1KM1A

Orotidine monophosphate decarboxylase mutant s127a crystal structure
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
212
structure length
212
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMAHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
publication title Mapping the active site-ligand interactions of orotidine 5'-monophosphate decarboxylase by crystallography.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 80
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2001-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1km1A00
3PM6A 4OBTA 1DV7A 3W7DA 4FNQA 3W2MA 1OF8A 3GNNA 5HUOA 3NM1A 4WXZA 1OFDA 3W7PA 1D3HA 3DU0A 1W1ZA 1HG3A 4UFIA 3KFTA 4Q33A 4X2RA 5FEPA 2TRSA 4K36A 4DF2A 2B0MA 2I9EA 1XUUA 1XDLA 3HGRA 4UFKA 1SW3A 1OF6A 2Y88A 1ZALA 4N9EA 5ABTA 4YWIA 1EIXA 3A5FA 3TC6A 3D0CA 3TW7A 1TPVA 5CG7A 1PE1A 3LHVA 1J4EA 3TUUA 3TJXA 3K30A 4RR4A 4IXXA 4AB4A 1H7XA 4FIRA 3JRKA 5D2TA 3P82A 5SWUA 3W7EA 3A9IA 4LWWA 4Y90A 3PB0A 1G4PA 4P2VA 5A8GA 1XL9A 4MIMA 3W7QA 1EWDA 1ZAHA 4RCXA 1KM6A 4XZ9A 1K02A 3IIPA 3M5ZA 3W76A 1XBVA 2BLEA 5CPLA 1TPFA 2VKZG 3TSMA 1H62A 3EWXA 5AHMA 5CSSA 2ZRXA 4JX5A 1O95A 5I3FA 3MP5A 3FJ6A 3CWOX 2JKPA 1OFAA 5D04C 3NQMA 4JX6A 2G97A 2H90A 2A1YA 3NPUA 4J9JA 4AEOA 1C9DA 4RV8A 2ZRVA 3LXBA 3W7KA 3M43A 3GDMA 4JTKA 3UPWA 1Q6OA 4A2RA 1GG1A 3QW4B 2RDUA 3NNTA 1OK4A 3ABSA 4IMFA 3W7GA 3LXCA 2DJLA 4MPQA 5DLCA 5LGZA 1F76A 4O1BA 4OHQA 3NQVA 3VE7A 3PSVA 4DO5A 4JDBA 3N9SA 1FUYA 3EKLA 1AL7A 1SZFA 2JGQA 1JRCA 3NVTA 1VYRA 2CLOA 3Q2DA 5F4XA 2XN1A 3I7SA 1GG0A 2EHHA 4NX5A 3UY7A 1W5QA 3GK0A 1F5ZA 4NJGA 1Q3NA 4M19A 3FLUA 4Z0SA 4JTFA 1TJPA 4WD0A 1AMKA 2VEPA 3CQ0A 3FA5A 4ZQRA 5D02A 3INPA 1P0KA 1ZNNA 1W0MA 2VFHA 1FDZA 2R94A 1VYPX 4QSHA 2QCMA 1QR7A 2O7QA 1KFJA 4MKNA 4R7JA 1SW7A 4MVAA 4FNUA 3LI0A 5FEWA 3LTSA 3TR2A 3GLCA 3HO8A 3WJWA 5HJLA 2DZVA 3QQ0A 2G5WA 4PH6A 2E5CA 2ZFAA 3SW6A 3WK3A 1SZEA 3SSJA 1VS1A 3W71A 3WFAA 4UFJA 4AHPA 1ICPA 4DF1A 4Q4KA 1J5TA 1KFLA 1QOQA 1MEWA 3MI2A 4C1LA 1ME8A 1TPH1 4UTHA 2ZTJA 2EAWA 4P61A 2Q3OA 1LORA 1FCBA 5AHIA 3W86A 1KFEA 2J9XA 4ZQPA 5I3KA 3N19B 4JTTA 4K7YA 1KM1A 3TMLA 1FCVA 3M44A 5K3VA 4XTDA 3LTYA 2E77A 4BFAA 3S1VA 1SZNA 1NF0A 3DZ1A 3PBVA 3TH6A 3UWWA 1H7WA 1VZWA 2Y85A 1O5XA 3A24A 3NL3A 3H54A 3HG4A 4JYFA 4UFLA 1I2PA 4FX6M 1KTNA 1X1OA 3L65A 1VYSX 4IPIA 2TSYA 5FF2A 4ZVJA 1GT8A 1R46A 1RR2A 3UPBA 5CKSA 2WO5A 2WOQA 2R91A 2E6DA 3TKFA 1KA9F 1DL3A 4MLJA 5CZJA 4PCFA 1GVFA 4DQWA 4M6QA 4H3DA 1RQEA 3RFAA 1KFCA 1T99A 4Z1CA 3LTPA 4GFSA 4NX0A 3TXVA 3CM4A 5F4SA 1W5PA 5BRBA 2YDAA 1FWNA 1WOAA 3T55A 3MBDA 1PL9A 4ORIA 5FF7A 3HIJA 2QDGA 5J5RA 3MHGA 1RPXA 1XC4A 1H5YA 5G4EA 4M6VA 3Q94A 1SQ7A 2A7RA 5T26A 5CSRA 3HGSA 1O94A 4UXDA 4N9CA 3E0IA 5E93A 1YTKA 4WY0A 1RV8A 1T8XA 1TQJA 3OVPA 3DFQA 2V5LA 3E02A 3NG3A 1H1ZA 3HPSA 1KM4A 2NWSA 1DQXA 1KM0A 1W5NA 3KVMA 2B4GA 4Y9AA 5L9FA 3NQDA 4IX0A 3W2LA 1EP3A 5AHLA 3NDOA 3S5YA 1ALDA 3M16A 2A4AA 1JQXA 3DFTA 3HG3A 3MJYA 3ZWSA 4IMCA 4DPPA 3M47A 3TDFA 1TPB1 1WOBA 1LCOA 2PURA 2PE4A 4E38A 4O8RA 1YDNA 4AAJA 1V7YA 4HIBA 4UTWC 1S5TA 2Y63A 5HWNA 4FX7A 2E09A 1LM1A 5CPOA 4HN4A 3G3DA 5AHFA 1S3HA 4JTJA 3F4WA 3W83A 4A21A 3M5VA 4E2DA 3OBKA 5FF3A 1Z41A 1T96A 2Z1BA 4JTHA 4O12A 1QOPA 1M5WA 3HPXA 4JR5A 5AYZA 3ATZA 3HJZA 5BMWA 3SY5A 5DXYA 1XFBA 5G2HA 1TQXA 2DZTA 2YCEA 3SIZA 3AJXA 2E68A 1J2WA 2ZRZA 1LBFA 4X3ZA 3UWYA 3TK7A 4X22A 2VEKA 3NXFA 4U28A 4NNAA 1NSJA 2NLIA 4QIUA 1WAUA 4O57A 1DVJA 3G1YA 4UCGA 4N6EA 1MSSA 4GRSA 2YPIA 4LNYA 2QF7A 4EWND 1NF7A 2AQWA 4O14A 5G2WA 4M5PA 5KINA 5LZLA 4AWTA 4NJKA 3O06A 2V8ZA 1G67A 1E51A 1Z42A 3EWUA 5H2ZA 3W87A 4OWGA 5HULA 4K38A 4TMCA 1PS9A 5FEZA 5IBXC 4N2YA 3EWYA 5EA9A 1EUNA 4EOUA 1XCFA 3W2JA 2YX0A 3NYZA 2V2DA 1LLZA 3GXPA 1TTJA 4QNWA 4BF9A 4TX9A 3W1NA 1G7UA 2B7OA 4AWSA 4O1CA 1YLVA 2F84A 3IVTA 4HKPA 4N02A 3SECA 1XDMA 2CZDA 1R30A 3UY8A 1K7FA 4NNCA 5CPNA 4BI5A 1PIIA 2ABAA 5CPMA 1GZGA 1P1XA 1VRDA 1B4KA 3W9ZA 1G7VA 2ZZ4A 4H4IA 3B0VC 3SGUA 5MHBA 3STEA 2VXNA 1MEHA 3B03A 3O8AA 4GUJA 1ZJIA 4NQ1A 4S1FA 3O07A 1DKWA 3OHIA 4PODA 5BOOA 3GDLA 3BV4A 1H60A 1YDOA 4YXGA 4KWVA 2Z0IA 1H7NA 3H55A 4HSOA 2ISSA 1G4EA 4Z1DA 4GJ1A 3HPZA 1RVGA 2RH9A 1KW1A 1M7PA 2NUYA 4JTLA 4C1KA 4LV4A 2Q8ZA 2OCZA 4LS1A 4A22A 2ALDA 2QAFA 1GTHA 3AO0A 4UTWA 1GVRA 1JCMP 3L67A 3TXZA 3UWUA 1GPWA 1WBHA 2QCNA 3C2VA 2WKJA 1K8YA 3VCRA 3CHVA 2NWRA 1W3IA 3SGZA 3EX2A 4DF0A 5KZEA 2YFNA 4NJJA 5DBUA 2C15A 4JTUA 1PHWA 4JY9A 1G69A 3OA3A 4PTNA 4M7SA 1LOQA 1NAL1 1TYGA 5CGQA 3LCFA 1ZAJA 1FWTA 5KSWA 1ADOA 1THFD 1CX9A 6ALDA 2XN0A 1SU5A 2VFEA 2ZBTA 3IVUA 2ZZ1A 4U4MA 3N3MA 4DBDA 4NXSA 4QISA 3THQA 3S0CA 4N9BA 1ZHAA 2A5HA 4O0ZA 3DKJA 3TW6A 4OV4A 4JS3A 4DELA 2A85A 2Y61A 5LNRA 4AWUA 3H53A 4UTLA 1H7OA 1L6WA 4O19A 3G1XA 1TRIA 2H8XA 4S2BA 3WJYA 3G0SA 1X7FA 2R8WA 3QPZA 1Z48A 4LW7A 1T0OA 1R2TA 3ANYA 3W73A 5K4ZA 1LRQA 3M1ZA 3QSRA 4UTKA 1AW5A 5F4WA 1W37A 1JUEA 3DFOA 3G18A 4JEQA 3CU2A 5IBXA 3MW7A 4ICNA 2J88A 3W1UA 5D09A 1CW2A 3BG9A 1RD5A 5F2MA 3NAVA 3L2IA 6TIMA 1MO0A 3MHUA 1GQNA 2H6RA 5EBUA 3TCEA 2OMAA 2Y89A 4IX2A 2KZHA 4WOQA 1N55A 1FWRA 4UTMA 1TV5A 1AL8A 1VJIA 