4NHVA

Crystal structure of b. anthracis dhps with interfacial compound 4: 5-(trifluoromethyl)-1,2-benzoxazol-3-amine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
274
Chain Sequence
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dihydropteroate synthase
publication title Identification and characterization of an allosteric inhibitory site on dihydropteroate synthase.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 104
structure length 274
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4nhvA00
4S3FA 4DJFA 1Q7MA 3H26A 4NIRA 2E7FA 3TYDA 2VEFA 4C1NB 2H9AA 3H2AA 4DB7A 3TYUA 2YCLB 2Y5SA 2DZAA 2YCJA 4D8ZA 3H2MA 1TWWA 1AD1A 3TYEA 4S3EA 2OGYA 1Q85A 3H2EA 2YCLA 1AD4A 3H21A 4DJDC 4DAFA 2Y0FA 1AJ2A 4MWAE 2DQWA 3K13A 2YCIX 3H2OA 4MWAD 1Q7ZA 4DJFD 4O1FA 4S3BA 4D9PA 1AJ0A 5JQ9A 4S3AA 4C1NA 1TX2A 2YCKX 4DJEC 2VEGA 2DZBA 2VP8A 4PZVA 4CCZA 4DJEA 1TWSA 1TX0A 4NL1A 1Q7QA 1Q8AA 4DJDA 4S23A 4MWAB 4DAIA 3H23A 4HB7A 4O0QA 4S3CA 4MWAC 3TYBA 3H2NA 3TYCA 4MWAA 4S38A 4NHVA 3MCOA 3H22A 3TZFA 3BOLA 3BOFA 3H24A 1Q8JA 2Y5JA 3MCMA 3TYZA 4G9PA 3TZNA 4NILA 4S39A 4S3DA 3TYAA 3MCNA 3H2FA 3V5OA 1EYEA 3H2CA 4DJED 4O1EA 3NOYA 4DJFC 2BMBA 1F6YA 1TWZA 4D8AA 4DJDD 2H9AB 3TR9A 1AJZA
chains in the Genus database with same CATH superfamily
3G18A 3R25A 2XIMA 4HIBA 1S2UA 3FOKA 1OC7A 1EJVC 3REQB 5I77A 4Z1DA 5TNVA 2CLLA 4XD4A 2XH7A 1UR8A 3T8QA 4BWLA 4X2PA 2VX7A 4I7WA 4MJ2A 4EE9A 3VIKA 3N2BA 3CHVA 2VFGA 1IGWA 3QMRA 3HPXA 1TPFA 3AO0A 3HTWA 5HNRA 2X42A 1XCWA 3M9YA 4DBWA 3HURA 2VMFA 1LBFA 2A7PA 2A3CA 5DQPA 2QXWA 3BCFA 2PRHA 5T9BG 3HGOA 4PUMA 2C16A 1UWTA 4WKFA 2CYGA 2V82A 5EPDA 4MB4A 1QVBA 3S0CA 3UF9A 3IJ9A 3TLQA 3S46A 1DHPA 4XKYB 1M5WA 3IK2A 3GVVA 3DX5A 1OF6A 3MSYA 3NQAA 1MW2A 3ZFHA 1H0IA 4CNPA 1WE5A 4C6IA 4AF0A 5AVNA 4IUGA 3NM1A 1A47A 3GXPA 1ZZMA 2XH2A 4I8DA 2F6XA 2BWGA 3FFSA 2EJ1A 5IFPA 4IG2B 3L4UA 4JTAA 3FYPA 4DJDD 4ICMA 2ZICA 3PN8A 2IQ0A 4IIBA 1WXJA 3L67A 2V67A 2CITA 3INPA 1TVNA 3ZVHA 2PWHA 4IL2A 1GOIA 4O52A 2KX9A 4M0XA 4IP4A 2D2HA 1ICPA 1HUVA 2DU2A 3N04A 1NAL1 3B04A 4EPBC 3NQ6A 1B3OA 1ADSA 2ZADA 3CB3A 2J75A 2HK0A 3TW7A 2XVGA 1QW7A 3DGRA 1EX5A 1UQZA 5CBIA 3FV9A 5G2WA 1F2JA 2GWNA 1JD9A 3RFAA 1QNRA 1ISYA 3RJXA 3OZPA 1M04A 2WPGA 3PZ9A 1YDVA 3U57A 2QCMA 4Y9NA 3QC3A 4V33A 4UMBA 1I0BA 4JNMA 4D72A 1BKSA 1FWNA 4W86A 3RX4A 1VYRA 3N25A 1U1UA 1IEVA 2DT3A 3OLGA 2CW6A 3W02A 4EF8A 4NSBA 1HN1A 5LA1A 4IFKA 3KTSA 3IJIA 3T09A 3A13A 2W4XA 3ZLGA 4MLJA 5SWUA 1QATA 1ZFJA 5BROA 4RUBA 2VFIA 2VVNA 1CWYA 1KB3A 3LM3A 1WZLA 2ZYFA 3CPUA 4BFAA 4QJ5B 4JTCA 4M6PA 5FA5A 1KNWA 3Q94A 1AG1O 1XLKA 3AS2A 1XLGA 3SAZA 3DFNA 5LIUX 5IXEA 4JTKA 3ALFA 1TJ0A 3EWYA 3UG5A 1V08A 2Y63A 5HPOA 2ZZ1A 3ARXA 2GOUA 2HDJA 4PCFA 4I3GA 1V0NA 4WSHA 1KFWA 2J7GA 3M4HA 4QLJA 5U7SA 2H90A 4K1WA 4RV3A 3WQGA 4DPPA 1EJTC 5LKYA 3G8RA 4JKMA 3TNOA 4O12A 2Y62A 1W56A 1QPQA 3UQNA 1TE1A 2RHGA 3UG8A 5C9WA 4JKLA 4GKLA 3WENA 4JTJA 4WK9A 1QW9A 1KV5A 3WBYA 2PA6A 3U0HA 2CHRA 2QPXA 1KD0A 4HHMA 2WZIA 3GTFA 3KP1A 4ONVA 3WLHA 4ZQOA 1KCKA 5C2CA 1IEIA 1XICA 4HHPA 5A6TC 2BS9A 5AFDA 3MBFA 4PMNA 4XSMA 5I7GA 4GZ7A 3L65A 1T41A 1FWFC 4UQCA 2Z2BA 3P62A 4CNUA 2GDUA 4ZCWA 2YW3A 5FJTA 3V5OA 2Y24A 2G96A 4EWJA 1EDTA 2G8ZA 3B8DA 3WFLA 2Z27A 4XZLX 3E1F1 3BJFA 3WDQA 1VLIA 2PTXA 1F8MA 4QJ4B 3H26A 1J0HA 1QNOA 3WLJA 1YQ2A 4HNCA 2WZTA 4LEFA 4AG0A 3MY9A 1VIZA 3N4EA 3LGEA 3BJSA 3MB9A 2ZFAA 3W24A 2XFYA 2E68A 1UC5A 1UZHA 2QUTA 4LALA 5KZMA 3TLLA 1Y5VA 3ONCA 1NELA 4MYXA 4PFMA 1W3TA 1W1A1 3GVRA 3PZOA 5CC6A 2Z24A 1JR1A 4E8DA 2J7EA 4GQBA 1JPHA 2PWUA 4TQTA 3ZT7A 5M03A 3KCLA 1F61A 2RJGA 3M0MA 2EPHA 3MU7A 3WDRA 5LSMA 1WDPA 4I5UA 2A6NA 4KWSA 3TWAA 4B2DD 4YTTA 5F4WA 3VGBA 4JIEA 2R14A 5HATA 3ARUA 2OQLA 4ZOBA 3HQPA 4BZYA 3M7SA 3APTA 3L0GA 3PHAA 5D8ZA 3NEHA 3HZ3A 2EQDA 4MWAB 4NZ5A 5RUBA 5EBUA 3BGJA 4DWDA 4O8AA 3LCFA 3IVUA 1KW1A 5C0QA 4MKSA 4XVEA 1J2WA 3MVIA 5DXYA 2BHYA 4PMDA 2QUMA 1L6SA 2V0TA 3ITGA 4JFVA 2FJUB 1EBGA 1FY6A 5IHSA 2Q3RA 3BVJA 1NOWA 4W9TA 1MQPA 3VNIA 3L2MA 1AW1A 3MZ2A 4DXKA 3F5JA 4M6UA 3I7RA 4N9DA 2W91A 4Q7BA 4GH1A 2WVVB 3LY0A 1M1BA 1K4GA 3PB0A 1XISA 1WX0A 2AQOA 2FJKA 1CDGA 4JQ3A 4AZCA 1YDOA 1UZ4A 3T1GA 4JTQA 2O56A 1I2QA 4KEZA 4H3DA 4UOQA 4HPJA 1Z42A 2DDXA 2P3EA 3W29A 4IP5A 3TW6A 1E1CB 3GU9A 2OSYA 3W9ZA 4Q4MA 2REQB 1S1PA 4P8UA 1Q6CA 1G6CA 1AQMA 2ISSA 2WMKA 4AX6A 3GU2A 3TDFA 2QAFA 2HBVA 5CPSA 1H09A 3PANA 3U8GA 3NYZA 4TVUA 4GABA 4I8YA 1XH1A 3VD4A 4KWOA 2RKXA 3WK2A 3UJEA 3RLVA 1KCZA 3NO1A 4HZ6A 2ATMA 4G7EA 2O9RA 1P4CA 4HZ8A 4OU1A 1UWRA 2Z6JA 1IWPA 1RJRA 3FGCB 3VKDA 4S39A 4A2RA 3LCGA 2XU2A 4DO5A 3AXHA 2D0HA 1A4LA 4G1NA 1H60A 1OX5A 1OFEA 5C2GA 4YU1A 5FSEC 2WLZA 1FWTA 4DJFA 1TPUA 2FZDA 1W9PA 4XQ6A 5CG0A 3I7QA 4E38A 1QWKA 1GG1A 3RCYA 1FDJA 3C8FA 3AYTA 4FSAA 4DXXA 4NZ4A 3FS2A 3LX9A 1R6WA 7TIMA 3STGA 4W87A 3EB2A 5ECUA 3KVLA 2HXUA 2QCDA 4W93A 1KRCC 3ERPA 2O55A 1GGOA 1WDWA 2HE5A 1SO3A 4O13A 2H8ZA 4LXFA 4L9ZA 2I9UA 3CM4A 4GY1A 4XG1A 4UIOA 3WLKX 1YBQA 4LFYA 2VC7A 1AH4A 3DOPA 2J6VA 4NF7A 3O06A 3WH6A 2AMGA 1K9TA 3HFYA 1NDVA 1IZKA 4U5KA 1E70M 5LGZA 1EEXA 5CSUA 2NVCA 3ATYA 