA 2VVSA 3W53A 5A6SA 4IPJA 1REQA 5EU9A 2CLPA 4ATLA 2WANA 9RUBA 4MKNA 4Q8NA 5DY2A 1TPH1 3ARZA 4UTMA 1ME7A 4PTXA 1E71M 3UR5A 4A8LA 4Q7IA 4NX0A 1DORA 1POKA 1W3HA 5A8MA 1XRSA 3CU2A 4AQLA 1W5NA 2OGYA 3ES8A 1XIMA 3W7LA 4FHAA 2FGZA 3LHWA 4AVOA 1M7XA 3C5QA 3NO3A 5BMWA 1B9BA 4IX0A 2ZFAA 1PDZA 5C9ZA 3SRFA 3TJXA 1E6QM 1TTPA 1ZENA 1MEIA 1QOPA 2W62A 2BX7A 2XIQA 4U33A 1V5XA 3EA3A 3C2EA 4UMCA 1BEUA 1A3HA 3CM4A 3W29A 2CZFA 1LOQA 2V6AA 2XVLA 1VBGA 5A1AA 2KZHA 4BK9A 5HJXA 3HG2A 2R1PA 3IJ9A 4HHMA 4IMAA 2XWDA 4J3WA 2XZ9A 2W5FA 2CETA 5T8GA 1E51A 1T96A 1JL8A 4MWAC 3K1GA 1XM3A 3LG3A 1MEHA 4JTQA 5J04A 4NUWA 2ZC8A 4JS3A 3H2MA 3T6CA 2PLMA 4ADTA 3W7GA 3VD7A 4B5NA 5CBJA 1Q8JA 4ZA0A 2FHCA 3GZ3A 4JKLA 3LRLA 4Q4MA 3H55A 4C6LA 4QX4A 3T4WA 1HIZA 4XV0A 1NFBA 5ECUA 4Y8EA 2J78A 3MVIA 4N2YA 1LLWA 4R53A 1UH2A 3DUGA 3VGBA 2R14A 3CEPA 1OT2A 1WZMA 5CBBA 1V0KA 1EPVA 1EF3A 2DP3A 3M5ZA 1P43A 1VEMA 3VC6A 4UTWC 5JU6A 1UC4A 2YGYA 2PS2A 1GK8A 3EX4A 5T9CE 4NX5A 1NSJA 3NZPA 1J8VA 1KBIA 4F0RA 4YTSA 3TN3A 3VD5A 4JN6A 4MOZA 2ZX6A 2FVMA 1XKYA 1W1A1 4M51A 2V81A 2ZZ5A 4MDPA 1HO4A 3RM4A 3NXLA 1US0A 2W4XA 4HA1A 2SFPA 2QXWA 4BWLC 4JCLA 3ARQA 1KM2A 1VR6A 1CI1A 3G1XA 3GB6A 2VEIA 3TOYA 3PBUA 6XIAA 2BODX 3W7JA 1XIIA 3S2CA 4WDWA 4MNKA 2AOSA 3FHQA 1HGYA 4F0HA 4UFLA 1GPFA 4PBFA 5A6BD 3Q67A 3VD9A 4NXKA 1XQKA 2E8ZA 5AECA 5HWNA 3SUVA 3VNZA 2JIWA 5ABGA 3W1UA 1BTMA 4HNVA 1CNVA 2Y1HA 1GW1A 1VCGA 2Y89A 3PSWA 3OVGA 4K3ZA 1Z44A 4Y2WA 1FVPA 3GC4A 1J18A 2X1TA 4C6CA 2DORA 3WH7A 4HU3A 4M0XA 1FWEC 3HQ1A 1JUEA 3SCPA 1XD1A 1XC6A 5E6ZA 1XFBA 1L8PA 2Q3RA 3EBVA 3FNDA 3AZSA 4KERA 3B8TA 4A4AA 4Z1CA 5KZDA 1UC5A 4HCHA 3CZGA 4YTUA 3UXAA 2ODOA 3AYSA 3DZ1A 3GM8A 3KP0A 1G0CA 4O14A 3QSRA 4WRHA 4GPNA 4X9YA 1R86A 4JTEA 2DH3A 1H11A 2ZCGA 3ALGA 2VFIA 3KRBA 3KTCA 3W74A 3SIMA 4XIMA 3WEMA 2CC0A 1TJ1A 4EACA 4Q4KA 1WX0A 2VL4A 4IUOA 1KTNA 3TTOA 4HPGA 4B2DD 1GGOA 1QAPA 4A8RA 4FALA 4AB4A 1MW3A 2PBOA 3LX9A 3DKJA 2VTFA 3DG3A 2OYKA 1VFSA 3R25A 4EX4A 2BDQA 4CNOA 1XHGA 1E72M 3O6CA 3ARUA 3FK4A 4JQ3A 4PULA 1MVYA 2VZTA 4M6PA 3AJ7A 4M81A 4H9TA 3OU8A 5EMUA 2Z0IA 3PFRA 4QHRA 1R8LA 3KW3A 1B57A 2MUCA 2HNEA 1TV8A 1P5BA 1I2PA 5G4HC 3SSJA 3WF1A 3MWAA 3P8JA 3GH5A 3LPPA 3RX4A 3TOPA 3E2VA 4C7GA 3V5OA 4F4RA 1A5UA 2VZUA 1ADDA 3HG5A 3T8LA 3THQA 1A5MC 