3GB6A 4E0CA 1Q45A 4NT0A 4LVDA 3VE9A 2E5BA 3GVGA 3HOJA 1W3TA 1TTIA 1H7RA 3JS3A 4OE7A 1YYAA 4TMBA 4UFHA 3TJLA 1FWSA 1UCWA 1QO5A 2A21A 3IVSA 4JDYA 1BKSA 4RZ5A 4FNRA 1UASA 2FPYA 1JCYA 4ADSA 4HT3A 3WJZA 3TC7A 2X1SA 3MI6A 2R14A 3EX1A 1SO6A 1XUZA 3SI9A 3W1RA 2GPTA 3B0UX 3P5YA 3TX9A 3I65A 2QCDB 1PV8A 1TV7A 3W7JA 4K7VA 3W2KA 3ZR4A 3EWWA 4H6KA 4DBEA 3CLMA 1QCWA 2G96A 4WXYA 5D30A 4MZ1A 1KBJA 4JIQA 3G24A 3HGJA 5EPDA 1PCKA 1Q6QA 4AVFA 4QAIA 2QCLA 5EMUA 1FCUA 3BPWA 2CLEA 4UTIA 1EEPA 3USBA 3W2NA 2UV8G 5TQLA 4CCEA 1EA0A 3KOFA 4O53A 1K03A 5G5IA 3SZ8A 3NQAA 3EXSA 3TQKA 2ZRWA 2WPBA 1YPFA 3M7WA 3L0NA 3LBMA 4I7WA 4LT9A 1AW2A 2WNZA 2OZ0A 3QMRA 4LOCA 4CLMA 1EP2A 1JR1A 4XBSA 4O28A 4LVAA 1OJXA 3ZWTA 2ZA3A 2CW6A 1X8FA 3UYCA 2I1OA 4QJ1A 1QFEA 3G1AA 3LCXA 5FF0A 1EX5A 2DJXA 3QMTA 4XQ6A 3GKFA 1XI3A 3DFNA 2P1FA 2J9ZA 3KRUA 1B57A 5DCBA 1YXDA 1Z44A 1HTIA 4FNPA 2V9DA 3KVJA 2BWGA 1M6JA 4N4QA 4KFPA 3W72A 3SFKA 5BNKA 1W8SA 3NOEA 2DZUA 3C8FA 3TV8A 3DHFA 1LROA 4QITA 4A3UA 1ICSA 5F2IA 1R2SA 1UJPA 2C19A 2GVGA 1OYCA 2HS8A 2X2GA 3BG3A 1MZHA 3HMJG 4TR9A 3GDKA 3S9YA 1LRNA 3TE9A 2A7PA 1FQ0A 4M6PA 3O63A 5D03A 4ML9A 4LUJA 5AYYA 1W5OA 5U7SA 2QCEA 1D9EA 1G6CA 3LLDA 1H63A 4GUGA 4JTIA 3W1TA 3LV5A 1B3OA 4WY0F 2QJIA 3W22A 3LCLA 2X30A 4LU0A 5H91A 5C5YA 5DXXA 3P8IA 3M41A 4JXCA 3WJXA 2Y7EA 1RQHA 1KM2A 2JBMA 2RKXA 3PG8A 3STFA 3KVLA 3FYOA 4MFEA 3TU9A 1PCWA 2QCCA 4JYEA 2AAMA 3NQ8A 2NUWA 4ZQOA 2VENA 3TAOA 3QEZA 4NNBA 3W75A 2CZ5A 1F6KA 4N6FA 1R47A 2VFFA 3PBWA 5F1UA 5D2WA 3RMJA 4YCPA 1W3NA 2I14A 2QCFA 2FJKA 3BARA 4KFOA 1DJQA 3DFPA 3U2OA 1OFEA 4MJZA 2RHGA 2VFGA 2ZZ7A 1FDYA 3O1NA 2ZRYA 1KTCA 4XBKA 3CB8A 3G0XA 2A7NA 3T40A 3A5VA 3MYOA 4PFMA 3L5AA 4O15A 2WNQA 2H3BA 1JCLA 2CLLA 4K6AA 4FO4A 3P74A 3QZEA 2W0UA 4MY1A 3EXTA 2CFFA 1QPRA 2PRLA 2Y6ZA 1ONRA 5D2XA 3G8RA 3NPVA 2OT1A 3PF3A 1KM3A 1X1ZA 1GOXA 1F6PA 3L5MA 3NQGA 5I3HA 3C2OA 1OVDA 3LHYA 3LCGA 2PRMA 5I3JA 2QCGA 3S8HA 4GXMA 2WQPA 3WK2A 1H7PA 3B05A 2J6XA 3E96A 4L4LA 3W7LA 2V2CA 5DELA 1KFKA 2E6AA 4ADTA 2NX9A 2GQ9A 1QWGA 3P80A 4BI7A 3O15A 3N9RA 2X1TA 3LERA 4DO4A 1NEYA 1O60A 1N7KA 3N34A 5GVJA 1DOSA 4KKXA 1TPEA 3MI3A 2QUVA 4IXHA 5CZ0A 3KX6A 3TSDA 4RXGA 4JNMA 4O11A 1N8FA 1QPQA 3W84A 3HG2A 1FCQA 2HMCA 2C14A 4LS0A 1NFBA 3N14A 4OT7A 5LNWA 3QYQA 3IEBA 3GDRA 3RK8A 4UFMA 2JKEA 4L4MA 4CCCA 3W70A 3W3OA 5K7JA 3BGJA 1SUXA 2IQTA 5L6UA 2NV1A 4TO8A 1FXQA 5HR6A 1GTEA 3L5LA 4BI6A 4ORMA 4O13A 1A5AA 3THAA 1VCVA 3NZ1A 3VNDA 3FEMA 2V5BA 8TIMA 3TFCA 4ZL1A 1OX5A 3IIVA 4K8HA 5E0KA 3PULA 4NUWA 4TU1A 4N9DA 3PVFA 2A2IA 2JGYA 2RDWA 4I7VA 3IIZA 2PCQA 1TB3A 4YMZA 3EXRA 4Y8FA 3GXNA 2P10A 2GVLA 4O17A 3GAYA 2DZPA 4RX0A 3G1DA 2NX1A 2H3DA 1TJRA 1VLWA 3KRSA 2GUUA 1VHNA 3KHJA 2DORA 5LNSA 4OV9A 3W7CA 5DN1A 4FB7A 3G8EA 1EPXA 3OEXA 1JULA 1B9BA 2QKFA 4AF0B 4R33A 3UZ5A 5TIMA 1I2RA 1DJNA 2HSAA 5HUPA 1YADA 3B04A 3FYPA 3O6CA 3W1AA 3C56A 4MFDA 2ZZ5A 2NX3A 1Q6RA 5G2IA 3OVQA 5A5WA 1F7BA 5G1TA 4NVTA 2NV2A 1B4EA 3MP3A 3RLUA 3ELFA 3P61A 2FB3A 1FXPA 4UNKA 3WJSA 3IGSA 5KZDA 4UR7A 1L9WA 5EY5A 1LOLA 2V81A 2GVJA 5K4XA 4O16A 2WSRA 1RZMA 3GIYA 3P60A 5AHNA 3W88A 4POCA 3HB9A 4LC6A 5KTLA 4B5NA 3A23A 3RU6A 1GVSA 4K39A 2E1DA 2B7PA 2VC6A 4JGDA 3NL6A 1I2NA 4NJIA 2C1HA 3OG3A 2V2HA 3STCA 1YTDA 4R34A 3MBFA 3L0KA 3UWVA 3LRLA 4RK8A 3S5OA 4GUFA 5D05A 5AC7A 5D37A 1XXXA 2NXHA 4FXRA 1FBAA 5DY3A 5DBTA 4G1KA 4UIOA 3KXQA 1G4TA 3IIOA 1HO4A 5G1YA 1JJKA 2QUTA 5CZTA 4O18A 1IF2A 1SFJA 5AN7A 5LKYA 3G1SA 3G22A 7TIMA 3S1WA 2EF9A 3PBYA 3NPWA 2C16A 3IIXA 2A6LA 3EWBX 4CNPA 4QQ3A 5K9XA 4TIMA 3HG5A 5BW6A 4JD4A 3UWZA 3I6RA 1JCNA 4IJBA 5E1QA 3MYPA 1AW1A 2WV8A 3DAQA 3LLFA 3C52A 2OT0A 1LZOA 1JVNA 1MEIA 1SZGA 2V30A 3BLFA 4GNJA 4GWEA 3I68A 3W7NA 3F03K 2Y7GA 1JQVA 1W56A 5AOUA 1W31A 3R5EA 1KV8A 4FNSA 3EB2A 5F1VA 4ONVA 3LM7A 2P0OA 2DZSA 3QPYA 3UXDA 2QCHA 2RDTA 2DP3A 4UNLA 3ABQA 1HFBA 1XBYA 3KAOA 3LGEA 2FPVA 2O7SA 3C3NA 1HUVA 1H51A 4MUZA 1UUMA 2A6NA 4WOZA 4AHQA 5FI8A 2ABBA 2YXGA 3GAKA 1UUOA 4OGZA 5LHEA 1R2RA 1QNVA 4LRTA 1TREA 3L9CA 1V5XA 5D38A 3GZ3A 3LDVA 2Y70A 4YCOA 2J24A 4MOZA 4HHPA 3C61A 4XWUA 2D73A 3W1MA 2QCDA 5LNUA 3DI1A 3CEUA 3CWNA 3LHUA 3HGOA 1ZFJA 4UTUA 3LHWA 2Y62A 2QAPA 2ZQ0A 1CI1A 4UR8A 5DY2A 3S5ZA 4MZ8A 5C55A 4FXSA 1GWJA 3W07A 3W1XA 1NVMA 1ZENA 1VGAA 4FIQA 2X1UA 1FX6A 3NGJA 4JTEA 2AGKA 4RZ6A 3NZRA 3CEPA 1VHCA 3PY2A 3C2EA 4UTTC 4UMBA 3TROA 3ATYA 1TV8A 1SSGA 1W54A 4I9AA 3R89A 2CZFA 1QO2A 4MJMA 4HNUA 3CPRA 2ZZ3A 1GYLA 1SFLA 1DHPA 4MLRA 3NM3A 2ATSA 3IGXA 4CNOA 4GBUA 2Y7FA 4QNEA 3TNOA 3W2UA 1SW0A 4IMEA 3U8GA 3ABOA 4PL1A 4HSNA 3N2MA 1SO4A 2GJNA 1ML1A 5FEXA 4HNTA 1LBMA 3IV3A 3NQFA 4JICA 2FPTA 2TPSA 2FIQA 1JCJA 2F7FA 2PRHA 2ZCGA 3DXIA 3LB0A 3MMTA 3W7RA 4DEFA 3DENA 3L21A 1OK6A 1VH7A 1OG0A 3TQ0A 1S5VA 2DU2A 4KFNA 3RNDA 3FJLA 2Z2UA 2YSWA 3B0PA 3S5NA 2Z6IA 5AYXA 2QDHA 3LHZA 2ZTKA 5J5DA 4O0KA 1TPWA 2C13A 3CIXA 5I3GA 3W7MA 1I4NA 3U6WA 2VOMA 2C6QA 4O1AA 5HR7A 4OQVA 1C29A 1YXCA 5K9CA 4XTIA 3T7VA 1K7EA 3BVJA 2ZA2A 3C2RA 3W1PA 1IXNA 3B4UA 2W79A 5G4WA 3GX9A 4UTJA 2RFGA 3LXAA 4YL2A 2ISVA 2Q8LA 5AB3A 3MHFA 4WQ6A 3VKJA 5AC6A 4WJEA 2J27A 2YYUA 3BLIA 4ZQNA 4Z1AA 