4XUYA

Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/gh10) enzyme from aspergillus niger
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
302
structure length
302
Chain Sequence
EASVSIDTKFKAHGKKYLGNIGDQYTLTKNSKTPAIIKADFGALTPENSMKWDATEPSRGQFSFSGSDYLVNFAQSNNKLIRGHTLVWHSQLPSWVQSITDKNTLIEVMKNHITTVMQHYKGKIYAWDVVNEIFNEDGSLRDSVFYKVIGEDYVRIAFETARAADPNAKLYINDYNLDSASYPKLTGMVSHVKKWIAAGIPIDGIGSQTHLSAGGGAGISGALNALAGAGTKEIAVTELDIAGASSTDYVEVVEACLNQPKCIGITVWGVADPDSWRSSSTPLLFDSNYNPKPAYTAIANAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable endo-1,4-beta-xylanase C
publication title Crystal structure of an endo-beta-1,4-xylanase (glycoside hydrolase family 10/GH10) enzyme from Aspergillus niger
rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 123
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4xuyA00
1VJSA 1PAMA 1JG9A 1WE5A 1VBRA 1VF8A 1TA3A 1M7XA 4ATWA 4A3HA 1V6UA 2CETA 2EO7A 4W8LA 2DT0A 3G6LA 2QF8A 3GXIA 2D23A 1E6XM 2ZWZA 1HJSA 1HJVA 2BS9A 1MXGA 1VENA 2VL4A 4YPJA 5JUVA 4M80A 2J7CA 1EH9A 1JI2A 1WAWA 5E09A 2CBVA 1J0JA 1BFNA 1IT0A 1E15A 4H2CA 4DM2A 3MV11 2EXOA 4CD8A 5AC5A 1CGUA 2V3GA 2JIWA 3DHPA 3ECQA 1MQRA 3NSMA 1HJXA 4D6JA 1OINA 2GUYA 2OWXA 2WAGA 2XFYA 4LYPA 3WNMA 1VBUA 4D6CA 1BF2A 4MNJA 2BXYA 5I3DA 2OYMA 2DSZA 3OZPA 4CD4A 3FW6A 5I0DA 1QNPA 4W7WA 4W5UA 2ZUMA 4J3SA 1LL7A 1GOKA 3M07A 5CLWA 5JIPA 2CERA 1ZB5A 4M1RA 2G3JA 2FH6A 4PMYA 2FHFA 1CXLA 3AIVA 3W4RA 3QOKA 5I2UA 4Q22A 5FD0A 3AYSA 4AZGA 1W9PA 3WDRA 1E4MM 4JHOA 3CZJA 2J8GA 2FDMA 5JBFA 3CIVA 1DEDA 3SEPA 1ECEA 2EBNA 4UFHA 3VGFA 3TTYA 3CBWA 1C91A 2Y5EA 1V0NA 1UH2A 4M29A 5C70A 3AIEA 4U33A 2EQDA 3CPUA 4UZSA 3MS8A 4GZIA 1AQMA 4B3KA 1BAGA 5A69A 1L0PA 5HDRA 1WZAA 4P8UA 2A3AA 2Y2WA 1GW1A 1KBKA 5DF0A 1NWRA 3MUAA 1GVIA 1NWUA 1VEMA 2YIHA 3VIPA 1JDDA 4ZFMA 2YLAA 1ITXA 2WVUA 1GOWA 2YJQA 1C8QA 1V03A 2CPUA 2DEPA 4GO9A 5A1AA 3WMBA 2WHJA 3WL1A 3ZOAA 4UFMA 4F66A 4F9DA 2Z1SA 4WKFA 3AHTA 1ISXA 1WPCA 1GUVA 3WBAA 1MW2A 4KWUA 4H8HA 1TCMA 3ALGA 1UA7A 2ZXBA 4IM4A 4OJYA 2ZX9A 4U3AA 1LJYA 2GFTA 2XGBA 1QHOA 3B9EA 3VINA 1K9DA 4HU8A 1E3XA 5A2AA 3ZT7A 3RDKA 1GHRA 1W91A 3ALFA 4UFJA 3BSGA 1H0GA 2W63A 1KBBA 4L4OA 2GDUA 2VURA 2QMKA 1UWQA 3AIRA 3GZAA 4W8BA 3GM8A 3SCOA 2WW5A 4PMQA 4TVDA 1FHDA 2VZSA 4BCEA 4OOUA 2YDRA 1CXFA 1UWIA 1B3XA 2W61A 1JXJA 1LWJA 4KRUA 3QGVA 4NRSA 3GTNA 3RO8A 3WDHA 2VRQA 5HPCA 2AOSA 2OSXA 1PIFA 3WMCA 4XV0A 3J7HA 1E6QM 4IPLA 4W86A 1JYWA 5AYIA 4HOZA 4KGJA 5E0FA 2CKSA 1KCKA 4V2XA 1QNQA 5HBFA 4PMZA 3GBEA 1U2YA 2XUCA 3OZOA 2RGLA 2A3CA 5M3WA 2WC7A 1KXTA 4MB1A 5DT7A 1ZJBA 2J7DA 5GQBA 1GORA 3BAYA 4AIUA 1MWOA 4ATDA 3EDFA 3WUGA 3OLIA 1WDQA 3VIMA 3ARVA 1XD1A 4MNMA 3NCOA 3AHZA 1B30A 4AD3A 3ARQA 4D6FA 2UY4A 2WANA 3DYMA 1D2KA 5I5RA 3PTKA 3ARUA 1OB0A 2VZVA 4EK7A 1RPKA 2XVPA 3ZQ9A 2VCCA 2VZUA 3ARWA 3WF0A 3GXMA 1CBGA 1HKMA 1E56A 3U5UA 4JFTA 4PBGA 1KGUA 5JIWA 2X0HA 4W88A 5EB8A 5ABGA 4W89A 9CGTA 1I75A 1C3FA 1KXHA 1O7AA 1UYQA 1LL4A 4HOXA 1DWAM 1VFMA 4LYQA 3THDA 1XH2A 2XM2A 1KR1A 2CITA 1P6WA 2CHOA 5IFTA 1AVAA 3N1AA 1XD0A 3AZTA 8CGTA 2DIJA 3WF2A 3TTQA 1NQ6A 2WNWA 5LA1A 1I1XA 1E5JA 3OGRA 5F7UA 1C92A 2XVLA 3EDKA 4J3TA 3I3EA 4IPNB 1V3IA 4KGLA 1EHNA 4GQQA 4BQ2A 1OGSA 4Q7NA 4OBRA 4TX8A 4P7OA 2QPSA 3OLEA 4JFWA 1B3VA 4WSJA 1UQZA 4U2YA 4JFUA 2DIEA 3DHUA 1A3HA 3PBGA 1V6XA 3MKKA 4B16A 1GHSA 3BC9A 3PZ9A 1ISWA 4CCDA 1HKIA 2PWFA 1MW0A 3L4VA 2D22A 3IAQA 2DSWA 3B8SA 3NIYA 3KZSA 2YL9A 2ZX6A 2XG9A 5IFPA 3EMCA 2BNJA 2GDVA 3UR8A 3CUGA 3MANA 1Q6EA 2E4TA 1IZJA 1UD6A 4J3XA 4NF7A 4ZENA 1QPKA 3WUEA 3OIHA 4BA0A 3UESA 3NDZA 1TMQA 4HMEA 4HA4A 1SYTA 1OT2A 4CD7A 5A6BA 1OD0A 3UG5A 1H1NA 1LWHA 3D3AA 2VRKA 4QCEA 1N82A 4M56A 1JAEA 3B9AA 4KMQA 3F5JA 4PN2A 3GNRA 3PZQA 1V02E 1W1TA 5FL1A 3A4WA 2UY5A 1E43A 3K4DA 4BQ4A 4W5ZA 1TR1A 4D6HA 5A6SA 4Y7EA 3WDIA 2PWGA 3ZT5A 4OBSA 2JIEA 3ZR6A 2C0HA 1UR9A 3VMNA 5IHSA 1U30A 1VFOA 3PZMA 5CPTA 1TVPA 3T2QA 1VAHA 1KXVA 4MPKA 1XV8A 1HP5A 1EOKA 2E9MA 3BAKA 3FY1A 1I1WA 2JALA 5CSUA 4JCMA 