4XUYA

Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/gh10) enzyme from aspergillus niger
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
EASVSIDTKFKAHGKKYLGNIGDQYTLTKNSKTPAIIKADFGALTPENSMKWDATEPSRGQFSFSGSDYLVNFAQSNNKLIRGHTLVWHSQLPSWVQSITDKNTLIEVMKNHITTVMQHYKGKIYAWDVVNEIFNEDGSLRDSVFYKVIGEDYVRIAFETARAADPNAKLYINDYNLDSASYPKLTGMVSHVKKWIAAGIPIDGIGSQTHLSAGGGAGISGALNALAGAGTKEIAVTELDIAGASSTDYVEVVEACLNQPKCIGITVWGVADPDSWRSSSTPLLFDSNYNPKPAYTAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable endo-1,4-beta-xylanase C
publication title Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Aspergillus niger
rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 123
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4xuyA00
4UFIA 1CLVA 4KGJA 4U2YA 1PPIA 1UQZA 1NWRA 1BYCA 2ZX9A 1DWAM 2D23A 3L4XA 2YKKA 2YDSA 3BLKA 4J3WA 3WN6A 3OGRA 3MO4A 3AHZA 2HVMA 2ZICA 1HX0A 2ZWZA 4ZXOA 4CU8A 5EB8A 2E3ZA 3HU7A 3PHAA 4KMQA 3E1F1 3VM5A 3CPUA 4QLKA 2GDVA 2JIWA 3VD5A 2DSUA 2VQTA 1J0KA 1ZBVA 3QOKA 3CLWA 4WK9A 1E0XA 3DYOA 5A8OA 2VZVA 3WMCA 2FGZA 2G8ZA 1Q6GA 2BY2A 3WDIA 1UWTA 1B3VA 1XYZA 5BWFA 2WW5A 3O6AA 4UQAA 4V28A 1O6IA 4BQ3A 1MW0A 5LA0A 2CHOA 5D9PA 4J3XA 3AOFA 3NSNA 5IHRA 3CUJA 3N13A 1UHVA 3LPFA 4HTYA 1GJWA 1UWIA 4IM4A 1XSJA 2CXGA 4S3KA 2ZX7A 1KGXA 1KCKA 1SMDA 1B31A 1XCXA 4WJXA 4FLQA 2WMHA 4W93A 4BQ4A 1E5NA 1FP9A 3ZR6A 3AS0A 5I6SA 4TVUA 4YPJA 3CHEA 1QVBA 1J18A 3TTYA 4KWUA 5E6ZA 1JXJA 3RJXA 5IHSA 2CITA 4UOQA 4Q7NA 4PEEA 2DT1A 3RIKA 5FCZA 4W8LA 2RGMA 4LGXA 3WUFA 2VX7A 1JZ7A 4WIWA 2CHNA 1U2YA 1WDPA 4KRUA 3BAXA 3AZRA 1CXKA 2IXVA 5IFPA 4F8XA 3AQUA 2J25A 1MXGA 1JDDA 4L4PA 2YL9A 5I3DA 2RGLA 4M24A 1HJUA 2BXYA 1GQLA 2XIIA 1TA3B 2A3EA 1W2VA 1NOUA 1R85A 3IANA 3UR7A 3NIYA 3GH7A 3ARYA 2NT0A 4TUFA 3M6DA 3VDHA 3WD3A 3PZTA 3DECA 4PN2A 1XD0A 1JAEA 2OSWA 5D8ZA 4AMCA 3TP4A 1W9PA 4A3HA 1KXHA 2A3CA 4W85A 1H41A 4D72A 5EMYA 4WKAA 3KL5A 3II1A 1W1TA 4AC1X 3VMOA 4MPKA 2VOTA 3KZSA 3EMQA 3IK2A 2EO7A 5M5DA 1I1WA 2CKSA 2WMJA 6TAAA 3NJ3A 4TOQA 3BCDA 3ZR5A 4UZUA 3NCOA 2D22A 1CGYA 3GXFA 5C70A 1DEDA 1CZ1A 1V6XA 4AISA 3MV11 3VIFA 1UD6A 1JAKA 1EOMA 5HNNA 3W29A 1HN1A 5DT5A 4DUXA 2XGIA 5A2BA 1JIBA 1VFUA 1WCGA 1CECA 1UA3A 5HPCA 3MUAA 5ABHA 1VIWA 3FNDA 3M7SA 5BCAA 2JE8A 2X8RA 4ACYA 2BHUA 2WKLA 1OGSA 1PEZA 1XD1A 1V6UA 4W8AA 1E15A 1C7TA 1Q6EA 1ZB5A 2DQXA 4YN5A 2GFTA 1JYNA 2YA0A 3AISA 1W3KA 1HL8A 4CVUA 1ISVA 5I2UA 3CO4A 3I3EA 1JZ4A 4HZ6A 4JFSA 5I5RA 3WDHA 5A6AA 3LMYA 3WQ6A 4M81A 3N12A 4TX6A 1KBBA 1FH8A 3CH9A 1MFUA 4CD7A 1W2PA 5A6BA 2WKGA 2GK1B 3SIMA 1GZJA 3G6LA 3VTRA 1HJSA 1QW8A 2WMKA 3VNZA 1OIMA 5HBFA 1K6AA 3AFBA 3WUBA 2D20A 1A47A 2CBUA 3AS2A 1EIBA 3MMDA 1VRXA 2GUYA 1QI0A 3EMZA 4AD2A 4D6FA 3B8SA 2XM2A 2YL6A 1AQHA 3VIHA 2AOSA 4UFKA 1TA3A 4K68A 1M7XA 1FH9A 4PMDA 2BS9A 1EQPA 3WBAA 4LYQA 4AZ6A 1GOMA 2ZX8A 3HN3A 3SCPA 5JUVA 3FAWA 3PZVA 1W9VA 1IZKA 5HXMA 1F4HA 3MUY1 2W67A 1LLOA 1KXQA 1M04A 2A3HA 2PWFA 4AZCA 2DPEA 1W1PA 2WSKA 4D6HA 3WH9A 2O9PA 3L2MA 1QHOA 1VF8A 4W88A 4OKDA 1WDSA 3GBEA 1F4AA 3SUSA 2CERA 3DHPA 4UOZA 2QPUA 1OGBA 4CVWA 4QP0A 2GJXB 2WC3A 4GO8A 2WSPA 2XJ7A 2WWDA 3WIJA 3BAIA 1TVNA 2FHFA 4AD3A 1BG9A 1NM9A 4Z2GA 3AHXA 4PMZA 2WWCA 1OSEA 5FD0A 3EYPA 3WD1A 2ZXDA 1DTUA 1D3CA 1UWUA 2J8GA 1KCLA 4HOWA 2C7FA 2QHAA 4GQRA 4BA0A 4PBGA 1E3XA 2C0HA 4DWSB 2ZX5A 4AEEA 3W26A 4M80A 3T2OA 3SUWA 2EBNA 2VR5A 1NP0A 3CTTA 3MANA 4AY1A 1H1NA 2J7FA 2XFRA 3MSGA 1GQJA 4HA3A 5BRPA 2BHYA 2ZUMA 2DT3A 4JFUA 3KE0A 4PTXA 3AICA 4OIFA 1QPKA 4BS0A 2J79A 1RH9A 2Y5EA 3PZQA 4IPLA 1E6ZA 3AIUA 2X0HA 4W5UA 1LJYA 1WDQA 1OT2A 2DT0A 4Z2IA 1XH0A 1VENA 1BQCA 3I3DA 1Q4NX 4P8UA 4OBSA 3AMCA 1UR0A 4JKMA 4HOZA 4WF7A 1SMAA 4XV0A 5AYBA 3KEHA 4F66A 1U30A 4TX8A 4RL3A 2XVGA 3WDQA 3T08A 4PMQA 1W9BM 4NZCA 1PAMA 1K9FA 1AQ0A 4QDMA 2OYMA 4UCFA 4W7UA 4AXNA 4FK9A 1BG4A 2J4GA 4X0NA 4HA1A 1ZBWA 4OOUA 1JZ3A 2VCBA 2E8YA 2OSYA 4PMVA 3VIGA 1UR9A 1B30A 4NRSA 3L2LA 2OYKA 3WNKA 1AVAA 4KGLA 5I78A 1GUVA 5A69A 3ARPA 4ATWA 4QCEA 4MDOA 3CGTA 3VNYA 5I0DA 4P7QA 3AIWA 1L8NA 1SFSA 2VI0A 3OG2A 1KFWA 9CGTA 1XCWA 4CUCA 1OM0A 1C8YA 1UR8A 2QPSA 3BAYA 5BROA 3WH8A 4JCMA 3SUTA 2ZXAA 4AWEA 4AEFA 4EAMA 2WVUA 2BHZA 4D6IA 2JF7A 4R27A 3S6TA 1QI3A 2O9TA 4CD4A 2JIEA 4W87A 3GNPA 1UKOA 1V0NA 4HMDA 4FF5A 5ECUA 1RPKA 1QOXA 3CMJA 3AMKA 2ZUTA 3GDBA 3LPOA 1FA2A 5HPOA 2ZE0A 2WXDM 4CCDA 1W9UA 1OBAA 4WKFA 2OSXA 2GVYA 1XH1A 4P7OA 1FHDA 1C8XA 2DSZA 2YL8A 4R5EA 1V02A 2QMKA 1Q6FA 3F5JA 4P8VA 2WCAA 5CG0A 5CGMA 4DWSA 4XB3A 2VURA 5DT7A 3AZSA 1DHKA 3WDPP 1BTCA 3N9KA 4FLRA 1W3HA 3GTNA 3PTMA 3A4XA 1Q6DA 3K8LA 3BAWA 2F61A 1E6NA 3U7BA 3K4AA 4Z2HA 3O9NA 3AMDA 3BMWA 3AHTA 1R87A 4LYRA 2FHCA 3GXMA 4PCSA 5CSUA 4PMXA 4UQDA 3TONA 1QI2A 2WVVB 1NOFA 5C8BB 2J77A 1BYBA 3RPMA 4XUYA 4WKHA 1C3FA 1ECEA 3VPLA 2VX4A 1ISYA 3SCWA 1J0IA 3ZSTA 4U5KA 4TTUA 3WNOA 1EDQA 4H7VA 5CPQA 1MWOA 3BAJA 1E73M 1ITXA 1V3JA 1CXEA 3W37A 2YDRA 1G5AA 3GH5A 1GVIA 3WF1A 1TE1A 2E9LA 3VX1A 7A3HA 2CCRA 1V3IA 1QHPA 4N42A 1GOWA 4HZ7A 1HKMA 1VFMA 1QNOA 3K1DA 5FOOA 2UY3A 4GINA 3W53A 3VGBA 1NWSA 4BZYA 1GOIA 1C8QA 2DGAA 3W4RA 1AMYA 4UOJA 4ZFMA 4HPGA 4AYSA 1W91A 2XVKA 4PMRA 