4XUYA

Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/gh10) enzyme from aspergillus niger
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
EASVSIDTKFKAHGKKYLGNIGDQYTLTKNSKTPAIIKADFGALTPENSMKWDATEPSRGQFSFSGSDYLVNFAQSNNKLIRGHTLVWHSQLPSWVQSITDKNTLIEVMKNHITTVMQHYKGKIYAWDVVNEIFNEDGSLRDSVFYKVIGEDYVRIAFETARAADPNAKLYINDYNLDSASYPKLTGMVSHVKKWIAAGIPIDGIGSQTHLSAGGGAGISGALNALAGAGTKEIAVTELDIAGASSTDYVEVVEACLNQPKCIGITVWGVADPDSWRSSSTPLLFDSNYNPKPAYTAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Probable endo-1,4-beta-xylanase C
publication title Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Aspergillus niger
rcsb
source organism Aspergillus niger
total genus 123
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4xuyA00
3WN6A 1PBGA 4JAWA 1JDAA 5BRQA 4FLRA 4AD2A 2QF8A 3EYPA 1BG4A 1BYCA 5A69A 4GI8A 5I3DA 1B3VA 1NM9A 4MNJA 2CBUA 5CQ1A 5BCAA 2BNJA 1M03A 4H8UA 2UY3A 5GPRA 4MAVA 1EIBA 2WCGA 4UZSA 4IM4A 1OGBA 3ECQA 2YBTA 1US3A 1CGVA 1TVPA 4MDPA 3QOMA 2XUCA 5BRPA 3M6DA 2GVYA 2J7HA 2V3GA 1LQ0A 3VINA 4WLCA 2O9RA 1D7FA 3VIOA 3VGFA 4F8XA 3FW6A 2V3DA 4UOZA 4UFHA 1CYGA 1V3HA 2A3HA 1GOKA 1UR8A 2E3ZA 2ZWZA 3POCA 4JCLA 5I79A 3VGGA 1MQQA 1B30A 4CD8A 5GNXA 4Z2LA 7CGTA 2G3MA 1CGUA 4PMNA 4JHZA 3ARTA 4WJXA 1H2JA 5JBFA 1E3XA 1OD8A 1AMYA 3RCNA 2ZIDA 4D1IA 4HMDA 2BVDA 3T09A 4AZIA 3NSMA 5AC4A 3ZJ6A 3UERA 3UEQA 3O2LA 3M46A 1GVYA 1LWHA 1C7TA 1ZU8A 4AMCA 3WIJA 2NT1A 2ZOXA 4U3CA 1HKIA 1H49A 3TTSA 1J0ZA 5IHSA 4CVWA 2O9PA 7TAAA 1R85A 5LYRA 1IT0A 2O9OA 4MDOA 1J0HA 1VF8A 4UFKA 2YL9A 3EDDA 2CESA 5D8ZA 5BROA 3A4AA 1PZ3A 1EO7A 2DSVA 3WKZA 1E6RA 4MNLA 3SUTA 2D0FA 4PTXA 3ZOAA 4AZCB 5A8OA 4AIUA 1GHRA 2X09A 2YIHA 2CNCA 3SUVA 5M3WA 2YL6A 1QI4A 2EJ1A 5GNYA 4CKQA 3CPUA 4MPKA 5HPCA 3BGAA 4ATLA 1CXKA 4P8VA 3GM8A 3RMEA 4GQQA 1FH7A 1O6IA 2Z1KA 1VB9A 2B31A 3WQ8A 1DP0A 4KRUA 3IANA 2VQTA 2OYMA 1OWQA 2E9BA 4M56A 3PBGA 4HA1A 4AC1X 2D20A 5ABFB 4P7RA 1H5VA 1E6QM 1XSJA 2ESCA 4U31A 2VOTA 4OBRA 4NF7A 2FHBA 4GZJA 4GZIA 1KWGA 2EBNA 4EAMA 5JUVA 3WEZA 1B9ZA 2C7FA 2VX7A 4PTVA 1C91A 3T0DA 1CZ1A 2A3BA 1OT1A 3NYDA 2WM0A 1M04A 3CZKA 2FH8A 4S3KA 1E73M 4CCDA 2J8FA 4AIOA 5KEZA 4CN4A 1NH6A 1ZJBA 1UH2A 2NSXA 1XD0A 3RM9A 1JD7A 4P7LA 2WBKA 5BYWA 2J8GA 3RDKA 4PMYA 4V28A 2JF6A 1C8YA 1OD0A 1UD5A 5A1AA 1A3HA 6TAAA 2WMJA 3L4UA 1CXHA 1XRVA 1WE5A 2W5FA 3GNPA 4PMVA 1FP8A 3VIIA 1ODUA 1MQPA 3AMDA 3WBAA 4QFUA 3ZSTA 1W9BM 2YDSA 1E55A 1E3ZA 1UH4A 2W63A 1VBUA 4Y7EA 2VL4A 1E5NA 1W91A 2DPEA 3N13A 1KGWA 4TVUA 2WZHA 5HPOA 3GXIA 1E4MM 2E9LA 4B15A 2XVKA 3KL5A 5AY7A 2XFYA 2XFFA 3PZ9A 1OIFA 4H04A 4N0RA 1W2VA 1V0MA 1Q6EA 2VZTA 3AMKA 1E5JA 3DECA 2WVSA 3WH7A 3VGBA 1Q6FA 1UR4A 1KGXA 1WAWA 3S6TA 4Z2KA 2XHYA 1UKPA 3MANA 3THDA 3WEOA 4CD5A 5I0DA 5A6BA 2EPOA 2Z1SA 5A95A 2EPNA 3L4YA 3SCRA 3W37A 2BY0A 3ARRA 3VIPA 1JZ5A 1CENA 4Z2JA 4GQRA 1LL6A 1H41A 2G3NA 2WMIA 3SUUA 3VIGA 2V3EA 1PIGA 2JALA 3EMQA 5BXPA 2DQXA 1CGWA 3BAJA 3VDBA 5DF0A 4PTMA 1BF2A 3L4WA 3VIHA 2WMKA 2PI6A 2OSXA 3VD3A 4EKJA 5DFAA 2A3EA 1G9HA 5IFTA 1UD4A 2ZUUA 4J7RA 3ZJ8A 1E1EA 4JIEA 3F4VA 1JAKA 1MQRA 3BAXA 1V3LA 4S3JA 3ZT7A 4YHEA 5BXSA 3FAXA 4AEEA 3BAIA 2YLLA 1UD6A 1JXKA 1SMAA 2QMJA 3GXMA 1NOFA 4QP0A 1WDPA 5GNZA 3GTNA 9CGTA 3F5KA 1OIMA 2GK1A 5FCZA 2WCSA 1MW0A 1JGIA 2EQDA 1F4AA 2Y8VA 4J3SA 3VX1A 3DC0A 1BSIA 3WDRA 4MAZA 4W7WA 5A8PA 4ACZB 1X1NA 4M81A 5A6AA 2WVTA 4JKLA 5LA1A 1JNDA 2D0GA 2OSYA 1VAHA 3AHZA 1V03A 4JCMA 4D6JA 2VR5A 3ARZA 3AJ7A 2X0YA 5IFPA 1HIZA 1TA3A 2F61A 2ZUNA 2VJXA 1R7OA 2WKGA 1KWKA 4PSPA 2YA2A 4TTUA 2ZX9A 4GKLA 2IUZA 3WDHA 3VD9A 3WY1A 2WAGA 3WNOA 1NWTA 2ZICA 4AZ6A 4EK7A 3A4XA 1UR0A 3VILA 3SCNA 2WMHA 2YKKA 1ISYA 1LG2A 2JIWA 1QNQA 1EO5A 3MMWA 1U30A 3OG2A 4UQ9A 2BHYA 3N18A 2W92A 3MMDA 2W62A 3OZPA 3IJ8A 4W85A 4PYSA 4HTYA 2Y24A 1S46A 2ZXBA 1QNOA 4URIA 3EDFA 3W81A 3PN8A 3TONA 3MSGA 1E0VA 2J75A 3TTQA 1CIUA 3PTKA 4UFLA 4P8WA 1E4NA 3UCQA 1HJWA 3HMCA 2J47A 1K6AA 4JKKA 4FMVA 2BS9A 5I5RA 3VPLA 2X0HA 4EANA 1C3FA 1ISXA 2D23A 1B3XA 2CXGA 4E8CA 1W9PA 3LPPA 3PZTA 4XX6A 3T0AA 1D3CA 3AIVA 4XZWA 3WQ6A 1E70M 4J27A 1R8LA 4DWSB 1JZ4A 1BFNA 1HL8A 4MB1A 1QOXA 2XTKA 2QLYA 3O6AA 1HF6A 4PN2A 5I77A 1W1VA 3WNLA 3LPFA 5E0CA 2WHJA 3LPGA 4BCEA 1ISZA 5CPSA 2D2OA 2UY5A 3WH5A 1W1PA 4XZBA 2W61A 3WD1A 2VTFA 4AEFA 2VZOA 3PZQA 1UH3A 4UQAA 1PX4A 3DHUA 1V02E 2UY4A 2WK2A 1DWJM 5D9PA 1JIBA 2YJQA 2GJXB 3VVGA 2CIPA 2WANA 4ZE4A 5I78A 5A2CA 2J7EA 2O9TA 4P8XA 1QW8A 1UUQA 3W6LA 1IZKA 1J18A 1VRXA 3GXFA 5AYBA 3TTOA 4ZEPA 6A3HA 3SCWA 4L4PA 3VD7A 5ABHA 1W9UA 1VEMA 4IPNB 1NQ6A 1UKSA 4PUDA 1HJXA 5E0FA 1GW1A 3QHNA 2VT0A 1W3JA 1WDQA 2PBGA 3PTMA 3VU2A 1Z32X 3SCUA 2D24A 1J0KA 2VO5A 4AD5A 1UKOA 4D6IA 2JEQA 3W53A 1J0JA 1ZB5A 1W3KA 4BQ3A 1MXGA 1WCGA 3IJ7A 4UFIA 3T0BA 1FFRA 3NDZA 3KL3A 1FH8A 1ZBWA 3VO0A 2OSWA 2EPLX 3QR3A 1X6LA 3WH9A 3VM7A 1Q6GA 3PZOA 3GH7A 3SIMA 3WF1A 3B8SA 5HOSA 1XH1A 3G6LA 1V3IA 1ISWA 4BQ2A 3GYCA 4W8LA 2ZUMA 5A6KA 4ZE5A 4EE9A 3OZOA 3RJXA 5JBDA 3CUHA 2CERA 4J28A 3AIUA 4A3YA 1HN1A 2A3AA 1SFSA 1UHVA 2CCRA 5CZKA 3N15A 4WSJA 3L4XA 2XWEA 1TMQA 1JXJA 2ZE0A 3FN9A 4BQ4A 3WNPA 3WF2A 1W1YA 1CWYA 1UQYA 5A6MA 3AIQA 4CU6A 3CHFA 2OYKA 