3VDCA 2ZUSA 2WWCA 3VGDA 2JE8A 1OWQA 4J3UA 1YQ2A 2D3LA 3KL0A 1B0IA 5I79A 2A3EA 3RIKA 1PX8A 2D0GA 3BLPX 2ZXQA 4MB3A 2GK1B 1MW1A 1ESWA 1QI3A 1PIGA 1GNXA 2XIBA 3WY1A 1E6SM 1OCQA 5A6KA 5BRPA 5JBDA 1QW8A 3UETA 3SCTA 1KCLA 2ZX7A 5GNZA 1TA3B 2G3NA 1YHTA 4J28A 1CXKA 1W32A 4MAVA 5D8ZA 5D9MA 3T0BA 3GNPA 1RD6A 3T09A 3VMPA 2QHAA 4CD6A 1W1VA 4MNKA 2C7FA 2GJPA 4MJ2A 1JF5A 4W93A 4R27A 1NWTA 5ECUA 3ZIZA 2ZX5A 2WLYA 5HNNA 3AROA 4F9JA 2J75A 3AIUA 3WH6A 4OZOA 4CUCA 2VMFA 3WFLA 1KR0A 5A6LA 5DT5A 3EBVA 3GH7A 1FH7A 1OIMA 3WQ6A 5EFDA 2VJXA 1BHGA 1M01A 1EGZA 1HT6A 1OT1A 4TVCA 3WF3A 2JF7A 2PF0A 2WVTA 4IISA 1JZ5A 2TAAA 2EPMX 1HP4A 2VQUA 4UQCA 5ABHA 1SMAA 7TAAA 4JKLA 4DUXA 4AZBA 1GJUA 3L2LA 4K68A 3CZLA 3WH7A 1U33A 3WIJA 1UR8A 1CGXA 4AISA 1CGVA 3M46A 2PC8A 2D20A 4X0VA 2EPKX 3SCWA 4D1JA 2J7BA 4D6IA 2O9PA 3VX1A 1MXDA 5E0CA 4ACZA 1TVNA 1XCWA 2W4XA 4AZCB 1J9YA 2OWWA 4DWSC 2JF6A 3WUFA 3UEQA 4RL3A 5I77A 2GK1A 1IV8A 3QHOA 4AEEA 1V6VA 4JZ5A 3WFZA 5CSYA 4X0NA 2YA1A 2E3ZA 5A6AA 5DEZA 1BGAA 4UZUA 3NYDA 1JD7A 3N17A 1C93A 2YOCA 1C8YA 3ZT6A 1UR4A 3OGVA 3UCQA 4PSPA 5E9AA 4GO8A 2CBIA 3PTQA 1A47A 2CYGA 3MSDA 1UWUA 1E70M 2J79A 1V3HA 1BGGA 3BAWA 1E4LA 4U31A 1K9EA 1UA3A 4TVUA 3VGEA 2ZUUA 1CXHA 1HVXA 4AC1X 1C7TA 2EEXA 2ZE0A 1US2A 3W26A 2CXGA 4LQ1A 1VJZA 4JFSA 5C71A 1VRXA 4HMDA 1G0CA 1WZKA 3VKKA 3PZUA 3MMWA 4RE4A 4HU0A 1H5VA 3K4AA 4CN4A 3CZEA 1R85A 1UD2A 2BY0A 2F8QA 1X6LA 4U2ZA 3ZJ7A 1BSIA 3W27A 2WMFA 3DC0A 4LGXA 3L2MA 1QBAA 2X09A 3T0AA 2WKGA 4L4PA 2WHLA 4H04A 3ARRA 4W7VA 4PTMA 1GVYA 4NSBA 4X9YA 4C7GA 4FK9A 3LPGA 1H11A 1Q6GA 2YBUA 2WM0A 3RMEA 3VTRA 1XH1A 2E8ZA 4AXNA 1E4NA 1W9DM 1V3KA 3WDQA 1HJUA 1QI5A 4AIEA 3WQVA 1PX4A 2BY2A 3CUFA 1AQ0A 4GZEA 2CNCA 2OYKA 4D72A 2PB1A 2VCBA 4P7QA 4PYSA 4P8XA 2OWCA 4H41A 5A6JA 1ISYA 3AIWA 1B2YA 2J7EA 4GZJA 1G1YA 3LMYA 2XM1A 2B31A 3AS1A 3WN6A 4AZCA 1UKPA 1H4PA 5I6SA 1Q6CA 4WIWA 1UKSA 1PPIA 3SUTA 3WH8A 3L4ZA 4WK9A 4HP5A 1JD9A 4ZXLA 5A95A 2E9BA 3WEOA 2Q8XA 3SCUA 2HISA 1G01A 5M5DA 5A8MA 1V3MA 4UQAA 1UR1A 4JKMA 1UWTA 4UTFA 1K6AA 3VM5A 4P8VA 2FH8A 3N13A 2XTKA 2F61A 4MNLA 1UH3A 2PI6A 3M7SA 4ZE5A 3W38A 3BMVA 2J62A 4CU8A 3HU7A 1PZ2A 3W81A 2BVTA 4AW7A 5D9OA 1EA9C 2PWHA 2XIIA 2W5FA 4Z2JA 3VNYA 4FLSA 4M82A 3F5KA 5CLTA 4MTVA 1HL8A 1ZBVA 1XRVA 4MDPA 4XX6A 7CGTA 1LG2A 1GCYA 5FIPA 1UKQA 3WQ5A 4P7RA 1EDTA 3RILA 2XJ7A 2WVSA 1JZ8A 2FHBA 2UY2A 1FP8A 1BVNP 1V0MA 1E6RA 2JEQA 1VFFA 3ZSTA 3VD9A 3WELA 4NI3A 4PCTA 2V5CA 2YL8A 2DSKA 4KRTA 5LYRA 3O2LA 2VCAA 2J78A 5BRQA 1RH9A 1WCGA 1BG4A 2DQXA 1L8NA 1JZ3A 4URIA 4DWSB 1OSEA 4WLCA 5CPQA 4PMNA 3WF1A 1BTCA 3WD0A 1ITCA 3ZM8A 1JXKA 1AMYA 3KL3A 1WDPA 1QI4A 6CGTA 3WBEA 3ARXA 4YN5A 4PCSA 5E6ZA 1IZKA 2WXDM 4D6DA 4QLLA 1E72M 1TG7A 1QOXA 2WMKA 1EO7A 4H7VA 5HPOA 1E5NA 2VOTA 4UFLA 2VTFA 3JUGA 4Z2KA 3KWXA 4FLRA 4JL1A 3WF4A 3UR7A 3DYOA 5FOOA 1GPFA 4D6EA 4QCFA 3PZNA 2W91A 3A4AA 3AI0A 2WLZA 2DSVA 3CGTA 3VDAA 1SR0A 1ODUA 1JI1A 1OGBA 1FA2A 2J25A 2PWDA 4GIAA 4AD5A 2UY3A 1CENA 1E1EA 2W92A 3ARZA 5CG0A 1M03A 3AMDA 5EBAA 3BAXA 3WEMA 5FKYA 1BLIA 1DTUA 2E40A 5A8NA 3FXYA 1OD8A 4J7RA 1G94A 2WMJA 3GNOA 1UZ4A 4ZE4A 3II1A 1M53A 3WL0A 1JNEA 3VUPA 1O6IA 3WQWA 1EXPA 4TTGA 2W67A 4OOZA 3WH9A 5I78A 1MQQA 1HJQA 4CN6A 2DH2A 3VOCA 1XCXA 3WNKA 1EDGA 1V6YA 1US3A 3UG3A 1JZ7A 5HOSA 4MAZA 5A6MA 1XSJA 3VIGA 4DUWA 4EAMA 3AXIA 2GJXB 1EO5A 1WO2A 4EKJA 4M8UA 2V3FA 1FH8A 1BYAA 1RP9A 4HZ6A 3AHXA 1XSIA 1JDAA 2ZXAA 2EPNA 1X6NA 1R86A 3ZR5A 2VT0A 4DWSA 5BROA 5KZ6A 1UOKA 2XWEA 5ABFB 1J10A 5GNXA 4B3LA 3VVGA 4HOWA 4W85A 1TUXA 2O9TA 3IAPA 5A2BA 4UQEA 3FHQA 2WC3A 1NWSA 2QLYA 3CTTA 2Y24A 1G5AA 3KEHA 3VU2A 1KFWA 3TONA 4PUDA 3VNZA 1MYRA 3ARSA 4W8AA 1JFHA 3OLDA 3I3DA 3ZJKA 3L4YA 3CHDA 1JF6A 1V3JA 3T0DA 1FH9A 2WMIB 3A3HA 1B3YA 1CZ1A 4PSRA 2EJ1A 1S46A 2ZUVA 5A6BD 1GOIA 1HIZA 3SUSA 5GNYA 3VIJA 1Q4NX 1V3LA 3EMQA 1E73M 4QAWA 5D4YA 1EIBA 2J8FA 1WDRA 3E1F1 3AICA 4AEFA 2XSAA 1NOUA 2WMHA 1HF6A 4PMDA 1WZLA 1CTNA 1WNOA 1QI2A 3CLWA 4ZXOA 3FNDA 1XHGA 4AZ5A 2VR4A 5BXSA 5I24A 1GOQA 