4QEHA 2HPIA 5GPRA 5K4XA 4GY7A 4R88A 3CV2A 1BF6A 3UR5A 5H2ZA 3V4BA 4EK7A 1XUZA 4ZR8A 1KM4A 1B3XA 3QZ6A 4G56A 4LAOA 1AL8A 3LOTA 5IFTA 5LHFA 5CGQA 4BQ4A 4A6GA 1DIKA 3P81A 5DCBA 5D09A 3AIWA 4B4FA 1M01A 1LM1A 2CLMA 5DCDA 2HZGA 3GM8A 4FXJA 2IS7A 1B0IA 3QV9A 5A6MA 3G6LA 4MY9A 1J0KA 3DGBA 1R38A 3HF3A 1DWHM 4ZEPA 2V8ZA 2VX4A 3QOKA 3FEMA 1KBJA 1EP2A 3OGSA 4JN7A 5C9RA 1JD7A 2FTYA 1W1ZA 2JFEX 3S2JA 2Y0FA 1GJWA 2EKGA 2W5FA 4NNCA 4QISA 3WMSA 1S5VA 1MXSA 4JS3A 4QQ3A 3CHDA 1OCBA 1BXCA 1KV8A 1VRDA 3C56A 4YYFA 1O94A 1OGGA 1VEMA 1PEZA 1X97A 3PNUA 4BCEA 3MKCA 1XS2A 4JTDA 4CQ9A 3NZRA 3VD5A 1YX1A 2OYLA 3N6HA 3CZKA 2ANUA 3PZNA 5I00A 1P6WA 5DN1A 3DYMA 1F3TA 3LBMA 5CZJA 1LYXA 3CAWA 3RIKA 3KBSA 4UC5A 4NQ1A 4PUUA 2VYOA 1V3JA 3UCQA 4UFLA 4GK8A 4GBDA 4M80A 3VOIA 4H9XA 5E6ZA 2YBTA 4E2BA 4BKNA 5M1TA 1BYAA 2ISFA 3FVDA 4LRSA 3W22A 4Z2IA 1GWJA 2HJPA 3C2YA 2A7NA 3CAQA 4JX5A 2W6RA 1T8QA 1WOBA 2A2IA 3U5YA 2TYSA 3PWAA 2XVKA 2DEPA 2E9MA 4L56A 1PCKA 1QI0A 2WOQA 3H53A 1ZSXA 4L4OA 1O1ZA 4TUFA 1SO5A 4Q8NA 2YPIA 2D1ZA 4PA8A 1ZBKA 2VC9A 2BZNA 2J25A 3ABRA 1KFJA 3I4EA 3NZQA 2HNEA 2VCCA 3GTXA 2BASA 3SGZA 2Z7KA 4B5TA 3L0KA 1QPNA 5DELA 2WNZA 1IYXA 2HWGA 1BLIA 3S1XA 3EOSA 3VTRA 3VFLA 4IM4A 3AALA 3GDBA 1LBMA 3JW7A 3U5UA 4IP7A 3UYCA 1DWJM 3ARWA 3I7SA 5HQEA 4OVXA 4FF7A 3A9BA 3RLHA 1TRIA 3SJNA 3ZS4A 1XPGA 3LTSA 2VEIA 4YN5A 1J0JA 2GUUA 4ICCX 1JCJA 4LX4A 4WX2A 1W91A 4UB9A 1OFBA 3E02A 3E9AA 1QHZA 2OZTA 3B8VA 2FQIA 4OT7A 4DF1A 3ABXA 1E9ZB 3OTRA 3AMGA 3KCOA 4G9PA 1DQXA 1NWSA 5A6SA 3W74A 1SJCA 3WLOA 1IF2A 1V8EA 2C7FA 1FH9A 1U5HA 4AZGA 2W63A 3A4WA 3WNPA 3VNLA 4UFKA 3SY1A 3GG1A 5M5DA 1ONRA 3B0PA 1ZAIA 2ICSA 1QI2A 1W9BM 1K9FA 3I6RA 3ZVIA 3TQ0A 3C0SA 1TSIA 1D9EA 3QYQA 2AL1A 1VEOA 1QR7A 3LI1A 2C3ZA 3E5PA 2YDQA 2GQ9A 4URIA 4JBRA 1KXTA 2P50A 2E9BA 2POZA 1MZRA 4PGLA 4Z2HA 1IQ8A 4IPIA 2C1HA 4HCDA 3AISA 3K1GA 3W1NA 2PDQA 3VZYA 2KAUC 1E6NA 2WHLA 3D3AA 3KOWA 3IJ8A 3GFYA 3OHIA 3VD3A 1TWSA 1TX0A 4S23A 1UWAA 5LNUA 1QNVA 4YMZA 4ZSUA 4GHRA 4N9CA 1W5NA 1JJKA 5A6LA 1KO0A 2OJPA 4IQEA 1V7YA 1R3QA 3DCPA 3PBMA 3DYOA 1NFPA 2OQHA 1LOSA 3CH9A 4S2CA 3MKKA 4KQNA 1JXKA 1RBLA 1TWZA 3AHVA 3C8NA 3VC6A 1OJXA 5ABFA 3GFXA 4DO4A 5ABGA 3CV1A 4QNEA 5DCEA 2CHNA 4LOCA 3IGHX 1JIBA 2HEJA 1O5RA 4DWSA 1J2BA 1KFBA 4MZ1A 2J74A 3FY1A 1YTDA 4QLLA 4RE0A 2Q8XA 4HNOA 4EXQA 1W1B1 3UA4A 3L0NA 1BPLB 3RM8A 1XKJA 4D71A 5C71A 2HCVA 3LLFA 2WJFA 3H2OA 4N0RA 5FEWA 4AEEA 4XAPA 3TROA 2RDXA 3QFEA 2QJNA 1PSCA 4C6OA 3CZ8A 1RLCL 3FVMA 2Q6ZA 2J7HA 4R9XA 3P0XA 3A4AA 1R2TA 1OZQA 3OA3A 2V30A 4RE3A 1JCNA 5CJNA 1UHVA 3O16A 2G3FA 4H6EA 3QZAA 3NQMA 4QGCA 3N4AA 2VP8A 1GOOA 3JR2A 1TJRA 3WBAA 5HQMA 3VAVA 1VBJA 3T9PA 4GYFA 4LUIA 2XWDA 1OABA 3NZGA 2QJIA 1UKPA 2VZUA 1K6WA 5BRPA 4DZIA 3SFWA 1VJIA 2CLOA 3HQOA 4Z2LA 1DIEA 4HYVA 4R7JA 4LVAA 3CJPA 3TMLA 4AFYA 4OOZA 4YYCA 3OHMB 4AW7A 3QOMA 4IIEA 4Q8VA 1UBPC 3FHAA 4JQ4A 1LQAA 3FSUA 3NJ3A 1C9DA 2EGZA 4EAMA 2I5GA 5HINA 1JFXA 4OGZA 4CU7A 5I0DA 4O11A 3WQPA 2X0HA 1XQLA 1TZZA 3TEVA 1P6CA 1AQFA 1Z8AA 2F2HA 1EX1A 3TC6A 2PF0A 4FX7A 5I5RA 3BAIA 4Q8QA 4M7SA 1GONA 3AMCA 1HNYA 3N3MA 4DBEA 1R87A 3ZJKA 2DUAA 3M5YA 1UR9A 3T2PA 5AYZA 3UZJA 3EOOA 3MW7A 4QG6A 4CCCA 1VPQA 2AAAA 3OEXA 1SZNA 4GYKA 1AW2A 3N17A 5FD0A 2FZ9A 2BTMA 1XI3A 3VKCA 2DY3A 3LGDA 1HF6A 4F0HA 1JI1A 3A6OA 4I6VA 2YGYA 2IXVA 4B5UA 3V0UA 3WNNA 2OZ0A 3NPUA 3W25A 3N11A 2NUYA 2QV5A 2C1IA 3HPSA 1RUSA 1VQTA 1KR0A 2YKKA 1EZWA 5G4WA 3CL6A 4JIPA 1ISZA 3VKBA 4JDBA 1YXDA 3LHYA 1HKVA 3W2KA 2XISA 1ITQA 3G0XA 4FEZA 2WCGA 4DM2A 1H7RA 2XVLA 1OEPA 2ZQ0A 3MI2A 4V2XA 1K7XA 3NXLA 2YZ5A 4GXMA 2ZZ5A 3VX1A 4J2PA 1UR4A 3UNTA 2PDIA 1B4KA 4GC3A 4R34A 2VZSA 1P43A 3QFWA 1WZMA 1JYWA 2X0SA 1O6IA 4AISA 2AKMA 4J1OA 5F7UA 2LLEA 1I8JA 1TTQA 1W1PA 1K4HA 1MNZA 1YPXA 4O1BA 1H7OA 1HVXA 3EZ4A 1S1RA 3E0WA 5IDIA 3NL5A 4ADSA 2DGAA 3LB0A 4WGHA 4HSOA 3PF3A 3G0SA 2ACRA 3EX3A 2YA1A 2WV8A 2NQZA 4XZNX 3H4GA 4Q32A 3MQTA 3KW3A 4ZO7A 3TKFA 2A3BA 1ONXA 4JX4A 4F0LA 4PMRA 1Q4WA 2PWGA 4C1NA 1FBAA 3VIFA 3UZXA 1V0MA 2NXHA 2GJXB 4DJEC 1V3IA 3MO7A 4LUYA 2WW5A 3DH7A 3TTOA 5GJMA 1TV7A 4GCAA 4NL1A 1JF6A 1F8IA 4DJDA 1OT2A 1E51A 5PTDA 3WQ8A 4O0QA 3VNKA 3MUAA 3CASA 1OFDA 1E0TA 2G4FA 4WXYA 3S1UA 1JAKA 3NNTA 1U1HA 3MCOA 4XKYA 3PTKA 3C3UA 2BP1A 4DZAA 1CXLA 1XKYA 3GFZA 2OT1A 3E3HA 1KFCA 4O17A 1ODUA 1DP0A 3W6MA 1PTAA 3T40A 3DENA 2V3FA 4AHPA 2E6YA 2I16A 1X6NA 5CPTA 1HJSA 3TTYA 3FIGA 3WL0A 4BEUA 3ORWA 3W53A 4DUVA 4LY8A 5EMKA 3ZMRA 1GHSA 1KBIA 3T44A 1WBJA 3WDHA 3MI3A 4MAZA 4GXPA 8TIMA 4DB7A 2J7BA 4DNMA 1DXEA 2I57A 2CNCA 1QU4A 3SIZA 1SYTA 4TMBA 4C6EA 5I3GA 4YS1A 3PJXA 4A8LA 3QVQA 4ZE4A 1W9VA 4W7UA 1B31A 2O9PA 4JFUA 4IX0A 4DO7A 2R1PA 4Z2GA 1FWCC 5AHMA 3O0FA 4GUIA 1BRLB 2NXIA 2ZRXA 4UUIA 3CHCA 4LBUA 3UR2A 4QJ1A 3MHFA 1WDQA 4HSNA 4QX4A 3EOEA 4YTRA 1NTHA 5F1VA 1R46A 3NGJA 1UB3A 5JBDA 1OGBA 1HZYA 1R5YA 1JRBA 3DFSA 4U3CA 4US5D 2BVDA 3W73A 4AAJA 3MTWA 2D0FA 1GNXA 1TUXA 3TZFA 3XINA 3DESA 2IPJA 2VC5A 1TUFA 3VKKA 1XDMA 4WLCA 2ZXAA 1X6LA 3EDJA 3G8EA 3MMDA 1JZ2A 1DJYA 2ATSA 1H7WA 3ANYA 2QJGA 2QEZA 4FZIA 4RXGA 1FH8A 3W2MA 1IIHA 4K7YA 3WD3A 3HV9A 4QS6A 1FA2A 