2ZA1A 3PUEA 2YW3A 3S1UA 5FF4A 3UXAA 3NEVA 4AXKA 3STGA 4GUHA 3NQCA 1F05A 1YXYA 4JN6A 1WXJA 1TTQA 4ZMGA 1VCFA 2G95A 3SR7A 2EGZA 1YTEA 4O10A 3PS7A 1LOSA 5AC8A 2CLIA 2PC4A 5DCDA 3GXTA 2DZXA 1TMHA 2LLEA 2VFDA 3GYEA 1BWKA 2GQ8A 4JIPA 1XBXA 1IXQA 1F74A 3CC1A 5C54A 5FESA 3EKZA 3E12A 2BXVA 1WBJA 3EWZA 4ALDA 2TMDA 4LUIA 1HL2A 3P67A 5D32A 2B7QA 2CLHA 1LLWA 4UC5A 2E5DA 3Q58A 1EP1A 4BK9A 4LVFA 1F73A 3QW3A 4WZHA 1I8JA 1KLYA 3GKAA 4IWWA 3UNDA 2VFIA 1OYBA 3UZJA 1TTPA 1VCGA 4JY8A 4RLIA 2QR6A 1A53A 1GYNA 4FX8A 3PAJA 3W85A 4K37A 3FFSA 3P5ZA 1IGSA 1JUKA 4UTTA 2HS6A 1JRBA 3WK0A 2A0NA 3DKLA 3DGRA 3C4UA 5LGXA 3EX3A 4QM1A 3BW2A 3A21A 3LI1A 4K8EA 1EWEA 4LRSA 3LHTA 1I2QA 3OVRA 3FS2A 3GNDA 5C2XA 3PBUA 3NO5A 4MYXA 1KTBA 2OX1A 4W9TA 1TPDA 3P8JA 3RF9A 2YR1A 4GC4A 3TQVA 1VPXA 3GR8A 1QDSA 4IMDA 3PSWA 1ME7A 3UQNA 2C18A 4LTSA 2CU0A 4KWWA 1O5KA 3G3MA 1LRTA 1OFBA 3NQEA 4WX2A 5F2LA 2B7NA 1P4CA 3S6DA 4MYAA 1Q6LA 3HQ1A 1D3GA 4BR1A 1SR9A 4LS2A 4Z0JA 3QSTA 2V0TA 3QF0A 3R8RA 2OJPA 3NQ2A 1LYXA 1QMLA 3GR7A 1EB3A 1U83A 4LVBA 4UMCA 5D2VA 1LTDA 2QUUA 2HTMA 3Q37A 1K3UA 3R12A 1JUBA 3E9AA 2YW4A 3QRHA 5HWJA 4FHAA 3LCIA 3GDTA 3M9YA 5K9DA 1PVNA 4O52A 3M5YA 3KRZA 5LSMA 3BK0A 3T4CA 4RXFA 1WYIA 4AMAA 4ZZ9A 3B06A 3W74A 4GE8A 3ZFHA 1W5MA 3G1HA 3CIWA 1LBLA 2ZYFA 1GVOA 4JTGA 4A29A 1KV5A 2XFWA 1WX0A 3VI2A 2FTPA 3EEGA 3BW3A 4AHOA 4DXVA 1OX4A 3G1VA 3TAKA 3SJ3A 4E2BA 5HNRA 3PC0A 4Y6GA 4RJEA 3EX4A 3BW4A 4DPQA 3LRMA 5KMYA 3NPXA 3QH2A 2NXIA 2GOUA 3TSBA 1ZAIA 1JCXA 1F2JA 3MUXA 4AF0A 2FDSA 3N73A 4AH7A 4PL2A 2ZZ2A 1TO3A 1I45A 1QAPA 4BWLC 2GQAA 4ZQCA 1OX6A 2W6RA 2Q3RA 3LX9A 1YPIA 2X16A 4LY8A 1IXOA 1TSIA 4O4WA 4Q32A 1X6UA 1LP6A 4DO6A 4N4PA 4EIVA 2FB2A 4JTSA 5TBOA 5U4NA 3P84A 3I7QA 3FKKA 2YFOA 3L66A 4IPJA 4O4VA 4O1DA 4Y96A 4OU1A 3LOTA 3B8DA 1QPOA 3G0UA 4NU7A 1AK5A 1PHQA 3O6DA 4FNTA 1U5JA 3W1QA 1AG1O 4D2JA 3V75A 1I2OA 3MWAA 1FWWA 1FY6A 3P62A 4X9SA 2E6YA 3CT7A 5EYWA 1A5BA 2NUXA 1RQBA 3BG5A 2BSLA 4CQ8A 3NR0A 1K8ZA 3ABRA 2NXGA 3R2GA 2EPHA 3MO7A 4O54A 5D33A 1TRDA 1TIMA 1H61A 1OYAA 1KFBA 3W7HA 2EKCA 1SPQA 3OIXA 4HNNA 1WA3A 3PG9A 1HO1A 1P5BA 3IRDA 1OX4B 4CQ9A 1OFRA 4IMGA 4PC8A 3LCHA 2FLIA 3W6YA 3WK1A 3A22A 3NA8A 1ICQA 4JYDA 3DI0A 1BEUA 4CCDA 2VEMA 1FDJA 3VFLA 4CNNA 3S42A 4RKAA 1SO3A 3UWQA 3HBLA 1TCDA 1L6SA 1UBSA 4FEZA 2CLFA 1OFQA 3M6YA 2NZLA 4ZQMA 5K2ZA 1KM5A 4IOTA 1VQTA 1Y0EA 3N2XA 3TIMA 2BX7A 3O16A 4HNVA 3QM3A 2BTMA 4WY0B 3LV6A 3C6CA 3KVKA 4PEKA 3PUDA 2ZDRA 3LCWA 3NL5A 2V82A 1A5SA 3P7YA 4IUOA 3QFEA 3YPIA 2Y7DA 4YLWA 3IGUA 1S5WA 3BLEA 1XM3A 2WSYA 2ZZ6A 3PWAA 2E6FA 1XBZA 1TPC1 3NQ6A 3W1LA 1DBTA 3BGGA 1EUAA 3R13A 4UMAA 3TFXA 3QC3A 1G4SA 2VELA 3DHDA 1OHLA 1ZY9A 3LRKA 1XKYA 3NL2A 3PUOA 4PA8A 3P81A 4XKYA 5F2GA 1DORA 5LHFA 2C3ZA 2YGYA 3EX6A 1MXSA 5CZSA 1OFPA 2CLMA 4Z1BA 5AHEA 1VC4A 3W23A 1GEQA 4BWLA 3CTLA 1O4UA 1K8XA 1BTMA 1H1YA 1ZCOA 2JK2A 1H50A 3FKRA 3S1XA 2J9YA 4LV9A 2WNNA 3ZS4A 5KITA 4MZYA 2GJLA 2YZRA 4WUIA 3HF3A 1UB3A 1OFOA 2CZEA 4EF9A 3JR2A 1QPNA 2CLKA 2BZNA 1WV2A 1WQ5A 2VEIA 4LVGA 3O6YX 1K7XA 2QEZA 2YYTA 3I7RA 3V1PA 1VR6A 4R53A 1A5CA 2CWNA 4LC8A 1OABA 1IIHA 4CQAA 5AFDA 1KBIA 2DZWA 2WJZA 4ADUA 1ME9A 1LDCA 4MY8A 4NJHA 2JKAA 4S2CA 4Z08A 4EF8A 2QJGA 4O50A 5HQEA 1L6YA 4I7UA 1GJPA 4RZ4A 3PR2A 3BO9A 2ATMA 3M0ZA 3QMSA 5IM51 3C0JA 1L2UA 5LNVA 3DFSA 4EVZA 3QJAA 3MP4A 2H8ZA 1SSDA 2WSQA 4GUIA 2X1RA 5HWMA 3M5XA 2ZRUA 2FQIA 5D2YA 4MY9A 5DCEA 3T44A 3F4NA 4HPJA 3UD6A 3L68A 2ISWA 4NZFA 4IGHA 3DBPA 3QQ1A 1BWLA 3O05A 3T78A 1IIGA 4IQLA 2FFCA 1KLZA 4XUGA 3TMQA 5HINA 3FOKA 5C6MA 1YDVA 2C0AA 4XKYB 2QJHA 1M7OA 3LBCA 3NQ7A 3C2FA 4HPXA 4UUIA 1TPUA 1GVQA 4M7TA 3E49A 4NZJA 1IXPA 2XN2A 3FIGA 1WDWA 3G1FA 3RLVA 1VLIA 4JX4A 3F1QA 5EKYA 4A2SA 3DH7A 2Z6JA 1P0NA 3L0GA 1C8VA 3W7IA 1SO5A 5HMSA 3TA6A 1A50A 5KZMA 5BMXA 5I3IA 1DQWA 2TYSA 4FF7A 3W7OA 5EL1A 3PB2A 4NXKA
chains in the Genus database with same CATH superfamily
3W7DA 3MUY1 5HUOA 3PBMA 1I0DA 4WXZA 4PB3A 3HA1A 1D3HA 5BWAA 4HPHA 1YRRA 3FXYA 5FEPA 1R3YA 2FKPA 2TRSA 4K36A 1Q63A 3C3UA 1XLJA 1B1YA 4LUYA 2I9EA 3DESA 3MKKA 4QBXA 1XDLA 5CLWA 2PDHA 3V1HA 1SW3A 1ZALA 2E40A 3AIRA 5ABTA 2ZUUA 1EIXA 4M81A 4BY3A 4TOQA 3TC6A 3WDRA 3SCOA 3D0CA 5HNNA 1JG9A 5CG7A 1DEDA 1IEQA 3TJXA 4DNHA 3WF2A 3K8KA 4LUSA 4IXXA 1H7XA 4FIRA 3S9IA 2XFFA 1JI1A 1YNQA 4NZ3A 2UY5A 4LANA 4MHBA 1CDGA 4CQBA 4MIMA 4C5ZA 1KCLA 2WAGA 1IEVA 2V5JA 8A3HA 1XYFA 4B4FA 1XBVA 2WMGA 2Z4GA 3WQ6A 5PTDA 5AHMA 4L6DA 2VCAA 4V15A 3GXDA 3D46A 2JKPA 4RL3A 1OFAA 1UR3M 4J9JA 2QLYA 3WLQA 1YPXA 4AEOA 1C9DA 2YIHA 3UJEA 3V35A 4RV8A 3FYYA 3PJTA 3BOFA 2QV5A 2WMIA 1J10A 4I9JA 3W7KA 3GDMA 1EBGA 1Z9AA 2PGWA 1GG1A 3NNTA 3ABSA 5CJMA 4B90A 5DLCA 3WELA 1J0JA 4AEFA 2DFAA 4OHQA 3GDBA 3NQVA 4PCPA 3IJ7A 3VE7A 4DJDD 1GW1A 4W8AA 3FY1A 4KRUA 1P7TA 1FUYA 5HATA 3EKLA 2GOKA 1BXNA 1JRCA 1EL3A 1XHGA 3NVTA 2J7DA 1VYRA 1NQ6A 1K8CA 4J27A 3S9ZA 2J4GA 1V6XA 4EXQA 4TUFA 1UWUA 3AHZA 2J79A 3ARTA 1GZ1A 3IAQA 5A2CA 2DVXA 4M19A 1XPYA 1HKJA 4HB7A 1TJPA 2Y8VA 4Y8EA 3OODA 1X6NA 4LF2A 5HNTA 1I9CB 4AYGA 1KFJA 3C86A 4MKNA 3AXIA 2OKTA 1BSIA 1TV2A 3LTSA 1RUSA 3AAMA 3QQ0A 2G5WA 4F8XA 1E9LA 1UWAA 