4CN1A 4OIFA 4UCFA 4Z2GA 5I6SA 4V2XA 2VZUA 4UOJA 5CLTA 2XM2A 3PZGA 4ACYA 4B3KA 4CU7A 1PX8A 3VGEA 2JIEA 1NP0A 3D5HA 2CBJA 3SCOA 1BHGA 5FKYA 3CUGA 1UWRA 2WW5A 2WVUA 2XPKA 1JZ8A 3CLWA 4JZ5A 3PHAA 2DEPA 3AOFA 1H11A 3IAQA 2W67A 2Y4SA 1V6WA 1F4HA 3K8LA 4NRSA 4AXNA 4HOZA 4TUFA 5TD4A 1VFOA 4ZXLA 2V3FA 3N12A 3GH5A 2W66A 4DM2A 5E70A 1TCMA 2QMKA 2IXVA 2EPMX 1J12A 1QHOA 1FH9A 1HP4A 4R5EA 1V0NA 4KRTA 4OUEA 2V38A 1J0YA 4JKMA 3SUSA 1UWTA 3QOKA 4UQEA 5FL1A 3L4ZA 1BVZA 3MUIA 4J3WA 3WD0A 3OLGA 3F5LA 1AQHA 2X8RA 2G41A 3AS2A 4HA3A 5A6SA 3WFZA 4QLJA 1WP6A 4AZ7A 2AOSA 3QHMA 4LYQA 7A3HA 2CBVA 5LA0A 4AZHA 2X05A 5BXRA 4KH2A 1E6SM 3AZRA 4A4AA 2WHKA 3SCSA 1B1YA 4WKHA 3WNKA 2FGLA 4DWSC 1LLOA 4W5UA 3PZNA 3GDBA 3L2MA 1NWUA 4W86A 3WL0A 4OZOA 1GHSA 3MUAA 1WZKA 3ZIZA 1HL9A 4AZCA 3ARUA 1DHKA 2Q8XA 3W27A 1FA2A 3ZO9A 1BAGA 3ZT6A 3AMCA 3EBVA 4PMDA 3K1DA 3SEPA 4GO9A 1CEOA 1XCXA 2DSZA 4RE3A 2EPKX 1LJYA 4M82A 3N17A 5F7UA 3W28A 1KCKA 3WD3A 3MMUA 1GJUA 2DT1A 3O9NA 5IHRA 1C93A 4LXFA 1W9XA 5C71A 2WB5A 1FHLA 1KCLA 1H4PA 1JZ3A 3SUWA 4KGLA 3M07A 4X9YA 2RGLA 2E8YA 2J7BA 1G0CA 4AIEA 1NOWA 1B31A 2J7FA 3HN3A 1DTUA 3E1F1 1GUVA 4MNMA 1JG9A 1UR2A 2CEQA 2UWFA 3KWXA 3U7BA 1EDGA 2DIEA 1US2A 2CPUA 4W7VA 1GOWA 1XV8A 5HBFA 1RD6A 3BAYA 3OB8A 4C7DA 1OT2A 4PMOA 2OWWA 3WSUA 1FP9A 3CGTA 2VMFA 1EOMA 4WK9A 2BHZA 4PMXA 4W84A 2YLAA 3MS8A 3WQ5A 1WPCA 2XVGA 3CO4A 1TR1A 3IAPA 4U33A 3VIJA 2ZX7A 3DYOA 1BGGA 1I1WA 1WNOA 3HU7A 1CLXA 4HOXA 4A3HA 4LGXA 4JL1A 2GSJA 3W25A 1MXDA 5E6YA 1OGSA 1H1NA 2WHMA 1EOKA 2YDQA 1FHDA 1TVNA 4UOQA 3RJYA 3D3AA 4HMCA 3TTYA 1QNRA 3N9KA 2D0HA 1GZJA 1JFXA 5BWFA 3TP4A 3WDJA 3ALGA 1NWRA 4AD4A 3ZR6A 1V0KA 1DWHM 3AISA 3RO8A 1PZ2A 4HU8A 4UR9A 2JFEX 1E43A 1CDGA 1BPLB 1V3MA 3MU7A 3T2PA 4D6CA 1QI0A 3U5UA 1XGZA 2YBUA 4U5KA 2ZX8A 5EBAA 3CZJA 1SMDA 1XCWA 2J79A 2WLZA 1B3ZA 1VIWA 3JUGA 1B90A 4CD6A 3CUIA 2PC8A 2F2HA 1W1TA 4WF7A 1W32A 3AIBA 3SURA 1E72M 1UZ1A 1HKKA 2WNWA 2YA0A 3GXDA 5IDIA 3WD2A 1EHNA 3EDJA 2E9MA 2VRKA 1BYBA 4D71A 2AAAA 4H7VA 1PX3A 4TOQA 4W7UA 4GI6A 2BXYA 3A6OA 1UKQA 4PMUA 3WF4A 4MJ2A 4CN6A 3LMYA 4M24A 5CGTA 2EEXA 1OSEA 2G8ZA 3S2CA 3BLPX 2WVVB 1E6PA 5A8NA 4H2CA 3WNNA 1PIFA 3WDQA 1BYDA 3W6MA 2CHOA 2VR4A 1OINA 1A47A 3FY1A 3ARPA 3WEMA 1G1YA 2D3LA 2VNCA 1LWJA 2GDUA 2XSAA 1BG9A 3II1A 1JYXA 5FOOA 2BVTA 3OLIA 1OCQA 3WUBA 1ZBKA 3FNDA 4NSBA 3U7VA 3ARVA 1V3JA 1V6UA 5A8MA 2UY2A 5E09A 1CBGA 5ECUA 2BY2A 1C8QA 1XSKA 3BSGA 1V6VA 4CCEA 4PCTA 2VRQA 1E40A 4ACZA 1IV8A 4UQBA 4CD7A 3OGRA 1WZLA 1MYRA 3BCFA 1NOUA 5A94A 2A3CA 4FLOA 5DEZA 3UR8A 3POHA 3AXHA 1VBRA 1V08A 4D6GA 1KB3A 2WMGA 3AS3A 4UQDA 2MANA 3CZ8A 3QHOA 3J7HA 2FH6A 1CXFA 1X6NA 1KGUA 3MV01 2OWCA 3DYMA 4C7FA 3L4TA 3VMPA 4UFMA 4JFUA 1HJUA 1C8XA 3U5YA 1UKTA 1UA7A 1VFFA 4UNIA 2PWHA 1CGTA 2WKLA 3CUFA 5EFFA 4D6HA 2VC9A 1YHTA 3VGDA 1DWIM 1CXEA 5CSUA 2FHFA 4J3VA 1OM0A 2VX5A 4DWSD 1DWAM 4W88A 4TX8A 3ZT5A 4CUCA 5CJ5A 1UD3A 3WF0A 3AHYA 3B9DA 3VMNA 2GFTA 3PZMA 3AHTA 4X0NA 4F79A 3WL1A 3AMGA 2YL5A 1ZJAA 4WSKA 1L0PA 2ZX5A 1BLIA 1GJWA 2GUYA 3GZAA 2PF0A 2J62A 1JI1A 3MSDA 3CIVA 2XGIA 4DWSA 1KBBA 4QLKA 1E6XM 4JFVA 2VCCA 3KL0A 1G5AA 4HZ8A 1JYVA 4BS0A 1G01A 1PJ9A 4RE4A 3AZSA 2X2YA 3CMGA 1CECA 1VEPA 1AQMA 4GINA 3PTQA 4P7OA 4HA4A 1XH0A 3G6MA 4X0VA 3KEHA 5DT7A 5ABEA 2ZXDA 8A3HA 2GJXA 2G4FA 3VDHA 1JNEA 1P6WA 1KXVA 1LL4A 5DT5A 4XV0A 3W0KA 2NW0A 2XVLA 3B9EA 4TVCA 2FGZA 1AVAA 1NP2A 1LF1A 2D1ZA 3L2LA 4GZEA 1W9DM 5E9AA 3CMJA 1HJVA 1HNYA 2WSKA 3WDPP 2VVSA 1ODZA 1W2PA 3A4WA 3THCA 1SR0A 4IUGA 1VJZA 1HJSA 1J11A 4AD1A 3BMVA 5JIPA 4HPGA 3SCPA 3AYRA 1BVNP 3VX0A 2CYGA 4R27A 4AD3A 2OLHA 3AS1A 2ZUVA 4H8HA 1PEZA 2DGAA 3W4RA 4OOZA 2TAAA 4U3AA 3BSHA 3WH6A 3FHAA 1E1FA 3WENA 4YHGA 5CPQA 5CSYA 1JAEA 2PWGA 3CTTA 1E0WA 3PZIA 1VENA 3L4VA 3FXYA 4GXPA 4NI3A 3W26A 4HPHA 3ZR5A 2J4GA 4B16A 3B9AA 2CHNA 3U57A 1AQ0A 3IK2A 3UR7A 1XHGA 2YOCA 3OLEA 2DDXA 2PWDA 1NARA 4HZ7A 4J3UA 1UWIA 4MB4A 4U2YA 1HJQA 4TXEA 2VCAA 1IZJA 1K9EA 1GCYA 1VEOA 1R87A 3T2OA 2WSPA 2Y5EA 4CCCA 3SCVA 4FK9A 1XYZA 4LPCA 1WZMA 1W3LA 4CU8A 4WKFA 4C7GA 4OKDA 4P7NA 1RP9A 4PRWA 1M53A 1UWQA 4ATDA 3VIKA 3MUY1 4UZUA 8CGTA 2YA1A 3ZJ7A 3BMWA 2WWCA 5A8QA 1E9LA 5CPTA 1OGGA 1JFHA 2VZSA 2VCBA 2BVYA 5GQBA 3K8KA 4H8VA 3CZGA 4W5ZA 1QHZA 3WMCA 2W91A 1E4IA 1M7XA 2W4XA 3CZEA 1WB0A 3WH8A 1MW3A 2CKSA 5AC5A 2DSWA 1UG6A 3N1AA 2WHLA 4BF7A 4BQ5A 1Q6CA 5EFDA 1WO2A 3I3DA 4IISA 1HXJA 3VIMA 5D9OA 1C92A 3AXIA 4P8UA 4Q22A 1UQZA 3AICA 1H0GA 4FLQA 4MJ4A 1KQZA 5I24A 3K8MA 1M01A 4AZ5A 1JDCA 3NCOA 3GNRA 2V5DA 4F9DA 3PZVA 4D6DA 1UD2A 1L8NA 1W9VA 1WDSA 5C8BB 2XGBA 4ML4A 2V5CA 1WDRA 2QV4A 2WYSA 1B2YA 4GIAA 2OYLA 5D8WA 2Y8KA 3GNOA 3A47A 1E15A 3T2QA 3NSXA 3BCDA 2XVNA 1KQYA 4QAWA 2VI0A 1E6NA 4PUEA 5FIPA 3NUKA 1GORA 1SYTA 2JE8A 1J10A 3ARSA 1UA3A 1BTCA 1QBBA 1JZ6A 2WXDM 1GQLA 1GOOA 2X1IA 3VDCA 5EMYA 3AIWA 2C8NA 3NDYA 1GOQA 3UG5A 3WQWA 5A2AA 1MVYA 1ISVA 1C7SA 3OIHA 1DWFM 1JI2A 4PMRA 2WC3A 4F9JA 1N82A 3AYSA 4H41A 5HDRA 4KMQA 1JDDA 4MADA 3VNZA 1EGZA 4NZCA 3AXXA 3APGA 1KFWA 1TZ7A 1ITXA 1QNPA 2ZUTA 2ZWYA 1KXQA 5FL0A 1UYQA 4ZXOA 2J74A 1G94A 3CH9A 3I3BA 3CZLA 4HMEA 1YQ2A 3WELA 1R7AA 4WIWA 1JF6A 2WC4A 3VDAA 