1VB9A 2J62A 4GI6A 1ESWA 4HOXA 4PCTA 1B9ZA 4GZIA 1RP8A 1H11A 1LQ0A 1E6RA 1KGUA 1E6XM 3BAKA 4JFWA 2VRJA 3WNPA 4Z2LA 1CLXA 1V3HA 2DSWA 3K46A 1CBGA 1V08A 1UG6A 1R8LA 3T2PA 5BXTA 1GPFA 4MJ2A 2OWCA 1H0IA 1VAHA 3KWXA 5BXPA 3CMGA 2FGLA 4F9JA 2DH3A 1V0KA 3ARXA 1NWUA 4F9DA 4CN1A 4D1IA 1BLIA 5EFDA 4OJYA 3VO0A 4ZEPA 1CPUA 1V0LA 3KL3A 1K9DA 3CZGA 5LA1A 4AD0A 3ARTA 1B0IA 3WD2A 4B9YA 3EBVA 4PSRA 1E3ZA 1MFVA 4FLSA 4J7RA 3NYDA 1E0VA 2DDXA 1V6VA 1KR1A 3VMPA 1OD8A 1XRVA 4W7VA 3GH4A 1J12A 3CHFA 4AD5A 5E9AA 1CGWA 1UUQA 3W27A 4AW7A 2CNCA 4ATLA 3QGVA 4EK7A 1UWSA 2E40A 5EFFA 1TZ7A 4H04A 4J3SA 5FL1A 4J27A 3B9DA 1EQCA 2VX5A 2W92A 1MXDA 3OLEA 1E6PA 1EXPA 4A3YA 2O9OA 1JZ5A 2XWEA 4D6GA 1NP2A 2D3LA 1MW2A 4JL2A 3VGEA 2F8QA 3WL0A 4CN6A 2VRKA 3T09A 3PZ9A 4WSKA 2ZUSA 1IT0A 3A47A 3RDKA 2WAGA 2G3IA 3AIBA 2XM1A 2BY0A 4GO9A 1TMQA 8CGTA 3UETA 1KQYA 4EANA 2WC4A 5CXPA 1WB0A 4AZCB 6CGTA 4AZ7A 4PMYA 4CD6A 1G01A 2WVVA 1XSKA 4IPNB 3ZJ6A 2WCSA 2VQUA 4CKQA 2W66A 2CBVA 2PWHA 4GQQA 1UKQA 5A6KA 4JFVA 3BSHA 4LX4A 4WLCA 2CIPA 1NQ6A 3NDYA 3AXIA 1KB3A 2WYSA 2EQDA 1JGIA 1JD7A 4ZENA 1B1YA 3WL1A 5ABFB 2W5FA 4JKKA 3IAQA 4U31A 2DEPA 2VO5A 1BVZA 4FLOA 2EPLX 2B31A 2PBOA 5CPTA 4ACZA 5ABGA 3W6LA 1CGUA 1HNYA 1CGTA 1VJZA 4MNLA 2E0PA 3W0KA 3AMGA 2XVNA 4OUEA 3CUGA 5E09A 1HJWA 1QI5A 3U7VA 4W5ZA 2O92A 1HP5A 3AYSA 4E8CA 1XC6A 5CQ1A 3QHOA 2XTKA 1CEOA 1E1FA 2V5CA 2VCCA 3KL0A 1W9XA 4NF7A 1JNEA 4LQ1A 4NRRA 1BVNP 3SCVA 2VVNA 5AYIA 2PWEA 4MAZA 3W24A 5F7UA 4H2CA 2BVYA 3WELA 1V6WA 2VZTA 2OLHA 3RO8A 2NSXA 2J75A 5E6YA 7TAAA 1FOBA 3OLIA 3GZAA 3WBEA 1GCYA 4EKJA 1TCMA 1OWQA 2VUYA 4U3CA 2WZHA 2J7HA 3JUGA 4Z2JA 4CGTA 2NT1A 3A4WA 4JKLA 1ITCA 4F79A 1JZ8A 1JDAA 2PI6A 3IJ9A 4P7LA 4BF7A 3BMVA 5GNYA 1NWTA 2GJPA 1GOQA 3WEMA 4XZWA 1E4LA 1G1YA 2J7BA 4D6EA 3SCQA 3SCNA 3ALFA 3AS1A 1OGGA 2CESA 3M07A 4PYSA 3N17A 1C91A 1B3XA 2XPKA 4U2ZA 1UA7A 4BCEA 1HJVA 1W1YA 3WQVA 1KWGA 2V3GA 2XFYA 1CGVA 4HPHA 3N15A 5ABEA 3UG4A 3VD4A 4FMVA 5C71A 1H49A 3D5HA 1B3ZA 1J0HA 1A3HA 2TAAA 1CDGA 4NSBA 1MYRA 1S46A 4TXEA 3L4TA 3OGSA 4GI9A 1BGAA 2YLAA 3UR8A 1D7FA 2WHKA 4IISA 1QW9A 3O2LA 3F5LA 4Z2KA 1H09A 3TTQA 4QCFA 1TFVA 3EDFA 1X1NA 3DYPA 3POHA 3K8KA 1YQ2A 3AXXA 2YOCA 4C7GA 2EPNA 3OBAA 1L0PA 1OINA 1PIGA 4H8VA 2VZOA 4JCLA 5A6SA 3AIRA 3PN8A 5CGTA 3AIVA 2A3BA 3AYRA 4KH2A 5A1AA 1GOOA 2AAAA 1UD3A 4LXFA 5ABFA 4UFLA 1EOKA 4OOZA 2GDUA 3PTKA 2WZEA 3VGGA 1R7OA 4KRTA 3W6MA 4M82A 2X09A 1LF1A 3MV01 3GXIA 2ZUVA 2PC8A 3EDEA 1VEMA 5KZ6A 1G0CA 3SCOA 4B16A 1X6LA 3VGDA 1VBRA 1X6NA 3UCQA 2ESCA 3SCTA 4AIOA 2JFEX 1CIUA 1DWFM 1CGXA 1V3LA 3FY1A 5M03A 1GHRA 3NSXA 4QLJA 1PX3A 3VDBA 1MW3A 1GHSA 4IUGA 3OB8A 4QLLA 4ZXLA 1ODUA 2JF6A 1ISXA 3WDRA 2XSBA 4GIAA 2QV4A 3ARRA 3UG3A 1FP8A 1BFNA 3L4YA 3OLDA 2BVDA 3N11A 1ZL1A 1NH6A 2V5DA 2J8FA 2FH6A 1BSIA 1FFQA 5HDRA 1JF5A 1HXJA 4HA4A 3RCNA 3WNMA 3UESA 1Y7VA 4PTWA 3WQ4A 2BY3A 1E6SM 1LL7A 3N04A 4AZIA 3U5YA 3VGFA 2VR4A 2WVTA 2WB5A 3WKZA 4YHGA 4HMEA 1E4NA 1M01A 1HP4A 2XG9A 3BC9A 3BSGA 1WKYA 4QAWA 2WMIA 2CETA 5BYWA 4WSJA 2EPOA 2UY2A 5JBDA 3HMCA 1DWGM 2J7GA 2BVTA 3CBWA 5D4YA 4JFTA 2VRQA 3W28A 5A8QA 3N18A 4MAVA 1NARA 1WDRA 4AZHA 4W7WA 4XZBA 4H41A 3ARWA 1PX4A 1G9HA 3WENA 4ZE5A 3SEPA 1WZMA 1J0ZA 3GM8A 3OZPA 1B2YA 2CYGA 1FFRA 4TVCA 4D6CA 1QNSA 2JEQA 1UKPA 3CUFA 2VJXA 4PUDA 4B9ZA 3MS8A 3SCUA 4DWSC 3VX0A 1LWJA 1JG9A 5I77A 4CU6A 1UKTA 3ARVA 2VL4A 1AQMA 4UFHA 1OIFA 5KEZA 3TA9A 2J7CA 2PB1A 4CN4A 4J28A 4MADA 4JL1A 4X9YA 3M46A 1JYXA 1E5JA 1LG1A 2YLLA 4DUWA 4RE4A 3VDAA 1LWHA 2DIEA 3MSDA 5D9MA 3WF2A 5CJ5A 2E4TA 3RM9A 3WEZA 4P8WA 3FHAA 3VMNA 1IZJA 3AS3A 1VEPA 3OLGA 1M53A 3WDJA 3VIPA 1UD4A 1HL9A 1HKKA 2Z1KA 4Y7EA 1OT1A 1ZBCA 2XSAA 3IJ7A 5CPSA 4ZE4A 5A2AA 1Q6CA 4J3VA 4V2XA 2G41A 1E71M 3UG5A 1V6YA 1ZBKA 1BYAA 3ZT5A 4U5IA 4N0RA 1JFXA 3WQ8A 1K9TA 1MQQA 3FW6A 3J7HA 4AZBA 2O9RA 3RJYA 2MANA 2XGBA 2UY5A 1BYDA 1MQRA 5A6LA 1HT6A 1EO5A 4MB5A 1B90A 1M03A 1LG2A 3CZJA 2Y24A 3ARQA 2BV9A 3VIKA 3VKKA 5IXEA 3MUIA 3ZJKA 1UQYA 3WF0A 3CZ8A 3QR3A 3TTOA 1U33A 1O7AA 4PMNA 5A8PA 4ACZB 4GZEA 2AMGA 3GXDA 5DMYA 1CXLA 3WUGA 3WSUA 2D2OA 1QHZA 3A3HA 1J10A 3ZM8A 2QMJA 1XGZA 2Z1SA 4DM2A 5A3HA 3GNRA 5A8MA 1QNRA 2QLYA 1E72M 3VU2A 3VD3A 1UD5A 5A2CA 1FH7A 1J01A 1NOWA 5I24A 1GVYA 3GBDA 3CZKA 5DF0A 1EA9C 3ZOAA 3RM4A 2ZIDA 1E1EA 4PSPA 2XIBA 5LYRA 3CZEA 3U57A 2WBGA 3WD4A 3W38A 3FN9A 5D9OA 5GNZA 1JFHA 2PWGA 3AJ7A 2Y2WA 3ZQ9A 1C93A 3A6OA 4DM1A 3QOMA 3RILA 1HJQA 3VGHA 3OIHA 2YA2A 1OCQA 2J7EA 1US3A 2W61A 5IFTA 4AZGA 1VBUA 3VIOA 2DT2A 2W62A 2UWFA 4NI3A 1VJSA 3PZGA 1BHGA 2J74A 3HJEA 4UTFA 1KWKA 4L4OA 4ATDA 1W3JA 1E9LA 2X1IA 2ZX6A 3WFLA 3WY1A 2Y4SA 2CPUA 3VDCA 1JYVA 3VINA 2V38A 3BLPX 1HVXA 5A6MA 2PF0A 3AHVA 5FKYA 3BCFA 5E0FA 1EDGA 5GNXA 1ZU8A 3W82A 3G6MA 4D1JA 4J3UA 3AROA 3OGVA 4CCCA 3TTSA 3NUKA 1E56A 4UNIA 3VIMA 5BXRA 2JALA 2ZWYA 4AIUA 1WZKA 3PZOA 3B9AA 3RMEA 1QBAA 1VEOA 3T0DA 1UYQA 3MU7A 3EDJA 1H3GA 3T0BA 1JDCA 1I1XA 3WH7A 2Y8KA 3VD9A 1CXIA 3VVGA 5D8WA 1W9DM 2F2HA 2VC9A 3SCRA 4UQCA 3WMSA 4GZJA 3W25A 1R86A 2WBKA 5A6BD 4JAWA 1MVYA 2X2YA 4P7RA 2WK2A 1J11A 4LPCA 1XYFA 1KBKA 1ZJAA 2E9BA 3MUZ1 1DWHM 1DWIM 1ODZA 3SCSA 2J7DA 3CZLA 2ZUWA 