4NHVA

Crystal structure of b. anthracis dhps with interfacial compound 4: 5-(trifluoromethyl)-1,2-benzoxazol-3-amine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
b'MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
molecule tags Transferase/transferase inhibitor
source organism Bacillus anthracis
publication title Identification and characterization of an allosteric inhibitory site on dihydropteroate synthase.
pubmed doi rcsb
total genus 104
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4nhvA00
2E7FA 4D8AA 2DZAA 2VP8A 2DQWA 2OGYA 3BOLA 4G9PA 2Y5JA 2VEGA 2BMBA 2YCJA 2H9AB 4MWAB 1Q8AA 2YCLA 3TZNA 4D8ZA 3TR9A 3H2NA 4MWAC 2YCLB 3H2OA 3TYCA 4S3AA 2Y0FA 3BOFA 1Q7ZA 2YCIX 3NOYA 4DJFC 1AD1A 3V5OA 3H26A 4DAIA 1TWWA 4DJFD 4DJDA 4S38A 1Q7MA 3TYAA 1TWZA 1AJZA 5JQ9A 1F6YA 3H24A 4S39A 3TYZA 1TX2A 4S3FA 4NL1A 4O0QA 2Y5SA 3H21A 4S23A 4C1NB 3H2AA 3MCNA 4HB7A 4DJEA 4NILA 4C1NA 4S3BA 4MWAD 3TYDA 4S3CA 2VEFA 4DJDC 4O1EA 1Q8JA 4NIRA 1AJ0A 4NHVA 4D9PA 4DJEC 4O1FA 3H2MA 2H9AA 3TZFA 4S3DA 3MCOA 3H2FA 1AJ2A 3MCMA 4DAFA 4DJED 2DZBA 3TYBA 3H2CA 4PZVA 3K13A 3H22A 4MWAE 1TWSA 4S3EA 4DJFA 1AD4A 4DJDD 4DB7A 3H2EA 1Q85A 1Q7QA 3H23A 1TX0A 4MWAA 3TYUA 3TYEA 1EYEA 4CCZA 2YCKX
chains in the Genus database with same CATH superfamily
1I6NA 2Q01A 4K8HA 3QHMA 1DORA 4AX6A 5I5RA 1F9CA 3LG3A 2YBVA 4TX8A 1UBSA 2PGRA 2ZZ3A 1ZP3A 2HVOA 4W7WA 4GNKB 4MUZA 2QYGA 5I79A 3UJ2A 1VBRA 2J47A 3ZVIA 3BZJA 1DWGM 3ITCA 5HK4A 2W62A 4JKMA 4EAYA 1Y5VA 4O12A 1XUZA 3IK2A 3MKKA 4HSNA 1J4EA 4AEFA 3GK0A 2DIJA 1SO3A 1KM2A 4A35A 4H9MA 1UPMB 1KFKA 4FXRA 3F5LA 2WVSA 3M6YA 1HXJA 4RPQA 3N17A 3UESA 4G8TA 3L23A 2DJXA 3W7JA 3EOOA 5JIPA 3VOFA 3KTXA 1WBJA 4DYKA 4H4IA 4JTLA 1Z41A 3W25A 1PXGA 1PZ2A 3RRXA 4FAMA 1H11A 1FWBC 4F66A 4Q8VA 4FO4A 2J77A 1WDPA 1GJPA 4ZZ9A 4PZVA 3UT0A 4AHPA 3AXMA 3GM8A 3R4IA 2OQYA 4TMBA 1YXCA 2O4QA 2ZDSA 4IIGA 1OFAA 4RE2A 1M5WA 3P0WA 4HU0A 2X8RA 2ZRUA 1ZLPA 1BLIA 3OZMA 4IP7A 4RW5A 4H2CA 4F9JA 3NTYA 3W73A 3UXKA 2FTWA 3SO7A 3COTA 3EPOA 1FCVA 1KB3A 1SO5A 4ZFCA 4KCUA 4MTVA 4QBXA 3ABQA 2P5NA 1L6YA 3DYPA 2R82A 2CW6A 4JYFA 2QCFA 1R8LA 4LALA 1W32A 1WQ5A 2B4GA 1ML1A 1UWSA 2TODA 4OOZA 2XGZA 2P0OA 2WC7A 1IIHA 3PWIA 3AIEA 1ZL1A 2OJPA 4GXPA 5CBJA 3FVDA 3V5OA 3VCRA 3SCOA 2PP0A 1SFLA 4MY8A 3UJSA 4DWSB 1VFUA 1J6PA 2QMJA 1AH3A 4CD6A 3T78A 4EKJA 3H2AA 1VIWA 1EBHA 3KL3A 1TZ9A 4RJEA 3W7EA 4Q6JA 1W3HA 1LCOA 4NZ3A 3NXLA 2IKJA 3C8NA 4HD5A 2XH0A 1XRFA 3HPFA 4NHVA 1VEOA 3EXRA 4Y9MA 1O7AA 3FDKA 1ZALA 1QI2A 5M2FX 5FF2A 3ITOA 4AMCA 2A5HA 2ZZ2A 2P88A 1JPIA 4Z42C 4LS1A 2QVNA 5CG7A 1RQBA 2J7FA 2C79A 1H1ZA 3URNA 1JZ6A 1V3KA 2QR6A 4LFYA 3GDLA 1FBAA 4FNTA 1G7UA 2YKKA 1FX6A 4RDWA 1TRIA 3G8EA 4KFNA 2ZUUA 3KTCA 4HMDA 4IT1A 2XUCA 1F4AA 3B97A 1GKPA 3ALGA 4N9BA 5I00A 4N6FA 4B92A 3APYA 1UKOA 1UWRA 2V5DA 3LB0A 3HU7A 4ZA0A 3ABRA 4ZQPA 2J6XA 5FI8A 1EOMA 5DBTA 4DAIA 4G6CA 4GQQA 3FJLA 2O4MA 4IL2A 3CK5A 2YCEA 1EJWC 1WZLA 4NY2A 2DSZA 1WOBA 3IVUA 4S23A 2ZUSA 2A7NA 1VHNA 4C6LA 2NWSA 3AZRA 5HQMA 1OK6A 3KFTA 3S47A 2WSKA 1XGZA 3BQ6A 1A4LA 1M53A 4KGJA 4Q4MA 5JH1A 3CZJA 4HT3A 4PRWA 5EY5A 4BQ4A 3FFSA 3LV6A 4H9VA 2GOUA 3A5VA 5DLCA 1SUXA 3SUTA 3CMFA 3A23A 3WCZA 2CLMA 1N2VA 3CTTA 3KBSA 3DFSA 1FP9A 2ZA3A 4BWLC 1XSJA 1UZDA 1PPIA 5C8BB 2JE8A 4LW7A 1GOIA 2GFTA 1PO9A 1CBGA 5G4EA 2VM8A 4FNPA 3WD0A 2ZKMX 3I68A 4RK8A 4UMBA 3TSDA 3JRKA 1KO0A 1X8FA 3QHNA 1Q6EA 3ZVHA 2OODA 3GNPA 2F8QA 1W5OA 2NXHA 2CHRA 2Y7EA 3A64A 4M6VA 3Q67A 4I6VA 3G0UA 1JXJA 4M6PA 1UIPA 4GYKA 1JYNA 2A3BA 4DBWA 2CXGA 1QPKA 4HJFA 4LY4A 3ZLHA 3WENA 3F5JA 1I1XA 3URBA 2BNJA 1VFTA 1E51A 1RD6A 2XVPA 3TYAA 4RCXA 3LCLA 3TIMA 1OC7A 2Q3RA 1G0CA 1RD5A 1DJXA 1DBTA 3VNLA 1C8XA 4C6BA 4FLSA 5E0KA 1F73A 1EOKA 5AHLA 4EP8C 3B8DA 1W17A 2Y61A 5DCDA 4INFA 1IYXA 4XO6A 5D32A 1HJQA 5G5IA 1KGXA 5D38A 3UZ5A 2ZUVA 3PAOA 5GNZA 3VNMA 1FA2A 3LCGA 3G0XA 4J2MA 4JYDA 3TJ4A 2C0HA 2Y70A 4ZL1A 1F3TA 4QJ1A 3PZNA 5E6YA 2G37A 3AUOA 3MI2A 2D22A 3C0SA 4XKMA 2DP3A 4OKDA 3HFTA 8XIAA 5E70A 2BB0A 1RSCA 4O1AA 3OQ8A 4DPPA 4L1GA 3VZXA 3OZYA 1XFCA 1CXFA 3PZOA 3UVAA 3VOIA 2QUNA 3BCFA 3TR2A 4XVDA 1A5CA 1R3YA 3VDCA 4PMQA 4FA3A 3ZLGA 3SY8A 3T8LA 5HUPA 4R5EA 1S1RA 2FZ9A 4UCFA 1ZAHA 2CFFA 2YBUA 3QV9A 3KS5A 4WLCA 1RUSA 2DEPA 1ZGDA 1G7VA 4WKFA 1HG3A 1I8JA 1W1VA 2WLZA 5HR7A 1IXOA 1XINA 2YIHA 4HMEA 1NP2A 3G8RA 2XFRA 3BG5A 2A3LA 2B7OA 4IIFA 3MCNA 4K8GA 4BQ5A 1UCWA 2ANUA 4IM4A 1C9DA 3KOXA 4PN2A 2DSWA 1XV8A 3H8AA 4XZNX 2PDBA 3LXAA 1PX8A 3QLDA 1V0NA 5AC6A 4NZ1A 2VENA 4PTMA 2WCAA 4GJJA 3LTPA 3VGEA 1WDRA 2NV2A 3VD3A 3EWYA 1WPCA 3H2MA 4QSHA 4AD4A 2BTMA 1WXZA 5KINA 4O4VA 3QZAA 3M0XA 3A4WA 4E2OA 1REQB 2QW5A 3R25A 3IUHA 4UFLA 3GZAA 1JPHA 1UWIA 1LWJA 1DQXA 5HR6A 4KWSA 1R38A 5G2WA 1W1A1 4IFKB 1U22A 2QNEA 1R47A 2PWFA 3LHZA 4ZXLA 1RH9A 3HGJA 3BANA 3D46A 2WC4A 3GC5A 1UPPA 1VD6A 3LK6A 4NP7A 1HL8A 4DF0A 3M7SA 1LROA 4KERA 1M01A 2KX9A 4J3WA 2GGEA 3APGA 2XM1A 3QJAA 2YCIX 2FKPA 2Y1HA 2ASHA 4CLMA 3WELA 1BHGA 3GTXA 4C6MA 1EZWA 1VP5A 2G5WA 2DZPA 3NGFA 3MT1A 4TOQA 4IX2A 1DQWA 4YL2A 3GR4A 3TMQA 3UXDA 1CXIA 2PP3A 4QE1A 5SWUA 3NJ3A 4UQDA 2GVJA 