4GY0A 1X8CA 3M6DA 2OR2A 2WLYA 4KF1A 3WFAA 1I0BA 4Q4KA 1KFLA 1J6OA 1QOQA 1MEWA 1ME8A 4UTHA 2ZTJA 4DXKA 3OGRA 2BXYA 4WGXA 1FCBA 3W86A 3B8VA 4BEQA 2OO6A 1P6CA 3GVVA 4ZQPA 1WP6A 3AXHA 1BYBA 1O6IA 3SJNA 2MANA 4XTDA 3KL3A 2E77A 4LPCA 4BFAA 3KDOA 3S1VA 1SZNA 1JZ4A 1KBKA 3BLDA 1UWRA 3GUWA 4KIRA 4M0XA 5CAHA 3NL3A 3V5FA 4JYFA 3L65A 4CNUA 2RJHA 4E8GA 3FJ4A 2DVTA 4MSSA 3UPBA 1QNPA 1IZCA 4XUYA 1GONA 3KOXA 1KD0A 2WOQA 4DWSA 4DRSA 5C9UA 4PCFA 2EG6A 1GVFA 4HNOA 1X96A 3T2PA 3VGEA 4E5TA 4GFSA 2D2GA 4L9XA 3TXVA 5F4SA 5BRBA 1RJPA 1W91A 1WOAA 2ZWZA 2POTA 5CLTA 3HPAA 1C8YA 1TE6A 1RD6A 5FF7A 3I10A 2VHLA 2ISDA 1XC4A 2WBGA 4ZE5A 3APYA 4Q7NA 1B9ZA 3K4WA 5CSRA 3HGSA 3SN1A 4OVXA 1O94A 2I56A 2O9RA 4JQ4A 4UXDA 5DMYA 1JD7A 5BRQA 3ARWA 2OKOA 1ZLPA 1V08A 1T8XA 1KWKA 1QUMA 3DFQA 3HPSA 2NWSA 4Y9AA 4F2TA 5L9FA 4DX3A 3RAOA 1DWGM 2J8FA 4C6QA 3DFTA 4FS9A 2GSJA 2CIPA 2FZDA 2VT0A 5E6ZA 2C79A 3TN4A 1HL9A 5H8MA 1ONEA 1S5TA 3WNLA 2E09A 3GXMA 2ANUA 2G4FA 4HN4A 3EAUA 1R86A 4GINA 1FP8A 1S2WA 2XTKA 3SADA 3OBKA 1CZ1A 1QOPA 4PUJA 1Q6FA 4GK8A 1M5WA 5AYZA 5BMWA 4RNFA 3BLKA 1XFBA 3W53A 2DZTA 4AD1A 2E68A 5D8ZA 1DQUA 2NLIA 1JPDX 4WLCA 1JL8A 1KRBC 3G1YA 4UCGA 1OSEA 1R3SA 3WYZA 1MW2A 2C1IA 1UWQA 2QPSA 2YPIA 2HISA 1NF7A 4CN4A 4O14A 5LZLA 2ACRA 1W32A 1UP3A 4J5NA 4AWTA 3O06A 1R3RA 3KCJA 1Z6KA 4KCUA 3RIKA 1G5AA 4XG1A 5I6SA 4OFCA 1XIIA 5HULA 2OQLA 4TMCA 4MUPA 4N2YA 3EWYA 4EOUA 1XCFA 3W2JA 3HPFA 3GXPA 2PLMA 4QNWA 1RPKA 4C5YA 3H7RA 2B7OA 1U1HA 3RN6A 1RBLA 3LG3A 1XRTA 4YN5A 2F84A 4M56A 1Q65A 3BE7A 3W81A 3WMBA 4M80A 1PIIA 2ABAA 1KR0A 3KW3A 3V0UA 1P1XA 1VRDA 3SGUA 4F0LA 5MHBA 1MEHA 4GUJA 2Z25A 3O07A 2INFA 3ERPA 3URNA 1PYFA 4G2DA 4QS6A 3BV4A 4RE0A 4BQ3A 4DWDA 2Z0IA 1POKA 1H7NA 4HSOA 1RA5A 4B9YA 4Z1DA 3HPZA 1QASA 2PAJA 1M7PA 3CLWA 3WQOA 3AMLA 2Q8ZA 3N2CA 2QAFA 3WLNA 1GVRA 3L67A 3TXZA 2VCCA 3UWUA 4PTVA 2WKJA 1TKKA 4GMEA 3EX2A 1S3TC 4DIAA 4KW2A 2QJJA 2GJXB 3E2VA 3P0WA 3OA3A 3TYDA 2WC4A 1XQLA 4IUGA 3WNKA 2VI0A 3BCFA 1UH2A 3C8NA 5IDIA 1SU5A 1KGXA 4CCZA 3Q45A 2CKRA 2VRJA 4TV6A 1CXKA 3N3MA 2VZVA 4RDZA 1PDYA 5HDRA 3ZIZA 5C0QA 3LUTA 5I3DA 4N9BA 3S0CA 3WENA 2A5HA 3N2TA 2UY2A 1XIHA 2Y61A 4AWUA 3W29A 3GH7A 2QHAA 1TRIA 2GVEA 2R8WA 3QPZA 4LW7A 3ANYA 3W73A 1B3YA 4JQ1A 4IPNB 3GG7A 3QSRA 3AWNA 3G18A 4Q4PA 3EMZA 4UR9A 3VM5A 3MW7A 3BG9A 4GVFA 4YIWA 1RD5A 3S1GA 3B9OA 3UCDA 1H3GA 4L1WA 2CESA 2OMAA 2KZHA 5DQPA 1N55A 5JU6A 1BPLB 4D9PA 3N11A 1AL8A 3LK6A 3BJTA 4W89A 3TYUA 1Q45A 1B90A 5G1MA 3WD1A 4P7RA 4S38A 3U7BA 3HOJA 2FH6A 1WPCA 3VKCA 1QXLA 3JS3A 1YYAA 3TJLA 5JBEA 1QO5A 1UJQA 2J8TA 4RZ5A 5FIPA 1B30A 3H4XA 4ADSA 3CAWA 5HMEA 3MUZ1 1T7LA 2X1SA 2D24A 5A8QA 1NH6A 3W1RA 1RSCA 3P5YA 2VJXA 5EU9A 2C91A 3QVQA 4DWSC 3CMGA 3W7JA 4WGHA 2YBUA 3FGCB 2FVKA 3ZR4A 3EWWA 4KPLA 4DBEA 3HN3A 1VIWA 3LEPA 4JIQA 1MRAA 1XLHA 1V8EA 3G24A 3HGJA 1PCKA 1Q6QA 4GI6A 2VR2A 4AVFA 2FMOA 2CLEA 2FZNA 4UTIA 3ARQA 1EEPA 2UV8G 4CCEA 1EA0A 3K1DA 4O53A 4Q8VA 2Y4SA 2YL5A 4M8UA 4LJ3A 4AIEA 3TQKA 2ZRWA 1YPFA 3M7WA 3L0NA 3LBMA 4LT9A 1AW2A 2Z27A 3ITTA 3QMRA 2R1LA 1CGVA 4YJ5A 1KFWA 4B4HA 4IGNA 4O28A 4LVAA 3ZWTA 3PZ9A 4ASTA 1X8FA 4LYPA 1QFEA 1AD4A 1XI3A 2Z1VA 2J9ZA 1ZBWA 4HMEA 3OOQA 3OYZA 1B57A 5DCBA 1YXDA 4G6CA 4JEJA 2V9DA 4E8DA 1UOKA 3W6MA 5I5RA 3W72A 4QROA 2Q6ZA 1W8SA 3B8SA 3TV8A 4QITA 4L1XA 1ICSA 5A6SA 2OYMA 3ANUA 3G5EA 4Z2JA 4O1EA 6CGTA 2HS8A 1UJPA 2X2GA 4HHMA 3B8TA 5T91A 5BYWA 4H83A 7TAAA 1OGBA 2G3FA 1QU4A 1U22A 3O63A 4M6PA 4F0SA 1Q6EA 2OGYA 3BGAA 1SVDA 1E6RA 1G9HA 5HXMA 3S47A 4HU3A 4U10A 1H63A 4QLJA 4GUGA 4JTIA 1JDAA 2PD5A 2QJIA 4L7ZA 3LCLA 4LU0A 2W66A 4DWSD 3M41A 4JXCA 5BCAA 1HJSA 3AYTA 1HKMA 2JBMA 2RKXA 3PG8A 3STFA 4MWAB 5FJRA 1YKWA 3KVLA 4MFEA 1C8QA 3TU9A 2QCCA 2VEFA 1E0UA 3NQ8A 5LIUX 4ZQOA 1V6YA 3W75A 5I06A 2WJEA 4K2SA 3SY1A 4N6FA 4FZIA 2VFFA 3N29A 4JQAA 4ZENA 4HNCA 4YCPA 3BARA 2FJKA 4KFOA 2RHGA 1J0IA 3O1NA 2ZRYA 1KTCA 3NO1A 3TTOA 1J93A 2XSXA 5BWFA 4PFMA 1KKOA 4O15A 2CLLA 4K6AA 4FO4A 5DF0A 2PRLA 1ONRA 5D2XA 3THDA 1KM3A 4X2PA 1OVDA 4DLMA 3XISA 3K4DA 3LCGA 1MQPA 4AIUA 3S8HA 2WQPA 2HPMA 1BQGA 1S1PA 4WRHA 3QPEA 4ZODA 1KFKA 2AL1A 2GQ9A 4XZHA 1OCQA 4BI7A 3VAVA 3N9RA 2PTWA 1T5AA 2WZHA 3U5YA 3VKAA 4DO4A 1PEZA 1N7KA 2XGBA 4KKXA 3MI3A 5AC5A 3FVDA 2CZVA 4O11A 3GIQA 4LS0A 5LNWA 5HMFA 1GCYA 3GDRA 1UIOA 2FH8A 3GO2A 2JKEA 3EB3A 1XG4A 1L0PA 4HBKA 4JL2A 3W3OA 4IFOA 1FHLA 5I03A 4Q8OA 4HYVA 1S2TA 2I16A 4WDWA 3U3HA 3LPGA 5HR6A 1GTEA 3EPMA 4BI6A 4C91A 2DDXA 3TOYA 3UXLA 3HV8A 5A95A 1HL8A 4LAOA 3THAA 2CXGA 3OQEA 4D6IA 3IIVA 4K8HA 1QJWA 3PULA 2BHYA 3F7JA 1M9HA 1UZ4A 2JGYA 1D8CA 2GWGA 1XP3A 1LUCB 3PWGA 2OZ8A 5M3WA 2Z1KA 2GVLA 3GAYA 3L23A 1OIFA 2H3DA 1TJRA 4EAMA 2XUCA 3THCA 2DORA 4M1BA 4AZ6A 5LNSA 3G8EA 3WLIA 4F2UA 4CNSA 3OEXA 1JULA 2HSAA 4ZBCA 2PDIA 4NF7A 5REQB 1VAHA 1ITUA 1Q6RA 3AHTA 3VZZA 3M64A 4HP5A 2VL4A 4MJ2A 2P3ZA 2NV2A 2V3DA 3MP3A 4UTFA 4AUBA 2ZXBA 4HCHA 2GGEA 4TVCA 2X8RA 3IGSA 4UR7A 5C7VA 1KRCC 4C6BA 4Q7BA 5E9AA 4IFKA 4PMRA 1S2AA 2J62A 1J12A 1RZMA 2XVKA 3P60A 1HT6A 3MWCA 4EWJA 3AZTA 4B5NA 3OQ8A 4C6DA 2J13A 4I9TA 4K39A 4GY1A 1C7SA 1YBQB 1H5VA 1M01A 2C1HA 2XIBA 3UWVA 3KTCA 