1VFHA 3RDKA 4CEUC 2QCGA 4UTTA 1TIMA 1FWNA 3SURA 4GINA 5HR6A 5D09A 1XLEA 2OZTA 3ITLA 2I5IA 4OU1A 4WGXA 2QAFA 5C2GA 4QJ1A 3CIXA 1XWYA 3ZSSA 3GY1A 1V03A 2QIIA 4FNQA 3CUHA 1RBOB 3VAVA 1M5WA 1YHTA 2ZXQA 5DCBA 1ITQA 1KTBA 1I2NA 1LZOA 6ENLA 1WKYA 2UY2A 2OX4A 5M5DA 4M8UA 4GNJA 5HMEA 4Z0SA 3VDBA 5AC5A 3W6MA 4XZLX 1O7AA 1XIEA 4WKHA 1JFHA 3A9BA 4LCQA 1XUUA 3BJFA 3AS3A 4PUJA 2LLEA 4MG4A 1OFRA 1RY0A 4LS1A 3POHA 1VENA 3PPGA 4GBUA 3M0YA 1XKJA 1WZLA 3H53A 3F2DA 2OQYA 4IM4A 3IANA 3TR9A 4YS1A 1W9VA 3VPLA 1GPWA 3STCA 1FWWA 1MYRA 5KZMA 3FAXA 5FJJA 4QSFA 4JEJA 5TIMA 3HQOA 1B5TA 4GH3A 2V3DA 4O1AA 3TSBA 3CUFA 1TV5A 3T0CA 2PU0A 2CLOA 8A3HA 4IXXA 3G1RA 1OC6A 3G8RA 4Y9NA 4NNAA 1YLVA 4NJJA 3A13A 4B4HA 3CV1A 3BQ6A 3VNLA 4C6QA 2BTMA 3EDDA 3UXIA 3W7NA 4YCOA 1N7KA 1Z32X 2ZBTA 1JXJA 5HUPA 1G5AA 1TPFA 1JF6A 3E9AA 3RHGA 3CLWA 3CV6A 1C8VA 3KOFA 2WC4A 1DHKA 2XWEA 3AUOA 1J12A 5CJ5A 3CHVA 4PUMA 3QH2A 4H4IA 3AYRA 1Z6KA 3PB2A 1WDRA 3W25A 3WLNA 2YA0A 2CZ5A 3NQ6A 3O7UA 5I07A 4KRTA 1AODA 4EXBA 1IXOA 3H2FA 2G4JA 5G4WA 1T5AA 2OLAA 1M6JA 1CX9A 3ECQA 3WBEA 1G7VA 5A6KA 2Z6JA 3S6TA 3UWYA 4HCLA 1DQXA 4NRRA 4XQ6A 2GJPA 1QBBA 3VINA 2Y8KA 1FH7A 2YFNA 4DJEA 1JAEA 5BXPA 1KRMA 4D8ZA 4AXKA 1TJRA 5EMKA 5IFPA 2FZDA 2AMGA 4ERGA 2IS7A 3QOKA 2HISA 4K39A 1CXHA 3QPYA 4JY8A 4UFIA 1QOQA 4C6IA 4PH6A 2EKGA 3EX6A 6PTDA 3VKJA 2V5JA 3BZJA 2INEA 3MS8A 3DU0A 2DSVA 2CLIA 1F61A 4HHHA 4OFCA 2XH0A 3BW3A 4UQDA 4IPNB 1VBHA 4LFYA 1OG6A 1UWQA 1LBFA 2QPSA 2QMJA 3G5EA 1M41A 1KXQA 2W92A 1B3XA 1VFTA 1QDSA 4DF1A 1T8XA 2J9ZA 2OOFA 4NZFA 4B5SA 2ZTJA 1NFGA 5HPCA 2I17A 2EKCA 4FLOA 3MDUA 1ZHAA 1W32A 1UA3A 4CQBA 4C65A 4ADUA 3MKCA 1O4UA 1VPXA 4IWWA 1V6XA 5FJPA 2PDWA 4MUZA 4WSJA 5BRPA 2J62A 4Q6JA 1KV5A 4FP1A 4AIOA 4KT2A 3IARA 3VMNA 3K30A 2J7EA 2Y88A 4UTUA 2PDPA 5FI8A 4XBSA 4UQEA 2OZ0A 2WMIA 5BYWA 1Y5WA 4GYFA 3UD6A 4AWSA 2ZUVA 4ECLA 3A12A 2PAJA 5GNZA 5DCEA 4NT0A 3BC9A 3HG4A 5D2WA 4GXWA 2GL5A 1ONXA 3IVTA 2J7DA 3UCQA 5JBFA 4LT9A 4PMUA 1OBAA 3KUMA 1Q4WA 1M01A 1HXJA 1QASA 5BU9A 1NY1A 4HTBA 2PP0A 3PZUA 4E4FA 4Q7BA 3C3NA 5A8QA 2XH2A 2OPJA 4C6KA 3PVFA 1TCMA 1SZRA 2EAWA 4GI9A 3L9CA 3AU6A 2RJHA 4ZGYA 2J75A 2QJGA 3IUIA 1YPFA 3T05A 3H2NA 4N42A 4QLKA 5D38A 3FEMA 1XBXA 4HNLA 2AGKA 4QCEA 4YJ5A 3E0IA 3KOZA 4DJFC 2VZSA 4H9VA 2Y24A 