4XUYA

Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/gh10) enzyme from aspergillus niger
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
b'EASVSIDTKFKAHGKKYLGNIGDQYTLTKNSKTPAIIKADFGALTPENSMKWDATEPSRGQFSFSGSDYLVNFAQSNNKLIRGHTLVWHSQLPSWVQSITDKNTLIEVMKNHITTVMQHYKGKIYAWDVVNEIFNEDGSLRDSVFYKVIGEDYVRIAFETARAADPNAKLYINDYNLDSASYPKLTGMVSHVKKWIAAGIPIDGIGSQTHLSAGGGAGISGALNALAGAGTKEIAVTELDIAGASSTDYVEVVEACLNQPKCIGITVWGVADPDSWRSSSTPLLFDSNYNPKPAYTAIANAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable endo-1,4-beta-xylanase C
publication title Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Aspergillus niger
rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 123
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4xuyA00
1UOKA 1VFOA 3T0AA 2A3BA 2UY2A 3EMCA 4LX4A 5BXPA 3VMOA 2OSYA 2Y24A 4OOZA 2HISA 2QF8A 4PTMA 2WMIA 5JUVA 5A6SA 2YA0A 4UCFA 1MXGA 3RO8A 1US2A 2QPUA 3ZO9A 1CXKA 1KGWA 3VNZA 4BCEA 2Q8XA 1E1EA 2V3EA 1GVIA 4BF7A 2GFTA 3FNDA 3G6LA 2W61A 4PTXA 1J0YA 2XVKA 2GJRA 2BFGA 1GW1A 1LWHA 4UZSA 3AJ7A 3PHAA 5LA2A 3K4AA 2Y5EA 4GINA 1JF5A 2PC8A 4PSPA 1UA7A 3MUZ1 3AHYA 1QI3A 1GHSA 5BXSA 1GQLA 4WK9A 4W86A 3ZT5A 1E5JA 1QVBA 1KR0A 5AC4A 1VFMA 4ATDA 2XUCA 4P8VA 5JBDA 2W67A 2ZXBA 5ABHA 4XZBA 1HX0A 4CUCA 1MQPA 4CCDA 1Z32X 4OIFA 4W8LA 4LXFA 1VB9A 1E40A 1GJWA 3ZJKA 2XTKA 3PZTA 3SUVA 2VVSA 1BG4A 3RM8A 1TVPA 1QI5A 5A3HA 1X6NA 4CGTA 3KL0A 1JI1A 9CGTA 2JFEX 4UOJA 3AICA 3BSGA 1WZMA 3GTNA 3ARWA 3RILA 2CBUA 3TTOA 2D0GA 4QDMA 4J3XA 1TMQA 2WHMA 2WZEA 2XJ7A 1C92A 4GZEA 1KQYA 1H5VA 4YN5A 1TA3A 3N9KA 2YA2A 4NI3A 4WKHA 4CN6A 1EO5A 3L4ZA 1EGZA 2JEPA 5C8BB 2WANA 3W24A 1VF8A 3VKKA 4MAVA 3T09A 1UD5A 3VIKA 3BLKA 5CLTA 2V3GA 4PMYA 1HJXA 3VVGA 3B9EA 3WQWA 5ABFB 1FOBA 1RPKA 1JZ3A 1UH3A 3DHPA 5DO8A 3M46A 1UD4A 4CN4A 2WC4A 1GZJA 2XVGA 1XGZA 3AIEA 4AZCA 4UOZA 3UERA 1F4AA 5JBFA 1UD3A 3N11A 2XHYA 5IFPA 2GUYA 2RGLA 1M04A 2JEQA 1JNDA 1CTNA 4P8UA 1TA3B 2ZOXA 4WIWA 1FFRA 1HIZA 5ECUA 8A3HA 3GBEA 2EPOA 4MB5A 1AVAA 4CD8A 2DT3A 1UWUA 4AIUA 4E8DA 3CZLA 3PBGA 2D24A 3WD0A 5A95A 2J77A 1SR0A 2ZUWA 4TUFA 1OIFA 2W66A 1YQ2A 1HJQA 3SCUA 2WLZA 1GONA 3AMDA 2DSZA 3CZEA 3N17A 3CUHA 2WHKA 1OGBA 1CXHA 4AZ5A 1CGTA 5HPOA 2VNCA 2WCSA 1Q6GA 4XUYA 3WH5A 5E70A 5BRPA 4RE3A 1UWTA 4AD4A 1Q4NX 1W32A 2PWDA 1B9ZA 2F8QA 1B3ZA 3EYPA 1QI2A 4ZEPA 3RM9A 2ZWYA 4W85A 2QV4A 4OJYA 1KWKA 3GNOA 2VCCA 3AYRA 2C7FA 4R27A 4DWSA 4NSBA 1UWIA 4CVUA 1V6WA 3VIHA 4UR9A 1OD0A 1QNSA 1ZL1A 3SCTA 2VI0A 4GKLA 4W89A 2O9OA 3A3HA 3AS3A 3K4DA 4AC1X 3RM4A 1KBKA 1K9TA 1E73M 1V02A 4CCEA 4IPNB 4IM4A 2XGIA 3WL0A 3WF2A 3MMDA 3CUFA 4UQBA 3ZR5A 3PZVA 1B3YA 1HVQA 3UR8A 1E72M 2J7BA 3MUY1 5BRQA 3AMCA 5FL1A 1E4LA 3AZTA 1BG9A 2A3CA 1GUVA 1KXVA 3WNOA 2BHUA 4DWSB 4C7FA 3AMLA 3APGA 2OSWA 1PEZA 2J7GA 1TE1A 3SCSA 5AC5A 1HL8A 3N12A 4EKJA 1QPKA 3KEHA 1CEOA 1GQJA 2GK1B 2E0PA 3WBEA 3QHMA 2OYLA 1M53A 3WFLA 3VIIA 4PMOA 2VX7A 5BXTA 1V6YA 3QR3A 4Q7NA 1ODZA 3UG5A 4CD6A 5A2CA 2VZVA 3DYPA 1OINA 5CLWA 1QW8A 1UR1A 1J0IA 2UY5A 3WQ4A 2Z1KA 1VEMA 1HNYA 3I3BA 1E70M 3LPPA 1W2PA 4JHOA 1ZJAA 1PJ9A 4W5UA 1OGGA 5AYIA 3MV01 5AY7A 4DM1A 3DECA 3NUKA 8CGTA 1BQCA 1V0KA 1WDQA 3ARXA 4TVDA 1ISVA 4TTUA 1NH6A 2VRKA 3BAXA 1JDDA 3TTQA 1G1YA 4E8CA 4FLQA 2E8ZA 5A8NA 5I24A 1OM0A 4WSJA 1UD8A 1B3WA 2DT1A 5I3DA 3HN3A 2XVPA 4GI9A 3VDHA 2BY3A 1XHGA 4MB4A 1CPUA 4S3JA 1DWGM 4IPLA 4KWUA 2JALA 3A4XA 4U5IA 1JIBA 1W9DM 1OT2A 4JZ5A 1M03A 1C93A 2D3LA 4HZ7A 2WM0A 5DF0A 1EHNA 4FK9A 5FOOA 5CQ1A 2V38A 1CWYA 3PZGA 4JCLA 5CJ5A 4YHEA 1H11A 3HU7A 3AZSA 5IFTA 4EANA 1Q6DA 3SCNA 2YOCA 2UY3A 4UTFA 2G8ZA 4QP0A 2A3AA 3J7HA 3WH8A 1PBGA 1JNEA 4B3KA 1NWUA 1JYWA 1FH7A 1ISZA 3WIJA 3VTRA 1V0LA 2WWCA 3W53A 4KMQA 2NT0A 1E6PA 3WDPP 1A3HA 4W93A 1JI2A 1FH9A 1DEDA 2XGBA 5CSUA 1CENA 1TUXA 1E0WA 2CPUA 1EQPA 5HOSA 5CXPA 1SMAA 3OGSA 4AZGA 1H41A 4GI8A 1JXKA 3U57A 2X8RA 5DT5A 3NIYA 1XYFA 3VM7A 4Z2GA 2YJQA 3FN9A 2J7FA 2WC3A 1E5NA 3CHCA 4D6JA 1O7AA 3EBVA 1NWTA 2CBIA 4QCFA 5D8WA 2VRJA 1DWFM 1G01A 1LLOA 2AOSA 3D3AA 4IUGA 4PEEA 5D9OA 3DHUA 1GOOA 5I2UA 2BY2A 1AQ0A 1D2KA 2E8YA 1FHLA 1JF6A 1E6SM 3EDDA 3L4XA 3CGTA 2ZXDA 4XZWA 1J11A 4A4AA 1GVYA 1XRVA 3O2LA 4KGLA 2J7DA 1W3LA 3QHOA 1UR0A 4KRUA 1OWQA 1JD7A 2WMFA 2NSXA 3NSXA 5EFFA 4W7WA 2EPKX 4DUWA 1XH1A 3NSNA 3PTMA 3F5LA 4NRSA 3CZJA 3NSMA 3TTSA 2ZICA 3CUGA 2XFFA 3BC9A 1H09A 1QI4A 4M24A 4CVWA 1B90A 4PTVA 3DYOA 1JG9A 4CCCA 1HL9A 1E55A 2V5DA 1C91A 2C8NA 4F79A 4FLRA 2VTFA 2VURA 5CPTA 3OZOA 3WMSA 3ZJ8A 1PX3A 1EIBA 1V6UA 1KXTA 3PTKA 2DQXA 3GXDA 3PZQA 1HJWA 5DT7A 2J79A 2WB5A 1J12A 4TVUA 1W9PA 4JFSA 1E4NA 5IHSA 1EHAA 2JF7A 1KGXA 4XB3A 1ESWA 4HMEA 3WUEA 3KZSA 1QHOA 3BAWA 2VZTA 1NARA 1UYQA 5GQBA 4M8UA 3B8SA 2WNWA 2A3EA 3WF0A 4S3KA 7TAAA 5EFDA 1CDGA 1KCKA 5BCAA 2D0HA 3CLWA 4LYRA 4WF7A 5I6SA 1NQ6A 4MDPA 2E9MA 3AFBA 3W81A 1US3A 2ZE0A 3AHTA 3AIBA 3ECQA 2WSPA 4Z2LA 3WENA 4M29A 2G4FA 3SUSA 5A6BA 2VRQA 3WH6A 5GNYA 1UHVA 1QHZA 2GVYA 4MJ4A 2YA1A 4HA1A 1J0JA 5A6LA 1XCXA 2GJXA 5M17A 1GJUA 4P7NA 1MW1A 3RIKA 3F5KA 4AYSA 2XG9A 1BYDA 2X2YA 3VDAA 2EQDA 4A3YA 3WMCA 1V08A 3ARVA 2X0HA 1TR1A 2JIEA 5I79A 4AD3A 3WD2A 2QLYA 4ZENA 5HNNA 