4MWAC

1.85 angstrom crystal structure of gcpe protein from bacillus anthracis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
255
Chain Sequence
EMTHRTKTRPVKVGNLTIGGNNELIIQSMTTTKTHDVEATVAEIKRLEEAGCQVVRVAVPDERAANAIADIKKQINIPLVADIHFDYRLALKAIEGGIDVRINPGNIGRRHKVEAVVNAAKERGIPIRIGVNAGSLERHIEKYGYPTADGMVESALHHIKILEDLDFHDIIVSMKASDVNLAIEAYEKAARAFDYPLHLGITESGTLFAGTVKSAAGLGAILNKGIGNTLRISLSADPVEEVVARELLKSFGLAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
publication title 1.85 Angstrom Crystal Structure of GCPE Protein from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 83
structure length 255
sequence length 258
ec nomenclature ec 1.17.7.3: (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin).
pdb deposition date 2013-09-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4mwaC00
4S3DA 2VP8A 2YCLA 2DQWA 4MWAE 4C1NB 3BOFA 4D8AA 2Y0FA 1AJ0A 4DJEA 3TYDA 3MCMA 4DAIA 3H23A 5JQ9A 3H2OA 2BMBA 1TX0A 3TYZA 3H26A 4DJFC 1AD4A 2YCJA 4HB7A 2YCIX 4CCZA 3TYAA 4S23A 1Q8AA 4NHVA 3TZNA 4DJFD 4PZVA 4S3CA 1TWZA 2Y5JA 1AJZA 1TX2A 4DJED 1Q7QA 3H2MA 3BOLA 4D8ZA 4O0QA 2H9AA 3TYEA 2Y5SA 2E7FA 4DJDA 1TWWA 4S3FA 3H24A 4S3AA 2YCLB 2YCKX 3H22A 4NIRA 3TR9A 2VEFA 4NILA 4S3BA 3TYBA 2H9AB 3H2NA 4DJEC 3K13A 1TWSA 3H2CA 4NL1A 3TYCA 4MWAA 1AD1A 4S3EA 4DJDC 4G9PA 1AJ2A 1Q85A 3TZFA 1Q7MA 1EYEA 3H2FA 4DJDD 4C1NA 1Q8JA 2VEGA 2DZBA 4MWAC 2OGYA 4S38A 3H21A 3MCNA 3MCOA 4D9PA 3H2EA 4DJFA 4DAFA 1F6YA 4MWAD 3TYUA 3NOYA 4O1FA 1Q7ZA 3V5OA 2DZAA 4S39A 4DB7A 4MWAB 4O1EA 3H2AA
chains in the Genus database with same CATH superfamily
1B54A 3WQ8A 1HX0A 5IHSA 4JTQA 3O0FA 2CETA 2P0OA 4NAFA 4O11A 1UZHA 3GX9A 3R13A 2X0YA 4Z1YA 3DECA 1C9DA 4IPLA 3W38A 5HOSA 2W3ZA 4AZCB 1N8FA 4LVGA 3PTKA 2GVGA 1JR1A 1UH2A 2XGIA 2Q71A 3HQOA 3W1QA 3P8JA 5A6BD 3QXBA 2C16A 1FRBA 4ZO7A 4S3CA 2QDGA 4WZHA 4ZVJA 3LERA 1KXVA 3TYEA 1WDSA 1A0CA 1X8CA 3C2VA 1Q6DA 1AODA 1EA0A 5G5IA 1VPYA 2CYGA 4LS1A 2PRLA 1UH4A 1OT2A 3CAWA 1TIMA 2DT3A 1BPLB 3CO4A 4I6KA 4N9DA 3KBSA 1EHAA 2J62A 1ISWA 3UXKA 5AN7A 4LBSA 3M4HA 4YWIA 1ITCA 1UP2A 4HNTA 1YEYA 1UH3A 3GXPA 4I9MA 4M81A 2NVDA 5JH2A 1PS9A 1H7WA 4TV5A 4X9YA 3WK1A 1VYRA 5G2IA 1JCYA 5LIXX 3VNIA 1XPYA 3WLPA 2J25A 4O16A 4IM4A 1RBLA 1GZ1A 3EXSA 1FWHC 3DHFA 3ANVA 4R33A 2ZZ6A 1Z3NA 1JNDA 3NM3A 1DEDA 1EPVA 5CZJA 1QO2A 4XBSA 2EG6A 4J3TA 1WDWA 4KH2A 1YTKA 5AC4A 4JTRA 4K1WA 3NZGA 4L5ZA 2VTFA 4MKNA 4DBUA 1TR1A 5I24A 3VMPA 1EIBA 2MANA 4J9JA 1ICQA 5JBFA 4NZ3A 3T2PA 1O6IA 5C2GA 3C8FA 1EDQA 2QXWA 4DO5A 4Q6XA 4PB3A 4W87A 7REQB 4GH3A 3MO4A 4HHLA 5JIWA 3GU9A 3GB6A 4H1ZA 1KGWA 2PDPA 2CLIA 3RF9A 2YKKA 2D20A 2ASHA 4L4OA 4AD5A 1UWAA 1K02A 3M0XA 3SCTA 4LNYA 3O6DA 3EKGA 3FJ6A 1OINA 3TU9A 2RDTA 4JOMA 4IT1A 1H09A 4P8VA 1WOAA 3EPOA 1I45A 3E1F1 4HYVA 4JY8A 4X0VA 4PTXA 3RNDA 2QCNA 4X61A 1K7XA 2OZ3A 2XDFA 3T1GA 5K4ZA 5BOFA 1W17A 1A4MA 3S2CA 1XSIA 4PMZA 3VM7A 1GHSA 4CUCA 4UB9A 1CXHA 1CXKA 2NUXA 3PG9A 4L7ZA 3R8GA 2QLYA 3WH8A 4A21A 3AUOA 3OHMB 3A24A 4Z2LA 2C1HA 2GGJA 3LY0A 4P2VA 1H63A 3VGHA 1W3IA 2EPHA 3WJXA 3MVTA 3GR4A 4IX0A 3BVJA 4Q4SA 2NLYA 4UTJA 2QUUA 4Q8NA 1LTDA 4C6OA 2YCIX 4UTWC 3WK3A 1XLMA 5AZ1A 4K39A 4C6BA 2OOGA 4UTTC 4IWWA 5AECA 1E6RA 4ECLA 1PL9A 3WK2A 1TPB1 3MDWA 4DWSB 3PSVA 4JFVA 1U33A 3JS3A 4FNPA 4REQA 3GHSA 4D2JA 3NL5A 3NO3A 1UYQA 1GQLA 3UG5A 5ABHA 3A12A 4JX4A 3HG4A 3K8MA 3WQWA 4N9EA 4ICCX 3TKFA 1D8WA 4MWAA 2G95A 3LHWA 3N4FA 2P53A 2J24A 4JKMA 4NZCA 1R46A 1SSDA 1NFBA 1F2JA 3NO5A 3PPFA 1ECEA 1OK6A 4IFKA 1RY0A 1SM9A 4MADA 3AAMA 4EPKA 4LRSA 4GJ1A 3WEZA 4AY1A 1G67A 4GXMA 2CCRA 5CZKA 1DPMA 5FEWA 1RR2A 4WDUA 1OC5A 3TJ4A 3KL5A 5KZDA 2AKZA 3K46A 3PANA 2QJHA 5A8PA 3RMEA 3T0DA 1S46A 3NZQA 4RE2A 2HISA 3BV4A 4L1XA 3W1AA 3HF3A 3HPAA 3SSJA 1JDAA 3CS2A 3WJWA 4F0RA 3M5YA 3WLNA 1KBIA 4XZMX 4N9CA 2JIEA 3FA3A 3SRFA 2DZTA 4K37A 1J6OA 5FJTA 3W7PA 1JRCA 2BVTA 3GO2A 1M53A 1AZ1A 2BGNE 5EGRA 3O16A 1UWSA 2W27A 1BEUA 2P50A 5I3FA 1Q6CA 3CV7A 3KEHA 1Q2RA 3F7JA 3BQ5A 4WUIA 3CMJA 3IJIA 4IOTA 3TSBA 1DQXA 3VC5A 4XV0A 1D3HA 4CN6A 3CPRA 2XIIA 5HR7A 1PWLA 2YX0A 2FMOA 3GTIA 8XIAA 3NQFA 2GGGA 3CIXA 4M19A 3WDJA 2VJXA 4NZ1A 1HJQA 4ATDA 3LGEA 1KBLA 2OOFA 3T0AA 4HNNA 4IF2A 4GO9A 3OZMA 2DVTA 3OOQA 4W5ZA 1EX5A 4Y2WA 4AHQA 1CIUA 4W9TA 3GHRA 4H9ZA 2HJPA 1E6PA 3BOFA 3VDGA 4MPKA 3AIRA 1TMQA 5LKYA 4H9YA 4D6GA 2DIKA 1BSIA 1PKYA 2PWVA 2FKPA 2PDFA 3VE9A 2XGZA 3OLGA 1BG4A 2ZUMA 1SO4A 1TMLA 3DXIA 5AOUA 4Q8QA 1KCKA 1MEWA 1KM4A 3GSMA 4PL2A 6TIMA 4MHBA 4OWGA 3ME3A 1KXHA 2PWUA 3D47A 1OC7A 2VEPA 1E6NA 1DJQA 1OFQA 4KWOA 2O4MA 2WHLA 3OLDA 4IP4A 3RPMA 3M0KA 4NRSA 2ZXDA 4MF4A 2YB4A 3GFZA 3TR9A 4XAFA 5HULA 6ALDA 3FLUA 2BY3A 2WBGA 4GGHA 1HJUA 4FP1A 3TR2A 4KRTA 2VM8A 1B9ZA 1MVYA 4RL3A 1QK0A 2WVVB 5I3JA 4TR9A 3AJ7A 4MM1A 2V63A 2D0HA 3RAOA 3HPZA 1LYXA 1FHUA 2OLAA 3TJLA 2QCMA 3WDHA 3HV9A 3UXDA 1NF0A 3N2MA 5H8UA 1TPUA 1BWLA 4I7VA 3WKZA 4OBTA 4XKYA 3EWDA 2WNNA 2XN2A 3FV9A 2ALDA 2X30A 3EBVA 4LXFA 4DM2A 1E9ZB 1P0KA 4NASA 1XDLA 4C6NA 2WMGA 1BGGA 5FF2A 4F0HA 2Q02A 3T08A 4OE7A 4Q8WA 1VGAA 2QS8A 2PC8A 4DF0A 4E4PA 4IP5A 1LWIA 1QHZA 3JZEA 4XBJA 4J3XA 2WM0A 3K4WA 4XAGA 3B8IA 1YLVA 3ECQA 1E9IA 3BG5A 3TW6A 