3CHCA 4DUXA 2E4TA 4UTFA 1K9TA 1R86A 1OB0A 1QBAA 1EA9C 2VVNA 4HU0A 4HZ6A 1U2YA 2C0HA 4E2OA 3N11A 2PB1A 5ABFA 3HJEA 5EB8A 1C90A 4J3XA 4JFSA 1ZBCA 3W82A 2HISA 2VURA 3WMBA 3IJ9A 3ZJKA 4AY1A 1H0IA 4UFJA 2XG9A 4OOUA 2PWFA 3CHDA 2D3NA 4ZFMA 5BXTA 1XC6A 4MTVA 3FAWA 4JFWA 2PBOA 4LYPA 3M7SA 3WUEA 3BH4A 1PAMA 2E40A 5CGMA 2GDVA 4HP5A 4JFTA 1HP5A 1J0IA 4QCEA 5JIWA 4DUWA 4AISA 5A6JA 5I23A 2VUYA 3KZSA 1EQPA 4V27A 1OBAA 4JL2A 4MB3A 1BGAA 4CD4A 1BYAA 1I75A 2WPGA 1XYFA 1B0IA 4AD0A 1NWSA 3UG4A 4WKAA 3ARWA 3VIFA 4FF5A 2NT0A 2WMFA 1E56A 4UQCA 3T08A 3WBEA 1LL7A 4J3TA 3BXWA 2BY3A 3AIRA 1HVQA 4AW7A 2EO7A 2FDMA 1KXTA 4E8DA 2WLYA 4FLSA 2EXOA 4MB5A 3A3HA 5AYIA 1VFUA 3VTRA 2XWDA 2CKRA 3QGVA 4L4OA 1EDTA 1GVIA 2J25A 1XSIA 3EDKA 1UZ4A 4B9YA 1XD1A 1MW1A 3MKKA 1TE1A 2WWDA 5CG0A 2Y2WA 4QCFA 4D72A 1V6YA 1B3YA 4Z2HA 4AWEA 1HKMA 4K68A 1I1XA 4TTGA 3N04A 4KGJA 4W8BA 4QLLA 5A6BD 4OJYA 1QHPA 2BHUA 1ESWA 1ZBVA 2J7CA 3ZQ9A 3TA9A 4PCSA 1CTNA 5ABGA 2VX6A 4LX4A 3AZTA 3FHQA 3BAWA 1EHAA 1MFUA 3ZM8A 2PWEA 4P7QA 1QNSA 2OWXA 3OGVA 1UWUA 1RP8A 2DH3A 2G3JA 1JYWA 1QI3A 1V0LA 1GPFA 3BAKA 3W29A 2WMIB 1EXPA 4M80A 4HOWA 3RPMA 4MNKA 4D6EA 4GI9A 2WZEA 5JBEA 1CNVA 2E0PA 2ZUSA 1RH9A 1MW2A 4LYRA 1JYNA 3WFLA 3KE0A 2WVVA 4AYSA 5C70A 2XIBA 4B9ZA 4N42A 1TG7A 3CHEA 4YN5A 1CPUA 2DIJA 3AFBA 3OLDA 5HXMA 5IXEA 2DT0A 4GO8A 2ZX6A 1JF5A 3BC9A 1JZ7A 2BY1A 2F8QA 1GQKA 4M29A 3OGSA 4U5IA 3VM5A 1V02A 4QDMA 1QI2A 2IXUA 2GK1B 2DT2A 5A2BA 2VX4A 3ARXA 3WQ4A 1UWSA 1K9FA 2HVMA 3PZUA 1JZ2A 4TVDA 3ZSSA 1W3HA 5KZ6A 3UG3A 1H3GA 3ARYA 4W93A 1LG1A 1KR0A 2XJ7A 3ARQA 3GBEA 1WZAA 1UD8A 3SCQA 2WC7A 2J77A 2JEPA 3AMLA 4CVUA 3AI0A 4IPLA 3VOCA 1E4LA 2ZXQA 4W8AA 1HT6A 1TA3B 3W38A 1PPIA 1DWGM 1EDQA 2XFRA 3OBAA 4NRRA 5DO8A 1CLVA 1VJSA 4W89A 5CLWA 2XSBA 3I3EA 3OA5A 1QI5A 4E4PA 5M03A 4XUYA 2WBGA 5M5DA 2VZVA 1QVBA 1B3WA 3MV11 3VD5A 4D6FA 2BV9A 2QHAA 2XYLA 3ZMRA 3AHXA 1UR1A 2D22A 1ECEA 2XIIA 3AS0A 2BFGA 3ALFA 3AROA 4Z2IA 1TUXA 1HX0A 3WUFA 1KXHA 3SCTA 1GQIA 1GQJA 4AZBA 3F5JA 1U33A 3CBWA 4RL3A 5D9MA 2YL8A 3NJ3A 4YPJA 1XH2A 3MO4A 4DM1A 2ZXAA 1CXIA 1ZL1A 1Y7VA 3EMZA 1Q4NX 2WZIA 1Q6DA 4BZYA 5I2UA 1JD9A 3VGHA 3MUZ1 1CGYA 1CGXA 1DEDA 4W87A 5HNNA 1GOMA 1WKYA 3K4DA 1ZS2A 1JL8A 1GNXA 2G3IA 2JF7A 3WUGA 4PSRA 4GPNA 2DSUA 1FOBA 1KBKA 1V6XA 3BLKA 2J7GA 1E6ZA 1HVXA 3DYPA 4B3LA 2J78A 1TFVA 1O7AA 3LPOA 4OBSA 5A6LA 4PBGA 5E6ZA 1EH9A 1UR9A 1J01A 1KR1A 2DT3A 3W24A 4U2ZA 1H09A 1FFQA 2CITA 4LQ1A 3VD4A 4PEEA 1CXLA 3DHPA 1QW9A 1E71M 2XM1A 2O92A 4PTWA 4DUVA 2DSKA 1MWOA 2E8ZA 2GJRA 3EDEA 3WDIA 1BQCA 2ZUWA 1K9DA 3TOPA 3VNYA 5DMYA 5LA2A 4TX6A 1GONA 2XVPA 3VKKA 4XB3A 3VUPA 3K4AA 4PMQA 4BA0A 1UOKA 4M8UA 3K46A 2J7DA 3WQVA 5FD0A 3RIKA 3AQUA 3GBDA 2YDRA 5D9NA 3RM4A 3WNMA 3GH4A 4CGTA 3AHVA 2BXZA 2VRJA 3VMOA 2CBIA 6CGTA 1GOIA 4ZENA 3RILA 3WF3A 1RPKA 3EMCA 1ITCA 5M17A 4Q7NA 3AIEA 1MFVA 1V3KA 4JHOA 3WD4A 1E0XA 1J9YA 4RE2A 2QPSA 5D4YA 4F66A 5A3HA 2GJPA 2WCAA 2AMGA 1EQCA 1VFMA 3NSNA 1D2KA 3WMSA 2QPUA 1QPKA 2VQUA 4AZGA 2CETA 4KWUA 4M1RA 3UESA 2FHCA 3RM8A 2DH2A 4D1JA 4ATWA 3UETA 4PMZA 3NIYA 3CUJA 2RGMA 5CXPA 1HKJA
chains in the Genus database with same CATH superfamily
1FWNA 2DZWA 3UWUA 5T8GA 2QNEA 3ANVA 2C15A 3NR0A 2QF8A 3LGDA 1V7AA 3UCCA 5A69A 5ECVA 5I3DA 3UJFA 1NM9A 1LBLA 4MNJA 3E96A 5BCAA 1G4EA 1M03A 4H8UA 4BJHA 5GPRA 3B0XA 4MAVA 3WLOA 4S3CA 4BKNA 4UZSA 3QMSA 1VD6A 2WSRA 1TVPA 2XUCA 3NEVA 4KEVA 3QH2A 5BRPA 2V3GA 4FSAA 2DW7A 3TZNA 3FSTA 1VBJA 1TRDA 4GYPA 4L80A 3FW6A 2P8BA 4UOZA 4GY7A 4IIFA 3C8FA 5F2IA 1V3HA 3UGVA 1GOKA 1NVMA 3QN3A 4JCLA 4F0MA 1RY0A 4Z2LA 2P53A 3TYDA 3DFHA 1W3NA 5F4WA 2ON3A 4JHZA 1Q6RA 2R1NA 1H2JA 2RDXA 5JBFA 1OD8A 3RCNA 4GD0A 4D1IA 1DORA 4UR8A 4AZIA 5AC4A 5EY5A 4GVIA 3GK0A 4IQLA 2XH0A 4D8LA 3KRZA 2NT1A 2OLAA 2VP8A 4FAMA 4TV6A 4JIRA 2O9PA 2WM1A 4MUPA 4IUOA 3KBJA 1DKWA 4M7TA 3UA4A 3PWIA 2RFGA 1LOSA 4PB4A 1J0HA 4UFKA 2YL9A 3EDDA 4MWAE 5BROA 1CB7B 2ASHA 4MNLA 2VHLA 4ZOBA 1AW1A 3ZOAA 5F1VA 3EEGA 2YIHA 3OVPA 5CZSA 3LU2A 2YL6A 5C7HA 2VFEA 5FSEC 2EJ1A 4ERIA 4JBRA 4ATLA 4YVXA 1JCLA 4ALDA 1VB9A 2B31A 4PL2A 1DTNA 3VXGA 3ITVA 2VQTA 2OYMA 4XIAA 3GDTA 2AL1A 3UYIA 1JCYA 4ADUA 4HA1A 5BRBA 1XIEA 1PYFA 5HR7A 2ESCA 3L23A 1FDYA 2FHBA 4AX6A 4GZJA 4JD4A 3GFZA 3WEZA 1XIMA 1TJRA 1TV4A 3T0DA 3CAVA 1EX5A 3TIMA 5EKYA 4XIMA 3WLTA 1M04A 2FH8A 4S3KA 3RGTA 4KW2A 3NVDA 3LYEA 3W2UA 6REQB 4I6KA 2KX9A 4Y9AA 1Q2RA 4MWAC 3EWXA 4P7LA 3MUCA 3LSCA 1PTGA 3NZGA 8XIAA 3L4UA 1SU5A 4GNVA 1CXHA 2IQDA 1M5WA 2L5HA 1ODUA 1Y5WA 4N4QA 2WNQA 3WBAA 3L65A 1PKMA 4XKYA 1OFBA 4LS1A 1RQHA 1E5NA 2HPMA 4PE8A 1AQFA 4XBJA 3LSBA 3TW6A 3GXIA 4B15A 3JS3A 2XFFA 3PZ9A 3NZQA 1OIFA 2ZZ7A 4WDXA 1QXLA 4AEOA 5AOUA 3RX3A 2V67A 2PGEA 4XAFA 2WVSA 1JCXA 1XUUA 3H2OA 5CGQA 5F2LA 1HG3A 2CLHA 2XHYA 2GVJA 1XLGA 3HA1A 3P81A 2EPOA 4L64A 1XC4A 4H6QA 1JZ5A 4M7SA 1XBVA 4GQRA 2G96A 3CWOX 2V3EA 3UJ2A 1MUWA 3NA8A 1WOAA 3W73A 2X40A 7ODCA 2QGYA 3L4WA 5CBJA 2PI6A 2YR1A 2OSXA 4PBEA 1PWLA 1UD4A 3LXCA 4J7RA 1E1EA 3O0KA 3M5VA 4HB7A 1GK8A 1Q7MA 3ANUA 4LS0A 3N6QA 5BXSA 3M7WA 1XXXA 5G2WA 3W7KA 5GNZA 4C6CA 3GXMA 4FXJA 4QP0A 3TYCA 1SO6A 4HHLA 1OIMA 1L2UA 5FCZA 4QQ3A 2GWNA 2WCSA 