1L9WA 2VEKA 4HU8A 3D3FA 3F2BA 1IXNA 1DV7A 3KDOA 3ENLA 2FLIA 2C13A 3ZR6A 1WB0A 3F4WA 5I02A 2VYOA 1DXIA 2IQTA 3DFOA 5J8LA 3NQEA 1HJVA 5KZ6A 3OQEA 1XGZA 1BQCA 4US5D 3QR0A 5D9MA 2A3BA 2WZTA 1E1CB 4EXQA 1TWZA 4PL1A 3PP7A 1WNOA 3FAWA 2CPUA 4YIWA 3VKCA 1TVNA 4C5ZA 1LTDA 3WDJA 5I3DA 3IJLA 3J7HA 3NVDA 5BROA 2HXTA 3OTRA 4PB5A 4HA3A 4ICNA 1QPQA 1KM1A 3UZYA 3FA4A 4JX6A 4AMAA 3PNZA 3E2QA 1M68A 1R2TA 1XSIA 4DBEA 1PCWA 4I6KA 3RM9A 3BGGA 1HVXA 2NQ9A 3FOKA 3LZ5A 5FF4A 1P1MA 4RDYA 2PWHA 3VD4A 1V6VA 1ISVA 4AZBA 3UNDA 3W1RA 1EXPA 3AYTA 3M1ZA 3HB9A 3VDHA 3ARWA 4XTDA 1KFEA 3S1UA 4OGZA 3SB0A 3EYPA 1EP3A 2J9YA 3OJGA 2DDXA 3INPA 4UTLA 3S9YA 2NW0A 2WVUA 7REQB 5LGXA 2XM1A 3GR8A 2YOCA 4Y9AA 1V0MA 4DLMA 4XO7A 4JAWA 3TE9A 2O9TA 4UFKA 2B7OA 1SSDA 3FYPA 1Q2RA 4NZCA 4JIRA 3MHFA 2YL6A 1F74A 1LG2A 1ZLPA 3KTXA 1UW9A 2D22A 3TNBA 4NJIA 2ACSA 4CCCA 2REQB 4XAGA 4XAPA 4HCDA 4H9YA 2R82A 1DIDA 3FY1A 4UCGA 3RCYA 4BF7A 3IAQA 4UFMA 2P5NA 2R8WA 2TRSA 3P74A 5TAOA 1G1YA 6REQB 3IJQA 1H5YA 2WMHA 1QK2A 2Z1SA 1HL8A 2IW0A 4U2YA 3FIGA 3W3OA 3S4TA 4ILSA 3PZTA 1TMLA 3ZJ6A 3WBYA 9CGTA 5HNRA 2VVNA 3KOWA 3KM8A 1US2A 2V82A 1DXEA 4MLJA 1D9EA 5CPMA 3QZEA 1HKVA 2GQ9A 4HT3A 4FXSA 1BVZA 3SR7A 1E6XM 1CENA 4UTKA 3UY7A 1F3XA 4G5DA 3W7EA 1LRTA 1ICSA 1XLMA 4KETA 1XXXA 1OINA 3URAA 1UR0A 1E0TA 2QUUA 3OG2A 3S8HA 4HNOA 3HPFA 1FH8A 2QQ6A 3KVLA 1OIMA 4JICA 2DJXA 4ZVJA 1JI1A 1YIXA 4NASA 2GDVA 3FYOA 2KX9A 1OYAA 3LENA 1QJWA 4JNZA 3W07A 2ISDA 1A4MA 1DQUA 1KNWA 3L5MA 4QG9A 1T7LA 4W7UA 1O68A 3B40A 4KH2A 1CXLA 3FVDA 4J3UA 1VLIA 3W84A 3WDPP 3V36A 3TU9A 3RITA 4INFA 4NIRA 2OKTA 5A2AA 1R6WA 3WLRA 1EXBA 3BAIA 4CNSA 3OLGA 1Q65A 2EEXA 1RD6A 1ZY9A 5EY5A 3N04A 1HJQA 1ALDA 4PBGA 2TMDA 1A5NC 5E0CA 2DZXA 3H22A 4U28A 2PODA 4GY7A 3T0TA 4M7TA 3NDZA 3CQHA 3GK0A 4MJ4A 1A50A 2DUXA 3C56A 1BF2A 2VCCA 3VZYA 1HKIA 1EF2A 1ZUAX 1E56A 1P6CA 1RA0A 2ESCA 3KBMA 5CSUA 4YMZA 4LV9A 1H3GA 1S2VA 3KCLA 3RO6A 4GZJA 2WSRA 4QITA 1DJWA 1VIWA 3W81A 2PDGA 4LAUA 1X38A 1LL7A 3PBMA 2WCGA 4E4UA 1OG0A 3H4WA 2XTKA 3G77A 3BLPX 3MO4A 5ABFB 4AFYA 4AX6A 1AH3A 3LERA 1MO0A 5M03A 2GWNA 3NQ8A 3H21A 1TWDA 1F73A 2YW3A 3U4FA 2W67A 4XZHA 5AKQA 3S0CA 1K9FA 4F0SA 3BAYA 2J7CA 3QR1A 2ACUA 1LF1A 1WE5A 1OD8A 2R24A 1ZCCA 4PSPA 2I9EA 3RPTA 1DOSA 3W1LA 4WDTA 2GJLA 1B4EA 