2JEPA 3OODA 2Z0IA 4GA8A 3LI0A 4OFCA 4F9DA 4JTTA 4YVVA 2DZUA 3PTDA 2PDBA 4UTTA 3SRKA 3FSTA 3QY7A 1XLCA 4Z1CA 3IS4A 3GYCA 1LQ0A 4A2SA 4HNLA 5J5RA 2HTMA 2YCLB 1LRTA 1EXPA 4YXGA 1QOPA 4J2MA 2CXEA 3RDKA 5HXMA 2WB5A 4HOWA 4I6KA 3GDMA 2YFOA 1XPYA 3GZ3A 4Q4QA 1VLWA 1RVKA 3TXZA 1QK0A 4W7WA 4OQVA 1SZRA 1WXYA 4PR4A 4QSFA 1U30A 4GUFA 4QG9A 1Z9AA 1OGSA 1UQYA 1EEPA 4UNKA 1FP9A 3MP4A 4JTUA 3W82A 3LGGA 4IUOA 4HU3A 3TXVA 2WJDA 3HBLA 1E5JA 1RBOB 3MP3A 1LRQA 3P82A 4FOUA 1LROA 4LNYA 3CZGA 4I9MA 2V63A 2PRMA 1FOBA 3N29A 2GGJA 1QT1A 1XSIA 1AQHA 3MCNA 2CEQA 4OOUA 3CUFA 1P7TB 3M0JA 5C5YA 4N6EA 1SQ7A 3KCJA 3P14A 3NQ8A 3F1QA 3I3BA 3TJXA 1RD6A 5K9XA 3MC5A 3NZ1A 3RRXA 4IH3A 4IIHA 4Z1BA 3F5LA 3GS6A 4MPQA 3ITOA 4LC8A 4EPDC 4HCLA 4B2DA 2IMRA 2YDSA 3CGTA 3ITLA 3OGRA 4LH8A 4JHZA 1FVPA 2YL9A 2FH6A 3WBEA 1XBVA 4JTEA 1LORA 2DQXA 3HOJA 6ALDA 3W0KA 5HNNA 1QPOA 3QC0A 1RK5A 3MUCA 3TJ4A 2ZCGA 2CETA 1DYSA 4MJ4A 2X1RA 2PDNA 1TX2A 1H1YA 3B0YA 3K46A 3YPIA 4L1WA 1W3LA 3PZIA 1JCXA 3TN3A 4RZBA 3TX9A 5BYWA 4LS1A 3CWNA 2EJAA 2NSXA 1WZAA 2DT2A 1J6PA 2YXGA 2OCZA 2D23A 1XDJA 2PF8A 2Y70A 4D1JA 3QRHA 3UR8A 3VDAA 4KIRA 4MWAA 3FDKA 1GEHA 3IVTA 1POKA 2BY2A 3I68A 1XBZA 1G4PA 4EOUA 1MEIA 4K2SA 5A95A 1FX6A 4D1IA 5AC6A 3WO8A 3HMCA 3QSTA 4XZHA 3QTGA 2CKSA 1JNDA 4W84A 3O6AA 3G77A 3WEOA 4S2BA 1TIMA 4NZ1A 3URBA 3GAYA 3ZWSA 4JTHA 1A3XA 4CN4A 4JOMA 3TR2A 1KM3A 4LUSB 2X16A 5CSRA 1V4YA 3FX4A 1QDSA 4NYYA 1XD0A 3TC3A 3ZSSA 3WQOA 1TV8A 1WDRA 1XSJA 2AAMA 4UZSA 3QKEA 3GUGA 4L5ZA 5MHBA 2F6KA 4GJJA 4KESA 3DUGA 1PZ0A 4UTMA 3IRDA 1S39A 5ABEA 1S5TA 4H83A 1EBHA 3RF9A 3M64A 3AIEA 3L4WA 4Z1AA 1CB7B 2BY3A 2PEVA 1VEPA 1YNPA 2ZZ7A 1E1CA 1JFHA 2J8TA 3W26A 2ACSA 1GOKA 4O28A 2VQUA 3A47A 4ZO6A 1BYCA 4WSJA 1TMQA 2OU4A 3ZSTA 4PZVA 4GLEA 3MJMA 5CSYA 4HN8A 2Z1XA 4IGHA 3WBXA 2XH0A 3KS5A 3CYJA 1JF5A 3LQGA 4EPKA 5KSWA 3TQPA 1IXPA 1RLDA 1NF7A 1D8WA 3NO5A 4IQLA 1X1NA 4LTSA 5BOEA 3PP7A 1UWUA 1C8QA 3MYPA 1R3RA 5D32A 4A8IA 2DORA 1GYLA 3JZUA 1TB3A 1UA7A 1UP3A 2J4GA 3LCIA 1EYWA 4JICA 2V38A 1QPRA 3WZ0E 3G6MA 2ON3A 5E70A 3TR9A 3KFTA 1XIJA 5A1AA 2VFEA 3ONBA 3QZEA 5EMJA 2V69A 2DSUA 1H3GA 4GIRA 2WMGA 4IOTA 4JTGA 3FCPA 5TAOA 3WK1A 2J8FA 2CWXA 3B03A 4RNFA 1QBBA 1H5VA 4M51A 1TTPA 2GPTA 3DERA 1H1ZA 3N2CA 1HKIA 4E4FA 4CU6A 2QCGA 4FALA 3AS1A 1PVNA 1TWDA 4HU8A 3RGTA 1HX0A 3RCMA 3GRIA 3IACA 1JUKA 1ITXA 4RE2A 3OBKA 3MSGA 5MKGA 2ZUWA 2P88A 3IJ6A 4LYKA 3AMLA 4O0ZA 4CQAA 3P60A 5T8GA 2OZ8A 3AIVA 3GWQA 1F4HA 3WX7A 1EIXA 5DMMA 2X1SA 3KZPA 3R58A 3LN3A 4CD8A 4ZA0A 4W89A 1XLBA 1XBYA 1Z48A 3ZVHB 3LSCA 2E5DA 3IIOA 1Z41A 1UD6A 4GZIA 1TZ9A 2BGNE 1VS1A 4DWSC 4A8NA 4QLKA 2AGTA 2J7DA 2V6AA 3IIZA 5HUOA 4BS0A 5DRCA 3LV6A 4FR1A 2ZX8A 3MUIA 4GQ0A 2ZUTA 1TQXA 4AY1A 1ECEA 5I23A 3WQ6A 1POJA 4L6OA 3DG3A 4O53A 4NJGA 3CLWA 3BTNA 5CBJA 3P80A 1TPWA 2GSHA 4R27A 2ZRZA 1X6UA 2QV4A 1BAGA 1FCQA 3UESA 2OGYA 4D6HA 3PAOA 1OIFA 1L8PA 3W2UA 4XBKA 1ZUAX 3VA8A 4M6VA 5C9ZA 2GVYA 1K77A 4IFKB 4F0RA 5TBOA 2DW7A 5EMUA 2XSAA 3W37A 4WZHA 3SN4A 4E2VA 1O1HA 3T81A 5DXXA 4MJMA 5AOUA 2J77A 4B92A 1EP1A 1O5KA 1U83A 2CBUA 4UFJA 4DLFA 3K8KA 3VIPA 3SQSA 4GYJA 3GD6A 1E4LA 2PCQA 1YMYA 1QOXA 5KMYA 3CT7A 5EB8A 4J3VA 1TCMA 1ALDA 4OUIA 1OCJA 4UR9A 1UZ1A 4S38A 3EEZA 4Z17A 1IIGA 1US2A 1E72M 3XIMA 2ONEA 3NQ7A 4KWUA 5JMUA 4S3DA 4ZQMA 4D2JA 2RFGA 3CQ0A 5K2ZA 1AW5A 2VEMA 4AD3A 2A6LA 3EXTA 2VEPA 3AQUA 2WSRA 1R7OA 5CJ5A 2V81A 2XN2A 1LRNA 1OD0A 3TYDA 3A3WA 2FZMA 2XGBA 3G0UA 2V5JA 3W7NA 1TQJA 3UG4A 1Q4NX 5CGMA 3SCNA 1TYGA 5EU9A 3OZOA 2YYTA 4KRZA 1FUYA 4HN4A 2DFAA 5AC8A 1BXBA 5A8PA 2JF7A 3WCZA 2Y85A 1R9ZA 1YE6A 8RUCA 1F6KA 2JQXA 4HBKA 1A50A 1MEHA 4GFIA 1IV8A 2CLIA 5F2IA 3E2SA 5CAKA 1F07A 3SI9A 3B05A 3PUEA 1IZCA 4FX6M 2WMFA 3W6YA 4IMGA 1TZ7A 4FK9A 2NQHA 3KBMA 4X2RA 3OGVA 4AD2A 3TSBA 1S5WA 2GGHA 3E0LA 4LU0A 1SGJA 4L64A 1GW1A 1GVSA 4LV4A 4RW3A 4Q8WA 2ZTJA 3UWUA 1V0KA 3W84A 1NH6A 2I1OA 3U4FA 1Q3NA 1YNQA 3B3DA 3EPOA 3W23A 1OIMA 3EKZA 2PDCA 5H8UA 5BU9A 1SM9A 3BANA 5BMWA 1V51A 2ZXDA 4RLIA 8XIAA 5BNKA 6XIAA 4ZB5A 4OV9A 2CERA 4GI9A 9XIMA 2F2KA 3Q45A 2G95A 1V03A 3N15A 1VP5A 1GT8A 3IGXA 1WBHA 2QDGA 1BD0A 3KRZA 3M5ZA 3IRSA 2OT0A 2JIEA 1UA3A 5I3HA 3PG8A 3NPVA 4DX3A 4DVOA 2V9DA 1ZALA 3GR4A 3BW3A 3ITCA 3SN1A 2NQ5A 3ZR6A 3PPHA 5E0FA 3L2LA 1JPDX 3GTNA 3UVIA 6A3HA 1AZ2A 3W1RA 1PX3A 3MS8A 3KL5A 4DJDC 1XFCA 3L21A 4QNWA 6REQB 3KRUA 5HR7A 3AHZA 4EF9A 1XGDA 2BODX 1A5LC 3GXFA 3S2CA 3D47A 1TPC1 3S6TA 4J3SA 1JZ3A 4BI5A 1XGZA 3DBNA 3DDMA 5L9FA 1Q6LA 3LENA 3V0SA 4WR3A 2YZRA 3GNOA 1Q7QA 4AXNA 3GHUA 3SADA 4BHYA 1HQTA 2BNJA 2Z00A 1U5JA 5AECA 1XH0A 3KL3A 3EX2A 3U2OA 4YVXA 2EEXA 3W7QA 2VENA 1LOLA 4O54A 4HHHA 5KITA 1K1DA 1XRSA 4Y2WA 3U4AA 3TCEA 5FJRA 5EFDA 3WNMA 4OZOA 4DJED 1B57A 3PFMA 2Q8ZA 3MPGA 4GUJA 3ZWTA 4PFHA 1KKOA 4PB3A 2QGHA 5CZTA 3BG9A 3JRKA 2WQDA 1T8XA 5CAHA 1E6QM 3W7HA 2PFHA 4YTQA 3C4UA 3GH4A 1R30A 3NZPA 3WJSA 4FOJA 3THUA 2XTKA 3MP5A 1VBHA 4MZ8A 1BEUA 3ELFA 3NAVA 2BOGX 3UBPC 2Y88A 3SY8A 3DAQA 3P3BA 1JDEA 3H2EA 4AB4A 3DFQA 1DJIA 4O57A 5CBBA 1KGXA 4UFMA 1XLIA 3TVAA 4B5WA 2QUUA 2ACUA 4G2DA 4AMAA 1D3CA 5EA9A 4HMEA 1Q65A 5A6AA 2YL6A 3NURA 