7PTDA 1VF8A 1GHRA 2GDVA 4A4AA 3D6NA 3UWUA 3M7SA 3VKDA 3LLDA 2Y5JA 1VFOA 2RH9A 3F4CA 4I7UA 3OZPA 4CD5A 4GC4A 5GNYA 3GNPA 5FJIA 1BSLA 4QTGA 4A8IA 2NQZA 4HN8A 4GXWA 5I06A 3OLIA 2V81A 2CZ5A 4IMFA 1LF1A 4QISA 3S5OA 3VABA 3AMDA 4ASTA 2ODOA 3WFZA 2OGYA 4C65A 3T55A 1B2YA 3M5ZA 1W1YA 8A3HA 3RMJA 1KCZA 4O53A 3GXMA 3WF3A 1Z69A 4JCLA 4UIOA 2O9RA 5F2GA 3RM9A 1J0IA 5GNZA 1BD0A 3AC0A 1KWGA 1VYPX 3CZEA 3BZGA 2J9ZA 1RP9A 1GJWA 1KCLA 4YU1A 1TELA 2PLCA 5CLTA 3FDKA 3G8RA 1VFHA 4RE0A 1VEPA 2YA1A 2V2HA 4NJJA 5HPCA 4LCSA 4KKXA 1BWVA 1EC8A 4W8LA 1ONEA 3FYPA 3W86A 4O1AA 4QS6A 1Y5XA 2WXDM 1R3VA 5F2MA 4BJHA 3RX2A 2BDQA 3TX9A 3T09A 5A8QA 3HGJA 5G2HA 3SCPA 2V3EA 4MY9A 5HWNA 5JUVA 2E9BA 2D0FA 5F1VA 4DYJA 3JW7A 2J47A 4A3UA 4CGTA 1VJIA 4ZXOA 3UVAA 3W1TA 2CZEA 5DY3A 4PMVA 1EF3A 3W7EA 3W7HA 1NFGA 5U7SA 3MZNA 3CL7A 3BSGA 1XHGA 1LRTA 2DW7A 4S3BA 1XLLA 2XG9A 4UTLA 4NL1A 1V03A 4OHQA 3ZLGA 3NQBA 1RP8A 5DBUA 3KVMA 1ITQA 3OYXA 1TCMA 4I7WA 2QCLA 3RFAA 5HQEA 4LF2A 4FLRA 5D33A 4ORMA 1X98A 3E0LA 3N15A 3TSMA 3KRUA 1C90A 3BLIA 3O07A 4F0KA 2NVAA 3KOXA 4A3HA 1VCFA 2D2HA 2RKXA 4MWAD 3N19B 2Z6JA 4KCUA 2Z2BA 5E6YA 3TWBA 1JUKA 2YIHA 2PCEA 1PXGA 3M0JA 3BW4A 3EOEA 1ISXA 3KBWA 3IJQA 3MQTA 1YMYA 1I0DA 1PE1A 2D69A 4P7NA 3ERPA 1PJ9A 5FJOA 5CXPA 3TOPA 2LLEA 3SUWA 4JTDA 3MSGA 3NPWA 1OFAA 5CJ5A 2OLSA 2VUNA 1S38A 1W32A 4K8HA 3ONBA 5CGTA 3F5LA 1T0OA 3W6MA 1YPFA 4B5TA 2IQ0A 4GNVA 5FEZA 5GJPA 2FPVA 3W29A 1B3OA 3WF2A 4RXGA 4LPCA 2PDJA 4KWSA 3MI2A 3CUXA 3RO8A 3GUWA 1ODUA 3A3WA 1W54A 1TRDA 2XVLA 1GOXA 1TV5A 1E5JA 1HKJA 4FLOA 1LQ0A 4CNSA 3C56A 4XSMA 2CBIA 2C14A 3C61A 3VNMA 3MI3A 1OT1A 3BMXA 2P1FA 4EP8C 2CITA 4NRRA 2RGMA 1XIFA 1XYAA 3LCHA 3T81A 5LIYX 1J79A 4FXJA 4XAZA 4D1JA 4DLMA 1E1CB 5LA0A 3REQB 2Z00A 4HD5A 1YXYA 2E77A 2CC0A 2VDIA 3LEPA 3C6CA 2CERA 4GLEA 4LB3A 1GVRA 1CECA 2XTKA 2IKHA 3D5HA 1QNPA 2FZ8A 3L67A 1I1XA 2G3JA 2ZX5A 4R53A 3WQOA 1IEXA 2I5IA 3NYDA 1QFEA 5DCDA 1FH7A 4RE3A 4Z2HA 4W7VA 4YCPA 4NT0A 4U5KA 4DBDA 3N17A 1EB3A 2ZZ1A 1GONA 4LUTB 3H8AA 1B90A 5AC6A 2H8ZA 3NQVA 3W7NA 2KZHA 5A6SA 1B3WA 2VZUA 3FJ4A 4ZO8A 1FVPA 1MW2A 2R1KA 3NEVA 4ZO9A 4HHMA 4O19A 1KTNA 4AVOA 3BGJA 4WVXA 4KRZA 3UWQA 3FYYA 2B7OA 3SJNA 4PUJA 2FHBA 4S23A 3QHNA 1XCFA 3VTRA 3BCFA 4G1NA 3D3FA 1J8VA 1XBXA 1J01A 1WBJA 3UESA 3UNDA 2VELA 2I57A 3I3BA 3HIJA 3WBEA 3OVGA 5A8OA 4XVDA 1FP9A 4Y9MA 5CZSA 2XVNA 3W7GA 3W82A 1EBHA 2Z1SA 2WQPA 3I65A 1RQBA 3MUZ1 4DI8A 4TVDA 1MRQA 3CEUA 4OBRA 1A3HA 3A23A 1XLIA 4JTFA 2RJHA 4OVXA 4AIBA 1ZQ5A 2I5GA 3UWVA 1IIHA 2HV5A 4RR4A 4QQUA 4UTFA 5BXRA 2BVYA 3GXDA 1OB0A 1E6XM 2DSUA 3B0UX 1TFVA 2Y7EA 3GDBA 3RRAA 4OQVA 2HVNA 1KFCA 3RDKA 1A5KC 3MYPA 3F2DA 2PDNA 5DF0A 3DG3A 1O66A 2GUUA 1KQYA 3DGBA 3M07A 3MHGA 3LXAA 1G0CA 4GYJA 1XYCA 2PWEA 1KM0A 2OXNA 3H2OA 1K7FA 2NW0A 2A5HA 4E8GA 4H7ZA 1XIBA 1GK8A 3KTXA 1X1NA 3VMNA 1EBGA 1OZMA 3PJWA 1QNOA 5CZ0A 8TIMA 2OSWA 1OCBA 2BFGA 1RD6A 4HTBA 4PMJA 3UT0A 4DO6A 4G7EA 1OF6A 5CLWA 1OIMA 2HTMA 4JIRA 3UWWA 4S2CA 4GY1A 5D04C 1Z32X 1LUCB 1Y0EA 3M16A 2WZEA 5BXSA 4H19A 3AXHA 5A95A 4HA0A 3T9PA 1JULA 4AF0B 3HU7A 3HGRA 1B5TA 4HYRA 2CLOA 2PD9A 4RV8A 4DWDA 2QULA 3PZUA 4B15A 2WANA 2HMCA 1WCGA 3TVAA 4F9DA 1JDCA 3UP8A 4A22A 1LJYA 1E6ZA 2PDIA 1XRVA 2WHKA 4RW5A 2WMHA 4JIIX 4HA4A 1OFEA 3NOYA 3IRSA 2WSRA 3KL0A 3A4AA 2ZWYA 2XH7A 1H4PA 3AXKA 4S3DA 3LCLA 1WZAA 3A3XA 3ELFA 1R87A 1JDFA 2BOFX 3TTQA 3GHUA 4ML9A 2D3LA 2NQ5A 4QJ5B 2D2JA 4MB1A 2CKRA 1AUSL 3SCSA 3P67A 2V0TA 1OWQA 4ACZB 3PFMA 3MKVA 2BB0A 2OODA 4NZJA 3SW6A 4HB7A 3A4XA 1UUOA 2FQIA 4BZYA 3JR2A 3GNDA 2GSHA 3S2JA 2Y8VA 3VIGA 3NPVA 3ABZA 1XRTA 4UQBA 1HIZA 4HMCA 3R43A 2FTWA 3W7JA 3FSUA 1HO4A 3C2FA 3PTMA 3DFTA 5D2XA 3DDMA 4QR6A 1R9YA 1IE7C 3K4DA 3L0KA 5CC7A 1R2SA 2IXVA 3NSNA 1H1NA 4FALA 3ZJ8A 1EGVA 4DIAA 5AC7A 2YXOA 3L4YA 3MMUA 3AYRA 4RZ5A 3UJSA 2A3BA 3W23A 2RFGA 1LT7A 2ZC1A 2ISVA 3NYZA 1Q6FA 4CEUC 4S3GA 2JQXA 2OTDA 4M7SA 4DN1A 3IV3A 5B80A 4GKTA 1FY6A 5BXPA 3V1HA 1A47A 2CHRA 4QXIA 2R6OA 3G8EA 4O8RA 1T6MA 5LYRA 1FCBA 4JDBA 4H6QA 3HQNA 3GKAA 4N02A 2QNEA 4W4QA 3PFRA 3SEPA 3U9IA 3UWYA 3VIFA 1J5SA 1TWDA 5A2CA 3E2VA 1YQ2A 3N4EA 4BF7A 2EJ1A 1T41A 3GUGA 4GIAA 4M82A 3VILA 1ONWA 3I7QA 3HMJG 4PYSA 2D23A 4JZ5A 3VOIA 1W3HA 4L9XA 3LA4A 5FEXA 2Y88A 2WZHA 2R14A 2EG7A 5CPMA 5AC5A 1RVGA 2FFCA 2Z24A 1IQ8A 4V1XA 4DRSA 1NQ6A 2GK1B 4F40A 1G1YA 1EL3A 1EJWC 5LZLA 6REQB 3KUMA 4FS9A 4HK5A 4HQVA 3P6LA 2A4AA 3VGEA 2XH4A 5FJPA 4GI8A 5EU9A 3WCZA 2Y6ZA 3B4YA 4KWUA 1SZRA 3OA5A 3O6CA 1FWSA 2HEJA 4GABA 5IM51 2Y8KA 1W3NA 1VZWA 1A0DA 3DGRA 3WH7A 5LGZA 3VU2A 1MW1A 2ZTJA 4WKAA 2EPOA 1QCWA 1D7FA 3KZPA 1DOSA 1R6WA 2BY2A 1IT7A 3OZOA 1KFLA 3M46A 3CGTA 2BVWA 1JEZA 3AOFA 2VI0A 3CUGA 3W7CA 3EWYA 3AU2A 3W2MA 2O9TA 3TP4A 3MSDA 1D2KA 2ZX9A 1UD3A 4J3UA 2B0MA 1ZP3A 1W1B1 4DNHA 4PMYA 1FBAA 1ONXA 3O15A 1JJKA 1OX5A 4F2BA 1DTNA 3WJSA 1UP0A 4S1FA 3GQYA 1Z44A 2EXOA 3PF3A 5A6MA 3P5ZA 2AQWA 3KWSA 3U4AA 3TYDA 4BI6A 3DFQA 1ZUAX 1UBSA 2ONEA 1NP0A 3LMYA 4GUHA 2HE8A 5BMXA 4AIOA 2WSKA 3ZSTA 6PTDA 1SFTA 1XUZA 3GNRA 3ATZA 1C29A 2V3GA 5DCBA 2A21A 4ILSA 1CWYA 5GJNA 1OFBA 2OQYA 1JVNA 3GAKA 2QDEA 2YYTA 3C2RA 3A21A 3UR2A 3U4FA 1VD6A 5AHFA 2J6VA 3RXZA 1REQB 