5CPSA 4UCFA 1EB3A 3IUDA 2Y8VA 2C16A 4OV4A 1VLWA 3NDYA 3GVGA 1C91A 1Q6RA 3VKDA 1FKWA 3JR2A 3SCNA 2INFA 1EQPA 2QCFA 3SQLA 1R9YA 4DELA 2O4QA 1ZZMA 1DWHM 2XUCA 2YSWA 4V33A 2G5WA 3ME3A 1V08A 1KGXA 3AZTA 1TA3A 5F2IA 3BAJA 4IIBA 4PTNA 5JQ9A 1UWUA 2E28A 3NFUA 3P81A 3MP3A 4US6A 4L5ZA 1TO3A 1HNYA 4I6VA 4TXEA 3UU0A 2OR2A 4AUBA 3P14A 4ES4A 4UR9A 2E1WA 1HVQA 1G69A 4ZO9A 4F66A 3M6YA 2VFHA 2EXOA 4UFHA 1XLCA 4CD5A 4JYDA 3L2LA 1TCDA 1DWIM 4PUDA 3UR7A 5CGMA 5CZJA 1R7AA 1ZBVA 1QBAA 5MHBA 1CTNA 3CAVA 4WXYA 1WCGA 4DNHA 2VDIA 3NSMA 4GC4A 3S46A 3QSTA 1DIKA 4O12A 1UQYA 3GNRA 3OGSA 5E09A 4ZB0A 2DSZA 1GYNA 4AZIA 2NLYA 2NXIA 2PDYA 3APYA 4HQVA 3DGRA 4CNUA 4E38A 2ONEA 3MQTA 1K02A 1VS1A 4O10A 3BG9A 4UTHA 4RV8A 3VM5A 2G3MA 3WIJA 3L68A 4LUSA 1DKWA 4BHYA 4FO4A 1CB2A 2VC9A 4LYQA 2Z27A 3IIOA 3CLMA 4JTGA 5GJPA 2O7QA 5HWJA 4GK8A 3NQAA 3S2LA 2XGBA 5A3HA 4BQ5A 1F4AA 1KCXA 3SDOA 3TC3A 3UPBA 4ZCWA 5BWFA 3NOYA 4IMGA 3M0LA 3VNYA 3BTNA 4TUFA 5CZ0A 5M3WA 2ADAA 5EA9A 4ZE5A 5EL1A 1FX6A 5K9XA 3NG3A 1IEIA 3OZPA 1PXGA 3GDRA 4IT1A 1Q6QA 4WVXA 4XAZA 2G96A 1LDCA 3EKGA 1XRTA 3A3XA 3NPVA 5DMNA 5HMSA 4CCEA 4IH3A 2NQZA 2HV5A 2NUYA 4Y90A 3GDKA 5DT7A 3QV6A 4HNCA 5ABFA 3H24A 1I8JA 3W71A 3UG4A 2WNNA 2DVXA 1PWMA 2Y2WA 1WOBA 4I9TA 1A5CA 1BXBA 4QE5A 1JZ2A 4QE1A 2HBXA 4NAEB 4Z1BA 2ZADA 4IHCA 3B3DA 1F6YA 2WM0A 3WBWA 1R9XA 5FCZA 3EWXA 1MUWA 1XLGA 2FKPA 3CGTA 2WPBA 4CNPA 5H6HA 3ABOA 3ONBA 2Z1KA 3B8WA 1I2RA 1K1DA 2NX9A 2O55A 5EGRA 4MYAA 3TA9A 3TW7A 2HPIA 3LM3A 3M47A 1QPOA 5H8MA 3PB0A 1UR3M 4KPLA 3GNXA 2FVKA 1EFZA 2A7PA 2R1NA 1UR4A 2CEQA 3N2MA 3SIZA 4F48A 2ZVIA 3L0KA 4UR8A 1RP8A 4HIBA 2FPVA 3LV6A 4GD0A 1K7XA 3SY1A 4YWIA 2OX1A 1W5PA 3NZRA 1K3UA 2Z28A 3QOMA 3S3GA 3TC6A 5IDZA 2YKKA 2PUZA 2ISSA 3NAVA 1YDNA 3TYUA 3AO0A 2VGFA 2V68A 1BQGA 4GI8A 4FMVA 3GKAA 3LNMA 4EANA 3M4HA 4O19A 4KEUA 2GQAA 4EP8C 5G1MA 5FSDC 3ES7A 3UJSA 3U8GA 4FOUA 2D2OA 5BMXA 3EOUA 2EPMX 3TH6A 1D7FA 5I23A 1BTCA 5AHEA 1S2CA 2J8TA 4YWSA 4EWJA 1GW9A 4XIAA 1UPPA 4QDPA 1V3KA 3LTPA 4OV9A 3MC5A 2R9RA 3W27A 4GKLA 4AAJA 2B7NA 2W0UA 4B3LA 4B91A 3N3TA 4N4PA 4J3SA 3QRHA 2QV5A 1ODUA 4TX9A 2J24A 2E6YA 3W85A 3MV11 1Q13A 4IOTA 4ZL1A 2BBFA 2RDTA 3OIHA 3LCHA 2PGWA 3W1QA 1QT1A 4J40A 1E9LA 5H8UA 4XBJA 3P5ZA 4B16A 4FX8A 4X0NA 1DIOA 7TIMA 1YMYA 1OB0A 