2QPSA 2XVLA 2WVVB 1JYNA 4D6DA 4AIEA 3VD5A 3VIMA 5A6KA 3UG4A 3CMJA 3MMWA 4Z2HA 3W4RA 1DWHM 2BHZA 3WF4A 4GPNA 4MPKA 2XSBA 1E71M 4M80A 1BPLB 2X0YA 1E3XA 2GJXB 4AEFA 1VFUA 4FMVA 2J75A 4AD1A 1KBBA 5ABFA 5EB8A 2DEPA 1U33A 2VX4A 3ZIZA 5A94A 2CESA 2WKLA 1WDSA 1UZ1A 1H0IA 5LYRA 2DSWA 2OSXA 5LA0A 1LG1A 4J7RA 3ZSTA 2J62A 1C7TA 2CBVA 4QLJA 1GNXA 1B30A 1RP9A 1V3KA 5JIPA 3THCA 1JZ2A 5FCZA 1MFVA 1OBAA 3VD9A 3W29A 1WP6A 2J7CA 5D8ZA 4W88A 2FDMA 3BCFA 4AZIA 2W92A 1W9BM 4J3VA 1Y7VA 2E4TA 3TOPA 5CGMA 5HBFA 3UCQA 7A3HA 1F4HA 2NW0A 2ZX7A 2W91A 4J3WA 2FGZA 3W27A 5HPCA 3VDCA 3CHFA 3M07A 4CU7A 3CUJA 3CZGA 1QNPA 1SYTA 1WZKA 2WMKA 4H8UA 4A3HA 2V5CA 3II1A 5FD0A 1DHKA 1WZAA 1UR4A 2CHOA 1JAEA 2VQTA 4WSKA 7CGTA 1QOXA 5I0DA 1WPCA 3VGFA 1OGSA 2ZUMA 1VRXA 1V6XA 1UH4A 4TVCA 5A6BD 4D6GA 1QBBA 2J8FA 4M82A 1J01A 3OLGA 2E9BA 1GOMA 4W7UA 4AWEA 1W9UA 3SCOA 3VIGA 1JAKA 3WUGA 4EK7A 1H4PA 3PZOA 2JE8A 3WF3A 1HKKA 3VO0A 3ARUA 3VGDA 1NWRA 2WHLA 4AZHA 1XH0A 2RGMA 1UWSA 1UKSA 1JFHA 3ARZA 3ARSA 3WNLA 2XPKA 5C70A 4W8BA 3UETA 3S6TA 2CIPA 2ZX6A 3N18A 3WD4A 1V6VA 4GXPA 1V3JA 4PMVA 3NJ3A 4WKAA 1DWJM 3WD1A 2VMFA 1WB0A 1H2JA 2QHAA 2PBOA 2WMGA 1KFWA 1JL8A 1QNOA 3VGEA 1J18A 4MNJA 4P8WA 2VCAA 3BAKA 1LL7A 1H49A 1XYZA 2XIIA 5F7UA 3AOFA 2O9TA 2DSUA 3CO4A 5E6ZA 3SEPA 3POCA 1CGWA 3AYSA 1ZB5A 2YBTA 4GQRA 1EDTA 3W0KA 1AMYA 1NWSA 1HKJA 2EPNA 3NDZA 1WAWA 3AROA 1W1TA 1HKIA 1WE5A 1E4MM 2GK1A 2D0FA 1R85A 2GSJA 3ZR6A 4U33A 3GH7A 3CBWA 1C8YA 1CGYA 3O6AA 4JAWA 3CTTA 1IZJA 3ZJ7A 5BROA 1KGUA 2XM2A 4CU6A 1JDCA 3SUUA 1QBAA 2GDUA 4Q22A 4V27A 4D1JA 2DIEA 3AHVA 3WELA 2WCAA 1UH2A 1VEOA 5E0FA 3FW6A 2E40A 3VDBA 3SCQA 2B31A 4PUEA 1ZS2A 2FGLA 2D3NA 1GHRA 4FLOA 1OIMA 3U5UA 1G0CA 2YDQA 4XV0A 4J28A 3PZUA 3PZ9A 4LQ1A 3AXXA 4HU0A 1ISYA 2PB1A 3AQUA 1KQZA 1ECEA 1FP9A 3MO4A 1PIGA 2VT0A 1WO2A 3WUBA 3SCVA 4JFVA 4UFIA 4EE9A 3K8KA 1NP2A 1J0ZA 1B2YA 3JUGA 3VIPA 1GOQA 4WKFA 3GXMA 3K46A 1H0GA 4H04A 5C71A 3N15A 1HP5A 2PI6A 1DP0A 3OIHA 1PIFA 4HA3A 2WBKA 5BYWA 3KE0A 1L0PA 1VIWA 1UKQA 3TTYA 2BXYA 1PX8A 2WPGA 2YKKA 3K8MA 4V2XA 1JYXA 2ZUSA 1P6WA 1WZLA 5A6MA 2WCGA 3W25A 3QOKA 3FHQA 1QNRA 1HJVA 5A1AA 1E43A 4QLKA 2BS9A 4HOXA 2BVYA 3WD3A 2WMHA 4PN2A 2VVNA 3ZSSA 1IV8A 2IUZA 1UWRA 2XIBA 1W3JA 1UUQA 3B9DA 3WSUA 2V3FA 4QAWA 1G5AA 2X1IA 4D6HA 1EOKA 3OA5A 5JBEA 4UFMA 4UQCA 2DH3A 2YL6A 2WBGA 4AY1A 1AQHA 1MW0A 4JL2A 3GXIA 4WLCA 4R5EA 1NOWA 1UD6A 2CITA 2DH2A 4E2OA 4TX6A 1W3HA 4M81A 1XSKA 1RD6A 4M1RA 4PUDA 4HZ6A 1EO7A 1EQCA 5FKYA 3BH4A 4JL1A 1VENA 1V3MA 2VC9A 2VZSA 4PBGA 1MYRA 5FL0A 2ZXQA 3TONA 3WDQA 4JKKA 2VCBA 1IT0A 3IK2A 4J3SA 3FAWA 1RH9A 4W5ZA 2CEQA 2VOTA 3WMBA 1HT6A 2QMJA 5GNZA 2YBUA 3WKZA 2QMKA 4N0RA 3VIOA 1XSJA 1JGIA 1LWJA 1NOFA 1DWIM 3PZIA 1JFXA 1R86A 3W82A 4W8AA 1BHGA 2J25A 3POHA 4UFKA 5A8PA 2XVNA 3VUPA 2BY0A 3BMWA 5IHRA 1OB0A 2F2HA 3EDEA 4JFTA 3T2OA 3F4VA 5CZKA 4OZOA 2YL8A 2G3NA 1E0VA 4MAZA 3T0DA 4MTVA 5GPRA 4L4OA 4RE2A 3BXWA 3OLEA 1TCMA 4CD4A 1ITCA 2PWGA 3OZPA 3WDRA 1OSEA 1S46A 2CHNA 4NRRA 1JZ5A 3BAYA 3QOMA 2EEXA 5A8OA 4U3AA 4B16A 2PF0A 4UQAA 2YDRA 1E4IA 4U31A 1KWGA 2CXGA 2ZWZA 3W6MA 4B9YA 1UA3A 2UWFA 3GZAA 3RJYA 4CD7A 1HVXA 3VIFA 4ZFMA 1ZJBA 2BVTA 4AZBA 3GYCA 4PMZA 3WL1A 4HOZA 2G3JA 3BGAA 1A47A 3VPLA 4HA4A 1PZ2A 3G6MA 4RL3A 3W37A 3OB8A 4MADA 2J4GA 4C7GA 5ABGA 4P7RA 4CKQA 4GQQA 3AMGA 4YHGA 1K9DA 1JYVA 2DIJA 5A2BA 3KWXA 4TXEA 3WQVA 4GO9A 4D72A 1XD0A 1V3HA 2O9PA 4UOQA 3VGGA 4CU8A 1JZ8A 1UD2A 2WWDA 3A47A 4PMDA 4MB3A 1D7FA 1FFQA 1EDQA 1C8QA 3VU2A 2WAGA 2WW5A 4OOUA 3TP4A 3SCPA 3GDBA 2J78A 3ZT7A 3VX1A 4Z2KA 4PMNA 2WVTA 3K1DA 4BA0A 2OYKA 4AZ6A 1M01A 3MSDA 4KRTA 3WH9A 3BLPX 3WNKA 3CMGA 2Z1SA 1C7SA 1Q6EA 5CPQA 4TOQA 1ZBVA 2ESCA 1CZ1A 1C3FA 1JD9A 3NDYA 1QI0A 3B9AA 3RPMA 4PCTA 1H1NA 3SCRA 2FHCA 3L2MA 3L4VA 3MKKA 1E6QM 2OYMA 1UKPA 3AS1A 5D9NA 1EXPA 2F61A 4ATLA 4OUEA 3SURA 1W1YA 2X05A 4H7VA 2WXDM 1JZ4A 1B31A 4B15A 1KB3A 4MJ2A 3T0BA 2WVVA 4BZYA 4URIA 2CKRA 1PX4A 1RP8A 4J3TA 3I3EA 3CZ8A 4WJXA 3WQ8A 4GO8A 1J0KA 2WKGA 4PYSA 1XCWA 5I5RA 2PBGA 1B3VA 2YLAA 3CPUA 3VGBA 4DUXA 1XV8A 3EDFA 1V3IA 1HN1A 1O6IA 2YL9A 2YDSA 2EJ1A 4U2YA 2OWXA 2OWCA 1CLXA 1R7AA 1KCLA 1XH2A 3GH5A 4BQ3A 5I23A 3I3DA 1CXEA 4V28A 1BLIA 2VR4A 1UG6A 1H3GA 1D3CA 4JKMA 2J8GA 4F8XA 1W91A 1R8LA 1B0IA 2E9LA 4P8XA 3EDJA 1NOUA 1W9VA 2ZUNA 3AXIA 2WK2A 3VGHA 2XWDA 4LPCA 1PAMA 1E6ZA 1GQIA 4JCMA 5D4YA 3VD7A 3WBAA 4PCSA 3L4YA 3SIMA 4UQDA 1OCQA 5DMYA 5A8MA 3ALFA 2XWEA 3AS2A 1XC6A 3ARPA 4HPHA 3K8LA 3RJXA 2WC7A 2FH6A 4ZXLA 4HU8A 4LYPA 1V0MA 3VM5A 3N13A 4K68A 1LF1A 2WMIB 5BWFA 1BGGA 2VO5A 2VR5A 5D9MA 2VZUA 5HDRA 1E3ZA 4E4PA 2EXOA 1ZBCA 4BS0A 2WMJA 2PWEA 1SFSA 1E6NA 2FH8A 3LMYA 1HF6A 1W1VA 1PPIA 1J9YA 3N04A 3SUTA 3VMPA 4AISA 4J27A 3FY1A 3ARTA 4HPGA 1W1PA 3FXYA 4JFUA 4BQ5A 2EO7A 2ZXAA 4W87A 1ZU8A 4X9YA 2GDVA 4ML4A 5JIWA 4P7LA 2V3DA 3MV11 4D6EA 4D6FA 3ZQ9A 4ACYA 1EH9A 3WNPA 1Q6CA 4B9ZA 1CNVA 3OLIA 2VQUA 3E1F1 2IXVA 1W9XA 3D5HA 1DWAM 2G41A 4Z2JA 2PWHA 1LL4A 2WLYA 3EDKA 3W28A 1UZ4A 2J47A 2WYSA 3EMZA 3GM8A 3WQ6A 2EBNA 4D71A 1E9LA 1GOKA 3IANA 1LG2A 3IJ9A 3W26A 6TAAA 4DUVA 4MNLA 4B3LA 2VX5A 1VJZA 3FAXA 2NT1A 4H41A 3OGRA 4JIEA 1MQRA 3UEQA 