4J3TA 4W84A 2UY4A 4AD4A 1VFFA 2HISA 3ARSA 5LA2A 1PZ2A 4PMUA 2VMFA 3AI0A 4QFUA 2GJRA 2NW0A 3D3AA 3BXWA 3VIJA 1CXHA 4MNJA 1UR1A 2WNWA 1EGZA 2G3NA 1BPLB 2WZIA 2EJ1A 3ALGA 3DYMA 3L4ZA 5JBEA 1QNQA 1CENA 2E9MA 1HVQA 3MMWA 4MB1A 2YBTA 3L4UA 3NDZA 1GQIA 1PIFA 2W4XA 1V3MA 1J0YA 1CXFA 1EH9A 4XX6A 1QNPA 1WE5A 2GSJA 4M8UA 2WMGA 1KGWA 5E70A 3CUIA 1BF2A 1JNDA 1UH4A 4UQ9A 4JHOA 1KR0A 1EHNA 3WUEA 2G4FA 2Y8VA 2X0YA 4X0VA 3IJ8A 3K8MA 2BNJA 4HU0A 3BH4A 1W1VA 3AZTA 4W89A 2C8NA 4W8BA 6A3HA 1I75A 3FXYA 1V03A 1WNOA 1E4IA 1B3YA 1DWJM 3AIEA 1H5VA 4E2OA 3ECQA 1PX8A 4HZ8A 1E0WA 5M17A 3T0AA 2G3JA 4UFJA 3WH5A 4AZ5A 2XWDA 5A95A 2WANA 5A8NA 3A4AA 1GJUA 4RE3A 1JZ6A 1J0JA 3ARZA 4E8DA 2WMIB 4D71A 4GXPA 1JYWA 1N82A 3B9EA 1RD6A 4URIA 2W91A 3PZUA 1UR2A 4UR9A 2D1ZA 1G94A 5GQBA 2XVLA 4V27A 3FAXA 1E55A 1VFOA 3VOCA 1BAGA 1XH2A 1EHAA 5JIWA 4U3AA 3W81A 3WQWA 2WVSA 1UD2A 3LPPA 3APGA 1YHTA 5JBFA 1KQZA 1WP6A 4MDPA 2FH8A 4MNMA 1XHGA 3THDA 4B15A 5FIPA 2XFFA 2WPGA 2WMFA 1TUXA 1V3KA 4HMCA 3WF4A 5FL0A 3BGAA 3ZMRA 5D9NA 3PZNA 3ZSSA 4CD5A 1PJ9A 2VVSA 2VNCA 1H4PA 8A3HA 1WZAA 4HU8A 4JHZA 1OD0A 2D0HA 2BY1A 2WLZA 1E40A 3UEQA 4B3KA 2OYLA 2YBUA 4MJ4A 5I79A 3S2CA 2FHBA 4EE9A 1LL4A 2D0GA 2PWDA 3I3BA 3GYCA 1CNVA 1MQPA 2EPMX 1HKJA 4CD8A 4MNKA 2BFGA 2W63A 3WEOA 1UOKA 5AC5A 2QF8A 4PUEA 3L4VA 3RM8A 1GOKA 5CSYA 3ZJ8A 4GKLA 1B3WA 2WHJA 4BQ5A 5GPRA 3WF3A 1GQKA 1BGGA 1WO2A 4JZ5A 4UQEA 4C7DA 1XSIA 4U33A 1HF6A 3F5KA 7CGTA 2ZXBA 1JZ2A 3K4DA 2WCGA 1GW1A 4PRWA 3THCA 1GORA 3MMUA 2DIJA 3EDKA 1UWRA 2A3AA 3WQ5A 5BXSA 1UH3A 1QI4A 4RE2A 3SUVA 4TVDA 2CKRA 5BRQA 3WH6A 1K9EA 4Q22A 3SURA 5A94A 2VT0A 5AY7A 4AIEA 2V3DA 5EBAA 2ZXQA 3FHQA 1P6WA 1DP0A 1W3LA 3L4WA 1UD8A 1JXKA 4M1RA 1UZ4A 5CLWA 2VZUA 3WFZA 1J9YA 5IDIA 2IXUA 1TG7A 2J47A 4MB3A 3ZIZA 1SYTA 1JF6A 4C7FA 1RP9A 3AHYA 3VIIA 4E4PA 4M56A 1FHLA 4BQ2A 4D6DA 4S3JA 1C90A 1LL6A 4PMOA 3ZT6A 4DUVA 1UH2A 2GK1A 1H2JA 2WM0A 4UZSA 2D0FA 3OA5A 3N1AA 1XV8A 3OZOA 2YIHA 4DWSD 5CZKA 3CHCA 1EO7A 2V3EA 2XYLA 2EPKX 3NSMA 3U5UA 1Z32X 2DH2A 5TD4A 3EMCA 4OBRA 4OZOA 3TOPA 2BXZA 3PZMA 4LYPA 2XUCA 4MTVA 1CTNA 3ARUA 2CBIA 3WD0A 4B3LA 1GONA 2DSVA 3VUPA 2VTFA 1ZS2A 4PTVA 3ZO9A 1UZ1A 2ZOXA 2IUZA 1TVPA 2WHLA 5DEZA 5M3WA 2WLYA 5DFAA 1V02E 2VCAA 5AC4A 4ML4A 4GPNA 1H0GA 1C7SA 3EDDA 2YJQA 2JEPA 1KXTA 2CBJA 3T2QA 2WHMA 1HIZA 2J78A 1WAWA 4CU7A 3CHDA 3VM7A 5CLTA 2ZUUA 2E8ZA 3ZT7A 2FDMA 3CIVA 5DO8A 3PZIA 3AMLA 1WZLA 1ZJBA 1WPCA 4AD1A 2DSKA 1MW1A 4P8XA 4A4AA 3AXHA 4D6JA 1HJXA 1QBBA 1IV8A 4M29A 1UR4A 1CYGA 1GNXA 1E6QM 4MB4A 1E43A 1US2A 1R7AA 4P7NA 1ISZA 1PBGA 5JIPA 2YL5A 2GJXA 3WNNA 3F4VA 4UQBA 5I23A 1SR0A 2D3NA 1C92A 5E0CA 3POCA 1E4MM 2X05A 1E70M 2PBGA 3WNLA 1JI1A 1UKSA 5HOSA 3WMBA 4JIEA 4PTMA 1JD9A 2YDQA 4UFMA 4H8UA 1UWQA 2XVPA 4TTGA 3CUHA 2Q8XA 2XHYA 2EEXA 3QHNA 2WC7A 1CWYA 1V0MA 2G3MA 3PBGA 1ISWA 3DC0A 4HP5A 3IAPA 1JI2A 4W86A 3VILA 4YHEA 2OWWA 1KXVA 1W32A 2CEQA 2VZSA 4H8HA 1OB0A 4CCEA 3UERA 2YA1A 3SUUA 3VD7A 3LPGA 4GI8A 1JL8A 1HKIA 1TR1A 3DHUA 1PZ3A 2OWXA 2EXOA 2ZUNA 3AIQA 2D24A 2VX6A 3MKKA 2V3FA 3GNOA 3QHMA 3ZJ7A 1EDTA 3PTQA 1D2KA 5A6JA
chains in the Genus database with same CATH superfamily
4KGJA 1A50A 2ZRXA 2YKKA 1S2AA 3CQ0A 4GJJA 3W23A 3IJ6A 2VR2A 3NVTA 1AL7A 3R89A 2ZWZA 4B90A 1U5HA 5EB8A 4XUGA 1A0EA 3AYVA 4YLWA 1M65A 4H9ZA 3QY8A 3LCXA 4Y9MA 3G1AA 3CPUA 1W8GA 2V82A 3UWZA 1N8FA 3NQCA 4QLKA 2GDVA 1F73A 4H9VA 4Y90A 1E0XA 2P53A 4WY0F 3DYOA 5A8OA 2VZVA 3WMCA 1Q6GA 2BY2A 5C9WA 2WW5A 4V28A 1TV2A 1O6IA 4ORMA 5EMLA 4BQ3A 9RUBA 1QTWA 2CHOA 2HPIA 2V67A 3H6OA 3NSNA 5IHRA 3KOFA 3FYYA 4IH3A 1W5PA 1UHVA 4QR6A 3USZA 5E1QA 1VZWA 4DLMA 4C6OA 3SFWA 2CXGA 3IJQA 1YLVA 4KFPA 1ZSXA 4L5ZA 2ZZ1A 4RJEA 4BFAA 4FNSA 4EP8C 3CL7A 4B92A 3PUOA 1RJQA 5FF7A 4GVHA 4LCRA 4W8LA 4LUTB 2C16A 2RGMA 3WUFA 4EWND 3R25A 2PODA 3ZXWA 4BEQA 2ZVIA 1WDPA 3LZ5A 4KWWA 4NL1A 4O14A 1YYAA 5IBXA 3BAXA 4C6IA 1PTAA 5FEPA 4DYJA 3NVDA 4M3PA 1CXKA 4F8XA 4JTIA 4M24A 1HJUA 2BXYA 2Q01A 3RG6A 1JCJA 3VI2A 4L1GA 3GUWA 3ITLA 3N2CA 3GNNA 4QX4A 7TIMA 1NOUA 5KETA 1P4CA 1R85A 1S5WA 3IANA 4JQ4A 2VC6A 4TUFA 1FWHC 3VDHA 3VAVA 1U1HA 3LTYA 2OR2A 2OSWA 4MM1A 4AMCA 1W9PA 4A3HA 1KXHA 4S3CA 4WKAA 1TO3A 3L65A 2OQHA 2REQB 3OG3A 3EMQA 3IK2A 1E1CB 2ZKMX 4MYAA 4MGGA 4H4IA 5LIKX 4EACA 3RX4A 3MPGA 6XIAA 1X96A 1XFCA 4FOUA 3NJ3A 3ZR5A 3BCDA 3PB0A 4GQGA 3NCOA 3CIWA 2D22A 4M6PA 3UY8A 3VKDA 1OJXA 2Y7DA 1JDEA 1EOMA 1XR2A 3F2CA 3W29A 4DI8A 3KAOA 4A2SA 1SSGA 2Y70A 2CZEA 5AYXA 1KM6A 1WCGA 1YNQA 5CZ0A 2JE8A 3EWZA 3WQGA 4MPQA 4XAZA 2ISDA 3DN5A 4GHRA 3WJZA 3M7WA 3R0UA 3NQVA 3BGGA 1A3XA 4TMCA 1XD1A 4W8AA 1E15A 4JDBA 2DQXA 4YN5A 1REQA 3OVGA 5D2XA 1HL8A 4N02A 3LCGA 3CXOA 2I14A 1I9CB 5DY2A 4CVUA 3BWWA 3UT0A 2VFIA 1Z48A 1OF8A 3TNBA 2CLLA 5FJPA 3ABRA 5A6AA 4HK5A 3WQ6A 4MJMA 4TX6A 4UXDA 1FH8A 2PP0A 2R1NA 2DZSA 5D04C 4CD7A 2WKGA 5EMJA 3RR4A 1P1XA 4Q4MA 2VEGA 3W2NA 1GG0A 1A5AA 1XYBA 3UWVA 4CNUA 2Y5SA 3FGCB 3WK1A 3AFBA 3HF3A 4JIHA 4PEKA 4M5PA 1JCXA 3WMLA 2CBUA 3KDNA 3S1GA 3N73A 4DJDA 2GUYA 1SO5A 1QI0A 4AD2A 4D6FA 1AQHA 3VIHA 3PUEA 4UFKA 3QZAA 4UUIA 3ZS4A 3MWAA 1LOLA 4EIVA 1I2OA 1ONRA 4LSBA 2ZX8A 1KV8A 5JUVA 1BWVA 1TTQA 3TQ0A 