4E8GA 3EA3A 2XG9A 4IICA 2EPOA 3P61A 5U4NA 5CKSA 4K38A 5FESA 1UBSA 4Y9AA 2PODA 1I2RA 1A5CA 4R33A 3IGUA 2YA2A 1AA1B 3WLNA 1NDWA 3EBVA 3KZSA 3R4IA 4C6CA 2F6UA 3MMWA 1R9YA 2D24A 1TV5A 2VJXA 2RDWA 3UEQA 4UTTC 1BHGA 3W28A 3SCQA 3UXLA 2DSZA 2DIEA 3LUTA 3H22A 2CHOA 2W0UA 3NL3A 2FDMA 3V75A 5DY3A 1AODA 1UWQA 2WCSA 3PZGA 3T4WA 4JX6A 4PRWA 1NF0A 3WQVA 1H62A 2Y7FA 4LJ3A 3QN3A 3S5NA 1IT0A 3TYAA 2PI6A 4HU0A 2HPMA 1XYMA 4RZ5A 2O0TA 3OIHA 4MNJA 4M29A 3W00A 4C1KA 4YCPA 1ZB5A 2FVKA 2QCDB 1PZ2A 3UJSA 2VGFA 1AH3A 3W72A 4GOAA 4LVGA 1I1XA 1QASA 3STEA 4ADTA 1XLEA 3MUY1 4DI9A 4J3WA 4I5XA 2CPUA 4JCLA 4UNIA 1W3IA 4R85A 3VOCA 1KC7A 3CL8A 4PSPA 3SUWA 4CNNA 1YDYA 1YBQB 3MV01 5DT5A 3F2CA 3VIJA 4MSSA 4HD5A 4C7DA 1A49A 5I78A 3RMJA 3SN0A 2PWVA 3PBUA 4HPGA 1UKSA 3V5CA 1G1YA 3PSWA 4ZVJA 1ZP4A 3USBA 2V68A 1OFRA 4KRUA 4Y96A 5DMYA 3RAOA 3RM9A 1EF2A 2AQWA 2YYUA 2KZHA 2QDDA 2HVNA 4ZSTA 3PM6A 2B0MA 1CIUA 3PFRA 5D05A 1Q45A 1YTKA 2G3NA 4F4RA 1Q8AA 1M68A 2B4GA 2J24A 1HGYA 1ZGDA 5FF7A 1L0PA 1ZBVA 1VZWA 3N1AA 1EGZA 2WM0A 4C6LA 5KZEA 1JYVA 2D3NA 3IV3A 3BAYA 3QR0A 1N8FA 3UP8A 1UMLA 2VDHA 3DFPA 4NZJA 3EDEA 3NQBA 4EAYA 3AWNA 5CPNA 2B31A 1KFEA 7TAAA 4UMCA 3SJ3A 3BG5A 1PDZA 2P0OA 4AD4A 3W27A 4NZCA 4JQ1A 4QE4A 3ZO9A 2VGGA 3WF4A 2OODA 4R7WA 2XPKA 3BWWA 2FZNA 3ABZA 3UWZA 4ENLA 3CXOA 4C6MA 1SO4A 3LMZA 5C70A 5KETA 5DFAA 1DIOA 1FWGC 4AD0A 1IEXA 2C91A 4TMCA 2D20A 2OKOA 3E96A 4IFRA 4ZBCA 2XSXA 4N4PA 2DVTA 3HG5A 2BY0A 4PB5A 1G69A 4ZFMA 1H50A 2AKZA 5DY2A 1GVFA 2OXNA 1IXOA 1OADA 3N6QA 1RZMA 2QDEA 3GG0A 5HBFA 3UY7A 4FPSA 3BH4A 4MWAE 2PTWA 1FDYA 4QDWA 3R79A 4ERIA 1KM6A 1TPEA 3DI0A 4HPHA 2V2DA 3VIIA 1UR3M 4C6DA 4AU0A 1C90A 2QZRA 2WVTA 1BYBA 1WUEA 2PDFA 3DC8A 5AN7A 2HV5A 2WMJA 1VYSX 3THDA 2ALRA 5BWAA 4CD5A 3H7VA 4K68A 1DQWA 4KCTA 2GJXA 4I7VA 1Z3NA 2BG5A 1H49A 3SCWA 2FZ8A 2Y5EA 1MRQA 1M3UA 2INEA 1XCFA 3RPTA 1W1TA 2UBPC 3LDVA 2VX6A 2P53A 4YTSA 2PU0A 3E0VA 4JZ5A 2INFA 1VBUA 4HVXA 2QLYA 4FXSA 4PTDA 3W2NA 3HQ1A 1DWFM 1HVQA 1WA3A 3BE7A 4UTIA 3T42A 4JDYA 5K9CA 4HNVA 1MDRA 2RDTA 2ESCA 1US3A 3HGSA 1E9YB 1V6YA 3WUFA 2GUYA 2FHCA 4JAWA 2PLKA 3SEPA 4C6KA 1W8GA 2ZA3A 1A80A 5EMMA 3WQEA 3GVWA 3PBVA 5EMLA 4XV0A 2WJZA 4MMWA 3ITVA 2F38A 4Q6XA 2UY5A 3P5ZA 2CLEA 1PKNA 4W5ZA 3S1VA 1ZAHA 1EFZA 1QI4A 3KWSA 3H4WA 3II1A 3KBWA 4PTWA 3WQ4A 2E8YA 2WZHA 1GJPA 3T2QA 3G1HA 1YW1A 3N6JA 1QO5A 3CQHA 1UOKA 1TO3A 1UJPA 1V5XA 3VDHA 2PLCA 1R85A 4K1GA 3QV7A 4J7RA 3VIHA 2E0PA 4QCFA 2Q8LA 2Z4GA 2CU0A 3VI2A 2EO7A 2YBUA 1PO9A 1OD8A 1AL7A 3UPMA 2YR1A 5E6YA 4TTGA 2R9RA 3WMCA 2EPLX 4KEUA 4LBRA 5DMNA 3B8WA 4UTLA 3S1GA 3UETA 1V77A 2NLIA 2PTYA 2VNCA 1TPB1 3CK5A 3LXCA 4GGHA 3CEUA 4DNHA 1XIEA 3R0DA 1Z89A 6CGTA 2YLLA 2DIJA 3EKLA 3UJ2A 1ZJHA 3V36A 3BLLA 1OCQA 3H12A 4ILSA 1SZGA 4GZJA 1MWOA 2JALA 3KVKA 1OB0A 4AY7A 2YCLA 1E0UA 4W88A 3G1SA 4NY2A 1FKXA 2Z1SA 1JVNA 5KZ6A 2ZRYA 3LG3A 4I7UA 3N2OA 1PXGA 2B7PA 1VFSA 3HPFA 3Q37A 1NDYA 4HZMA 5HMDA 1XIHA 4WKAA 1GVYA 2C6QA 1XF0A 4A3RA 2DPEA 1E55A 5LNRA 5KEZA 1J10A 5TF0A 5E9AA 3W1MA 2Y6ZA 4ZTYA 3OJGA 1IEQA 1ZHAA 1REQA 2B7QA 3SCRA 4GFSA 3SSJA 4PCNA 1BQCA 3QY6A 1F5ZA 3WNOA 1BGAA 4EWND 2PDHA 1ZS2A 3BGAA 5CPOA 4A3QA 4P7QA 4LAKA 4L1GA 4HTYA 1GPFA 3KOFA 4P7OA 1E4IA 4FS9A 3GW3A 4ZTXA 2GK1B 4JHMA 3PBYA 1SFJA 2HNHA 1XH2A 4POCA 3EYPA 4FNRA 6PTDA 1S2AA 4B9ZA 2NLYA 1G4EA 1X39A 3LPFA 2VURA 4RW5A 3P74A 4A35A 5I07A 1DKWA 5G2IA 2HVOA 2QF7A 2FDSA 3W7KA 4K8GA 1L6YA 1PAMA 3QQ1A 3VM5A 5JXQA 3ZXWA 1NEYA 3W7EA 5TD4A 5K7JA 2WWCA 2HSAA 3A4JA 1AUSL 5CGTA 3B0XA 4NYUA 1XW8A 1B4EA 2A5HA 2YCKX 3N73A 3BLPX 4RNIA 1TJ1A 2PRLA 4CCZA 1ZAJA 1YEYA 1DORA 4R5EA 5IDZA 1NJJA 4IIGA 4LNCA 3BCDA 3QKZA 4JTIA 4TVDA 3G3DA 2BHZA 3QW3A 2QJHA 3WNKA 5JH2A 2W67A 1G67A 4Y90A 1F7BA 1Y8BA 3R13A 1PPIA 4FOKA 4W5UA 5D9PA 4BY3A 2I9EA 2GVJA 3WYZA 1ME7A 2FHBA 5TQLA 3WQCA 3WLPA 3SCSA 3OU8A 1S3HA 2QCLA 4J3TA 1UMYA 2WVSA 4NU7A 1K7FA 4XAFA 1CTNA 2WMHA 4IHCA 2WKLA 2W62A 3WF2A 1P0NA 2ZC8A 1NM9A 4V1YA 2QS8A 1J0YA 4BI6A 2GGEA 5I3FA 2PURA 1EHAA 5DT7A 2V5LA 2HS8A 2ODOA 1T99A 1BVNP 2WHMA 2BV9A 3C2VA 1P6BA 3H2MA 1TMHA 3TJLA 4UNLA 3RRAA 3G24A 4LT9A 3MDUA 4F0KA 3T07A 4LS2A 4LUSA 5FF0A 3R12A 3THCA 1H2JA 1UWSA 1QRQA 3Q4DA 4PMYA 4PMJA 5G1MA 3N12A 2WSYA 2H6RA 3NYDA 3VFCA 1UR0A 3W1UA 4GQQA 4K8EA 1H11A 4CVUA 4WDTA 3SURA 5D02A 3S9YA 3R0KA 4IJCA 3AOFA 3QYSA 5CPMA 1YDNA 3TN4A 4TR9A 2QKFA 1P48A 3MSRA 4LF1A 3TOPA 1DTNA 5BWFA 4FF5A 3S5SA 4O4VA 2VKZG 2C13A 4AIUA 2PDXA 4Q8TA 4FNTA 3W7RA 2QCFA 1J93A 1MI3A 1PKYA 1B2YA 3OVPA 1LG2A 1EP3A 1ADDA 3TSMA 3AYRA 1R0MA 1E0VA 1A53A 1GQIA 3G5EA 1KQYA 3UXAA 1B5TA 5HK4A 5I02A 2FGZA 1KR1A 3ZR4A 1ZENA 2QMJA 3TN6A 2XHYA 1OY0A 2Z2AA 1W3KA 1Q6RA 3FAWA 3CWHA 3TFXA 4C1NB 3THQA 1ZBWA 5E9XA 5I24A 4S3GA 3W7MA 1DHKA 4LGXA 3M0IA 1SSDA 2OZ3A 4F2UA 5I3IA 2ISDA 4PYSA 3VNMA 1RCXB 2OELA 3P7YA 1TPH1 3GK0A 1S38A 3PZMA 3LD5A 4WKHA 1PJ9A 2Z1WA 2XVNA 1HJVA 2PGFA 3URAA 7XIMA 4M82A 4HT3A 4JN8A 5BU6A 1FWHC 3B8TA 5LA0A 3IV8A 3LLDA 2ZA2A 2VFDA 3M16A 4FHAA 4DQWA 1JI2A 3GB6A 1QHPA 3CNYA 4DUOA 5I6SA 4GINA 4FAMA 1F6PA 3SGUA 1EJ7L 5BRBA 1N82A 3V7PA 4YL2A 1E9IA 1O4UA 3VU2A 1W5QA 4N7QA 4INFA 