5K9CA 4QJ3B 4L4PA 4UUIA 3WNPA 2TAAA 4CNTA 5TQLA 4BS0A 1RH9A 4KEZA 1ZB5A 3DYMA 3FXGA 4XK2A 3W7PA 5AB3A 4WSHA 1FHDA 1A3XA 4PEKA 2RGLA 3VGHA 4DWSA 2VP8A 1F9CA 3L4WA 3ORWA 5GQBA 1RVKA 4NZ4A 3ONCA 3TK7A 2GUBA 3GTXA 3PN8A 2TSYA 2PWUA 2XH4A 2OQLA 4NILA 5D37A 2YFOA 1WDWA 4UWMA 2QCEA 3L4TA 5CPTA 3ATYA 1O5RA 2WLYA 3BLDA 1S1RA 1TTJA 2X1IA 1EX1A 3LMZA 4RZ6A 1F8MA 2NWRA 2ZZ3A 1Q85A 1AK5A 1X1NA 2OZ3A 2PRLA 2WAGA 3CHEA 3TSMA 2QKFA 4NL1A 4W8LA 3WQWA 3VIJA 1XIJA 4PMZA 3KAOA 2HXUA 1HFBA 1FP8A 3NIYA 3PS7A 4L9ZA 4QRNA 1W9DM 1JCMP 4GQGA 4GOAA 1M7OA 4AYSA 4JNYA 2Z1VA 5DT5A 2W3ZA 1KFWA 3N9KA 3STGA 4BCEA 4WHBA 4AF0B 3S2JA 4TV6A 4FIRA 2VFFA 1VP5A 5F7UA 1EO5A 4FOJA 2YDAA 5C55A 5DF0A 1QHPA 4OQVA 3W23A 1TE6A 3M6DA 2FPTA 3ABXA 1WBHA 3VKKA 1W54A 1OFPA 4J3TA 2WSKA 3F5LA 4YTTA 1UP0A 2YXGA 4JFSA 4LF1A 1D3GA 2PDUA 4O1EA 1V0NA 5AZ1A 1XYAA 2DFAA 3T42A 3H7UA 2BVDA 3BV4A 3G3DA 1H50A 2G41A 3RLHA 1WUEA 3KXQA 3FKKA 4B5XA 3WQ4A 3W7HA 3QGVA 2X2YA 4QQ3A 4GYPC 4ENLA 3QM3A 4KEMA 4ZQMA 2QDDA 4HB7A 5DY3A 3TLQA 3AALA 5JVLA 1GYMA 2WJZA 4ZO7A 1AL8A 5LA0A 3GLCA 4Z1DA 4E3TA 1QOXA 3C0LA 1JG9A 4D6CA 1SO6A 1CXKA 1BWVA 1K4GA 2XPKA 2OELA 4GHRA 3KRZA 1P0KA 1H4PA 1OX5A 5EB8A 2Z24A 1LT8A 1QK0A 1BAGA 1EP2A 2OSYA 3UZXA 4AU0A 1LYXA 2OU4A 2J88A 4LUTB 4DJED 4RE3A 5HNUA 1XYBA 5GJMA 1GVYA 2O0TA 3GYEA 2BG5A 3Q2DA 4UR7A 1HJSA 1TMHA 3HFYA 4QR6A 2RDUA 1YE4A 4I8YA 1A47A 1QCWA 3GR7A 4QXIA 4L6OA 1EJTC 1MUCA 3PUDA 3FX4A 3GG1A 4LB3A 3W38A 1XLKA 3SUTA 1B0IA 3UJEA 8CGTA 1AQ0A 2PEVA 1K8ZA 1IZCA 4QIUA 4M3PA 4W88A 1TELA 1AJZA 1OM0A 3A4JA 4PCTA 4RDVA 2RUSA 3UG3A 4PUUA 4JTAA 4W86A 1A5LC 4ZXOA 1S38A 3VXGA 4NYUA 5JH2A 1SJDA 3N4FA 1H7XA 4EVZA 3BL3A 2D73A 1R3TA 4CCZA 1N55A 2JFEX 1AUSL 2PCQA 3KOXA 2R91A 1OQFA 3M5YA 2ABBA 1NM9A 3OQ8A 2AGTA 3GIQA 1T6MA 3GU1A 3WQFA 3C52A 2FHBA 3BAWA 3D46A 1PB0A 4O0KA 4RPPA 2VEGA 3EXTA 1GTEA 2NV2A 4GJ1A 1A5OC 3R43A 2XU2A 4HK7A 4CQAA 3I3BA 3ZXWA 3MSGA 3VNMA 4HOWA 1EO7A 1XDMA 3OBAA 3EWDA 3NQBA 3KEHA 5SWUA 1WXZA 1FOBA 2IQDA 4AWTA 4B3KA 2PRMA 1A0EA 1W2VA 5D8WA 1LL6A 4H2HA 2QCMA 1EGZA 2CYGA 5LSMA 1MXGA 3SFWA 5BOFA 3SRDA 4MLRA 4Q8OA 3O05A 4LTSA 4O15A 3U7VA 3IGXA 3SCRA 1JRBA 4XSMA 2PDLA 6TIMA 1UIOA 4JN7A 4CD7A 4Z42C 1NEYA 3EDFA 3WEOA 2A4AA 2QLYA 5FESA 8RUCA 3MWCA 2OLSA 2D69A 3VX0A 2ZRYA 