3FAWA 3OTRA 2ACRA 4XWUA 3VCRA 1KXQA 3TQPA 2EHHA 1W1PA 1HO1A 1QHOA 1VF8A 1ELSA 4HGXA 4HNNA 2CERA 3O15A 1TZ9A 3DHPA 3WQCA 3W7HA 5EGRA 3EZ4A 3P8JA 2WC3A 1GKRA 4F48A 2FHFA 4AD3A 1S3TC 3VNMA 3A3WA 3AHXA 4O15A 1UIOA 1R3SA 1N8IA 4E5TA 1QAPA 3CM4A 1DTUA 1D3CA 1UWUA 2J8GA 4BA0A 3VYLA 2OZ0A 4A3UA 5EMUA 4OHQA 3BLDA 2AGTA 4E4UA 1P0EA 3W73A 1UMYA 5G4HC 2EBNA 4FPSA 4O1FA 4DJFD 1GVOA 1VFLA 1I60A 2VDIA 4PB4A 4QE5A 1KM2A 2BZNA 3TFCA 2XFRA 4FHAA 1GQJA 4HA3A 1ZFJA 5BRPA 3G1SA 2YZRA 3HIJA 4K7VA 4DZ5A 3KE0A 3EOUA 3UGRA 1QPKA 4HYWA 4BS0A 4Q4KA 5HMDA 4DZAA 1A5MC 1E6ZA 2PWUA 4W5UA 1WDQA 1EKOA 2DT0A 1CB7B 3UJFA 3ONCA 4NJKA 1BQGA 4P8UA 4IG2A 3JR2A 1UR0A 4JKMA 4WF7A 3AC0A 4F66A 1U30A 1EPVA 3U6WA 2XVGA 3WDQA 4DXKA 2ZZ5A 1W9BM 1K3UA 3MKVA 1OFOA 2GOUA 1KRCC 4NZCA 1HTIA 4KQNA 1AQ0A 2OG9A 2OYMA 2BOFX 1EXBA 4AXNA 3STCA 4FK9A 3EWDA 2E5CA 5DN1A 2PTWA 1VLWA 3BLLA 4OOUA 1JZ3A 3APYA 2E8YA 1DV7A 3VA8A 3VIGA 2VOMA 3L2LA 2OYKA 2H90A 5I78A 1EBGA 4ZR8A 4QCEA 2FZ9A 4LS1A 2FZ8A 3OG2A 4HCLA 1U5JA 2FLIA 4CUCA 5LXEA 1F2JA 4AVNA 3H55A 4ORIA 3OU8A 4JTGA 3SUTA 1SW3A 4AWEA 1Q3NA 4CNNA 2YGYA 4R27A 1WDDA 1EZWA 3NM3A 4EVZA 1GZGA 2VDGA 5FEWA 3UZWA 1RPKA 1SW7A 2OJPA 3LG3A 1M7OA 3LPOA 4LH8A 4JIQA 3WJXA 4Y8FA 2WXDM 4CCDA 4AY7A 3BG5A 4Z1BA 2DSZA 3TCEA 3F5JA 1F3TA 4GNKB 3CV6A 3ANYA 2JKPA 3GR4A 3EXSA 5B7ZA 1D3HA 1W3HA 3A4XA 2QGYA 4I8YA 1SJBA 1UP3A 4BI7A 3TYCA 1TPWA 3K4AA 4Z2HA 2VEPA 3BMWA 3F2BA 5M2FX 4JD4A 2BG5A 2DU2A 1IXPA 1RA5A 3IV3A 4PMXA 3GAYA 3UCCA 3TONA 3N4FA 5C8BB 2V81A 4NY2A 3RPMA 1O94A 4YXGA 4F0KA 1ISYA 4DHGA 4U5KA 2PSNA 2OZTA 3APTA 2GSHA 3M64A 1ICSA 1V3JA 1CXEA 1TQXA 4H01A 1R2RA 4LEQA 4NYUA 2VXNA 2YDRA 1VYPX 3XIMA 2Z29A 1TR9A 4WJ8A 2E9LA 1J8VA 2CCRA 5I02A 1QHPA 2F84A 3DGRA 1P7TA 2NVAA 1Z69A 3NZQA 3RU6A 2W79A 4JTEA 4Q8VA 2UY3A 2ODOA 1NWSA 2DGAA 1M6JA 1AMYA 3EOOA 2XVKA 3W1MA 4PMRA 1XM3A 1XLEA 1LBLA 1GK8A 4GZIA 1WQ5A 3DG3A 5U7SA 1KGUA 3BAKA 3WNPA 3LSCA 1IEQA 4Z2LA 1V3HA 1ME9A 2R14A 3WQPA 1R8LA 1KLYA 4MJ2A 2PAJA 4G8TA 4RZ6A 1R3VA 3NO3A 1VAHA 1MDLA 2TYSA 4F9JA 4MG4A 1CLKA 4UTLA 1DJGA 2A3LA 1OQFA 2HRWA 5C54A 1K7FA 1DJXA 1C9DA 4H2HA 1SW0A 3T8LA 3KS6A 3GTHA 3PSWA 4X2PA 3WD2A 3OHIA 1MFVA 2GGIA 3W7KA 1BRLA 1E0VA 1PB0A 1V4YA 1OD8A 5DRIA 1Q13A 3VMPA 4F0MA 3B9NA 5DY3A 3W7EA 3CHFA 5E9AA 4UMBA 1W0MA 4WRHA 1UUQA 1SQ7A 2CNCA 4X3ZA 3FLUA 1UWSA 2NV9A 5FL1A 4J27A 3BLIA 2VX5A 1EXPA 1I2NA 4ZQNA 4YWSA 3R4IA 1R0MA 2P3EA 3T09A 4WSKA 2ZUSA 1IT0A 3W00A 1PCKA 2G3IA 1JRCA 1MZHA 4GO9A 8CGTA 3GDKA 6CGTA 2W0UA 2GQAA 3VZYA 3PY2A 5EL1A 3GTXA 2LLEA 3PAOA 3NQFA 5T91A 5A6KA 4JFVA 3BSHA 3TU9A 3NDYA 3AXIA 4RNIA 1KB3A 3SQLA 3NL6A 5HNTA 3ATYA 3MT1A 2WJDA 3O8AA 1JGIA 3O6DA 3AXKA 4Z1DA 2WSYA 3P93A 3IAQA 3LTSA 2GQ9A 5C2GA 3LXCA 1BVZA 1O5XA 4FLOA 5HQMA 4NI8A 3SGUA 4RK8A 1S5NA 3TROA 6PTDA 3E74A 2WSRA 2E0PA 1XIJA 3AMGA 4OUEA 3CUGA 1ZGDA 1TJPA 3DGBA 4C6LA 3HPZA 3NAVA 1XLMA 3CT2A 3TR2A 3UPMA 1XW8A 2FVLA 3AXMA 5G4EA 3AYSA 1HP5A 3O05A 4Y8EA 4HCHA 4N4PA 2QDHA 3ZWSA 3KBWA 2VCCA 3V35A 1FHUA 3BL3A 2Y8UA 3HURA 2FZDA 4DY1A 3PWIA 2V5KA 1C9WA 4NRRA 1Z42A 4FOKA 3TYAA 3FCPA 2VVNA 3OYZA 2PWEA 2BVYA 3I68A 3WELA 3MVIA 2VZTA 1LYXA 1TPH1 1VP5A 3DH7A 3OLIA 3HA1A 2EKCA 4XIMA 1AW1A 1TCMA 4DF2A 3QV8A 3JUGA 4CGTA 4XTDA 1W56A 3DBPA 4NNBA 1XIHA 3IJ9A 3MHGA 1CB2A 1HKVA 2NQJA 3GIPA 2Y7EA 3WEMA 2J7BA 4IIGA 5HATA 3SCNA 4PYSA 3L68A 1FWCC 1KV5A 4DPPA 2ACSA 5ABEA 5LKYA 3G1YA 3FJ4A 3D5HA 3QRHA 1H1YA 2OTDA 3A21A 2TAAA 5EY5A 1CDGA 3NZ1A 4F3HA 5LSMA 3E3HA 2GZXA 1MYRA 4NYYA 3LDVA 2OEKA 4UTTA 3HGSA 1V77A 2BDQA 1D7FA 1HQTA 3SZ8A 3IRDA 1YADA 5U4NA 5LHEA 3KFTA 3DYPA 4JTLA 3V0UA 1YQ2A 2RJHA 4D8LA 4C7GA 1SR9A 2O7SA 4XISA 2BODX 4XZIA 1RJPA 4Y2WA 1TQJA 3URBA 4LV4A 3AIRA 1WXZA 4O0QA 1EYWA 3H21A 3GO2A 4G1KA 3A5VA 5CGTA 2ZRVA 3UWEA 5ABFA 4UFLA 5T8GA 2ABBA 3WQOA 4IIHA 4MYXA 1R7OA 4S2BA 3TC3A 3W6MA 5G1MA 3SM0A 3RMJA 3O63A 2X09A 4JQAA 3G1RA 3IK4A 4I3GA 3E96A 2W6RA 1XS2A 6XIMA 1J93A 2HK1A 1G0CA 3HFYA 2ESCA 3SCTA 1OCNA 1E9ZB 1LLZA 4ZOBA 1IT7A 4X2RA 4KBXA 1W6TA 1V3LA 5CPOA 1DORA 1U1UA 3VDBA 4WQ6A 5EMMA 1K4GA 3QY7A 2CXEA 1ISXA 3WDRA 4GIAA 5C2XA 1XPGA 3UG3A 3CNYA 3TZFA 1FP8A 1BFNA 2JQXA 2PDYA 3IGSA 2BVDA 4GKTA 2PDWA 3N11A 4J1OA 3WX7A 2X16A 3G0SA 3BDKA 3UESA 4JHMA 1S2UA 3KRBA 4WOQA 2BY3A 4H8NA 2QULA 3N04A 4A2RA 4QM1A 4XD4A 3TN4A 3VGFA 1OVDA 2VR4A 4IFOA 1DL3A 2WVTA 2WB5A 1AW2A 1HP4A 3BSGA 1WKYA 2AAMA 1P7TB 2RDUA 3W1UA 2BVTA 1FVPA 5A8GA 3V36A 1SUXA 2FQIA 2VRQA 3W28A 4CLMA 3N18A 4Q6XA 1AZ2A 3KLLA 4WR3A 4AZHA 1UUMA 3MI2A 4XZBA 3VOHA 4A22A 2PDJA 3E5BA 4DYKA 2NX1A 1WOBA 4BR1A 4HT3A 3WENA 3SEPA 1J0ZA 3GM8A 3OZPA 1ME7A 4DJFA 4Q8PA 3SN4A 3UXAA 3L23A 2JEQA 3MS8A 1F9CA 4ROQA 4HHLA 5I77A 4WEVX 4CU6A 3A13A 3FK4A 4MOZA 2UV8G 1HGYA 3LN3A 2A7NA 3PANA 4R53A 5KEZA 2QS8A 4YTQA 2HROA 1TTIA 4FXSA 2PB1A 2W9MA 4CN4A 5HK4A 4J28A 5BZAA 3H4GA 3S9YA 3OYXA 4MADA 1OX6A 2BVWA 1J96A 2QVHA 3CQIA 1QXLA 2BOGX 3U4FA 5FF0A 4DXVA 3GDLA 3C3NA 3M0IA 3MSDA 5D9MA 3N2XA 3BTNA 3WF2A 4XSLA 2X7VA 1X98A 3E2QA 3RM9A 3WEZA 4P8WA 3A23A 3B04A 5BNKA 4JPGA 3MDUA 1AD4A 1LZOA 3B40A 3DFNA 5C6MA 1OEPA 3VIPA 1UZDA 1AH3A 5HAOA 2I16A 4AXKA 3LXBA 1G4PA 5CPSA 3KBNA 