1K8YA 1F76A 1FFQA 3EX4A 1GW9A 2J47A 4UQBA 1C3FA 4KT2A 3M5VA 4KS0A 2G50A 5CQ1A 3ICJA 2J7CA 2PLJA 3GHSA 1JDFA 1OG6A 4LS0A 3QGAC 1PE1A 3WMLA 3WUGA 1GVOA 1CGUA 4JKKA 3KBVA 1FXQA 3N13A 1L2QA 3H6OA 1RHCA 1VBRA 4KH2A 1Q6DA 3M41A 1J6OA 3IUIA 3TK7A 4L9YA 3B9OA 4KCVA 1OX4A 3HG2A 3B4UA 4PL1A 3D46A 4GJIA 4NIRA 4OV4A 3M0LA 3S9IA 1GCYA 3CMGA 2WC7A 4IMAA 1OM0A 2I7GA 6TAAA 3FNDA 2WMIB 3W7CA 3ES7A 1OYCA 1GQJA 4P7RA 1RJPA 1NQ6A 3OO2A 4F8XA 1CX9A 5BCAA 1TJPA 3CPGA 2CZ5A 1QPKA 1RQHA 4ATDA 1Y5XA 4LF2A 4ATLA 2E77A 4D6FA 3AHXA 5E0KA 1RR2A 4QSHA 4A29A 1GKRA 1D2KA 3BURA 5DMLA 5CSSA 4E2OA 4DUXA 3AZRA 1RALA 3WUEA 4E4UA 1YYAA 3WLSA 4GX9A 1JDDA 2JEQA 4Z2KA 5AC7A 1G0CA 1C93A 3PPFA 3A5VA 2FB3A 4DLMA 2E6FA 4UFIA 1B54A 2WM1A 4WDUA 1AMYA 3GBDA 2FMNA 3TV8A 4AZBA 2PMQA 1JG9A 4H04A 3C0JA 3BARA 2YB4A 1Q63A 3GR7A 1WO2A 4H41A 2WNWA 3DHDA 2CC0A 1DBTA 3ARYA 5BOOA 1P0BA 4FIRA 3EA2A 6XIMA 2CXGA 2WC4A 1BWKA 3PVFA 1EOMA 4LANA 1XLDA 1TJ2A 1X7IA 2R1LA 4UR8A 2XWEA 3NQ2A 3GSMA 4ZOEA 2XN0A 3GDTA 4WD0A 2DT0A 4DN1A 4CGTA 4UBPC 1A5AA 1K03A 2VZTA 3PY2A 5FJOA 4LY4A 1MO0A 2R24A 2VFHA 3DN5A 4H8VA 3F4CA 4M24A 4W7VA 1NWTA 2GFTA 2DZXA 2TAAA 1W2PA 1YE4A 1ZL1A 3KTXA 5IHRA 5REQA 3T2OA 1DWGM 3NDZA 3E38A 2J9XA 3PJWA 3ZZ1A 2FIQA 1A0CA 1VCFA 1OSEA 3ATZA 3GR8A 5HJXA 3UJFA 2FTPA 4OUEA 3UYIA 1U22A 3AHYA 3IAQA 2OEJA 4DBSA 9CGTA 1HKKA 4ZO9A 3GNRA 1EDGA 4MNLA 3TA6A 2AL2B 1Q6FA 1V02A 4RDVA 4A05A 4WOQA 2FH8A 3KLLA 3CTLA 1CXFA 1VD6A 3PZQA 1W1IE 3ISIX 1OWQA 1TREA 4UTUA 3L4VA 1M7JA 4WXZA 3OLIA 3GVGA 1XUUA 3ANUA 4HKPA 1PUDA 1FWRA 4WUIA 1R3TA 1GG0A 1GUVA 1CGTA 2GUBA 1OFAA 1MQRA 1VHNA 3SBFA 3B9AA 1TWWA 4IFOA 3QH2A 4J27A 5JIPA 2NT0A 2Q01A 1L2UA 1CZ1A 5I06A 1SFTA 3PB2A 4JIIX 3NQDA 4ZQRA 1AD4A 3U7BA 2OR2A 3KWXA 4RDZA 3N34A 1KFKA 1RY8A 2VCBA 4D6IA 3NR0A 4O16A 2VD9A 1BWLA 2IPGA 4C5ZA 2ZC1A 3GIYA 1TTJA 2Z7GA 1RP8A 3S83A 3KOZA 3QBUA 5JQ9A 4NAFB 2RJHA 4Y8EA 3WK3A 2XSBA 6REQA 2G3IA 5FF2A 3EXRA 1XWYA 3UWWA 3DKLA 5JU6A 1O12A 3QQ0A 3VIGA 4IL0A 2OOGA 3RR1A 1Y0EA 2BFGA 4DJEA 1SMDA 1NU5A 3N2TA 4C7GA 1BSLA 3AUJA 1YADA 4NI3A 8XIMA 1TMLA 2WHKA 1HL2A 1R8LA 1E4NA 3NVTA 4LUJA 7ENLA 3BOLA 5EYWA 4XBJA 3SUVA 4DRSA 1Q8JA 4HK6A 3GW0A 1MUMA 1YNYA 5C7VA 1MMFA 4XIMA 1EDQA 2XFFA 2OWCA 1E6RA 3BMVA 2C15A 3CIXA 4LV9A 4E6MA 2EBNA 3V3WA 3EX6A 2Y7EA 1GZGA 4PULA 4IQDA 5C7HA 2HROA 3BUVA 2ZDSA 4Y9PA 1IEWA 3HIJA 2EKCA 2DZAA 3K5XA 3A5FA 4AY8A 4PMVA 3LS9A 1UD2A 1VH7A 2FB2A 4U5IA 2UZ9A 3LBOA 4FNUA 3AMKA 3I65A 2DSVA 2YBVA 4EP8C 3NUKA 2QULA 1Q5MA 4XIAA 5C55A 4U3AA 1M03A 1E4MM 2V5BA 1ZY9A 3LHTA 3PULA 2Z6IA 4A3UA 2NWRA 4GBUA 3WEZA 5FEPA 4KEVA 2H3DA 1PYFA 1XL9A 5F2MA 1OYAA 4Q22A 4Y9OA 3VCNA 4LRTA 5CLTA 3L12A 4AWTA 3H4XA 1NARA 1OC5A 4ICNA 1LQ2A 2IQDA 1TPVA 4G7FA 1MYRA 1TPDA 3BXWA 1W9XA 3CAKA 5HMSA 4ZODA 3R43A 4ZMGA 3G22A 3LLXA 1R2SA 2BX7A 2PTDA 4U33A 3U2CA 3VCRA 3CWOX 4H6QA 1C7TA 4J9JA 4QP0A 2CWNA 2ZZ6A 4Z08A 4OWGA 1LLZA 1FWDC 4X61A 3B0VC 1WZKA 4M6QA 1GZJA 1XYFA 3NQVA 1KWGA 5MKGB 1EB3A 4S3FA 3W1XA 4PCPA 3I6EA 4HHLA 3QEZA 4L80A 3EAUA 3U7VA 2A3AA 1LL4A 1Q6OA 1LOQA 2BDQA 2OLHA 1V7AA 2WCAA 3NSNA 1UP2A 4PL2A 4ERGA 1FDZA 3OB8A 1BTMA 4N42A 1N7KA 5CLWA 3F4DA 4ATWA 2A3EA 2R1MA 1LL7A 1VRXA 3WDPP 5BZAA 3D6NA 2BLEA 2UV8G 2ZBTA 3CUGA 2WLYA 1D3HA 4ZXLA 2D2JA 3IEBA 5A69A 1B3YA 4PSRA 3GG8A 1JQVA 1XLJA 1OBAA 1TELA 1HO4A 3VKAA 1XG3A 1XYLA 1LWIA 3ME3A 4IMCA 4LB3A 1H7PA 7A3HA 3G1RA 1CGYA 4H2HA 1NQKA 1RCOB 2DZTA 1JGMA 2FGBA 3D3FA 1LBLA 2PDLA 3BW2A 5TIMA 1UH2A 2Y8VA 4ZB0A 3VOGA 3AIBA 1B1YA 4PUKA 4DF0A 3OBAA 2J8GA 3TP4A 3KEHA 2QUNA 4HMDA 1H41A 1OHLA 1G01A 2QJJA 3SW6A 1RQEA 2YCJA 3EGJA 1HJQA 4FO4A 1G5AA 1WV2A 4X9SA 2F61A 1X8CA 3E0IA 2QHAA 1DE5A 3S5YA 1PIGA 5CH9A 5BRQA 1P1MA 2EG7A 4PTVA 3LBCA 3SCTA 1SJAA 2J9ZA 2PDJA 4AVFA 1GJUA 1I45A 1CENA 3KHJA 3KBJA 3TONA 7CGTA 5HDRA 4F66A 3R10A 4A3HA 3RMEA 1EXBA 1RBAA 3PTMA 1YIXA 3CL7A 3U2EA 3QHNA 4DYEA 4REQA 2FYMA 3N2XA 2ISWA 1E56A 3WBWA 3UWEA 4RPQA 1KRMA 4BF7A 4NX5A 1JDAA 1XSKA 2I5IA 3RXZA 3CYVA 3C2FA 4NKCA 1MUCA 3G1AA 4UQEA 2NX9A 3WQ5A 3VC5A 4J28A 1LUCA 4GD0A 3VVGA 3GXMA 5D37A 1EYEA 3GE7A 3P5YA 1ICQA 3AIUA 4RV8A 3VPLA 5LIYX 1PYMA 1EJWC 2OLAA 4E2DA 2OPJA 4GIAA 3NQFA 5I09A 1N2VA 1FFRA 1K9EA 3M6DA 3WF1A 3GXIA 3H2AA 4B3ZA 4M5PA 4QEEA 2WSQA 4PUEA 3A23A 4PTXA 2PS2A 4H8UA 1DL3A 3TYEA 3UPWA 2VDIA 1Q6QA 2IKGA 3C61A 2E1WA 3AWOA 1J12A 2OO6A 4XO6A 4LAMA 3UXDA 2XH4A 4AX7A 3V1PA 1JRCA 5LGXA 4W85A 3VDGA 2XIBA 2PB1A 3WN6A 1MW0A 4QBXA 3UY8A 2EHHA 4QRNA 3TOYA 1FH7A 4ML9A 1XIMA 4UR7A 1I75A 4I9TA 5KTLA 3LQLA 3M47A 3A9IA 4KCWA 3P67A 4BQ3A 4RZ6A 1XYAA 1H5YA 2ZWZA 4WGXA 3TH6A 4UTWC 1DTUA 2PDGA 1RVGA 2C18A 5M17A 2VC6A 2J78A 3LCHA 1CECA 1Q6GA 1TWIA 4Q4SA 3KUMA 4IJBA 4HTBA 2E9LA 3GC5A 4NJIA 1MNSA 4UOJA 4H6RA 1BVWA 3BLKA 3THAA 5J04A 3H7UA 2MNRA 1LP6A 4IMEA 4H7VA 1YKWA 4B5NA 3E6EA 4HGXA 1PZ1A 3M0YA 3POCA 2XN1A 1F6YA 1XJBA 2DH3A 3DBPA 3NPXA 4GACA 3E2VA 3KRSA 3O3RA 4NZFA 3NCOA 4D8LA 3APGA 3ZR5A 1PKLA 2BHUA 4AIOA 3L4TA 5E5CA 2EPNA 5LNSA 1K6AA 1W0MA 4H7CA 1T7LA 1OK4A 5CEWA 3BSGA 1NVMA 2A3HA 4F0SA 1V6VA 1KRBC 5F2GA 2BVTA 1JUEA 4PUJA 3H21A 4HA0A 2CIPA 1UD5A 3B8SA 3BAJA 