5HBFA 5A6KA 3PFRA 3WUBA 4W85A 5DY3A 1E9ZB 1B3XA 2PWGA 3IIOA 2NQJA 1JJKA 5JXQA 5FL1A 4U33A 4O18A 5LKYA 3H2OA 1A0DA 3N17A 5MKGA 1OZMA 2A6LA 1C7TA 3P2VA 5LA0A 5K9XA 3FVMA 4TIMA 3OIHA 3QR3A 3GFXA 3GXIA 4B9ZA 1JGIA 4JHOA 2HK0A 2IKGA 3VIHA 1YE6A 3LLFA 1GK8A 1H0IA 2OT0A 4GWEA 3BLFA 1J9YA 3F03K 2Y7GA 2ZUMA 1JQVA 5FAGA 1V6UA 3MSGA 4FR6A 1A3XA 4B92A 1KV8A 1KXVA 2FVMA 1XV8A 4Q6JA 3UXDA 3TLLA 4PMOA 1VB9A 2DP3A 5H1WA 2EG8A 3ABQA 4PRWA 1XBYA 3LGEA 1JZ6A 2O7SA 1N2VA 1HUVA 1EJXC 3A64A 1UWIA 5FI8A 4PYSA 4OGZA 4LRTA 3L9CA 5D38A 1OGGA 1JYNA 3GH5A 3HZ3A 3OGSA 4Z2KA 1GQJA 1A5NC 1IT8A 2Z24A 4MOZA 1LL6A 3DI1A 3BJSA 3FJNA 5EBAA 1D8WA 3HGOA 1R7AA 1ZFJA 3LHWA 4UTUA 3R4IA 1HKKA 5DY2A 6PTDA 4DUXA 2YCJA 4MZ8A 3WUEA 3GC2A 3GU1A 4FXSA 3WN6A 3WQWA 1VBHA 3DIPA 3ARYA 3DERA 4U2YA 1F3XA 3ALFA 4XVDA 1ENUA 4BJHA 2AGKA 4LBRA 3VXGA 4EPBC 3WNOA 1EX1A 3PY2A 4QTGA 4PTMA 3TROA 1SSGA 4I9AA 4JIEA 2RDXA 3R89A 2CZFA 1SM9A 1UZDA 4HNUA 3CPRA 4IM4A 3SN4A 4MLRA 3BC9A 4RPPA 1QHZA 1IWAA 3TNOA 3KBMA 4LCQA 6REQA 4IMEA 3URQA 1J79A 4WHBA 3ZQ9A 2GJNA 1CIUA 1EGZA 3MTWA 1LBMA 3AIBA 1TA3A 5CJNA 4R88A 2MUCA 3ZZ1A 2YA1A 3WF1A 2TPSA 1WDQA 2CHNA 1O66A 2I5GA 4H9XA 3DENA 3FJLA 1F6YA 2YSWA 2OLSA 5AYXA 2QDHA 2ZTKA 1TZ7A 1PZ1A 3U6WA 3VABA 3LPFA 2C6QA 4NP7A 4JTCA 3MANA 3AS1A 5K9CA 3BVJA 1GNXA 8XIMA 3VNIA 1Z69A 3KBJA 1XPGA 3E2SA 2PDPA 3RM4A 2VURA 3RR1A 2INZA 1JDCA 3PBGA 2W79A 1NM9A 1AQHA 5AB3A 4EPKA 3WQVA 5AC6A 4WJEA 2J27A 3VPLA 2YW3A 2QPXA 3CL7A 4ZOBA 5C9XA 4I5UA 2BVTA 3OZPA 4AXKA 3STGA 1NP2A 4JN6A 2BG5A 3T2QA 4C6CA 4HTYA 4XSMA 1TTQA 3SR7A 4NSBA 3PS7A 1LOSA 4RDYA 2JF7A 2P53A 3F4VA 2XIQA 1ZJHA 2X7VA 2FZMA 4G9PA 1XBXA 3EKZA 3B9AA 2W67A 4LUSB 2F38A 2BXVA 1WBJA 1ELSA 4AQLA 1R3QA 2ZE3A 3R10A 2B7QA 3CV6A 4WZHA 1KLYA 1BVWA 3UNDA 1EF3A 3UZJA 1PJ9A 1TZ9A 4JY8A 4RLIA 4ZCWA 1A53A 3PAJA 4BQ2A 2O56A 1FWIC 3AICA 3EBVA 5EMMA 1XLMA 4C6FA 4UTTA 4V33A 1FWFC 1JRBA 5LGXA 4QGCA 3SCTA 3R11A 1QHOA 2W5FA 4TQTA 3KS6A 2V5DA 2IKIA 2Q01A 3LI1A 4E4FA 4LRSA 3VX0A 3S2MA 3M0JA 3R79A 2WMIB 4PRTA 2OYLA 4IIDA 4QJ3B 1PX4A 3RF9A 3VINA 3LSBA 2YR1A 1S38A 1WUFA 1K70A 3Q65A 3TQVA 4EXAA 2VX5A 1VPXA 4B3KA 2XIOA 3GR8A 4IMDA 3CWHA 4OUEA 2CU0A 4CU6A 2B7NA 1WKEA 4IL0A 1P7TB 3KWXA 3UJ2A 1WXYA 4BR1A 2PB1A 4LS2A 3UPMA 1OEPA 2YL9A 3QF0A 2QZRA 3RX2A 2OJPA 4WSKA 2EJ1A 3UG4A 3GR7A 1T40A 1U83A 5D2VA 4FI4A 4CU8A 4LB3A 3R12A 1JUBA 2NSOA 3O0KA 3LCIA 1UWTA 4PUKA 4XIAA 2Y5JA 3UCCA 3M5YA 4PUMA 1EQCA 1OY0A 4RXFA 1WYIA 1C3FA 2E9LA 3CIWA 3I3EA 4H01A 1GVOA 4JFSA 4C7DA 3CB3A 5TAOA 4DY1A 1WX0A 4C6IA 3EEGA 3BW3A 4Z2GA 3TAKA 1E4MM 4DYEA 3PC0A 4HVXA 3VD4A 4RJEA 1W17A 1ADDA 3EX4A 4NG3A 4DPQA 4F48A 2UBPC 3CQKA 4U31A 3NPXA 3TSBA 1ZAIA 1JCXA 3MUXA 2OG9A 2X05A 3GWQA 4LNCA 1QI5A 3DHUA 4BWLC 1E4NA 1OX6A 2Q3RA 3TC3A 3LX9A 2YA0A 1RK5A 3VD9A 4G7FA 4BQ4A 1IXOA 4S3BA 1TSIA 3GSMA 4Q32A 3P93A 2WKLA 1LP6A 4DO6A 1X1NA 4N4PA 4BA0A 4JTSA 2JIEA 3GC5A 2XWEA 4AZ5A 5CZKA 3L66A 1GOQA 2CBVA 3E2RA 4KIEA 3LOTA 3CAVA 1QPOA 2ZWYA 2BGQA 4IG2A 3G0UA 4GIYA 4V1YA 4FNTA 2BHZA 1VP5A 2X09A 2ZXQA 1FY6A 2PLCA 3W25A 1EXBA 2E6YA 4E8CA 4G1NA 3NSXA 1A5BA 2NUXA 1RQBA 2PDYA 4DXXA 3RX4A 2HPIA 5D33A 2E0PA 1SMDA 1SPQA 1HO1A 1OFRA 2VZTA 3W6YA 2QV4A 1ICQA 4Y9PA 2V67A 1NY1A 1TCMA 4YU1A 2Z26A 2KAUC 4JIRA 4RKAA 3WCZA 4PMVA 3HBLA 2G50A 4FEZA 5E0FA 1DYSA 2NZLA 4ZB0A 4AFYA 2PZ0A 2XFYA 2NVAA 3O16A 1KGUA 4CU7A 2BTMA 2XG9A 3R7MA 1NELA 4HYRA 3S2CA 2ZUSA 3V4BA 3KVKA 4PEKA 3NL5A 1E70M 1A5SA 1KCXA 2YLLA 2Y7DA 4YLWA 2WVUA 3BLEA 4HNLA 5EMJA 3MKCA 3W1LA 4JTRA 1A0CA 3BGGA 1EUAA 4H8VA 1XIFA 2QT3A 3R25A 3UVAA 1G4SA 1N82A 1X98A 1U1UA 1UROA 3O3RA 1XKYA 3P81A 4XKYA 4J3ZA 1MXSA 3VGBA 1OFPA 2CLMA 3RGTA 1J0KA 4H9TA 2JEQA 5A8MA 3WD3A 1K8XA 4HA4A 4XV0A 3BAJA 1H50A 4MB1A 2WNNA 3ZS4A 1U33A 5KITA 1B2YA 2PDUA 1JGMA 5EMYA 1QPNA 3VO0A 4B91A 1WV2A 2J77A 3GE7A 4R53A 4PBEA 4HOZA 3SSZA 3H8AA 3GHTA 7ENLA 1GOOA 4ADUA 5FOOA 5C2CA 1QNQA 1RBOB 5HQEA 2ATMA 1XICA 1XISA 3M0ZA 2CBJA 2CKSA 2NSXA 4UZSA 3BSHA 4GY7A 2V3FA 4EVZA 3BAIA 2I5QA 2WSQA 1V3JA 4C6KA 3F4NA 3LQGA 4HPJA 3UD6A 4KT2A 4GYKA 3L68A 2IKJA 2ISWA 4IGHA 3DBPA 2VWSA 2C7FA 3CL8A 1IT0A 3UU0A 2J25A 1R85A 1YDVA 5CPQA 3V16A 1JZ3A 3NQ7A 2DVUA 3C2FA 4UQBA 4H6EA 3LPOA 4HPXA 1GVQA 4GGBA 1B5TA 4XD6A 1ZSXA 1WDWA 3RLVA 4JX4A 3M0LA 1SFSA 1ZBVA 3DH7A 2Z6JA 3L0GA 2E9BA 1C8VA 4LGXA 2XIMA 3W7IA 4FSAA 4NI3A 5KZMA 3VGGA 4H8HA 2TYSA 2C1GA 3O2LA 3W7OA 3NZGA 2PTZA 3B8IA 4OKDA 3W2MA 5A6JA 3GNNA 2WZTA 3AYVA 1XYMA 3DU0A 3Q67A 4LSBA 4UFIA 3BAXA 4Q33A 1XW8A 4LFYA 3WY1A 3GQYA 1BLIA 1QHPA 4DF2A 2PWVA 5FACA 5AYBA 5DT5A 4G56A 3A13A 2G3JA 3TLQA 3BTNA 4N9EA 4AD2A 4YWIA 1M7JA 1XJBA 2JIWA 2VVSA 1TPVA 3QHNA 1KRMA 5JBDA 3TUUA 3VILA 3POCA 4EAYA 1LJYA 2F8QA 4AB4A 1HN1A 1J6PA 1WZAA 3M0MA 4AEEA 5SWUA 2QW5A 1XRSA 3PB0A 4QEEA 3FAWA 5A8GA 1EHAA 3H70A 1W9XA 1XL9A 4HGXA 1ZAHA 2PWUA 4RCXA 3CYVA 3PZNA 3WX7A 1K02A 3IIPA 1PWMA 3WBEA 2BLEA 3ARZA 2GUBA 2VKZG 2ZRXA 4Y9NA 1QNRA 4GVIA 1A49A 1L6FA 1J0HA 2O9OA 3ZT5A 1B3WA 4HZ6A 2GGHA 2YJQA 1UC4A 4PB5A 1T6MA 4X9YA 4R9XA 2PEVA 1EXPA 2WQDA 4KERA 4JTKA 1IEXA 2PSNA 1UPMB 4IMFA 3LXCA 2DJLA 3H2CA 5LIYX 1XYCA 5LGZA 