3I6EA 2AMXA 2WCSA 3SCOA 4EOUA 3E0FA 3ZZ1A 1NQKA 3AU6A 1B4EA 5REQB 1E5NA 3ATYA 2ZX7A 3IIZA 1PVNA 1XH1A 2ON3A 3BE7A 1CBGA 4HK7A 3FXGA 1DHKA 2QVHA 3TE9A 1JPHA 3OVQA 2PODA 2JF7A 3AS0A 4CQAA 2PGRA 4JN6A 1XPGA 2VRQA 3A9IA 4EAMA 4JQAA 1YHTA 1PWMA 4AU0A 4UFLA 1ZS2A 4IJRA 3OGVA 4B4HA 1NWTA 4CD8A 4WGXA 3CT2A 2GVEA 3NVTA 4Z0SA 4CU7A 2WC4A 3W2JA 5AHLA 4A8LA 1FQ0A 4AXNA 1SGJA 1MXGA 3AXXA 3EA1A 3EDEA 4JYDA 4HSOA 1XIMA 4K7VA 4UWMA 5HR6A 1XXXA 2GOKA 3SIMA 4E2VA 3CLMA 1QWGA 2JEQA 3I3EA 1YDVA 1K9FA 3LPPA 4H7CA 3VD5A 2DZSA 5HATA 4EAYA 2OEMA 4PE8A 3VD9A 1AMKA 4JQ2A 3DG6A 1SMAA 2WC7A 4FPSA 4H9XA 2WCGA 1DJGA 3EDDA 2Z29A 5A8NA 3CB8A 2WPBA 1DXEA 3BICA 5LNRA 1YDYA 4L6HA 3WLJA 4QCEA 4ZR8A 5EMKA 1GTEA 3KLLA 1W2VA 3CYJA 3WLLA 1SZFA 1JCMP 3CIVA 3DAQA 1EO5A 2Q8LA 4ML4A 3LOTA 2GGEA 2W92A 4MZ1A 2XFWA 4MLJA 3FVDA 2YDRA 2CIPA 1JFHA 1H0GA 1U30A 3CQ0A 4OBSA 1P7TB 4PRWA 3JUGA 3PJUA 4QE1A 1UWRA 1WPCA 3HQPA 5DEZA 1JF6A 3TA9A 2DEPA 3ARVA 2PBGA 2ZYFA 5LIUX 1F5ZA 2PTWA 4AVFA 3L4XA 3G0SA 4FIQA 4WY0F 3O6AA 3O0KA 3RX3A 3URBA 3IIXA 4LS2A 2E6YA 1AH3A 3TC3A 3QV9A 1LL4A 4GMEA 1KBBA 3GAYA 1JPDX 1TTIA 2E40A 1MQRA 5C70A 3G5EA 3PSWA 3P62A 4MFDA 1H5VA 2XWDA 4I8DA 4R88A 4KERA 4V28A 3DKLA 1PCWA 3CQHA 4B5NA 3SCUA 3WLSA 3DFYA 3W01A 2PP0A 1AW2A 1UHVA 4YVPA 1JCLA 3ZM8A 3WENA 3WH5A 1TPWA 4YYCA 3ZJ6A 4CD4A 2YL6A 1YE4A 1BF2A 5I3KA 2ACSA 3TJXA 1X1OA 3IACA 3MSYA 3WQEA 2R82A 1BTMA 1IZKA 1WKEA 4QDWA 3KX6A 4Y90A 3O6YX 1H41A 1J4EA 3E02A 2RJGA 3C2EA 3HQ1A 4I9AA 3L0GA 2Y7GA 3AWOA 3P0XA 4YMZA 1EDTA 1CXEA 4BQ4A 1YRRA 4E0CA 2CLLA 3BW2A 3C8NA 4AZ6A 3NQMA 2PRMA 2YCLA 1QT1A 4XUGA 2ZXQA 2QEZA 1S5MA 3PN8A 1M5WA 1DL3A 3ZR5A 2YA0A 1PYMA 1DORA 1UIOA 4A8NA 1KCXA 3OJGA 3VFLA 4HU0A 1ZAHA 1RAKA 1LP6A 3A47A 4P7RA 3FHQA 4JFTA 5KSWA 1Y5VA 1SW3A 1TX2A 2A7PA 3AYSA 2XN0A 1DIOA 4PBGA 4MYXA 4B9YA 1TA3B 2WPGA 2WVUA 4O15A 1V3KA 3W37A 3TYBA 2ZOXA 5CAHA 1H49A 4DF2A 1LBLA 4CNPA 3QEZA 4TVCA 2A3HA 4JY9A 1TPEA 3MV11 3TLLA 3AYTA 1FUYA 4UCFA 2EAWA 4ZB5A 3S5ZA 2J13A 2GGIA 2UZ9A 3MHUA 4LC6A 3TDFA 3M7WA 5TAOA 3N14A 4IMGA 4BFAA 3LCXA 1QR7A 1P6CA 3TW7A 1FWAC 5HJYA 2B31A 3AHTA 4ZMGA 4NJGA 4PUKA 3EA2A 4AZ7A 1OABA 3KBMA 5CKSA 3BCDA 5FKYA 1JG9A 3P82A 3IGXA 5C9UA 4PUMA 2WMIA 1QRQA 4NYUA 4U4MA 3NQ7A 5CPQA 1HJXA 3QY8A 3VUPA 4DEFA 5FD0A 4AX6A 1J0JA 3QHOA 2ZUVA 1WXYA 4O28A 3QTPA 4P61A 4RUBA 2Y2WA 3WBYA 5K9CA 3DN5A 4UOQA 1U5JA 4AIEA 3W72A 2HWGA 2WLYA 5CCZA 2UY5A 1Q4NX 5ECVA 3PM6A 1P6WA 1RK6A 4X60A 5HNNA 3DFOA 1SZGA 4M6UA 4GVIA 4FSAA 4WY0A 2CBUA 1XQKA 2AAAA 1QO5A 2DVXA 3BOXA 2X42A 2ZRUA 4H9MA 2HQAA 2J79A 3UWEA 4TO8A 4EPDC 2X1TA 4HZ7A 4KFPA 1IGSA 4QIUA 2IKJA 1HF6A 3BLDA 3KOYA 3PAJA 4HN4A 4CQCA 1NDWA 1SYTA 4XO7A 1GJUA 2WKLA 1VBRA 5I77A 1W9BM 3B8DA 3ZMRA 2OMAA 3AIWA 3VNKA 1CXIA 2X1SA 3CZ8A 5BYWA 1TV4A 4FA3A 3AMCA 2GUBA 4MGGA 3N4AA 2PWDA 1W1PA 3WFLA 3R12A 5A69A 4C91A 1WYIA 2BV9A 4AZ5A 4DAIA 2GJPA 1RJRA 1QW8A 2IPFA 3VIOA 1NWRA 4GQQA 1QPRA 4RE4A 4PUNA 2DY3A 1FOBA 2R1MA 4XZBA 2J75A 3FIGA 4PB5A 1EOKA 4RXFA 4BQ3A 1ICSA 4FF5A 1A5CA 1XRSA 4IGNA 1JQVA 3HG3A 1SO3A 3QH2A 1PIFA 3OGRA 4I5XA 4ZODA 4A2RA 4O57A 3CUHA 4D8LA 2ZQ0A 2F2KA 2PLMA 4JFWA 3LZ3A 4AYSA 2CLMA 2TAAA 1JL8A 3S46A 1TWWA 1US2A 1VFFA 3CH0A 4C6MA 3S0CA 2AGTA 2PF0A 5M17A 3C0LA 3GIYA 4R85A 2ZRYA 4IICA 1OYBA 3PAOA 3AMLA 4YLWA 4MSSA 1WO2A 3CXOA 4RJEA 3SRKA 4Z2IA 2E6FA 2IPJA 5CZTA 5FA5A 1EJXC 3CB3A 1E4IA 4AZCA 2VHLA 4DHGA 1CLXA 4C1LA 5GPRA 1L6SA 1G4EA 3M9YA 4JNMA 3UA4A 3U2ZA 3N18A 1OSEA 4B5VA 1GT8A 1XIGA 1NVMA 1A5OC 4ZSTA 2XISA 1O68A 4QS5A 5D02A 3CM4A 4F4RA 3BG3A 3SR7A 1GVEA 3NFUA 3HGSA 4IGHA 5HMFA 3NTYA 2VX6A 1Q6RA 2C15A 4Y9PA 3DENA 4H9VA 1HKWA 1HG3A 4AD1A 3EPMA 4O4WA 3W75A 3LCGA 3HB9A 4OUIA 4ZE4A 4LYPA 3MC5A 1R9XA 2I1OA 2ZCGA 3OZYA 1F07A 2B7PA 4CN4A 2NXHA 5SWUA 4UFMA 4WF7A 4N0RA 3TW9A 3OLEA 1ZBKA 1TJRA 4N42A 1DHPA 1TWSA 2W6RA 3TNOA 4H2CA 1DJHA 4WQ6A 3GTHA 3P80A 4BHYA 3E0IA 5DFAA 1FWCC 3W74A 1TE6A 3CZKA 1FHLA 3GE7A 4PRTA 1VFUA 3FEMA 4MIMA 3W53A 2ZUNA 2WZIA 1FWIC 2NLIA 4J35A 4WDTA 3U2EA 1TPVA 2BVDA 4I5UA 3LUTA 1F6YA 4XG1A 4W86A 4Q6JA 5IHRA 4HSHA 3ZR4A 4FX7A 3GU1A 1KM3A 1EUNA 3MS8A 3VGDA 1U5HA 5FCZA 3IUDA 4JS3A 2RAGA 3DOPA 7REQA 3RLGA 1UR9A 2FJKA 2CZFA 1W9XA 4GG9A 2I9EA 4TX9A 3T78A 1IXPA 3WL1A 1R3YA 4E8CA 3GNOA 3H23A 2BSLA 2WHMA 1V4YA 4CKQA 1BKSA 2YCEA 2CU0A 3BDKA 4B5SA 1CB7B 2PRHA 4JIPA 4Z42C 3KOFA 4CCCA 2Q6ZA 3GC2A 3VDAA 3SBFA 3G0XA 3QFEA 1HKVA 4DPPA 3GDTA 1KO0A 2IQTA 2PLJA 1A5SA 3WQFA 4F2UA 4FB7A 4FNUA 3A5FA 4HPGA 4PH6A 1EPXA 1M01A 2WJFA 3E6EA 3FAXA 3THCA 4Z2JA 1HKMA 2XH0A 4X22A 3LI0A 5CAKA 4PMXA 1FX6A 1MZRA 1M7PA 3ZLFA 2AMGA 4PUEA 3NM1A 4FF7A 1C91A 1DWIM 1B3VA 2DSZA 3P5YA 3WD4A 2WK2A 3GK0A 5EYWA 1OD8A 3LHYA 1G4TA 3IVSA 2Z28A 4Q7BA 4O0ZA 1G7VA 1OM0A 3ISIX 2IXUA 1F4AA 3TXZA 1W5OA 3W0KA 2R9RA 3HO8A 1AW1A 1O95A 3GVWA 1W5QA 1HO1A 1JD7A 2ZA2A 4NZ5A 1IEWA 4UOZA 2C7FA 3H2AA 2GWNA 4BI5A 4DWSA 4EF8A 4UQ9A 4JTTA 3FDGA 4C1NB 1J93A 4GY7A 1E9YB 4D1IA 2G4JA 4ZQOA 1L6WA 3CHVA 3GWQA 2J8FA 1B0IA 1HP4A 2CHOA 4ZB2A 3ZYZA 3S1WA 1EDGA 3B05A 1EJUC 1WKYA 3T4WA 1W6TA 3NZ1A 4NX0A 3LRMA 3EX4A 4JN7A 2V5JA 2CWNA 2DUZA 4M80A 1PTAA 3PZOA 4QSHA 2CXGA 3IJLA 4IG2B 1IT0A 4DVOA 