1I4NA 4NX0A 2EQDA 2PE4A 4DZ5A 1F4AA 1XLKA 4J3SA 3VX1A 2P5NA 2YW4A 3DC0A 3W07A 3WQDA 3T6CA 3VNIA 4DWDA 2YFNA 4M81A 5A6AA 2WVTA 3IIPA 2BWGA 4IXXA 5LA1A 1JNDA 4JCMA 1VAHA 1V03A 3N2BA 4ZOAA 3SN4A 5IFPA 4GJ1A 2ZE3A 4HSOA 1FXQA 4PSPA 4FF7A 2ZX9A 4GKLA 3QYSA 1Q66A 2WAGA 4MKVA 3V1HA 2XN1A 4AZ6A 4EK7A 3AYTA 4DY1A 3VILA 4LAUA 3LQGA 1RJQA 2FB2A 4FX7A 3OA3A 2V69A 5DLCA 3OG2A 2HBVA 4O57A 2AQVA 2XFWA 5D04C 2Y24A 3MJMA 1BTMA 4DBEA 3PN8A 1SSDA 3ISIX 2H9AB 3TTQA 1LWIA 3FGCB 3GW3A 4UFLA 1E4NA 1FTXA 1K6AA 2OZ8A 3VPLA 2D23A 3N6HA 1FWHC 3M64A 3RFAA 1B3XA 2CXGA 2CC0A 1W9PA 3ATZA 3W7QA 3AIVA 1AW5A 4YCOA 1Z9AA 3QXBA 4YXGA 2DP3A 5FESA 3A64A 1U5HA 1QOXA 4NZ4A 5D2TA 2V6AA 1F3XA 3THUA 5E0CA 2WHJA 2FQIA 1ISZA 1DQUA 1W1PA 3WD1A 3QKEA 1TWIA 5I02A 1EUAA 1IGWA 3UPMA 3GTFA 1ZAIA 4IIBA 4UQAA 1YTDA 1PX4A 2VC5A 5F2MA 2GSHA 4JTRA 2WK2A 5D9PA 2CIPA 4JX5A 3S3GA 5I78A 5D03A 5A2CA 1XDJA 3W1PA 1AL7A 3BJFA 3WLPA 1QRQA 5EA9A 3W6LA 1IZKA 1J18A 3GXFA 1VYRA 4FR1A 5AYBA 3TTOA 3GU9A 3FKRA 4HJWA 3O05A 4DEFA 2FVKA 3QTGA 4PUDA 1UKSA 1T0OA 3LG3A 4GGHA 4Z1DA 1WDQA 3PTMA 4QG9A 3VU2A 4WGXA 4GFSA 4PRTA 2VO5A 1UKOA 1PDYA 3GD6A 3N4EA 4KCVA 2NV1A 3DKLA 4UFIA 1UJQA 2DVXA 2RAGA 3A3WA 3KL3A 1E51A 1FH8A 3VO0A 1D8CA 4G7FA 2H3DA 3PZOA 3SIMA 3B8SA 5AYXA 3VNLA 1KCZA 4MWAD 2V0TA 3L21A 1ISWA 4BQ2A 1P0EA 2ZUMA 1MRQA 2QZRA 3MI2A 1HW6A 4XZHA 3GWQA 4J28A 1ZZMA 3AIUA 2A3AA 1SFSA 4MVAA 2NX1A 1JULA 3QZAA 3ZLHA 3N15A 3GU1A 1GTEA 3OPSA 4LAOA 2ZE0A 4HNCA 1KO0A 3FN9A 4P2VA 3KLKA 4A35A 2HQAA 5HUPA 2OB3A 2OR2A 1H7WA 3H21A 3B04A 3AIQA 3CHFA 4L9ZA 2OYKA 1KTCA 2ACRA 1XR2A 4OIFA 4Z2GA 1N7KA 1WBJA 4F2TA 3CJPA 1J6OA 3O07A 4GIRA 5FF2A 5F1UA 2P10A 2X7VA 5BU6A 2CU0A 3T81A 2XM2A 1A5MC 3PZGA 4ZOCA 4MUZA 1POJA 1B4EA 4H2HA 3VGEA 2JIEA 2REQA 4JYFA 3D5HA 2CBJA 1EGVA 1BHGA 3SCOA 4UB9A 2IKJA 3HFYA 3AOFA 1EZWA 1F7BA 1H11A 1A5SA 2W67A 1LUCA 4TO8A 3NQ8A 1FRBA 3ABXA 1F4HA 3IJLA 4AXNA 3GO2A 3RNDA 1OY0A 3N12A 4QGCA 1L8PA 1HP4A 4R5EA 4DZHA 4OUEA 1J0YA 5D30A 2JKEA 3SUSA 1UWTA 5FL1A 5DBUA 3VOHA 1XIDA 3WD0A 3DBNA 1T40A 1FWIC 1AQHA 4YNGA 1R3TA 4RNHA 3A23A 4ZMGA 1YRRA 4Z0SA 2QF7A 4HHHA 4NZ3A 5U4NA 3W87A 3CL8A 2PWUA 4AZHA 1A4LA 6ENLA 4KH2A 4J40A 3QGAC 3GVGA 5HINA 4A4AA 4UTMA 3G1VA 2VFHA 1B1YA 4WKHA 5K9CA 4C1NB 1LLOA 4US5A 5L6UA 1KFLA 1MUCA 4ADTA 1UPPA 4W86A 4OZOA 3MUAA 4QS6A 4H9ZA 4LF2A 4NL1A 1HL9A 3W27A 1FA2A 3N3TA 3ZT6A 5LNRA 3MP4A 3AMCA 4PMDA 2A6NA 3W7HA 1UC4A 3LEPA 4JDYA 2DSZA 4FXFA 1ONEA 2GDQA 1IR1A 4JYDA 3GR4A 4G8TA 1DHPA 3N17A 3SR7A 1EUNA 4HPNA 2DT1A 1LOQA 2OTDA 2V63A 4LXFA 1W9XA 2GOKA 1VPXA 1I60A 1RA5A 3EXRA 2GQ3A 4AIEA 1LYXA 4DO5A 1B31A 3ATYA 1QO5A 3KWXA 3GTIA 4WSHA 1RD6A 3OB8A 1OT2A 4PMOA 1F6PA 4YVVA 3CGTA 2VMFA 3N3MA 5G1YA 3C0JA 2BHZA 1C9WA 2OFJA 2QULA 3WQ5A 1WPCA 2TPSA 3CO4A 4ERGA 5E5CA 3G1SA 1WNOA 3HU7A 3UD6A 2WOQA 3QV6A 3CK5A 3S6OA 5DCEA 4HOXA 2PDFA 2GSJA 1OGSA 4LT9A 1O68A 2WHMA 3EOSA 2FTPA 1TVNA 4MY1A 3R11A 1DJNA 3RN6A 3RLHA 1P0NA 2PSNA 3EWCA 3RJYA 3TH6A 3D3AA 1BSLA 3F4WA 3W71A 5D02A 1QNRA 3N2XA 4CQDA 2D0HA 2NLIA 2PDQA 4H7CA 3PR2A 1V0KA 4ORMA 3ZYZA 2Z6IA 3S1XA 1G69A 1S5WA 3RO8A 1PZ2A 3WLJA 3LCGA 2JFEX 1E43A 3N4FA 3LCHA 3MU7A 1PL9A 3SGGA 3T2PA 3P0XA 4D6CA 2YBUA 5TNVA 2ZX8A 3CZJA 2J79A 4DAFA 4EACA 3IIZA 4G7EA 4MFEA 1KV5A 2C18A 1W32A 3LA4A 4LVDA 4OTKA 5FF0A 1O5QA 4EXBA 2GWGA 1UZHA 3S8HA 2VR2A 2WNWA 2YA0A 4I9MA 2YB4A 5DANA 4DF1A 2CLKA 4D71A 2AAAA 4H7VA 1PX3A 1EBGA 5EMKA 3S5YA 1H5YA 3TDFA 4PMUA 4MJ2A 3NQDA 1XPYA 2XSXA 1A5OC 1I2RA 2G8ZA 3S2CA 2P50A 3T07A 1EFZA 5CBBA 1E6PA 4H2CA 3C0LA 1BYDA 1D8WA 3W7CA 3WEMA 5D2XA 2D3LA 1TUFA 1BG9A 4GFIA 3II1A 5G5IA 5FOOA 2O7QA 3GC5A 3E12A 3OLIA 4QSFA 3S1WA 2I5GA 1OCQA 3OHIA 4GCXA 2I7GA 1K03A 1OCNA 2V9DA 1QATA 3WLIA 3INPA 1I0DA 4GUFA 4H3DA 3FCPA 3KTCA 1VFLA 1V6VA 4KETA 1IIGA 1HZYA 1A80A 3BICA 1AUSL 5T9CE 5KZMA 3E74A 3POHA 1X7IA 3AXHA 1VBRA 1IEXA 1XBZA 3AS3A 2MANA 2ISVA 2PDWA 3HFTA 1RD5A 1SO5A 3G2GA 3SN0A 3V35A 1CXFA 3R58A 1OFRA 1FWCC 3PG8A 4YMZA 3L4TA 4C7FA 4LFYA 5I3FA 4JFUA 1C8XA 2G5WA 1UA7A 1DJYA 4AVNA 1NSJA 3TVAA 2YCEA 4D6HA 4I5XA 1SR9A 2V5BA 4J3VA 1OM0A 2VX5A 1DXFA 3WMLA 3U2ZA 3C2RA 1UD3A 1U1JA 1CW2A 1AJZA 3W84A 1R3YA 4X0NA 1VCVA 1IXOA 3P84A 1B57A 1GZGA 3TCEA 1DE5A 1L0PA 4EX4A 1EEXA 3IVSA 1UOZA 3GZAA 3ICJA 1JI1A 3A9IA 5HQEA 3EB4A 3FFSA 4DO7A 1AODA 3I7RA 1E6XM 1TPC1 2VCCA 4C91A 3FA3A 4PUKA 4RE4A 1PE1A 1V8EA 3AZSA 3CMGA 2DQWA 1CECA 4P7OA 3VNKA 4JQ2A 3CV6A 4X0VA 3B8TA 1FCBA 2SFPA 2OQYA 3EOOA 2OT1A 4HCDA 1UIPA 8A3HA 2GJXA 3S0CA 1AJ2A 1KXVA 3FV9A 3FDKA 2NW0A 4EXQA 2XVLA 2X0SA 1US0A 2FGZA 3UPBA 3VOFA 2CLLA 3UNTA 3CMJA 1TJPA 3DU0A 3WDPP 2AAMA 1NF7A 3A4WA 2I1OA 4IUGA 4Y8FA 1J11A 4MOZA 3E0FA 1DIOA 2DJXA 2VKZG 4HPGA 3RF9A 1XF0A 4QAIA 3HQPA 3VX0A 4QITA 2OLHA 4FPSA 3WLNA 2ZUVA 3RCMA 1NDYA 4C5YA 3QV7A 3WH6A 3FHAA 3TCSA 4NNBA 2X2GA 3REQA 3WENA 5G2HA 4WXYA 3CTTA 2ZQ0A 3PZIA 3BTNA 5IM51 4BWLC 5K3VA 3ZR5A 1DJHA 2CHNA 1L6GA 2ZDRA 3U57A 2W27A 3BSMA 1XQLA 2C0AA 2OLSA 2BMBA 3N9RA 4TMCA 1VFHA 2PRLA 1IZJA 1K9EA 4O18A 3TV8A 1ENUA 2HK1A 3I65A 4J2PA 3SCVA 2C3ZA 4LPCA 1OZQA 4E3TA 1YX1A 4XK2A 1WKEA 4IT1A 2FJUB 1FUYA 4S2BA 1P6BA 4WKFA 4C7GA 4OKDA 