3VDGA 4E4PA 4WVXA 3VOGA 3WQ8A 4P8VA 4QJ4B 3GG8A 3ITXA 1E0TA 1Y5WA 1AL7A 2NLYA 2GSEA 2EG7A 1AJ0A 2CLOA 3Q2DA 4H1ZA 2EHHA 3QLDA 2AMXA 3UY7A 5BZAA 4Q4QA 1PSCA 2J7BA 2PBGA 3ONCA 2VEPA 4C7GA 4ZQRA 4QE1A 3BQ6A 5D02A 3BDKA 1ZNNA 1VFSA 2WANA 2Y5EA 3GVWA 4LF1A 4R7JA 3PHAA 1XLFA 1SW7A 4MVAA 3N15A 4FNUA 1W6TA 3LI0A 5FEWA 3UFYA 3D3FA 5D9OA 5HJLA 4MDOA 1R3VA 4W8LA 4E2VA 5IXEA 3SW6A 4JFUA 1SZEA 1VS1A 4DF1A 1PX3A 4HJWA 3P6LA 4MKVA 3GTXA 2EAWA 1AH0A 2F6KA 2V69A 4P61A 4Q8WA 5AHIA 1KFEA 4MNLA 2J9XA 1GQLA 4Z2LA 2Z00A 1WO2A 1KM1A 3E5BA 3ARXA 3TMLA 3M44A 3E6EA 5K3VA 3LTYA 1ONXA 5TF0A 2YB1A 1NF0A 3M0KA 3PBVA 4FOKA 3UWWA 1H7WA 2UZ9A 1VZWA 1O5XA 3GTIA 4B5SA 4PGLA 4TTGA 1HJWA 3H54A 4TVUA 4UFLA 1ZQ5A 1I2PA 4MADA 3S2NA 1KTNA 1XIGA 1UR4A 1OCJA 1KB3A 3VU2A 3CV1A 3WLHA 2WJFA 3GHUA 3QN3A 2WVSA 2G4JA 3CZ8A 2E6DA 1CGUA 1QI0A 2OZ3A 4M51A 2O4MA 1L6GA 4DQWA 1TR1A 1V6TA 4M6QA 3RCYA 1KFCA 1T99A 4Z1CA 3LTPA 2DW6A 3CM4A 4AZ7A 4UNIA 3EPOA 3HQPA 1CYGA 1PL9A 4ORIA 4KEZA 1OADA 3KBVA 1MUWA 1RPXA 3STPA 1AD1A 1HP5A 5GJNA 1DXIA 3VIOA 2OGJA 1SQ7A 4DJFA 1Q7QA 3OG2A 1DJHA 4YVVA 4GC3A 5FAJA 4CQDA 3E0IA 1TMLA 1RHCA 4NRRA 3PNZA 3VIJA 3EMQA 3MY9A 5HPCA 2VX7A 2D2OA 3E02A 3TW9A 4ROQA 4GG9A 3T81A 3WO8A 1VJZA 5A94A 1PYMA 2E67A 3KVMA 4TXEA 2B4GA 2VRKA 2D2JA 3KWSA 3NQDA 4IX0A 3W2LA 1EP3A 3HJEA 4L4PA 2VR4A 3GD6A 3NDOA 4D6GA 3LY0A 5FSDC 4BQ5A 3WQGA 3MJYA 3ZWSA 2BOEX 3CZEA 1OD0A 4DZAA 2PURA 2AKMA 3DYOA 3CHCA 1VRXA 3AIEA 4FX7A 1Q66A 3GHSA 4FXJA 1U1JA 1Q7ZA 1CBGA 4XZBA 4LBSA 4G5DA 4FOJA 1S3HA 4A21A 3ISIX 5GQBA 1T96A 4C6MA 2Z1BA 4WF7A 1BRLB 4JR5A 4YHGA 5CEWA 3SY5A 4IMAA 1W9UA 1I60A 3SIZA 1BYDA 1J2WA 1LBFA 1GQKA 1UKOA 5JUVA 4HQVA 3UWYA 2VEKA 4NNAA 4XVEA 2FHBA 3UG5A 3E3HA 1WAUA 2PF0A 4GZ7A 1DVJA 3O0FA 4QG9A 4N6EA 1UD8A 4B3ZA 3UZWA 4GRSA 3KM8A 2ZC8A 2QF7A 4UQDA 1MWOA 3W0KA 2AQWA 3IACA 4W88A 1UR8A 4REQB 5FA5A 3NCOA 5G2WA 5KINA 4H8NA 3U48A 3FX4A 3UJSA 2HDJA 3S4TA 2V8ZA 4EANA 4ZXLA 1E51A 5H2ZA 4CD5A 4OWGA 4K38A 1B3ZA 4IIBA 1TWWA 2E8ZA 4RUBA 2PTXA 1EUNA 3OLIA 4J3WA 2YX0A 4WKFA 2GJXA 3NYZA 2V2DA 6ENLA 5I79A 1TTJA 1PX8A 5CC5A 1EBHA 4XAYA 3T0TA 3W1NA 1G7UA 3IVTA 5C71A 4XO6A 4MB4A 4QAWA 2CZDA 3UR2A 3BSMA 5CPNA 1VFHA 3K5XA 4BI5A 5CPMA 1WDDA 3W38A 1Q4NX 4R3UA 3OVGA 3VM7A 2Z29A 1DTUA 4ATWA 3B03A 1UYQA 2WMHA 5XINA 1ZJIA 1GVIA 1J2BA 5LA2A 2A3HA 4GI4A 2X41A 3GDLA 2PLJA 1VFOA 2BASA 3MCOA 1H60A 4KWVA 4YTTA 1W2VA 4KRTA 4NASA 1T8QA 1UG6A 4B5XA 2NUYA 4S3JA 3ALGA 4JTLA 3UG3A 4PFHA 1EKOA 1PDZA 4LS1A 5ECVA 1J96A 3B4YA 2FZ8A 4PB4A 3PK7A 4ACYA 5KEZA 4UTWA 3VD3A 2VC7A 1J11A 3I4KA 3H2AA 4GZIA 4IFKB 3VCRA 4V27A 3P3BA 3UXIA 3QV9A 4DF0A 4Y2WA 4JTUA 3CZJA 4JY9A 3D47A 1NWUA 1LOQA 4KS0A 1TYGA 5CGQA 2W92A 3LCFA 1ZAJA 2VUNA 3BLPX 3L7RA 3UCQA 4HHHA 1C90A 4LAZA 2VDIA 5LA1A 2XU2A 1FWTA 1ADOA 5HQLA 6ALDA 3S5SA 2XZ9A 4DBDA 4NXSA 4HK5A 1NJJA 4O0ZA 4PSRA 3IUDA 3MKVA 3VDHA 4JS3A 2WZMA 1E72M 1H7OA 1L6WA 3G1XA 3N12A 4S2BA 1XSIA 1AVAA 2I7GA 5MKGB 4C6LA 1JZ5A 1CECA 4AZIA 3M1ZA 2EPLX 4ZXOA 5F4WA 1ITXA 1W37A 3IV8A 2HNEA 3DFOA 3AHVA 3EDFA 3CU2A 5IBXA 4ICNA 2J88A 5D09A 2P76A 3G6MA 4QRNA 4HD5A 3RRAA 3GNRA 5F2MA 3NAVA 6TIMA 1MO0A 1EDGA 1GQNA 1G0CA 3S6TA 2ZUNA 4AU0A 3TCEA 4MDPA 3T05A 3S6OA 5CC7A 3ZLGA 3CO8A 2WBKA 3WLOA 1JIBA 2PWDA 4UTMA 4WEVX 1VJIA 3WLRA 1WE5A 4E0CA 3OZYA 4LVDA 1XWYA 1PKNA 1W3TA 3SUTA 3KBNA 3GYCA 4DZIA 5B80A 1E6XM 5HAOA 1CLKA 4CD6A 2KX9A 4B2DA 1UCWA 3WZ0E 3FHAA 4C6EA 3K1GA 1UASA 1JCYA 4ERIA 1W1YA 4HT3A 3VOIA 3SO7A 4UWMA 3SI9A 3I65A 1UR0A 3PWIA 2WW5A 3T0BA 4DVOA 4D71A 2QXWA 3SUSA 3L4XA 2DT1A 1LWHA 1S5NA 2G96A 1W1A1 2W61A 4X61A 3AISA 5RUBA 1R7OA 4XZIA 1KBJA 3QKZA 4H9MA 3TN6A 4QAIA 5EMUA 3R43A 1KBBA 2AMGA 4WIWA 4IIHA 3USBA 3W2NA 3KZSA 5I00A 1OGSA 4KBXA 3KOFA 2DUAA 5G5IA 3SZ8A 4UZUA 3T08A 3WQDA 3EXSA 4I7WA 4DJFC 2PWEA 1ODZA 2WNZA 1GOWA 1W8GA 4XBSA 1E3ZA 2ZA3A 5HJYA 3VNMA 2I1OA 2WCAA 3W37A 3N2BA 2OSXA 3GKFA 4A3YA 2V5KA 2P1FA 3CMJA 3KRUA 4GLEA 2CNCA 2HVOA 1M6JA 4N4QA 3LU2A 2PDWA 2ZVIA 1FWAC 2AOSA 3M0HA 4A3UA 4PZVA 3WH9A 4YTUA 4QX4A 3E38A 4LEFA 2D0HA 1R2SA 2GVGA 1OYCA 3BG3A 1MZHA 4TR9A 1LRNA 4FOUA 3VK5A 4DBSA 3E74A 4F79A 3T0DA 5A2AA 1XCXA 2R1MA 3U2EA 2GLKA 3G77A 4PBFA 2VQTA 4RW5A 2OOGA 3W00A 4D8ZA 1W5OA 3NEHA 3KTXA 1D9EA 1GOMA 3QTGA 3LV5A 4WKAA 3F4DA 3NYDA 3W22A 2FZ9A 3FSUA 5D9NA 4JKKA 3LGGA 3B9NA 1X38A 1BF6A 1PCWA 4GCXA 3KP0A 2AAMA 3EOSA 2VENA 4KRZA 1F6KA 2OZTA 5D2WA 4QG8A 3LNPA 1GHRA 5AVHA 1DJQA 4C60A 3JU2A 3U2OA 1OFEA 3UERA 2FVLA 3RCMA 3ITLA 2EO7A 4DJFD 3CB8A 3AOFA 3G0XA 5CGMA 2HBVA 3MYOA 3L5AA 4JKLA 3MV01 2H3BA 1K9DA 5CC6A 1KWGA 1CXIA 3I4EA 2BDQA 3ZR5A 5DT7A 4N42A 1UQYA 1X1ZA 3L5MA 3NQGA 3TVAA 1K77A 2GK1A 3H4GA 3LHYA 2WC7A 1VEPA 1GKRA 1H7PA 3N6JA 2DT2A 2J6XA 7ODCA 3E96A 1JYXA 1LQ2A 5A6TC 4AC7C 2NX9A 1XR2A 1K1DA 1LQ0A 5REQA 4XO7A 3N34A 5GVJA 1DOSA 2X0YA 1KQYA 3SB0A 4A8LA 3TSDA 2XISA 4RXGA 1K9EA 3USZA 2W9MA 3QZAA 3RJXA 3HG2A 1MFVA 3N14A 3C0LA 4OT7A 3DX5A 1FA2A 3CZGA 4CCCA 3WQPA 3K13A 5XIMA 4GJJA 4Z17A 2DIJA 4J28A 3BGJA 4EKJA 3L12A 2AL2A 4Q4RA 3H2NA 3D3AA 4HZ8A 4BKNA 3B9EA 3N9KA 2PI6A 5I77A 1UW9A 4B5WA 3NZ1A 1Q6DA 3FEMA 3TFCA 2F2KA 1IYXA 