4GZJA 1QMLA 4MAZA 3GBEA 1MUCA 1W31A 3S6OA 1J0JA 4HKPA 2NQZA 1YDOA 1MNZA 4FPSA 3VVGA 1E6PA 2ZX5A 2V5JA 4J2PA 1U1HA 4R88A 3R12A 5CPQA 1CLVA 2BODX 3N2XA 5F4SA 3GFZA 1B57A 1CXKA 5IRPA 3FNDA 3Q2DA 3DFYA 4ZSTA 3HZ3A 1R3RA 1H0GA 4J5NA 3V75A 3URQA 3WJWA 2J9YA 4AY1A 3NSMA 4BY3A 1G4PA 1G4TA 3BLEA 3DHUA 3K4DA 1J96A 4ATDA 4YHEA 1NJJA 5BMWA 1TVPA 2DZAA 4Y90A 2FFIA 2PDPA 3AU2A 3B40A 2XIQA 3ISIX 4UNKA 4EF8A 4DUWA 2CERA 4KT2A 4TMCA 5BU9A 4Z17A 2ZUMA 4BK9A 3II1A 1KNWA 2WB5A 4LOCA 4JN8A 1UD2A 3STGA 1FHVA 3WK3A 5L9FA 2YOCA 3GLCA 1L6GA 2WWDA 1KM0A 2QGHA 1AMKA 1EX1A 3NOEA 1ICPA 9CGTA 2CC0A 2Z2UA 1PTGA 1OBAA 2C1GA 1DWHM 3NDYA 1NU5A 3PJXA 1Q66A 4JCMA 5AC5A 1V6XA 3FAXA 3ZJ6A 1POKA 4PODA 3H7UA 2P76A 3W26A 5C7VA 3CZEA 3RILA 3PBYA 1JQXA 3M0VA 4AHQA 4H41A 5G1YA 4AIUA 3CBWA 4TTGA 2WMHA 4CNNA 4EAMA 1TCMA 3EDFA 3BLKA 1LL4A 5A6BD 2TPSA 1BQCA 2XIOA 4MZYA 4GNVA 5D2WA 2PDGA 2O7QA 1PCWA 3E6EA 1XLIA 4S3GA 1LOQA 5H6HA 4JOMA 1KTNA 5AYBA 1UUQA 3N6JA 9RUBA 3EWDA 3TFCA 3BLLA 3BGGA 2REQA 3NPWA 1U83A 2J25A 4E8CA 2AKMA 1HL2A 4M6QA 3OHIA 3PWGA 1NARA 3PTDA 5CPMA 3MMWA 3L65A 2YYUA 1AODA 5AYIA 4PEKA 3PJTA 3FV9A 3V0SA 2ZXQA 5AHEA 5HUOA 2ALDA 2YDAA 1QK0A 3RRAA 1XLGA 2FB2A 3WQOA 4NVTA 1FWNA 2BGNE 1ENUA 2YCLB 3S9YA 2VFEA 4ZVJA 1FY6A 3GDKA 3CPUA 3PTKA 2QT3A 2HTMA 1GHSA 4GNJA 1L6SA 3MUY1 1XSIA 3MSRA 1B90A 1VBHA 2L5HA 4Z1CA 2WMKA 5LHEA 5F1VA 2PGWA 4IF2A 4JHOA 3WF0A 1B1YA 3R0KA 2BBFA 3QYQA 1LUCB 2UBPC 3L0KA 3FJ4A 4AF0A 3WQ6A 1QBBA 3FYOA 2D3NA 2BY0A 1YADA 3LBCA 3RYSA 2IQTA 3TZFA 3N12A 1UWAA 3TYBA 2OR2A 3TC6A 5TIMA 5HXMA 1TREA 3F2BA 3PZGA 4TX9A 2ZIDA 1VCGA 3C0QA 2EEXA 3IRDA 3BXWA 4IX0A 1UA3A 2R91A 4BA0A 1WAUA 1V0KA 3DECA 5BROA 4JEQA 5E6ZA 3VKKA 5AHFA 2CKSA 1NDZA 1HJVA 4DO4A 3I10A 4PUJA 3M41A 1I75A 3WNOA 2YCJA 3OP2A 3UZYA 3N34A 6PTDA 1XKYA 1UZ4A 4LNYA 1J8VA 3CV1A 3N2OA 3WLHA 3N11A 4FS9A 1ICSA 1KCKA 3ZQ9A 2FFCA 1B3YA 4RUBA 1SMDA 4O1DA 3BPWA 3KHJA 3G1SA 1MSSA 1TMHA 4WGXA 5H8PA 2Y85A 3QFWA 4XO7A 3SGGA 1JCMP 2ZFAA 1L8NA 3M43A 2DT3A 2PGFA 3AHZA 5EYWA 1KFWA 4NX0A 4MDPA 3TYDA 4Y96A 5HQLA 1UZHA 4NT0A 3LCHA 2Y89A 2PTWA 3RM9A 3WL1A 2W79A 1XLKA 2Z0IA 5I3JA 3IVSA 4RZ5A 2F2HA 3NVTA 1XIGA 1PV8A 2WMJA 5A6MA 3MU7A 1FFQA 3FHQA 2WVUA 3LHUA 2WBKA 4I7VA 4DLFA 5PTDA 3GR8A 4DWDA 1FP8A 1D3CA 3M44A 4HHLA 3D5HA 3EWXA 2I17A 4N9EA 2NX3A 1ONXA 3HN3A 4H9TA 2O0TA 4Y6GA 3T8QA 2PDCA 4Z1DA 3UZXA 5F2LA 4DUXA 4UQBA 4Q6XA 2XH7A 1QFEA 2NZLA 3LNPA 4GJ1A 1F8MA 3EDEA 2QCNA 3TH6A 4LQ1A 3GU2A 4D6EA 4I5UA 3P80A 3MWAA 4GYPC 3MWCA 4D1IA 2FTPA 2E77A 2J79A 2A3HA 1T99A 2QQ6A 3GH7A 3MTWA 3BW3A 3GHUA 4WY0F 2Y4SA 3R43A 4NQ1A 1WKYA 3E49A 4DZIA 2G97A 1XX1A 3TC3A 3OLGA 1QR7A 1M9HA 3CHCA 4MB4A 3T9PA 2VC7A 4PMZA 2FGBA 3VM5A 2DUZA 1JZ4A 3BJTA 1K8ZA 3REQA 3CLMA 1S1PA 3N29A 3MYPA 2HROA 4Q4RA 1RVKA 3QW4B 1KTBA 2GSHA 5FJTA 3SI9A 4DI8A 3K1DA 1PUDA 4O1FA 2R1MA 2ZQ0A 1RJRA 5BZAA 4MKNA 4US5D 1KFJA 2QCHA 1OM0A 3ZSSA 4XD4A 1X1ZA 3EWZA 4Y2WA 1GVSA 3CMJA 4JDYA 2GPTA 1E4MM 1XG4A 2Y8UA 2GDQA 1LLOA 2CESA 4K6AA 1XRTA 5M17A 3BLDA 3EOSA 1IEVA 2W27A 3W81A 4CU8A 4LV9A 2A4AA 3CV2A 4TR9A 3WZ0E 3LHTA 3W00A 3WSUA 5F2GA 3QR1A 4KGLA 2DQWA 2Y24A 5D30A 5KITA 2IPJA 4OV9A 4OUIA 3EKGA 3STPA 4B4HA 3W88A 3E0FA 4IGMA 1HVQA 3CMGA 2F6KA 1Q2RA 3BLFA 2J78A 3ARZA 1I2PA 3OVGA 1FWGC 1GORA 4KF1A 4IMCA 2V30A 3VGGA 2WW5A 5CJNA 1XIJA 1R7AA 1OT1A 1TPVA 1HO1A 2WMFA 3GTIA 1I2NA 2VC6A 3L5MA 4XUGA 2FLIA 3W01A 1EBGA 3W6LA 2OLHA 4QDWA 3RUBL 1R2RA 3Q94A 1KD0A 4X63A 3LCFA 3FCPA 3L4TA 3OIXA 4UC5A 3WDQA 3E12A 4WF7A 3NDOA 4GE8A 3EB4A 2GJPA 3AI0A 3CWOX 4C60A 4Z1YA 4J3TA 1JQVA 2V5KA 3EGJA 4WEVX 3IJLA 3RN6A 3CUIA 1EYEA 4Z2JA 1XDMA 5TQLA 3OBEA 4IUGA 3QY6A 4GUHA 2XVLA 2QUMA 3CWHA 2XH2A 4D6CA 3G18A 2ZRXA 1B5TA 2FHFA 3CZLA 3U4AA 4GO9A 4LUSB 2NT1A 2GQ3A 2Z1SA 4XAPA 4PRTA 2BLEA 3H55A 1OFRA 2ZZ5A 3N3TA 4NG3A 1QOQA 1TIWA 2EJ1A 2PCQA 3WLRA 3ABOA 1RPXA 3KLKA 5KZ6A 4ZFMA 2VWSA 1H60A 1H7RA 2MANA 3U2OA 3EB3A 4E2DA 1IEQA 3GYEA 1QHOA 4ML9A 3TQKA 3THUA 4BI7A 1Y5WA 4CQ8A 1EXBA 1OG6A 5GJPA 3VD7A 2WANA 4GUJA 3BCJA 2ZUWA 3BMVA 4PCSA 2CZEA 1TVLA 2OU4A 4PRRA 3DU0A 1KR1A 2IQDA 8TIMA 1L0PA 2UWFA 4L56A 4LCRA 5AYYA 2V3EA 1CXEA 3W2JA 1V0LA 1VHCA 2RUSA 2Z29A 3B03A 3OOQA 4HCDA 1G94A 2VOTA 1KGWA 2HJPA 4MWAA 2O56A 4XG1A 1M7JA 4DLMA 1SPQA 3ID7A 4N0RA 3TWAA 4MKSA 3HOJA 3W6YA 3EDJA 1JRBA 3STFA 4IGNA 4O54A 4PMDA 1IWAA 3P2VA 1PIIA 3SECA 1NQKA 5A94A 1EYWA 1UP2A 2G4FA 2ONEA 4ZENA 2PDJA 2PDIA 5DCBA 4P8UA 2X1SA 3MVTA 3ZOAA 1OT2A 2G95A 8A3HA 1O5RA 3EX4A 1O6IA 4IIHA 3SZ8A 3EX2A 2AGTA 4NYYA 3QLLA 1M68A 2FPYA 3ZJKA 3GIYA 4NSBA 4YTTA 3T6CA 3UYIA 3IEBA 4R34A 1VBJA 4B3KA 1OFQA 1EIXA 2A7RA 4J40A 3ARSA 3WDHA 5CKSA 1R7OA 3W6MA 3CQIA 1XISA 3W82A 2J7HA 1JCYA 2DIKA 3IV8A 3OBAA 5FJRA 2VX7A 1IEIA 2CKRA 1FWEC 4C91A 4GQGA 1UROA 1WV2A 3T09A 3NR0A 4ERGA 4K1WA 5LIXX 1D8CA 4OWGA 2B31A 2OB3A 3MZNA 4LWWA 1NTHA 1FXQA 1GKRA 1KFLA 1XWYA 1P7TB 1XLJA 2A2IA 4JIEA 4GZIA 1XG3A 1US2A 1WDDA 4L9ZA 4TVCA 1ZNNA 1K9FA 2AL2A 3UR2A 1E40A 3P8IA 3TMLA 5D2VA 3P60A 3RFAA 5FJOA 1WP6A 4C6IA 3E96A 2X05A 4AG0A 3FLUA 1J79A 1TO3A 1U1JA 7A3HA 1EEPA 3EEZA 3MHUA 1TA3B 1V6WA 1FCUA 3SGUA 