5GNXA 1CLVA 1TFVA 5A6JA 3CIVA 3MUIA 4GI6A 1NP0A 3AIRA 2DT0A 5EBAA 2O92A 1W2VA 1VAHA 5CSYA 3AIVA 2OLHA 4HOWA 4DWSC 3VX0A 3VILA 5IDIA 1PZ3A 1R87A 4AD0A 4AMCA 1CXLA 1K6AA 1NM9A 1XD1A 2J74A 5A6AA 4UZUA 3T2PA 2VUYA 3UG3A 4D6IA 4RE4A 2X09A 1BAGA 2ZX9A 4UFLA 2AMGA 4D6CA 5FIPA 1V0NA 2ZIDA 4MNKA 2ZUVA 1MW3A 4H8HA 3A4WA 5DFAA 3WN6A 1E6RA 1OD8A 1VJSA 2J7HA 3DYMA 4AZCB 3AISA 3BAJA 4PRWA 4HMCA 1MVYA 1WDPA 2OWWA 2C0HA 1HJUA 2FHFA 5A8QA 2W62A 3SCWA 4YPJA 1JXJA 1V03A 4UQ9A 4U3CA 4NF7A 4F9DA 4AD5A 4Z2IA 4TX8A 1E0XA 1X1NA 3M6DA 4JKLA 2DDXA 1KXHA 2VJXA 1IZKA 2BXZA 3AIQA 1CGVA 4H8VA 4AIOA 3GBDA 2CCRA 1FH8A 3WY1A 4TTGA 3W38A 1BFNA 4BQ2A 4ZE5A 4QFUA 1FP8A 1XSIA 2D1ZA 5E6YA 3WEMA 2XFRA 3BMVA 1HJSA 2J7EA 3QGVA 1I75A 3ARQA 3HJEA 3O9NA 2YLLA 4EAMA 3PN8A 1K9EA 1M7XA 1VFFA 2G3MA 4GIAA 2XYLA 3F5JA 4H2CA 1CECA 1V3LA 1B3XA 1QHPA 1CBGA 1LQ0A 2BNJA 2BY1A 3UR7A 2EPLX 1CXIA 2ZUTA 4DM2A 5BXRA 1GPFA 1YHTA 3CUIA 1BF2A 3NYDA 3WF1A 4D1IA 1K9FA 1BTCA 1CYGA 4HMDA 2FHBA 1B1YA 1VBRA 1TG7A 4W84A 1MW2A 1BYBA 1U2YA 1CGXA 4JFWA 4N42A 4GZIA 1Q6FA 2G3IA 1UWQA 1J10A 4NZCA 1I1WA 3WDHA 1W3KA 2E3ZA 3IJ7A 1VEPA 3L4WA 3THDA 3AS0A 5E09A 1CIUA 2DT2A 4UFJA 3U7BA 1TVNA 1ZBKA 2CYGA 1G94A 3PZNA 1AQMA 3ZM8A 4X0VA 3AXHA 3QHNA 3OG2A 1EDGA 5KEZA 2VZOA 2VX6A 3LPOA 3WEOA 1GOWA 1UQZA 3EMQA 1E15A 1U30A 4OKDA 3MSGA 4AXNA 1FHDA 3A6OA 3ZJ6A 5IXEA 1MWOA 1L8NA 5A2AA 3LPFA 4LYQA 3MMUA 3VIJA 1JZ7A 2UY4A 3BAIA 3ZMRA 3OBAA 5LA1A 2VL4A 5CPSA 4GZJA 5E0CA 1C90A 4Y7EA 2XFYA 1BVZA 1VBUA 5HXMA 1QW9A 3VOCA 3CHDA 1BYCA 4OBSA 3WNMA 5A69A 3AMKA 4HTYA 3LPGA 2DPEA 3U5YA 3CH9A 2D2OA 1R7OA 2ZX5A 2WZIA 1ISXA 2MANA 3AI0A 1BGAA 2AAAA 1GQKA 3FHAA 2JF6A 1QNQA 2XSAA 3BCDA 1UQYA 4JHZA 4P7OA 2Y8VA 4QCEA 1ISWA 4DWSD 4AZ7A 3WDIA 4MB1A 3ZOAA 1WKYA 5ABEA 4OBRA 5E9AA 5M5DA 3L4UA 3GXFA 2D22A 2TAAA 4AD2A 3M7SA 2A3HA 2IXUA 1GORA 2WSKA 3CHEA 3RDKA 2ZX8A 1UR9A 3L2LA 1WCGA 4ZXOA 3T08A 3N1AA 2O9RA 3WQ5A 2D20A 3L4TA 5CG0A 3VD3A 4UFHA 2DSKA 4M56A 2XM1A 3OLDA 3AIUA 3AZRA 4PTWA 2WZHA 3KL5A 3WNNA 3A4AA 6CGTA 3SUWA 4ZE4A 2BHYA 3RCNA 3ARYA 5DEZA 4AW7A 1SMDA 3MUAA 3GNPA 2WHJA 3TA9A 4KGJA 1KXQA 4ACZA 1KR1A 1N82A 4CD5A 1CGUA 3KL3A 2CKSA 2Y4SA 4PMQA 3WH7A 2Y2WA 5I77A 5I78A 1MXDA 3RMEA 4FF5A 4PSRA 1ODUA 1LL6A 1X6LA 3VINA 1JDAA 5EMYA 3IAPA 3MS8A 2ZUUA 1ITXA 2YL5A 2PWFA 1HXJA 1TZ7A 1WNOA 1GOIA 3GNRA 4F66A 1JZ6A 1BSIA 3PZMA 2JIWA 3AHXA 4J3UA 4P7QA 1UR2A 1C8XA 4PMUA 5D9PA 2BVDA 3PTQA 4ACZB 1CXFA 3UESA 4AEEA 4W7VA 2CERA 4IISA 1ZBWA 2HVMA 4F9JA 2WVUA 3T2QA 3MANA 4LGXA 2EPMX 3CZKA 4U5KA 3VNYA 1MFUA 1UKOA 4XX6A 2YIHA 3MU7A 3HMCA 4C7DA 1HP4A 3WFZA 5TD4A 1EOMA 1EA9C 3U7VA 3GH4A 3NCOA 3ARRA 4UQEA 1E6XM 4CN1A 4ATWA 4U2ZA 2Y8KA 4L4PA 3WUFA 3WEZA 2WVSA 1HKMA 3BSHA 1BYAA 2W4XA 1OT1A 2W5FA 3ALGA 3DC0A 5KZ6A 1BVNP 3AIWA 3OGVA 5CGTA 3VD4A 1V02E 2D23A 4PMRA 2DSVA 4KH2A 4BQ4A 4X0NA 4MDOA 6A3HA 4HP5A 1LJYA 1UKTA 3IJ8A 3IAQA 5AYBA 3WDJA 5M03A 2CNCA 1GCYA 2W63A 2BV9A 1DTUA 1WDRA 3ZT6A 1J0HA 4HZ8A 2DGAA 1G9HA 1E56A 3AHZA 3VMNA 1FA2A 2GJPA 4MNMA 5M3WA 1UR8A 1E1FA 4PMXA 4UNIA 4QLLA 2CETA 3W6LA 1I1XA 3S2CA 4FLSA 2CBJA 1MQQA
chains in the Genus database with same CATH superfamily
3A3WA 4YLWA 2HISA 2QF8A 2EPHA 1RALA 3NL6A 3W7PA 1RQHA 3QXBA 4UCFA 1MXGA 2HNEA 1US2A 3CWHA 2QPUA 4BCEA 1NSJA 4NAEB 3A24A 4BF7A 2OX1A 3FNDA 3G6LA 3S46A 3YPIA 2B81A 3BLFA 4PTXA 1J0YA 3NL5A 3OO2A 4PR4A 4E2DA 3UJRA 2WPBA 3GTFA 1LWHA 3AJ7A 3FJLA 3IIXA 2O0TA 4OHQA 3UFYA 4PSPA 4LS1A 1UA7A 1KCXA 4W86A 5D02A 4P8VA 2ASHA 2W67A 1IXOA 4ZB2A 2D73A 3S1WA 2HROA 4XD5A 1GJWA 5A6TC 5HJLA 4MFDA 3FDKA 1QI5A 4CGTA 2J6VA 4P2VA 2F7FA 2Z4GA 2DZVA 3IIVA 4EXQA 3ONCA 5LNSA 2CBUA 3NEHA 1Q8JA 1W6TA 3CS2A 4XISA 2OQHA 5LHFA 2L5HA 3N9KA 1EZWA 2YA2A 4Q4OA 1H7NA 3R12A 4PGLA 3V36A 5FACA 1EO5A 3W75A 1EGZA 1U83A 3W24A 1PKLA 3T09A 5MKGA 3BLKA 5CLTA 2V3GA 2PDXA 3VVGA 2QJGA 3WQWA 5ABFB 3A5FA 1QFEA 3DHPA 2B7OA 4HCDA 2EG6A 3U2OA 3RO6A 1XGZA 3UY7A 1MNSA 2DV0A 1F4AA 3PPCA 2GYIA 3PWIA 2XHYA 4V1YA 5IFPA 4GVHA 4ZQRA 4MYAA 1M04A 1M7OA 1JNDA 3O16A 1RZMA 3QLDA 1TA3B 4JYEA 2V81A 3IIOA 1HIZA 5ECUA 4A3UA 3PJXA 2PDLA 1AVAA 2H90A 4AIUA 3S1UA 4FF7A 1L6SA 2J77A 4HNUA 3W87A 1OIFA 1OX6A 5FF0A 3SCUA 1GONA 5HNTA 4DAIA 3N17A 4K8GA 4NZ3A 1QCWA 3DFQA 3CUHA 2NX9A 2ZC1A 2CW6A 4AZ5A 4RNHA 5HPOA 2KX9A 1OFDA 2ZTJA 1XBXA 4RX0A 4XUYA 1QT1A 1UUOA 2Y7FA 3P5ZA 2A4AA 7PTDA 2F8QA 1MEWA 1XIIA 2E6DA 1QI2A 3FEQA 1TYGA 2ZWYA 4PL1A 4S23A 1KWKA 3OA3A 3E0FA 5LNWA 2RH9A 5K9CA 4DWSA 2PGWA 2VM8A 1B57A 1TV4A 1V6WA 4Q6XA 4GRSA 1ZL1A 4AC7C 2BODX 4W89A 2FB2A 3NPUA 3K4DA 3TFCA 4AC1X 3B3DA 2IQTA 1AJZA 3WF2A 3DOPA 3B0XA 4UQBA 4C6LA 1HVQA 3UR8A 1TWSA 3LV6A 5AZ0A 3R11A 3QZAA 3MUY1 3GXNA 3EXRA 4HK5A 4C6FA 3WNOA 2BHUA 3NOYA 4C7FA 2ZA2A 3AMLA 4PUJA 1IZCA 4GY7A 1YYAA 3SCSA 3NXFA 3KBWA 4JDYA 5AVNA 3HFTA 3QHMA 2DUXA 3KOFA 2RJHA 3PS7A 3WFLA 3P14A 3EX2A 3LOTA 4PMOA 4RJEA 4LUJA 1P7TA 2ICSA 1V6YA 4DQWA 4XUGA 4GQ0A 4LUIA 2OU4A 3SBFA 5CLWA 1QW8A 3BW3A 1B4KA 4DYKA 1QUMA 1M1BA 1E70M 3LPPA 1W2PA 3DHFA 1YNQA 1ZJAA 4DYEA 3ANUA 1LBLA 1PDYA 1A50A 2RAGA 3L65A 3LV5A 1V0KA 4TVDA 1ISVA 4FOJA 2VRKA 3QV6A 2NVDA 4A8NA 1JDDA 4JGDA 5G4WA 3RLGA 3TQVA 