4G8TA 1H4PA 3WFLA 2INEA 5EMKA 4HK6A 3PPCA 4N9DA 1XLBA 2A2IA 5T9CE 3IIZA 1O5QA 4YMZA 4D6CA 2WSPA 3R0KA 1E6QM 4GH1A 4AZGA 3GXNA 2DZPA 4RX0A 2ZE0A 2NX1A 4J3UA 3A3WA 1VLWA 1SZRA 3KRSA 4D8LA 2GUUA 1VHNA 4AY7A 4O8AA 2FGZA 4OV9A 3W7CA 4H2HA 1EPXA 1MXDA 3G6LA 4NZ4A 5TIMA 3B04A 3FYPA 1EH9A 1JZ8A 1BXCA 2ZZ5A 5G2IA 3OVQA 2RJGA 5A5WA 4GYFA 3GNPA 2ZADA 4NVTA 5AKQA 2VM8A 3RLUA 2HVNA 1W3KA 3ELFA 4UNKA 4DJEC 4R5EA 5KZDA 2F6XA 1J01A 2QVHA 2V81A 2WWCA 4IG2B 4DI8A 3T07A 4UQCA 4O16A 1KCKA 3HB9A 3BAYA 3H2MA 3IPWA 4Z42C 2ZX6A 1GVSA 2E8YA 1JEZA 3DECA 4JCMA 4Q22A 2E1DA 4A4AA 4JGDA 1FKXA 3OG3A 1YTDA 2V63A 3LRLA 4RK8A 1OG6A 2IMRA 3CUFA 1XXXA 1OBAA 4FXRA 1RK6A 4WCJA 4G1KA 4UIOA 3DC8A 3KLKA 2RAGA 5G1YA 1TJ1A 1VEMA 5CZTA 1IF2A 1SFJA 5AN7A 3G22A 2EF9A 4A8NA 2Q02A 1G94A 3EWBX 4QQ3A 2BOFX 5BW6A 2NQZA 2X42A 3UWZA 3I6RA 3URAA 3M4HA 2YBTA 1JCNA 1R38A 2GGGA 4XK2A 2DT0A 2QQ6A 1V79A 1HKIA 2WV8A 1RP8A 3DAQA 3C52A 2XVGA 1JVNA 1SZGA 2BY1A 2V30A 1RBAA 1W31A 4J3VA 3EB2A 3V0TA 5CCZA 4U5IA 5F1VA 1Q8AA 2FTWA 2QCHA 4C1NB 3VDAA 3LN3A 1DJGA 1E4LA 4QS5A 1KXTA 1P0BA 2FPVA 4JIHA 2E9MA 2VX6A 3VNKA 1ISZA 1LWIA 4PULA 1UUMA 4WOZA 2ZUVA 4MWAC 2A79A 1UUOA 3RLHA 4ACZB 5LHEA 4PEEA 3BQ5A 2ZX7A 2E7FA 2XJ7A 3EA3A 4J2PA 4XWUA 2PCEA 3W1MA 3WLLA 1EC8A 1J18A 2JE8A 2R1NA 1V3KA 4OTKA 4S3FA 3QFWA 6A3HA 1UOZA 3WLMA 4RNJA 2F9RA 3MCMA 1E1CA 5HPOA 3W1XA 4FIQA 2J8GA 1FX6A 3BJFA 4RZ6A 4CD7A 1V4YA 3NZRA 3AMKA 3ZMRA 3CEPA 1OB0A 2XDFA 2PPGA 2QNEA 3GNOA 1W54A 1QO2A 4B2DD 1K4HA 4MJMA 2BS9A 4F40A 3NXLA 2ZZ3A 3F2BA 2ATSA 4GBUA 3SCUA 4S3KA 2Y7FA 4EPDC 3W2UA 3T1GA 4OECA 3HFYA 4V2XA 4PL1A 3TWBA 1HP4A 2IPFA 4HSNA 1SO4A 2P3EA 1MMFA 1Q2RA 2VTFA 2ASHA 4US5D 1NDZA 2CWXA 1HJVA 3QYSA 3QHMA 1YMYA 5I2UA 1UD4A 4JICA 3T6CA 2I57A 3QR0A 2FPTA 3RM9A 2FIQA 3PFMA 3CUGA 4M29A 4JCLA 4LX4A 4CN1A 4PMZA 1V3HA 1S5VA 2DU2A 4KFNA 3RNDA 3TQ0A 2OB3A 3MC5A 4J3SA 1NOUA 4AZCA 3LHZA 4O0KA 2VOMA 1YNPA 2OLAA 4OQVA 3OJGA 3C2RA 3KE0A 4MWAD 1IXNA 3B4UA 5EB8A 2C8NA 3OZMA 4PTDA 2Q8LA 4DZ5A 2YDRA 3AXKA 3VKJA 1FVPA 1GPFA 2YYUA 2Q09A 2BB0A 2OO0A 5CH9A 4ZQNA 4Z1AA 3S1UA 2F6UA 5FF4A 5ABFA 4GUHA 3NO3A 3NQCA 1YXYA 2WCGA 3OA5A 1WXJA 1U5VA 4W5UA 1PZ0A 1M1BA 4FA3A 2WWDA 4H41A 5AC8A 1VKFA 2WKGA 2OLHA 3GXTA 2DZXA 5ENLA 1BWKA 2GQ8A 4JIPA 5C54A 5FESA 2QYGA 3E12A 2ZOXA 1CCWB 2PDBA 3OLGA 1C92A 4LXFA 4UC5A 3Q58A 2GSHA 4X63A 4W84A 2GJPA 1OYBA 3SCRA 1R8LA 3SRFA 1GYNA 3WBWA 4K37A 3EYPA 1IGSA 2HS6A 3ANVA 3DC0A 3BAWA 3FNDA 4QM1A 3BW2A 4IQJA 3GG1A 1DWIM 2BGNE 1S2UA 3LHTA 1I2QA 3A4AA 3OVRA 3ZT6A 3GNDA 3NO5A 1XKJA 4MYXA 3WD2A 3VNZA 4M82A 3FAXA 4GC4A 4HU8A 4H9YA 1LWJA 3AZSA 1QDSA 1R9XA 2BVDA 4LCSA 1ME7A 1Z8AA 3UQNA 1A80A 3A6OA 2W3ZA 5EFDA 3OW1A 4ML4A 1OFBA 4GX8A 4WX2A 5F2LA 1VPQA 1DE5A 1Q6LA 4EX4A 3TCSA 1D3GA 5A8OA 2YKKA 3U4AA 2V0TA 2DV0A 4OZOA 1XLIA 3NQ2A 5BU6A 1QMLA 1A4MA 4LVBA 1VIZA 2QUUA 2Z1XA 5D4YA 1ECEA 2HEJA 3CT2A 1K3UA 4JAWA 5HWJA 3OP2A 4GYPA 3IRSA 1RH9A 1PVNA 3BK0A 1MQQA 4JFWA 4AMAA 2FMNA 3W74A 4GE8A 4E3VA 5D9MA 3MCNA 1W5MA 3E2QA 3VUPA 3FA4A 3SFWA 3BOLA 2XZ7A 4A29A 3M0IA 1FWBC 2VNCA 3CK5A 4AHOA 4DXVA 1DJZA 3ARRA 3G1VA 3NFUA 4E2BA 4Y6GA 3SCWA 3OLEA 3BW4A 1DJXA 2X0HA 5KMYA 1C9WA 5C2GA 2NXIA 4MTVA 4AF0A 5DMMA 2FDSA 3N73A 1EPVA 2WNWA 2ZZ2A 4ZQCA 3AWOA 2W6RA 1YPIA 1TWSA 2P8BA 5TBOA 4HOWA 1XDJA 1TX2A 3P84A 2P88A 1CGYA 1Q4WA 3B0YA 3BURA 1D2KA 4PTWA 2PDJA 3M0XA 4Q3MA 3R6IA 2WPGA 3IJ9A 2PC8A 1U5JA 3CH9A 5BXPA 3W1QA 1I2OA 3MWAA 3WNMA 4X9SA 1ZS2A 4NYYA 2BSLA 2V3EA 2QDEA 2EPHA 3WNNA 3TTYA 4CQCA 1KFBA 3OIXA 4HNNA 1WA3A 5IFTA 2VGBA 1OX4B 4PC8A 3LCHA 3WK1A 4BF7A 1S2CA 1FH7A 3A22A 3UZZA 3WEZA 3DI0A 2XH0A 1UIPA 2YB4A 1BEUA 4CCDA 3DFYA 3AYRA 4CNNA 1E6PA 1SO3A 1L6SA 1PXGA 4HSHA 3H21A 3M6YA 1H1NA 4RW3A 4YVPA 1NIUA 1XLAA 4IOTA 1VQTA 1Y0EA 3TIMA 4PTXA 1XG3A 4HNVA 4GA8A 1QBBA 3C6CA 3A4WA 2IS7A 3PUDA 2ZDRA 3LCWA 4PN2A 4IUOA 3QFEA 3YPIA 1CWYA 3RX3A 4XIMA 1S5WA 1XM3A 3M07A 3H22A 3NQ6A 2DIEA 3R13A 3DHDA 1OHLA 1LLOA 4RE2A 3NL2A 3DUGA 1W9BM 4CD4A 2O4QA 3NSMA 2YGYA 2G3NA 3EX6A 1W9VA 4Z1BA 1CGXA 3UA4A 3AIUA 1XLEA 4AVOA 4ECLA 3W23A 3PTMA 1PIGA 2QJNA 3CTLA 3F4CA 1CB7B 1BTMA 3FW6A 5ECUA 4LV9A 2XIIA 2GJLA 4WUIA 3HF3A 1IZKA 1N8WA 4EF9A 4MB3A 3JR2A 1V3MA 3WQCA 1E3XA 1SYTA 2CLKA 2W62A 1Y5XA 2NVCA 1WQ5A 3DG6A 5H6HA 1SR0A 2VEIA 1IT7A 2QEZA 1VR6A 1FWCC 1IEWA 1M03A 1HKWA 3WH8A 1IIHA 4JOMA 1ME9A 1LDCA 4MY8A 4TV5A 4B15A 1QWKA 2QJGA 4O50A 1L6YA 4IIGA 3WMSA 3BMXA 5LNVA 3DFSA 2NW0A 4GVHA 4YVXA 2X0SA 1SSDA 3CZLA 2D3NA 5HWMA 4QEHA 3M5XA 2FQIA 4DYKA 3C2YA 1MYRA 4NZFA 1ONWA 3LLXA 3BZGA 4NKCA 1BWLA 3O05A 3T78A 1IIGA 4J4KA 4MB5A 5HQMA 5HINA 2C0AA 3T8LA 1M7OA 3LBCA 4J35A 4ZO6A 4RE4A 1TPUA 4M7TA 2WC3A 3E49A 1QK0A 1IXPA 1GJWA 1VLIA 4E4UA 4KCTA 4KGLA 2ZIDA 2DH2A 3E5PA 4GZJA 3WLSA 4AX6A 2DQWA 2GYIA 4GFIA 3TA6A 4R9OA 4GISA 5BMXA 4AISA 3CQHA 3CPGA 1TJ0A 3PM6A 4OBTA 1DV7A 4L1GA 1XSKA 2REQB 5XIAA 3W7PA 4GOAA 4DNMA 3RITA 1W1ZA 2WM0A 5I24A 4X2RA 4B3LA 1I1XA 1W9DM 5A6MA 2ZXDA 3HURA 1NDWA 2PDLA 2D22A 4GQ0A 2B0MA 1WCGA 5JH2A 3OB8A 4QHRA 1XUUA 1EGVA 3HGRA 2WHLA 4IGMA 1OF6A 3K2GA 4YS1A 2PWFA 4S23A 3UZYA 3RU8X 3TW7A 3LZ5A 3LPPA 4I90A 