4ZE4A 4IWWA 5CSSA 4J3VA 1IWAA 1E71M 2PU1A 3UG5A 3C52A 3W7DA 4U4MA 4QQ3A 1U22A 1L6FA 1G6CA 4H7ZA 3SQMA 3LYEA 3J7HA 5F1VA 5FJTA 3RHGA 2Q71A 1CX9A 3EX1A 2XGBA 3PR2A 2V2HA 2UY5A 3QH2A 5A6LA 3G1HA 4MB5A 3W2JA 2GYIA 1B90A 4O10A 1FWTA 2Y24A 2BV9A 2GUBA 3KTCA 3MI3A 1JPIA 1PTGA 1JUBA 1GKQA 3QVQA 2V9DA 3CZ8A 4LAUA 3QR3A 2NXGA 2PRMA 4GZEA 1CXLA 3WSUA 1YIXA 1LP6A 3GG8A 2D2OA 1QHZA 2QAFA 3THAA 1XBXA 1XGZA 6ALDA 2PGWA 2QLYA 1E72M 1MXSA 3FEMA 1FH7A 4IFKB 3EWYA 5I24A 4GBUA 1EX1A 1XGEA 1AJ0A 3RM4A 3WK3A 1ONEA 1E1EA 3PB2A 3V75A 4F2BA 2XIBA 4RNJA 3CZEA 2WBGA 2C6QA 3BLEA 4DJED 3W38A 1JFHA 3DERA 2Y2WA 3ZQ9A 2GJNA 4UNKA 3L7RA 2Z2UA 1HGWA 3QOMA 2OQYA 1XRSA 3VGHA 3CWHA 1XG4A 3O07A 1KKOA 2J7EA 4ADTA 5JVLA 2ATSA 5IFTA 3W1PA 3QMSA 1SZFA 1BKSA 3P2VA 1VJSA 3NFUA 1M5WA 1TKKA 4UTFA 1KWKA 1K77A 4FXJA 3W72A 1GVSA 2J66A 1E9LA 1UPMB 2X1IA 3W83A 3WFLA 2CPUA 3VDCA 3QN3A 3RFAA 1HVXA 5A6MA 4JGDA 2XZ7A 1T6MA 4NG3A 5E0FA 1PWMA 4H6QA 3G6MA 5DBTA 2Q8LA 1QFEA 3WLHA 5AC8A 4CCCA 4C5YA 1E56A 4PCFA 5T9CE 1MNSA 2ZWYA 3WG6A 1AODA 2HVNA 1MUWA 2GL5A 3T0BA 2YB4A 4C91A 3VVGA 1PXGA 1EF3A 2VC9A 3DEQA 4UQCA 3WK2A 3MJYA 2VFEA 3I6RA 2X30A 3P5YA 1MVYA 4JS3A 3H24A 2WK2A 4LV9A 4XO7A 3HTWA 2A5HA 2E9BA 3WO8A 4MLRA 2ATMA 3SCSA 1DWIM 4H7CA 4K38A 2X1TA 2ZUWA 3T78A 4J3TA 4O28A 2PS2A 4PMUA 3AI0A 4PUUA 2NW0A 5G2HA 1E0UA 5GJMA 2VFHA 1WKFA 1H7XA 1CXHA 4MNJA 1UR1A 1EGZA 2CLMA 2WZIA 3KRSA 4DLFA 2EJ1A 5FJRA 3ALGA 3DYMA 5JBEA 1QNQA 2DUAA 3MMWA 2YX0A 4MB1A 2YBTA 4L1WA 3DU0A 1HFBA 1QNPA 4EF9A 4M8UA 1KGWA 3LCIA 4UQ9A 1PKMA 1KR0A 3D6NA 3R8HA 2RDTA 1XYLA 4P5UA 1EWDA 3E2RA 1W1A1 4W89A 3W85A 1F3WA 3FXYA 3W76A 3E38A 3KRUA 3LV5A 1MEIA 2G37A 4PRTA 3VOFA 4LCSA 2KAUC 4YCPA 3G22A 5LNVA 3RRXA 3ECQA 4REQB 1YXYA 1PX8A 3PNZA 1TWSA 1RK6A 4HZ8A 4XVDA 1JULA 3P3BA 5M17A 3T0AA 2XWDA 2R1KA 2NQLA 4RE3A 1A5KC 4ZODA 4GXPA 1FCVA 1N82A 4HN4A 3STPA 3VKCA 4URIA 2W91A 1NDVA 3IIXA 4UR9A 5GQBA 3B05A 5CZSA 1DBTA 4GX8A 3GC5A 1XDJA 3MKCA 3FKRA 1SJCA 2POZA 1XH2A 3URNA 4XSMA 3DG6A 5BOEA 4K36A 3TSDA 1KKRA 3VC5A 1KQZA 1WP6A 4MNMA 1A4MA 3THDA 3ANUA 2P76A 2WMFA 1YDNA 2CW6A 4HMCA 3TLQA 4AUBA 3WF4A 1H62A 5FL0A 4I7VA 5D9NA 3G0UA 3OZYA 3VFCA 1PJ9A 3CLMA 4FF7A 1RHCA 1H4PA 2W3ZA 3CV1A 4GXMA 1WZAA 3BLFA 2WJFA 2WLZA 3GTIA 1QPNA 1TRIA 4MJ4A 5I79A 1BXCA 2PWDA 3I3BA 4NQ1A 1CNVA 5DX7A 3BSMA 1KM4A 2BFGA 3WEOA 1WBHA 1Q6RA 2FDSA 2XZ9A 3LBOA 1DJWA 5CSYA 4M51A 2HV5A 1B3WA 1R6WA 5GPRA 5D2TA 3WF3A 4I7UA 1WO2A 4ML9A 3EKGA 3PUDA 2Z1BA 3K13A 2A21A 3CK5A 2ZCGA 4UQEA 4C7DA 1AQFA 4GOAA 2A7RA 4B5UA 3FYPA 1HF6A 3F5KA 4LVBA 1JZ2A 2ZRUA 3JW7A 4PRWA 3MMUA 4ICMA 1T8QA 3TK7A 3MJMA 2DIJA 1P48A 5LIXX 1DXIA 1XIEA 4JTCA 1QI4A 1TPVA 4RE2A 4TVDA 2ZTKA 1DIOA 3G77A 2P8BA 1OFDA 4GI4A 2H9AB 3FHQA 5A6TC 1DP0A 5K4XA 4R85A 3N2OA 3R94A 4LTSA 1M7PA 1BSLA 2VD9A 1J9YA 4E8GA 3HB9A 4RR4A 1M68A 3ZIZA 2FVKA 4FEZA 3NZGA 4LAKA 4C7FA 3AHYA 2SFPA 1FHLA 3GB6A 1S2WA 3ZT6A 4DUVA 1WKEA 3WFAA 2GK1A 3URQA 4K2SA 4R33A 2QUVA 3H26A 1JCLA 4PULA 4DWSD 4NXKA 3MZNA 3TKFA 3T07A 3U5UA 1Z32X 2DH2A 4OZOA 4N9DA 4Q4OA 2XUCA 4AY8A 1TCDA 1L2QA 4CNOA 7REQA 3M1ZA 3ARUA 3MO7A 3WD0A 5G1YA 3ZO9A 2ZOXA 2WHLA 2WLYA 4G1NA 5DFAA 2VCAA 3PPHA 4GPNA 3T42A 4RW5A 3MUCA 2PLJA 2ACUA 4JY8A 3PAJA 2FB3A 1ADOA 1KXTA 4JTTA 3EGJA 4ZOAA 3T2QA 2WHMA 1HIZA 3CHDA 5CLTA 2FDMA 4AEOA 3R43A 3QPYA 3TAOA 3AMLA 4YIWA 2ZQ0A 3REQA 2E67A 1XKJA 1X8FA 4P8XA 4A4AA 1JRBA 1QBBA 3KBJA 4PBEA 1IV8A 1ZAHA 1CYGA 1US2A 3TN5A 1PBGA 4MKSA 1MMFA 1GPWA 1DJIA 1KNWA 4JNZA 3F4VA 3U9IA 4UQBA 3PBVA 5FF3A 3RLGA 5CBBA 2FGBA 3S2LA 1XIDA 4DF1A 1JI1A 4GUHA 4RE0A 5DCEA 5AHEA 3ORWA 4MY9A 4JIEA 4MKVA 1IGWA 1LDCA 4XD6A 4H8UA 3W2MA 1KRMA 3PVFA 4K8EA 3H70A 5J8LA 1RUSA 6TIMA 5HUOA 1Q2RA 3UWUA 3O0FA 2XHYA 2EEXA 4WZHA 3ICJA 1ISWA 4M7SA 4DB7A 1A5SA 3BK0A 1KXVA 1W32A 3UERA 2YA1A 1A3WA 3VD7A 3LPGA 4ERAA 3GHRA 1JL8A 4IQJA 1F3XA 2PTDA 2VX6A 2OEJA 1NQKA 1EDTA 1K8CA 5A6JA 4GG9A 1KRAC 1FWWA 5K9XA 1PPIA 3L4XA 4C1NB 1VFSA 3MC5A 1BXBA 4M6UA 2E3ZA 5KZDA 4EF8A 1C8VA 4RDWA 1QATA 4ZFCA 3VM5A 3GVRA 1KM3A 2ZRZA 3T4WA 1ML1A 1XC4A 3OVPA 1QT1A 1VPQA 3CYJA 3WDIA 1EEXA 5BWFA 3Q65A 4LAZA 4XK2A 5LA0A 5D9PA 4J3XA 4NAFA 4Q3MA 3N13A 3UPBA 3CQHA 4FXFA 1XSJA 1NTHA 3TR9A 2OZ3A 5TAOA 2ZX7A 4ICNA 1KCKA 4UTIA 1XYCA 3BG9A 2WMHA 4QIUA 1FP9A 4Y9OA 3AS0A 4YPJA 3CHEA 3TTYA 1J18A 1L8PA 4KWUA 3O06A 5E6ZA 3DESA 2PTXA 5C9ZA 3L0NA 3SJ3A 4IQEA 5IHSA 3DENA 4Q7NA 1KTCA 4PEEA 2NLIA 3S2NA 5CC7A 3E49A 5D38A 2VX7A 4WIWA 4B5NA 2CHNA 5K3VA 3D0CA 1JJKA 3LM3A 3TMQA 4KWOA 2IXVA 4R34A 2RGLA 3CTLA 3KVMA 1TA3B 3WBXA 3V18A 3HGOA 3QV9A 3FSTA 3UR7A 3NIYA 4IX2A 3M6DA 3WD3A 2UZ9A 2PD5A 1IXOA 3ZYZA 2BP1A 4D72A 2O55A 3CB8A 3II1A 1M9HA 4DJEA 4I5RA 1LROA 3LERA 2VOTA 3EB3A 4TV6A 3KZSA 5K7JA 3WLPA 4BWLA 4Q8NA 2EO7A 3T6CA 1X6UA 4UC5A 2CKSA 1AW5A 3QSRA 2QUNA 4UZUA 1N7KA 2YCKX 4C6QA 2HEJA 1CGYA 3GXFA 5C70A 1CZ1A 3W84A 1V6XA 1VCFA 3MV11 3VIFA 1UD6A 1JAKA 5H91A 3QW3A 3B8VA 2GGEA 1XCFA 3WLSA 3FJNA 4KPLA 1TWWA 2C13A 2XGIA 3IACA 3VE7A 4DUXA 5A2BA 1VFUA 3PJWA 1CECA 5HPCA 3MUAA 3FNDA 1ZY9A 4ACYA 2HPMA 5AHIA 1F6YA 2PDMA 1OGSA 1V6UA 5FI8A 1Q6EA 3HFTA 2GFTA 3AISA 1R3YA 1W3KA 1YDYA 4IGSA 1YDVA 