3TTQA 4NILA 2ACUA 2OVLA 1OADA 3VNJA 1YKWA 1XIBA 3Q4DA 3LHWA 3EWYA 3CQKA 1XC4A 1DWGM 4IPLA 4M5PA 3URBA 5CSSA 3A4XA 4NJIA 3BOFA 4MUZA 1M03A 4PUWA 1R46A 2WJFA 3ZVIA 5DF0A 4IGNA 3KOYA 3PZGA 4XZIA 5ABTA 2V0TA 4DJEA 3KBSA 1NQKA 4YHEA 1H11A 3A21A 4GJ1A 4RDWA 4UTFA 3BARA 1G4EA 1TJPA 2E09A 1Z9AA 1NWUA 3B8IA 4B3KA 3WIJA 1AH0A 1V0LA 2QT3A 1XP3A 3LCFA 3HIJA 2X30A 4GYPA 1A3HA 3M0XA 4W93A 2HSAA 2XGBA 1D8WA 1JDFA 3GIYA 2BOEX 3OGSA 3TLQA 4GI8A 4NUWA 3C52A 3EEGA 2PCEA 4Z2GA 2YJQA 3FN9A 3EX4A 2J7FA 3CHCA 1ZFJA 1O7AA 2VRJA 1KM3A 3D3AA 4BKNA 1W0MA 4P61A 2QJMA 2P8BA 3R1ZA 2NUWA 2RDXA 3N73A 4QG9A 3P80A 3W2LA 5D2XA 3CGTA 3S5ZA 4UUIA 4M0XA 1A5OC 3T9PA 4HU3A 3O2LA 3H2FA 1W3LA 4LC8A 4W7WA 2EPKX 4H9VA 3PTMA 3ZYZA 4NRSA 4RW3A 5HQMA 2XFFA 3EGJA 1ADSA 3UXIA 3GTHA 4GNKB 1QI4A 4CVWA 1B90A 1FVPA 1YXCA 4PTVA 3KLKA 4MM1A 4CCCA 5F1VA 2X1UA 2V5DA 4F79A 3W7HA 3A9BA 3WLKX 4JQ1A 4QG6A 4JIIX 2NVAA 1PX3A 5C7HA 3KHDA 2DQXA 3GXDA 3KBVA 1HJWA 3E38A 5DT7A 1TJ2A 2ZRUA 4Z1YA 2J79A 2WB5A 1J12A 3M9YA 1W9PA 1DQUA 4A29A 4XAGA 4YCOA 1KFBA 2QCEA 1EHAA 3TXVA 4F0RA 3KZSA 2V5BA 3GG0A 3UXAA 3GFZA 3HGRA 2V2CA 1QHOA 2VZTA 3T78A 4A8IA 2QYGA 3SJ3A 1UWAA 2PP0A 3AXKA 4LYRA 1TV3A 5LIXX 2ZCGA 3AHTA 5EU9A 3VAVA 4NY2A 2Z1VA 3AIBA 3ECQA 5HJXA 3UXLA 3FVDA 4Z2LA 3CXOA 2BTMA 3DKJA 2G4FA 3SUSA 3T1GA 2GVGA 4DX3A 3DI0A 3RFAA 1UHVA 3LBMA 5DRCA 2JKPA 4HA1A 1J0JA 3CPGA 1I4NA 1REQA 4HJWA 3MPGA 1XCXA 5M17A 4OECA 1S38A 1BYDA 2X2YA 2EQDA 1I9CB 4A3YA 3WMCA 1V08A 3IARA 3OU8A 3WQPA 1F6YA 2ZZ4A 3WD2A 2QLYA 2YB1A 4ZENA 4UTIA 2XVLA 2WVVB 5CBJA 4NNBA 1FWTA 3CB3A 2QJHA 3W2KA 4Z1DA 2E1WA 4Z2HA 1DQXA 2DIKA 3W4RA 4LY4A 2HK0A 3WF4A 2NSOA 4MPKA 2XSBA 3QKEA 1E71M 3C0QA 3DFNA 4JYDA 2LLEA 2YCLA 5JH2A 2VD8A 1LLWA 5DCDA 4TO8A 4DZIA 1HGWA 3EX3A 3UGRA 2GSHA 4QISA 2PWVA 1U33A 2HNHA 1H62A 3CB8A 2INEA 4AWTA 5LA0A 1LG1A 3HGSA 1O5RA 1DIOA 4GVIA 1A4LA 1B30A 4ERIA 2Y5SA 1OBAA 1T41A 1Q6RA 2QPXA 4AU0A 1XLGA 1DTNA 4FNTA 3QJAA 4LSBA 1LOLA 1N55A 4TX9A 1Y7VA 5HBFA 5CBIA 3UCQA 2NW0A 1WOAA 3K4WA 1VHNA 4HN8A 5HINA 4NU7A 1FWHC 3VDCA 4CU7A 3B04A 1IF2A 1K7XA 2PDWA 1TZZA 4WY0F 2WJDA 5FD0A 1WZAA 1P6CA 1F6PA 2CHOA 1GTEA 3A64A 3E49A 2R24A 4J4KA 2Q6ZA 4V1XA 1IXPA 3L0GA 4HQVA 1XKJA 1OGSA 5DY3A 3IEBA 1VRXA 4TVCA 5CZSA 5DY2A 3OLGA 1GOMA 1OF8A 5I09A 4EP8C 1JAKA 3WUGA 4EK7A 3U3HA 1XLIA 1U5JA 3WF3A 3VO0A 1RVGA 3LEPA 4ZFCA 5H91A 1IEVA 1E9ZB 3W73A 3FV9A 1A5SA 4W8BA 3UETA 4XKMA 2Y8UA 1PHWA 2EF9A 4LUSA 1DIDA 4S2CA 4GXPA 3ITVA 2FB3A 5CG7A 4M6VA 3UW6A 4ML9A 4FNSA 3NJ3A 3WK3A 4MUPA 3WD1A 1X96A 3R43A 3NZPA 1BSLA 1W5OA 4JQ3A 2PC4A 3O6YX 1XUZA 4P8WA 4QG8A 3AOFA 3AYTA 4B4HA 1RLCL 4PZVA 1JRBA 3CO4A 3S6DA 4H7ZA 4E5TA 2HCVA 2AL1A 3POCA 3AYSA 2YBTA 2IPWA 3W0KA 2CLIA 3KCJA 1K02A 1OQFA 1HKIA 1E4MM 3W1XA 1XQLA 5EYWA 2GK1A 2Y63A 2D0FA 4EX4A 1EX1A 3GH7A 4NHVA 1C8YA 1SJAA 1IZJA 2DU2A 3KBJA 5HQEA 4D1JA 4AEOA 2DIEA 3BOXA 1OFPA 2WCAA 1UH2A 1VEOA 2PRHA 3FW6A 2E40A 1K7EA 3LCXA 2IQDA 3ZR4A 1ZS2A 1MUWA 3U5UA 5I7GA 4CQCA 1XLBA 2YDQA 4LQ1A 3AXXA 3GNNA 4UTLA 1R3QA 3VKDA 2CFFA 2PB1A 4O13A 3AQUA 2YW3A 3LUTA 5BRBA 4E4UA 3WUBA 1TPVA 3SCVA 3PR2A 1J0ZA 3W1RA 3JUGA 3VIPA 1GOQA 2I1OA 4WKFA 3EKZA 3UWQA 4H04A 5C71A 3TE9A 3O6CA 3RX2A 2OLSA 4I6KA 3BGGA 1D9EA 1ENUA 3ABXA 3LYEA 1J93A 1VIWA 1F8MA 3TTYA 1PX8A 3V7PA 3DZ1A 4FX8A 3C56A 2RDUA 2WCGA 3W25A 3WK1A 3QOKA 3E3HA 3D3FA 1QNRA 1HJVA 3DAQA 1UIOA 3WD3A 4PN2A 1W3TA 4J35A 4IIFA 4GUHA 2AQWA 1EGMA 3GDKA 3B9DA 4QAWA 3UJEA 1DQWA 1EOKA 3OA5A 5JBEA 3MDWA 3TMLA 1W1B1 1KFLA 3ICJA 4UQCA 2YL6A 4HCHA 1AQHA 3W7QA 1MW0A 4OQVA 2OGJA 1KM2A 3BMXA 3H8AA 4R5EA 1BKSA 1NOWA 4ZO6A 1WAUA 3W72A 2GVJA 2QGHA 4HK7A 4M1RA 1Z6KA 2ZRZA 1K77A 2SFPA 4R53A 1VPYA 4ZZ9A 5FF3A 3GE7A 2PCQA 3HBLA 4PBGA 4PCPA 4C5YA 1LYXA 1M9HA 4XK2A 4IMEA 4NG3A 4JKKA 4Q4SA 3FGCA 3SQMA 1DXIA 3KCLA 2V82A 3R89A 2QMJA 4D8AA 3WKZA 4N0RA 3VIOA 4WDUA 4C91A 1R86A 3IJIA 1O5KA 1V93A 3KHJA 3FOKA 5CAHA 2XVNA 1H7XA 3VOJA 3T7VA 2WSQA 2QKFA 4MY1A 5FJJA 4GMEA 2V69A 2YL8A 1E0VA 5GPRA 3BXWA 3EOSA 3Q58A 1TELA 3H2NA 4CD4A 3MJYA 2DJXA 2C79A 3WDRA 1JZ5A 3BURA 3UZYA 2I5QA 4LCSA 4M7SA 1RV8A 4U3AA 2I5GA 4B16A 1TJ0A 1PWMA 3KAOA 4KCWA 3DH7A 3PANA 4QHRA 4IL2A 3VIFA 3BZGA 2WM1A 3KDNA 1KTCA 1P0KA 3SN0A 2UV8G 3FLUA 4D8LA 3H23A 3MSYA 5H8PA 4X9SA 1PZ2A 3G6MA 3OB8A 1SJCA 4C7GA 4JHMA 3HPSA 3TYEA 3CTLA 3GG1A 4GQQA 4YHGA 4AAJA 4GZ7A 4X22A 3R2GA 2VEGA 3KWXA 5CH9A 4O1DA 4D72A 3CQHA 1XD0A 3DGRA 1V3HA 5M1TA 4UOQA 3UXKA 1UD2A 1D7FA 4KWSA 1EDQA 4C6MA 1C8QA 4MLJA 2ABAA 2CLHA 2CU0A 3GDBA 2J78A 1TB3A 4Z2KA 4PMNA 3K1DA 1M6JA 1UMLA 5D32A 1M01A 3MSDA 1JCJA 3WH9A 3BLPX 3FCPA 1V79A 3CMFA 3CMGA 2FDSA 2GUUA 4TOQA 1X8CA 3WLIA 1CZ1A 4ALDA 1J96A 3CPRA 3V5OA 1JD9A 3QRHA 2ZDRA 3MCOA 1DBTA 1GKRA 1YMYA 1JDEA 3AYVA 2OYMA 2PDFA 3AS1A 2QVHA 2F61A 3N6JA 4XG1A 3QSTA 2YZ5A 4H7VA 2WXDM 1B31A 4G5DA 1EP2A 2DZSA 3IV8A 4PUNA 3KP1A 3HURA 4URIA 2CKRA 1UUMA 2PU0A 3AUOA 1N2VA 2VHLA 4AUBA 5I5RA 4G7EB 2PBGA 3TYZA 2CLLA 3TK7A 2YLAA 2Z1XA 2G96A 4C65A 1V3IA 2IQ0A 2QCDA 1XS2A 3B8VA 4U2YA 3DX5A 2HTMA 2OWCA 2Z29A 4XKYB 4LRTA 3KRSA 5HWNA 1UR3M 3LM7A 4DNMA 1RBLA 2VR4A 1UG6A 5CPMA 2J8GA 4BEUA 1RJQA 2INZA 5D33A 1NOUA 