4F40A 2FHCA 3ZZ1A 2OYKA 3BSHA 1Q6QA 5HNUA 3NEHA 4I9AA 5HULA 4DJFD 5A8OA 1ZCOA 2BGQA 1A0EA 3TOPA 1S5NA 4GOAA 4JNMA 2INEA 3N9RA 3QZEA 1J01A 2VEKA 4GVFA 4CQAA 2XZ7A 3CO8A 5DEZA 1WZKA 1UH3A 1YTKA 3TLQA 4IPPA 1QATA 3M0MA 2CZ5A 2VZSA 4IMDA 1EDTA 1P0NA 4P7RA 3S2MA 2Q71A 2YDRA 4GFIA 2BGSA 4V2XA 4RXGA 5LSMA 1ZB5A 4NKCA 1KKOA 5IHRA 1BYBA 3KEHA 3TVAA 3ITLA 5REQB 4HZMA 5C9UA 3GDMA 4Q4QA 3VKCA 1LQ2A 1RLCL 1LLWA 4J3ZA 4UTLA 4ZODA 2D24A 5BWFA 3L4VA 4H6RA 3QPZA 1P0DA 4B5NA 2DZWA 5I3GA 4BF7A 4Q4SA 1YRRA 3V36A 1BSLA 3WEOA 4RNHA 3F03K 4LBSA 2ZC8A 2D2GA 2QCLA 4HVXA 1Y65A 1QWGA 3GO2A 1KM3A 4LU0A 4RDYA 2I5IA 1BG9A 1YIXA 3PFMA 5E1QA 5HJXA 1UP0A 1QJWA 3WN6A 4URIA 1V51A 3DFHA 4GWEA 1J11A 4M6UA 3UWQA 3H7VA 1KTCA 2WVVB 1W37A 2A7PA 3ITYA 1UKTA 4HB7A 1YPIA 1XLLA 3BW2A 4N9DA 4C7GA 4G1KA 2R1LA 4RDVA 2DT2A 3A4JA 3PP7A 3OIHA 3AS3A 2XJ7A 1MQQA 1X1OA 4O1EA 3AICA 3EZ4A 2MUCA 3G1XA 4WY0B 4DYJA 3SRDA 3E2SA 4RLIA 1QI4A 4R9OA 1MZHA 4B5XA 4ZEPA 3GXNA 1ME8A 4CNSA 1VFLA 1UR1A 3AZSA 1P6BA 1AG1O 1WKFA 2QJIA 3WF2A 1GEQA 4AZIA 5BOFA 2QJGA 4K2SA 1MYRA 3GR7A 4PL2A 5HPOA 4IPLA 1DP0A 3E9AA 1GW1A 1O66A 2DSKA 1QWKA 4AZCB 2BS9A 3APTA 3NO1A 3RITA 4GG9A 2CLEA 3PZIA 1ITCA 1XR2A 5DY3A 1TIMA 2D1ZA 1BYAA 3DH7A 3TTSA 7XIMA 5A6TC 5I07A 1VCFA 2PUZA 4ZCWA 2VGGA 3IRSA 3RR4A 1XP3A 2WZMA 1EF3A 4P5UA 4GI9A 1N8WA 1YDYA 1F61A 3AIWA 2QPUA 2V69A 5CGQA 4HNUA 1ZJHA 4LUIA 5BCAA 1UWUA 5I78A 4GUGA 1P0BA 3CQJA 1SM9A 4ZO6A 3LGEA 3EKZA 4C65A 1VAHA 3LX9A 4JIRA 1X6LA 1EO5A 1GYMA 1I2RA 4AFYA 2OWXA 1RLDA 1UOKA 2ZRWA 3GC2A 4PTVA 5FOOA 3M64A 3W38A 1VC4A 4CQCA 5BMXA 5I3KA 2V5LA 1M6JA 2X1TA 3I3BA 2XVKA 5E93A 4A8LA 4Y7EA 5JIWA 2G3NA 3ARTA 1DIOA 3SRKA 1PYMA 4GIYA 4ZE4A 1QO5A 3C86A 4NZCA 5F2IA 1XBVA 1LWIA 4NJJA 3T40A 4H8HA 3L9CA 1JF6A 2NSOA 1MMFA 4ILSA 3NPUA 4F0HA 1E43A 3LSCA 3CAVA 3NZQA 1E0UA 5CC5A 2DZVA 4J3UA 4JAWA 1E3ZA 3VIGA 3B9DA 2EPMX 4H6QA 3SUWA 4BI6A 3MYOA 2EPKX 5E0FA 2YX0A 2C6QA 4MKVA 2RDXA 4I6KA 1OFDA 4DZAA 3RHGA 1UJPA 2PLJA 2HVNA 1NDVA 3RLGA 3S2NA 4DUOA 2W67A 3MJMA 3GHRA 3I6EA 3DGBA 3SJ3A 1K8XA 3K30A 1A49A 4LYRA 5XIAA 2YXGA 1OGSA 3QY7A 2PLMA 3VNJA 1BWVA 3KL5A 4XD5A 4MNKA 4DBSA 3BICA 3N25A 3ICJA 1A5BA 3WQPA 4DJEA 1E1CB 3A5FA 1Q6GA 1N82A 5I06A 2OT0A 1V7YA 1K8CA 2C13A 2DVTA 4NRSA 3L4ZA 6CGTA 1SVDA 2HISA 4GYJA 2DGAA 4UZUA 4IMAA 4B3LA 4D9PA 4GX8A 1Q2SA 4A2RA 3UGRA 2Y8VA 3W1TA 4EX4A 3MMUA 3ONCA 3QR0A 5FCZA 1AUSL 2F2KA 3V4BA 3UA3A 2JKAA 1PKYA 2EG7A 1NDWA 3PSVA 2FZ8A 1ZCCA 1XD0A 3YPIA 3T4WA 3WLPA 1NELA 3DX5A 4PR4A 1T96A 5FL0A 1E9LA 1OFPA 2CWXA 3U2CA 3U9IA 1FWDC 1XD1A 2V3DA 2YB1A 5KZMA 2WNQA 4LNCA 1FDJA 3GVGA 4BEQA 1JPDX 3CV7A 3LCXA 5G2HA 2I9UA 3EEGA 4TIMA 3GG7A 3S6DA 3OTRA 4F0LA 3MUIA 3QM3A 1ISXA 5DANA 3CUGA 4ZB0A 2X2GA 3CUHA 3P82A 4B16A 3LBMA 4A22A 3QFEA 3KOZA 4FX6M 5C71A 3NQ6A 3VX0A 3ZIZA 1N7KA 4OBRA 1K1DA 1KGUA 2KZHA 2VQTA 3KP1A 4OVXA 2PDFA 3ORWA 1EPXA 3M0JA 4M19A 2B0MA 5CEWA 1VYSX 2DW6A 4OT7A 4E0CA 2LLEA 4P7NA 4L6OA 1TPB1 4Z0JA 1ZZMA 3UZWA 4NILA 1F4HA 2OZTA 1BXBA 3O9NA 4IFOA 3UP8A 2PU0A 2PE4A 3AWOA 4C6DA 4WJ8A 1JG9A 4E6MA 4HCHA 5M03A 1YXYA 4MUPA 3PBGA 3QC0A 4HA4A 1CNVA 1RXOB 2JGYA 2CPUA 3EMQA 2ZYFA 1C29A 1TVNA 4S3DA 5LNUA 3LI1A 4DAFA 4DJED 4P2VA 5DT7A 3W7GA 1YNPA 3CQKA 3W7MA 5F2MA 2ZTKA 1SW3A 3SUUA 2WM1A 3XIMA 1QI5A 1BRLA 4LF2A 4EACA 3U8GA 4R53A 4W4QA 4GQBA 4E38A 4FOJA 4NAFA 1K70A 3B0YA 3OHMB 2V5BA 5ABEA 3RAOA 3UG4A 3USBA 3WG6A 2QJNA 3SGZA 3C6CA 5LNRA 3BQ5A 1Z44A 1DIDA 5CPNA 4N7QA 3G5EA 3UA4A 3P5ZA 2FZMA 3NQBA 5BXPA 2GWGA 4H6KA 3KRSA 2DZTA 1V0MA 4V1XA 2DSVA 3TYCA 1W9UA 1PX4A 5LIWX 2UY5A 3UZZA 5G4HC 3PJWA 2VDGA 4UFJA 3AMGA 1RPKA 4US5A 1C93A 3W85A 3C0LA 4J9JA 4DI9A 2PURA 2V6AA 1GOXA 1TX2A 1ISVA 5G1MA 3RO8A 3ALFA 3W2LA 2IW0A 3NZ1A 8RUCA 4DJDC 1H0IA 3LRLA 3UXAA 3E02A 2ZZ6A 3MDWA 4JD4A 4AIOA 1E6NA 4MGGA 3RM8A 1AQHA 4LC6A 4XZIA 1I0DA 5C5YA 2WZHA 1IGSA 1TE1A 4QSFA 5I23A 1W1IE 1NOWA 1S39A 4GY1A 3S5SA 3I3EA 2ZC1A 3S2JA 1V77A 4RE4A 1W5MA 3DHFA 4PC8A 1XDJA 4N6EA 3IIOA 3ARQA 3L0NA 3LERA 4ZO9A 3QKEA 4QJ5B 2WPGA 1TWDA 2PPGA 1XQLA 5A6AA 4XK2A 3WLJA 1Q5MA 1XICA 3CASA 1DTNA 1D3HA 4HNVA 2HPIA 1VYRA 5A6JA 4MHBA 4WR3A 4WUIA 4M5PA 3VUSA 3B05A 5FSDC 2DPEA 4K7YA 2OGYA 2HXUA 2C15A 3HPZA 3GVRA 1NAL1 1UMYA 2OOFA 5L6UA 1ECEA 2VRJA 2WKGA 1W9VA 4IP5A 4UTJA 4FNSA 2DORA 5HANA 4GHRA 3V0TA 3DUGA 1Z8AA 3EX3A 2A0NA 5A2CA 2VCAA 5AHNA 1MNSA 4DJDA 1C8VA 1RCOB 3R1ZA 3E0WA 3ZT6A 3BG3A 3A3HA 3EPMA 3WLIA 1UD5A 1CEOA 2J7EA 1XM3A 3L0GA 4JTUA 4YVPA 3KCOA 3IJ6A 4GGBA 2F6XA 3O16A 1WZAA 4CN6A 1WBHA 3N4FA 1E56A 1R9ZA 2RKXA 2NVDA 1TJRA 1XYMA 1JCJA 5BXRA 4C90A 2G50A 2PDLA 2XPKA 1F76A 1OF8A 2YXXA 3L7RA 2E8ZA 2WSPA 1W1TA 4ZOBA 1CI1A 2EPHA 4PUMA 4JL1A 3VM7A 3GKAA 1QI0A 2O92A 1QAPA 3PUDA 4KEUA 3R58A 3TQVA 2E6AA 4AU0A 2VQUA 3TLLA 2F38A 3WQGA 2CETA 4AEOA 2CBIA 3MANA 1EF2A 1KFBA 3P8JA 5C6MA 4WGHA 2YLAA 4PCTA 3FA3A 2DH2A 1RK5A 2HNHA 1H1YA 5D04C 2X09A 2E6DA 3POCA 6A3HA 5ENLA 3UGVA 2X7VA 3BAYA 1BD0A 2DQXA 1XCXA 3HQNA 4S3JA 2FHBA 3QOKA 2E68A 5C0QA 1DE6A 4KMQA 2X41A 3WY1A 2FPVA 4O11A 3QZ6A 1AD1A 3QW3A 4F79A 2G0WA 3AS0A 3WNLA 3PHAA 1JDDA 1HKJA 1OD8A 4A8RA 1TKKA 3W2UA 