4L9YA 4QBXA 5I2UA 3CO4A 2QCDB 3WLNA 5FJIA 3TJLA 3W1NA 2D2HA 4JXCA 3LMYA 1LRNA 2NUXA 2OXNA 4E4FA 1KBBA 2IQTA 3CH9A 5CPLA 3SBFA 1NU5A 3UU0A 2GK1B 3G6LA 3O6CA 4HBKA 3VTRA 3VNZA 4JTFA 2OVLA 2HNHA 3WUBA 3MA8A 5J04A 2OLSA 2D20A 3KHDA 1RLCL 1JPMA 1A47A 2VKZG 4LEFA 1T99A 3DI0A 2QDEA 3AS2A 1EIBA 1PDYA 1VRXA 3M16A 3MHUA 1HO4A 2DZXA 1RQBA 3EMZA 4PE8A 3B8SA 5FA5A 1IEIA 2P3ZA 2PA6A 1TTPA 4HKPA 1EQPA 4C65A 4LYQA 1EJRC 4AZ6A 1FWDC 3KLKA 3HN3A 1VC4A 3PZVA 1J5TA 3N3MA 2R1PA 4S1FA 2HCVA 3RUBL 2WSKA 3REQB 4WXYA 4N6FA 2O9PA 3AU6A 4X61A 1WDSA 4ZZ9A 3BVJA 2GVLA 4K6AA 1G7VA 3GBEA 2H8XA 2QPUA 5A5WA 2CLEA 1ZUAX 1PSCA 2WSPA 4DN1A 2WWDA 3THUA 3WIJA 3S9ZA 1NVMA 3BAIA 4N2YA 2XIOA 1PVNA 1BG9A 1S2CA 3TYUA 1NM9A 4FP1A 4PMZA 4DUOA 3CUXA 2DQWA 4PZVA 4TMBA 4XVEA 4QSHA 1R9YA 3WD1A 4PBGA 5LIWX 3R8RA 4B5TA 2WPBA 3T2OA 3CTTA 1ZAIA 1FWSA 2XIQA 3UP8A 5BU9A 1VFHA 4WX2A 2BHYA 2ZUMA 1SO6A 2OELA 3LZ3A 4JFUA 2HBVA 1DKWA 4JTUA 3LGGA 2GGJA 4UTKA 5H6HA 4JQ2A 3PNUA 3AIUA 2X0HA 1XUZA 4LBSA 4JIPA 1DYSA 4KFNA 1XFBA 4GVFA 3PWAA 4ENLA 4IZGA 3AMCA 1JCYA 3KEHA 5AYBA 4G2DA 3S5YA 1LBMA 3T08A 1XLAA 1FQ0A 2VD8A 4KESA 1E9YB 1PAMA 1QOQA 4DAIA 3FVDA 3MWCA 2NWRA 4W7UA 2W27A 1XJBA 2J4GA 4S39A 4QROA 4X0NA 3ERPA 3UJRA 2V5LA 5DLCA 4WCJA 3QLLA 3VUSA 5A69A 3ARPA 4ATWA 3HG2A 4MDOA 3VNYA 4NAFB 5I0DA 1FWGC 1KM5A 1UC5A 5T26A 1SFSA 2AMXA 1IIHA 2Z7KA 1KFWA 1FCBA 1XCWA 1OM0A 2EJAA 1C8YA 3W07A 2QPSA 2EF9A 3KW3A 3BAYA 5BROA 1R47A 4ES4A 4JCMA 3HV8A 4N7QA 2DZWA 1S38A 3GG1A 4EAMA 2WVUA 4B5WA 3EX2A 1G67A 4D6IA 4H6KA 3K30A 4OV9A 1QI3A 2O9TA 1MO0A 2VEFA 2WJEA 1V0NA 4HMDA 1A5OC 5AFDA 3QBUA 4J5NA 5ECUA 1QOXA 3CMJA 3AMKA 3BJSA 3GDBA 2XU2A 1I45A 4R3UA 5LGZA 1JEZA 4MKNA 1OBAA 3O1NA 1EPXA 1FHDA 1RAKA 4XAPA 1C8XA 3G18A 1FWJC 2YL8A 4R5EA 3VZZA 5CG0A 2J9ZA 4DWSA 4G7EA 4S3DA 5DT7A 3QR0A 3W1AA 2V0TA 3N9KA 4IMGA 4MWAB 3MUXA 1Q6DA 7ENLA 3BAWA 4RV3A 1E6NA 2D69A 3AMDA 3P61A 2V2DA 4L4MA 1R87A 3GXMA 4QNEA 4PCSA 1JCNA 1FWBC 5CSUA 1D9EA 1MDRA 4UQDA 2Q3OA 4LOCA 1QI2A 2WVVB 1GKPA 3OZMA 4US5D 1Y5VA 1BYBA 4XUYA 4WKHA 1F6PA 4K7YA 1BTMA 3VNDA 3GS6A 3NO1A 4G5DA 4H7VA 5CPQA 1E73M 3LEPA 3MB9A 5CCZA 4XKYA 3W37A 3E6EA 1SZEA 1KCXA 3C2OA 3SY5A 4HSNA 2DVUA 5KITA 4R7WA 1BEUA 4MFDA 1TE1A 3TJ4A 4HHHA 4JX4A 3AU2A 1GOWA 1XIMA 4O1DA 1QNVA 1D3GA 4GINA 1GEQA 5JU6A 4KWVA 2IKIA 4QG8A 4JN8A 1R9ZA 4UOJA 4ZFMA 4XBJA 3LV6A 1VD6A 4N9EA 4AYSA 4LY8A 1O60A 1NFGA 3E02A 3OBKA 1PCWA 4LC6A 1LQ0A 4IF2A 5K2ZA 2O7QA 1CLXA 2EG7A 1R30A 4KKXA 1W5QA 3M4HA 3V5CA 4HNCA 3T2PA 2VP8A 3OP2A 5BXPA 3L21A 3QMTA 2DH3A 3STEA 3ARXA 2YBVA 4CN1A 2QJNA 1BLIA 1X7FA 3IJLA 5EFDA 3VO0A 3UW6A 1V0LA 4B5VA 1RQHA 2HMCA 1XLKA 4AD0A 2C91A 3EBVA 3KCJA 2I9EA 4PSRA 5CGQA 3N25A 3SAZA 2GPTA 4JNYA 5D03A 2DDXA 4QJ1A 1K8XA 3GH4A 2YR1A 4GC3A 3VC6A 5G5IA 4AW7A 1EP2A 1VIZA 3QGVA 2E6FA 2YPIA 3W88A 2BB0A 2E40A 1ZENA 4H04A 5EFFA 2QZRA 3UJEA 3FA3A 1EQCA 4AC7C 1E6PA 3NWRA 3D47A 4A3YA 1JZ5A 3SI9A 2XWEA 2D3LA 3AUOA 1MW2A 1LM1A 2F8QA 1F3EA 3CEPA 2VRKA 4LU0A 3UGVA 2ZZ3A 4MFEA 3A47A 2DZVA 3AIBA 2XM1A 2BY0A 2YCLA 4GISA 3STFA 4EANA 4A05A 2WC4A 4WDWA 4AZ7A 4CD6A 3NL3A 1OY0A 3EKLA 2W66A 1N8WA 2CBVA 1UKQA 3NO5A 3KVJA 4LX4A 1RSCA 3IJIA 1U1JA 4L65A 2PC4A 3OHMB 3R7MA 3KXQA 6REQA 3KOZA 3W1LA 3WL1A 2CLOA 4JKKA 4KEMA 4FB7A 4U31A 2VO5A 1XLLA 2B31A 1DE5A 5AECA 4DZIA 1TREA 3W6LA 1DJHA 1CGUA 3UXLA 2B0MA 3V7PA 1HJWA 1J4EA 3U7VA 1UMLA 4G7FA 2YW4A 1CI1A 4E8CA 1XC6A 3I7QA 4JN6A 3KM8A 2XTKA 3KL0A 2GOKA 1JNEA 3RPDA 4PODA 3P0WA 4Z1AA 5AYIA 2VWSA 3G1FA 5E5CA 2B7PA 1W1IE 1OG6A 3RO8A 4FALA 5K9CA 2NQHA 5E6YA 1FOBA 1IR1A 2WV8A 1I2PA 4PCPA 4U3CA 4HNVA 3AUJA 4JKLA 1JDAA 2PI6A 4F0LA 2GDQA 4BF7A 3A4JA 1T7LA 1TMLA 3W70A 2PD9A 3OBEA 3W7CA 1LRTA 4HNLA 3AS1A 1YTDA 3ABZA 3M07A 1WUFA 1C91A 4LS0A 3LGDA 1Q85A 1HJVA 2XFYA 2IPWA 1CGVA 1AA1B 1RY8A 1RPXA 4HN8A 3UG4A 3RITA 2X42A 3M0MA 3VD4A 4FMVA 5C71A 4L9XA 1WOAA 3GDMA 1A3HA 2H3BA 5CZJA 2GGHA 3A9BA 1RBLA 1U5VA 3L4TA 2HXTA 1BGAA 1TPB1 2PZ0A 3HQ1A 1KW1A 4HHMA 2VHLA 2B7OA 3NM1A 5EBUA 4Z2KA 4H19A 4E2DA 1WXYA 1MSSA 1BXNA 4YYCA 2EPNA 4HYVA 3K1GA 5LNWA 2AGKA 4LJ3A 1PIGA 4H8VA 2VZOA 3TV8A 5A6SA 3C3UA 3QV7A 1GT8A 4Y9NA 1MEHA 1ADSA 2A3BA 4KH2A 3IIOA 3GG7A 2QJIA 3OA3A 2ZADA 1LF1A 4AX7A 4BKNA 3GXIA 3HMJG 3V4BA 5CJNA 2DZAA 4KT2A 3SCOA 2R24A 4G7EB 1EJXC 3VGDA 3UCQA 1DWFM 1CGXA 4YTRA 3FY1A 5JH1A 2CLPA 2ZZ2A 1GHSA 4JICA 1VCVA 4ZXLA 1ODUA 2JF6A 1ITUA 4MIMA 2XSBA 4JTSA 4ZSUA 1G4TA 3GC2A 1DQXA 2B4GA 4M6QA 2CHRA 1ZL1A 3DAQA 1T5AA 3LMZA 2FH6A 4POCA 5MHBA 4H1ZA 1AZ1A 3RCNA 4B4HA 3P60A 3WNMA 2A85A 4UTWA 1Y7VA 4GUFA 4PTWA 1VPXA 1YBQA 3WQ4A 2R6OA 2G50A 1RCOB 3LA4A 3BO9A 4XKYB 3U5YA 3DBNA 3Q58A 1BVWA 1KTBA 4AFYA 2D2JA 4HMEA 1M01A 4DF0A 5CBJA 2DVXA 1PKLA 3JU2A 2CETA 2R1LA 4PTNA 3UVAA 3ANVA 1O4UA 2J7GA 3N2MA 3IGHX 5FESA 4GFIA 4FNPA 3JVAA 2Y88A 4JFTA 3BE7A 3UR2A 2EGZA 1MRAA 1XF0A 4U10A 5A8QA 4IHCA 4ZQOA 2J27A 1VJIA 1UZHA 3QEZA 1ONWA 1XP3A 3LB0A 4WOZA 5CJMA 1ZALA 3QV6A 3GU1A 1WX0A 1PX4A 5EPDA 3G8RA 3ITOA 3L5AA 4H83A 3BUVA 4WDTA 4D6CA 4FI4A 3MQTA 2VELA 3W22A 4JTAA 1UKPA 2VJXA 1XIGA 2VFDA 1OX4B 3EPOA 4XD3A 3VX0A 1LWJA 3BJFA 1UKTA 1KFLA 1ZP4A 3UXDA 3ID7A 1AQMA 3CV7A 