4BF7A 3AIQA 1J12A 1V02A 4B9YA 3NJ3A 1NARA 4MB5A 1UKTA 1J18A 1V08A 4CVUA 4RE2A 3L4TA 1DWHM 1WP6A 2O9RA 3ZO9A 1W9XA 2A3BA 4HZ7A 2MANA 2E9LA 1R8LA 1F4AA 1UG6A 1ISZA 2OLHA 2Y8VA 1WB0A 1E0XA 2E8YA 2WBGA 1SMDA 4WSKA 1CGYA 1R7AA 2D2OA 3WNLA 2GJXA 3CHCA 1CEOA 1QNRA 4CN1A 4CGTA 1CIUA 3N18A 1H3GA 3GH4A 3AHYA 2X8RA 3PHAA 4S3JA 3MUZ1 1J0YA 4AY1A 4JAWA 4GPNA 4CU6A 3CH9A 4AD4A 1WDSA 5ABFA 2ESCA 3OLGA 2AAAA 2G41A 4XZWA 1DP0A 4J3VA 4CCEA 3W0KA 1C90A 1GZJA 4ACZB 3G6MA 1V0LA 1DWIM 2VX5A 1CPUA 2OSYA 4U5IA 1R7OA 1UHVA 3D5HA 3TOPA 5D8WA 1J0IA 1EHAA 4W7UA 4EANA 2WWDA 3PZGA 4ATLA 1PX3A 3BSHA 4QLJA 4C7FA 5IXEA 3WDJA 1ZBKA 2A3HA 2YBTA 1VB9A 2WMIA 4W87A 5CJ5A 4W84A 4M24A 4PMVA 3THCA 3VGHA 1FP9A 3WMSA 1K9TA 4P7LA 5CXPA 3L4WA 5CGTA 3IJ9A 3GXDA 1H09A 1Z32X 6TAAA 1SFSA 5LA0A 3FAWA 2DSUA 4AZ6A 1W9UA 2IUZA 3AMGA 3NSNA 3VDHA 1J0KA 1CWYA 3SUVA 3U57A 2GSJA 3WQ4A 4BS0A 2XHYA 3LPPA 1MVYA 4P8WA 2WKLA 3MU7A 2G3MA 1PJ9A 3IANA 4GXPA 2DH3A 2ZUTA 3DECA 3VIHA 1K9FA 4HPHA 3W6LA 3GYCA 2EPLX 1GQKA 3RM9A 4UQBA 4P7NA 4MDOA 1C8XA 2XVNA 3FN9A 3VIOA 2WZIA 2XSBA 5GPRA 1M04A 2YL5A 4AZHA 2CKRA 2ZUNA 2D0FA 3NDYA 4QDMA 3CUHA 1H49A 3S6TA 1GJWA 2XFRA 3CMGA 3W25A 2GJRA 2VC9A 2WCSA 2VVSA 4XUYA 3N11A 7A3HA 5ABEA 3CZKA 3WNNA 3LPOA 3N04A 3A6OA 3RJYA 2VRJA 1KWKA 1HX0A 1E0VA 1VIWA 3T2PA 3PZOA 1FOBA 2W66A 3PZTA 1UD4A 2D0HA 4LPCA 1UKOA 3I3BA 3AYRA 4GQRA 1R87A 1JZ6A 3TTSA 4TX6A 1F4HA 2WCGA 4CCCA 3VGGA 4AD2A 3FAXA 4JFVA 4TTUA 4AZIA 2WCAA 1KXQA 3TTOA 1LF1A 1QNSA 2WHKA 5A3HA 1J0ZA 2D24A 4N42A 4HMCA 2J47A 4YHEA 1X1NA 2XYLA 3AXXA 3SCNA 5CQ1A 3CHFA 1W3LA 1XGZA 5CZKA 2XVGA 1XH0A 2YDQA 2X1IA 1AQHA 4A4AA 2WPGA 1BYBA 4FMVA 4GKLA 3RM4A 1HKKA 3U5YA 4PMXA 4PTXA 4BQ3A 3BMWA 1BPLB 1VEPA 1BYCA 2BVDA 3AS0A 1CNVA 2VZOA 1MQPA 2YL6A 3IJ7A 4JKKA 2C8NA 1OGGA 4PRWA 1XSKA 2QPUA 3A47A 4UQ9A 2Y4SA 4V28A 5EMYA 3F5LA 5M17A 3N12A 3EDDA 2ZXDA 4UOQA 2CEQA 4JCLA 2BHYA 3CZGA 3PZIA 2WZHA 4PMRA 4B15A 4TOQA 1ZU8A 1FFRA 4D1IA 5C8BB 5JBEA 4ACYA 1NOFA 1W2VA 3CMJA 4FLQA 2WSKA 4LX4A 5A8PA 3PN8A 2QV4A 1QI0A 2O92A 1VFUA 2ZWYA 3SCRA 3AFBA 5BCAA 5FCZA 3AZSA 5IDIA 2XWDA 5A2CA 3O9NA 1CYGA 2WC4A 1HKJA 2F2HA 2VVNA 4TXEA 1HL9A 1ZL1A 3MUIA 3BCFA 2YDSA 1PEZA 2D3NA 1CLXA 1CXEA 3MMUA 4B9ZA 3VGBA 4CVWA 4WF7A 1W3JA 1Y7VA 3WD4A 1JZ2A 4D71A 4AZ7A 3WD2A 1UD8A 2V3DA 3BCDA 4AYSA 1DWJM 5DFAA 2X2YA 2XVKA 4XB3A 5DMYA 5HXMA 2WSPA 4Z2IA 1BYDA 1KB3A 3BAIA 2VQTA 4F8XA 3QHMA 3ZSSA 3WD3A 4NRRA 3WENA 3K1DA 4OIFA 4JL2A 1LLOA 3SURA 5CPSA 3MUY1 4WKHA 4MB4A 4AWEA 3T08A 4WKAA 5BXPA 4OUEA 1ZBCA 4CU7A 1CGWA 3MSGA 3AMLA 1UWSA 3AMCA 3AMKA 4GI8A 4TUFA 1Q6FA 4S3KA 4GINA 3K8LA 1J0HA 4FF5A 4QP0A 1EQCA 1E3ZA 2O9OA 3EDEA 1W9VA 1WKYA 1UUQA 3VIIA 2JEPA 2GVYA 2HVMA 5A8QA 3RPMA 4MJ4A 1KQZA 1H41A 2CIPA 3MV01 3WNOA 4CD5A 2D1ZA 2VO5A 3WH5A 3CO4A 4HTYA 1CDGA 2YLLA 1B3ZA 1XYFA 3WUBA 3AZRA 3VO0A 1NH6A 3AJ7A 4N0RA 1JNDA 1W1YA 3ZJ6A 3K8KA 2WBKA 3ZMRA 4UR9A 1QNOA 1DWFM 1FFQA 3S2CA 2ZICA 2VI0A 3VD7A 5LA2A 1MFUA 4C7DA 1FHLA 3VDBA 4AD0A 2PBGA 1JL8A 5BYWA 2V5DA 3WKZA 1V0KA 2V38A 4PEEA 1GOMA 2WVVB 1B1YA 1KGXA 2OSWA 1UR0A 2XPKA 1D7FA 3MO4A 6A3HA 4GI9A 3GBDA 1EDQA 3K46A 2BHUA 4DM1A 4UOZA 1HJWA 3QR3A 2WYSA 3AHVA 5TD4A 2NT1A 3VILA 4D6GA 4V27A 4AMCA 1E40A 3HJEA 2ZUWA 1E1FA 3BGAA 3U7BA 3VX0A 2CESA 1MW3A 2WK2A 2BVYA 1ZS2A 1PBGA 3IJ8A 4YHGA 2G3IA 1QHPA 4Z2LA 5BXTA 1JYNA 3WSUA 4PUEA 1KQYA 2G4FA 3SIMA 3RM8A 4E4PA 1EOMA 1QHZA 2VX4A 4DWSD 3ARPA 3GH5A 1E55A 4HZ8A 3HMCA 3TA9A 2J74A 3TP4A 1JAKA 2NT0A 1LL6A 3BLKA 3BH4A 1E0WA 3OGSA 4H8UA 1JYXA 2FHCA 2ZIDA 3K8MA 3VIKA 4DUVA 1CXIA 3NUKA 1QW9A 2FGZA 1HXJA 4UFKA 2CCRA 4OKDA 4AIOA 3OB8A 4LXFA 1E71M 3O6AA 1UD3A 1ZBWA 1UZ1A 2YA0A 3SUUA 4E2OA 1DHKA 2CBJA 2ZOXA 4J3WA 1CGTA 3WQ8A 3WEZA 3SUWA 3POHA 3GDBA 2ZX8A 3VD3A 5AC4A 4F79A 3AQUA 3U7VA 4Z2GA 4XZBA 5DO8A 5A8OA 3W53A 3OG2A 1WZMA 1NP2A 1MFVA 2WVVA 3UG4A 3N15A 1JDCA 5BWFA 4QFUA 4UCFA 2WZEA 2QMJA 4UNIA 1E9LA 3MMDA 3VIFA 1ISVA 3AOFA 1B31A 1BVZA 4PTVA 1OIFA 2FGLA 5A94A 1E6NA 1QVBA 2JFEX 3AIBA 3EMZA 5IHRA 2CHNA 