2QCHA 5TBOA 2WO5A 3V18A 4O52A 2AGKA 2XWDA 3U8GA 3BLEA 4DN1A 4S3FA 4HVXA 4DBSA 1ADOA 4Y9MA 1Q8AA 4R88A 3SO7A 3O1NA 5D4YA 2VD9A 3VKBA 2FPTA 1CLKA 3NO5A 3E0LA 2Y0FA 3OPSA 5J8LA 4S3GA 4PA8A 5AB3A 4Q4MA 4NKCA 1HTIA 3L4YA 4FHAA 3RN6A 4RXGA 1KD0A 5DMYA 3H7VA 2XWEA 3AS2A 3ARPA 1EGVA 4EPEC 3VM5A 3NL2A 5BWFA 1BGGA 1E3ZA 5CGQA 3TYDA 1QXLA 1SFSA 1NFGA 4DJDA 1PPIA 2W79A 4AISA 1VFSA 4J27A 3UWVA 3ARTA 2ZBTA 2EO7A 3LLXA 1NDZA 2V3DA 3MV11 1WQ5A 1ZCOA 3ZQ9A 3PFRA 4L9XA 3NVTA 2AL2B 3D5HA 1DWAM 2MNRA 5E9XA 3URAA 2X42A 4YVPA 4DBUA 1LL4A 4HHMA 3DEQA 2XN0A 1IGSA 5G2HA 1EP1A 3L0KA 4D71A 1E9LA 2YYTA 3ATZA 5LNVA 4UTUA 2VX5A 1VJZA 4GE8A 1OCNA 3FAXA 3T0CA 2NT1A 4JTRA 4JIEA 4JYFA 3WQOA 5JU6A 1MEIA 1TFVA 4N7QA 3CIVA 5C2CA 3HB9A 1XYBA 3MUIA 3AIRA 4J9JA 5D37A 2O92A 2DVUA 2PDNA 5E1QA 1VAHA 3QQ1A 1C29A 4HOWA 3VILA 5IDIA 1R87A 3UD6A 1RCXB 4JS3A 1PYFA 1NM9A 3F2BA 2J74A 1JGMA 5D03A 3T2PA 2C18A 3STFA 4ZQOA 2ZX9A 3UG8A 4L6DA 3M5YA 2AMGA 4AF0B 4D6CA 1TWDA 5FIPA 1RCQA 4KS0A 4H8HA 3A4WA 5CKSA 4IG2B 3WN6A 3SRHA 5IDZA 1VJSA 5HWMA 3DYMA 4AZCB 2I5IA 5AC8A 4PRWA 1S5MA 1MVYA 1TX0A 1LZOA 4QRNA 3VNKA 1JPHA 1WDPA 2FZ9A 3HJZA 5B7YA 1DIEA 2W62A 4Q8OA 4RNFA 4NL1A 4UQ9A 1JPIA 4B2DA 1SZEA 2VGIA 4O1AA 4TX8A 2F84A 1YEYA 1LBFA 3UA3A 3AIQA 5I06A 2FQIA 1IIHA 1CGVA 4F2TA 5TQLA 1W5NA 4AIOA 2CCRA 2ZKMX 4GQGA 4H6RA 2WJEA 3W38A 5AHMA 3PJTA 3V4BA 4QFUA 1HJSA 2J7EA 3LU2A 2YCKX 2O7QA 1EYEA 4EAMA 1M7XA 1VFFA 2G3MA 3F5JA 5HK4A 3OQ8A 3UR5A 1OK6A 2OOGA 4B4FA 1W3IA 1B4EA 2BY1A 5FA5A 2I14A 3DG6A 4RZ6A 2X1SA 1PXGA 4DM2A 1IT8A 2IW0A 4D1IA 1K9FA 1BTCA 1EYWA 3PG8A 3GDRA 3G1XA 1MW2A 4ICNA 3GG7A 4HKPA 4ZOAA 1Q6FA 2G3IA 2PLJA 4NZCA 4RLIA 3WDHA 1W3KA 5DANA 2FGBA 1GEHA 6REQA 3GLCA 1KCZA 2I16A 1M5WA 4RDYA 1PL9A 3P67A 3PAOA 2IKJA 5E09A 4ILSA 2XU2A 3SJNA 1JUEA 4UFJA 4L7ZA 1TVNA 5E0KA 4PB5A 4Q8VA 1G94A 3WLTA 3PZNA 1AQMA 1BQGA 3MHUA 1PCWA 3QHNA 2CHRA 4CQ9A 1EDGA 1ZP4A 4JX6A 1ONXA 2WV8A 2XISA 1X8FA 2X7VA 1I2QA 1O94A 2PS2A 5IOBA 3LCHA 5A2AA 3T40A 5BMWA 3VE9A 5D09A 2PDQA 3VIJA 4GOAA 4UBPC 2CLFA 3E9AA 1FHVA 5LA1A 2RFGA 3QQ0A 1P43A 1MRAA 1DJQA 4OTKA 5E0CA 3K2GA 1UIPA 2XFYA 4AMAA 4I8DA 1A53A 5LNRA 3TH6A 3WNMA 2PDIA 5A69A 5D2TA 3AMKA 3LPGA 2P50A 1R7OA 2FLIA 2MANA 1XGEA 1BGAA 1DJYA 4QITA 3O63A 1QNQA 2XSAA 3GU2A 1VFHA 1WA3A 4JHZA 4K38A 4HSHA 4N6FA 2G0WA 2PDHA 4DWSD 4AZ7A 3WDIA 2GJNA 4JY9A 4OBRA 3TLLA 2YDAA 4E2BA 1VCFA 5M5DA 3L4UA 3GXFA 4QM1A 4H7CA 3QQWA 3GVWA 3NQ7A 2A3HA 1GORA 2WSKA 3CHEA 3RDKA 4XQ6A 3ME3A 3WQ5A 1EWDA 3ABRA 2XM1A 4WVXA 1Z7AA 4XVEA 3AIUA 1XPGA 3RF9A 3KL5A 4XWUA 2QUTA 3NA8A 4LAZA 2F6UA 3L5AA 2E6YA 2Q8ZA 4JTTA 4AW7A 1NDWA 5CC7A 2WHJA 3TA9A 3ZLFA 4BFAA 4PMQA 2VKZG 1W1IE 2QF7A 5CCZA 3I68A 1A80A 1O5XA 4Y9OA 4PSRA 1NFBA 2D2HA 4JQ4A 4US5A 3VXGA 4LAMA 2Y1HA 4RZ5A 3MS8A 2ZUUA 4XSLA 2FMOA 1ITXA 1K1DA 4QE5A 1J4EA 2WNNA 2PWFA 4MWAB 4OE7A 2QVNA 3FKKA 3PZMA 1IEIA 2JIWA 4FS9A 4PMUA 3LZ5A 3VZZA 3UESA 1JCMP 4MF4A 3DUGA 4IISA 1ZBWA 1ZP3A 5XINA 4ECLA 3TU9A 4PUKA 1MFUA 4LEQA 3NOEA 3N3MA 2ADAA 3AWNA 3U7VA 3GH4A 4DELA 5C9RA 4UQEA 5LHEA 3GHRA 1XBZA 2OTDA 2D69A 3SQSA 1FY6A 1M65A 3IPWA 3ALGA 2W5FA 3B03A 3AIWA 1AUSL 3OYZA 3LSCA 4AVOA 3A5VA 4PMRA 1LCOA 3T07A 2B7NA 1F6KA 2CZDA 3EAUA 4CNUA 3L9CA 1PKYA 1UKTA 2ACRA 3IAQA 5M03A 1V77A 4H83A 1DV7A 4DJED 5KSWA 1J0HA 3TX9A 4HZ8A 3P81A 4XSMA 1XYCA 4DXKA 1J8VA 2XH2A 4IFKB 4QLLA 3W6LA 3M44A 4N9BA 2CBJA 4ZB5A 1Q65A 5EY5A 3T0AA 2A3BA 3VKCA 4LX4A 4HNTA 3ITTA 2OSYA 3WLMA 4J2PA 4OOZA 4JX5A 1J6OA 2DFAA 3WZ0E 5D2YA 3KTSA 4QNWA 3HF3A 2Q8XA 1E1EA 1GVIA 1DJHA 4G2DA 2GFTA 2REQA 2XVKA 1TX2A 2V5LA 1TPUA 1BRLA 1TJ1A 3RCYA 5LA2A 4B91A 1TV8A 1GHSA 1GQLA 2RJGA 3ZT5A 1GVQA 1E5JA 3TQPA 3M4HA 1KR0A 2PDJA 1VFMA 2YFNA 4ATDA 3NEVA 2ZXBA 3KRZA 4MLRA 4ZBCA 1MEHA 4XZBA 3EX6A 3GIQA 2GL5A 1Z32X 4F4RA 5FEPA 3MW7A 2XTKA 1BXCA 1KRMA 3SUVA 2HWGA 4LF1A 8RUCA 1BG4A 1KRBC 3FSUA 3V0UA 1OHLA 5C6MA 4M7TA 3A3XA 3KL0A 1P0DA 4UOJA 4QSFA 1WZMA 3GTNA 3DFHA 1ZALA 3TN3A 3R0KA 3TTOA 1T7LA 2D0GA 4QDMA 3AU2A 1TMQA 3QC0A 2WZEA 5HMDA 3REQA 5HANA 1UP2A 3V0TA 4GZEA 1KQYA 3TXZA 3BICA 3NQ6A 3L4ZA 3MYOA 4GD0A 1Q2RA 2JEPA 1TUFA 4IH3A 3IVTA 8XIAA 3VIKA 3C2OA 1UH3A 5T91A 1O12A 2ZRWA 3W1AA 1ICPA 1GZJA 2XVGA 1F3XA 2C91A 1IT7A 1UD3A 5EGRA 1ZUAX 5G2WA 3N11A 1O4UA 1W3NA 2BGSA 3NPXA 3AXMA 2IKGA 4WIWA 1FFRA 3RK8A 5AC7A 2EPOA 2DT3A 2D24A 3WD0A 2QUMA 5A95A 3KLLA 4MKSA 3NGFA 4L4MA 3GNXA 2FZMA 1QK0A 6TIMA 4DO6A 4RDVA 5DX7A 3AMDA 3CZEA 4A8LA 2WHKA 3L5LA 1Q6OA 3NYZA 3I7RA 4Y8FA 2E5CA 3LHYA 3WJYA 1JVNA 1XX1A 1I45A 5BRPA 1R0MA 4RE3A 4FX7A 4M1BA 4K2SA 4UTKA 1Q4NX 1W32A 3HA1A 5E93A 2PWDA 1KA9F 4K1GA 3V35A 2FJKA 1B9ZA 3EYPA 4HJFA 4ZEPA 3Q37A 4C1KA 2QV4A 4OJYA 3GNOA 3AYRA 1I2RA 4OT7A 4R27A 3SQLA 3GX9A 1ONWA 3Q67A 4WRHA 1UWIA 2R9RA 1EIXA 5FJIA 3EX1A 3A4JA 4DBEA 1QNSA 1I0BA 2VI0A 3LTYA 4C1LA 2A7PA 3TSMA 3N2CA 4LB3A 3AS3A 3RM4A 3N6HA 4UWMA 3C8NA 3WQGA 3G5EA 3QH2A 4IM4A 3WL0A 3RGTA 3CUFA 3OJGA 1PDZA 3JZEA 2VFGA 4LOCA 3PZVA 1B3YA 1I2NA 4POCA 2PP1A 5U7SA 3BANA 1E72M 3LHTA 1T5AA 2BWGA 3KX6A 1XBYA 2NUXA 6PTDA 1BWVA 3VE7A 4A21A 1E4LA 4GGBA 2BG5A 2GLKA 4GYJA 3W02A 2A3CA 1R2TA 2OPJA 1KXVA 4DWSB 3VI2A 5CZTA 