4UFHA 3PP7A 1RV8A 3C5QA 3R2GA 3NG3A 3LHUA 3CAQA 2EPHA 4JL1A 4OE7A 1EJSC 3M46A 3O3RA 1JYXA 1E0TA 1E5JA 1LG1A 4DUWA 4RE4A 3W2KA 2YFOA 4QE1A 3IIPA 4WY0B 3B8DA 5CJ5A 3EEGA 3R0DA 3FHAA 1IZJA 1POJA 1TV4A 3CASA 4P61A 5HJYA 4B3ZA 4ZO6A 2G97A 3M41A 1ZBCA 2YCLB 3P82A 2YZ5A 2YDAA 4DO5A 5A2AA 1Q6CA 2P88A 5LZLA 2XN0A 1DQUA 4V2XA 2G41A 1V6YA 1RBOB 3CPRA 3DHFA 3SDOA 3ZT5A 4U5IA 3WQ8A 1K9TA 2O9RA 4L6HA 4XZ9A 4C6FA 1XISA 4QJ3B 3QYQA 5TF0A 3Q45A 2VM8A 3WQEA 1HT6A 3SW6A 2E5BA 4LUSA 4TQTA 3GC4A 4EXBA 2FTYA 2CC0A 2QCCA 3ARQA 3VKKA 3VIKA 4XZHA 4IMAA 4JOMA 3ZJKA 3TTOA 2HNEA 3B4YA 3WJYA 3VFLA 3NZRA 3GXDA 3W7LA 4PUMA 3SGGA 3UG8A 3WUGA 5ABTA 1Q6OA 5DMMA 1GEHA 4DM2A 1PDZA 1D8CA 2KX9A 1IE7C 4QISA 3MP5A 4GJIA 3VU2A 1UD5A 1YXCA 5A2CA 1YXDA 1B4EA 4Y9PA 3KBSA 2Y5JA 1GVYA 3CZKA 4E2BA 2PDKA 5DF0A 3RYSA 1EA9C 4IPIA 3LX9A 4PSPA 3XINA 5LYRA 1F76A 1THFD 4Q8TA 3ZLGA 5D9OA 5GNZA 2PWGA 3I4KA 3DI1A 3AJ7A 4O1EA 1C93A 3LTPA 3A6OA 3RILA 2FZMA 3AJXA 2EG8A 3BW4A 4J2MA 4MWAC 1OCQA 1IF2A 2PUZA 3PFMA 2J24A 2WZTA 3VIOA 5F1UA 2DT2A 3CU2A 3LCLA 2UWFA 4HD5A 4Q7IA 5C55A 2J74A 3U4AA 1XINA 5AC7A 3MCOA 4LT9A 3B0VC 4UIOA 3E5PA 4ATDA 4DVOA 4UMAA 3KOXA 1WV2A 2ZZ6A 3LNPA 1IXQA 3BLPX 2WZMA 1X97A 1ZHAA 4GE8A 3BCFA 4NP7A 1EDGA 5GNXA 1ZU8A 4F4RA 4L64A 3FOKA 4NX5A 4JN7A 3B9OA 4D1JA 2OLAA 3OGVA 4WSHA 1TPDA 1RXOB 3TTSA 4MMWA 4GLEA 4Q8QA 4UNIA 3VIMA 4FR1A 3S6DA 2JALA 3PZOA 5GJPA 5I06A 1H7WA 1EYEA 3KZPA 4K37A 3NNTA 1I0DA 1I1XA 4JYFA 2Y8KA 2AL2A 2J9YA 1W9DM 3W25A 1R86A 4L7ZA 2WBKA 1I8JA 4P7RA 2GWGA 1KBKA 4RKAA 1ZJAA 1IIGA 3NQEA 1Z9AA 1RVGA 2TMDA 1OC5A 4O17A 3MCNA 2OKOA 5LA2A 1YNYA 2PDXA 2VMFA 2GJRA 3D3AA 4I5UA 4PFHA 1LT8A 1ZNNA 1KFCA 3LLXA 3A12A 2E9MA 1HVQA 1O5RA 1FHVA 3NDZA 4PH6A 2W4XA 4K1WA 2Y89A 4XX6A 5MF5A 3LHYA 1TVLA 1FRBA 4A8RA 3XISA 2WMGA 1K7XA 4HJWA 1FWNA 2CZDA 3FJLA 4JHOA 1EHNA 1XX1A 2G4FA 3TW6A 2X0YA 5FACA 1C29A 4X0VA 3IJ8A 3K8MA 4CQBA 5BW6A 2C0AA 4C1LA 1W1VA 3AZTA 5DCDA 3GYEA 2C8NA 2R1MA 3I65A 1POKA 3UQNA 4N9BA 4XD5A 6A3HA 1OFEA 3VNIA 3T7VA 4YMZA 4IMDA 3LHWA 1O1HA 1B3YA 2Z0IA 1DWJM 1O95A 4I6VA 3AIEA 3A24A 1J79A 3CIXA 4E2OA 4E3VA 2RDWA 4WJEA 4A8LA 1NF0A 4UFJA 5A8NA 4AZ5A 3A4AA 1K1DA 5H1WA 2ZZ7A 4FNUA 1QPRA 1JYWA 1ZQ5A 3EKZA 1MZRA 4FIQA 4V27A 1FX6A 3S9IA 4BHYA 1H7NA 4IPJA 3VOCA 1SFLA 2X1UA 1H60A 1EHAA 5I3IA 5B7YA 2XIJA 3M0VA 2WVSA 3LPPA 4JNMA 3APGA 1PZ1A 3UWQA 1XHGA 4WHBA 1A5LC 1US0A 1V3KA 4GVIA 4E38A 3BGAA 1Q7QA 3DFOA 3ZMRA 4ADUA 5LNSA 3EOEA 2YXGA 1P0BA 5E93A 1Q6LA 1A80A 4JHZA 2D0HA 2BY1A 1TPC1 1E40A 1ZTVA 3DG7A 3GVWA 2CU0A 1EL3A 3ITXA 1HKJA 4MNKA 3N9RA 4LNYA 4PUEA 1GTEA 2RH9A 2PDQA 3RM8A 1GOKA 4HPNA 2DORA 4Q8OA 5IM51 4FOJA 1KRBC 4DO7A 1GQKA 1BGGA 3DXIA 4MY8A 4L1XA 4U33A 3NOEA 3H7UA 1XLDA 2Z1VA 4NZJA 5KMYA 2WCGA 2YCIX 3BICA 3THCA 1G7UA 1WAUA 2A3AA 3WQ5A 4Z42C 2CKRA 3WH6A 3TAKA 1K9EA 3SURA 3KWSA 3SJNA 2G3FA 3H2AA 3B8WA 2V3DA 2NXHA 5EBAA 1IXNA 3T0CA 4QTGA 3IGXA 3W1XA 1TYGA 3E2VA 2VGGA 1AFSA 1RZMA 2I5QA 3RXZA 4S23A 4NZ3A 2VZUA 3URAA 1S1PA 3ATZA 4L6DA 4AG0A 2QDDA 1TG7A 3TSBA 4LUSB 3W1QA 1B4KA 1SYTA 4BJHA 5BRBA 2XH2A 2VEIA 4E4PA 1LWIA 5HMFA 4DBWA 4RDVA 3TN3A 4BQ2A 3FS2A 3CC1A 1EUNA 1TE6A 1JUEA 1UH2A 1XLJA 1U83A 4LNCA 1IR2A 3MY9A 3OA5A 3N1AA 1Q8AA 3G1XA 4LYKA 2YIHA 1XI3A 5CZKA 3W9ZA 2E6YA 5D09A 2P5NA 1BWLA 1F5ZA 2EKGA 2EPKX 3N29A 1XQKA 5TD4A 2JKAA 3EMCA 1VR6A 2A1YA 3P80A 3PZMA 3KBVA 3N34A 2HVOA 4MTVA 3AYTA 2QUUA 1CTNA 4GYPC 5I7GA 3EOLA 4HNUA 4ZTYA 1UZ1A 4FS9A 1V02E 4RX0A 5AC4A 4AWUA 4IP7A 1FWRA 4ZCWA 3I6EA 3EDDA 3EA2A 2YJQA 2JEPA 4MHBA 2Q09A 4IICA 1KC7A 1P6BA 4AF0A 4CU7A 4ZQPA 4DO6A 2BGNE 1UC4A 3ZT7A 3Q2DA 3QTPA 1WZLA 1RLDA 3M44A 4FIRA 2TODA 1ZRQA 4D6JA 4M29A 4MB4A 4C6JA 1E43A 3RLVA 1R7AA 1DIDA 1ISZA 1OC6A 1FXPA 4EPKA 2GJXA 5I23A 2QUMA 4G56A 3IARA 4PUKA 1F61A 1SR0A 1H1ZA 3TYEA 3GAKA 2X05A 3SY1A 2Y7GA 3IRSA 3VE9A 4Y6GA 2IPGA 4GFSA 2VFFA 3WMBA 4PTMA 3N6HA 2VC5A 2NZLA 5L6UA 4C6BA 4IIBA 4UFMA 1QWGA 1DXFA 1DIKA 1D7KA 3BOXA 1UWQA 3PPFA 2XVPA 5AB3A 4KIRA 3CUHA 1MUMA 4HSOA 3QHNA 1CWYA 1GG1A 2QDGA 4HP5A 3Q67A 3IAPA 1Q7ZA 1JI2A 1XKYA 1OADA 5LNUA 2XN1A 2OWWA 2CEQA 4H8HA 1EEPA 4O53A 3UJ2A 4CCEA 1OFRA 3SUUA 4S38A 4GI8A 3G1VA 1TR1A 1ZPTA 2OMAA 3DHUA 1V93A 4H00A 2EXOA 3L0GA 3AIQA 1I4NA 3LI1A 1K70A 2PRHA 4HSHA 4O1BA 3KBMA 1D2KA 4UFIA 4YCOA 1DJYA 2GSEA 4U2YA 1UQZA 1NWRA 1BYCA 1DWAM 4P2VA 4J3WA 3IUIA 2DVTA 3S47A 2HVMA 4YVXA 3KVKA 2ZICA 3NQDA 2NQZA 4GY7A 3WLMA 1HX0A 4ZXOA 5C5YA 3L12A 3TCSA 1PUDA 2ZTJA 1AD1A 5AN7A 4GZ7A 3B0UX 2JIWA 1J0KA 3CLWA 2WNQA 1SM9A 2G8ZA 1UWTA 3S6OA 3O6AA 4UQAA 2PP3A 4MWAE 1OC7A 1SZGA 3ZWTA 2JK2A 3AOFA 3WLTA 4O12A 4RCXA 3PULA 3CUJA 1REQB 2PDFA 3LPFA 1GJWA 1NF7A 4IM4A 3ABOA 4L80A 1KGXA 4PFMA 1B31A 1XCXA 3BARA 4WJXA 1V7AA 4QE4A 4FLQA 4W93A 1DIEA 1E5NA 4GK8A 4TVUA 2ZDRA 1QVBA 3NQ8A 4X63A 1JXJA 3RJXA 1XLGA 4KF1A 2DZBA 2CITA 9XIMA 2DT1A 3RIKA 3IIZA 4KS0A 4LGXA 1L6SA 3PFRA 1NFBA 1M7JA 1XIFA 5HQLA 4HPJA 1U2YA 3CHVA 4JTHA 4KRUA 4JEJA 3AZRA 5IFPA 3G24A 1GYMA 3AQUA 1TJRA 2ZRWA 1JDDA 1KBJA 4L4PA 2YL9A 3ITYA 1LOQA 4LBUA 4AAJA 5BMXA 3UXIA 3PBUA 4W9TA 2A3EA 1IQ8A 1TJ1A 3LM7A 3R1ZA 3ARYA 3TDFA 2NT0A 1FWFC 4PN2A 1JAEA 5H8UA 3TP4A 