3DYPA 2DDXA 3CHEA 4UFIA 3RJXA 2J77A 4PMUA 2XFFA 3CZ8A 5E6YA 4E8DA 4HA1A 4CKQA 1EQPA 3B9DA 1B9ZA 2X0YA 3SCPA 1CECA 3WDPP 3M6DA 1UR2A 4Z2HA 2WMGA 2YKKA 5E70A 3W29A 1NM9A 1NP0A 2WB5A 4H8VA 5FL0A 2W62A 3KE0A 2NW0A 2Y8KA 3AS2A 1UD5A 3RCNA 3CUIA 3QHNA 1PZ3A 4UQDA 2YA2A 3VPLA 2G8ZA 2DT2A 1TFVA 1TZ7A 3NSXA 1NOWA 2BV9A 3VM7A 3W37A 4U3CA 2VZTA 2J4GA 3ARYA 1VEOA 3IK2A 1W2PA 1UWRA 4PMOA 3N9KA 3WNPA 2J7HA 1H2JA 1JYVA 3HN3A 2EPOA 3AS3A 3VMOA 5CGMA 2XGIA 4KH2A 1JZ4A 2IXUA 1RP8A 4HPGA 2RGMA 3OA5A 1JIBA 5M03A 3GXFA 1TE1A 1G9HA 3VD5A 4BQ5A 1B3WA 2VX6A 3SCSA 1HVQA 1W1PA 2VR5A 3BXWA 5KEZA 3POCA 4NZCA 2BY1A 1UQYA 3A4XA 3W28A 1JGIA 4LYRA 1J11A 1E6PA 1ZJAA 1E6ZA 3EYPA 4IUGA 1OM0A 2WHMA 4MADA 3WD1A 3T2OA 1D3CA 3SCQA 5D9NA 2J7GA 2PWEA 5D9PA 4J27A 1OBAA 2E0PA 3AXHA 2UWFA 3APGA 4UOJA 1C7SA 2VUYA 4ML4A 4HA3A 3ARTA 1LG1A 1KGWA 2BXZA 3L4XA 3W82A 4QLKA 4JIEA 1BG9A 3W24A 3L4UA 1GQIA 1V6WA 2DT1A 1JFXA 2Z1KA 1GQLA 4GI6A 1W3HA 4A3YA 1LQ0A 3PTMA 2DPEA 1KWGA 4E8CA 2VNCA 3F4VA 4JHZA 4BZYA 4FLOA 1UH4A 4EE9A 5AY7A 4ZEPA 1B90A 3OBAA 8A3HA 2PBOA 5EFFA 3CUJA 3BAJA 2DGAA 3SCVA 5BXRA 1CLVA 1GQJA 1XYZA 3LPFA 3W6MA 1BQCA 1XC6A 4AD1A 3KL5A 1HN1A 1W3KA 1DWGM 3VD4A 1E4IA 2DT3A 2AMGA 1ODZA 2OYLA 1Q6DA 2V3EA 3AISA 1GOOA 3QOMA 4PTWA 4U5KA 1W9BM 1HNYA 3UERA 1QBBA 5AYBA 2VX7A 4WJXA 3FHAA 1GONA 4M81A 1J01A 2BY3A 3PZVA 3ZJ8A 2IXVA 4RE3A 4R5EA 2J7FA 1H0IA 5I23A 3EDJA 2NSXA 2X05A 2BFGA 2CBUA 2BHZA
chains in the Genus database with same CATH superfamily
3NGJA 3W7JA 4RDVA 5I3IA 3IRSA 3CH0A 5G2IA 1JG9A 1WE5A 1VF8A 2QUNA 4PB4A 5DMNA 4I9TA 4GBDA 3EKLA 1VFLA 3VXGA 4PA8A 1KTBA 3D46A 4W8LA 3CUZA 3E12A 2CLKA 2NVAA 2QF8A 4XD3A 4LUJA 1S39A 4CQ8A 4O0KA 2OOFA 1BF6A 4GA8A 3WJWA 1L6GA 5FSEC 1X8CA 3H24A 1L2QA 2G97A 2O7SA 1JI2A 2CBVA 3DXIA 2BZNA 1QCWA 2OKTA 3QQ0A 3H70A 3W1XA 1E15A 1J93A 1FCBA 4IQDA 5AC5A 4JEQA 2V3GA 3RGTA 1QMLA 1A5CA 2QJMA 1HJXA 5LXEA 1IEIA 2GUYA 2FTPA 3LXCA 1GK8A 5G4HC 1BF2A 4JTRA 5BOEA 2DSZA 1IQ8A 3NQGA 1SJDA 1M3UA 4UTWC 4HNTA 2CLEA 5LIYX 2VEMA 4JIRA 2FVMA 3NDOA 5LXXA 2YCEA 3LB0A 1CXLA 1A3XA 1Z69A 3AIVA 3IV3A 3W4RA 3QOKA 5I2UA 4Q22A 3NM3A 3AYSA 1VRDA 1E4MM 1RCQA 4JHOA 3CZJA 5D2YA 4XZMX 3W7IA 4DZ5A 3UJEA 1Z7AA 4UFHA 4DJDA 3TTYA 4L1GA 4GG9A 1DORA 4RZBA 2EQDA 1VS1A 5LNVA 4B3KA 3TQ0A 4X22A 2PDXA 5EMUA 2JQXA 1GW1A 4PRRA 3RUBL 3MUAA 2P1FA 2DZUA 4NAFA 2YLAA 5HWJA 3WBXA 1GOWA 1C8QA 2I56A 3WMBA 4OQVA 2Z1SA 4WKFA 2XN1A 3CL6A 1KNWA 4IFKB 3H6OA 4JX5A 4H8HA 1REQB 2ZXBA 2GLKA 1LJYA 4ZR8A 4M6UA 1T8XA 1QHOA 4PR4A 3VINA 1K9DA 1Z3NA 3HFTA 3ZT7A 4E8GA 1NDWA 4DPPA 4O19A 4MKVA 4EVZA 4JR5A 3GZAA 4DNMA 4BCEA 4IT1A 2CFFA 4QJ1A 3SQSA 3W87A 1UWIA 1B3XA 3U2CA 5BW6A 1LWJA 3K4WA 3LHWA 3GVVA 4AB4A 1ITQA 3UWEA 1SO3A 3LTPA 3S2MA 2DORA 4KGJA 5E0FA 1ZY9A 1K8XA 4V2XA 1QNQA 3GBEA 2HK0A 1YDVA 3O63A 3H7RA 3QV9A 3FK4A 2QCCA 3B8TA 2J7DA 4RLIA 3TR2A 3BAYA 4AIUA 4MMWA 1VKFA 2ZZ6A 1XLBA 3VIMA 4JGDA 4XSLA 3BOLA 2WSRA 3GAKA 3ITCA 4D6FA 1I2OA 3DYMA 1D2KA 3KUMA 1JUBA 3PJWA 3W88A 3ARUA 1OB0A 3REQA 2VZVA 4EK7A 4N2YA 2VCCA 3LS9A 3EKGA 3GHSA 3LRMA 1KGUA 3DFTA 1QDSA 2X0HA 4GABA 3GNNA 3BUVA 3H2CA 2C3ZA 1N7KA 2HXUA 3NXLA 1RVGA 3VZXA 5DY2A 3AU6A 4ZO9A 4NILA 1UC4A 1HZYA 1XIIA 5HINA 3THDA 3CJPA 4LF1A 2CITA 1POKA 3R13A 1P6WA 2CHOA 2YYTA 3RU8X 4YVPA 2HV5A 2PCQA 2XH7A 8CGTA 5HR7A 5LA1A 1NQ6A 1JCXA 3C0SA 2PLMA 1XIBA 1E5JA 1FDZA 2X41A 3EDKA 5I06A 5K9DA 3S6DA 1DIEA 4GQQA 4RV8A 3WLTA 1OGSA 3IARA 4GI4A 2QPSA 2GOUA 4LYKA 4JFUA 4Q8VA 5AYZA 3K13A 3CT2A 1KA9F 2NLYA 2V5JA 3NO3A 2ZCGA 4V1YA 3MKKA 5LNSA 1I6NA 3UPWA 1XYLA 1HKIA 1MW0A 2D22A 2Y7EA 1OYCA 3NIYA 3DKJA 4BEUA 4PCPA 3DFSA 3RO6A 1PZ1A 2BNJA 1Q45A 3CUGA 4IMAA 4FPSA 3WUEA 3I6EA 4QEEA 4AVNA 4OECA 2G95A 3LCIA 1OT2A 4AF0A 1OD0A 2VRKA 1O4UA 4GVIA 1RBAA 1V79A 3C6CA 3GNRA 5FL1A 4H7ZA 4BQ4A 2PRMA 6XIAA 3G1YA 5KINA 4ZQMA 2ZC1A 1UR3M 4OBSA 2JIEA 3ZT5A 3VMNA 4LSBA 1QJWA 3UYIA 3T2QA 2P50A 3QM3A 4MPKA 1DJIA 4ORMA 3BAKA 1I1WA 5CSUA 5D03A 3VDCA 4XQ6A 4JPGA 2JE8A 3SM0A 3UJ2A 4GJIA 1V77A 1TPH1 