4P7NA 4PRWA 2DJLA 3TYEA 1M53A 3HGSA 1MNSA 1KBIA 2IPFA 3QY6A 3BMWA 5A8QA 3Q58A 4HA0A 4Z42C 4XBKA 1X8FA 2NLYA 1XLAA 2VZSA 4O53A 5FEPA 3UVIA 5HMEA 1TV7A 4GA8A 4H8VA 3LY0A 1M7XA 2W4XA 3BOFA 1W5OA 1MW3A 2CKSA 3CWHA 4GY1A 4L61A 1ZENA 4A2SA 3W7OA 5EFDA 1O60A 3I3DA 4IISA 2BZNA 2DUXA 4Q22A 3ONBA 4N9EA 4FLQA 2NX3A 3DFQA 4HK6A 1M01A 2WO5A 5J04A 2Y5SA 1ML1A 3R4IA 1X1ZA 3DGRA 2PDXA 1VJIA 3CU2A 4IF2A 4BI5A 1XINA 3F4CA 2Y8KA 4PCNA 1E15A 2ZC8A 4JTQA 1KQYA 2ZADA 1E6NA 1Z89A 5FIPA 1P0KA 4IP4A 3KZPA 1GORA 4O1BA 3IIOA 4HBKA 4IWWA 1BTCA 4QS5A 1QBBA 1NDVA 3LBMA 4E3VA 2WXDM 4NAFB 4Z1BA 3L2IA 1W37A 3NDYA 3UG5A 3WQWA 2Y7DA 1OF8A 5FI8A 3NPUA 3WLRA 3OIHA 4PMRA 1OFOA 1Q65A 3AYSA 1PSCA 3HQNA 4YWSA 5C55A 4IX2A 1EGZA 3AXXA 1TZ7A 3MY9A 1KBLA 3KBMA 2QGHA 1T5AA 1KXQA 4ZB0A 4PEKA 4Y9NA 3IGHX 2QV5A 4IFKA 3CH9A 3I3BA 3CZLA 4HMEA 3L66A 4WIWA 4O11A 3CHCA 2HPIA 1K9TA 1CX9A 3TYBA 4H9MA 1U2YA 3PAOA 3HGRA 3MJYA 3HJEA 5EB8A 3VCRA 2IW0A 1ZBCA 2VURA 2NZLA 3QSRA 4IQEA 2IPWA 1QOPA 4UFJA 1A0EA 1ZTVA 1DOSA 4OECA 2GVEA 5D09A 4OHQA 2VEIA 3FJ4A 3WUEA 2HBXA 3WJYA 3I10A 2MUCA 1TQXA 3GX9A 3C56A 2RDTA 3M16A 3FJ6A 5BMXA 3EWDA 1YXDA 4JFTA 1HP5A 2C71A 2Y70A 3B0YA 2VUYA 4IPIA 3ANYA 4Q4PA 4V27A 1OBAA 3UCDA 3WK0A 2VGBA 4G9PA 2HZGA 3JRKA 1TTJA 3UG4A 3ARWA 3IK4A 1P1MA 4WVXA 3T08A 1TJ0A 3BXWA 3AIRA 4AW7A 3R8GA 4A2RA 1KXTA 3QY8A 2WLYA 2EXOA 4NYYA 4JTSA 1Y8BA 3RK8A 3GQYA 3CUXA 2XWDA 2Q3RA 2CKRA 3QGVA 1X1OA 2UBPC 3V0TA 1M1BA 1RVKA 1XSIA 4KF1A 1MW1A 3MKKA 5HJXA 1TE1A 4PMJA 3DFYA 1EX1A 4LRTA 1B3YA 4XG1A 4AWEA 3HQ1A 5AHNA 3DHDA 4KGJA 4Q6XA 2ZRVA 2J6VA 3S42A 1ESWA 3SQMA 2R8WA 5ABGA 1S1RA 4NJIA 2ZVRA 5REQB 2PWEA 1RQBA 2R14A 2FTWA 3OGVA 1RP8A 1IIHA 3NGFA 3PSWA 4YTUA 3SO7A 3UWZA 3CQKA 5FF7A 2C13A 2PLCA 3T9PA 2WMIB 3CEUA 2CZFA 4H9YA 3TQ0A 4MNKA 1RA0A 3E0LA 4GI9A 5JBEA 4JQAA 2E0PA 1OFQA 3IUHA 4ZQPA 1RH9A 4BF5A 3KE0A 4UTWA 1TPUA 3LCIA 3CHEA 8TIMA 4DJDC 3OLDA 5HXMA 2MNRA 5IXEA 2WQPA 1PXGA 4AVFA 2EF9A 2BODX 3R10A 4LU0A 1UUMA 3LB0A 4JTUA 4O12A 2BP1A 1JZ7A 2BY1A 4V15A 4HZMA 4N02A 1JPHA 4X61A 5A2BA 1I2OA 3WQ4A 2VOMA 2HVMA 3PZUA 2A4AA 4QG6A 1A3WA 3UG3A 3M4HA 4HK7A 1G4TA 3ARYA 5GVJA 4JIPA 4JEJA 2XJ7A 1WZAA 1UD8A 2WC7A 2JEPA 5D37A 4IPLA 4XKMA 2BG5A 4W8AA 3HGOA 1YADA 1TCDA 3RU8X 4E4FA 4S3GA 1FKXA 4AH7A 2PDJA 4NRRA 1CLVA 1VJSA 3HZ3A 5CLWA 5F4SA 1OG0A 3I3EA 1Q7ZA 1TTQA 2F9RA 2WBGA 4HJFA 3E38A 3R25A 8RUCA 3L12A 1EJTC 3VD5A 4FNRA 5AC7A 3VKBA 1TJ1A 1RAKA 3SBFA 2XIIA 3AS0A 3S6DA 2BFGA 1PHWA 3SCTA 4L1WA 2H9AA 1IT7A 2ACUA 1AH3A 4Z1YA 4EPEC 1W3IA 5CZJA 4IPJA 2Y61A 1YDVA 2DZBA 4ZVJA 4YPJA 1XH2A 3MO4A 2Q3OA 3SRKA 2FJKA 3WX7A 1Y7VA 1Q4NX 1Q6DA 4BZYA 4F0KA 4AMAA 4IMCA 5TQLA 1XI3A 1CGXA 4Q8NA 4QE1A 5HNNA 1K02A 1GOMA 1WKYA 3K4DA 3IJIA 1GNXA 3TJIA 2QCFA 2ALDA 4O1FA 2W6RA 3QMRA 4ZA0A 3Q37A 1KBKA 1V6XA 1X6UA 4B5TA 1GQNA 1DJWA 1E6ZA 2R9RA 3KOYA 1UZDA 3DYPA 4H6EA 4B3LA 4OBSA 1O7AA 4H9VA 4PBGA 1UR9A 1J01A 3S47A 3GB6A 4A8IA 2PFHA 4LQ1A 3VD4A 1HGWA 1O66A 5DXYA 2BTMA 1QW9A 1V79A 3PJXA 1IEVA 3SIZA 1QK2A 3EDEA 2ZUWA 4ZQNA 3VNYA 4RW5A 4TX6A 5HWNA 5C9ZA 3VKKA 3K4AA 4PMQA 3MCNA 3GKFA 4S38A 1OYCA 2YDRA 3UG8A 5CPOA 3CYVA 5G4HC 1V77A 3AHVA 3GUGA 2VDIA 3RILA 2QEZA 4GE8A 5AFDA 3QLDA 3EPOA 3UXAA 1L6FA 2QPSA 1VFMA 3NO5A 5L9FA 2TSYA 1VC4A 3PF3A 3LENA 2QPUA 4JTCA 3PNZA 4KWWA 4FA3A 1YE4A 4M1RA 5CKSA 2FHCA 3KVMA 3GYEA 1RCQA 3OW1A 2DH2A 4RKAA 2XIJA 4PMZA 1KM6A 1X38A 3CUJA 1F8MA 3GHSA 1HKJA 4NJHA 3NZRA 4Q8VA 1VR6A 3P93A 1VHNA 4XZLX 2UY3A 4RR4A 3M0LA 2Z00A 4DNHA 1WDDA 3N2CA 3S4TA 1US3A 1CGVA 4CCZA 3NQFA 1I2QA 4WDWA 4LB3A 3DG6A 3NPVA 2GVYA 2J7HA 1A53A 1LQ0A 3ERPA 3VINA 4LAMA 2PGRA 3RXZA 3VIOA 3R1ZA 1D7KA 4RZBA 3NZ1A 1CYGA 2A3HA 5J5RA 2IQ0A 3L0GA 4K8HA 3UFYA 1QDSA 1UR8A 3UPWA 2E3ZA 3DIPA 3BGGA 3POCA 1FWBC 3E2SA 3VGGA 4GVGA 4CD8A 5GNXA 2A85A 3W9ZA 4PMNA 2XISA 1RK5A 3NO3A 4DJDD 3ZLGA 1DVJA 2BX7A 3BE7A 3ARTA 4BFAA 2HE8A 1E3XA 4LVBA 1P5BA 3CMFA 3NQ2A 3TC6A 3NSMA 4HHPA 3UERA 1EYWA 4KFPA 5AVNA 1GVYA 2PTZA 1CB2A 3TJLA 4U3CA 2ZOXA 4US5D 1THFD 1XIIA 1H49A 3WCZA 4J4KA 4INFA 1HFBA 5EMLA 1XX1A 4YJ5A 2ACQA 3H24A 2X7WA 1R85A 1SVDA 4NZJA 3E5BA 5LYRA 4C1NA 1W5QA 4OV9A 1VF8A 1Q45A 1RPXA 3VA8A 1Z44A 3WKZA 1E6RA 4UR7A 1QFEA 3B3DA 4DRSA 3SUTA 2D0FA 3A9BA 5AECA 4AZCB 2ZZ5A 1KNWA 4AIUA 1WA3A 1A49A 1QI4A 1ECQA 3E0VA 4RUBA 1Z8AA 4CKQA 4X60A 1OX4B 1TV3A 3C8NA 5TIMA 4J2MA 5HPCA 4M19A 3R0KA 4ZB2A 4LYKA 1CXKA 4P8VA 1ALDA 3AXKA 1QK0A 2F2KA 3RMEA 1VCGA 4RX0A 2JGQA 1M7JA 2QCEA 1WBHA 3EX1A 3NVTA 8XIMA 4KRUA 4KERA 2OG9A 3U2CA 4JQ4A 4FP1A 3S1UA 3IUIA 5D33A 3VZXA 2QCDA 3WLSA 1E6QM 2VOTA 4OBRA 1IE7C 5HMSA 3GG1A 3MHFA 4PL1A 1KWGA 3SN1A 5JQ9A 1SPQA 3GC4A 5I00A 2AL2B 3TK7A 5HMDA 1R38A 1ZY9A 3F4DA 2WSQA 2A3BA 3NZPA 2PURA 2BOEX 3ITLA 4WDUA 3CZKA 1XQKA 4I9TA 1E73M 3GFYA 4KWVA 3USZA 4AIOA 4CN4A 3QMTA 2NSXA 3O7UA 3MHGA 3RM9A 2J8GA 2JF6A 1C8YA 1UD5A 3KRBA 1F6KA 6TAAA 2QR6A 2ZA1A 1N8IA 1K7FA 1WE5A 2W5FA 2PRHA 1YE6A 3ZSTA 1ZP3A 2ALRA 1AZ2A 4YU1A 4O1DA 1ICPA 3I6RA 1WOBA 3RHGA 3TYAA 1KGWA 3MC5A 4JTTA 2FKPA 3TN3A 1SGJA 3KL5A 5AY7A 4E0CA 2XFYA 4GACA 2XN0A 4ZSTA 3KP1A 1Q6EA 2ISFA 2X1SA 5TAOA 1E5JA 4HKPA 5EMJA 5IOBA 2PZNA 3GDLA 1UR4A 