2XM2A 4KWWA 1LT8A 4A8RA 5D9PA 1RCQA 5C71A 1CCWB 3L21A 1XJBA 1J0ZA 4G8TA 5FAGA 5HINA 2ACQA 3H55A 1ZBVA 3O8AA 5AVHA 1F8MA 1U5VA 2O92A 1OBAA 1J10A 4KPLA 1VFMA 3ITXA 4GCAA 1QHOA 4KIRA 1J2WA 2ZBTA 1GPWA 1UUMA 1LWHA 2C6QA 1K3UA 9XIMA 1L8PA 1RZMA 3OVRA 4OIFA 4L9ZA 4Q4MA 3WLKX 4UFHA 2J66A 1XBYA 2X8RA 3G1RA 3SM0A 2V38A 3WH9A 1H7NA 2XM1A 2BXVA 5I78A 5IDZA 3FKRA 1B9BA 1GJPA 4FIRA 3TH6A 5D9OA 3QQ0A 1LLWA 4F0SA 2F38A 2E5BA 4V15A 3DFHA 4HNCA 3DEQA 1Q2SA 2PDMA 4MJ2A 1MQPA 1AQFA 2ZWZA 2BNJA 1KKRA 3G6MA 3VNLA 4HHPA 5HBFA 1POKA 2X40A 1FH9A 5GVJA 4CCZA 4K38A 4UR8A 3A64A 3WLHA 2Z26A 1YW1A 3NQEA 3W70A 3AI0A 5C0QA 4PMOA 3WO8A 1BGAA 2WZMA 3GNXA 1T5AA 2EPLX 4RPPA 2JGQA 2PDYA 3PTQA 3QGKC 4N7QA 4LRTA 3H7VA 3F03K 1JUEA 3P74A 1W3LA 2J27A 3WQGA 1GYNA 1P0DA 5C5YA 3TC6A 7TAAA 3ANYA 3XISA 5D2TA 3U5UA 3NL3A 2WSQA 4NNAA 5EA9A 2J7HA 4QGCA 4LC8A 4X2RA 5A6TC 1IEVA 2VXNA 4U31A 3UBPC 4P7QA 1GVFA 5AZ0A 1OADA 1SJDA 2ZZ7A 1CW2A 1FKXA 1NEYA 4A05A 2H8XA 5AYZA 4XX6A 4D6JA 5DLCA 4I90A 1QOPA 3TK7A 4HPNA 5AHMA 4DUWA 4HU8A 4XTIA 2FHCA 4AC7C 1E43A 4PTMA 2XVKA 2DFAA 2JK2A 3FGCA 4LAKA 5K9DA 3LYEA 4P7OA 4XIAA 3VD4A 5JQ9A 1Q13A 4PFHA 5F7UA 2QDHA 1M1BA 4ATLA 3MANA 4Q8UA 4GJIA 5FF4A 3KBNA 1L8NA 4MPQA 3VCCA 4XQ6A 1YYAA 4WKFA 1CDGA 1KB3A 2FFIA 4XO6A 2WVVA 3LRLA 2D3NA 3IIPA 2DP3A 3LGGA 3FVMA 4LUSB 5LHFA 5E6ZA 3H7RA 5K7JA 2OWCA 3Q65A 4AD4A 2VYOA 3ABRA 3E2RA 5DMLA 1V6UA 3V5CA 2F2HA 3TTOA 1P43A 4GQGA 5H8PA 3KW3A 4DQWA 1XLHA 2F61A 4PB4A 4QX4A 3WDQA 3ARZA 4RNFA 3ONCA 2ZRXA 3WD0A 3KTCA 3IANA 5FJJA 4OTKA 4NJKA 3L4VA 3I4KA 1ELSA 2E1WA 3FJLA 3LTPA 5GQBA 3R7MA 1CX9A 4I9TA 5AYIA 1T96A 4H9UA 1GW1A 4C7DA 4HZMA 1W1VA 4HSNA 3SY8A 4Z1CA 1WXJA 2YLAA 3H6OA 1FCVA 2QGHA 3LTYA 3EA3A 1WKDA 1VR6A 3DHDA 1SSGA 5A2AA 3LCWA 3PUEA 3T6CA 2KX9A 1UROA 2YFOA 1VC4A 5IBXA 2P8BA 1PTGA 2YZ5A 1V7AA 1D3GA 1FWWA 1V08A 4GISA 5LNSA 4DM1A 4O14A 4PA8A 4UTIA 3U7BA 2BGQA 4EWND 5BRPA 1TG7A 1IEQA 4ACYA 3H26A 3KE0A 2J78A 3ZQ9A 3L7RA 1FXQA 4C6IA 1N2VA 3SGGA 2DQXA 1B57A 3I68A 2HVMA 2RDXA 1KNWA 3PC0A 2NSOA 3SURA 4ZZ9A 4ICNA 2ZX8A 4JTCA 4CNTA 2V5KA 1WZLA 1SMDA 4HNOA 4TV6A 1UMLA 4JR5A 1MFUA 5J5DA 5A94A 4RNHA 2PDHA 2E9MA 1A3XA 1EJSC 3PBGA 4ERAA 1M7OA 2PDLA 3MBDA 1H50A 4V27A 1EA9C 3FXYA 1S2TA 1SW7A 4QROA 1VHNA 2XN1A 2FDMA 2VX4A 5FJUA 3J7HA 4INFA 2P88A 1UKTA 4IPNB 1KV8A 1MW3A 1CGVA 4JKKA 4O52A 1EZWA 4M29A 3ARPA 3BWWA 4H41A 1O60A 2RGLA 2YBTA 2TRSA 3TTSA 1VBGA 3DHUA 3UR8A 3U8GA 1EOMA 1KA9F 5AC8A 2WV8A 4NU7A 3USZA 2ISDA 4GI4A 1EJVC 1L2QA 4MLRA 3WQPA 3WDRA 2Q3RA 4WXYA 4PN2A 1JPIA 1O5XA 3KHJA 4QBXA 2GSEA 3MWAA 3BJTA 4UZSA 3CIWA 4DWSD 1E56A 4GFIA 4U3CA 1DIDA 3AO0A 1E0VA 1WXZA 4M1BA 1SJCA 1MQQA 2YCKX 3PZVA 2J6XA 3NPUA 4H6EA 1BF6A 3C2OA 5D03A 3K13A 3F5JA 1U22A 1K4HA 2V3DA 1QTWA 4QDMA 2BHZA 1ITUA 2PU0A 3W7KA 3A4WA 4U3AA 2BG5A 1NJJA 3W9ZA 3UXAA 4R7JA 5A3HA 1ZAIA 4ROPA 4W88A 1F3EA 4UQEA 5LNVA 4R7OA 2EPMX 3VCNA 3I4EA 1GYLA 5GNXA 1RBAA 5D37A 2A3AA 1RALA 1ME7A 1QPNA 1UW9A 1W5PA 1R5YA 1RHCA 4YPJA 4KEUA 2WVTA 3S1VA 4QJ4B 3LCFA 1RD5A 4GUJA 3W2NA 2DQWA 1H7OA 2WWCA 1XGDA 4Y7EA 3ZFHA 1PKNA 3PBYA 3LRKA 2NQ9A 3WK0A 3EOLA 1Z6KA 1E1CA 2XU2A 1JDEA 3REQA 4YTRA 1SUXA 2OQLA 3WQDA 3FN9A 2ZTKA 1Z8AA 2HSAA 1UR0A 3GDLA 5CSYA 2R24A 1JZ4A 2PDXA 4PCPA 2C13A 1DJIA 4BKNA 2G3IA 3QOKA 3FS2A 3S1UA 2YFNA 3CTTA 4BS0A 1OFRA 1W8GA 1EJTC 4XWUA 4NIRA 4HCLA 2W5FA 2VEFA 3IPWA 2YOCA 1RVKA 4OKDA 4AY7A 4AUBA 5AB3A 3G77A 4H00A 2CLHA 3PWAA 3IARA 4J1OA 3KCOA 3EWBX 4LUTA 3P60A 1QI4A 4MAVA 5A6AA 5D2VA 4KCTA 2FVMA 1L6FA 2XJ7A 4EX4A 3B40A 2PDBA 3M6YA 1HGYA 4DXVA 4UFIA 3MKKA 1E3XA 2Q3OA 2Z27A 2YJQA 4LYKA 4MY8A 4TU1A 1LL7A 1H3GA 4JL1A 3EPNA 1OYAA 4S39A 1TWIA 5C8BB 4UZUA 4H04A 3ARUA 4GQ0A 1LM1A 2PUZA 2PDQA 3NNTA 2H6RA 1EO7A 2A1YA 3MA8A 3ITCA 4JHZA 5HAOA 3THQA 1MUMA 1XX1A 1XDJA 1E15A 3W02A 3P7YA 1NIUA 2ISSA 3DBNA 3H53A 2H90A 2CZDA 3TWAA 3NPXA 4F48A 4LBRA 4C1KA 1U2YA 4IPPA 4IPJA 4MDOA 1SZEA 3T0CA 3ARYA 4LALA 4GX8A 1GKQA 5CSRA 1V8EA 1YNPA 3K1GA 3WELA 5DT7A 2DW6A 4N4PA 3QW3A 3AZRA 1TB3A 4HA3A 3N12A 4FNQA 4RCXA 1OF8A 1RJPA 2ZRZA 2JBMA 4WXZA 1THFD 5M03A 4S3FA 3T0BA 2F84A 4CD6A 3FA4A 4JYFA 2JFEX 1JFXA 4DJEC 3VXGA 3VOCA 3LTSA 4JCMA 2FTPA 1R3WA 4YYFA 4LEQA 4L1GA 3SECA 3ZSSA 5M1TA 2G96A 3JRKA 3IUIA 4ZQPA 3S9ZA 4LYRA 2C1GA 3RM4A 3ANUA 2WAGA 4CU8A 2PFHA 2NQJA 2VOTA 4WK9A 4D6CA 4MNMA 2QCEA 5A5WA 4ZA0A 2C18A 3T40A 4E6MA 4FOKA 2DV0A 3SGZA 1WOBA 2V82A 4U28A 3ZS4A 4D6HA 1SFLA 4UOJA 1NOWA 2PGWA 1YDNA 1F05A 2QJIA 4GH1A 3TMQA 1DWAM 3SN1A 1J0YA 3VGFA 4LVDA 4JQ4A 1LUCA 1V6TA 1A5LC 2D2OA 2E25A 1G7UA 1WUFA 3GIPA 3QR1A 1WDDA 4UFKA 4AF0A 2XVPA 3S8HA 4WJEA 4M3PA 1DTUA 4IMAA 1SJAA 4KGJA 3CL6A 1G4PA 3IVUA 1XIDA 3B0XA 4ZENA 3OBEA 4LUIA 1L0PA 5F4WA 3AIUA 4C6EA 2P10A 1UZDA 4QM1A 2C1IA 2ZZ4A 2Y24A 2AAMA 5ABFA 4C60A 2X0HA 3IV8A 2QAPA 2EBNA 3L12A 1AZ2A 2O55A 1K70A 2ATMA 4P8XA 4B5UA 3CV2A 3BJSA 4HHHA 3WQVA 1X38A 3GFYA 2VURA 1L2UA 1QNQA 3EMZA 3W81A 4Q4KA 1XGEA 1XSJA 3SRHA 5LNUA 3NQCA 4JKLA 5I2UA 1I2PA 4ADUA 3LM7A 5H2ZA 2VENA 3LPFA 3VAVA 4DYEA 3TUUA 4ACZA 2VR5A 3PZGA 3BMWA 3KDNA 3L2IA 2VQUA 3JU2A 3Q4DA 3N6QA 3W26A 1LLOA 4ZO6A 1F7BA 4UTMA 3IIVA 3SZ8A 4AX7A 3NA8A 2HK1A 4OJYA 