4O19A 3LPGA 3M7WA 1J01A 3SCOA 2W61A 4U28A 3VCCA 3C52A 3AC0A 3EOUA 2YOCA 1N8IA 1GYNA 3AYSA 3ZT5A 3MO4A 1RPKA 2Z1VA 4N02A 4J35A 4RNJA 5IRPA 4HPNA 2Z26A 2TRSA 2EPKX 4PCSA 5CC3A 2PLMA 1XHGA 1XLHA 3G2GA 5G1YA 3R0UA 2AQVA 1XLMA 3LXAA 4IX2A 5AYBA 1O7AA 1E5NA 3VD7A 1A5MC 4C65A 4GNKB 4R7OA 1ODZA 1S3TC 2PP1A 4JQAA 3GX9A 3UGVA 3WQDA 4GG9A 4XSLA 3RYSA 3R8HA 1PL9A 4GI8A 3STPA 4IJRA 3W85A 2GQ8A 2XFWA 1J11A 4KRTA 3WF3A 5HA7A 4L4LA 3MI6A 3L5AA 4Q8UA 1PBGA 2PBGA 2OGJA 5GJPA 3PR2A 2GK1A 1RSCA 3RCNA 2E3ZA 4IPNB 3UZWA 3E2QA 5FEZA 1Q85A 4AD1A 2YL8A 4KPLA 2QNEA 3KBNA 4WEVX 4M3PA 2NW0A 4DAFA 4GVFA 4XB3A 2CESA 3RUBL 4BA0A 2YA0A 4IPLA 3W7JA 3WH5A 4BI7A 2DJXA 2Y8UA 3CUJA 3W1PA 5LIWX 5JUVA 2ZZ2A 1X8FA 5ENLA 1W17A 5LYRA 3TTQA 4XAGA 1JYNA 3Q65A 4M8UA 4NJHA 2W92A 2WKJA 3JUGA 3U2ZA 2V5CA 2NT1A 4MPKA 5EGRA 4NRRA 4UQ9A 4UTJA 2FTWA 3DFYA 2GQAA 4IQJA 3F7JA 4O14A 5AY7A 3JU2A 5IM51 1XIIA 1WKFA 3EDDA 1CEOA 1HFBA 1Z7AA 1HKMA 4LCRA 1A3WA 1HKWA 3POHA 1DE6A 4NG3A 1B3ZA 3O15A 3TUUA 1J0ZA 2C0HA 3TSDA 3RLUA 4Q7IA 2H9AB 4HYWA 3WLRA 4CLMA 1RA5A 1QCWA 3PNZA 4X0NA 2IKIA 2XUCA 3ITYA 2I17A 4UZUA 1A3HA 3AI0A 4YNGA 1KM0A 4KIEA 2WSKA 1CXIA 3W87A 5BW6A 3PZUA 4PTMA 4WIWA 5FI8A 3AHTA 2NZLA 2VDGA 4B3KA 3KTCA 5A6JA 3R94A 1EL3A 3BW4A 1V02E 2RGLA 1TG7A 2RUSA 3IJLA 4WRHA 1X98A 4AD5A 1UYQA 3W6LA 1VFOA 1UJQA 1ZBCA 2DZBA 2PE4A 5D4YA 3MBDA 5HMFA 2WHJA 3P84A 4AXKA 4PMXA 1WOAA 1O5XA 2XM1A 4AZHA 4HP5A 5FOOA 4YPJA 4U10A 3UXIA 2X1TA 1OF8A 3K4WA 5EMYA 2OKTA 1HW6A 4FXFA 4KEMA 4FNPA 2BVWA 3W1QA 3GDLA 1AH0A 2X09A 3EB3A 2X1IA 4FLQA 1CXHA 3RPMA 3AUOA 2GSJA 1WPCA 1AVAA 1MZHA 3QF0A 1UW9A 2ZUSA 2E40A 2L5HA 4M56A 1HKJA 3PUDA 4YHEA 1UD4A 2CCRA 2VL4A 1ELSA 1ISVA 1BSIA 1DOSA 5J8LA 4RDYA 3DG7A 4L1XA 3K4AA 1O60A 4JQ2A 1LTDA 2PUZA 1PWLA 1EA9C 1FWWA 5DANA 3BG3A 2D69A 3M0KA 1XGEA 5D9OA 2PBOA 5CPLA 1XIFA 2J7FA 3VGDA 1AJ0A 1GQKA 1JPMA 2E28A 1CI1A 3ZOAA 5XINA 3W38A 1XLLA 4F0MA 3LM7A 3QR3A 4ZZ9A 5C9XA 3AFBA 2A1YA 1VKFA 3R1ZA 1F3WA 3IJQA 3OYXA 3U9IA 3IPWA 4PCTA 1S2VA 3TYBA 4X3ZA 3MA8A 1LT7A 2ZUUA 1J18A 4NHVA 4A3YA 4G1KA 4HNUA 5AHLA 1PCWA 3P93A 4ACZA 5CXPA 3M07A 4A21A 3CQKA 3P2VA 4XBSA 4WF7A 3TCSA 4XD6A 4L61A 3AROA 3U3HA 4H9YA 3VYLA 4HK5A 1EIBA 4JL2A 3W7PA 4U31A 3D0CA 4D6DA 4YCOA 3MSDA 4JGDA 3W2LA 1TVPA 4TOQA 2QDHA 1GQLA 1HP4A 2ZRVA 3MYOA 3VOJA 4QG8A 2ZUVA 2BGSA 2ZX5A 1I9CB 3GU1A 3W83A 3UXKA 4CUCA 1F3EA 2DSKA 3S42A 2VRQA 3VE9A 2WMIA 3I6TA 1UOZA 3AU6A 4AUBA 5LHEA 2OX4A 4M81A 4KWWA 5F4SA 3CMJA 3UVAA 2WNNA 4B3LA 4B4HA 1EPXA 2FFIA 4MKNA 3TTEA 4CCDA 1XRVA 1P0DA 5GNXA 1W9UA 3EA1A 2Q3OA 3NDOA 1V3LA 3R89A 1ITCA 3L7RA 4WSKA 4HB7A 2HBXA 1GOQA 3DECA 3PAJA 5GQBA 3H55A 5J5DA 3MWCA 4LWWA 3MDWA 3UCDA 2Z28A 4GI4A 5HMEA 3OZYA 3UJRA 3W7IA 1L6FA 4NP7A 1UR2A 4ZXOA 1SZFA 1D8CA 4PBGA 4YWIA 2W3ZA 3RLGA 3VIMA 2HE8A 1PHQA 1V3HA 3IIXA 3QJAA 1WUFA 4QFUA 3MHGA 3OVGA 2PD5A 4AYSA 3C3NA 3CC1A 1EF3A 3TU9A 1HO1A 4QDPA 1QNSA 4GCXA 5D30A 1N55A 4EVZA 1GKPA 1REQB 3SCVA 1ZCCA 3S47A 3CQJA 5FAJA 1JDCA 4TX8A 4YIWA 5K3VA 3K1DA 4TIMA 1TR9A 1V3MA 3VNZA 4IF2A 4D6CA 3DIPA 4RX0A 1NDZA 4AVNA 1MQQA 1XX1A 1XV8A 1J4EA 2WO5A 3FKKA 2O9OA 4B9YA 2P0IA 5DEZA 3L66A 1JCLA 1BGGA 2OSXA 2JK2A 1ONEA 3I10A 3BLIA 1OFQA 5ABHA 3OG2A 4GO8A 4Q7NA 1M9HA 4QCEA 2J66A 4IPJA 4ROQA 3S5ZA 3TFCA 1W5OA 4FNQA 2NV2A 4K39A 3UZZA 1NIUA 3NO3A 3SZ8A 4C60A 4QJ3B 2WZMA 6ENLA 1P0EA 1W9DM 2OMAA 1EO5A 1R3SA 2AL2A 5G5IA 3DKJA 4MUZA 1BKHA 2GVEA 2I14A 5B80A 4MNKA 4L65A 4KERA 4N9BA 4UMAA 1WCGA 1C7SA 2WVUA 2OYMA 1UR1A 1MDLA 5D2YA 1V6UA 4MY1A 3V1HA 4W4QA 3EB4A 1K7EA 1R47A 4UWMA 5A8NA 4MADA 5A8OA 3NGFA 3S9ZA 1X1ZA 2IKJA 3EX1A 4ES4A 2Y5SA 5AZ1A 2C19A 1QNPA 1CGVA 3HN3A 3QMTA 1XM3A 2BXZA 4AC1X 1WNOA 2ZUNA 3SRDA 1A5OC 1XP3A 3WQFA 1CNVA 2R91A 4Y8FA 3SFKA 4HMCA 5T26A 3K13A 4UTHA 1FWJC 4MWAD 1P1XA 3OVQA 1R7AA 2ZXBA 4KBXA 1FXPA 1YRRA 2BOFX 2HMCA 1H4PA 3EWBX 3V18A 4JHOA 1JZ4A 3B40A 4ZOAA 4QDMA 4UQDA 5FACA 1UROA 3GH5A 2O7SA 2H8XA 3RX2A 4NAFA 4RDWA 1HG3A 3FXYA 3DXIA 2C0AA 1QK2A 2QQ6A 1B9ZA 3VX0A 1UC4A 1KTCA 5HJYA 3Q67A 3SUUA 3GLCA 3M0ZA 1EA0A 8CGTA 3I3DA 3EWDA 3BAXA 4S3KA 3CLMA 5CZKA 4Z42C 4OJYA 2D73A 1XYZA 5G4HC 1CBGA 4K37A 4O1EA 3KL0A 2MANA 4OHQA 3VDCA 1EOKA 2A85A 2VD8A 2X8RA 2Y89A 1Y65A 2OG9A 4LSBA 1UWIA 3ABSA 3KVJA 1PS9A 2BXYA 1C29A 3RHGA 1UD3A 1WKYA 3O9NA 1YXCA 2NVAA 1W5PA 4HYRA 2IQTA 4NT0A 1V0LA 4NAEA 1SW0A 4R3UA 3MV11 2XM2A 3QY8A 3OA5A 4FI4A 2X7WA 2V3DA 3SM0A 2VWSA 3OYZA 3R6IA 4X60A 5D8WA 2DZWA 3N4FA 2EAWA 4H6KA 4X22A 1HJUA 3LRMA 4M1RA 3LEPA 4OBSA 3SSZA 1MRAA 3EXSA 4JNZA 3OQ8A 5A6KA 1TCDA 2PWFA 4US6A 2BB0A 4DAIA 3T7VA 5IBXA 1JGIA 3HO8A 2WBGA 3S4TA 4PMQA 3PTQA 2OTDA 1A5NC 2XZ7A 3G1YA 2R1KA 3TZNA 3U48A 3OOQA 1T40A 3GIQA 4H9UA 4UTFA 3LPPA 1EJUC 4KFNA 3TTSA 3CO4A 4GQRA 2NV1A 1GEQA 1JCTA 3QLDA 2FVMA 4JTLA 1XLFA 3KOYA 2B7NA 4GISA 1WQ5A 4QTGA 3VXGA 3D5HA 3N9KA 2WJEA 3O8AA 5JBEA 1EC7A 2Y61A 3TAKA 1AD1A 3CMFA 9XIAA 2J62A 1KCXA 3I3EA 4GWEA 5EY5A 1VR6A 3VMNA 4DYJA 2E67A 1JEZA 3S2LA 1XLAA 5JIWA 1CCWB 2DQWA 1A5BA 2RGMA 4W8LA 5FF3A 2IPWA 1ICSA 3GNNA 3T6CA 3USZA 3QHOA 3L23A 4GNVA 3FKRA 3RITA 3UFYA 1VAHA 3ZQ9A 4V27A 1KM1A 4H7ZA 