1DIEA 4QX4A 2A21A 3R5EA 2IPFA 3WBXA 3JVAA 1JEZA 3M0LA 2A1YA 4JX6A 3PNZA 5MHBA 4XAYA 2PMQA 1VFOA 2Q3OA 1ZBCA 4MWAD 1O5KA 5HMDA 1BEUA 4XKYB 1H7WA 4AXKA 3R89A 3PG9A 4H8VA 2HK0A 4O0ZA 2QDHA 1B3ZA 4O57A 2V82A 1MXDA 3GDBA 4U3CA 3SSZA 3B0PA 4L9YA 1TCDA 1ZY9A 2AAMA 3IANA 2OEKA 2CLHA 3DC0A 2PZNA 2D0HA 1W3TA 3I7RA 4ML4A 3BVJA 1QW9A 4GVGA 4RL3A 4IPJA 3ZVHB 5A6KA 4Q4OA 2CBVA 4HHPA 4TXEA 3LU2A 3S2LA 3T0AA 4L4OA 1J5TA 1T7LA 4I9TA 3P6LA 3VKJA 4PE8A 1KV5A 1WXJA 5LGZA 3MS8A 5KTLA 1LRNA 1KA9F 2FMNA 1UHVA 3T2OA 1D7KA 2X16A 1B3VA 4GH1A 3PG8A 5CAKA 1FVPA 4ICCX 2GSJA 1ONEA 3OBKA 5LGXA 2PTDA 4PBGA 4HK6A 1PTDA 3WD3A 4UQAA 4LYQA 5KEZA 1UB3A 4EIVA 4DX3A 5HNRA 2V3FA 3SEPA 1QW8A 5EA9A 3BDKA 2D0FA 4RX0A 5ABGA 3FJ6A 4A3HA 1FDZA 5K9CA 4RKAA 4OFCA 5GPRA 5EMUA 3P0XA 5DCEA 3WEMA 2QJJA 5HOSA 4HHMA 4ZO7A 3VNKA 3AOFA 4LB3A 2TYSA 4K68A 5K4ZA 3W29A 3SRHA 2VVNA 1LP6A 2Z26A 3IK4A 1DIKA 4WVXA 3BMXA 3WMLA 4G7EB 4F0KA 4DJFA 1Z32X 4ZQOA 2R1NA 4IPNB 1DVJA 1EP1A 3T4CA 2Z4GA 4QE4A 1HN1A 4AWEA 4HNCA 2TRSA 1IZCA 1O95A 4AX7A 1B0IA 2ZX9A 3MW7A 2WNNA 1A5OC 1XPGA 3FHAA 3LD5A 1E15A 1P0KA 1BVZA 2I5GA 2QJHA 3LCWA 1KW1A 3NPVA 2CU0A 5BW6A 1ZRQA 1Q6DA 1OCNA 3SCTA 1R85A 3PZ9A 1HTIA 1ZU8A 5BWAA 4GY0A 3CQ0A 2GOKA 4MPQA 3G1RA 3BL3A 2WQPA 2V67A 5AYZA 1GG1A 4ONVA 5A8MA 3CWNA 1MEHA 1C7TA 2GLKA 1QPOA 3IGSA 3TQPA 3VMNA 1SR9A 3CZ8A 1ZSXA 3FJNA 5TD4A 1EC7A 4W5UA 1PYFA 4EXQA 2WK2A 4H3DA 1C7SA 4XX6A 4YNGA 4MLJA 2Z25A 4J1OA 2Z7KA 3WQWA 3B4UA 4D72A 4GVHA 3A9BA 3FEQA 4X9YA 3KBJA 3W7CA 1R2TA 4JFUA 3M46A 3A13A 1GK8A 4GC3A 4D6IA 3V3WA 1UD8A 4CNUA 2BOEX 3OA5A 1DJGA 2GL5A 2EHHA 1BF2A 2Z1BA 3VI2A 2VC9A 4LVBA 2BX7A 4NASA 4GMEA 1GOKA 4WDWA 5D03A 3MA8A 4IFKA 3DOPA 1J0HA 1U5VA 5HWJA 1CWYA 5D05A 3LYEA 2X42A 5HNNA 4HK7A 1W3KA 5IDIA 3TXZA 2VUYA 4I90A 1QOPA 2VO5A 4PSRA 1P48A 2QGYA 4CUCA 2RAGA 3NQAA 1F5ZA 2GK1A 4EPBC 4UMCA 1PIGA 2HBVA 2E7FA 4Q8PA 1FUYA 4AH7A 2NX1A 3N1AA 1SJCA 5LKYA 1Y8BA 5A8NA 3B3DA 2H6RA 2HZGA 4A3QA 4KEVA 5FEWA 2OO0A 4DJFC 3FEMA 3LPFA 3F2DA 2NW0A 3KS6A 3NQCA 4HZ7A 4JTTA 3QSTA 3ZT7A 1YMYA 2FZBA 1MVYA 3LSBA 3M0KA 2Z7GA 1AZ1A 4CEXC 2TSYA 1FH7A 3KX6A 1HGWA 2IS7A 1TELA 3T2PA 4GI8A 3M0HA 3MV01 1K7FA 4QCEA 1Q65A 3PVFA 1JFXA 3RK8A 5TF0A 3TTEA 5T9CE 2NV1A 3M0IA 5AN7A 4ACZA 3WMSA 5HA7A 3A21A 1HL9A 2CNCA 4XD6A 4HPHA 3SQSA 4YTSA 4JTQA 5BOEA 1JZ7A 4A6GA 2BY2A 3QV7A 4LYPA 3PPHA 5FJUA 3KXQA 1ZQ5A 4HMCA 1XYBA 3RCMA 2BHUA 3VABA 3OLDA 3WLQA 1A0CA 1JYXA 4YPJA 1Y0EA 1QO2A 3TQ0A 3NL2A 3IIVA 3VGFA 3OYXA 3W53A 4KH2A 1JJKA 2QDGA 4EXAA 4LEFA 3W70A 5A3HA 5HBFA 4OBTA 5EMLA 3PB0A 1B4KA 1KXVA 5EU9A 5G4WA 4MZ8A 3U6WA 1AL8A 1DWIM 1V3HA 4J28A 2YFOA 3S5ZA 3R10A 1EHAA 3P81A 2JF6A 3S5YA 2P0IA 3GZ3A 4YHGA 2P8CA 2QEZA 3AIVA 4F8XA 1G4EA 3ABXA 3WQFA 1UIOA 5JBDA 2Z1XA 3NFUA 3ZJ7A 1AFSA 2VGIA 4AZBA 2VOMA 4L4LA 3A3WA 4GIAA 1PTAA 3UNDA 4YWSA 3QBUA 1JDAA 3VNYA 1QHPA 1TPH1 1TE6A 3VIIA 2OMAA 2OSWA 3WQVA 3N6QA 2C18A 3N73A 3WDRA 2CBJA 1EIBA 4UQEA 4OHQA 1J0KA 2WYSA 1NY1A 4CEUC 4POCA 3UPMA 4PMJA 3AHVA 3GXMA 2NVAA 4HNTA 1SJAA 1ZFJA 5C54A 4YN5A 1RBAA 1BAGA 3BLIA 1MW0A 1EJXC 3GBDA 2V68A 3QSRA 3W1LA 3WQEA 4HSHA 4L4MA 3H23A 4OGZA 5DXYA 4UFKA 1TV5A 1SZRA 2GQ9A 5FESA 2AGKA 3WJSA 4IQJA 3R8GA 5GVJA 1V3IA 3NURA 1YBQA 2CLFA 3T07A 2OEJA 3LGDA 2IXUA 1J0IA 1O5QA 2JK2A 5JBEA 2GDVA 5FF3A 2RDUA 4AMAA 3CAWA 3FYYA 2W9MA 1FWIC 3KM8A 4HJWA 3RIKA 3SIZA 4UR9A 4IG2B 5ABFB 1A4MA 1I1WA 2VC5A 1WUFA 1WXYA 2R1PA 1GVFA 1ZUAX 5HAOA 3HV8A 4ZE5A 5I77A 4H04A 3GAKA 3ITXA 1PIFA 1A5NC 1XIBA 3SY1A 1XLDA 2J24A 4F48A 4LS2A 4I9MA 4D6GA 3U5UA 3DBNA 6REQA 1N55A 2UZ9A 1CTNA 1I2QA 4WIWA 1W2VA 2W91A 3DDMA 3L12A 4U10A 2BOGX 5T8GA 3CEUA 2NT0A 4QISA 4Q8NA 2PC4A 2ZZ7A 4XBKA 4EOUA 3UQNA 3TP4A 2QZRA 1TRDA 3TX9A 1KKRA 3QQ0A 5HJYA 1ITXA 1ODZA 2PLKA 3B9NA 3KDOA 1KV8A 4MIMA 2Q09A 3G1YA 2OQLA 2BFGA 3R7MA 4DRSA 1XIIA 3DKJA 3H54A 3AS2A 3KBMA 4DY1A 1E0WA 4GFSA 1JF5A 2VYOA 1E6SM 1KM1A 5LHFA 3T81A 3N9KA 2VX4A 1WKEA 3CYJA 3TC7A 3VPLA 2ABBA 1PL9A 1SW7A 3AO0A 2VCBA 1KBLA 3QQ1A 2NUWA 1E3XA 4HPJA 2E9BA 2FJUB 4IIEA 4S3AA 3WFAA 3SFKA 4J3VA 3SJNA 3LRKA 4M56A 2E4TA 3B8VA 1AL7A 1GVEA 1IIGA 3C61A 5JH2A 1RAKA 3HURA 3DFQA 1JD9A 1V02E 1RALA 3WF4A 1CLKA 3WMCA 2Y7GA 2X0HA 3SN4A 3ABSA 3OZPA 4YCPA 1OX4A 3HG3A 4NAEA 1GKQA 2PODA 4LV4A 4QCFA 3NM1A 2CITA 2PWHA 1VPQA 4LBRA 3LRMA 3U5YA 3LZ5A 3VOGA 2ISFA 1RHCA 4B5SA 3H12A 1MW3A 1XBZA 1XYFA 3OGVA 4JX5A 3N2MA 4AZHA 3UG8A 4JIQA 4BCEA 3F4DA 2DJLA 2F6UA 4XD3A 2OEMA 4O8AA 4LTSA 1W8GA 2WMGA 3DHPA 4JTDA 5E9AA 3C8FA 4J4KA 3OLIA 4B2DD 3G2GA 5AC7A 1KBJA 2VEIA 4RXFA 4PCFA 1TV3A 4Q7NA 3S1GA 2BG5A 4BQ3A 1C8QA 2VEGA 3R2GA 1D7FA 4UTTC 2X1UA 1K3UA 2HE8A 3WNNA 3LHWA 1PKMA 1FWFC 1W6TA 1V6UA 1OJXA 4QQUA 1HJWA 3EKLA 1REQA 4YLWA 4UNLA 5CJ5A 3WLKX 2WAGA 3GW0A 5I3HA 2EF9A 3GNDA 4AC7C 3NL3A 1BGAA 3ARYA 3IWPA 6XIAA 2ZWYA 1FWTA 2VMFA 1RQHA 1A3XA 2ZOXA 4I7WA 3W71A 2OLSA 3PZVA 3W76A 4W5ZA 2D2JA 5I0DA 2QVHA 2GUBA 1L6FA 1FHDA 2CWNA 4Q8MA 1TPUA 3TTQA 5KETA 3O7UA 2OSXA 3M07A 1E9IA 1LRTA 4HMNA 4HGXA 4R33A 1YNQA 4DJDD 3NVDA 4CKQA 2PWDA 3BOXA 1H5YA 3QKZA 4QE5A 1K9TA 2QS8A 4XAZA 4FF7A 2PF8A 2W92A 3E38A 3G1DA 5EPDA 3TFXA 