4ACZB 4Z08A 3GHUA 1B9ZA 4R88A 5MKGA 3WMBA 1GONA 4XD3A 1JD9A 2PDBA 4CCDA 2QGYA 1OX4B 3EWCA 4E8GA 3NSNA 2XGZA 1W9PA 5IBXA 3DI1A 3B06A 1Z89A 3I10A 1V3LA 3DYOA 1JCTA 3TKFA 1GOOA 3DFTA 4PCSA 4WGHA 1MEWA 3B8VA 4L4MA 4ZQRA 2VZVA 3QV8A 1DWFM 1F4HA 2BWGA 4GKTA 2E6DA 3TUUA 1EH9A 1TPEA 3Q37A 4ML9A 4WK9A 2DVTA 2FMNA 4LAZA 3ZVIA 3VKBA 1QNVA 3V7PA 1W3LA 2D0HA 3RXZA 1F8IA 3CPRA 1HZYA 4F8XA 3W6YA 2PC4A 4D1JA 4ACYA 2CERA 2V2DA 1AJ0A 2GJXA 2Z1BA 3MMDA 3LTYA 3TYDA 3ZR4A 2YX0A 3IVSA 5IM51 1NELA 4PCFA 3GDTA 4MJMA 2XFYA 3EMZA 4FR6A 1GUVA 3PM6A 3RUBL 4BI7A 1Q45A 1L2UA 1SM9A 1QW9A 3LRKA 1UZDA 3KHJA 1EDTA 3S42A 3FLUA 2E77A 1AH4A 3WBAA 2ZA2A 2UZ9A 1X8FA 1Q6OA 5DMLA 4B9YA 1D2KA 3QTPA 5J5DA 4MNLA 1TIWA 5U4NA 5M17A 2HSAA 3AOFA 5AYXA 4X61A 2DZSA 2FB2A 3DC8A 1PL9A 4H6EA 3GTIA 2O92A 3E38A 4N4QA 1VIZA 3V5CA 5HA7A 4WUIA 2E25A 3P0WA 4FEZA 3LGEA 4RW3A 3RRXA 5LXXA 3M0ZA 4K38A 3NPXA 4LJ3A 4LYRA 3JU2A 3EDJA 1POJA 4HU0A 2HNHA 3WLQA 2NZLA 3M5VA 5CKSA 1OGGA 4HHPA 2OQHA 1QNOA 2ZWZA 4IL0A 1TV2A 2FZNA 1J01A 3CUXA 1KQZA 1ISZA 1B90A 4H1ZA 1SFJA 4LF2A 1GJWA 5TNVA 4A6GA 2Q71A 3SUSA 5FA5A 4QM1A 3F4VA 4F0MA 3MUXA 4MVAA 1W3NA 3VIIA 2JBMA 1KLZA 4PMQA 5LA2A 1JRCA 1W8GA 3AAMA 1YQ2A 4H8NA 1A5SA 5AHLA 5BCAA 5KMYA 4NZ3A 3A3HA 2CU0A 4UNLA 3AS2A 4MHBA 4L65A 1EBHA 1FHVA 3KL0A 1DJYA 3AHVA 3E74A 1D3HA 1SPQA 2Z1WA 2EHHA 4V15A 3WQ8A 3FS2A 2W63A 2VC5A 5D9NA 3ARVA 3CO4A 3VE9A 3LXBA 3TQKA 1V7AA 1KFCA 1TQJA 3R6IA 1OX4A 5HQMA 4H9ZA 3N19B 3CYJA 1ZP3A 3GXTA 3SUUA 3RU8X 4O4VA 1IEVA 3AHZA 2IKIA 3K8KA 4LALA 1GZ1A 3MCNA 3H2CA 3GFXA 3LHUA 3LN3A 4K37A 5C5YA 4L7ZA 3QW3A 3WN6A 2WKGA 3LPGA 5FJOA 1B54A 2PDFA 3DCPA 3G1DA 1DEDA 4HK5A 4P2VA 5H2ZA 3QZAA 1LQAA 2I1OA 2I9UA 1GQKA 4LCRA 4L1GA 3CL6A 3PSVA 2GLKA 3N2BA 3KTSA 3ZVHA 3L2MA 3RX2A 1JZ7A 4BQ2A 2PWGA 3WDHA 1OZQA 3MP4A 1ME8A 3TTEA 2XINA 3P62A 5IDIA 3DESA 2V5BA 3UGVA 1J93A 1MWOA 3AMLA 1Q6EA 2CBUA 1KM3A 4IIEA 4PCPA 4R7OA 4JIQA 2ZDRA 1PO9A 3QPEA 3NYZA 3QQWA 3EKLA 2E4TA 3R8RA 3WG6A 4NJGA 4DF2A 5EPDA 1FFRA 3GQYA 1MNZA 2MANA 4P5UA 5HANA 2NXGA 3DH7A 5I78A 3H7VA 4GCXA 4X3ZA 3W1PA 4MWAB 1UWRA 1RPXA 3WZ0E 2QJJA 4UTTC 2QJHA 4GXPA 4F0LA 2ZQ0A 1WKFA 2J79A 1AD4A 3GAYA 3U0HA 2PGRA 3SZ8A 1VAHA 1EL3A 1LBLA 4BJHA 3LDVA 4L4OA 3W26A 3JVAA 3RCNA 1LOLA 4I7UA 3OBKA 4DUOA 3ISIX 