3BARA 5CEWA 1MSSA 1VLIA 1XPYA 3PBUA 2NUWA 2GK1B 1SZNA 1MI3A 3WLKX 1E6SM 3P3BA 1G7UA 5A6KA 1IE7C 3UETA 3M0IA 3URAA 1KCLA 4Q8QA 2GOKA 4GIEA 4GUHA 2R82A 4D8LA 1CX9A 1CXKA 1W32A 1KTCA 5XINA 5D33A 2R24A 1F74A 3H23A 3A5VA 1JF5A 3W83A 4EPBC 1US0A 2ZTJA 1YXDA 5HNNA 1N8WA 2J75A 1OYBA 3GH7A 5BWAA 4K2SA 1WDDA 1OIMA 3JS3A 3MYOA 3MI3A 3L0NA 2INZA 1BHGA 1HUVA 1YPIA 1EGZA 5F2IA 4H9YA 1TVLA 1UZHA 2PF0A 2WVTA 4IISA 4ZFCA 5T9CE 3Q45A 2WV8A 1HP4A 3FSTA 1A80A 3NNTA 3W71A 1OC5A 4AZBA 5G2WA 3WH7A 1U33A 3WIJA 2LLEA 1X7IA 4E2DA 3T4CA 3B9OA 2Y6ZA 3GVWA 3QSRA 1YE4A 1XLGA 2Z25A 4HKPA 3NXFA 4O17A 1RLCL 4EXAA 1M9HA 3SGUA 4A29A 2J7BA 3GAYA 2X1TA 3M4HA 1MXDA 5KTLA 1GT8A 3GTHA 3N2OA 2PGRA 4BY3A 4US6A 2P8BA 4KW2A 5I77A 5JU6A 4DZIA 1IV8A 4H9ZA 4AEEA 1UPPA 4JZ5A 4WX2A 3AC0A 4IIEA 4X0NA 4DAFA 4UZUA 3N17A 1KM2A 1W3TA 2PA6A 2GVLA 3UCQA 1PVNA 4PTNA 4PB5A 4GO8A 2VGIA 3PTQA 1OX6A 1UWUA 2OZ3A 2J79A 1V3HA 4HYWA 3B9NA 4U31A 4LVGA 1OFRA 1EYWA 3W70A 3NVDA 4GLEA 4YVXA 3ONBA 2D2JA 3VAVA 2EEXA 1E1CA 4PUMA 2PGEA 3RLGA 4HMDA 3TQPA 1SSDA 3UR5A 3VKKA 2VYOA 3LCFA 4P5UA 2VDIA 4CN4A 5HULA 2F8QA 2BY0A 1G4SA 3DC0A 4A05A 4PC8A 1ITUA 3LBCA 2WKGA 4L4PA 2WHLA 5K9CA 3ARRA 4PFMA 1GVYA 2ZBTA 1FTXA 4X9YA 5CSRA 4KPLA 4FK9A 3CL7A 1H11A 1W31A 2QGYA 4IMFA 3RMEA 1F2JA 3S8HA 4AXNA 1W9DM 3UBPC 4BI7A 1KC7A 3VKJA 1XKJA 1TPFA 1EGVA 4DJDD 1FWSA 4MY1A 4D72A 3I6TA 2PB1A 4PYSA 1ZGDA 3VI2A 1ISYA 1EEXA 2DUAA 3AIWA 4GCXA 2J7EA 3H26A 4GZJA 1TPEA 3M0JA 4C6IA 3WN6A 1SU5A 3E96A 3LTYA 1L9WA 2NVCA 3A9IA 3PPGA 4UC5A 2ABAA 2QCGA 1TO3A 4ZXLA 3GDRA 3WEOA 2PWUA 2HISA 5CJNA 5M5DA 1LDCA 1V3MA 3B04A 4IIFA 3KWSA 3F2DA 3S83A 3N13A 4FXJA 2F61A 2PP3A 1RR2A 3M7SA 3W1UA 7PTDA 2NX1A 3MQTA 4CU8A 1O5XA 2V5LA 2WZTA 3HU7A 3TE9A 3H53A 5D9OA 3PWIA 3W7RA 3D0CA 4M82A 3EPNA 1HL8A 1ZBVA 4MTVA 1GZ1A 4LV4A 1G4TA 2OEMA 1EJVC 5I3FA 4H9TA 3TLQA 5AC6A 3VD9A 3TDFA 1NFBA 4B90A 4PCTA 2Z2UA 2QW5A 4KRTA 3DGBA 4DZAA 4FXRA 2QZRA 4S3CA 2VCAA 3MSRA 4NNBA 3CB3A 2Y61A 1BG4A 4YXGA 1AZ2A 5H91A 1GKPA 4A8IA 4C1LA 3I10A 4LC6A 1JXKA 2VGGA 4L6HA 1RZMA 3MI2A 4HMNA 4BF9A 3FS2A 2XISA 5K4XA 4I8DA 4I7UA 3SN0A 2V2CA 3LRLA 4H7VA 1EO7A 3LOTA 2VOTA 5JH2A 3OOQA 2C1GA 4Z2KA 4FLRA 5FOOA 1GPFA 4D6EA 4FF7A 4AX6A 1TV5A 1RALA 2A7PA 2DSVA 3VDAA 1ODUA 1JI1A 4O8AA 4LT9A 4EPEC 5DXYA 3SECA 4CNNA 3IVSA 3L67A 4QG8A 1R3RA 1OVDA 3WQEA 3WEMA 1U22A 1DTUA 3LXBA 4J7RA 5F1VA 3ZXWA 4NHVA 2VFFA 1TTJA 4HCDA 3W7PA 3SY5A 4JTUA 3FX4A 1FWWA 4F40A 1EBHA 2J66A 1QFEA 1VPQA 3QR1A 3WH9A 3HURA 2CZFA 1FUYA 6TIMA 5D2WA 1OFEA 3UG3A 1JZ7A 4MAZA 3GU1A 3R94A 4ORIA 4O0ZA 1J6OA 1K7XA 1RQHA 4R88A 4KWVA 1KTNA 1KRBC 3GHRA 4S3AA 3O0FA 1S38A 4HZ6A 3GUWA 4LV9A 3ITVA 5CGQA 1X6NA 4GK8A 1R86A 4DWSA 5ABFB 1UUOA 2YB4A 2BOGX 1DJGA 3NQ6A 3VVGA 4HOWA 5BZAA 4W85A 1F6PA 1RXOB 4ZBCA 2O9TA 5A2BA 3R8HA 4XBSA 2DJXA 1E9IA 4LUSA 1QK0A 4F2UA 1XXXA 3TONA 3M0LA 2A2IA 1MYRA 3P7YA 3OLDA 3BJTA 3W74A 4RDWA 1FH9A 3A3HA 3OQ8A 4FHAA 4IPPA 4EIVA 1GOIA 3VIJA 5CZTA 1DV7A 4ASTA 4RW3A 1Z41A 1TJ0A 1BKHA 3E1F1 3AICA 1KM1A 2BP1A 1WNOA 1QI2A 3AAMA 4AVFA 1A5UA 4ZXOA 4N6EA 4KIEA 2A3LA 5I24A 1GOQA 4QE4A 1XLDA 3AIQA 4PGLA 4TMCA 2E6FA 4AWTA 4MB5A 3V5CA 4LVDA 4HK5A 3MCNA 2D73A 3P84A 3HPXA 2E9LA 1R8LA 1F4AA 4Q8TA 2OLHA 2Y8VA 1T8QA 1E0XA 1VFTA 3M0YA 3B8IA 1IHIA 4XSMA 4CCZA 1R7AA 3ITLA 2QCEA 2R1NA 3CHCA 1DJZA 4B2DA 3W02A 1RPXA 3N18A 1F6KA 1H3GA 4S3JA 1IZCA 1CB7B 1J0YA 2I9EA 2KX9A 4M6QA 5K9XA 4AD4A 1WDSA 3OLGA 2AAAA 2GJLA 3WK1A 5LIKX 1QWKA 4G1KA 4ACZB 4FB7A 1DOSA 3UT0A 3F7JA 1XPGA 3E2QA 3KOYA 3D5HA 3TOPA 4LAMA 5D8WA 1EHAA 1YXCA 3W72A 5HNRA 1J96A 3W7LA 3BSHA 4QLJA 3S42A 3ABRA 4FR6A 4C7FA 2WMIA 4PE8A 4M24A 4PMVA 3IUIA 3WMSA 1K9TA 3MUXA 3UZYA 4P7LA 1KM4A 3LUTA 5CXPA 3PS7A 8RUCA 4JTEA 2DSUA 3NA8A 4XZ9A 1X1OA 4WDXA 5BMXA 4AZ6A 1W9UA 3W1RA 3UYCA 3RK8A 4P8WA 2NXIA 2WKLA 2G3MA 4JTDA 4AWUA 3S9YA 1PJ9A 3B4UA 3APYA 3IANA 3TYAA 2Q3RA 3ANVA 3GC5A 4RPQA 2RAGA 4HPHA 3W6LA 2PAJA 3GYCA 3WLIA 2QIWA 3RM9A 4UQBA 4MDOA 2XVNA 3R10A 1CCWB 2Z1XA 5FEZA 4PEKA 2XSBA 1M04A 