1TR9A 3FFSA 2JKAA 1ADSA 1LQAA 2WMKA 3VKCA 1ZJBA 1XLJA 1I6NA 2INFA 3GTXA 1F76A 2WNZA 7A3HA 4MY1A 4H8VA 3RJYA 1JIBA 4JTUA 3G2GA 1V02E 3CU2A 4JN8A 2OEKA 3PVFA 4DJFC 2VOMA 1D8CA 2EKGA 2Z2UA 4FHAA 1US0A 1FWGC 1HL2A 1GZJA 1BXCA 3BLPX 1ZCOA 2E09A 5DQPA 1ICPA 5EL1A 1VBHA 4M56A 4M6QA 3FCPA 5E0CA 2BS9A 1VLIA 1V93A 4D8ZA 3A9BA 5CPLA 3AS3A 1EEPA 1F3TA 3M64A 3ARSA 4HNVA 2ZX6A 2EO7A 3VZZA 5DX7A 1M41A 4YJ5A 2OX4A 5D30A 1E1EA 1BYCA 1YIXA 4S3EA 1BYDA 5B7ZA 1K6WA 2ZA3A 3TNBA 2VD9A 1MNZA 1DE5A 1Q7MA 2TYSA 3BTNA 1HJWA 4MYAA 5D38A 4CU6A 3SUVA 3WLMA 3VIIA 2WJDA 4EKJA 4A29A 1ZFJA 4L4PA 3QJAA 1NF7A 4KS0A 3QLLA 2QPUA 1EC9A 3MCNA 3QPEA 2FB3A 2DIEA 1CYGA 1BFNA 4GE8A 1XYBA 3NL2A 2VC6A 3DC0A 4FX6M 4AH7A 2O7SA 5A8GA 4DXXA 1XLGA 2ISFA 3WQ6A 2GK1A 3ID7A 9RUBA 3CPUA 1ISZA 2FH6A 6REQA 5CGQA 4FX8A 3HOJA 3BL3A 1P0BA 5AY7A 4EXQA 4NXSA 4WDXA 2GQ8A 4D8AA 4KF1A 2CWXA 5KMYA 3GVGA 3SI9A 4UMCA 1UKSA 2O9PA 3ZOAA 4OGZA 1XQLA 1I60A 4YTUA 4HJWA 3QW4B 4R9OA 2PP1A 1AD4A 3S5NA 1IWAA 3MP4A 5KTLA 4BWLA 3ES8A 3ARXA 2W0UA 5E93A 3R2GA 5LA1A 4XD3A 4DNMA 3TEVA 2WM1A 1UWIA 4O0QA 4HPJA 1MDRA 1SZNA 3EX1A 1UASA 4CVWA 3BLFA 3DYMA 2IS7A 3W1RA 4NILA 3VX0A 4C6LA 3GS6A 5BROA 1WB0A 1J11A 1KR1A 3MDUA 4IJBA 2PGEA 2ICSA 4WIWA 4LVBA 2F6XA 4GVGA 5J5RA 3F4VA 4J3VA 1UWTA 5D09A 2VCAA 3W76A 3B97A 4H6KA 1UG6A 4LV4A 4RPQA 4PR4A 4DAFA 3S5SA 3B04A 1XWYA 2YZRA 2C8NA 1FWBC 3EKLA 3G1SA 1KM6A 5CG7A 4PTWA 4PTNA 3UZJA 2W91A 4GNKB 5ABEA 1DIKA 4JIHA 3R8HA 1I2OA 4G56A 2J7DA 4QCFA 4FI4A 2ZE3A 4BQ5A 5I3HA 4GFSA 1YKWA 2GGHA 4JPGA 3FNDA 1KGXA 4L6DA 1PUDA 3LBMA 3VI2A 2GQ9A 4NJHA 1XCXA 3CPGA 2EF9A 4PODA 2E9LA 3G1XA 3NL6A 4OOZA 3WD2A 2BXYA 2BMBA 1REQA 1KTCA 1TUFA 3OU8A 1S2UA 2OQHA 1AG1O 2W66A 5K3VA 3S2LA 2I14A 3BV7A 1TVLA 3N9KA 5L9FA 5REQA 5CSUA 1QPKA 1LQ2A 1BLIA 3C52A 2PA6A 3WG6A 3H2MA 1X6NA 3L66A 1N82A 1UR3M 3VMOA 4H9TA 4RLIA 2Z6IA 1HL8A 3B8SA 4CNNA 1KFWA 1SO6A 3H2NA 3P81A 3NSXA 3EEGA 4KFNA 1PX8A 1CGTA 1S2AA 3VIPA 1VRDA 2DZWA 2J88A 5CBBA 4KETA 1OZQA 3NEHA 1US3A 1EYEA 4JQ3A 3W71A 4LCQA 1MSSA 4CQDA 1PDZA 3EX2A 1MO0A 1AL8A 5LXEA 3G3DA 3SFKA 2A3EA 4DUOA 4NF7A 1O94A 1K9DA 3UEQA 1FWDC 2G41A 5D8ZA 1MXDA 5ENLA 3W22A 2ABAA 3GM8A 1JD9A 7XIMA 1S2CA 1OCNA 1OJXA 4BI7A 4PBFA 1YXCA 1QXLA 3N2BA 5CPTA 4R34A 3WF4A 1EH9A 2IQDA 2E28A 1GVOA 1H5YA 3AZTA 4JBRA 3EDFA 1A49A 5LGXA 3VVGA 1XH2A 1VKFA 1YDOA 3K8LA 3FGCB 4NI3A 2GJRA 5EY5A 2IMRA 1MNSA 2GVJA 1OCQA 3B4UA 7ENLA 1OK4A 2QT3A 1QI5A 4IH3A 5CGMA 3N3TA 1W3KA 2AOSA 1HP5A 1RSCA 3CC1A 4ZB0A 3V3WA 5HNTA 1CT5A 4RNIA 1TQJA 1NELA 2X1UA 4Q4QA 2YPIA 1BWKA 1E51A 1P7TA 3K4AA 3WNLA 3VKBA 4MB4A 2OSXA 1P0NA 4PFMA 3SCQA 2H3DA 5DT5A 2E0PA 1YX1A 5EBAA 3UVIA 5AHIA 2CESA 3LXCA 1QMLA 2E5CA 1FDJA 1S39A 2VX7A 3SIZA 2DT0A 2NWSA 4AZIA 1L9WA 4DY1A 2UWFA 1GWJA 2O4QA 5CH9A 3W1UA 1O5QA 4MUZA 4Q32A 3AFBA 4IMCA 1PPIA 1LL6A 1YBQB 3UZZA 4I9JA 2OGJA 2POTA 1RUSA 1K77A 2VMFA 3HJZA 4EF9A 2ZDSA 1XGZA 4XD4A 4HGXA 4HJFA 3INPA 3QR3A 2DSVA 3N3MA 4HOWA 1XYLA 1ME9A 3VO0A 3WNKA 4WOQA 1Z48A 2CLFA 3CJPA 1S1RA 1JCNA 1DXFA 1XLAA 3R1ZA 5HQLA 1JZ8A 3QKZA 4ATWA 4FNTA 1IZJA 3TV8A 3RCYA 3WD1A 1ESWA 2FB2A 2NSXA 4UMAA 1ZL1A 1KR0A 3BSHA 3URAA 1DKWA 3N13A 4F2TA 1KW1A 4K7YA 3T7VA 3ABQA 2QKFA 1BXNA 4G6CA 4DJDC 3G24A 1XV8A 5HA7A 3TFCA 1TQXA 3T05A 1PX3A 2V9DA 3T2OA 4IXHA 2E8YA 1DWJM 5C2XA 4QEHA 3ITGA 5F1UA 3GBDA 4IIEA 1XLDA 5PTDA 1C7SA 4L1WA 1GOIA 3MYOA 1X7FA 1H2JA 3ZT7A 2IUZA 3OEXA 1X97A 3S9YA 3AHXA 2DORA 1TJ0A 2V8ZA 3DHPA 1R47A 1UD5A 4ZL1A 3KS6A 4G2DA 2DT1A 2A6LA 3GFXA 2ATSA 4UCGA 3QYQA 5XIMA 5I09A 3S9IA 5I3GA 3AALA 2P0IA 3AZSA 1TA3A 1QJWA 1AMYA 1GORA 2BOGX 1QPQA 4DX3A 2FZBA 1HVXA 3AHYA 1IWPA 3VC6A 1H7XA 3QMTA 4ZTXA 4E5TA 4UXDA 5BRQA 3WUGA 3M6DA 4L61A 4BEQA 3FY1A 1BVZA 3MUXA 1C3FA 3RJXA 5D2WA 1FWJC 1DWHM 1SR9A 2DU2A 3ITYA 3BLOA 1P4CA 3SQSA 1TUXA 1FDYA 2J8GA 3UWZA 2OWWA 5BZAA 2VZVA 1F61A 1HJVA 2PF8A 3H4GA 4P8UA 5EMUA 1SQ7A 1XW8A 2J8TA 2ZKMX 1UB3A 2QHAA 3JVAA 1IT8A 1MI3A 4DZAA 4JL2A 2WC3A 4AIUA 1R3SA 2BLEA 3SO7A 5C9ZA 2Y63A 4QJ1A 1D3CA 2XIOA 2DGAA 2WNWA 3NGFA 3WD3A 3ZJ7A 1LG2A 4L6OA 1ME8A 2SFPA 4D6DA 3MCOA 3SJ3A 4ERIA 1T99A 1XLFA 1W8SA 2AQVA 3B9DA 4GZ7A 4UTWA 3BARA 3R0UA 4PSRA 4UTTA 1ZNNA 2VCBA 3S6TA 4GACA 4LEFA 4W8BA 4QITA 1UD8A 2FZ9A 1JZ2A 4LB4A 3Q2DA 4U33A 1R3RA 4X9SA 4U5IA 3HA1A 1A80A 2Z1XA 3W28A 1AJ0A 5HUOA 2PP3A 5TF0A 4JTSA 2FGZA 3SUUA 4QQ3A 5D8WA 2XZ7A 2FHFA 3OG2A 3B8VA 4HA1A 5CPSA 1KTBA 1DV7A 3QQWA 3L4TA 3UJ2A 2Z2AA 2YW3A 3CUZA 2VDGA 1TMHA 3MW7A 1OFPA 4PCNA 3MPGA 4UQDA 1RQEA 1M03A 3CHDA 2I9UA 4W7WA 1CGXA 3W7LA 4JTHA 4J2MA 4EANA 2E7FA 3PWIA 2OZ8A 4HMNA 1XYMA 4YHGA 2UY4A 3W07A 4MOZA 3RRXA 3T2QA 3N25A 1PV8A 1QW9A 2OU4A 5TIMA 1U1JA 2WLZA 3KZSA 2QJGA 3I6TA 4MB5A 1F8IA 3QM3A 3TROA 2PLKA 3NXFA 2CW6A 2NV1A 3NDZA 4C6KA 3IRDA 3L2LA 1R2TA 2G3FA 1P0EA 4AG0A 2E4TA 2Y5EA 3HZ3A 3EWXA 3NAVA 4Q8OA 2WWDA 4A6GA 4ZSUA 1RCOB 1OCJA 1KM5A 3B8UA 1ML1A 4H83A 2XIQA 1KBJA 3L68A 5I3IA 3PJTA 3DYOA 5A8MA 2DZAA 4PMDA 4IPIA 4GVFA 3O2LA 3E9AA 1E6SM 3OB8A 5EPDA 2PDUA 3G3MA 4EPBC 4K6AA 5FL1A 1M04A 3C3UA 1YPXA 3GLCA 3NGJA 1GVSA 2Y4SA 3GXIA 4IGSA 3OW1A 1TV8A 2I16A 3UPMA 2ZFAA 1XD1A 3VOJA 1XSKA 5DBTA 3BLKA 4IQLA 1LOQA 1GCYA 