3CT2A 3HQPA 4KWVA 2ACRA 2HBVA 4JN8A 1GOXA 3UZZA 3HGJA 4ZB5A 1OGSA 3NDOA 3IUHA 1S2TA 4U10A 1VCFA 4HP5A 3NNTA 4I5RA 1U5VA 2F38A 3F5JA 1EKOA 1U5HA 1BKHA 2NSXA 4JL1A 4CU6A 4QTGA 4XKYA 3NEHA 3DBNA 4IIFA 1X6NA 4LS2A 3R79A 1LCOA 1JYWA 3EX2A 4C6DA 3R8GA 3O3RA 3NURA 4HMNA 4EXAA 2PDMA 1XYMA 5GNYA 4UQAA 1BFNA 4Z2HA 4PB4A 4HD5A 3L2IA 2F2HA 3A47A 4M19A 4A3YA 4NRSA 5E0KA 4M24A 4IF2A 4XD4A 4MY8A 4D8AA 4RE2A 3TC7A 1E6NA 1DVJA 3BG3A 4W7VA 3OO2A 4JXCA 5BXTA 3R5EA 4FR1A 3FA3A 2RJGA 1U1UA 2DZWA 2JE8A 4UNIA 4FNUA 2A5HA 4X60A 4D6JA 1KM4A 5D2XA 2WXDM 3ITCA 3OVPA 3AHYA 4IX2A 3CQIA 3LD5A 4ZB2A 3GAKA 3REQA 3BCDA 4XAYA 1SMAA 4O52A 1Y5VA 2EQDA 2PDCA 4IQEA 1K4HA 3F5KA 1NDVA 1LRQA 1W0MA 3L12A 3TTSA 5IXEA 3H23A 3N18A 1W1VA 1XX1A 1SQ7A 1B3VA 2A3HA 2YZ5A 1DJNA 3M0JA 3M43A 1V51A 4DEFA 4I3GA 3RGTA 1GVFA 1HKWA 2ZUMA 3ZFHA 2YYTA 4CN6A 1G67A 1WDSA 4E2VA 4C7DA 3T40A 3PUGA 3VNDA 1CXEA 5HINA 3BCJA 4AC1X 3W00A 2V5DA 1ELSA 3AICA 4E2DA 1XQLA 3QY7A 4ML4A 3VM7A 4IJRA 1RR2A 2CHNA 2CLHA 5CCZA 3CH9A 3I65A 3WKZA 3UG8A 1JZ5A 1B3OA 4A3UA 3KBWA 2A3LA 5FACA 1SW0A 4DO4A 4IFKB 2QYGA 4MWAA 2ZX9A 1CT5A 1MMFA 3PWAA 1XYCA 1OFEA 4C6BA 1PTGA 3K2GA 5F1VA 2PWDA 3EKZA 4AISA 1FCUA 2WK2A 4GI4A 2PF8A 1LUCA 3MPGA 3GHSA 1RXOB 5C7HA 1J2BA 1S5NA 4DIAA 2HPMA 1XLJA 4WCJA 2PDIA 1XC4A 1SJCA 3W73A 6TAAA 4O13A 1E6ZA 1EJXC 4Z2LA 2NT0A 3GBDA 4BA0A 3MYPA 3MSDA 4GG9A 5JUVA 3TQ0A 1AG1O 2D3NA 4O53A 2XFFA 3GXPA 1R3WA 4HNTA 3QY6A 2PBGA 2V5KA 5FEXA 2YBVA 4UTWA 2GFTA 3GXMA 3VGDA 2VO5A 4GNKB 4N6EA 2YL8A 4KS0A 1WUFA 5F4SA 1YDVA 1EJWC 1HGWA 3S1WA 3OHMB 4DXKA 4ZSUA 3TTYA 3M44A 2QMKA 2BP1A 5DEZA 1JPKA 3ZJ8A 4G7EA 4BWLA 2X2GA 1TTQA 4TX8A 3SM0A 1GHSA 4J9JA 2RKXA 4DZIA 4EIVA 3IWPA 2X09A 4L4LA 2C18A 4A8IA 1K9EA 2PLJA 3W37A 1H0IA 3VDCA 4AD1A 1BYBA 3QN3A 3MKVA 4AZGA 3ARPA 3BLOA 4O0ZA 3OB8A 4GRSA 4XAFA 3E12A 3CWNA 2Z2AA 1J6OA 3GW0A 2ZXBA 5E70A 5C9XA 4W7WA 4I9JA 1N8IA 2HK1A 2I5GA 2HEJA 1PWLA 2G37A 1Q2SA 2D1ZA 4X0VA 2X1RA 4AVFA 2FPYA 3N13A 2VR2A 1IF2A 3RO8A 4HPXA 3P3BA 3K4AA 1L0PA 3CZKA 4HYVA 1XRVA 5JIPA 3A23A 3AISA 4DX3A 1FA2A 1TZZA 3EPNA 2ATMA 3NTYA 2ZA1A 2O4MA 2RFGA 1S3TC 5D30A 7TAAA 4HK6A 2P3ZA 1A3WA 3FN9A 4G7FA 4J28A 1QO5A 4WZHA 4IJCA 1WDPA 3LBMA 4XTIA 3DERA 1B1YA 1W1ZA 5LIKX 3A24A 4RDWA 3MW7A 4I5UA 1TJPA 2Q3OA 4H01A 