5I03A 4CN6A 1AFSA 3NDYA 3CU2A 1DQUA 1VFUA 4BF5A 3UT0A 3LCXA 4LUTB 3V35A 3CZEA 2XGZA 1A0EA 4ML4A 3BQ6A 2QCEA 4MIMA 2W27A 3C2EA 5E93A 1OX4B 1RD5A 1H51A 4DO6A 4W8BA 4H4IA 1TR1A 1A5UA 1ZCOA 1PV8A 3WEMA 4CD7A 1SR0A 2PZNA 4WHBA 1JZ6A 2WWDA 2VVSA 2DVUA 5LA2A 4UTKA 1IHIA 2P76A 4BJHA 1A5SA 3O6CA 1E43A 3W75A 1TIWA 3T0CA 3KM8A 3ITTA 2ACQA 4UOZA 4B16A 5JH1A 4R9OA 5EFFA 5LXXA 4JEQA 1Z69A 3W88A 2NX1A 2BSLA 1L9WA 4P8VA 2EG6A 4GVIA 3GVQA 1ZNNA 3BCJA 2Z1KA 3COTA 3I4KA 1DXIA 2DUZA 3DI1A 2I56A 4XAZA 3HPAA 4Q3MA 2IXUA 2GQ3A 2FHFA 1ISWA 5DX7A 3C0QA 3B06A 3WLLA 4DYKA 1W5MA 4WCJA 3T78A 1FHDA 1EQPA 2V5DA 1M7OA 4EXBA 2JKAA 4Y6GA 4IMDA 2X0YA 4JTFA 2PP3A 4BF9A 4C90A 3LU2A 1EWEA 4W8AA 2GYIA 1EO7A 4WOZA 1GK8A 2WC3A 4Y9MA 1LCOA 4QM1A 2VXNA 1QBAA 3TMQA 2A79A 1OK6A 3IWPA 5T91A 2GVLA 1GVIA 2C71A 4AHQA 1WAUA 1L6GA 2FPTA 2O92A 1C92A 2R1NA 2Y1HA 4J3ZA 4H8NA 3WJXA 3M5XA 4ZGYA 4S3CA 5HOSA 3LHZA 3IVSA 1GKQA 4H9TA 3CH0A 1QWGA 1W6TA 1NFGA 2X41A 1VIWA 2Z25A 1IT8A 5FEXA 3A12A 2VFFA 1W37A 1CXKA 4LYPA 1QOQA 2FGLA 2G41A 2PWDA 2TSYA 3QGVA 4G8TA 4Z1YA 4IPPA 5D38A 3WLTA 2PDUA 3FLUA 3AXIA 3PWGA 2BMBA 3DFOA 4A4AA 2GL5A 2ZOXA 3KAOA 4H8HA 1G4TA 4CNTA 3BV4A 3KS6A 2C14A 4C6JA 1IT7A 4AMCA 1LG1A 2OSWA 4UFHA 4ALDA 1XDLA 1XG4A 4BWLC 5BXRA 4AIEA 3FW6A 5REQB 2XIQA 1RXOB 4CEUC 2VGIA 3BDKA 2BY1A 2R94A 2VELA 3GDRA 4RCXA 1R3VA 3TJIA 3C86A 3EMQA 5D2XA 2C1GA 1ZP3A 2X7VA 1TRDA 1GVRA 5D03A 3SIMA 4OIFA 2YXOA 4L6DA 5FJJA 4J3XA 3DC0A 1X7FA 4DEFA 5HWJA 1LLWA 4I90A 3F4VA 3ABQA 4DPQA 4RE4A 4BK9A 2Q02A 4PC8A 3ARZA 4AEOA 1SJDA 4M1BA 3BQ5A 3RK8A 4P8XA 1OC6A 2PZ0A 5ABTA 1PKMA 1MSSA 1EC8A 3PJUA 2CLFA 1RQBA 2GDQA 3WELA 3UCCA 3M6YA 3H8AA 4X9YA 3AJ7A 3BOFA 3H24A 4IGMA 4L4MA 1WDSA 2D2OA 3P6LA 2PD9A 2F84A 3GIPA 4WJXA 3QHMA 1H7NA 3M43A 4NRSA 3WFZA 3AMDA 4ERAA 2GZXA 1T6MA 4AWEA 1JULA 4KFOA 3VMPA 4WY0B 1N8WA 2ZRUA 2YLAA 1OX6A 2IPFA 2BXVA 5A2CA 4J3UA 4ZOCA 3E0FA 3ZT6A 4BEQA 2XDFA 4DBUA 2DT1A 2NQJA 2JGYA 3MJYA 1XFBA 4CN1A 1LF1A 1SR9A 1NY1A 1F73A 5K9DA 3M44A 4C1LA 1Z6KA 4XX6A 1T5AA 2DUXA 4L6HA 3E74A 2FZBA 3ANVA 4O8RA 4PEEA 4ORMA 1VPYA 2DP3A 3UA3A 4F40A 2OEKA 4HMNA 4WY0F 3WD1A 3K2GA 1XR2A 3SR7A 3L4XA 3IGSA 1FWEC 3MWAA 4OTKA 5HAOA 4DM1A 2WK2A 2J6XA 3O05A 5FJUA 5D33A 1H0GA 4Q6JA 3SUSA 2VCAA 5A8GA 4H9VA 3MHUA 1KGWA 1S46A 2VR5A 4HNTA 3WDJA 3H2FA 3EMCA 2YJQA 1QNQA 3FJ4A 1GVEA 2WPBA 3TNBA 5XIAA 2QUVA 3C2RA 1V93A 4PEKA 4LEQA 4C6NA 4QHRA 1VPXA 5H91A 2X40A 2E7FA 3M0VA 2JKPA 6TIMA 5D2WA 1BG9A 1KCLA 4P7NA 2G97A 4GIYA 4K36A 1WKEA 1PB0A 4MB5A 4HNNA 3W71A 3KDOA 5F1UA 3C2OA 1SUXA 3HJEA 2GGGA 4XD3A 5BXTA 3F4WA 4PH6A 4CNSA 2YDAA 1ME9A 3N3TA 1UKOA 1VHCA 3W07A 1VFHA 3EPNA 3ZLFA 4XZBA 2V5KA 2ALDA 4Z2JA 3QMSA 1DPMA 2CLHA 2ZX7A 3GTIA 1HGWA 4LBSA 1U33A 2P1FA 5CCZA 4LAZA 2VEGA 5AHFA 1UCWA 3NFUA 4JNYA 5AYXA 5I3JA 9RUBA 4MJZA 3LHVA 3QLLA 3IK4A 1QI3A 3VGGA 3W1AA 3E49A 1UKQA 4HU4A 1HTIA 4NNAA 1DJNA 3HPZA 3NL6A 1JCYA 2Z29A 3O0KA 2J79A 3N19B 2G4JA 3NSXA 3T8LA 1PIFA 2GOKA 3LPOA 3VZZA 3TC7A 3KDNA 1BYDA 1C8XA 1HXJA 2V2CA 1E1FA 1BG4A 4I9AA 5AC4A 1UH4A 3H2CA 1MW1A 3R5EA 4HOXA 3W3OA 4TV6A 1HT6A 3QXBA 2QCNA 4KMQA 3TQVA 1E6PA 4E5TA 3VDBA 3LV5A 1BXNA 1V6XA 1M6JA 1EC9A 5C6MA 2ZZ4A 2H9AA 2G0WA 3VOFA 1XQKA 2NX3A 1M53A 5AYIA 3GNPA 3P8IA 4XTDA 1JAEA 3AYVA 4GPNA 2VO5A 4DZHA 2OWXA 1UP0A 1E3XA 1CGXA 2X1UA 1E6ZA 1TA3B 4S3JA 2G37A 3SUTA 4D6JA 3G1DA 8A3HA 5L6UA 1L8NA 2XFRA 4WJ8A 1FCBA 5HR6A 4AZ7A 1BF2A 4S3AA 1OFOA 3ZJ8A 2G5WA 4YTUA 4QS5A 2ZXQA 2NQ9A 4O18A 5AHEA 3OLDA 1NOFA 3REQA 3O7UA 4DHGA 1Z44A 1E0XA 2ABBA 1KRAC 2VI0A 2QAPA 4TV5A 3FK4A 3JS3A 5CC5A 1KWKA 3W81A 4G5DA 3FN9A 3ARTA 2FKPA 2GWGA 2HQAA 3VK5A 1SFLA 3L4YA 1GOXA 1LL6A 3QSRA 2PTZA 3GKAA 1EPVA 1UASA 4P61A 2DV0A 3CZLA 3TQKA 2P3ZA 5LIKX 1FHUA 3WMBA 4ORIA 4JEJA 2QVHA 1KLYA 5IOBA 4FP1A 1Q7MA 3VD9A 2CBVA 1VJZA 2YL5A 5AKQA 1ZPTA 3FJNA 3OVRA 4H19A 1PTDA 3MVTA 4XUYA 4HPXA 2YX0A 3R8GA 4ZQPA 3WK0A 4B5VA 1E71M 4REQB 3BC9A 3WF0A 2QCCA 3E5BA 1I1WA 3BO9A 4C6QA 4GUHA 2QW5A 1WXZA 3PSVA 2IKHA 3GYEA 4IG2A 1IXNA 3RG6A 4UQAA 4S3BA 3UPBA 4K8HA 3PK7A 2PCEA 2QF8A 3RM4A 1SFSA 3EKGA 3VNYA 1LUCB 5GJNA 2XIJA 5HANA 4Q8OA 2FVLA 2BBFA 1RH9A 1ZJAA 1E1EA 4CD6A 1L6WA 1GZ1A 3VUSA 3ARQA 3UZ5A 1JUBA 4M7TA 2ZDRA 4LYQA 1EJSC 4JFTA 3CHEA 3V5FA 4XZIA 3T0DA 3CIWA 4IZGA 1NP2A 2WZEA 1MFVA 2E25A 3TYCA 1KXHA 1KBBA 3QTPA 2XIIA 3LHUA 4XZWA 1CXEA 1EJXC 4P7LA 1THFD 1J79A 4MAVA 4M19A 4GJ1A 5I2UA 3RNDA 1DEDA 4DJFC 4MGGA 3ARSA 3ARVA 1VYPX 5DO8A 1D7KA 3UGRA 1Y7VA 4US5A 1XC4A 4O0KA 3CO8A 4KKXA 4FR6A 4PMUA 5HNUA 1W3NA 3AXMA 4GYPA 5AVHA 3WQWA 3G1XA 1W3HA 3PZTA 3NSMA 1I2NA 1NP0A 3RR4A 5C8BB 1J96A 2YSWA 3HV8A 3WLIA 5H8PA 5FAGA 5IBXC 1SVDA 3BSMA 1DIDA 4UXDA 4Q4OA 1FWBC 3GG7A 1EKOA 1JNEA 1FWSA 1MFUA 4ZENA 5DLCA 3CUZA 1VJSA 2P10A 4AZIA 4PE8A 3BAWA 5CZ0A 5I3KA 4DIAA 2E4TA 1JPIA 2C79A 1JZ8A 3BLFA 4EXAA 3M1ZA 4K6AA 4CU8A 4QXIA 5FIPA 4PRTA 2PSNA 3RN6A 1ADOA 4BQ2A 4FIQA 2HS6A 2O4QA 3XISA 3U6WA 3TA9A 5G4EA 3UW6A 3ZJ6A 3N2MA 1CGWA 4QAIA 3HQNA 5DBTA 3TYZA 3B0UX 2JE8A 4NILA 2FPVA 4V1XA 1JL8A 3RILA 4G6CA 5G2HA 4FLSA 1M7PA 2WSPA 4S1FA 3W01A 4ECLA 2Y4SA 3AZSA 2JIWA 7REQB 1CT5A 1G94A 