4ALDA 4AZ5A 3TONA 3C3UA 3GG8A 1X39A 1V6VA 1AQFA 4YS1A 2EO7A 2POZA 4ECLA 2OWWA 5EMYA 4LRTA 1B9ZA 2Z2AA 3RM4A 1Y5XA 4GKTA 3PANA 1ITQA 4B2DA 1KBIA 2PWVA 1XBYA 2BP1A 2VURA 1MQRA 3IUDA 2YL8A 3S42A 3NG3A 3ARXA 1BSIA 5AKQA 4E3TA 1JCNA 5G2IA 5C9WA 4RE3A 1GVIA 2ZVIA 4PCPA 2ATSA 5IFTA 4QQ3A 3MSGA 2QJMA 3N4EA 5CC6A 1BWKA 2FTYA 3BC9A 4HU3A 4O1BA 3PWAA 1XLHA 1OFOA 4ZSUA 3WL0A 4NIRA 1XLBA 4FIQA 4IJBA 4GIEA 4HPGA 3DGRA 4JBRA 1ALDA 2VJXA 1CXLA 4DJEC 1UR0A 3ES7A 3SCPA 1XPYA 5JMUA 2FB3A 1EPVA 3UY7A 1G5AA 4U33A 2XFFA 5HJLA 5KZDA 5CC3A 4JYEA 2G3FA 3NL5A 4D6HA 5AVHA 2G4JA 4IIBA 4NUWA 1GOWA 1POJA 3SCQA 3VGHA 1I0BA 5LIUX 1GZJA 3SN0A 1B3OA 5AC4A 2CZVA 1ZBKA 1O1HA 3H7RA 4PMUA 4M51A 2CYGA 4ZQRA 2DUXA 2XH4A 1EKOA 4JFVA 4GRSA 4CD4A 2VP8A 2FZNA 2JALA 1BFNA 1B2YA 1VR6A 1H7XA 3A6OA 1TB3A 4E4PA 1BTCA 3SCNA 3FSUA 1UUMA 7CGTA 4N4QA 1ADDA 4O18A 2HCVA 1XIEA 1B9BA 1H09A 2BOFX 1KCZA 3L4WA 1IEXA 2REQB 2AOSA 3GG1A 3WK0A 3L2LA 2ZTJA 3C52A 1IWBA 1AJZA 4JTIA 2IUZA 4XIMA 3U7BA 1B54A 4WHBA 1K4GA 1M03A 3AYRA 2C3ZA 4C1NB 5A1AA 1AA1B 5D37A 1YTDA 2BVDA 1FRBA 3PUOA 5AB3A 3B4YA 4OZOA 3SFWA 2ZICA 4PL1A 5MKGB 3WLLA 3V7PA 3W1MA 2PRLA 3GH5A 1GVQA 4C6EA 1AJ0A 1HO4A 2VZTA 3GKFA 4GYFA 5I2UA 1C90A 4YMZA 2KAUC 3WX7A 3CIXA 1UKQA 3E5PA 1R5YA 4N02A 4QM1A 3S1WA 2HNEA 3BO9A 5JBFA 3UBPC 1MDRA 1ISZA 2OG9A 3SBFA 3ME3A 3W28A 1JCXA 1OG0A 1RP8A 3GVVA 2PZ0A 1C91A 3BGJA 1S5WA 4AAJA 2WMIB 4UXDA 3L67A 3WD1A 2I7GA 4CCZA 1CGWA 2VZUA 3WO8A 1A3HA 5C7HA 4G9PA 4H6EA 3O0KA 3UWUA 4Q7IA 1TTPA 3LLFA 3C2YA 2YW3A 1GQLA 2ZX6A 3ATZA 3PBMA 4LVFA 5I3IA 1CW2A 3UVIA 4A3UA 4R7WA 2B7PA 3M6DA 1QI3A 1WX0A 3AROA 2QCEA 4XSLA 3SM0A 4MJ4A 2CHOA 3NCOA 6TIMA 3TNBA 4W8AA 3N04A 2UY4A 3SURA 1NFBA 2ZUNA 1XKJA 2D23A 3DG3A 5ABHA 4LUTA 1Q4NX 3BW4A 1OYCA 2Y8KA 5XIMA 7REQA 4KESA 5AYXA 2DUAA 3EA2A 3GFYA 4Z2GA 3N6HA 1SMAA 3POHA 1UC5A 4HN8A 1C8YA 3TTOA 3DYOA 3Q58A 1XGDA 3MKVA 1JZ5A 1E9ZB 2VFDA 2E6YA 1J10A 3DKLA 4QLKA 3DFNA 3CIWA 4XAGA 2Y6ZA 1JAEA 3KP0A 1W1ZA 4K7VA 3WLNA 1DJQA 1M7XA 3HPXA 1Q7QA 3GH4A 3MUAA 4O1CA 4W93A 2IKHA 1W2PA 3UXLA 4HZ8A 2X0YA 3SCVA 3T44A 3KZPA 2ZUTA 1TPWA 2HS6A 3GU1A 4MPKA 2XN1A 4FK9A 1US3A 3CLWA 4BFAA 1VZWA 4A3RA 6TAAA 3SADA 1OABA 2QF7A 3ZT5A 4WSHA 3W2NA 3FGCA 4WXYA 1GTHA 2CHNA 2Q6ZA 5AVNA 1Z7AA 3OODA 5E5CA 1Z3NA 1JNDA 2RH9A 3A4AA 1TSIA 4IMEA 4F4RA 4W8BA 3LGGA 1T0OA 1XQKA 2OKOA 5CLWA 1MEIA 3MKCA 4JS3A 1DJIA 3OO2A 2E1DA 1K4HA 4HU8A 4KRUA 3MMDA 5AECA 4WJXA 1DL3A 3K46A 3CAKA 4FLQA 5B7ZA 2GJLA 1I2OA 2OX1A 5F4WA 1XLMA 1TYGA 4ZQMA 1SZEA 3UZJA 4MDOA 2PU1A 1P5BA 2ZDRA 2H9AA 3CT7A 4OECA 3W37A 3H2FA 1GJUA 2RJHA 3LTSA 1W3LA 4UZSA 1OZQA 2A6LA 3OG2A 3G24A 4KRZA 4CVWA 1DJYA 3ZR5A 3VUPA 1BQGA 1BWLA 4FLRA 1H51A 4UIOA 4E8GA 1K02A 1Q85A 3U48A 3IUIA 4RR4A 4GD0A 3V35A 1GQIA 1UR3M 2J7GA 3QPEA 3G3MA 1L6WA 3LUTA 3QPYA 1LORA 4GKLA 5DO8A 1P4CA 1KM6A 3MV11 4XTDA 1FKXA 1Q6FA 3PUEA 3LA4A 5ABTA 1FOBA 4EK7A 3A9IA 3T0BA 2I57A 4R3UA 3V5FA 4X0NA 4GGHA 3DN5A 1VFMA 3N4AA 4ASTA 4LAMA 4P8XA 3UR5A 5ECVA 3NPXA 4M0XA 1UWTA 3FS2A 1UG6A 1UP3A 2Q8LA 4HYRA 3W7RA 2YJQA 1E6RA 4B90A 2W0UA 5DF0A 1PVNA 4JL2A 5JU6A 1J93A 1LL7A 3PNUA 4S3BA 2PSNA 3N15A 1ISWA 3MUXA 3VA8A 2YYTA 1HW6A 3RX2A 3KRZA 2PDXA 3O15A 1GZGA 2BXZA 3BZGA 3VGBA 4AY8A 1R3SA 1SZNA 1VFFA 4DEFA 4CCDA 1R9XA 4HN4A 2OT1A 5JXQA 3B0VC 2OYMA 4ZO8A 3PTQA 1PSCA 1JDEA 3DI1A 4Q33A 1S2WA 2NQHA 4C7FA 1ONWA 3UR8A 3U57A 1SU5A 5CC7A 3A47A 3HV9A 4DB7A 3RG6A 4EE9A 3TN6A 3AHYA 5EBAA 2QULA 3I6RA 2Q02A 1JUKA 1OIMA 4QJ3B 5AHMA 3UU0A 4GXMA 4UCGA 3C5QA 3QTGA 3WDJA 2A3CA 1PDYA 2YA0A 2GVYA 4W89A 1QNOA 1JPKA 4YTQA 1WOAA 4XZ9A 1UC4A 3W72A 1JXKA 3G3DA 1DWFM 3RLVA 3VINA 4AY7A 3BMWA 4JFWA 3O1NA 1GQKA 2GJXA 5LYRA 1B4EA 3HBLA 1SGJA 5A8GA 4GYPA 3NDZA 1W9DM 3C2EA 4DPQA 2QPXA 3H21A 2ON3A 4AVFA 3ONBA 3T7VA 4FNRA 4ROQA 5ECUA 3ANVA 5A8QA 4M24A 3L2IA 3GWQA 1GPFA 2A79A 5EB8A 3WK2A 4IPIA 1DEDA 3PB2A 4RZ4A 3QMSA 1LZOA 3CHFA 3KWXA 1E4LA 3K1GA 2P3EA 2R6OA 3B06A 1XLFA 1VBGA 2WOQA 3FYPA 1AK5A 1ESWA 3EBVA 3G6LA 4YVXA 4BF5A 1EXPA 1FWRA 1TWSA 1R3WA 2J8GA 3F4VA 4NF7A 4ZMGA 2PDUA 1WDWA 4L7ZA 1L2UA 3ES8A 2ZE3A 4JN7A 1YNYA 1H1NA 1E5JA 1WYIA 4ORIA 1NM9A 2PBOA 2PA6A 3GB6A 3VDAA 3W23A 4C5ZA 1EA0A 5A2BA 2GZXA 4YVVA 3MI6A 3VKBA 4DUVA 1QNPA 1G9HA 4ENLA 3PZMA 3R6IA 1RZMA 1TMLA 4NNBA 5CPSA 3G6MA 1E1CA 3PZQA 4LUYA 2FJKA 5IFPA 1OYAA 4DWSD 4NX5A 2VFIA 1YDNA 1XLCA 3IIZA 3Q4DA 5DX7A 1NOFA 4JR5A 2BWGA 1IQ8A 4YCOA 1X98A 3RPMA 2J9XA 2V2DA 2XYLA 2F9RA 3WLMA 3GAYA 3WBWA 2XINA 4JQ2A 3EA1A 2WZEA 2X1IA 3BLPX 1SJDA 4QEHA 3MPGA 2YA2A 4JZ5A 4AF0B 1EZ2A 3BG9A 3WQDA 1F3WA 3VTRA 1GOMA 1RK6A 3ARUA 1XXXA 4UWMA 1FWAC 2DVUA 3INPA 2Z28A 1F3EA 1I45A 3EX6A 3C2RA 3DC8A 3Q37A 2HXTA 1TPEA 1IT7A 4ADSA 2XVNA 2J9ZA 3AMDA 2HQAA 1E1FA 1X6UA 4YIWA 4GUIA 3OB8A 2QUVA 3ABZA 3DERA 1YE4A 2YSWA 3OEXA 1H50A 3VILA 3UF9A 1LQAA 2ZXBA 1EJUC 4KCTA 4CQBA 1UWQA 2FDMA 2HPMA 4UB9A 3ZM8A 4JICA 4O16A 1EH9A 4FR1A 3EMZA 3I7SA 4BKNA 1E70M 1ECQA 3SCUA 5IBXC 1R0MA 4WZHA 1NOUA 3KE0A 5D2TA 4I5XA 4H9UA 3W4RA 4JTFA 3A12A 4F2BA 1JDCA 2ICSA 1LDCA 3CUZA 1GQJA 5G1TA 1B30A 4HK5A 3DXIA 3RJXA 2YL6A 4CU7A 1CX9A 1XCFA 1PWMA 4QS5A 