2X1UA 3HJEA 1B3ZA 3IJIA 5CC7A 3G8EA 1DL3A 5M1TA 4PN2A 3WMCA 1E40A 3AIEA 3PUEA 3OG3A 4IMFA 2VHLA 3AWOA 3LM7A 2CBJA 2R1MA 3Q65A 1I9CB 3A4WA 1I45A 2CFFA 4LVFA 3WNLA 2Q8XA 3CMFA 1DQWA 3U5UA 3TSDA 2QCNA 3LOTA 1MZHA 1S5WA 1HG3A 4FZIA 1UBPC 1H61A 3V16A 1RY8A 2HDJA 1RLDA 3OOQA 3IRSA 4RJEA 2ZUSA 3DGBA 2XSXA 1R2RA 5F2MA 4DWSD 3WFLA 1RK6A 3CUIA 3Q45A 3GHTA 5D33A 1W2PA 2Y5JA 4J2MA 3HA1A 1E9YB 1VJSA 2YR1A 2QS8A 4JQAA 1V3HA 4P7OA 2VT0A 2WVVA 5G1TA 5DXXA 3WY1A 3TAKA 4D71A 5F2GA 5JBEA 3GR4A 4WKFA 4A2RA 1V02A 6A3HA 4Q4QA 1DYSA 4MJZA 3QZ6A 1BYAA 3W1TA 3P93A 3UWEA 3P60A 1H63A 3UJRA 4DY1A 1P0EA 2EJAA 3FV9A 3NCOA 2QUTA 2PTDA 4C6FA 2GOUA 5EBAA 1R87A 2DY3A 3QFEA 1XRFA 1EDGA 3S1VA 1EEPA 2GVLA 3NEVA 3HURA 4HPHA 1IIGA 3W72A 3IK4A 3WFZA 4AZ6A 2GGEA 1YBQA 3N4EA 2G3IA 1VF8A 5I3HA 1ISXA 1JPMA 4F9DA 1OCQA 4GUGA 1EUNA 3EDEA 1JCYA 1I4NA 2BVTA 4XG1A 3RILA 3GE7A 2VR4A 3KDNA 2QUNA 5IRPA 4W87A 1L6YA 1P7TB 5A8NA 4O28A 2CLFA 4LY4A 4O0QA 1GORA 3VOIA 4KRZA 3V1HA 4N02A 1FP9A 1CCWB 4EKJA 2PTZA 3E0WA 4MY9A 1JDAA 1DJIA 1BVWA 5LNSA 4K1GA 1PKMA 4P8WA 3EWBX 3VIHA 3D5HA 2O7SA 3OBEA 1OGBA 3NA8A 5IHSA 1O60A 3I7RA 5REQA 1C92A 2V3EA 3RNDA 2PRHA 1J0ZA 3PY2A 1E4NA 1Q4NX 1ADSA 4YHGA 2EG6A 2OFJA 3QR3A 1VEPA 2ZRUA 1EJRC 1RPKA 3GXDA 1S5MA 5BU6A 1R5YA 1K8CA 4OKDA 1XLFA 4WR3A 4LWWA 3W28A 2XIJA 1YPXA 3AXXA 3WUBA 3G1SA 1BSLA 5E9XA 3LSBA 3UPWA 3GW3A 1GT8A 3UFYA 2YA1A 5I3FA 3T4CA 3EPMA 5I6SA 1GVQA 3T0AA 3CBWA 2VKZG 2JKAA 4YYFA 4ZE4A 3HPXA 2IQ0A 1E5JA 1JPHA 3WH8A 4I5XA 1FTXA 4MAZA 2WNQA 1QXLA 1JR1A 3USBA 4TOQA 3NL3A 3NUKA 3PR2A 4Y6GA 3M41A 1JZ6A 2Y7EA 3CAQA 4YN5A 1X39A 1KM0A 1TZ9A 1TMQA 2YZRA 4NU7A 1H7OA 2RH9A 1UPMB 4IPIA 3PNUA 1TG7A 1ITCA 5D2TA 4AHQA 1YPIA 4FK9A 4H7ZA 3U7BA 3TEVA 5FOOA 1LQ2A 3GNDA 2CKRA 3VIPA 3WQGA 4LNCA 3KHDA 4JTUA 4LEQA 4GJJA 4Q8PA 1JEZA 1JXKA 3USZA 1C8YA 3GZAA 2J66A 2ANUA 1ENUA 1FWHC 4PFHA 2B0MA 1H1ZA 3KL3A 2V69A 3SN0A 2DZAA 1HKKA 2XM2A 1O94A 1TWIA 3SQSA 4R85A 3W75A 5AFDA 1Z41A 3I4EA 3LK6A 5LIYX 2QPUA 5AYZA 3SJ3A 3P82A 2WCSA 2G3FA 4OZOA 1XR2A 2FIQA 3N6HA 3D0CA 4NZJA 4ONVA 3ZJ7A 3ZYZA 4GJIA 5DO8A 2B81A 5DQPA 4KIRA 4S3BA 4IGHA 4L9XA 1TPUA 3RAOA 1PYFA 3OLEA 4Z1AA 4O54A 2PDNA 4OVXA 4W8BA 4GZEA 3GXFA 5ENLA 1VPQA 4LYPA 3I7SA 1UBSA 1I1XA 3RR4A 2QT3A 2GSEA 2IPGA 1PCKA 4PMYA