3IGSA 1JCTA 4LAZA 4DUXA 2DIJA 5CC6A 4HZ8A 3RILA 1DQWA 4I3GA 1TE1A 3PUOA 3KFTA 2ISWA 3KRBA 1KRAC 3NDOA 1PX4A 3WIJA 5F2LA 3WUBA 3SADA 3MVIA 4JD4A 3WMSA 1NU5A 3E2SA 4KESA 1H60A 2V69A 3VE7A 3QF0A 4AYGA 4AWSA 5FIPA 1LRNA 3NJ3A 1XYZA 3B0YA 2A6NA 3PNUA 4H7VA 4QJ3B 3TOYA 2J9YA 3LLFA 4O0KA 3G0UA 4JYEA 3QY6A 4W85A 2C0AA 3ZVHB 4XISA 1C8XA 2OX1A 4AZGA 4E38A 1JXKA 3L4WA 4GI9A 3EMQA 2HROA 4E2BA 2WMFA 5GJMA 3M0IA 5HUPA 2ZVIA 3FK4A 4RDVA 4YTTA 4AD0A 2OKOA 4ZBCA 3WBXA 4HP5A 4GBUA 1UPPA 3EGJA 3CHFA 1CLVA 3BANA 3UG4A 3GG8A 2VC9A 2AL1A 3E0WA 4C90A 7ODCA 4NUWA 1RPXA 4TMCA 3TYZA 3LBCA 2XFRA 2UV8G 1WZMA 4WD0A 4GCXA 1EZ2A 2V5CA 4CQBA 3PB2A 3OGSA 2Z4GA 3TQKA 5CBIA 2ZUWA 1KGUA 2G37A 4H8HA 3W27A 1XIIA 4BEUA 4ADSA 1VH7A 4HK6A 1K7EA 1WV2A 4AD3A 1DJZA 3GY1A 4KEZA 1E72M 5ABFB 4HBKA 4Q8VA 2NT1A 3UYIA 5J04A 3IVTA 3WSUA 4Q3MA 3CTLA 4BR1A 1XISA 4G1KA 5CQ1A 1IZCA 4YN5A 2C0HA 1QOXA 2NQHA 2REQB 3MSRA 3QZEA 3W4RA 4O50A 2YL5A 3TC7A 4LNCA 4JIEA 4IFRA 4GINA 4NVTA 4RDZA 3VYLA 3RK8A 1XCWA 2ZZ3A 1FWFC 4I8YA 2VRJA 4DF1A 3EYPA 3ZWSA 3KBJA 3F4DA 3U5YA 4ONVA 3QTGA 1D7KA 3SSZA 1IGWA 4DLFA 3TLQA 4DXKA 4GWEA 3I10A 5LIKX 3MMTA 1XBZA 2NZLA 4J3WA 2PBOA 1E4MM 2Y0FA 5C6MA 3UGRA 4W7UA 3LNMA 2E5DA 2FVLA 1X6LA 3PBMA 3PWGA 5IFTA 4HYWA 3E12A 3LBOA 4O4VA 1O5KA 4IUOA 1GQJA 4DJFD 3RLVA 1A4LA 4C6PA 5DELA 3MTWA 4KWVA 3GH7A 4DJDA 4ZXLA 2ZUUA 1B3YA 4S3AA 3H22A 3MP5A 3CAVA 3B9NA 4HNLA 4ZQCA 1DQUA 1EJ7L 3WEMA 4HNUA 1J0KA 1B30A 4QSFA 5EMMA 1RLDA 3B9AA 1GG0A 3VUSA 3P93A 1UPMB 2OT0A 2V67A 2YBUA 4XZIA 5C55A 1QBBA 2QCDB 1UKPA 1JCXA 4C1NA 3ZLHA 2CNCA 1ENUA 4IIFA 5T9CE 1EF2A 2UBPC 1RQHA 4AEEA 4N2YA 5KEZA 1EP3A 3N34A 4E3VA 4H8UA 1AA1B 3M0ZA 3CASA 4DBEA 4TTGA 1H7RA 5BWAA 1S5TA 1OGSA 4ZOCA 4R5EA 3QR0A 1TJ2A 3SB0A 3OIHA 1SFSA 1N8WA 3KRZA 1VAHA 3UJEA 1M6JA 2F9RA 1XC6A 3GDMA 4IG2A 3B3DA 3P8IA 2VFEA 3AWNA 2G4FA 3R89A 5BXTA 1GOMA 1Q5MA 4YVVA 1BXBA 3LCIA 1YXDA 1O5RA 1WP6A 2CXEA 3VIMA 3EEZA 2QDDA 4XSLA 3ARRA 2OZ0A 3R11A 5D2YA 4F66A 1FHVA 1PEZA 5XIAA 4KT2A 5C2CA 4ZCWA 3WLQA 5CJNA 3MUIA 1R3QA 4CVUA 3M0HA 1CGUA 2OSYA 4PBEA 5MKGA 1RV8A 3WQCA 1HW6A 1BTCA 3UJFA 1D9EA 2DVUA 4IUGA 3DYPA 3N6JA 1VCVA 2QJMA 2XIMA 1EGMA 1PAMA 3QZ6A 1OD0A 2XIJA 4LF1A 5JVLA 6ENLA 3PJXA 3P84A 5DY2A 4X2PA 3VKAA 3H2CA 2PWHA 1JZ6A 1WA3A 4MJMA 4BA0A 2L5HA 1S5VA 3VFCA 4LOCA 1Q66A 3VIHA 4F9JA 1W0MA 1QK2A 1BAGA 3JZUA 1I4NA 5KINA 4UQAA 3TCSA 2VC7A 1XINA 1GGOA 4YNGA 5EMYA 1QASA 2JKPA 1ECQA 4KEMA 3T0TA 3N2TA 2QPSA 5FSDC 3QC0A 3N9RA 4XVEA 2Z7GA 3UG3A 1UJPA 3IJ7A 2J4GA 3LG3A 2VRKA 2X1IA 2NWRA 3M0LA 3NXLA 3HTWA 1QPOA 3D46A 3VIKA 3OA3A 2G3NA 3GXTA 3PZNA 1PZ0A 3DFPA 2QUNA 4ERGA 3BAJA 3UCCA 2GJXB 4AFYA 2QVNA 4QAWA 3HJEA 2WSYA 1IHIA 2DZXA 2B81A 3AJXA 2PGFA 2PZNA 5I0DA 4XD6A 3RITA 1FWRA 3T07A 4CCDA 3ARWA 4G7FA 1Q45A 3L4UA 4LUJA 1VENA 3MY9A 4HU4A 1W3JA 1ONRA 2A85A 2X1RA 1G4SA 5T91A 3TN6A 2BX7A 3KP0A 2MUCA 1K03A 5DN1A 2XH2A 5CSSA 5E5CA 4GVHA 1JGMA 5EMJA 2NXGA 5AYXA 4MZYA 3STEA 1IXOA 2JF6A 4L65A 1L6YA 2OVLA 3P14A 1TREA 4GK8A 3EWWA 4B16A 4FMVA 1H62A 2BHUA 2V3FA 3W1MA 1R85A 3ITOA 5A1AA 1XLBA 2A7RA 2YB1A 1K8YA 2FPTA 4IL2A 1EKOA 2VWTA 2QUVA 3GDKA 5C7HA 1R30A 2BY1A 4CQ9A 1XR2A 3RIKA 2JALA 4GIRA 1XD0A 2J7EA 1CB2A 5HDRA 2AKMA 2DUAA 3SN0A 2Y85A 4JEQA 1RK5A 4YL2A 3WNNA 4LUSA 3AS2A 4FZIA 1UWUA 3EB3A 1SW0A 3VOHA 1JYVA 3E3HA 3DUGA 5HWMA 3STFA 1UJQA 4S3KA 1UD4A 4UUIA 4YCOA 1WNOA 2VZSA 4Q8TA 4IX2A 1S2VA 1VS1A 4PTVA 4S2BA 2OO0A 2F6UA 2QGYA 3QFWA 4JTGA 5HNRA 4GNJA 2OR2A 3LPOA 2D0GA 2HE5A 5K2ZA 1XDMA 5L6UA 3L65A 4C5YA 4TX8A 2VT0A 4PCTA 4O18A 1TYGA 4FK9A 1C92A 1FTXA 4IHCA 2QF8A 4AWEA 2BP1A 3AIBA 2W61A 4AD2A 2FTYA 1LLZA 3E2QA 4B3KA 3PK7A 4LYQA 1RA0A 3COTA 3K2GA 4QFUA 1XKYA 3EZ4A 3ZR6A 3OP2A 2XVGA 3ES7A 3H70A 3RPTA 4AEFA 4NYYA 3H4XA 1FH8A 5E9XA 4DZHA 1ZLPA 6XIAA 3B9OA 3DZ1A 4Z1DA 4XAYA 3F5KA 1JQXA 1ODZA 5AFDA 1I2QA 5HNUA 1XS2A 3UFYA 1V6XA 3NQ8A 2X0SA 5A2BA 5FESA 4O1FA 3QBUA 3I7SA 4HZ6A 4HMDA 1X96A 3SQLA 4PULA 1QBAA 3O06A 3WYZA 2ESCA 1TJ1A 4RDYA 1GW9A 4NI8A 3VINA 2EPNA 3F4WA 2VP8A 1SFJA 2PTXA 1WDRA 2R94A 3BG9A 2OYKA 2CKSA 3M1ZA 1R8LA 1BRLA 3NQDA 1VBJA 5DXXA 1EFZA 3LQLA 3U7VA 3BAXA 1ZU8A 4Q8MA 3GTNA 3LNPA 2VEMA 4BF5A 3A6OA 3VNDA 4TXEA 3O7UA 3NWRA 5EFFA 3W6YA 1W1A1 2WYSA 1U1HA 4WR3A 1Y5WA 4ICMA 4FOJA 4GD0A 3STGA 1RLCL 4FXRA 1V0NA 2WMJA 5FSEC 3E5BA 4GGBA 3SFWA 1DJWA 3HURA 4WJXA 3KTSA 3R4IA 4D71A 2TSYA 3QOMA 1M3UA 3W00A 4DJDD 3V7PA 3I3DA 2CBJA 1QVBA 4CEXC 3MBFA 4ZQNA 4QAIA 1HT6A 3T8QA 6CGTA 1LROA 2V2DA 3FA5A 1YTEA 4UR9A 3RYSA 3GVQA 1POJA 2EQDA 3WBAA 4IGMA 3VKKA 1UUQA 4NG3A 3L4ZA 4O10A 4HTYA 3EKZA 3B0VC 3NZPA 4L56A 3LS9A 3M47A 4AY8A 1GVYA 1E4LA 1HL9A 3DC8A 4UMBA 2FZNA 1WDQA 5G1MA 3LD5A 4EACA 3KHDA 1EQPA 5G1TA 4HPHA 2B4GA 1KFKA 2ZIDA 3AMKA 3CYVA 3NIYA 2YGYA 2ACUA 3CNYA 2VC5A 2A7NA 3PHAA 3TYAA 4CD7A 3APGA 4AWUA 4NAEA 1TWZA 1MEIA 3W3OA 2X7WA 5I7GA 3CQKA 1FWNA 2GFTA 4NJIA 2H9AA 3G1YA 3SY5A 1JPKA 3WJYA 4PMUA 3RR1A 4AISA 1XFBA 1GOWA 4A35A 1C8VA 1JGIA 1RXOB 1UKOA 1ZJAA 4MZ8A 3TQVA 2OYMA 4OV4A 4LFYA 4B91A 4PMNA 1VFSA 4OZOA 2AGKA 2FYMA 4AWTA 2WOQA 3AYVA 3VDHA 4OFCA 2GDUA 4U2YA 4J40A 3TN3A 4S38A 1Q63A 3KAOA 3IEBA 1T7LA 1HQTA 2PEVA 3A5VA 