4DBSA 3NTYA 2A3CA 4W85A 1H41A 5EMYA 1KM0A 2IQDA 4AC1X 4MPKA 4MVAA 3PPCA 1XRTA 4GX9A 5FSDC 1PKNA 5D37A 1I1WA 4DEFA 2V30A 2ISVA 4H9TA 1X7IA 3BZJA 4EOUA 1EB3A 7ODCA 4DQWA 4JQ1A 4N9CA 4O13A 3LQLA 4IT1A 1XYAA 2VUNA 2PDGA 1RBAA 5SWUA 3RF9A 1TWIA 3UJSA 1RCXB 4MSSA 1HZYA 3W7JA 2O56A 4UCGA 1A4LA 4IGMA 4GIEA 5RUBA 5CG7A 4H9UA 4DNMA 3M9YA 4GQBA 4LF2A 3T81A 5DBUA 4A21A 1L9WA 2J9XA 1UA3A 2ISSA 5ABHA 5IOBA 1VIWA 3KS5A 5BCAA 2X8RA 2QCNA 1YTKA 4LC8A 4I9JA 2R94A 2WKLA 1J6PA 1PEZA 3CAVA 4QS5A 4IOTA 4UR7A 1TELA 1C7TA 2OQLA 1ZB5A 1JYNA 1I2QA 3HG5A 4GACA 4C6NA 1Y0EA 3W7MA 2GWNA 3I3EA 4ZSTA 4HZ6A 3GY1A 4OQVA 1OCBA 1TJ0A 2J8TA 3UYCA 2DIKA 3UPWA 5HJLA 1FKWA 4JTDA 3GSMA 3N12A 2V68A 3RLUA 1QUMA 1W2PA 4RDYA 1HUVA 4IG2B 3SIMA 1GZJA 1FDYA 3WLIA 2X1SA 2ALDA 3SRHA 1XXXA 1HJSA 3TMLA 2WMKA 3LS9A 1JR1A 4LUTA 4TO8A 3Q37A 4NZFA 1OIMA 1V51A 1FBAA 3FYOA 1IEXA 3GRIA 1X38A 2YSWA 2GLKA 3IUDA 1H50A 3VOGA 2ZDSA 1VGAA 2H6RA 4GYJA 2AOSA 3M5YA 3WBYA 4HHPA 1GOMA 4IFRA 4B4FA 1SPQA 4AF0B 3EXTA 1W9VA 1F4HA 3MUY1 2GVEA 1XLFA 1LLOA 2PWFA 4AZCA 3LY0A 2DPEA 2QCFA 1K7EA 4UTHA 1DJNA 1YEYA 2F9RA 3L2MA 5L9FA 1O5KA 2REQA 1VQTA 1LQAA 3SUSA 3CV2A 2OZ8A 1Z3NA 1QO5A 4UOZA 2Z6JA 1OGBA 4F2TA 4QP0A 4R9OA 3NA8A 2QUTA 2GJXB 4L56A 4GO8A 2XJ7A 2WNZA 3V16A 3B0YA 4FAMA 2QJGA 1AK5A 1UP0A 1TVNA 2JKEA 1K8YA 4Z2GA 4G9PA 3FSUA 1PYFA 3EYPA 4KERA 4X60A 2C7FA 3H2EA 4GQRA 3TYZA 3VZXA 1E3XA 1SU5A 3C2VA 9XIAA 2MUCA 5CSRA 1X1ZA 1FCQA 4MZYA 3W26A 2BGQA 4M80A 1QO2A 3SUWA 1QMLA 2VYOA 2VR5A 3ITVA 3MANA 1A5UA 3KOWA 3AAMA 3VCCA 2QCHA 3Q94A 1XICA 4AY1A 1H1NA 1UOZA 2Z4GA 1F8MA 3UWWA 1ICQA 2BXVA 4S2CA 4GC4A 2DT3A 5M1TA 3AICA 4OIFA 1RH9A 2C71A 3S46A 4IPLA 4HK7A 2TSYA 4DZHA 1LJYA 4XZNX 4ZO7A 4Z2IA 1XH0A 4KWSA 1Q4NX 3RAOA 4F0SA 1X1OA 3U3HA 3QM3A 3UNDA 4OBSA 1WDWA 4HOZA 3IGUA 3PBMA 4TX8A 1FDZA 4C6DA 4YU1A 4FNTA 5HUPA 4PMQA 3G3MA 2P8CA 1ENUA 2F7FA 2A79A 2FJUB 3HQOA 1OG0A 2NV1A 2WKJA 3R8GA 3VNKA 3GHSA 2QT3A 1ONXA 2NVCA 2Q02A 4YNGA 3DFPA 1OZQA 4PMVA 3DHDA 3A3XA 4UNLA 1B30A 2XDFA 3W3OA 1AVAA 1SVDA 4KGLA 3SO7A 3QZ6A 1KFJA 3CGTA 3DIPA 4FA3A 1EWEA 4WDXA 3JS3A 1UR8A 1VBGA 4PTDA 4Q8MA 4H9MA 4LVGA 5BU6A 1PIIA 3S6TA 2PMQA 4CD4A 3GNPA 2DV0A 3SR7A 2E7FA 3DFYA 1CT5A 1BRLB 3LUTA 2I9UA 2ZUTA 1FA2A 2ZE0A 4S3BA 1W9UA 2OSXA 2GVYA 5H2ZA 2GVGA 1XH1A 4HCDA 2JGYA 4GWEA 2WCAA 5LNRA 2DUZA 2H8ZA 2DZPA 4XB3A 3AZSA 2NV2A 1BTCA 1TX2A 3GTNA 3N6QA 3PTMA 1T8XA 3L5LA 2NXIA 4RZ5A 2F61A 1W5NA 2XN2A 3U7BA 4ZQCA 5D2YA 3AHTA 3E2SA 3M47A 4LYRA 1LQ2A 3T0TA 1W54A 1NOFA 1QWKA 1KCZA 2J77A 4Q8UA 3KUMA 1NIUA 4I90A 5G4WA 2VX4A 3VPLA 3W75A 1J0IA 3ZSTA 5DANA 2J6VA 4HK6A 1EDQA 1MWOA 3GFXA 4JBRA 1ITXA 3VKJA 4B5XA 4AMAA 1G5AA 1V79A 1QRQA 2CZFA 1V3IA 4N42A 3CL8A 2ICSA 4UTUA 5EYWA 5LIUX 2ABAA 1QNOA 3K1DA 5FOOA 1S2VA 3W53A 4KCWA 4YTSA 1C8QA 3W4RA 3VABA 4HPGA 5HMEA 1VB9A 4S3GA 5JMUA 1B9ZA 1H11A 2C15A 3SECA 3ABXA 1E6XM 1EC9A 3BPWA 4AU0A 4LALA 4RLIA 2QF7A 4H9XA 1CBGA 3S3GA 5F2MA 1GPFA 1LRQA 4PL2A 1H0IA 3KWXA 3CMGA 5IBXC 2FGLA 2Z1XA 1V0KA 3I7RA 2NQ9A 1NWUA 4A8NA 4OJYA 3KTSA 3UZYA 3NGJA 4R9XA 4A35A 4ZEPA 4Q33A 1K9DA 5LA1A 3ARTA 4B9YA 4IX0A 3DFQA 1E3ZA 4FLSA 4J7RA 5IDZA 3C86A 3NYDA 1V6VA 4K8GA 5C7VA 2FTPA 4IJCA 4OTKA 4AD5A 4D9PA 3N4EA 4HTBA 1S1RA 3W27A 5I03A 2EAWA 4PBFA 4DELA 4J3SA 3QMRA 3LQGA 3B9DA 4UWMA 1R2TA 4D6GA 3TW7A 1NP2A 4JL2A 1QCWA 3N19B 4E6MA 1QPOA 3C0SA 2G96A 3RDKA 4C6MA 2WAGA 3UA4A 1TMQA 3EEZA 1AMKA 3UETA 3S4TA 3H7VA 1WB0A 1HG3A 4ROPA 4AZCB 3GR8A 4PMYA 1GYLA 4QS6A 2Y7FA 1G01A 2WCSA 2VQUA 1YKWA 4CKQA 2PWHA 4E2VA 1NQ6A 1J2BA 1EJVC 3C2RA 3TZNA 1A5NC 2EQDA 4LUJA 4IQDA 3UR5A 3PSVA 3LD5A 2FMOA 5ABFB 1MNZA 2W5FA 1UASA 5KINA 2Z2AA 2YFNA 4L9ZA 4IGNA 4YL2A 1K6WA 2EPLX 3PS7A 2PBOA 2X1RA 5CPTA 1KA9F 4ACZA 5CEWA 5ABGA 1P6CA 3VK5A 4G6CA 1W8SA 1HNYA 1VJZA 3W0KA 4C60A 2XVNA 2FB2A 5E09A 1QI5A 3QJAA 3B3DA 3LLDA 2BTMA 1EGVA 5CQ1A 3QSTA 1VHNA 1CEOA 2V5CA 4I9TA 5XIAA 4F40A 3TTEA 1W9XA 3P7YA 3FVMA 1XDLA 4NKCA 1BVNP 1NEYA 3U2ZA 3CYVA 4MAZA 2I7GA 4DAFA 2OLHA 2NSXA 3EWBX 3U0HA 5KZEA 4A8IA 3WBEA 1GCYA 4DJDC 1OWQA 2C14A 2OO0A 4IP5A 2DFAA 3IPWA 1JZ8A 2NT1A 4F79A 2PGRA 4P7LA 3BMVA 3UFYA 4GJ1A 4J40A 1Q4WA 4XZWA 1TWZA 1GVEA 3SCQA 1B3XA 3M0ZA 3U8GA 1V7YA 2E28A 4BCEA 4OVXA 1KWGA 2V3GA 3TOYA 4HPHA 4XG1A 1AJZA 4MF4A 5I3GA 1QPQA 1H49A 1B3ZA 2YW3A 1H61A 4WGXA 4NSBA 1S46A 2ANUA 2PTYA 3OGSA 4GI9A 3IEBA 1VH7A 1YX1A 2YLAA 2WHKA 2HE8A 4PCNA 5D2WA 1Q63A 3F5LA 1P0NA 4NASA 4QCFA 4J2PA 1RVKA 1TFVA 3C6CA 3K2GA 4QXIA 3T44A 3AXXA 2VWTA 3EX3A 3NPWA 3OJGA 5AVNA 3SIZA 3OBAA 3QFEA 1L0PA 4GYFA 1TSIA 1VLIA 4JTQA 1UUOA 2BMBA 1MI3A 3AIVA 3AYRA 3SGZA 4MJZA 3L9CA 4PB5A 1MUCA 4OOZA 2XISA 4ALDA 3VGGA 4KRTA 1LOSA 2AQOA 3C56A 3MV01 3TQKA 2NWSA 1UJPA 4C90A 2OFJA 3DDMA 2NX3A 4LVFA 4WXZA 1OFPA 3C2YA 3EXRA 1VEMA 5C7HA 5KZ6A 4WVXA 4B16A 1X6LA 3GFZA 3WLQA 4AIOA 1CIUA 3H4WA 5M03A 3U2OA 3NSXA 7PTDA 1JPHA 1UCWA 4IUGA 3OB8A 1PHQA 4OECA 1I2RA 3H22A 3P6LA 2QV4A 1OF6A 3N6JA 4D2JA 5LXXA 3HBLA 1AH0A 3JZUA 3FIGA 3S1VA 4W4QA 2V5DA 1BSIA 5HDRA 2IW0A 3BGJA 1JF5A 1RR2A 1HXJA 3P8IA 5I00A 1QJWA 4HA4A 3ABQA 4O4WA 7XIMA 5AOUA 1YRRA 4AZIA 4Z0SA 3L2IA 1ZZMA 1XBVA 3WKZA 1XQLA 5CPMA