1FXPA 5HNUA 1PEZA 1WXJA 5HUOA 3NZ1A 5AC5A 3QW4B 4EKJA 2HVOA 3EA3A 4IX0A 1CEOA 3HV9A 1GQJA 1VH7A 2E0PA 1A5BA 3GWQA 3LRMA 4FALA 1VRDA 3HQPA 2VX7A 3QR3A 4FNRA 5I3JA 4QE1A 4Q7NA 1ODZA 4LS0A 4CD6A 1TRIA 1WX0A 1J0IA 4L9YA 1LRQA 3BLLA 5J5RA 3I3BA 5EMLA 1JUBA 2V67A 3F4NA 3GUGA 2OZ3A 1PJ9A 5DRIA 3L2IA 2DUAA 3DECA 4YYCA 1BQCA 4O0QA 3WQCA 3FYPA 3AC0A 4S3EA 1NH6A 3BAXA 3NXLA 3H4GA 5JH1A 3UR2A 3W71A 3LNMA 4I9MA 2E8ZA 1AH4A 5A8NA 9XIMA 1B3WA 1IWAA 1MSSA 3CK5A 1L8PA 2QUNA 2BY3A 1L2UA 1NDVA 3BTNA 5AYXA 3BLIA 5I03A 2VENA 3EWZA 4HTBA 4Y6GA 2PD9A 3LRKA 2YPIA 3TYCA 3V1HA 1KNWA 2A6NA 4XZHA 1W17A 1SW7A 2JBMA 4Q33A 4S1FA 2PTWA 2D3LA 4HZ7A 2WM0A 3W7DA 1EHNA 3DDMA 5CQ1A 2V38A 1CWYA 1H51A 1J79A 3B4UA 5FEXA 3UWWA 5IFTA 1Q6DA 4I9TA 4A2RA 3SY8A 1A5UA 3RUBL 4X63A 1KM5A 2G8ZA 3VOHA 1HQTA 1I2OA 1JYWA 1ISZA 2Y85A 3VTRA 1H60A 2A85A 4GACA 4LUTA 3GDMA 2BGNE 3WDPP 1OFQA 3QGKC 1TTJA 1DEDA 3MUCA 3MWAA 1TUXA 1E0WA 3U2ZA 4GFSA 2VR2A 4DF1A 5LGXA 3V0SA 3H54A 4F3HA 2DZTA 4K8EA 3U57A 4FXFA 4NAFA 5DT5A 4K7VA 1XYFA 3VM7A 1K8XA 2CWXA 4G56A 2VGFA 1A5MC 1KKRA 4D6JA 1AG1O 4HYVA 5KITA 1FCUA 1NWTA 4DI9A 1RPXA 1LLOA 1PHQA 4IUGA 3GHSA 4IFOA 5FJPA 4HNNA 5I2UA 2PGEA 4IXXA 1HG3A 4EACA 1FHLA 3RHGA 2OO0A 4LAKA 1E6SM 4IIEA 8TIMA 4RV8A 3S47A 4UR8A 1HO4A 1GVYA 3LCWA 4MFEA 1FTXA 1UR0A 3O7UA 1OWQA 2WMFA 5E5CA 5EFFA 4MSSA 4DUWA 3XINA 3NSNA 3D6NA 3F5LA 3WFAA 4BHYA 3NSMA 4LNYA 3MVIA 1DE5A 4A35A 3BC9A 2A5HA 4IMAA 3TC6A 4KBXA 1HL9A 4LFYA 3H6OA 1XYAA 2C8NA 2VURA 1PZ0A 1TTQA 3OZOA 3A13A 2YXGA 1XXXA 3TQKA 4FOKA 3PZQA 3EXTA 3APTA 4F2BA 2CXEA 4ZL1A 3NM1A 4MVAA 4TVUA 5C9UA 4JFSA 1E4NA 3BOLA 4S39A 1ESWA 3EB4A 2QDDA 1A4MA 2WZMA 1Q45A 2C6QA 5BWAA 4DJFD 1NARA 3D47A 1UYQA 1EL3A 5GQBA 3R8GA 2C1GA 3JZUA 2IS7A 4ROQA 7TAAA 1DIKA 1JQXA 4WJ8A 4AB4A 2RHGA 4E0CA 1EC7A 3W81A 1US3A 4H19A 3PPFA 1DJWA 3NZRA 1SJBA 1U1UA 3MSRA 2A7NA 2WSPA 3BSMA 3FS2A 2ZTKA 3JS3A 5CAKA 2VRQA 3VCCA 3WH6A 4H6EA 1QHZA 1ITQA 4MJ4A 2DZAA 1EJVC 1U5VA 1KM4A 5BW6A 2GJXA 1GJUA 1MW1A 3RIKA 3NTYA 3V75A 2PLCA 3SN4A 5IBXA 4BI6A 1W8GA 1RD5A 4HSOA 3ARVA 3TVAA 4S3DA 2X0HA 3C0JA 4LU0A 3LCGA 5I79A 4AD3A 1XIFA 3N2XA 1JYNA 4AIEA 3U6WA 3UG4A 3CMJA 3MMWA 3PF3A 1K3UA 4H2HA 4GPNA 4O0ZA 3WJZA 1BPLB 3QF0A 2X0YA 1E3XA 4QEHA 2YFOA 4O11A 1VFUA 3BG3A 3UY8A 1KBIA 4Q8MA 2PTYA 1KBBA 2GGJA 5ABFA 4UTTC 3ZIZA 2OJPA 5A94A 2CESA 1ICSA 1WDSA 1JEZA 1UZ1A 3W7JA 2DSWA 3FEMA 2OSXA 3M5ZA 1JCYA 4J7RA 2OKTA 1ONRA 2PZ0A 4TIMA 4WCJA 1FWCC 5CBBA 2Z25A 3W83A 1GNXA 4NZJA 4DYJA 1T8XA 2H3BA 3MBDA 2OKOA 4E6MA 1JULA 3THCA 1JZ2A 4UTJA 2KZHA 4LWWA 2FDMA 5AHLA 3BCFA 2DW6A 3N34A 4AZIA 4IPIA 4M6UA 4MIMA 1XLJA 1W9BM 3HQNA 3FA3A 2E4TA 1TQJA 5CGMA 4KF1A 2ZX7A 1TREA 1K03A 3IVUA 3W27A 5HPCA 1OFEA 3M07A 3CUJA 1B3OA 2NZLA 1FKWA 1ELSA 3E5PA 1WZKA 3SRFA 1OK4A 5REQB 4A3HA 4JTDA 3H22A 2F38A 2V5CA 1EB3A 3R94A 1SZGA 2VELA 5A5WA 4HN4A 2VQTA 1P48A 1ZPTA 3G1HA 7CGTA 4RNJA 1EX5A 1QOXA 3PUDA 2QZRA 1WPCA 3PSVA 2HPIA 1N8FA 3QMTA 3SB0A 4D6GA 1QBBA 2J8FA 4M82A 2E9BA 3GVQA 4W7UA 4C6QA 1T6MA 3STPA 3EPNA 3SCOA 3E6EA 1HKKA 2CZVA 3VGDA 1GG1A 2YSWA 2W0UA 1UWSA 1SW0A 1UKSA 3PTDA 3TUUA 3WNLA 4GBUA 2XPKA 2CZ5A 4W9TA 2BMBA 3OQEA 3S6TA 2ZX6A 3MP3A 3S5YA 1J2BA 1UJQA 3WD4A 5KZMA 1EC8A 2CZFA 4IMFA 1DWJM 2E68A 2VMFA 3EKGA 3F4CA 4GY0A 1JL8A 1QNOA 1J18A 1MXSA 1H49A 5F7UA 2O9TA 2DSUA 1F73A 3SEPA 3UPBA 1ZB5A 1AMYA 3M0JA 3TAOA 1NWSA 1P5BA 1TCDA 1WAWA 3DHDA 3BO9A 3CHVA 3THUA 1WE5A 3HFYA 3RU8X 1PTAA 3UVIA 4LUSB 1K4GA 3TJIA 2EG7A 3CV6A 3O6AA 3SSZA 1E9IA 1D3HA 2XM2A 4WDWA 4CU6A 4DJDD 2DJLA 1JDCA 3T8LA 4U10A 5EL1A 3M0LA 4EXAA 4Q22A 3AHVA 2E5BA 1XWYA 4KIRA 4Y90A 3SCQA 2D3NA 1GHRA 2QS8A 3C6CA 4FLOA 3C86A 1OIMA 1S2AA 2J9ZA 4L5ZA 1QMLA 1BWLA 4Y8EA 1TZ9A 4FR6A 1AL8A 1BD0A 3MO4A 5H1WA 4O1EA 4H6QA 4GX8A 4C6BA 1NP2A 3S2NA 4ZOEA 3GR4A 1THFD 2NWSA 4KCVA 2PI6A 1W5QA 3LI0A 1LLZA 4HA3A 1Q6QA 1ZY9A 4UTMA 4IPPA 1L0PA 1UKQA 3EWCA 2QUVA 2GSEA 2AGTA 1JYXA 2ZUSA 1P6WA 3G1AA 1G7UA 5A1AA 4QLKA 3FYOA 5RUBA 3HPZA 1QAPA 3W7RA 2OX4A 1UWRA 1W3JA 4LTSA 1TPC1 3G77A 4MMWA 2X1IA 3M41A 4UFMA 3BUVA 4O16A 5EMKA 2TPSA 3GC5A 1TPWA 2ATMA 2Q3OA 3R0DA 4JL2A 3SDOA 4NNAA 2ISDA 4CCZA 5H8UA 3B8WA 4BEQA 3GRIA 7ODCA 4E2OA 1W3HA 2O55A 1EO7A 1EQCA 5FKYA 3SY1A 4DLMA 1S3TC 2VZSA 3WQFA 2A7RA 2D2JA 4H1ZA 4H9TA 4O15A 1BXNA 5FL0A 3WLQA 3LGDA 5LGZA 3TOYA 3TONA 3WDQA 4F2UA 2VCBA 1IT0A 3N14A 5CEWA 1RH9A 2CEQA 2VOTA 3WMBA 2YBUA 2PPGA 3C8FA 1RA5A 4MHBA 3TYBA 1NOFA 3PZIA 2A79A 4AIBA 5C9XA 4W8AA 3POHA 4UFKA 4JIRA 3VUPA 3HZ3A 3BMWA 5IHRA 1OB0A 2F2HA 3EDEA 2Z0IA 4JFTA 3T2OA 5CZKA 4JNMA 4MAZA 1YDVA 5AYZA 4CNTA 2PTDA 3HV8A 3N3TA 4UMCA 3W1UA 3OZPA 1X1OA 1OSEA 1S46A 4NRRA 3S0CA 5IM51 1TMLA 3BAYA 3HG4A 3FGCB 3HTWA 1RJRA 2Z2BA 3GXPA 1POJA 2NQJA 1RJPA 5HUPA 1QO2A 2PF0A 4UQAA 3NAVA 1KRCC 1OYAA 1VCVA 2QCFA 4CD7A 3IVSA 4O17A 1HVXA 1F9CA 4ZFMA 1ZJBA 4IIDA 3BW4A 2R6OA 1R9XA 3MI3A 2G3JA 4Q7BA 1NJJA 2ANUA 1GKQA 1WBJA 3VPLA 4MZ8A 1FWGC 1QO5A 4MADA 2J4GA 3NR0A 1FWFC 5ABGA 4CKQA 3LTPA 3AMGA 2RDTA 3W01A 3LS9A 2DIJA 3ZXWA 3LBOA 1QATA 2POZA 1YDYA 4L80A 1RHCA 3U9IA 3VGGA 4CU8A 1JZ8A 1PUDA 3RYSA 2WWDA 4PMDA 4MB3A 3O06A 4MG4A 3GK0A 2WW5A 3TYAA 4WZHA 