1JULA 1R2SA 1E6QM 4MMWA 1HIZA 1TFVA 5HMSA 1XHGA 1JZ8A 2NUXA 4MNMA 1F3XA 1X6NA 5AHIA 4QITA 3NQ2A 1OYBA 2WZIA 4AZGA 4IZGA 1W5NA 5MF5A 1XSKA 4NAFB 1AMYA 4QFUA 4DF2A 3W7DA 1I4NA 3UJEA 3ZR6A 2P53A 4PB3A 1PKLA 2D73A 4QG6A 2ZX7A 1QOXA 2NVCA 1PB0A 2QCDB 1F8IA 1UR9A 5BU6A 1SFTA 2J75A 4UTUA 2SFPA 3TA6A 2PDYA 4AVNA 1NWTA 3A3XA 5BRPA 2PDKA 5DN1A 2XN2A 1KLZA 3CYVA 2GYIA 2G41A 3AXIA 3FK4A 3S5NA 4QRNA 5CQ1A 1OY0A 2OFJA 3W86A 3LHVA 2OCZA 4RW3A 3W1QA 4S1FA 4C6PA 3W1RA 3AMCA 4W9TA 1SFSA 4G1NA 7TAAA 4LF1A 1J18A 3E0LA 1PDZA 3BTNA 3XINA 5A8PA 4PBEA 1E9YB 1DWAM 2Y7FA 1D8WA 1CYGA 1F74A 5CZTA 1EJRC 3K2GA 1J0YA 2C7FA 1A5AA 3W7KA 4GO8A 3HG2A 2FQIA 3MCOA 2PP1A 4H19A 2E0PA 2XFWA 3E74A 1F05A 3VU2A 1JZ2A 4ZOAA 3RX3A 3NL6A 3K8KA 4F3HA 1Q6CA 3W74A 1C92A 4L65A 5EBUA 5B80A 2QAPA 1DQUA 1WAWA 3O2LA 5IXEA 1DHPA 1FWWA 4J7RA 2INFA 1EFZA 2Q8XA 5E9XA 1B3XA 2AKZA 3AYTA 1KM4A 4WY0A 2QUTA 1KCXA 3I4EA 3RO6A 3CEPA 3A22A 1QK2A 4WJEA 4A05A 2BXVA 3BV4A 1IEWA 2ZRVA 3RLHA 3KOWA 1FCQA 2QKFA 3L5LA 3LNMA 1U1UA 4AYSA 4PUUA 4DBDA 2VTFA 4AZCA 3M5ZA 1I60A 1WNOA 3DZ1A 1V3LA 1W9XA 2XFYA 3O07A 2VD9A 3SCRA 1HX0A 3RR1A 1XI3A 1JL8A 5D9MA 1IZJA 2VDIA 1PS9A 4XZLX 4HIBA 4D6DA 3WUEA 3LEPA 1MRQA 3LXCA 4HTYA 4JTHA 1JRCA 7TIMA 2D20A 3CHVA 3MHFA 4FOUA 5FKYA 3IGHX 3P5YA 2XN0A 1W1YA 3I65A 1Q13A 5D8ZA 1AD4A 3F4CA 2AQVA 4JQAA 3MC5A 1YKWA 1XRSA 3TW6A 3GC4A 4I5RA 3B9EA 1WA3A 4PFHA 1OX6A 2XSAA 1Q45A 5AOUA 2G8ZA 2PRMA 2J88A 1IXQA 4HTBA 4PMYA 4YYFA 1XC6A 3H4WA 5D2YA 2RDWA 2EXOA 1EGMA 3W87A 1YEYA 1FH8A 4MYAA 3WJYA 1JGIA 3AISA 3RMEA 4J35A 1IF2A 1PZ0A 2PWGA 5DMNA 3O06A 3H2NA 3RJYA 1XYCA 4PMXA 2OPJA 4KBXA 2YXOA 1CGYA 3TDFA 3BOFA 2QIWA 1J6OA 3BLOA 5LA2A 4DXVA 1OC6A 4KCVA 3W07A 4A4AA 4GZEA 3NAVA 4FLOA 4M7SA 3VIHA 1KXTA 3GY1A 4IQDA 3B8TA 2Y5SA 4CCEA 1TPFA 2WKLA 4I8DA 1V8EA 4DO7A 1TJPA 2VGBA 3BV7A 3ZS4A 5LNSA 1BKHA 4KKXA 3NZRA 1KRAC 2J7DA 1DPMA 3NEVA 2JKPA 3DFPA 4L9XA 5FF7A 3IJ9A 1TV2A 3LOTA 4XVEA 2VEPA 1IV8A 3MP4A 3VZYA 5HWMA 2OYLA 1A47A 1YE6A 4JIIX 1K7XA 2GGHA 3LM7A 3VMPA 3WNMA 3RLUA 4GCXA 3H6OA 3ZXWA 1KRCC 2GQ8A 3KBWA 3OW1A 1IT0A 3DHDA 3HFYA 3MDUA 4RNJA 3TJLA 2FDSA 1QNQA 2WHLA 1IE7C 5FIPA 5EMJA 4S2BA 3LN3A 4YU1A 4ICNA 2VNCA 1WKDA 1DXFA 3ITVA 2DZXA 3VNZA 1XIHA 1DJHA 4O28A 1H41A 1W9BM 1S2AA 1P6WA 3WH5A 4LAUA 3G0SA 1HGYA 2FVMA 3F4WA 3UCCA 5CPLA 1UYQA 2VFFA 2VI0A 1GNXA 2YB4A 2I9EA 1E0XA 4CD7A 2DY3A 1DYSA 3IJIA 3GHSA 1EWEA 3NWRA 4QLLA 4MY1A 1QBAA 5KMYA 2QPSA 5FA5A 1GCYA 3HM7A 4R9XA 3W7PA 4K1GA 1X96A 3H24A 4W88A 4H7CA 2C19A 4QNWA 4GZ7A 2G96A 2X0SA 2VR4A 4ZXOA 1GTEA 3W7QA 1KBBA 2J8TA 5J5RA 1ZAJA 5IHSA 2E67A 4IH3A 1H62A 4ZB5A 1SO4A 1UASA 1DJZA 4ES4A 2AQWA 4MZ1A 4G7EA 1BYCA 1AW2A 2BY3A 1EX5A 5D02A 1J2BA 3I4KA 2BHYA 1R6WA 1YLVA 4PUEA 2FGZA 3C4UA 2GJNA 3N18A 4AD0A 3BAXA 2EPLX 3FXGA 3AQUA 1RBOB 3N2BA 4EXBA 1NWUA 4LSBA 2WHKA 5A6BA 4HBKA 2ZXDA 1TPDA 4CQ9A 4LPCA 3LHYA 3W84A 1NP0A 2PWEA 3FW6A 2Z27A 1BPLB 2NXGA 4X61A 3WD2A 3BAKA 1FCBA 3S3GA 5M5DA 3ZMRA 5CPOA 3CAQA 1SFJA 3ZR4A 4DBUA 3RU8X 2PDQA 3E2VA 4GISA 3TE9A 1HQTA 3WLSA 1S5MA 3WFZA 3AZTA 2JIEA 1IHIA 3VOHA 3PPGA 1BRLB 2R24A 3CT2A 3ENLA 3W1NA 2BASA 1HVXA 3CS2A 3W7OA 1Q6OA 4DIAA 3QMTA 3HJZA 5E0CA 4AB4A 1VFSA 1RVGA 4I3GA 1F6PA 4ZOEA 3PR2A 3AALA 1R3QA 4WDUA 3S1VA 2NLYA 4XISA 3FKKA 1LJYA 1TZZA 3W83A 3IV3A 1TG7A 3G22A 2I1OA 4IXXA 2I14A 3MMTA 3AHTA 2QV4A 5HNTA 4CCCA 1AJ2A 3MCMA 4JPGA 4CU6A 1CCWB 4REQB 3LLXA 3PK7A 4MADA 3WLOA 4MWAE 3NUKA 2Y63A 3U4FA 1G69A 1W3IA 1OD0A 1BG4A 3ECQA 4JDBA 5A95A 1A5UA 3HG4A 3I6TA 1VJIA 1EQCA 3VGDA 1NIUA 4HQVA 4HOXA 4ZR8A 3VX1A 4MG4A 3BOLA 3PM6A 1Q6LA 3GTHA 1S2TA 5TNVA 4CD5A 5CH9A 3W7LA 1ZENA 3UWYA 3REQB 3K4WA 1MDLA 1ZBWA 5U7SA 2Z1KA 4JTRA 1P6CA 3UPBA 1RJPA 4S3FA 3C2VA 4NL1A 4O0QA 4ADTA 2H90A 2DT1A 1BVWA 2IPGA 5GNYA 1NEYA 2X2YA 3G1FA 3IJDA 5DXXA 1S46A 1QUMA 4K37A 2VEFA 4FOKA 1LOSA 1JAKA 2GDUA 3IARA 3R11A 1NF7A 1PJ9A 5CLTA 2YGYA 4FB7A 3AFBA 3MB9A 3BWWA 1CPUA 3PF3A 4Z2IA 2XWEA 2PGEA 3NQFA 3LS9A 4PULA 4P61A 2NV9A 3AXHA 4PA8A 5FEXA 3KDNA 1PCKA 5A5WA 1M41A 1AW5A 1X7IA 3FN9A 3WNKA 3D6NA 1T8XA 3T05A 1S5TA 3TYUA 6ALDA 3DFTA 3UFYA 1P1XA 2NXIA 2Z6JA 4H00A 4N9CA 3SIMA 3C3NA 4CGTA 4G56A 2ACRA 4MYXA 2Y5JA 4NJIA 1T6MA 3UG3A 2HV5A 4JTGA 3TR9A 1KLYA 3UETA 1VENA 4JKLA 3PTMA 5J04A 3IIPA 2PTYA 4MAVA 1FHLA 3L5AA 2UY2A 4XZHA 3M5YA 1US0A 1OVDA 2UV8G 3OGSA 3SSJA 3PULA 6XIMA 2J8FA 2V9DA 4KRTA 3QY8A 4DXKA 1O60A 4UFMA 4KW2A 5LA1A 1VFHA 4UQ9A 1V6TA 2V2HA 2XG9A 3W7HA 1OEPA 2RGLA 2ZZ1A 4ZTYA 3CHEA 4F0SA 1Z6KA 3N3MA 1YDVA 1KWGA 4C7DA 4KFOA 4AXNA 4JNYA 1V3JA 1TTIA 4M1RA 2OLAA 2AQOA 2VD8A 1M65A 3GHTA 4DO6A 1YPXA 3MY9A 1JCTA 3FOKA 4B3ZA 1Y7VA 2IKIA 5BRBA 3AIBA 4QLJA 4C5YA 2J13A 1ZJIA 2VELA 1TQJA 5LXEA 3GNNA 1XH2A 4GIRA 4JXCA 2WVTA 1YBQB 4PSPA 4PBFA 1CLXA 1W5QA 4WRHA 1CB7B 2HS8A 4DWSA 3M47A 4HA1A 1Q3NA 4KWVA 3LQLA 3QR3A 5CXPA 5CSRA 1IR2A 4KIEA 1YYAA 3U3HA 1EJ7L 1ME9A 1OCJA 4XKYA 3S9IA 3EMCA 4X2RA 1KM5A 2AAAA 1E4NA 3E0VA 1SSDA 1VH7A 4IMFA 4QNEA 3ZWTA 3TN5A 1Z48A 1RP9A 1Z42A 2QCMA 3DYMA 1J2WA 2V3GA 2X7WA 4CQDA 5DQPA 5U4NA 1UJQA 2ISSA 4KIRA 1S2VA 1S2UA 1C3FA 1GHRA 2OZ0A 4QTGA 1V08A 4LAZA 