2YL5A 3CQKA 5I7GA 2CKRA 2ZUNA 2D0FA 4QDMA 4NAEA 1H49A 1S5NA 4R85A 5HMDA 3ZLGA 2VVSA 2QDHA 3KCJA 1G4EA 1GYLA 1ZQ5A 3WNNA 5DCDA 3RJYA 4PBFA 3TW6A 5H8UA 1OJXA 3U0HA 4JQ3A 4IXXA 1VIWA 5KZEA 5DCBA 2E6DA 3PZOA 3HQOA 3EEZA 3GR7A 1UD4A 3S5SA 4LPCA 1LRNA 1JDFA 4FA3A 1LOSA 2FFIA 3TAKA 2YXOA 2VEGA 3FA5A 1F4HA 3VGGA 4GVHA 3OJGA 1IT8A 4KKXA 1G69A 2WHKA 1XDJA 1PKNA 5A3HA 4AWSA 1J0ZA 3S3GA 3W7EA 4N42A 4YHEA 1X1NA 3AXXA 4LY4A 5CZKA 1XDLA 4TU1A 5GJNA 3F4CA 3FV9A 2FTYA 3G3MA 2X1IA 1S2WA 4FOKA 4HT3A 5TF0A 4FMVA 4XZIA 4BQ3A 2BX7A 1BYCA 2BVDA 8XIMA 3KP1A 3V18A 4ZA0A 2VZOA 4JKKA 2EGZA 3E02A 1OGGA 2QPUA 3U2ZA 3TCSA 4BF5A 4JTKA 4GIYA 3GVGA 5EMYA 4GY1A 1JRBA 3VA8A 5FA5A 4FR1A 5M17A 5K4ZA 4A8LA 3N12A 4HVXA 3U3HA 1J4EA 2ZXDA 2CEQA 3C61A 3KRZA 1UBPC 3UJFA 1Q6QA 3TYEA 3EX3A 3NURA 2BTMA 4GGBA 4Z0JA 3N9RA 1XBZA 1NOFA 3CMJA 4ZB2A 4FLQA 4LS0A 5G2HA 4JIQA 2C1IA 4CEXC 3ABXA 1OF8A 1VFUA 4OHQA 3SCRA 5BCAA 1VIZA 5HWNA 4C6MA 2PZNA 2IPGA 3I4EA 5HMEA 2VC6A 2VVNA 1QO2A 3H54A 1DQWA 1TPVA 4OE7A 3DI0A 2D3NA 4Y6GA 2Q01A 3BG9A 3V0SA 3VGBA 1JCLA 2JKPA 3CQHA 1FWDC 4HNUA 3WG6A 1W3JA 3WD4A 1JZ2A 2C6QA 1SFJA 1ZAIA 4LBRA 1EC7A 4AZ7A 2JKEA 1Q6RA 1UD8A 2V3DA 2EAWA 3DERA 4HHLA 5HXMA 4Z2IA 1GVEA 2PFHA 2WSQA 5HWMA 3TJ4A 3VKBA 4C1NB 2CC0A 2ZDRA 3OVPA 4JL2A 4QEHA 1I9CB 3MUY1 3B0YA 1S5MA 4AWEA 2NUXA 2RUSA 4WKAA 1A5OC 2XIMA 4ZL1A 4CU7A 1MMFA 1CGWA 1RK6A 3AMCA 2Y0FA 4HIBA 4C1KA 1GKRA 4QP0A 3O3RA 1PYMA 3W85A 4IJBA 1E3ZA 4ZOAA 2QULA 3FGCB 3OU8A 3T07A 1UUQA 3VIIA 2GVYA 4MWAA 5D09A 1IIHA 4JNZA 3KS5A 3RPMA 3RR1A 2BOFX 2ACQA 4MJ4A 1KQZA 3KBNA 3QMRA 2D1ZA 2VO5A 3O6DA 1VCFA 4HTYA 3VC5A 4HYVA 1OK6A 2H3DA 5AHMA 4YL2A 4IP4A 3KBWA 1W1YA 3W1MA 4BJHA 3S2CA 3KTXA 2ZICA 3VD7A 1O66A 1QOQA 4E3TA 1FHLA 4KCUA 2G37A 5BYWA 3PNZA 3UXAA 1V0KA 3TR9A 1XI3A 3C5QA 3QQ1A 1MEWA 3ZLHA 1UP2A 1BXCA 2YCJA 1TQXA 4ENLA 3H21A 9RUBA 5KMYA 1D7FA 1LP6A 5I09A 3GBDA 2J6XA 3TEVA 3QR3A 3AHVA 3UU0A 1WXZA 2OT0A 1E40A 3OYZA 5FF3A 4HPNA 5XIAA 2ZUWA 2Y89A 3BGAA 3VX0A 2CESA 3KCLA 5EGRA 4Y9NA 2J9ZA 1JYNA 2FQIA 3ATZA 2F9RA 2G4FA 4JX6A 4DUOA 4DAIA 1BXNA 1EOMA 4DWSD 5KZMA 3LEPA 3ARPA 3ES7A 4YTRA 3GH5A 1DJHA 1E55A 1OZMA 2YR1A 3TA9A 2Y7FA 3DDMA 2DZAA 1E0WA 3W7NA 2ZIDA 4YNGA 5LIUX 1QATA 2FZNA 2XGZA 1N55A 4X60A 3PUOA 2FVLA 1E71M 1ZBWA 2ZOXA 4WY0F 3NL6A 4J3WA 1TIWA 4GYPA 4HJWA 4ZB5A 3WQ8A 4BKNA 5AHLA 3G1HA 3IGSA 3RR4A 2ZX8A 2V5KA 3C2EA 2P3ZA 3LGDA 5AC4A 4L56A 1EX1A 4Z2GA 5BMWA 4XZBA 5A5WA 5DO8A 3QVQA 1K4GA 1UB3A 3OG2A 1WZMA 2PURA 2C71A 4DO4A 4F48A 4C5ZA 4ZZ9A 1YBQA 5BWFA 1TWDA 3T40A 2WZEA 3NPXA 4QR6A 1F3TA 4UNIA 5I3KA 4O50A 2ACUA 4M1BA 3MMDA 3AOFA 1S1RA 1B31A 1XIFA 4H6RA 1OIFA 3RN6A 5A94A 3NQEA 3O07A 3M41A 3BJFA 1CLKA 2W6RA 3O16A 1O1HA 1R3SA 1E9ZB 2DDXA 5CSSA 5C2CA 2ACSA 2J24A 3UNTA 1DJQA 1T5AA 4X63A 1J6PA 3CZ8A 3GRIA 3FEQA 4CKQA 4ALDA 3N3MA 3UVAA 3BW2A 4GOAA 1EIXA 2PTYA 3NL3A 3AWNA 4QG6A 3HTWA 3PTDA 1NM9A 2DZXA 3N2TA 5FL0A 3KE0A 4WGHA 1FWNA 1O1ZA 4DJFA 1Q66A 3CUIA 3QHNA 4UQDA 1NFPA 1MXSA 4C6BA 3TZNA 2DT2A 1TZ7A 3DKLA 1IXPA 4U3CA 3BLFA 1HKVA 1KRAC 2VZTA 3ARYA 4H8NA 1PDZA 2E6AA 2PP0A 4FI4A 3VMOA 1JZ4A 3N6HA 4EXQA 1RP8A 2IPJA 4HPGA 3OA5A 2PDCA 1JIBA 4TMBA 1FKXA 4O28A 1B3WA 4XTDA 2VX6A 3SCSA 4QNWA 4DXVA 2VR5A 3C8NA 2DUXA 4AX7A 3TXZA 4PL1A 4KEMA 2QQ6A 2VM8A 7XIMA 1ZJAA 1E6ZA 4IUGA 1D3GA 3B4YA 4MPQA 3WD1A 1UCWA 1D3CA 3O6CA 3P74A 3KRUA 2Y5JA 5D9NA 4J27A 3JU2A 1WYIA 3VCRA 1UC5A 1Q8JA 3DH7A 4ML4A 3ENLA 4HA3A 3ARTA 1LG1A 1KGWA 2GQ8A 1UBSA 2ZC8A 3PJXA 3W24A 4IJCA 2QF7A 2QR6A 2Z1KA 4GI6A 1W3HA 1Q3NA 3EXRA 3LCXA 1B4KA 1FWBC 1JEZA 2DPEA 3IGHX 1I45A 4GXMA 4E8CA 3F4VA 2ABBA 4FLOA 2VR2A 3M0ZA 2I5IA 2DGAA 3SCVA 3TFXA 1Q7QA 1CLVA 1KKRA 3BLOA 1KM0A 2Y63A 1BQCA 5FJIA 3G1DA 2RJHA 2HWGA 2ZVIA 3IGXA 1E4IA 4LEQA 2ZYFA 4HCLA 4C6DA 1TJ1A 2OYLA 3W75A 5T8GA 4N9BA 2A6LA 4PTWA 1IIGA 3S46A 4IMGA 4D9PA 3RX4A 4HHHA 3ONCA 1AH4A 1QBBA 3MZNA 5AYBA 4G1NA 3R89A 4M81A 4Q33A 3KOZA 3W9ZA 4RPPA 1J01A 3PANA 4HA0A 4R5EA 3G1RA 1P5BA 4IF2A 2CBUA 2BHZA 3R25A 3LRKA 1M7JA 