1LDCA 3NQGA 3DG6A 2HK1A 1BQGA 1KFLA 2D22A 3FYOA 2CZVA 3LCWA 5D9NA 1A5KC 3BV7A 1AK5A 4H2CA 1X96A 4LCSA 4GVHA 3F2DA 4D8ZA 3UWYA 4CKQA 1G7UA 1LJYA 4NASA 1XINA 1S2TA 2A3LA 4HK7A 4UCFA 4JXCA 1SO6A 4TX9A 4O1AA 4UCGA 2MUCA 1DJWA 4FXRA 5FJPA 3S3GA 1BVZA 3T08A 2VRKA 3A24A 4C6FA 2GJNA 4J4KA 4FX8A 3B9EA 1C8YA 5XIMA 2E5BA 1Q6EA 2GGIA 2Z1BA 2QIWA 4MKVA 1XD1A 1DWAM 4F9JA 1E6SM 5E0CA 2VR2A 4KGLA 4N6FA 2QJMA 1RA0A 3H23A 1IZJA 4U2ZA 3PPCA 2VWTA 3LNMA 3GQYA 3N9RA 4RK8A 5BOFA 3NEVA 2J88A 4ZB2A 5ECVA 1DVJA 1I6NA 4MNMA 5CPQA 1QUMA 3S8HA 4O4WA 4GUGA 5AZ0A 2PDWA 2QPSA 3TN5A 1RP9A 3DHUA 2VRJA 1I0DA 4YLWA 2QPUA 4HCHA 3UD6A 4XTIA 4XISA 3PUOA 5EBAA 3WH7A 2PC4A 4AH7A 2TMDA 1KXQA 3QV6A 4Z0SA 1PX4A 1OG0A 1V6WA 2HRWA 4IIDA 1VENA 2PGEA 2PP0A 3C0LA 1AQ0A 4IMFA 4E0CA 3DEQA 1SSGA 2PDKA 2DZSA 1EUNA 4GNJA 3ENLA 3WLQA 4S3EA 2XVPA 3CTTA 3KOXA 3CQIA 3N9SA 2CZEA 4NXKA 4A8RA 3AZTA 4N2YA 1CPUA 1PHWA 4HA4A 2I5QA 3SQLA 3IUHA 5LNVA 1W1VA 2YDRA 5CJMA 3C5QA 2HVMA 4PTNA 2NV9A 5DBUA 3A21A 5FSDC 1DJQA 1K8CA 1WKDA 1GQNA 3ZYZA 2WNQA 2JKEA 1ONWA 4FLOA 5GNZA 4JIHA 1TKKA 2WVVA 1QI5A 4QQUA 3QPYA 3BPWA 1S2WA 3FA3A 5A6BD 3PG9A 3SRHA 3HU7A 4QAWA 3OZMA 1MUWA 2IUZA 1M65A 3RU6A 3L5LA 1W8SA 3ZIZA 3OP2A 1C91A 1FWIC 3JZEA 4MB1A 3MZNA 3K4DA 4HSHA 3V16A 3UERA 3VUPA 3FHQA 3BJTA 2RH9A 4RKAA 1NSJA 2FPYA 1TFVA 2BVYA 1X38A 3ZJ7A 4E8CA 1R86A 3GAKA 2REQA 1K3UA 1XYCA 4LYRA 2Y7GA 1B3VA 1UIPA 2D3LA 3VGFA 1AZ1A 4JR5A 3A4XA 3N18A 3STCA 3SDOA 1JPKA 1UKTA 1J5SA 3M0XA 4HQVA 4DXVA 2TODA 4XUGA 4E3TA 3HFTA 1IWBA 1DV7A 3NIYA 2PGRA 4AYGA 3KP0A 3URQA 1MXDA 3TYUA 3F5KA 2AGKA 5EKYA 2VGBA 2VM8A 1UUOA 4RJEA 1MXGA 3GKFA 3FGCA 3ARPA 5LXEA 3ARRA 5GNYA 4JN6A 1LWJA 1K9DA 4WQ6A 2OLSA 1SU5A 4GZEA 3WG6A 4CQDA 1C8VA 3DHPA 3DU0A 1ZU8A 3LMYA 3T0AA 3BMXA 3B8UA 3S2NA 1GYMA 3R7MA 3PUGA 3VOHA 1J5TA 2D2GA 4KW2A 4K7VA 2GSEA 3EWZA 4YJ5A 3OIXA 3OG3A 2Z2UA 1DJZA 1H61A 3GC2A 1V3KA 4GIEA 4CCEA 3LERA 4Q4PA 4AF0B 1M7XA 3RO6A 4H9MA 1QXLA 4UTWA 1VFFA 2UY4A 3OPSA 1UD8A 4X63A 2DIKA 4ZL1A 2YFNA 1I2OA 5KZDA 5A8QA 3M0HA 4FA3A 1QAPA 1W3JA 5JBFA 2ZKMX 4NI8A 3WLMA 1I60A 2OFJA 4D8AA 4WVXA 3DFTA 1GPWA 4CVWA 4QROA 5HJLA 3CBWA 3HG4A 2GVGA 4B91A 2B81A 3PBWA 1WAWA 1KGUA 2HXTA 3OQEA 1V79A 4PUNA 4NUWA 1B3WA 1YPIA 5AHNA 4MG4A 1NOUA 1US0A 2WKGA 4Q33A 3VNJA 1BTCA 3NG3A 3VNDA 2PC8A 5A94A 1TE6A 3KHDA 3LTYA 5JVLA 4ACZB 2EPMX 3S5OA 2CBIA 2WAGA 3WSUA 1ITUA 4V28A 1GOMA 3IJ7A 4XKMA 4Q4RA 3FEQA 2A4AA 1KQZA 3BLDA 1JYXA 2X2YA 1EHNA 3NPWA 4OECA 4P8WA 3SO7A 1I4NA 1QJWA 4Q8PA 1CLVA 1VGAA 4F48A 1IR2A 3JVAA 2V3GA 3DFHA 2UY2A 5A3HA 5GVJA 4LUTA 3IJDA 3AICA 5G1TA 1KM2A 1GVQA 3KRBA 1PTGA 3GBEA 3UWVA 3P8JA 1FWAC 4H1ZA 2OB3A 2DH2A 5A8MA 1UUQA 3S2MA 3VMOA 3GNDA 4MDOA 3WD4A 1KLZA 4ZO8A 4QITA 5CZSA 3ALGA 4O15A 4KWVA 1IE7C 4L4PA 5I3DA 4DELA 3LZ5A 1E40A 1OCNA 1RY0A 3OBEA 4Q4KA 2CZDA 4GY0A 3BZJA 1QHOA 4B15A 2VOMA 1F74A 2O9TA 1W1YA 1U5VA 3QW4B 4CQ8A 1R3YA 2PAJA 4GGBA 2A0NA 3EDKA 1VFLA 3PC0A 1W32A 1PIIA 1MEWA 3ZLHA 3GH7A 1IR1A 4MF4A 4O1FA 4HZ7A 1HJWA 5A2BA 4RZ4A 2ZTKA 1VBGA 4IGSA 2UWFA 2ZIDA 4D6EA 2NUXA 4ROPA 2DZPA 2GDVA 1O66A 3CT2A 4C6BA 3SECA 2OEMA 2CBJA 3HM7A 3T05A 3FAXA 1K02A 5C2XA 2CLKA 1Q2SA 1ML1A 3BGGA 3H2NA 4R53A 1DXFA 7ODCA 3CIVA 3IIPA 1OINA 4V15A 1J8VA 3SCUA 4MY8A 3DZ1A 1QTWA 2AMXA 4E4PA 1QO2A 3L2IA 3GC4A 2Y2WA 5BXSA 1E0WA 4AWUA 1EGMA 4RXFA 1TVLA 4P2VA 2E8ZA 4JTSA 5KINA 1AJZA 4EKJA 4HA1A 1FRBA 2PWEA 4XWUA 4BR1A 2E1DA 4Z0JA 4Y7EA 2PDYA 1B9BA 1EQCA 1BWVA 3B8IA 3HG3A 4HJFA 5A5WA 2TPSA 4B90A 1P5BA 3WDIA 3N14A 1CW2A 5BXPA 4IIFA 3B97A 4LVDA 3NOEA 2Y7DA 1RK6A 4KGJA 3W1LA 1MVYA 4TTUA 4D6GA 3KVMA 1XCXA 1F3XA 4AC7C 3RO8A 1UPPA 4RR4A 2EXOA 4XD5A 4IXXA 3LYEA 3F4NA 1SMAA 3VILA 4IT1A 4O1CA 1VF8A 1QFEA 2X30A 3E2RA 3W86A 4MHBA 1EGVA 3ITXA 1EZ2A 4MOZA 2ZRWA 3EWXA 2ABAA 2AOSA 1JQXA 3VGHA 1LWHA 1E6XM 3SQMA 2OYKA 3W76A 1OVDA 3EOLA 3AIQA 3HA1A 4EANA 1CLKA 3CS2A 4FMVA 3UNDA 4ADUA 2Y5JA 3EWUA 2POTA 1HJXA 1ECQA 2V3EA 2R82A 1EH9A 3A3HA 2ZZ3A 2BOEX 3VKJA 2NWSA 3CUXA 2INZA 2QIIA 3AIRA 2QT3A 1YTEA 1UZDA 3P0WA 2PDMA 5FL1A 5A2AA 4OBRA 1QW8A 4GE8A 4AZCB 2ASHA 3VE7A 4B5SA 1SZEA 4J5NA 3VO0A 4H00A 4WY0A 4Q8MA 4N9EA 1PDYA 3H7RA 4JFWA 1KKRA 1S5MA 4GMEA 2VUYA 1JZ5A 3FJLA 4JPGA 3TAOA 3LTPA 3MMUA 3LXBA 4MB3A 2X2GA 1X1OA 1DWIM 2ADAA 4JIQA 3R2GA 4KETA 1S5NA 1FHLA 3RPDA 4MFEA 1VCGA 4WJEA 4GVGA 3BK0A 3W70A 4PUWA 2O4MA 3MANA 1M41A 3NL2A 3EWWA 5FF4A 5LNWA 2GJPA 2ZUMA 3KLKA 4PODA 4WDXA 1Y5WA 1EWDA 4C7FA 2WYSA 3HGRA 2O7QA 2UY3A 1ZTVA 4AEFA 2XYLA 4J40A 1UH3A 1F4AA 2W9MA 3GXDA 4GO9A 4G7EB 4O50A 3G3MA 3AS0A 1ZQ5A 4MLRA 3BLOA 2NXGA 3T4CA 4CD4A 1HL9A 3NWRA 1A0DA 3WUBA 3W1TA 3A64A 4JY8A 2GLKA 5HQLA 4GYPC 4NAEB 3RU8X 4CQBA 4ASTA 3EPMA 4JTRA 5M3WA 5FKYA 1Z32X 4ZQNA 3PBGA 4GRSA 3CZJA 5FCZA 2ZE3A 3NOYA 3M46A 4HA3A 4EIVA 3MUZ1 5LIXX 3SCPA 3GHRA 1H7XA 3T55A 2E6DA 1XIBA 3PJTA 2D0GA 1J9YA 3CAVA 1NWRA 1FCVA 1PZ3A 2ZA1A 5EL1A 3W4RA 2G3JA 5FL0A 4A22A 4DBDA 1H1NA 3LZ3A 3F2BA 4NVTA 2Q71A 1ISXA 1XYBA 2J27A 4YVPA 2YCIX 5FJIA 4DJFD 1R2RA 1C9WA 3ES8A 4L7ZA 4JYEA 3BL3A 3QPEA 5CC7A 3MUXA 4RL3A 1ENUA 3NVDA 4GXWA 2CKRA 4GX8A 3UR7A 3WIJA 4DY1A 3B9DA