2CLEA 1WAWA 1J96A 4Z2KA 1SJCA 3GS6A 3D0CA 3WEOA 1JDFA 4CD5A 5I0DA 2Z1SA 5A95A 1R6WA 5H8PA 3ARRA 3W2NA 3VIPA 1CENA 1SO3A 1H41A 2G3NA 2JALA 1FWEC 3GAYA 5BXPA 1CGWA 1BF2A 5LGZA 3O1NA 1FWSA 4ILSA 1TREA 4O16A 1CI1A 1XICA 1VH7A 3NL2A 3BW3A 2QUVA 3RLGA 2VYOA 1RXOB 3F4VA 2Q71A 1ITUA 2LLEA 2QCCA 1W6TA 4YHEA 2PPGA 1Y0EA 4XISA 3IJ6A 1LCOA 1E9YB 3CV7A 5AHLA 3SRFA 1SMAA 9CGTA 3NG3A 3GTNA 3F5KA 1K7EA 4C6QA 2GK1A 3G24A 1JGIA 1RHCA 3T42A 1W17A 4NNCA 1AH4A 1KFKA 3WDRA 1GYNA 4PUNA 4MAZA 4W7WA 4DJFC 2IS7A 4ACZB 5CC6A 4LUSB 5J5DA 3NQEA 1RSCA 5EPDA 3AHZA 2D0GA 3PBWA 3SECA 3ARZA 2HVNA 2QJIA 3DC8A 1QO2A 3EOUA 1EP1A 1TA3A 2ZUNA 1KWKA 2WKGA 3CH0A 3G18A 2IUZA 3OZMA 3WDHA 4ZGYA 3WNOA 2VFDA 2ZICA 4F2UA 4M6VA 5K4XA 3LV5A 4TQTA 1UR0A 4N6FA 4AYGA 1LG2A 3DZ1A 1EO5A 2PDIA 3MMWA 1U30A 2Z7GA 1KD0A 4UQ9A 4MZ8A 2RDWA 3SGUA 3MMDA 4ADSA 3G1AA 2XZ9A 3KTXA 1BKSA 3W72A 4W9TA 1QNOA 5I3GA 4URIA 3EDFA 5FEXA 4R85A 3W81A 4DVOA 3WG6A 1E0VA 3N25A 4ML9A 4NXSA 3HMCA 4JIQA 4YVPA 2X0HA 4EANA 4MMWA 1M7OA 5LXEA 4XZWA 3WQ6A 3H12A 1E70M 2C14A 4IFRA 4DWSB 2QUUA 2OEMA 3VZYA 2XTKA 1HF6A 3BOXA 2UY5A 3W70A 2RKXA 2H6RA 1W54A 4JTKA 4JTGA 1J2BA 4U4MA 1XBYA 1O4UA 4R9OA 2UY4A 3EB2A 5HJLA 1JIBA 3VVGA 2WANA 5HWJA 4ZE4A 5KSWA 1JPKA 2Z24A 3T05A 2J7EA 3WQCA 2O9TA 4P8XA 1QW8A 4HT3A 4ZEPA 1UUOA 1F3WA 3SCWA 4J1OA 1TX2A 3W7JA 4K8GA 4GC3A 3QHNA 2E6AA 2D24A 5HQLA 1J0KA 1TO3A 4NX5A 1PTDA 1WCGA 1D3HA 3URAA 2DORA 5BOOA 2VWTA 1ZBWA 2YB1A 5EL1A 1YEYA 1FY6A 2ATSA 1YKWA 2EPLX 1X6LA 3FYYA 3QR3A 5HWMA 2ZTJA 4B5NA 2PTDA 1XH1A 1YDNA 1XRSA 4GJJA 4KFOA 4FNUA 3LRMA 5A6KA 4G5DA 2CERA 2VFFA 4JY8A 4LCSA 3L5AA 3HM7A 1YNPA 5CZKA 4GYFA 4C60A 4NHVA 4MWAA 4BQ4A 3GVRA 2BLEA 2VUNA 3EA3A 1UQYA 4U10A 3W7RA 4JN7A 4RDVA 5DRCA 1M3UA 2YBVA 4V2XA 1TPH1 2VZUA 4LCQA 4CNPA 4CU7A 4KT2A 1DBTA 1UWRA 4JTDA 1JZ8A 4ICNA 1GKRA 1ZJHA 1V6WA 4NYUA 3L67A 2OQLA 2E25A 1AH0A 4NRSA 4TUFA 1RR2A 3F4NA 1CLKA 3FA4A 4ZXLA 4GZ7A 3M44A 3GH5A 4DM2A 3UZYA 4OE7A 1JVNA 2IXVA 4REQB 1S3HA 1FH9A 4NKCA 2GGGA 4MIMA 1I9CB 3PY2A 3ELFA 4B5UA 3QOKA 1YIXA 2NQJA 1UMLA 3QPZA 5G2IA 2X8RA 3AS2A 2ZFAA 5A6SA 1WX0A 3IJDA 4QLJA 3EZ4A 3RR1A 1ZJIA 3QHMA 4LYQA 3NPXA 3U9IA 1E6SM 3LLXA 2J88A 2Z29A 3LV6A 1QJWA 4MM1A 3OBEA 4S2CA 3CXOA 5F2GA 2PD5A 3W7IA 4JIIX 4WZHA 3DBPA 4ZO8A 3XIMA 4XUGA 2A7RA 3EBVA 1V5XA 3SEPA 1EKOA 2PTYA 2YPIA 2DV0A 1XCXA 4IMAA 5B80A 2EKGA 1DQWA 4H9XA 4RE3A 4XD4A 2PDYA 4M82A 5GJNA 2VEPA 1KCKA 3WD3A 3W1TA 5IHRA 1UCWA 5CBIA 1KCLA 1H4PA 1JZ3A 1ZFJA 2D2GA 4WEVX 5RUBA 4KGLA 3M07A 2RGLA 2E8YA 3WBXA 2PAJA 3TE9A 1NOWA 3LZ3A 3TW9A 3HN3A 2OELA 1TE6A 1US2A 2YFOA 2Z1WA 4W7VA 1XV8A 5HBFA 2OWWA 4Y9MA 2CFFA 2XVGA 3O3RA 2Z26A 2ZX7A 2OJPA 5KETA 3PPGA 3TSBA 1CLXA 1NELA 3E0WA 1VFTA 3W25A 4L4LA 5E6YA 3KOZA 3G1YA 1QNVA 4UXDA 3E02A 4KESA 3TTYA 4L6HA 3HPSA 3VKCA 3WO8A 1JFXA 2R1MA 4XVEA 3WK2A 3WDJA 5HAOA 4B91A 3ABRA 3AWOA 3AISA 5CJNA 4KFNA 2V30A 4HPJA 2W79A 3KBNA 1V3MA 3A21A 1SO4A 3GU2A 1XLJA 3U5UA 1QCWA 3BZGA 3U2EA 1SMDA 4LH8A 2AGTA 4G1KA 4FALA 3GDMA 2WLZA 1J79A 1JCJA 4R53A 1B90A 3QQ0A 4PCFA 3Q4DA 3N73A 1U22A 1GJPA 5KZDA 1UZ1A 5REQA 1REQB 2VD9A 3H2AA 2ABBA 3G1RA 3KVKA 3TA6A 3ABZA 3GXDA 3WD2A 3GZ3A 2E9MA 4ZO7A 2OEJA 2VRKA 2DZAA 1BYBA 4I5UA 1FDJA 4UTUA 2E28A 4IP5A 3HV9A 2BXYA 1PHQA 4XAPA 3CNYA 2ZKMX 3BW2A 4DIAA 2B81A 4GBUA 3DHFA 4M24A 5CGTA 2EEXA 4C6PA 1A5NC 2NUXA 1IWAA 3WNNA 5HNTA 3IGUA 3WDQA 2CHOA 2VR4A 2V8ZA 1OINA 1CT5A 1G1YA 1LWJA 2XSAA 3UA3A 2G97A 3UZZA 1MZHA 1W8GA 1JYXA 4UWMA 1R47A 2Q8ZA 1H61A 3W7NA 2BVTA 3T44A 1I0BA 4FX6M 7REQB 4B2DD 3WUBA 1ZBKA 2RDUA 4NSBA 4HN8A 1V6UA 4LUTA 3LNPA 3GVQA 4NAEA 4QX4A 5A8MA 2EAWA 1CBGA 3R8HA 4H9TA 3QQ1A 1O94A 2BY2A 1C8QA 4HYRA 1S2TA 2DW6A 3H54A 4CCEA 3P8IA 2BBFA 3KM8A 3MT1A 3P6LA 4UQBA 3OGRA 2XZ7A 1FWWA 1NOUA 3ITXA 4EF8A 4QJ4B 4WY0B 3ZVHA 2WMGA 4UQDA 4O19A 3ZXWA 3CL6A 1EYEA 4JN6A 1S38A 3J7HA 4YS1A 1GYLA 3MV01 3TLQA 3DYMA 3VMPA 4JPGA 3OVRA 4NUWA 2HNEA 1HJUA 1TTIA 3N29A 4LB4A 3LN3A 3W7MA 1VFFA 3WJXA 4AIBA 5FAGA 4UNIA 2PWHA 1NTHA 3W23A 4DN1A 3FA5A 1IEQA 3R0UA 4UBPC 3KWSA 2VC9A 1YHTA 3VGDA 4IL0A 2ISWA 1OC6A 3QTPA 1CXEA 3HPFA 2WKJA 3PPCA 5C54A 3CQJA 3ZT5A 5CJ5A 3WF0A 5HA7A 3AHTA 3TN6A 3VOIA 2Q6ZA 3WL1A 3MKCA 3AMGA 1XPGA 3PVFA 1TJ2A 1VYPX 1ZJAA 4F40A 2HE5A 5B7ZA 4EAYA 5CC3A 2ZRYA 2ZYFA 5M2FX 1N8FA 2PF0A 3LRKA 4MKSA 1MXSA 3V18A 3CPRA 3CIVA 4XSLA 4S3DA 3DFTA 4JFVA 4H8NA 4OQVA 2NX9A 1JYVA 4BS0A 1G01A 3DEQA 1OVDA 1Z6KA 4U28A 2YZRA 1ZCOA 2E7FA 2OGYA 4QQUA 4QTGA 3VDHA 1JNEA 1P6WA 4PULA 4G56A 4MLRA 4LBUA 3MUXA 3TAKA 1TR9A 3C6CA 2FVLA 4ZTXA 1AVAA 2HCVA 1LF1A 2D1ZA 7XIMA 2WJDA 1OHLA 3L2LA 3TOYA 4GZEA 5E9AA 1EWEA 1BXBA 1HNYA 3EPMA 2WSKA 1W2PA 5JXQA 1SR0A 3VFCA 4YIWA 1HJSA 2PF8A 4AD1A 1P4CA 1I6NA 3SCPA 3AYRA 1NU5A 2CYGA 4AD3A 2Y62A 3FXGA 3AS1A 2H8XA 3T8LA 1XIJA 2DGAA 3CPGA 4Q8TA 2XH7A 1BQGA 3CHVA 1E1FA 4WY0F 3B8VA 3O06A 4YHGA 2HTMA 3KS5A 4JTHA 3UXDA 4MGGA 5CSYA 4HYWA 1JAEA 1L6WA 4CLMA 4GXPA 3M6YA 5FJPA 1EGMA 1W5MA 4HPHA 3FEMA 2J4GA 4B16A 3B9AA 4DZAA 1XIBA 1IYXA 3N19B 3U48A 1XGEA 2OU4A 3OLEA 2DDXA 4ZQOA 3M41A 1ICSA 1P7TB 4J3UA 1VHCA 4UTHA 4U2YA 2A3LA 4TXEA 2VCAA 3LHWA 1YXYA 1R87A 2WSPA 1ME9A 1X39A 