3VA8A 2G97A 1KM1A 4NP7A 3GR7A 4BK9A 1O12A 1GQNA 4LSBA 1R38A 1KRCC 3RG6A 1GKRA 3WLOA 3LK6A 3ZWTA 5HJXA 1L6GA 4GPNA 1V79A 1P1XA 1F3WA 3TJIA 3MB9A 1UP3A 3S6OA 4YTQA 2BZNA 2W67A 2IKIA 1PZ3A 4EWJA 4FEZA 1K1DA 3DESA 3UZYA 3W7QA 1I2RA 2VL4A 4O17A 2B7QA 4MNLA 4QDPA 4MUPA 3WLRA 4W89A 1M9HA 1JZ3A 5I79A 1IEIA 3NCOA 4GUGA 1BYBA 1XG4A 4TUFA 2VWSA 2KAUC 2PDWA 2CLEA 2XGBA 3APYA 2JEPA 4ZOAA 1HZYA 2HRWA 5G2WA 3EB2A 3VOGA 1RJQA 1OFOA 3EOOA 2GSJA 5BMWA 4WGHA 3R94A 1ISYA 4GQRA 1GTHA 2XIBA 2O56A 3LLXA 1W1ZA 1F4HA 3H2FA 4H3DA 4JTEA 3WDIA 2IPGA 3BGAA 1JDDA 3PPGA 4Z2GA 5KZ6A 1WDPA 3PZMA 2D73A 3H21A 1UZ1A 2PI6A 4EVZA 4AHPA 3DIPA 2A3CA 3GW3A 1N55A 2WBKA 2CZVA 2WZTA 4WSKA 5H6HA 2VKZG 1DJYA 3L5AA 3FKKA 2OCZA 4ENLA 1TTQA 1V51A 2PTZA 4UTKA 2HPIA 1RCXB 1DJNA 1UOKA 2X09A 4R27A 4PEEA 4UR7A 1JRBA 4L64A 5CPOA 3MUY1 3UYCA 3KVJA 3QSRA 4DO4A 1PYFA 3PZ9A 1QI0A 2ZADA 3GZAA 4K36A 1KC7A 3GNNA 3TSDA 3PBWA 1AQMA 3DG7A 1FWTA 4FNRA 4LAMA 1VPQA 1ADOA 3T44A 3IJ6A 2ZUTA 4PRRA 2WNQA 4Q22A 5DMMA 2EHHA 1EEXA 3URNA 2YBVA 4MKVA 4CQ8A 3R6IA 1UA7A 2QV4A 5HMDA 4C6JA 5CC5A 1J2BA 2C91A 3CLWA 4DZIA 4UNKA 1GEQA 3VGGA 3DCPA 1QI2A 3N2XA 3U2CA 3MT1A 1ITXA 1M7XA 4S3JA 2HBVA 3HFTA 4TQTA 4JNYA 4W8AA 3KOZA 3V35A 1V02A 4MDPA 2GLKA 4H8NA 3UGVA 4G5DA 4B5WA 1A0EA 4KIEA 4GY0A 3TYUA 3V18A 3W7IA 2Y62A 4N6EA 4Q4OA 1E1FA 1R0MA 2WKJA 2Y61A 2YSWA 3KVKA 2R1PA 1F3XA 4TMBA 3WMCA 3CV1A 5CPNA 2HNEA 4O1EA 2CLPA 5A6LA 1J6PA 5BOOA 4PSPA 3IK2A 3GH4A 1BKHA 5JIPA 2PU1A 2I56A 2Z7KA 5BU9A 3K8KA 4MB3A 5B7YA 1AFSA 3EDJA 3A4JA 2PDGA 1CGWA 1M7JA 2HCVA 2BOEX 3L5LA 5JH1A 3R0KA 2GOUA 1RPKA 1B3XA 4HOXA 4XZ9A 2AL2B 2ABBA 3SQMA 4BCEA 4OU1A 1HNYA 2VGGA 1E0WA 4JTIA 4KCVA 3WF0A 3WMLA 1IR1A 1UQZA 3SRDA 6XIMA 1LBMA 5IRPA 2G8ZA 1XC4A 4M51A 2R8WA 4AAJA 4HKPA 2VQTA 2CFFA 1I8JA 1CZ1A 2D2GA 3NZRA 2VEIA 1S3HA 3W2KA 4GYFA 1AVAA 2MNRA 1CEOA 2DDXA 4TIMA 1V6VA 3WEOA 1AH4A 4EXBA 5C9RA 2QAFA 1OQFA 2NV2A 3TN5A 4TOQA 5RUBA 4FOUA 4AC1X 4CNOA 4M6VA 2ZA1A 1NDVA 3QMSA 1VPXA 3CK5A 2VFFA 2VNCA 3GDRA 1UA3A 3OQ8A 4LAOA 2PE4A 5DXYA 1VBUA 3CQIA 3SGUA 3P2VA 1DVJA 3NQAA 3CMFA 1TPH1 5E0KA 1ZJIA 1VEOA 1E73M 3UZ5A 1EXPA 1PKMA 1HGWA 2PMQA 4AW7A 2HZGA 1XLKA 1MW0A 4FXFA 3PPCA 4KRUA 3N04A 2CHNA 4CN1A 1UR1A 2YYUA 1UR4A 3CT7A 1Z9AA 5BRBA 5M5DA 4UFJA 3TMLA 5AHEA 3TA6A 4KQNA 4BY3A 1H0IA 2YL9A 2YDSA 1LBFA 3PNZA 3V16A 3B9EA 3O1NA 4FXSA 4NAFB 3VDBA 2I5QA 5EB8A 3S1GA 3WQ4A 1Q4WA 1V0LA 3SY1A 4XIMA 4NZFA 2ADAA 3W88A 1ZBWA 4OV9A 2Q01A 4ZQRA 2XFYA 3R25A 3O05A 1CGYA 1I75A 3TIMA 2GZXA 1UR2A 3WLTA 1BYAA 3PZTA 4WX2A 2JE8A 2ZXAA 1EC7A 3T42A 3CZGA 1V0MA 2DH3A 4O1DA 5FACA 3G1HA 3LN3A 1MFVA 3PPHA 2VX5A 2OEJA 4Q7IA 1HFBA 3EB4A 3TQPA 3VKJA 5A6JA 4IQEA 5TD4A 3UD6A 3ENLA 3VNZA 4F3HA 3NO1A 2ZUSA 1EYWA 3W7MA 3SCWA 1GOOA 1ZRQA 3BGGA 3BO9A 3RLUA 4GUFA 5CC3A 1NP2A 1ZJHA 2P8CA 3HPSA 1TZZA 3EWCA 4OECA 1J9YA 4RZBA 3DU0A 4TX6A 1TVNA 3KVLA 9CGTA 3AROA 4V1YA 1KXQA 5ECUA 4IL0A 4WSJA 2R91A 4LCRA 4IMDA 2XHYA 3PY2A 4GZJA 3O63A 5MKGB 2HS6A 1C7TA 4RKAA 1CXLA 3UW6A 3UU0A 3IJDA 1KWKA 2IW0A 2X41A 1VEMA 5BWFA 5H8MA 2TMDA 1W2PA 4YTSA 1F9CA 3E49A 3W6LA 3MP3A 2V5LA 2GPTA 5U4NA 1BQCA 1DBTA 3RU8X 4WLCA 2PTYA 3PG8A 3M0VA 2VZOA 1JF5A 4O8AA 2ZDRA 1G9HA 1E0UA 5DRIA 1V77A 2INZA 1TTJA 3P3BA 4AZHA 1VQTA 3V0UA 5G4HC 4FLSA 2INEA 5HWJA 4KEVA 5IXEA 2VGIA 1JCJA 3ARTA 4IIGA 1KFBA 1UIPA 4JFSA 5HQMA 1W9PA 2RDWA 1V3HA 5JU6A 1KQZA 1NWSA 1KBKA 3NG3A 2X7VA 2VEKA 3H7UA 4WSHA 3VZYA 2HS8A 2XPKA 1S5NA 3EX3A 2IPWA 3RM8A 3E0VA 3C5QA 3A13A 4MNJA 3LB0A 4TTUA 4PL1A 1ZENA 1XL9A 3M5VA 1Q6OA 5BU6A 3EOSA 4AXKA 4NHVA 3LX9A 2Q8XA 3TONA 3WNOA 1A3WA 4HPXA 2Y7DA 3UETA 1MUCA 1GYMA 4RW3A 3VM5A 1QWKA 5AYBA 2E68A 2NUWA 1FFQA 4LS0A 3E74A 9XIAA 4UTUA 4JNZA 4B9ZA 2Z1BA 1WAUA 1UD6A 3UR7A 3E5PA 1AD1A 1UD2A 4HCHA 3B0PA 4MJZA 8RUCA 3UZXA 1EWEA 1XFCA 3UPBA 3CWNA 3WLIA 1ZCCA 2VO5A 5I03A 1PDYA 4XKMA 5LA2A 1H1YA 4HIBA 3WBWA 2J9XA 2FDSA 4XBKA 4R9XA 2GDQA 1VIWA 4B5XA 4WEVX 4E4FA 1R7AA 3OPSA 4DZ5A 3AISA 1WUEA 4REQB 1HKIA 3BAKA 3MHFA 3ZT5A 4NZ4A 2P3ZA 4DB7A 1NH6A 4F8XA 2GJLA 4MWAB 3ORWA 4GYPC 3CWOX 3IJ8A 5M3WA 2DJLA 4C7GA 1GOKA 4BQ2A 1R9ZA 5I07A 4GI6A 3PUDA 4IFKB 2VGFA 1JZ7A 1MRAA 5CEWA 4JGDA 4KFOA 5IOBA 1ZB5A 2WW5A 1UWQA 1HJSA 4K8GA 1W5NA 3V5FA 5KZEA 3B8TA 4KMQA 4CLMA 1RH9A 3WN6A 3AIVA 2FZDA 4WOZA 3BAYA 2HPMA 4EE9A 3DKJA 3G1DA 4JX5A 5IDIA 4A3YA 1QW7A 4I6VA 2POZA 3HPXA 4Q4PA 1GNXA 4XZWA 3RCMA 1PHWA 1N7KA 5I6SA 2P76A 1TPC1 1S5WA 1YBQA 1YNYA 1PBGA 1P6BA 1K9EA 4R3UA 2OYLA 2ANUA 4NQ1A 4A3QA 4WCJA 1XH0A 3KL3A 4LQ1A 4K1GA 1W5MA 1FHDA 2VDHA 3VOFA 1TPDA 4B3LA 1ZAJA 2GUYA 5I02A 3OQEA 2FLIA 5HK4A 2F8QA 3OO2A 1MEHA 2GQAA 2WKGA 2O9OA 2ZXBA 2CBVA 2G5WA 1GQKA 4JIQA 1Q7ZA 3MI6A 3KWXA 5DO8A 2P3EA 3IAQA 4QE5A 3VNYA 2DZUA 3M0YA 2BGSA 1NARA 4PEKA 1I2NA 4AEOA 3LMZA 3OODA 3V4BA 1Y8BA 2VR4A 4MWAE 4AMAA 4MJ4A 4QNEA 2NXIA 2C3ZA 1EJRC 1SPQA 3UPWA 4MMWA 3GVRA 1AH0A 3VD3A 2WHJA 1F74A 4XTDA 2FPYA 3BC9A 5EFDA 3HG2A 3V75A 1R2RA 4ZOBA 1VP5A 3LHZA 2JKEA 4QE4A 3LQGA 1BRLB 3D3AA 2PWGA 2A3LA 4IIDA 3FAWA 3W1XA 4B3ZA 2VFDA 4EXAA 2PDKA 3BOLA 4MNKA 3GC4A 2GVLA 4DO7A 2NX9A 4IMEA 1KRBC 1W9DM 1XIEA 4GKLA 2YDAA 4DELA 4KGLA 2VVSA 3TYCA 1ZZMA 2QUTA 