1IXQA 1LOSA 1LRNA 2VEMA 5K4ZA 2VFFA 1WYIA 2YBVA 2F6XA 5AZ1A 1C7SA 2XIOA 2QCNA 1Q6EA 4PH6A 3M0IA 1C3FA 4O8AA 2FHCA 3L2MA 2BLEA 3E5BA 1E6QM 1K70A 1XGDA 1UKPA 1P1XA 1Q7QA 3P93A 5D9NA 4AY7A 1L6WA 1J5TA 4ATLA 1NTHA 3GDLA 3QV9A 4MKNA 5I3KA 3PUOA 1RCOB 1YXDA 3T0BA 2KAUC 2WVVA 3TR2A 1T8QA 5C0QA 1PX4A 1Q66A 2QCMA 4J3TA 3H24A 1QU4A 4E2VA 2WKGA 4PYSA 3XIMA 4HPXA 5FJUA 1LTDA 1B3VA 3ZVHB 3H21A 1XIHA 1XLDA 3PNUA 3TZNA 3CPUA 4ADUA 1XV8A 3NO1A 2YL9A 4ONVA 2VOMA 5TNVA 3CQIA 4FX6M 3TWAA 4V33A 5FI8A 3W7EA 2I9EA 4V28A 1CW2A 4GBDA 2YGYA 8XIMA 1D3CA 1JRCA 1SO4A 2J6XA 4F8XA 1W91A 1R8LA 2JK2A 3NQBA 1B0IA 1QNVA 4GC3A 4GCXA 1W9VA 2GGGA 3ZLGA 4D2JA 3VGHA 4C6PA 4OBTA 1PAMA 1E6ZA 4US5D 1K8CA 3NVDA 3QV8A 1GQIA 3GFYA 3QFEA 1H7RA 4PCSA 3S5OA 5D38A 3SIMA 4UTWA 2PWUA 4DNHA 3FFSA 2VXNA 4BI7A 2ATSA 3GW3A 2TSYA 4LRSA 2C71A 3Q2DA 2XZ9A 4I90A 2FH6A 4ZXLA 4HU8A 1OCBA 3DIPA 4IJCA 4DVOA 3MCMA 3N13A 4K68A 2WMIB 2VR5A 5AFDA 1NVMA 3S9IA 1OFBA 4E4PA 2IPGA 3I10A 2VWSA 4NJHA 1O1HA 4K39A 1F8IA 3RX4A 2W9MA 1CB2A 4BWLA 2FH8A 3LMYA 1W1VA 1J9YA 3N04A 3SUTA 4YVVA 3VMPA 3W2UA 1W1PA 4WDXA 3FXYA 4W87A 2YCEA 4MKVA 4DXXA 3TKFA 4ML4A 5JIWA 1ME8A 3RX3A 4B5UA 3QPEA 4ACYA 3QR1A 3LX9A 1LT8A 3KVLA 1W9XA 5I3GA 4IFRA 4Z2JA 4GVGA 3BLDA 2Y7GA 1UZ4A 4LAOA 3RNDA 1US0A 4IXHA 2EBNA 3IJ9A 6TAAA 4DUVA 4H41A 3OGRA 3IACA 1MQRA 3UEQA 1CLVA 1EJTC 3WLOA 4GI6A 1NP0A 4DIAA 2DT0A 5EBAA 1S2WA 3GC2A 4GIRA 4GUFA 3TDFA 1IQ8A 3AIVA 3LQGA 3V5CA 4DLFA 4DWSC 3WBWA 3QEZA 4IMGA 3BQ6A 4MY8A 4AD0A 3R10A 1TPDA 1CXLA 1XD1A 5A6AA 4UZUA 1L2QA 3UG3A 4D6IA 1GT8A 4RE4A 3KOZA 1BAGA 4WHBA 4YXGA 4OWGA 2ZIDA 1R3RA 3O3RA 5K9XA 3ERPA 4IQLA 5DFAA 3MDUA 3AALA 5JMUA 5EPDA 1OD8A 2TMDA 2QJNA 5A8QA 1XLLA 5AHIA 3PBVA 4YPJA 1V03A 2QCLA 5AECA 3CQJA 1ME9A 3R8RA 3MT1A 4IPJA 3NQCA 4F9DA 2QDHA 4AD5A 1P0BA 4J3ZA 4Z2IA 2ZYFA 2DDXA 1DKWA 4Y9NA 4B5VA 4H8VA 3W86A 3GBDA 3UQNA 1MMFA 4I7UA 1UROA 5BU6A 1BFNA 4ZOCA 4ZE5A 1YXYA 3BMVA 3O05A 4JTIA 1I75A 4JDBA 5LIUX 1I0DA 3CV1A 3ARQA 1VKFA 3HO8A 3RLHA 2CWNA 3EA2A 1CECA 4G9PA 2X7WA 4YNGA 2XSXA 1HKWA 2X0SA 1EJRC 2BNJA 3OVRA 3UR7A 4QX4A 2EPLX 3RU6A 1CXIA 4NZFA 3EOEA 3GFXA 2A6LA 4HMDA 1CYGA 3GTIA 1Y0EA 1U2YA 4N42A 4GZIA 5AN7A 4JN6A 3QMRA 4QAIA 2P53A 1UWQA 1TRDA 5JQ9A 4JNZA 2C19A 3TW7A 1VEPA 3THDA 1EA0A 1SSGA 2Z7GA 4C6DA 3TSDA 4Q4QA 1CIUA 1IE7C 3KDOA 2QAPA 3D0CA 1NU5A 2OT0A 3AXHA 5G1YA 2PURA 1XLCA 3LPOA 3OZMA 3WEOA 4XD6A 1OF6A 4LYQA 4DJEC 3ZMRA 2GQ8A 5LIYX 4R85A 6REQB 1BKHA 4GZJA 1D8CA 2FFIA 2Z24A 3W7NA 1DVJA 4PB3A 4LNCA 1DJGA 3VOCA 3CHDA 2HZGA 1QRQA 4GVFA 1TKKA 4GYPC 4HTYA 1FBAA 1GKPA 3U5YA 2D2OA 3DXIA 1Z69A 3ZZ1A 4HD5A 1TJRA 5DELA 4B5NA 5AHEA 3BCDA 1IEWA 5HAOA 2EAWA 2Y8VA 1ISWA 2J13A 3UU0A 4S3AA 4M6QA 1D3GA 2AKZA 4DPQA 3WJXA 3STEA 1OABA 1X7FA 2G95A 2PFHA 2ABBA 1TO3A 4XAZA 3S1XA 4QXIA 1N7KA 4G1NA 3L23A 2YXXA 2D20A 3VD3A 4M56A 4QROA 5DBTA 3T55A 3WO8A 1EBGA 4ICMA 2WZHA 4IGMA 2FMNA 3WNNA 3A4AA 3VCNA 3PSWA 4N9EA 1DHPA 1TR9A 4ZE4A 1YTDA 2VFIA 3MUAA 3GNPA 2R14A 2DP3A 1FWRA 2NQHA 1XIEA 3S4TA 4KGJA 1N82A 3I7QA 1CGUA 4GC4A 4WXZA 4LVGA 1UP3A 1XIJA 1FCQA 2V30A 5I77A 1ZAJA 5I78A 4FF5A 3MHGA 4H00A 1GW9A 3UJ2A 1IWBA 3UVAA 1VPQA 1FWSA 5CJNA 2PMQA 1W1A1 2YL5A 2OXNA 1G4PA 1HXJA 2HEJA 3T4WA 1JZ6A 1BSIA 1K7FA 4IP7A 4P7QA 1I8JA 2VFEA 2ON3A 4RPPA 4RZBA 4W7VA 1L9WA 2WVUA 3EB2A 4KERA 3MANA 1VP5A 3WLLA 4U5KA 3NPWA 2P76A 1IWPA 3ONBA 3HMCA 4L64A 3QVQA 1EOMA 4LALA 4C6JA 1E6XM 4N02A 1Q5MA 3WLNA 3WUFA 3WEZA 2WVSA 3NQEA 3DC0A 4QJ4B 4WGHA 5HULA 1V02E 1EF2A 4I5XA 1G67A 1JPDX 2D23A 4H9YA 1LUCA 2RUSA 4BQ4A 2YW4A 3DBPA 5F4XA 4ZA0A 4QSHA 4HP5A 5JVLA 4ZTXA 3IJ8A 5AYBA 1TV7A 3A9IA 3HG5A 1HW6A 3TTEA 5LXEA 2OFJA 2NV9A 1WDRA 4O4WA 1I2PA 1JQVA 2X41A 3ZT6A 3AUJA 2QIIA 2DGAA 4DEFA 1G9HA 3P0XA 3AHZA 3VMNA 1A3WA 1W5MA 2GJPA 5M3WA 1XRTA 3E12A 3LGGA 1ONEA 3F2DA 1UR8A 1E1FA 4LAUA 1FX6A 2CETA 3S2LA 4FLSA 2ZQ0A 7XIMA 3LNPA 4CN6A 1XM3A 3DC8A 5BXPA 3W88A 4IIBA 1OX5A 3EOUA 3NQFA 4IJRA 5A6SA 3NQAA 4K37A 3G3DA 3FSTA 3RO8A 3WLSA 3ZO9A 1CXKA 1KGWA 3VNZA 1RK5A 1AODA 3P82A 3KVMA 3BDKA 4OFCA 1Y65A 2PRMA 2GJRA 3IGSA 2B4GA 2FFCA 2GGEA 3K4AA 2Y5EA 3OG3A 4GINA 3PPHA 3MUZ1 3TN4A 3AHYA 1QI3A 4MGGA 5BXSA 3N9SA 4WK9A 4Y9AA 4H4IA 1QVBA 2AL2A 1UC5A 1HX0A 1MQPA 4CCDA 1JCNA 4JTSA 3USZA 4OIFA 3USBA 4LF2A 4A2SA 3H53A 3ZJKA 3LXAA 3G18A 3NQVA 3GAKA 5T8GA 1P6BA 3CL8A 5C9ZA 1TVPA 3QGAC 2H6RA 1JI1A 9CGTA 2O7SA 4PBFA 5AVHA 3DGBA 1EKOA 2PDKA 3BSGA 4H8NA 1BRLB 3F4WA 3OOQA 4O12A 3TQ0A 4O54A 4L4LA 1CI1A 4J3XA 1XR2A 2EKCA 4H01A 1YX1A 3ES8A 4F0LA 1PZ1A 2XJ7A 2NXGA 4PC8A 4YN5A 4KETA 2VP8A 4PUMA 2ACQA 3TWBA 1Q63A 4CEUC 3PP7A 3GZ3A 3DI1A 4RR4A 4Q8TA 5C8BB 2WANA 4LJ3A 1VF8A 5EMJA 3VKKA 4AF0A 3V3WA 1UD5A 3S8HA 2I9UA 4PMYA 1GWJA 1EUNA 3B9EA 1CT5A 3MC5A 3R8HA 4GA8A 3LLFA 1JZ3A 4MWAE 1J2WA 5DO8A 1RQEA 4R7OA 3M46A 1UD4A 3M43A 4CN4A 2WC4A 3AIEA 4AZCA 3U4AA 1O60A 4ZQPA 3UERA 1S2CA 4QGCA 3R7MA 2ZRXA 1XBVA 3HGJA 2FIQA 1OC6A 4UMAA 2GUYA 3XISA 1B5TA 5H2ZA 2RGLA 2JEQA 1CTNA 4P8UA 3S1GA 2ZOXA 4MJZA 2BDQA 5KETA 3IGUA 1GGOA 2VYOA 4O14A 5JXQA 4L65A 1UWUA 2FVKA 3B8TA 4E8DA 3PBGA 5CPNA 1Z41A 3CT7A 1SR0A 2ZUWA 4TUFA 1FWWA 1YLVA 1HJQA 3M0MA 2WLZA 2XDFA 