4AD5A 1TWZA 3IJ7A 3LLDA 3GTNA 3B8SA 2EGZA 1GVOA 3TA9A 2ZADA 6REQB 3UEQA 4HOWA 4O0KA 4HYVA 4GACA 4JTSA 4X60A 4LUSA 1AH0A 4H9ZA 1EC9A 3W22A 3A24A 4GPNA 4DN1A 3USZA 2Y88A 3B0UX 1QPQA 3EOEA 3NQ7A 3K4AA 2Y62A 3TAKA 3AAMA 4AIEA 4W7VA 5IBXA 1DKWA 2I5QA 5FSEC 3GXIA 2WCGA 4LAKA 5K9DA 3AXKA 2HE5A 3MO7A 2XIIA 4FNUA 3S0CA 4PMVA 2PDNA 3L21A 2FIQA 4KWWA 4E4FA 2E5CA 2HRWA 3AHXA 4HU4A 2CLPA 5DMLA 3AC0A 3MBDA 5LIKX 1MO0A 3STCA 4IHCA 4UTFA 1J5SA 4KEMA 1OK4A 1XGEA 5LIYX 2YCLA 3NO3A 3PFRA 3OGRA 4MJ2A 5K3VA 4FSAA 4JEJA 4U28A 4JNZA 3S1XA 1EO7A 4GXWA 2GVGA 4B4FA 2VUNA 3ZO9A 1JVNA 3D47A 5JQ9A 1OGBA 1OX5A 3NIYA 3UWZA 4DELA 1W0MA 3QGAC 2ZCGA 2WSQA 4W8LA 3FSTA 1QNRA 3C2OA 1F07A 4JY9A 3QTPA 1LUCA 3S1UA 4B15A 2PDMA 1X7FA 3DG7A 1IXPA 1LM1A 4OTKA 1P7TA 4IJRA 5C2XA 1E6XM 5HWNA 3OZOA 4KCWA 1PHWA 4JTEA 1EJSC 2NSXA 1ONRA 5D9OA 3VE9A 4C6FA 3GXPA 1CECA 2E25A 2WHJA 3T0TA 2XZ9A 3SY5A 4GLEA 4M29A 3F1QA 2BVWA 4G5DA 1ZTVA 1BKSA 1O94A 4HHHA 5I02A 4YXGA 3W1AA 3AS1A 4WK9A 4BS0A 1BGGA 1LYXA 4WOZA 4LVAA 3NZPA 4PH6A 1H2JA 2PAJA 2PBGA 4YTUA 4B5UA 1Q6RA 4KEZA 3S6TA 3FA5A 3VIPA 2IXVA 3WQ8A 3GD6A 1NFPA 4TV6A 4Z0SA 3P93A 4E4UA 1LWHA 5DY2A 4TX6A 1Q8AA 3TZNA 3W1XA 1BXCA 2IPWA 4G7FA 2YDSA 4MFDA 4FXSA 2Y0FA 1UH4A 5J8LA 2W66A 4U2ZA 1VRXA 2VT0A 1OFEA 2EPNA 1V7AA 4DWSC 1NQ6A 1UR4A 4RV8A 4OQVA 3JR2A 5BOOA 3SUVA 3PY2A 5GJMA 1UBPC 4M3PA 3WH7A 1KQYA 1WZMA 2VVSA 1GG0A 5AY7A 4UTWA 4E2VA 2WM0A 2VXNA 4H7VA 5REQA 4WKAA 1DXIA 3N9SA 3OA3A 4JQ1A 1HZYA 3OVRA 3N2TA 1EP2A 1XL9A 4PB5A 3AXXA 5BXSA 2VRQA 3THAA 4W86A 2BVYA 1LG1A 5CAHA 5GNXA 3KLLA 1Q63A 4UR8A 2A6NA 7ODCA 1ZPTA 3CU2A 4X9SA 4QEEA 5J5DA 2IQ0A 3ZJ8A 2GWNA 1SQ7A 5AC8A 1NVMA 2G3IA 1E0VA 1QNVA 1GYLA 4MJZA 3VIOA 4EWJA 4LH8A 3IIXA 4EVZA 2BSLA 4YJ5A 1OINA 3N19B 2DSUA 2NQ9A 1VEMA 1LT7A 1AH4A 4FXFA 1U5JA 1H4PA 1M04A 2J62A 1RV8A 4MF4A 4RDZA 1XIFA 2DU2A 1GVRA 1H63A 4D6FA 2IKGA 1S3TC 2VKZG 4G2DA 3WK1A 1MEWA 1L2QA 2WSRA 3LPGA 5K7JA 3VC6A 1BTMA 3EWBX 5M3WA 1F6YA 4WD0A 1U2YA 2QAFA 2GSEA 4F2TA 3K8LA 3LMYA 1MW1A 4C6QA 4EPKA 4QDMA 3AU6A 4XWUA 2RFGA 3HGSA 4MJMA 5D09A 4PUDA 4QAWA 3WNPA 1THFD 3J7HA 2PRHA 3WBAA 3JS3A 5DT5A 5K2ZA 3CB3A 1E6ZA 2WXDM 5CPTA 2PDHA 1TUXA 1VYPX 2PB1A 3WH8A 1WE5A 2Z24A 4UTWC 4IXHA 3EDDA 1EJVC 3UXIA 3B8WA 2DZSA 4UR7A 1T8QA 2CEQA 5K4XA 4DHGA 1DJWA 2O9TA 3GSMA 1H5VA 4DXXA 5BXTA 3O0FA 1FH9A 3AIUA 5HPCA 1CB2A 3IACA 1SJBA 4GUFA 5DMYA 1CGTA 2ZBTA 3RDKA 3ANYA 2EKGA 1E4IA 3P14A 2XSBA 4GBUA 1OCBA 5BYWA 1O5XA 3HTWA 4B91A 3PN8A 4AD2A 2WSYA 4E3VA 2JEPA 5BRQA 1K8YA 3PBVA 4R7OA 3HG5A 4TQTA 4FI4A 3OPSA 4IICA 3R0UA 3NA8A 2PD9A 5C9RA 1LQ0A 1OHLA 2OXNA 4JHZA 3SR7A 4GH3A 1OSEA 5MKGA 3W75A 5FJPA 4L1WA 3NXFA 1LG2A 1EL3A 5CSUA 1LF1A 4PCNA 3O05A 5C2CA 2Z00A 4TO8A 1UKSA 4D1JA 4AUBA 4JTCA 3LM3A 3N13A 3O6AA 3W7IA 1T5AA 2MNRA 3LBOA 2VFHA 4QAIA 2Y7DA 1QTWA 3PSWA 3ZSTA 4Q8UA 4FZIA 3THCA 1FWJC 2ISWA 5AFDA 3WBEA 1K9EA 3U2EA 1YXDA 4NJHA 1TWIA 3NGJA 3UWEA 4PYSA 5H8MA 2OO6A 2ZE0A 2FMOA 3WJZA 1VF8A 3L4YA 1NWRA 4LEQA 4ATLA 1ZJAA 2GGIA 3WDPP 4ACYA 3M5XA 1JUEA 1TTJA 1YQ2A 2YL5A 3FY1A 2VGFA 4Q8QA 1YPFA 3AMKA 5CSSA 1T40A 4MNLA 1R86A 3M7WA 1GONA 3CXOA 2E1WA 3O6DA 2C0AA 5DBUA 4NYUA 1EDQA 4D8AA 1GWJA 3QXBA 3O6CA 3VDHA 2C1IA 4ERAA 2D2OA 2PLCA 4RNIA 1GOOA 3W0KA 3UNTA 1GUVA 4XV0A 1EDGA 4C1KA 1UQYA 3ITTA 3FX4A 3JZEA 5A2AA 3HIJA 3VCNA 3AUJA 4H8UA 2GVLA 7REQB 2PEVA 1VCVA 4WOQA 4EPDC 2NQLA 4JIHA 3TOYA 4JFSA 3BUVA 5CGMA 3CHDA 3TSBA 2GJRA 1A50A 5C2GA 2OZ3A 2CIPA 3RPDA 1UQZA 4GC4A 3UY8A 2OX4A 5H2ZA 2ZXAA 3KCJA 3F2CA 1HFBA 2JBMA 1ZBVA 4L1XA 3ZWSA 9XIAA 4M1BA 1JIBA 1IXNA 3TK7A 2QDDA 4DM2A 3KRBA 2GUYA 3CO4A 2F84A 3R8RA 4X2PA 4DF1A 4UNIA 2VZVA 4FX7A 1HNYA 2P10A 1UR8A 1PWLA 4S3EA 1EB3A 1HT6A 2DVXA 2VFGA 3NYZA 4D8LA 3NQDA 1TR9A 3KHDA 2PTZA 3GW3A 2DV0A 1O12A 1M3UA 4K38A 3T55A 1I9CB 5T26A 2ISVA 4E5TA 1VJSA 1TV8A 3FGCB 8CGTA 4AZ7A 3LV5A 1E5NA 3CJPA 1ZP4A 2J66A 5D9NA 1VB9A 4B5TA 3VD9A 2JF7A 1EQPA 4CN4A 4A8IA 2ZZ4A 3W02A 4P8VA 2Z6IA 4XQ6A 4DM1A 4OBSA 2VDHA 2XTKA 3WFLA 2EAWA 3SUSA 4UOQA 2O7SA 2ZA1A 5GJNA 4L80A 1XJBA 5KZEA 4JIPA 3D3FA 3RMJA 3TYZA 3WQCA 3CV6A 3DAQA 2V81A 2OKTA 2R94A 2W61A 1DHKA 1A5KC 1EUNA 4PB4A 4UBPC 2NQ5A 4S3CA 5FF4A 1H3GA 4ZQCA 2QUUA 3BJFA 5F4XA 1W91A 3GXDA 3U0HA 2O9OA 3M16A 4QR6A 3EAUA 3WBYA 3HF3A 2GGJA 3P62A 4GX9A 5FF0A 1CZ1A 2A85A 4OOUA 4HCLA 1ME7A 1E1EA 1W56A 4Y8FA 2B7NA 5CG0A 4CD8A 4PMRA 1GW9A 2DW7A 4OE7A 1O68A 3O8AA 4LT9A 3SRFA 4LBUA 4IFRA 1ZHAA 3H4GA 5I3DA 1UUOA 5EFFA 4IWWA 3N2CA 5I03A 1VIZA 2CLIA 5C9ZA 3PUGA 2AMXA 3WYZA 1P1MA 3JUGA 1CXHA 4H7ZA 1K77A 3QGKC 4XUYA 4DYEA 1TA3A 5EGRA 3K5XA 2VCCA 3WLTA 3VK5A 5LZLA 1TQXA 3OLEA 3VD5A 3PC0A 3H2OA 2PS2A 5TAOA 4V1YA 2X30A 1XH0A 1DV7A 3EYPA 2WQDA 3CUXA 3H26A 4MM1A 1OGGA 1J12A 2OTDA 3G1AA 3B9OA 2VHLA 3TJXA 2HBXA 3CL6A 4L6HA 3TTYA 3VFLA 4AYGA 3CUFA 3SW6A 3OVPA 3MSYA 4B5WA 3ZFHA 4OU1A 3ARWA 4P7QA 4BEUA 3S83A 2CBUA 1QHZA 3KBVA 3VDGA 3V1HA 4C6CA 4CNOA 2EG8A 3HO8A 4Y8EA 4NXKA 2WO5A 4AHOA 4Z2HA 1XIDA 3O3RA 3HB9A 1KFEA 1M1BA 4OIFA 4F0RA 2JFEX 2FGLA 1LRQA 7ENLA 2HEJA 4LXFA 1RQEA 3LCIA 2NX9A 2EKCA 3GE7A 2ZX8A 3UCDA 3QVQA 4Q22A 2WCSA 1RA5A 1HJXA 