3PR2A 5HJLA 5MHBA 2TPSA 3NQ6A 1DWFM 1GZGA 4LAUA 4JICA 2R1LA 3F1QA 3GVVA 4DUVA 1HXJA 3FX4A 4ZEPA 3AXIA 1ZALA 1LWJA 1H11A 2CLKA 2C19A 1SVDA 1JI1A 1OX4A 3A3HA 1J18A 3NSMA 1P5BA 1X7IA 4WRHA 3N2CA 4L9YA 4GO8A 3GW0A 2HXUA 3W84A 1VB9A 1WQ5A 4X3ZA 4J3ZA 2E3ZA 3N73A 5D32A 1VJZA 3S1XA 2OG9A 1XICA 1CNVA 3W2LA 4QEEA 4M1RA 2WSPA 1QNSA 4LBUA 2D1ZA 4CCEA 2RDUA 1TCDA 4ZE5A 3RLHA 1FKWA 3BXWA 3EAUA 3FYOA 3IAPA 4XD5A 4H2HA 3I7RA 4D6EA 4JFUA 3OHIA 1S1PA 1TVPA 1VHCA 4XKYB 5F4SA 1MYRA 2Y89A 2QW5A 4IQDA 3U2OA 1Q8AA 4WJ8A 4XB3A 3K1DA 5XINA 4JHMA 1ZTVA 4IIHA 5FF7A 1GVIA 1XP3A 1JPMA 3AUJA 3MJYA 5EMLA 3V1PA 4NAEB 4GZIA 4P7LA 1CLKA 2V30A 4F0MA 3F4NA 3GTFA 4RZ4A 3LXBA 2H9AB 1FP8A 1EGZA 5FL0A 1OEPA 1H7PA 1Q6LA 1QHPA 1KM2A 2R1NA 2V6AA 3NR0A 1UKQA 1Q85A 3VPLA 3HN3A 4K8EA 4N4QA 1GEHA 1JAKA 2Z1WA 2H3BA 3ZT6A 4EIVA 2VFHA 1KV5A 1W37A 5DANA 3TAKA 3W2UA 3G18A 3IK4A 3GYEA 1PTDA 2O7QA 4NKCA 3APTA 3ABXA 4DI9A 3G1VA 1Z42A 2Z25A 3W1PA 1XYFA 3OIXA 1JYXA 1YADA 1NY1A 2JGYA 5DMYA 2HVOA 3TXVA 7CGTA 3V36A 1VFLA 2NT0A 3UNTA 5CJMA 4J3SA 2QMKA 1XUUA 1Z41A 4W5UA 1PKLA 1PSCA 1XIHA 4ZGYA 2XZ9A 2FH8A 2GL5A 1VLWA 3EWZA 3EDKA 1JNEA 2QJNA 4J27A 4Y9OA 1V5XA 3HV8A 3L2MA 2A2IA 1KFEA 3CUJA 5H1WA 3P61A 2FVKA 3DERA 3RHGA 2Y5SA 4QHRA 3GH5A 4DWSC 1OX6A 1X8FA 1C8QA 3VCRA 3CL8A 5BOEA 3PZQA 5LXXA 2D22A 2PCQA 3CZJA 5G1YA 5HXMA 4B2DA 1MUWA 1EIXA 1Q65A 2HK0A 5KETA 3TZFA 1DXIA 3W7RA 1WX0A 3CEPA 3CQJA 2A79A 4LX4A 2XFFA 2HNHA 3CBWA 4C6FA 2GYIA 3H2EA 1QNVA 2TODA 5FJRA 3AXMA 2OELA 3IIOA 4XK2A 1FFRA 5ABTA 3AHZA 5ABGA 3UCQA 1DP0A 3PP7A 3UF9A 2UY3A 4GXPA 3E96A 1LZOA 4LV9A 4GYKA 4UQCA 5I00A 5IFPA 2CEQA 1C93A 3S4TA 5JMUA 3FHAA 1HKKA 4N9BA 1A5NC 4QLLA 3WH6A 3QC3A 3OTRA 3TZNA 2V68A 2ZZ5A 2BHYA 2VFIA 1QU4A 3GG0A 3ZVHA 1OG6A 2OO6A 5LNWA 3Q37A 3QYSA 3XIMA 3ITLA 5J8LA 3OG3A 5TBOA 3HPFA 4KW2A 1JXJA 1PHQA 2G0WA 3UCDA 2E8ZA 4IZGA 2EG8A 3S5YA 5MF5A 2YR1A 4JDYA 2V2CA 4JHOA 4NSBA 1EHNA 4M0XA 2OFJA 1AJ2A 1ZP4A 3WUEA 1A5UA 1NM9A 1NTHA 4GC3A 4GJJA 1CPUA 2FJUB 3LM3A 3W24A 1Z89A 5EBUA 2FIQA 4O12A 1O7AA 1LORA 4D9PA 2Y1HA 1LDCA 4GYPA 3RR4A 3RGTA 1QUMA 1GUVA 1LRQA 4AQLA 3QQ1A 4D6FA 1XF0A 4LW7A 4GHRA 3IGUA 4PCSA 2RUSA 3DFSA 5F2IA 3QV6A 5AHNA 1A5AA 3F2BA 4E4UA 3CUFA 1K8XA 4Y96A 1E71M 1EXBA 3W1LA 3FW6A 3B06A 1U1UA 3B03A 5KITA 2FGBA 3UERA 3AIQA 4R7WA 2A0NA 4Z08A 3MZ2A 3RN6A 2QIIA 3LDVA 4X63A 2YDQA 3MO7A 3C0SA 4C5ZA 2VUYA 2YXXA 3ZIZA 4P8WA 1T8XA 3N1AA 2REQA 4Y8EA 3FEQA 1QAPA 1BVNP 3CAQA 4O1BA 4M7TA 2E6DA 5LIWX 4L4LA 1A5MC 5K4XA 4J7RA 2F7FA 4ALDA 4H4IA 2NX1A 2HDJA 3LHTA 3BQ6A 4IXXA 3WUFA 3OYZA 1NDYA 5JXQA 3IWPA 3QVQA 3RU6A 3PTDA 2OT1A 1A5BA 3MUAA 2QF7A 1TO3A 2XWEA 3C0QA 3C2YA 3SDOA 3VNJA 2YW4A 4HOZA 3C3NA 3POHA 5AVNA 3PUGA 4DPQA 4FR1A 3FJNA 4B4FA 2OKTA 2QMJA 1KLZA 4PUUA 1BG9A 3AHVA 1OC6A 4M6PA 3UXIA 2B7NA 3GG7A 4HU3A 4TVUA 3THDA 2ZE0A 3CH9A 2Y7FA 3DFNA 5FF0A 2RHGA 1MXSA 1W31A 3M41A 2OWXA 3HG5A 2ZVRA 3TAOA 4RV3A 4XZNX 3MUCA 4GUIA 3DI0A 3GR8A 3YPIA 4Z1AA 4LU0A 4PMRA 2QCDA 3Q67A 4YHEA 3MKCA 3O3RA 1S2WA 3GZ3A 1AJZA 3BMVA 1Q7QA 1SJBA 1RA5A 1HUVA 2GJNA 3PULA 2XSAA 2J7FA 3QGVA 2Z1KA 5IBXC 4YWSA 1EQCA 1G01A 2BXZA 4H6RA 4POCA 1Q3NA 4GZEA 1UCWA 2FMNA 3ITTA 1BHGA 2IKGA 2BTMA 4QP0A 4GBDA 2W9MA 4XZHA 4C6DA 3LU2A 3Q45A 1LOSA 4G7EB 4HVXA 1QDSA 1Q8JA 3T4CA 2DT2A 3M43A 3C4UA 4IFOA 5E09A 1MWOA 2NQLA 3M5XA 1KD0A 1U83A 1JYNA 1HTIA 2J74A 3O9NA 3S42A 4AMCA 1LG1A 2PWFA 1ISVA 1I1WA 3IJ9A 4Q7NA 4N6FA 1MDLA 2AQOA 3B8WA 3DH7A 2Q8ZA 4P5UA 4V2XA 3K30A 2QUMA 3S83A 3R79A 4BF9A 1OHLA 2Q09A 2PTDA 1Q6EA 2XSXA 1PZ2A 4OT7A 3AQUA 3VIJA 1FWEC 4JTJA 5H91A 2VCCA 1PO9A 3USBA 1ZBCA 4D72A 4L80A 1V7YA 3TN4A 3RUBL 1VJSA 3QRHA 1UOZA 2X2GA 1F73A 3KBVA 2GWGA 1A50A 3LGDA 4J5NA 4WHBA 3MV01 1IV8A 2FZMA 2W63A 1DIEA 3STCA 3MMWA 3UR5A 3BLLA 3MJMA 1XM3A 1S3TC 4F79A 3K5XA 1Q6GA 3BK0A 3G1AA 4WKHA 4JQ1A 1CTNA 4ZOEA 3PB0A 2XYLA 3PS7A 3E38A 2GJXA 3LHUA 1XG3A 1WKFA 4UBPC 8CGTA 3DI1A 5FF3A 3BZJA 8XIMA 1GG1A 1NOUA 3QSTA 2FGLA 1IF2A 4O1CA 4PUWA 4ZTYA 1AL7A 4B2DD 4MTVA 1R86A 4FO4A 4LUYA 4ES4A 1OIFA 1M65A 4EPEC 1TRIA 2X05A 1MZHA 4MAZA 3NQ2A 3QV7A 3GYCA 3QLDA 1TZ7A 1V3LA 2X2YA 4US5A 3AICA 1IIGA 4KBXA 4GX9A 4YVXA 3S6DA 1SR0A 1QOQA 3WZ0E 4YIWA 3QPYA 1AQHA 1K8CA 4C6CA 3ITVA 3KP1A 4ROQA 3ALFA 1Y65A 1WZKA 5C54A 3LSBA 3GC5A 5I3DA 3N2OA 3GD6A 1E9LA 6TAAA 1SU5A 2ALRA 2VFGA 2WB5A 2PD5A 4B90A 1V3JA 4Z2KA 1W91A 5K9XA 1YE6A 4LVFA 5JBDA 3CMGA 4U2ZA 4E3TA 3EXTA 4B92A 3ZO9A 1R7OA 5T9BG 2W62A 3R58A 3BPWA 3EXRA 1DWGM 3QPZA 4JTLA 2DUXA 3WNPA 2NVCA 2G3MA 4QNWA 3S2MA 3HM7A 3W73A 4US6A 4M5PA 3V5OA 4AVNA 2OPJA 3U3HA 3H4WA 1W3TA 1QATA 2PDCA 4RDWA 4IP7A 3ICJA 3MWCA 4FLQA 4Q8PA 1FDZA 5D9MA 4NXKA 4ZFCA 4LY8A 1TV3A 3D0CA 1H1ZA 1I0BA 4DJEA 3R5EA 3MCMA 5TNVA 2QCGA 1C8YA 3QY7A 1H61A 2DSWA 1E0XA 1YNQA 4GIYA 4JTKA 1E55A 3WDPP 1UC4A 5I5RA 1VCGA 5AYYA 3QGAC 4LJ3A 2BWGA 4L4MA 3WFAA 1KKOA 4UNIA 1V3IA 4GA8A 4J4KA 1W9UA 1E6QM 2HXTA 3UZWA 3H24A 1HN1A 2J77A 1E70M 3SCRA 3W7DA 2WQDA 2OZTA 2ZICA 1GQIA 3VX1A 2PS2A 1H51A 1PIGA 3UJRA 3MMDA 3VDCA 4G9PA 3WL0A 3W87A 3NVDA 3FOKA 3WF1A 1W1IE 3BURA 4MG4A 2WJZA 1GOQA 1CI1A 2VEGA 3UG8A 2QYGA 1UZ4A 2VZTA 3WNMA 4K3ZA 1AW5A 1OFDA 4Z0JA 1OVDA 4C6QA