3C0SA 4FK9A 3LQLA 5G1MA 4F0SA 1VKFA 1WZMA 2AQOA 1ZNNA 2QCLA 1SM9A 1NFBA 5SWUA 1FCVA 1B9BA 2CLMA 2NXIA 1BWKA 3GIPA 1UWQA 3VIKA 3MUY1 2PRMA 4OUIA 2YA1A 3G8RA 4PGLA 2W3ZA 2DFAA 1EWDA 3EGJA 5F4XA 3WQPA 1E9LA 1LQ2A 1OGGA 3CV2A 1JFHA 3NURA 4H1ZA 5FJTA 4BI7A 5CJMA 5GQBA 3CZGA 1QHZA 2G50A 2W91A 2DUZA 3U3HA 3DFPA 1R46A 4BQ5A 4A6GA 1VYSX 3NGJA 5D9OA 2FZBA 3AICA 1KQZA 3OBKA 1OCBA 1RCOB 2FVMA 4AZ5A 1JDCA 3GNRA 3KVJA 2V5DA 3P67A 3PZVA 4GGBA 2R94A 1UD2A 1ZLPA 4NIRA 1W9VA 1WDSA 2TRSA 2XGBA 2YYUA 2QV4A 4KEUA 1B2YA 1EJXC 3M5XA 2OYLA 5D8WA 1P6CA 4HSNA 1YMYA 2R1PA 3VKDA 4QAWA 2XVNA 2CLFA 2VI0A 4PUEA 2GVGA 3Q2DA 3CL7A 2JE8A 3ARSA 5C9RA 1Q13A 4RNFA 3UU0A 2HDJA 1GQLA 2J9YA 2HVOA 9RUBA 2E6FA 2Z1BA 3VDCA 4QRNA 1GOQA 4DQWA 3BG9A 1HO1A 3UVAA 1DWFM 4F9JA 4S3FA 1FHUA 4H41A 4KMQA 1JDDA 4MADA 3VNZA 1G7VA 3JW7A 3APGA 4QE5A 1QNPA 3VCNA 3R43A 2V2DA 1F2JA 2ZUTA 4QSHA 2ZWYA 5FL0A 2PDUA 1OADA 5HR6A 7ENLA 3BGJA 4ZXOA 1PCKA 1G94A 4BF9A 2I5IA 3WELA 1M7PA 4HMNA 5HUOA 3VDAA 2WC4A 4Q8UA 3C5QA 4UTFA 3CV1A 2PDBA 2AMXA 3MBDA 3LHZA 2Y85A 1QBAA 1EA9C 2VVNA 4HU0A 3SQLA 2OQHA 3N11A 3GNXA 1F73A 4ZQCA 2UV8G 4JDBA 4LUJA 3WMBA 5XINA 4GX9A 1H0IA 4C5ZA 2PWFA 4A8RA 5BXTA 4ZFMA 4MTVA 5I3JA 3M7SA 2E40A 1TWWA 2NWRA 1KFCA 3H7UA 2GDVA 5BNKA 2NV9A 4GUGA 3VI2A 2CXEA 1ONXA 4GLEA 2X16A 4K2SA 3GC2A 2E6YA 5I23A 3R89A 4H01A 3IEBA 4L1XA 4JNYA 1PCWA 1BGAA 4CD4A 1BYAA 1I75A 2WPGA 1XYFA 4IGSA 2VC7A 2E09A 4RDWA 4V1XA 2EG6A 2ISSA 4LF1A 4FF5A 2NT0A 4NZFA 3TWAA 1E56A 3OVGA 5IBXC 2QJGA 3SRHA 4XO6A 1XKYA 4FLSA 3A3HA 2O56A 4MZ1A 1VFUA 1KRMA 1TTPA 4XKYB 4R7JA 4L4MA 1UPMB 2V68A 1BXCA 1RALA 3M0YA 4L4OA 1EDTA 1VBHA 4AF0B 4UTTC 3ABQA 2BASA 3GSMA 2WWDA 2Y89A 3G22A 3B8DA 4D72A 2BDQA 4Z2HA 1DV7A 4K68A 1O12A 3CT2A 4CNSA 5A8GA 4FIRA 1GKPA 1QHPA 3JVAA 2J7CA 3TA9A 4PCSA 1CTNA 1VFSA 2EHHA 3EB3A 3BAWA 1KFBA 1MFUA 3OJGA 4P7QA 3V5OA 1QNSA 2OWXA 1G4SA 5LIYX 3W7PA 2G3JA 4PFHA 1TPVA 4GK8A 3EX4A 4BWLA 4NI8A 2PTXA 4M80A 1J5TA 4D6EA 3NNTA 1O1ZA 1UMYA 1WXJA 2WPBA 1FVPA 3WFLA 3I68A 3WLMA 2WVVA 5LHEA 2XIBA 4B9ZA 4N42A 2FTYA 1TPWA 2YCIX 4IG2A 1CPUA 3QJAA 5FACA 1IXNA 2DIJA 4LTSA 1GYMA 1OABA 5AKQA 2DT0A 4K1WA 5EYWA 4GO8A 2ZX6A 5LHFA 1JF5A 3N2OA 2J13A 2O55A 1VQTA 1GQKA 4M29A 1EC8A 3IGSA 4C6KA 1V02A 1ZPTA 3PTDA 2P76A 2IXUA 2DT2A 2VX4A 2PCQA 3SW6A 3CWNA 5LZLA 4ECLA 4L9YA 3CC1A 4H6KA 1DQXA 5XIAA 4W93A 1A5UA 2R6OA 5FA5A 3ARQA 3AALA 2YDAA 1JQXA 5KTLA 5I07A 2Y6ZA 4CVUA 2VFGA 4RJEA 3RUBL 4XZNX 3W38A 2IPGA 1PPIA 1DWGM 4JTEA 1EDQA 3OEXA 3OBAA 5D05A 1TPDA 1ELSA 5DO8A 1Q2SA 4R7WA 2XSBA 3H6OA 3PS7A 3OA5A 1QI5A 4YTTA 4E4PA 5M03A 4W4QA 4M0XA 5M5DA 1GVQA 1QVBA 1B3WA 3MV11 4DXKA 2BV9A 1TELA 1UW9A 4GG9A 3ZMRA 3XINA 2OO6A 3AHXA 1UR1A 3NQAA 3ALFA 3AROA 4Z2IA 1TUXA 3PPFA 3WUFA 1KXHA 3EA2A 1MEHA 1FXPA 1GQJA 2DVTA 3RX4A 4GH1A 5FEZA 4IMEA 2EJAA 1ZUAX 3CBWA 4LOCA 4DBUA 2ODOA 3M0MA 4KCUA 5CEWA 4GQ0A 4IJBA 3T40A 3MB9A 3CAQA 3EMZA 2OXNA 3QGKC 1P1XA 2Y7EA 2P3ZA 2VM8A 3V7PA 3O0FA 1JD9A 2ZZ6A 3UJRA 3VGHA 1JL8A 2G3IA 4K37A 1MRAA 4L6OA 4C6IA 2ACSA 3OODA 4GPNA 3H4GA 5EBUA 2OCZA 5C9UA 4CQCA 5G4EA 2OOGA 1XW8A 2CZVA 1W1B1 4TV5A 3FJNA 3IWPA 3PUOA 2P0IA 1K4HA 2J78A 5A6LA 3FYOA 1EC7A 3W24A 4U2ZA 2E5CA 3NOEA 4UCGA 4LBSA 2GVLA 2XM1A 4GIEA 2O92A 4AWTA 2XDFA 1K9DA 4YTSA 2POZA 3THAA 2NUYA 1WV2A 4XB3A 3ES8A 1X7FA 5CAKA 3ZR4A 3DX5A 3WQVA 4BEQA 3OVQA 3RIKA 3GBDA 4O28A 3WNMA 1OX5A 3R12A 2NWSA 2VRJA 2D2HA 1V51A 4ZENA 2E6DA 3WF3A 3AJXA 4Q7NA 1MFVA 3ME3A 4Y90A 4F66A 3G1DA 2Z6JA 1QASA 2AMGA 5C6MA 3LXAA 1A0DA 1LZOA 2PDPA 3GDRA 2Q8LA 3BLFA 2HXTA 1MEWA 1XFCA 2CETA 4HGXA 2CWXA 4O0QA 1AJ0A 3WN6A 3BANA 1PBGA 3DN5A 4ZSUA 5BRQA 4FLRA 4AD2A 3LXBA 5AHFA 5C2CA 1BYCA 5AYZA 3LMZA 1B3VA 2CBUA 2POTA 3VOJA 3PWAA 1OK6A 2CLIA 1N55A 3IUDA 4IM4A 4NASA 2YBTA 2ZCGA 2REQB 3LLFA 2WV8A 1E1CA 2PDMA 3BG3A 3WK3A 5D2WA 2QIIA 1GTHA 1E9IA 2O9RA 1D7FA 4OFCA 3VGFA 4LAZA 3W1AA 2V3DA 1LUCB 3CQ0A 3OG3A 3SGZA 4ZQMA 3BQ5A 3T4WA 2YGYA 2ZWZA 1B30A 4B5WA 1OC5A 3WQGA 1QPQA 4XVDA 3BLOA 3W76A 1B3OA 1H60A 3RU6A 4HMDA 2BVDA 3T09A 3PC0A 3VK5A 3ZJ6A 4QJ5B 3O2LA 1H51A 1Q4WA 1LWHA 1C7TA 1ZU8A 1KKOA 3ITGA 1VBGA 3WIJA 2NQ9A 3MA8A 3MP5A 1HKIA 4DJDA 1J0ZA 4CVWA 3NOYA 3AU6A 4POCA 5DBTA 2E67A 3Q67A 1IT0A 4M6UA 2J9ZA 2O9OA 2GGHA 1TMLA 4MDOA 1Z42A 1TWDA 5KINA 2QXWA 2CESA 5D8ZA 3A4AA 1PZ3A 1EO7A 2DSVA 1Z48A 2P8CA 4AC7C 1OCJA 2HXUA 5FJRA 4UMBA 3WQFA 3QC3A 4Z1CA 2VXNA 3GG8A 1GHRA 2X09A 3URQA 2OODA 1TYGA 4NY2A 5M3WA 1S5MA 2ZRXA 3EWBX 6XIMA 3HBLA 1SZGA 3B4YA 4I9JA 3H22A 1UIOA 3BGAA 4C6LA 3O63A 1FH7A 4HU3A 1O6IA 3BK0A 2PU1A 2GUBA 1A4MA 1KTNA 1DP0A 4EWND 1R3VA 5LNUA 5CSSA 4DAIA 2J24A 1OWQA 3VCCA 4GY0A 3V4BA 1XP3A 3RPTA 4M56A 4M6QA 3PBGA 2FZDA 2D2JA 4GCAA 4EXAA 2Q09A 4RDZA 2D20A 5ABFB 3PP7A 4P7RA 1H5VA 1ZCCA 4HIBA 4U31A 3TR9A 3R94A 4MPQA 2E1DA 4FB7A 3UGRA 4GZIA 5AC6A 3H8AA 4EAMA 3SFKA 2HV5A 2C7FA 4EWJA 2QVNA 1J2WA 1C91A 5KZEA 1F07A 1M6JA 4N9BA 4F48A 1OT1A 3E2VA 3H2EA 2OOFA 3P82A 2G0WA 4RPQA 4CCDA 2RHGA 2RUSA 2TYSA 5KEZA 1R5YA 1RK6A 1NH6A 1ZJBA 1UH2A 2QCGA 3W2KA 4HCLA 2FFIA 1XD0A 4LNYA 2PP1A 5DMLA 3E2QA 2WBKA 4PMYA 4Q4RA 1OD0A 2FPTA 5A1AA 1A3HA 1VRDA 1UASA 2GL5A 1XRVA 3GNPA 