1VJSA 5BOFA 4HK6A 3LGEA 2GWGA 4QS5A 1M7XA 4ATWA 1V6UA 2CETA 2EO7A 5FJRA 1NF7A 3RLHA 4OVXA 3LV6A 3GXIA 3USBA 3UZ5A 2YZRA 4XG1A 4MZ8A 2ZWZA 3ERPA 1HJVA 2ZKMX 4O11A 5CC5A 3B03A 1S2CA 4NAFB 3SO7A 3NZQA 2PLJA 3DAQA 4YPJA 4I7VA 5FAGA 3N2CA 3H2MA 1EH9A 1WBHA 1Z9AA 3UJRA 4LAOA 3CASA 3DU0A 1BFNA 1IT0A 4H2CA 4IIGA 2EXOA 1HTIA 3NZRA 5LKYA 1OINA 2WAGA 1XLCA 3RRAA 2AL2B 1VBUA 3URBA 2X7WA 1JUKA 4LS1A 3PY2A 3W23A 3QR0A 3BSMA 4IPJA 1C9WA 3UWVA 3S5ZA 2I17A 3VFLA 2ZUMA 4J3SA 2EF9A 3H8AA 1JPDX 3PWGA 3M07A 1ZB5A 3BQ5A 2H8ZA 3KCOA 2FHFA 4BWLA 2OU4A 2YGYA 1M5WA 1YTKA 1DQXA 1W9PA 4Q4RA 2FDMA 5JBFA 1SR9A 1TRIA 2EBNA 3VGFA 4MWAD 5C70A 1R3WA 2WO5A 4U33A 1KFBA 4UZSA 1XG4A 3KDOA 3MS8A 1EJSC 1BAGA 4IL0A 5HNTA 1W54A 4P8UA 1LRQA 1IXNA 4C90A 1FWHC 5EBUA 4ZO6A 3STPA 1VEMA 2YIHA 3IUHA 1GYMA 1PDYA 1O94A 1NY1A 3NTYA 3M9YA 2VGFA 4KERA 2CPUA 3LN3A 3REQB 2RDTA 5A1AA 4YYFA 4UFMA 3B05A 4ADSA 2POZA 3HJZA 3AHTA 1B5TA 1WPCA 3VNLA 1BQGA 1GEHA 4U3AA 2X16A 2XGBA 4KEVA 3CTLA 5HK4A 2IKJA 2V0TA 4MFEA 4CQ9A 5MKGA 3C2VA 1GHRA 1W91A 3ALFA 3RHGA 3H2OA 2OX1A 3N9SA 4QAIA 2W63A 3HFYA 1X6UA 2GDUA 2VURA 3AIRA 1UWQA 4DYEA 1WXYA 1FHDA 5AHIA 1UJQA 2YDRA 1KBJA 1CXFA 3F4DA 4MF4A 2QUTA 3B8WA 2W61A 4GFIA 1OADA 3IJIA 3GTNA 2VRQA 2QKFA 2OSXA 1MDLA 5K2ZA 1O5RA 1PE1A 4QNEA 3J7HA 1GQNA 2QCMA 3JVAA 3WJXA 1JYWA 3LM7A 3PB0A 1RLDA 4FIQA 1FWAC 4XBJA 2HBVA 1XLEA 1E0UA 4NP7A 4HPXA 3E74A 4YTSA 2BGSA 3OZOA 2A3CA 3E3HA 2YW4A 1KRMA 2C15A 2X1SA 3W76A 3PAJA 2HVNA 4NVTA 4DJEA 4ZQPA 4ATDA 4DLFA 3EDFA 4K7VA 3OLIA 3T8LA 3EX4A 3O6YX 1XISA 3UZXA 3W2JA 3E5PA 1K8CA 3DGRA 4MNMA 3G1SA 1XC4A 3AHZA 3NCOA 3ARQA 1J5TA 1XM3A 5I5RA 1SJBA 3W1AA 1XIMA 3GG8A 4WY0A 4AF0B 1O5QA 4RNIA 3ZQ9A 2VZUA 3ARWA 3Q65A 2E5BA 4RZ4A 1TMHA 1E56A 4JNYA 4PBGA 1WXJA 4EPDC 5EB8A 1EB3A 4GYFA 3MB9A 3L0GA 2BODX 3WJZA 3TFCA 1KXHA 4N7QA 3WLSA 1UYQA 6XIMA 2Z0IA 1QT1A 2PU1A 4HOXA 3B06A 1DWAM 1XH2A 1AD1A 1AJ0A 5IFTA 1TTQA 1B3OA 3LBOA 5CBIA 5U7SA 3STEA 3TTEA 4EWJA 4M7TA 3WF2A 4NUWA 2WNWA 3I65A 5AVHA 1I1XA 3OGRA 3I6RA 3I3EA 4IPNB 4HPJA 1OHLA 1EHNA 2V68A 4GRSA 4BQ2A 4Q4QA 3SY8A 3GUGA 4OBRA 4TX8A 4P7OA 3EX1A 1EP3A 1B3VA 1UQZA 1FX6A 3G8EA 1Z6KA 1A3HA 1T96A 3PBGA 4HCHA 1V6XA 2VEKA 3BZGA 4B16A 1ISWA 1NDVA 3IAQA 2A79A 5F2MA 2DSWA 4DJFD 3QEZA 3WK2A 2WKJA 2BGNE 1FWCC 2XZ9A 1LORA 3QJAA 4O10A 2GUBA 4C91A 2X1UA 2E4TA 5EMKA 4NF7A 4BA0A 1XYMA 1TMQA 4HMEA 5HNUA 4HA4A 4ZODA 1SYTA 5A6BA 3D3AA 4QCEA 3QF0A 5PTDA 1JAEA 4GD0A 3F5JA 4Y9OA 4PN2A 1V02E 3PZQA 1H7RA 1E43A 2ZA3A 4IP5A 2V6AA 4WDTA 3USZA 1AFSA 4L9ZA 1WOBA 4JHMA 4GWEA 4UTWA 4Y7EA 4LBSA 1OFAA 5IHSA 3EWUA 1U30A 1JPMA 3SN1A 3BOFA 2B7QA 1XV8A 2NXHA 1SO5A 1HP5A 1NVMA 1EL3A 1YW1A 4JCMA 4S3DA 3VKAA 4E0CA 2ZUSA 3HGJA 3VGDA 1OWQA 1EJWC 1TE6A 2D3LA 3KL0A 5DRIA 3TYZA 1V7AA 1KV5A 3RIKA 3BLPX 2ZXQA 3Q2DA 1YNQA 3C2FA 1QI3A 1PIGA 1RQBA 1AL8A 2FMNA 3TNBA 1OCQA 1DBTA 3UG8A 1DKWA 4J28A 4MAVA 4QRNA 5D9MA 4L9YA 3GNPA 2QHAA 4CD6A 1W1VA 3HPFA 4WJEA 4C6CA 2C7FA 4MJ2A 4W93A 4YMZA 3QY7A 3W3OA 4RW5A 2WLYA 3S1XA 1E1CB 4ML9A 3AROA 4HN4A 4R3UA 2BGQA 2VMFA 1KR0A 4MJMA 4G6CA 1FH7A 3EA3A 1MUMA 1K02A 1QASA 1YDYA 3PG9A 3WQ6A 5EFDA 1SVDA 1D9EA 1KRCC 1OT1A 3W07A 4TVCA 4O4WA 1D8WA 3R79A 1ME8A 3SY1A 1XINA 3KAOA 3PBWA 2JGQA 2EPMX 1MUCA 4UQCA 1LUCA 4FIRA 1YYAA 5D2TA 5TIMA 4S3BA 4Q8PA 1A5LC 5AHNA 1S3TC 4A2RA 1GJUA 2ISVA 3L2LA 2OEKA 1EUAA 5MF5A 3MA8A 1CGXA 1CGVA 5CH9A 2OQYA 1U5HA 4IGSA 1AJZA 3QMTA 4MLJA 3W1LA 2EPKX 4E38A 1MRAA 3W1TA 4D1JA 4UTUA 4PFHA 4EF8A 4D6IA 3TJIA 4DF0A 1W56A 5CCZA 3PC0A 4ACZA 1XCWA 3Q58A 2BG5A 4KIRA 4XAGA 2OWWA 2JF6A 1X1ZA 4O15A 3CEPA 3QHOA 4LBUA 1LTDA 3ID7A 2OZTA 4A2SA 3FDGA 1BGAA 4MFDA 3LXAA 4IQEA 1C93A 3TAOA 5FJUA 3OGVA 4MM1A 4HNLA 5E9AA 1A47A 1EJUC 2R8WA 3MSDA 1E70M 3R8GA 4Q32A 3L68A 1K70A 3A12A 2VEIA 1QUMA 3CPGA 2QJHA 1KLYA 2CWNA 1ONEA 4AC1X 2CXGA 4AMAA 4LQ1A 4JFSA 3W2KA 1G0CA 1WZKA 3PZUA 3MMWA 4RE4A 4HU0A 3MP5A 4UBPC 2R1KA 3SBFA 4V15A 3BO9A 1R85A 1UD2A 4AVOA 1X6LA 5FSDC 3W27A 2WMFA 3BOXA 3T0AA 3L2MA 3TN3A 2QVNA 3VCNA 