3LHVA 1J4EA 4KCVA 2HXTA 4A8IA 4UOQA 3AIVA 2VGGA 4G7EA 2VQUA 3W7EA 3WH6A 2QPUA 4LWWA 4Y90A 1Z7AA 3TZFA 1Z3NA 5I0DA 2QUMA 4P2VA 1B54A 3W7QA 2GQ3A 4JNYA 1EWDA 3E0LA 4XZ9A 3NZPA 2AGTA 1DWJM 1H62A 5A6BA 1UBPC 1O95A 4IIEA 5I3FA 2R24A 3FJ6A 3CWOX 5FJOA 5D04C 4JX6A 4FLOA 3ABXA 2PDCA 1AZ1A 2G97A 1NP0A 3NPUA 1WDSA 3GZAA 1XLCA 4IJCA 3LXBA 4U5KA 3UPWA 4AX7A 4NL1A 4H9ZA 2OYKA 2XGIA 2WJDA 3QW4B 1TUXA 1OK4A 1QI2A 5AY7A 3DCPA 4ZA0A 2XVNA 3SCQA 4HZMA 1F76A 2WHMA 1MW0A 2DSWA 1IQ8A 3BUVA 4KWOA 3T0AA 1A5UA 1GVYA 3N9SA 4NIRA 2HJPA 4P8XA 1SZFA 3VZXA 4AY8A 1A5MC 3VTRA 4L65A 2XN1A 5BROA 4EP8C 1CLVA 4XZLX 1W5QA 3OZOA 1F5ZA 4NJGA 5GJPA 3FLUA 4Z0SA 4JTFA 4WD0A 3REQA 2E1WA 3CQ0A 3FA5A 3AIQA 5CJ5A 2YA2A 3QKEA 4W7WA 5E9XA 3AMCA 1VYPX 2WHKA 3ZVHB 1IZJA 5C7HA 3SY8A 1XCWA 5JIWA 3WBAA 3TR2A 1E40A 3SUWA 3T4WA 3WJWA 1JF5A 4XISA 4PH6A 1QW9A 2VYOA 5FJJA 2ZFAA 3WK3A 4AHPA 2X40A 4PUDA 5E6YA 3VKBA 3PNUA 3ZR6A 3MI2A 4C1LA 3H24A 3T0CA 1FWDC 1LQAA 2IPGA 3H23A 3OO2A 5I3KA 3HFTA 4K7YA 1F61A 1FCVA 2QS8A 1VBJA 3DEQA 3P14A 3GU9A 5LIXX 1WZKA 2Y85A 1UKSA 1QBAA 3VX1A 1F4HA 2PDKA 2W4XA 2B81A 4FX6M 1W1IE 3NWRA 1VYSX 3HTWA 5FF2A 1EYWA 1R46A 1RR2A 1V6VA 4MF4A 4PMUA 1BHGA 3WF0A 2HRWA 1JPIA 5HANA 1KA9F 4UCFA 3LSCA 1TV3A 2QGHA 2QDDA 3NDZA 1RQEA 7A3HA 3W6LA 1OC6A 2HE8A 3RFAA 2QIIA 1FH9A 3IGHX 4NX0A 2Y2WA 4ZTXA 1W5PA 3TN5A 3AFBA 4FLQA 1EC7A 1UR9A 3HIJA 4D1JA 1BRLA 5B7ZA 2QDGA 1UA7A 3MHGA 2J47A 4H04A 3GTFA 2ACSA 4M6VA 3Q94A 4FP1A 4WK9A 4ZTYA 2A7RA 3QV6A 1JDEA 5T26A 3EOLA 1OIMA 4RDVA 2EPKX 3ARUA 4BS0A 5ABHA 3CV7A 4XD3A 5E93A 4WY0A 1E0VA 4F0HA 1DHKA 2GFTA 1BVNP 4AY1A 1RJRA 1K9TA 1GYMA 5MF5A 1TQJA 2PTYA 2V5LA 1X97A 2OEKA 1H1ZA 1DQXA 2BNJA 4REQA 7REQA 3PN8A 3WLKX 1BGGA 2EQDA 3CBWA 1W1VA 4XKMA 5AHLA 4LCRA 3VNYA 3MUCA 4BZYA 1I6NA 3M16A 3DG7A 3HG3A 4NAFA 4DPPA 3M47A 1TPB1 1FWGC 4S3EA 3E0VA 3KL0A 4E38A 1JZ2A 4AAJA 4HIBA 3DGBA 3F5JA 3GUGA 4XZNX 5AHFA 2PDXA 4FLRA 3W83A 2PP1A 3VGDA 1Z41A 3V7PA 3WUGA 2GK1B 3N1AA 4UQ9A 2PA6A 4RV3A 5I07A 3HPXA 4UBPC 3WH7A 2X7WA 3UESA 5D8WA 5DXYA 3IJLA 5G2HA 1TQXA 2Y8KA 3AJXA 2H9AA 2ZRZA 4X3ZA 3ZJ7A 4HA1A 3WF4A 1XINA 3NXFA 1ZBKA 1NSJA 1WXZA 1AFSA 4QIUA 1POJA 4PBGA 4Z2IA 2CEQA 4JQ2A 3IUHA 3SAZA 2PGRA 2OVLA 3WQEA 1Y5VA 1CLXA 4M5PA 3EA2A 1NARA 3LD5A 4NJKA 1D7FA 3TYBA 1G67A 1Z42A 3TYAA 2AL2B 3ITOA 3W87A 4M3PA 1PS9A 5FEZA 4TX8A 4GI8A 3UBPC 1O1ZA 3FCPA 1O68A 1LLZA 2VGIA 4BF9A 2CETA 4TX9A 4M24A 2WLZA 1R87A 1W2PA 4N02A 4HKPA 2DIKA 1XDMA 1QATA 3UY8A 3MVIA 2JQXA 3VIPA 9XIAA 2PD9A 1H49A 1QW7A 1XIJA 2ZZ4A 4H4IA 2RGLA 3R0UA 3B0VC 1BVZA 3AYSA 3STEA 4NQ1A 4S1FA 2XYLA 4W4QA 3COTA 4HMDA 4FR1A 1YDOA 3N4EA 4YXGA 1M53A 1G4EA 2JALA 1US3A 2RH9A 4H8UA 5CBBA 4IF2A 4LV4A 2OCZA 2BMBA 4H9VA 2FHCA 3AO0A 4XAGA 4FK9A 1JCMP 3KTSA 1FRBA 4AYSA 5GNZA 1WBHA 1K8YA 3CHVA 3KEHA 3ENLA 4L80A 3PZQA 3A12A 5M2FX 4GABA 5KZEA 2XH2A 2YFNA 1QNOA 5DBUA 1W3JA 5KZ6A 1PHWA 3J7HA 1AH3A 2QVNA 3JZUA 5KSWA 2BVWA 2WCSA 4I5XA 3TN3A 5A3HA 4BCEA 1THFD 2VFEA 1OCBA 5BRPA 3VGFA 4Z1YA 1JPMA 2P8CA 3THQA 7XIMA 4DYJA 5A8NA 3MMWA 4E6MA 4OV4A 4DELA 1J0YA 4UTLA 2SFPA 3UG8A 3WJYA 4KETA 1EA9C 1X7FA 3WUFA 1Z48A 2GZXA 4CNTA 1E9IA 2NQ9A 3UJRA 1EO7A 1AA1B 5K4ZA 2VZOA 3A3HA 1AW5A 4QG6A 3CGTA 1JUEA 1CTNA 4HJFA 1UQZA 3SQMA 3WH5A 1VFUA 4FLSA 2H6RA 2DSZA 3JW7A 4J7RA 5A6BD 1XSJA 1A5KC 2VWTA 3R0DA 3VYLA 3BLLA 3UR7A 2AQVA 2E5BA 1TTIA 1P6WA 3QY6A 3U2CA 4TMBA 2W63A 1FWSA 4AXNA 2RGMA 2BHUA 2A21A 4A8RA 4JDYA 1E73M 4JN8A 1MXGA 1V51A 4ICMA 1EJTC 3SQLA 2R14A 3EX1A 4J3XA 1KRAC 2DUXA 3TX9A 2DQXA 2Y0FA 1JYWA 1CGTA 1TV7A 4K7VA 4AZBA 2PGEA 3L2LA 3W2KA 4P7LA 4H6KA 1V3IA 4Q8TA 5E0CA 3MS8A 4ZFCA 3V5CA 1E1CB 4MZ1A 4C6OA 3DYMA 4ZGYA 4XSLA 3EPNA 1GGOA 3BPWA 4KWUA 4PSPA 3CUIA 4U2ZA 3CV2A 5TQLA 3WKZA 2OOFA 3BICA 2PMQA 1V7AA 3RO6A 3MVTA 1E71M 4ZSTA 3F2CA 3QY7A 5C70A 4I9MA 3NQAA 3RXZA 2IUZA 2OZ0A 4CLMA 1EP2A 1WDPA 4Q4SA 1WKFA 4PMDA 1OJXA 1XYLA 2CW6A 3CHEA 5FF0A 1EX5A 3QMTA 1XIDA 3GW3A 4XQ6A 2NV9A 3DFNA 2HNHA 2OWXA 5CGTA 4PRRA 3JUGA 3CH0A 1MW1A 4J2MA 4KFPA 4CKQA 1UMYA 3EDDA 5FJIA 1ZJAA 2DZUA 3C8FA 3DHFA 1LROA 4L64A 3UW6A 5F2IA 4CGTA 4AZCB 1WZMA 2O55A 2C19A 1YDYA 2VOTA 4YNGA 3HMJG 3GDKA 4NI8A 4L61A 1ITCA 1FQ0A 3ZJ6A 4ML9A 4LUJA 5KETA 2G41A 3Q4DA 1UR1A 1E0WA 2QCEA 4Q8MA 4FALA 1G6CA 2ADAA 3O6AA 3RDKA 3H7VA 3W1TA 5LXEA 1AQFA 3FHQA 1ISYA 1FH8A 2X30A 5I23A 5H91A 4B5VA 5ABFB 3NDYA 3P8IA 1XYZA 3H26A 4L6OA 5T8GA 4L6HA 2Y7EA 4YYCA 1KM2A 4C6JA 2EKGA 3WNPA 3AUJA 4LH8A 3FYOA 1GVEA 3CAKA 1UD2A 2CXEA 1OINA 4JYEA 3OGVA 4GIEA 3AJ7A 1Y7VA 1KXHA 3TAOA 4URIA 1E9YB 2CZ5A 2NT1A 4Z2HA 1BYCA 3TYZA 3PBWA 5F1UA 3SN0A 3BCJA 3RMJA 3WD4A 4F0KA 3VOCA 2I14A 4OBSA 3QXBA 4MJZA 3E0WA 2VFGA 2ZZ7A 4DO7A 5DMLA 4GKTA 1DTNA 1W3HA 4JQ3A 3A5VA 3FDKA 1OQFA 3N04A 2G8ZA 2WNQA 1JCLA 3KOZA 3P74A 1VENA 3QZEA 3VNJA 3EXTA 2CFFA 1QPRA 4DUOA 3A47A 2R1PA 2ICSA 3PF3A 3PTQA 1GOXA 5I3JA 2QCGA 4GXMA 1FWEC 3B05A 1ZBCA 2V2CA 2DW7A 2XSBA 5DELA 2E6AA 3BV7A 4ADTA 1V02A 1QWGA 4F66A 3UYIA 4XB3A 1RY8A 3H12A 1PTDA 4JHZA 1JAKA 1BQCA 3QTPA 1UC5A 4R85A 1O60A 1TPEA 2QUVA 2HMCA 2Q8XA 2C14A 5AVNA 3QYQA 4UQAA 4UFMA 1Q2SA 3SRDA 3W24A 4B5UA 5K7JA 1SUX