4PMVA 3VIIA 3B8WA 1G6CA 4R33A 1ZQ5A 4UTKA 3AMDA 3NQ7A 2YDSA 1E55A 1RLDA 3S2LA 1E3ZA 1UH4A 2QUMA 2W63A 2WZMA 4Y7EA 4KEZA 1LROA 2WSYA 2DPEA 4TVUA 1XLBA 4O0ZA 2E9LA 3VFLA 3WQOA 2XVKA 3CYJA 3JU2A 1RY8A 4TR9A 3MO7A 4N0RA 1YTKA 1KKRA 1W2VA 2B0MA 5BOFA 1V0MA 4ZBCA 4FO4A 2VZTA 4UTLA 1REQA 2INEA 4N9DA 3DECA 3MVIA 1A5AA 3VGBA 1Q6FA 2AKZA 4R9XA 3S6TA 1UKPA 3MANA 3THDA 3H2NA 1NDWA 5A6BA 3UF9A 4AB4A 3L4YA 3IPWA 3W7LA 2BY0A 2PC4A 1EJRC 4DYKA 3O15A 3MYPA 1LL6A 3SUUA 1NAL1 1LDCA 1PIGA 3EMQA 2YCLA 3P3BA 3BAJA 3VDBA 4B5VA 3VIHA 5C9WA 3P5ZA 3GIQA 1XS2A 3VD3A 3V1PA 4EKJA 3SY5A 5DFAA 3EWYA 2Y1HA 3WLKX 4Q4SA 2XH4A 3ZJ8A 1DXIA 4JN8A 4ORIA 1JAKA 7REQA 3BAXA 4GNKB 1V3LA 2WJEA 2IKIA 3M0VA 1F05A 1UD6A 1F3EA 1JXKA 2R91A 2QMJA 2YLLA 1NOFA 3RX2A 1WDPA 1XRTA 1AD4A 3AO0A 3PSVA 1MW0A 4X63A 3ZWSA 2Y8VA 3AYVA 1I2NA 3ITCA 1MEIA 3HG4A 3NQMA 1SJAA 3AU2A 5GJMA 5A8PA 2G37A 1Q8AA 2Y0FA 2QJMA 4JKLA 1H7PA 4K1GA 4WY0A 4HU4A 2X0YA 3K4WA 1HIZA 4HNOA 2F61A 4TTUA 1WDWA 4JGDA 3W22A 3WY1A 3NQVA 1NWTA 3OYXA 3E3HA 2V5JA 4JTJA 3SCNA 1LTDA 2YKKA 4CQ8A 2JIWA 3W6YA 3FX4A 3D3FA 4S3AA 3N18A 2W92A 3OZPA 3B0PA 1D3GA 4W85A 2C1IA 4PYSA 1IT8A 4HTYA 3KAOA 3TQKA 5G4WA 5DXXA 4B92A 5LNSA 2J75A 3P8JA 1X97A 1HO4A 4P8WA 4RCXA 2BS9A 5I5RA 6ALDA 1HTIA 1RQEA 1H1YA 1NF0A 4XX6A 1C29A 3D6NA 1D3CA 5C2GA 4JS3A 3EOEA 3G0XA 3GFXA 4B4FA 4J27A 2GQ8A 5HJYA 1JZ4A 2DZUA 2Z0IA 3O6AA 1JDEA 3IARA 5I77A 1JCTA 1Z41A 2OT0A 1W1VA 3LPFA 4S3EA 2BVWA 2QCNA 5CPSA 2D2OA 3WH5A 4XZBA 2W61A 2VTFA 1MUMA 1W0MA 3CAKA 5AB3A 5K9DA 2E68A 1UR3M 1K6WA 2VZOA 3PZQA 2HEJA 3TJ4A 2NQLA 3W83A 1R9YA 1V02E 1DWJM 4HD5A 2Q02A 3FYPA 3TMLA 2FZMA 2GJXB 5GJPA 5FJOA 4HNVA 3B0VC 1TV8A 2EG7A 3DI0A 3MP3A 1UUQA 1VRXA 4E2BA 2PLMA 3LGEA 5MKGA 4G2DA 2GQ9A 2JK2A 3VD7A 3LM7A 5ABHA 1W9UA 4IPNB 3WJWA 3FLUA 1NQ6A 4IFOA 2C6QA 3W02A 5LNVA 5E0FA 4RNJA 4C6FA 3GAKA 2VT0A 3GIYA 4S1FA 1Z3NA 3UWQA 3W53A 1J0JA 1W3KA 1B54A 1N2VA 3IJ7A 5DY2A 1FFRA 1TB3A 3NDZA 3REQB 3E6EA 3NFUA 4C6BA 1XG4A 3WJSA 3FOKA 3P0WA 3VM7A 1Q6GA 3GY1A 2Z28A 3UJEA 3GH7A 1Q3NA 2YX0A 3IS4A 3G6LA 2YW3A 3NEHA 3SSZA 3GYCA 1ZAJA 4AWSA 1BRLB 4ZE5A 4EE9A 3OZOA 3RJXA 1KRAC 5JBDA 5JH2A 4IPPA 4A3YA 1UHVA 2CCRA 2HMCA 2YXXA 2A5HA 3L4XA 4WSJA 2XWEA 3UYCA 1JXJA 3VABA 2P1FA 5I03A 3ABOA 3WNPA 3V5CA 2PUZA 1CWYA 5A6MA 4PC8A 3PB0A 4CU6A 3U4FA 4CN1A 1Y5XA 2NSOA 4UCFA 5HMFA 5CH9A 4J5NA 1TPB1 4IGNA 1GW9A 4UOJA 2JKPA 4E5TA 4GBDA 1NFGA 3MHUA 1PX8A 2GJLA 2W9MA 1NP0A 5FKYA 3WLQA 4US6A 4LEFA 2WW5A 2WVUA 3H53A 5I09A 2XPKA 3CLWA 4JZ5A 2VGIA 4Q8OA 5K4ZA 3GR7A 2JBMA 4C1KA 2Y4SA 5D38A 1EBHA 4YTQA 2PZ0A 3P5YA 3K8LA 3NQ6A 2XGZA 4MYXA 4NT0A 5TD4A 1VFOA 3QYQA 2V3FA 4LY4A 2W66A 1L6SA 1P0BA 3OO2A 2QMKA 1KCXA 1HUVA 2EPMX 1EZ2A 2GJNA 2A0NA 4YCPA 1V0NA 4KRTA 3TLLA 2V38A 4O10A 2UZ9A 3NPWA 1XIFA 4JKMA 4DYJA 1BVZA 3MUIA 2GGIA 4IIHA 3W88A 3OLGA 2G41A 3JZEA 4O8AA 2Z2BA 4PH6A 3UY8A 1WP6A 3TX9A 4XZ9A 2NVDA 4K7VA 3H7RA 3AUOA 4IMFA 4P5UA 3UW6A 2FB3A 4DX3A 5BXRA 3RG6A 5DN1A 1EC9A 3NXFA 2WHKA 3SCSA 4X2PA 5DELA 3KVLA 1AFSA 3WNKA 4DWSC 4W5UA 3L2MA 1GHSA 1FWRA 1W56A 2HS6A 4DBWA 1GVOA 3KXQA 3LCXA 3ARUA 3W1NA 3ZO9A 3K5XA 1BAGA 2GLKA 1GVRA 3CEPA 5BWAA 3SRDA 4DJFA 1F9CA 4PUMA 1K77A 3PB2A 3R6IA 4HNLA 4IGMA 1PV8A 3GUWA 2QUTA 3MDUA 4IFKB 4XZIA 3NQGA 1Z7AA 3MMUA 1GJUA 3C2EA 1H7RA 3O9NA 2B7PA 1MO0A 2WB5A 4MY8A 2Y7FA 3SUWA 4K3ZA 4X9YA 2J7BA 1PVNA 4Y8EA 5CPNA 3PUDA 4DLMA 1EPVA 1DTUA 3E1F1 3K30A 1UR2A 4XAYA 3U7BA 4B90A 4WHBA 3MCMA 5CPMA 4QEHA 3BAYA 1ITQA 4C7DA 4IIDA 3WSUA 5E93A 1ZALA 4DHGA 1ONWA 4WK9A 1GGOA 4PMXA 2AGKA 4W84A 4I7VA 2PCEA 3S5ZA 4NZ5A 4U33A 3VIJA 3DYOA 2GQAA 1BGGA 4Y6GA 3PUEA 3TJXA 3UWWA 4D9PA 2Y7GA 4A3HA 3NYZA 5ABTA 4AAJA 4KCWA 4LGXA 1EJUC 6REQA 3STPA 2HJPA 1EOKA 1PZ0A 1FHDA 5D2VA 2JKAA 4A21A 4UOQA 3NL6A 1YPIA 4MKNA 2DZTA 4K6AA 2INFA 3KBSA 3A24A 4JTIA 2C91A 1NDZA 1GZJA 5BWFA 3TP4A 3HMJG 1NWRA 1IXPA 4AD4A 3ZR6A 2I9UA 3FJLA 1DWHM 1TZZA 1O95A 3QW3A 4N9CA 4AF0A 2ZC1A 1CDGA 1BPLB 2J8TA 3EX2A 3CIWA 4NNAA 2QJJA 1EB3A 1TV2A 4O4WA 4O54A 2HS8A 4U5KA 5EBAA 3LHVA 4FOKA 2QVHA 4ICMA 1B3ZA 4CD6A 4K7YA 2PGWA 3V36A 4QHRA 2E5DA 2PC8A 5K9XA 1W1TA 4WF7A 1NJJA 3AIBA 3SURA 1EEPA 1E72M 3H70A 5FJIA 3S1VA 1HKKA 5DY3A 3KDNA 2PMQA 3LI0A 4PB5A 5TBOA 1F6YA 2ANUA 5IDIA 3QEZA 2DY3A 3EDJA 3DG3A 2B7OA 4TOQA 1XCFA 4W7UA 3O6CA 5LIXX 4GI6A 3EOLA 3HF3A 1UKQA 2A7PA 3PUGA 1VIZA 3TSMA 3GG0A 4CN6A 1X98A 4IMDA 4UNKA 3TQVA 5K7JA 4K8EA 1OSEA 1RV8A 4M6PA 3BLPX 5A8NA 3OP2A 4OVXA 2A6LA 1MSSA 5AVHA 1PIFA 3R79A 3DAQA 5IRPA 1A47A 2GDUA 3TSDA 4C65A 4I8DA 4WR3A 1QUMA 4FNSA 4DZIA 4Z1AA 3N9SA 1DE6A 1XLMA 3BW4A 3BURA 2R82A 4GMEA 4BEUA 3ARVA 1V3JA 3PANA 1HGYA 5K2ZA 5ECUA 5AHMA 3H2FA 3BSGA 2GGJA 2NQHA 1J5SA 4PCTA 3F2BA 3KRSA 3STFA 3GG7A 1XDLA 2XINA 1UROA 3VC5A 1IV8A 4CD7A 4B2DA 1WZLA 3EWUA 5A94A 4XTDA 4G6CA 4O1AA 3GHTA 3V5FA 1KB3A 5BU9A 2ZA3A 4XO7A 4OV4A 2PDLA 1OEPA 3QHOA 1TQJA 3MWCA 4WGHA 4R88A 1KGUA 3TYUA 3S2JA 4NJKA 1TV5A 1PB0A 3ITTA 4AFYA 3WFAA 4KWOA 4IGHA 4DJEC 3U5YA 2E77A 3UP8A 2QW5A 3L9CA 3CUFA 1JUKA 1IWBA 4HHMA 5EFFA 3C86A 4XTIA 1DWIM 4GNJA 4M5PA 1SUXA 5AN7A 3GVWA 2FHFA 4DWSD 4JY9A 4W88A 3FGCA 2ZZ4A 2OGJA 3ABSA 1F61A 3B9DA