5DQPA 1OGBA 3QTPA 1CXHA 5FF7A 2VNCA 4MJMA 1GEQA 3IRSA 3OZYA 3GVGA 1WKFA 4HYWA 1UWTA 3C2EA 4IIGA 4Y96A 3MZ2A 1FCBA 4IOTA 1B3ZA 4A6GA 2VGBA 2OELA 4PUUA 4W85A 1MDLA 4NVTA 1XYLA 1M7JA 5B80A 3BPWA 2XIMA 1RBAA 4FR1A 4IX2A 3VIHA 4UR9A 1OD0A 1XICA 1XQKA 5I00A 4XZLX 3SY5A 4GKLA 1KBKA 2J66A 1EP3A 1E73M 4NYUA 4PE8A 3B0PA 4H9MA 1V02A 3SIZA 4IPNB 2DQWA 2XGIA 3MMDA 3ABSA 4L1GA 4HZMA 5T9CE 1Z44A 3W1LA 2YX0A 1BG9A 4QIUA 2HK1A 3EKLA 4JQ2A 3FX4A 3NQMA 3LENA 3QPZA 3L5MA 1GVEA 2DVXA 3ZS4A 1C8VA 1J5SA 1ZJIA 3E2QA 4GIEA 2HS8A 2J7GA 5LKYA 1TE1A 1TWIA 3LM3A 1HL8A 1UASA 5T9BG 2F6KA 3KEHA 3TYUA 1SR9A 4HA0A 1H50A 3P61A 3WBEA 4RK8A 2OYLA 2BXVA 4KFNA 4WY0A 2H9AB 5BXTA 1XFCA 4BK9A 3VUSA 2VEIA 3DYPA 1Q2SA 1QPQA 3UWUA 3WQ4A 1HNYA 3M5VA 4AH7A 2HE5A 3UPMA 4JHOA 4OGZA 3W07A 4JTEA 4LVFA 3G3MA 5AYIA 3MV01 4DM1A 1XW8A 4LBUA 2C1HA 3PWGA 1ME7A 3R25A 8CGTA 3NM3A 3EA1A 1WDQA 3PBYA 1OCJA 4HPNA 4E8CA 3SZ8A 2JGQA 1R3SA 3U2CA 5I24A 2BX7A 3EZ4A 3L12A 4WSJA 1EFZA 5I3DA 3KVJA 4LH8A 3VDHA 4YS1A 1VQTA 4MB4A 1CPUA 1MUCA 4UCGA 3F03K 4PEKA 3K30A 3MYPA 1S3HA 5DLCA 4KWUA 2JALA 4FNPA 1XFBA 1ZTVA 1WBHA 2DZBA 1XRSA 3UT0A 2Q09A 1C93A 4I9AA 4FK9A 4DJFA 5FOOA 3FJ4A 1HO1A 1QPNA 3HU7A 3AZSA 4WQ6A 4XBJA 4J40A 2HXTA 4I7VA 3J7HA 2CLEA 1PBGA 3TZFA 2W6RA 1FH7A 2HE8A 3BK0A 2WWCA 3V5FA 3W53A 4MWAA 3NO3A 4KMQA 1OYCA 1ML1A 2AQVA 4K36A 3FA4A 4AVFA 1E6PA 1JI2A 1CENA 1PS9A 4LBSA 1EQPA 4JX4A 4LVBA 5HOSA 2DW7A 4E4FA 2WSRA 2XN2A 5CXPA 1SMAA 5LZLA 4GNJA 5I3FA 4M51A 4QS5A 4GJJA 3NIYA 5KZDA 4QJ5B 4Q8PA 4JTLA 1E5NA 4ERGA 4PBEA 1UCWA 3EBVA 3EPOA 4QCFA 3SGUA 1DWFM 1G01A 5D9OA 1DJNA 1GOOA 1VC4A 3BQ5A 3VA8A 2BY2A 1AQ0A 1D2KA 4UNKA 3GC4A 4LUTB 2E8YA 4GK8A 5C5YA 3EDDA 1SZRA 5D2VA 1J11A 2V5JA 4KGLA 2J7DA 4XZMX 3QHOA 3UWYA 4KRUA 4X2RA 3L21A 4KPLA 2NSXA 1ZNNA 3NSXA 4DBDA 2WOQA 3VKJA 1HUVA 3ATYA 1XLMA 1RXOB 1H63A 1XH1A 3VABA 1DORA 5TIMA 3HQOA 3TTSA 1A3XA 1TWZA 2ZICA 3CUGA 4JD4A 1H09A 3GUWA 3BVJA 4M24A 4X3ZA 3DYOA 1JG9A 3JR2A 1E55A 1C91A 1KFEA 4FLRA 2VTFA 4RV3A 4KT2A 4YTRA 5DXYA 3ZWSA 5IHSA 2JF7A 1KGXA 4HMEA 3WUEA 2INFA 4JTQA 5HR6A 3BAWA 2PLKA 2DORA 1F2JA 4RW5A 3BW2A 4GH1A 3M0KA 3IGHX 4DO4A 2WNWA 4JN7A 3GYEA 4XD3A 1RR2A 4S3KA 5EFDA 1XCFA 1KCKA 2PE4A 5BCAA 3CLWA 1LDCA 5I6SA 1NQ6A 4MDPA 2E9MA 1A5NC 4J5NA 2ZE0A 3W7GA 1W8SA 2ONEA 4O53A 5C54A 4XZNX 4IZGA 3WENA 4M29A 4R9OA 3DFOA 1LRTA 1DPMA 4C6NA 2P8CA 4ROPA 2VC6A 4I9JA 1KC7A 2GVYA 1SO3A 4U4MA 5A6LA 5I02A 4P7NA 2ZZ6A 2A3LA 4O0KA 4AYSA 2C3ZA 3ZFHA 4KEUA 3ZWTA 2R1LA 2Q02A 1OVDA 1UBSA 4DJDC 3C61A 5U4NA 1IIGA 1WDWA 2NUYA 5HNNA 2QPSA 3CQ0A 3DENA 3VD5A 3VIMA 1OFAA 2CLOA 2QIWA 5A6KA 4NXKA 3PNZA 4J1OA 2C0AA 1SUXA 2ZDSA 1YTKA 3BCJA 2YB4A 1LQAA 4M80A 3URQA 2JGYA 2ZFAA 3UJSA 1IEXA 2GJXB 4AEFA 1AW2A 1Y5VA 2J75A 4AD1A 2YYUA 4O4VA 4ZTYA 4JTAA 1YPXA 2VX4A 3N2OA 2WKLA 1H0IA 5LYRA 3N4FA 4Q6JA 3ZSTA 4UXDA 3N2MA 1C7TA 3PM6A 2QDGA 1V3KA 2OCZA 2G97A 4UNLA 1XDJA 1R6WA 3CUZA 1G69A 5I3HA 4L6HA 2VDGA 4IP5A 3VNIA 1MFVA 9RUBA 3VD9A 3W29A 2J7CA 5D8ZA 4DO5A 5BOOA 4W88A 4PL2A 1SJDA 2E1DA 3OTRA 2W92A 1MZHA 5C9WA 4O1FA 2Z1BA 1WDDA 4J3VA 3TOPA 1EF3A 3W1TA 4FO4A 2W91A 4JIPA 4GH3A 3HM7A 4JY8A 2GGIA 7ENLA 3H7UA 3QZEA 1KV5A 3CZGA 1SYTA 4WUIA 4H8UA 1FWAC 1MDRA 1AZ1A 3NZQA 4F0HA 1DHKA 4LY8A 1IYXA 1UR4A 1JAEA 3C0LA 1SM9A 2PDUA 2W3ZA 5I0DA 3VGFA 4EPDC 4CNNA 4ZB0A 4LB4A 3JVAA 1J6PA 5A6BD 4AWSA 1EPXA 5B7ZA 3QKZA 2R1KA 3GSMA 2QXWA 3PZOA 1TSIA 3B8UA 3LQLA 4GFIA 3KCOA 4AZHA 1TPB1 1XH0A 2OEMA 2RGMA 2VEKA 3GR8A 4ZQNA 3TN5A 1EJUC 1JFHA 1DL3A 3ARZA 4TQTA 5C70A 2YCJA 2I7GA 3VC6A 2CIPA 1P1MA 2D2GA 1V6VA 1V3JA 3LDVA 3I6EA 1Q85A 4O1CA 4OU1A 4WKAA 1WB0A 1H2JA 2PBOA 2WMGA 1KFWA 4G1KA 4FEZA 1K8ZA 1W5PA 3VGEA 3GU1A 2OQLA 2NQLA 1LL7A 1FKXA 1XF0A 2TRSA 3CAWA 3SRKA 5E6ZA 2J9YA 3TROA 1CGWA 4ZOBA 2ZZ1A 4GQRA 4C1NA 3NDZA 3AROA 1X6UA 1UZHA 3EOLA 3R4IA 2HPMA 3P6LA 5DN1A 3OIXA 4U33A 3CBWA 4LCRA 4REQA 1CGYA 5DCEA 4JAWA 3ZJ7A 4YCPA 1Q7MA 4X2PA 5BROA 1KGUA 4AX7A 1C9DA 3SUUA 3WLRA 2GDUA 4KIEA 1OEPA 2H3DA 5DBUA 3WELA 1ECQA 4WX2A 3G1SA 4IGHA 3WCZA 3TCSA 3VDBA 2B31A 1F74A 5DMNA 5F4WA 3TJLA 1R5YA 5KMYA 2ISFA 4XV0A 4J28A 1SFLA 3PZUA 2C16A 1ISYA 1KQZA 1ECEA 1FP9A 5DXXA 1ZSXA 4JFVA 3K8KA 1B2YA 4R3UA 2I17A 3OBEA 2P3ZA 3GXMA 3K46A 2HRWA 1OX4B 1H0GA 4O19A 4GLEA 3BGJA 1HP5A 5LIWX 1DP0A 5LNUA 3G8RA 1RAKA 4XTIA 2WBKA 5BYWA 3LN3A 1T40A 2BXYA 2WPGA 2X16A 4HCLA 4V2XA 2W27A 3FHQA 2OB3A 1GOXA 1E43A 2Y88A 3LY0A 1FWJC 3UNDA 3ZSSA 5GJMA 1BTMA 3B0YA 4PTNA 1IV8A 1X1ZA 2IUZA 2OG9A 2XIBA 3CIXA 1UUQA 3WSUA 2V3FA 4IQDA 3F2CA 2PDPA 1G5AA 2B7PA 1KV8A 2DH3A 2VGGA 2WBGA 1ICQA 4AY1A 2ZVRA 3GXIA 1ZQ5A 4WLCA 2XH0A 4GXWA 3W70A 4NIRA 1QR7A 3EWDA 2HBXA 2V5KA 1UD6A 2DH2A 3UZZA 3KTCA 4LC6A 4M81A 1VBHA 1XSKA 2P1FA 1RD6A 1Q6LA 4PUDA 4L56A 3WLHA 3ENLA 3EWUA 3S1VA 5HR7A 1VENA 1MYRA 1YE6A 4GG9A 2E67A 4HK6A 1TE6A 2GQ3A 3A12A 1R30A 3FAWA 1HT6A 1B54A 2QMKA 4TV5A 7TIMA 4BF5A 1XSJA 1LWJA 2VDHA 4M19A 3G22A 1XG3A 3MWCA 4WEVX 4IIHA 3S6OA 4N2YA 1R2SA 4S3BA 4LV9A 5A8PA 3CT2A 2BY0A 4RCXA 1GZGA 1VLIA 3VZYA 3F4VA 3TW9A 1E1CB 4CQAA 4I6VA 4OZOA 5K9DA 2G3NA 3H7RA 4L4OA 4RE2A 4RDZA 3SAZA 4ZODA 3OLEA 1YDNA 4Z42C 2PWGA 5J5DA 4EPBC