4FMVA 4PGLA 4JQ4A 1HP5A 3OYZA 2OELA 3KCLA 3THDA 4XBSA 2HSAA 4IISA 4GJIA 4KQNA 4LC8A 3VD4A 1K9DA 2GUUA 1WCGA 4Z2KA 4DVOA 3B0XA 1IT8A 4MSSA 2EQDA 1MI3A 3P3BA 4MNJA 1UW9A 1FQ0A 2GJXB 2JEQA 4NZFA 4AWSA 4O10A 3PPFA 2YW4A 4FHAA 1RY8A 1GOQA 1VGAA 3V1PA 5DELA 4WQ6A 1OB0A 4LRSA 1XDLA 1FWHC 3UCQA 1LOLA 1SW0A 2WLYA 4U4MA 2RDTA 2ACQA 5D33A 3HA1A 3KZSA 3WD4A 3HPSA 3VOCA 2WVVA 1B3WA 1X38A 3CPGA 4U31A 1XIMA 4KPLA 3VXGA 3QV8A 4JQ3A 1XC4A 5D8WA 4I7UA 3PZUA 4O15A 4L6DA 4HA3A 4DZHA 5HINA 2V2CA 2RJGA 1E55A 2JGQA 3F4NA 5RUBA 3R13A 1W54A 2D2HA 4M82A 3BSGA 5CJMA 1G1YA 5CZKA 2C71A 4OUEA 4DQWA 3CH0A 4Q4KA 1E73M 3SB0A 3HJEA 1V03A 3OQEA 2VR2A 4EPEC 5D4YA 5FEPA 3LMZA 2WNZA 4QXIA 1M7OA 1LTDA 3LTYA 3VIFA 1N8FA 9XIMA 3LQGA 3PS7A 5F1UA 3S9ZA 1QVBA 3T2QA 1JPMA 3M5VA 3TU9A 3CIVA 4P7OA 3BGAA 4Y9NA 1Z89A 3VAVA 1S38A 2YCKX 2HWGA 4Q3MA 4JTKA 3NQGA 1VPYA 2J74A 4IUOA 1ISYA 2JQXA 4JKKA 1XF0A 1OF6A 4AD3A 3TN4A 4XBJA 3T0DA 4Z2LA 1JI2A 1PKNA 7PTDA 1DJNA 5IDZA 1QDSA 3GG0A 2V38A 4NI8A 5JVLA 2NUYA 3M4HA 4LCQA 5CGTA 2UY3A 2B81A 1G67A 3M9YA 1FTXA 1CIUA 3GTFA 4PTNA 4AC1X 1MFUA 1GJWA 4NZJA 4YTRA 1G4SA 1XYLA 4MFEA 5T91A 1FHUA 1J0ZA 1JGMA 5DFAA 4BJHA 1GZ1A 3EX1A 3MP5A 1QPNA 2EG6A 4F0MA 1RCQA 3VKAA 1EP3A 2ATMA 3NNTA 1TJ2A 3ARRA 3RPTA 1WO2A 1VKFA 3KTSA 4UTIA 3NQEA 1T41A 4FEZA 1AVAA 3CQHA 3ZLFA 5GQBA 2FPTA 1X97A 3RCNA 2BVTA 3WQ4A 1DE5A 1N8IA 4O19A 4LUTB 2VWTA 1F6KA 1W1B1 4LVGA 3VC5A 2EBNA 2YLLA 5I09A 4MVAA 4M7TA 4RE0A 2F7FA 3VYLA 1MFVA 4HA0A 3L66A 3D0CA 3LXBA 5HDRA 3KBNA 3NYDA 5FD0A 3JZUA 2VL4A 2G3JA 1CDGA 3GU9A 3GNOA 3E3HA 2FH8A 4ATWA 3MP3A 1EA9C 4ZB2A 2RHGA 1XH1A 5CBBA 1W3JA 3EB2A 1GVYA 4NNAA 1D3GA 1MXGA 4S39A 1GYNA 4UUIA 4L61A 2W4XA 4HNLA 1JI1A 1HP4A 2Y5EA 4C6JA 1MWOA 1TV7A 2WHMA 5EKYA 3MVIA 2YZ5A 3VMOA 3EXTA 4XIAA 2PCEA 1GQNA 3SN1A 4M81A 3FXYA 2XIJA 3V18A 1W1PA 3TWBA 1ICQA 1A5LC 3HQ1A 3DCPA 1H7NA 3AJ7A 3EDKA 4TV5A 3TROA 4B5VA 4FX8A 2DIEA 1D9EA 3PPCA 1NH6A 3B8IA 3SQMA 3R79A 4HZ6A 3VOJA 3GNXA 3DI0A 1E72M 2I56A 2EPOA 3DEQA 3PJUA 5I24A 1V93A 2C14A 3CZGA 3IJQA 4O17A 4LAOA 1H49A 2DFAA 4XZMX 4N2YA 1AQMA 3OG3A 2WZTA 4FNQA 4Q32A 5DRIA 2XU2A 1SZFA 2JKEA 3IGXA 4Q8WA 2DH3A 4US6A 1GPWA 2VZOA 1UZ1A 4HYWA 2DZUA 2A3AA 1V4YA 2H9AB 4A21A 4D8ZA 1S3HA 3B04A 1XW8A 4TTUA 2I16A 2TAAA 4U2YA 3WUFA 2XWDA 4JX4A 4KFPA 3VCCA 2P50A 4H9YA 3TW9A 3P7YA 4KS0A 2X40A 2ZWZA 3RXZA 2QHAA 2XHYA 3BARA 4PUKA 4U5IA 1HUVA 4V28A 3S4TA 2ZA2A 4S38A 4MB1A 3AWNA 3K8MA 2ZVRA 3W24A 2R9RA 3RGTA 1R3TA 4TVDA 2CLKA 1UKPA 3GRIA 2QDEA 3BAWA 3MUCA 3C2FA 5FEZA 2BXYA 3GYCA 1DTUA 3M1ZA 2QCGA 3P61A 1K6WA 2Q8ZA 3QC3A 3NSXA 4LGXA 4R7JA 2ACSA 3KW3A 4RNFA 3VIJA 3BE7A 4O53A 2J27A 3W1PA 1Z69A 3E1F1 2GK1B 4LVDA 4AWTA 1MQPA 5KSWA 2GGGA 4Y9PA 1JCLA 3H2CA 4QROA 6ENLA 3DIPA 3HMCA 3KL0A 3QMRA 4Q8OA 1TUFA 5EL1A 2V8ZA 3CL8A 2V5CA 2OZ8A 3WDIA 1W3NA 4PMNA 3MZ2A 3MO4A 1RBLA 3M0YA 4Q7BA 1LBLA 2E8YA 4DBEA 4A2SA 4AIBA 1R87A 1OFBA 4XZBA 4DNHA 1R9YA 1ODUA 1XRVA 4FF5A 1UH2A 1H7OA 1U33A 4ERIA 1VJZA 2BY1A 1ITUA 4GK8A 4IQLA 1AW1A 3E5BA 1MZRA 2D69A 1V02A 4H8NA 2VEMA 1TPC1 4X3ZA 4JHMA 4Y9OA 1R46A 1RA0A 4PUNA 5CCZA 1W5PA 3KVMA 2PD5A 3KUMA 3VDBA 3C56A 3WKZA 5EMMA 1GT8A 4GVIA 3NO5A 4ADUA 3GUWA 2PC8A 3SCWA 3URAA 5CZSA 1IGWA 4PFMA 3W9ZA 4L64A 3UD6A 4IP4A 2F61A 1MXSA 3EPNA 4LYKA 1HJSA 4QIUA 3P84A 4JCLA 3VNDA 1JDFA 1XS2A 1U30A 3K13A 5C70A 3QV6A 1PEZA 1LBMA 3KVLA 4GQRA 1MRAA 4TUFA 2Z1WA 4K39A 4ZOCA 4V15A 1TJ1A 3QOMA 2WJDA 1VLWA 4L5ZA 1KC7A 1UOZA 3TEVA 5HQEA 4XTIA 1CT5A 1K03A 5I6SA 4HP5A 3CPRA 5FJIA 3RCYA 2HK1A 3IVTA 1QU4A 5LNWA 2NQJA 2BMBA 3CTLA 2W63A 2PDWA 4RPPA 3STEA 1OC5A 1ZS2A 4P8WA 1CENA 2OQHA 5LXXA 3WQ5A 3NOYA 4CN1A 3MBFA 4AWUA 5EFDA 3WUGA 4E8DA 5EMKA 3CH9A 2FYMA 2WV8A 3QH2A 2O55A 1PHQA 2WKJA 3TKFA 4WX2A 1S5VA 3AYVA 5AZ1A 4LX4A 3MI3A 1FXPA 2OOGA 3GQYA 3UWWA 1NWSA 4C1NA 5IOBA 3NQ8A 4W84A 5XINA 1VRDA 3W2MA 3KVJA 1MUMA 3R8HA 3LZ3A 3SDOA 2QIIA 4CVUA 3GXFA 4IGSA 2WBGA 2PI6A 2BHZA 1HKWA 3CM4A 3E2QA 4QJ4B 1RR2A 2XVGA 3VO0A 3W7NA 3WMBA 4AVOA 4XB3A 1EWDA 4H9XA 4NNCA 5D2XA 3AMLA 4GABA 4N4PA 1HJUA 3HPAA 4I8YA 3NQMA 4D71A 2ABAA 3FA4A 1XLEA 2Z1VA 4B9YA 3DESA 2VX5A 2P1FA 1HKVA 2YBTA 1V5XA 1OWQA 2E5BA 3FIGA 4ZBCA 3ANUA 3ITGA 1A5MC 4H2HA 5DRCA 2ZRZA 2ISDA 3LY0A 1IR1A 2E9LA 3Q45A 1TZ7A 5H8UA 1JR1A 4QG9A 1AZ2A 3V0UA 3NQVA 4LUJA 4WDTA 4FXJA 2NLIA 1FKWA 3UERA 4H1ZA 2W3ZA 4NJGA 1Q7ZA 3V16A 3LDVA 1C9WA 3THQA 3WF3A 4RZ6A 1EJTC 3O63A 3B9AA 3CGTA 3HMJG 5HATA 1TWWA 5CBIA 3D3AA 4FR6A 1R3VA 3GVQA 1XFBA 3QEZA 5HMEA 2DDXA 4DO5A 3TNOA 2J6VA 3PBUA 1UR2A 3VKDA 2QMKA 1OIFA 3RX4A 2HVMA 3QF0A 1IZKA 1KXQA 4MY9A 1E71M 4Y9AA 4IG2A 1UD4A 3UPWA 5ABFA 3MHGA 1L8PA 1JUBA 3DFOA 3F5KA 5C9XA 3W1UA 1QW7A 1KRBC 4ZQNA 4IJCA 3KOYA 1PZ1A 2E28A 5CSYA 4Z1BA 4OJYA 1EGZA 3GS6A 3WUBA 3EOLA 4NU7A 1A3WA 3PBWA 4RV3A 2IMRA 3A4XA 1KFCA 2E40A 1TR1A 1LBFA 1RY0A 2E9MA 1XBXA 2A3EA 3WJXA 4I9JA 3AIRA 4Z1AA 4WSKA 1WB0A 4QDPA 3VIKA 2HDJA 1ZJBA 4PTXA 1JZ3A 3I7QA 3UYCA 4MWAB 1EGVA 4MWAC 1OX4B 4UFHA 2DT0A 2XIMA 2YPIA 3EXSA 3GIPA 3SQLA 4O4WA 2YL9A 3H70A 4S3KA 2V63A 4U5KA 1XYZA 1XCWA 4HOZA 2XGBA 4GY7A 4L4PA 4BWLA 1H61A 1WUEA 1EHNA 3Q65A <