2I57A 4GC3A 3NEHA 1G7VA 4FXFA 2GDQA 3M1ZA 2F84A 3IS4A 4ZOBA 4F2TA 4IZGA 2DZBA 3VTRA 2E8ZA 4CNTA 3WLRA 1E4NA 1DTNA 1V3KA 3MHFA 3QPEA 5IRPA 4Z1DA 1ML1A 2HE5A 3UWZA 2ZRYA 2BY2A 1X39A 1AQ0A 4ZGYA 1TMLA 2WJEA 2EKGA 3EA1A 3FVDA 5ABTA 4YVVA 3S0CA 5MHBA 4P8XA 5AHEA 1YRRA 4GC4A 4GQGA 2O7QA 2Z26A 2CLHA 1UKPA 4S38A 3MC5A 1Q6CA 4RXFA 2VEFA 4WDUA 3QLLA 2QJJA 1IR1A 3NQAA 4OU1A 4ZQCA 4GE8A 3CV7A 1PS9A 5HUOA 3IIOA 3SCUA 3LNPA 2REQA 1KLZA 4CQBA 2R9RA 5I02A 3FFSA 4ZO7A 4KWOA 3OIXA 3VM5A 4DI8A 2XTKA 4O16A 2PI6A 4GVFA 2HS8A 3W7HA 2MNRA 3BMVA 3W38A 4M7SA 1PZ2A 1SPQA 1EA9C 2PWHA 1MNSA 4NJKA 4ERAA 2YCIX 1OCJA 1LG2A 4DWDA 3LMZA 5FIPA 2OGYA 1R3VA 3TW9A 5AN7A 1UKQA 1FDYA 2WNZA 2XJ7A 1JZ8A 2FHBA 1E6RA 2JEQA 3L23A 3UR2A 1J2BA 3VE7A 1IWPA 4HJFA 4ZO8A 4RKAA 2E77A 3TC6A 5TAOA 1GTEA 1AG1O 4KRZA 3MUCA 4K1WA 1L8NA 3W01A 4URIA 2XH4A 4DWSB 1OSEA 3SGGA 4O1EA 4NJHA 3QTPA 4IQLA 3WD0A 4QJ4B 4XVEA 2BDQA 4LNCA 1AMYA 1QI4A 1UMYA 3WBEA 3ARXA 4YN5A 2L5HA 4PCSA 4O8RA 4DQWA 5HA7A 1W1IE 5E6ZA 4E2VA 4UNKA 3FA4A 1E5NA 4E3VA 3JUGA 3ZR4A 4WHBA 3CV6A 4JL1A 1V7YA 4RNFA 3DYOA 3A4AA 3AI0A 1FWIC 5D38A 4C6FA 3LLXA 4B5SA 1YX1A 1B57A 2Y85A 3GHTA 5DLCA 1EPVA 2PWDA 4AD5A 2NXGA 3W1QA 2W92A 1TSIA 1U1UA 3AMDA 2VELA 1NFGA 5EBAA 3UWUA 3BAXA 4ICNA 5A8NA 3WQFA 1H63A 3WQDA 1QPOA 1BVWA 1UZ4A 4OBTA 2Y70A 1R2RA 3II1A 2WNNA 1O6IA 3A3WA 4HHPA 3DUGA 2ADAA 4V33A 3EOOA 3B8DA 2DH2A 4HZMA 1XCXA 3VOCA 1XYAA 1EDGA 5H6HA 3TVAA 3UVIA 1Q63A 5A6MA 1XSJA 3AXIA 2BWGA 2E67A 1WO2A 4EKJA 4YLWA 1NDYA 4JQ1A 4GNJA 1XSIA 3HMJG 1PWMA 2ZXAA 3TCEA 3LM3A 2EPNA 3I68A 1H50A 3O05A 3ZR5A 2VT0A 5KZ6A 4XZLX 4FNPA 1J10A 4B3LA 1J5SA 2H6RA 3UY8A 2R6OA 1F05A 4O4VA 5EY5A 1PV8A 2ZDSA 2WC3A 4DRSA 1GKQA 1XBXA 4I9AA 3LCGA 3KVJA 4PUDA 2VP8A 3S47A 3L4YA 3CHDA 3T0DA 5CZJA 4K1GA 2YXGA 3QV7A 1XCFA 2WMIB 1EJ7L 1CZ1A 3T05A 1S46A 2O4MA 3LYEA 1OK4A 5A6BD 5FAJA 6ALDA 1Q4NX 4A6GA 5D4YA 3TXVA 1AQFA 2J8FA 3OBKA 4US5D 4AEFA 2GQ3A 2WMHA 1HF6A 2GSEA 1YLVA 3VKDA 3CLWA 1XHGA 4AZ5A 3O1NA 4WVXA 5LNUA 4WR3A 5I3HA 1XIEA 1EWEA 4S39A 2R1PA 5AKQA 3ZVIA 3L4TA 1LOQA 1WP6A 3GFXA 3L12A 4HZ7A 1TX0A 3TKFA 7TIMA 1ISZA 1UP3A 3E0LA 1WB0A 2E8YA 3WQOA 2WBGA 3L66A 2CZEA 2C79A 1CGYA 4NAEB 5HMFA 3HB9A 1E51A 2DVTA 2GJXA 1CEOA 2PEVA 1GVSA 1QNRA 1ME7A 1CIUA 4Q4PA 3I7RA 1WKFA 4AY1A 3CH9A 3CV1A 1TV3A 3QV6A 5HQLA 1L8PA 4C6KA 2G41A 3WQPA 4J3VA 2A5HA 2HXTA 1C90A 1RV8A 4E4FA 1YDOA 1DWIM 4L64A 2ZRVA 2VX5A 1PSCA 1CPUA 2IMRA 2DJLA 4RDZA 4QHRA 3DCPA 1DHPA 4KEUA 2A3HA 3W7QA 3QZ6A 5CJ5A 5EL1A 1FP9A 1L6YA 2DVXA 2PDUA 5ENLA 2RHGA 4XKYA 5RUBA 5CGTA 2NV2A 4HHMA 2ASHA 3Q67A 3R43A 4P2VA 2HNEA 1UASA 2CW6A 4K6AA 1RCOB 4O1FA 3NSNA 1J0KA 1CWYA 2IPFA 4OTKA 2NVDA 3HBLA 3N2BA 3MU7A 4U28A 1SW3A 4N9DA 3M0MA 5E0KA 2GVEA 4NJGA 4GXPA 2ZUTA 2PODA 4O1BA 3VIHA 3P0XA 3VNMA 3TLLA 2OGJA 2BB0A 3T6CA 3QYQA 1GQKA 5D30A 2WZIA 3UD6A 3THAA 5GPRA 2H9AA 3NDYA 3TU9A 2GGJA 2GQ9A 1U1JA 3P61A 3FSUA 3OVRA 4IJRA 3T44A 2XFRA 2GJRA 4WJ8A 1H60A 1OFPA 3KOXA 5C9WA 3N11A 5ABEA 3A24A 2ATMA 1RA0A 3A6OA 5J5DA 5EKYA 2J6VA 1DXFA 1HX0A 2PS2A 2W66A 3PZTA 3MY9A 3NQ7A 4G56A 5HATA 1VBJA 2O55A 1UKOA 3I3BA 2PZ0A 4HSHA 1EZWA 1JZ6A 2FIQA 4TX6A 3MP3A 5LNWA 3FAXA 3VFCA 4F0HA 2ZZ7A 1LF1A 4HMCA 3SCNA 3CWNA 1W3LA 5AOUA 1XH0A 2GGHA 3TSMA 4HB7A 4C6NA 2DU2A 1AQHA 2WPGA 4F0MA 3SQLA 1VEPA 4HQVA 2NQLA 3N29A 3IUDA 4S3EA 4AY7A 4XAPA 3PBYA 3CHVA 5HJLA 1XSKA 2Z1BA 2VD9A 2W9MA 4UQ9A 4PL2A 1MEHA 3SJ3A 4IICA 1R2SA 3OEXA 3KOWA 3C3UA 4KWWA 5AHFA 4MWAB 3WQCA 4YCOA 1FWRA 3R2GA 4EX4A 3KVLA 3CZGA 3PZIA 1VYPX 4UCGA 3NWRA 3URNA 4TOQA 1ZU8A 3BLLA 5EMMA 1OFOA 5JBEA 4BI5A 3E0WA 1K6WA 4LX4A 1CB2A 3OZMA 2QV4A 2XIJA 2O92A 4GUGA 2ZWYA 5IDIA 1RK5A 1OC7A 3PBMA 2WC4A 4A3UA 1BSLA 1HL9A 5EYWA 3MUIA 1TPWA 3HPAA 2YDSA 3WLQA 4RDYA 4YCPA 1ONRA 2YFOA 3AU2A 4L1XA 3L65A 3DN5A 2VGBA 1SJAA 3SR7A 3LG3A 1OX4A 3LHYA 4ZCWA 1PTDA 3WD2A 1EJRC 2WQDA 4AYSA 2PDMA 4QISA 2X2YA 4JY9A 2ISDA 1H5YA 4TV6A 5REQA 3ZSSA 3WD3A 3WENA 3K1DA 1A4LA 2MUCA 4WKHA 4MB4A 3T08A 4LC8A 2VC7A 4RNJA 2FDSA 3AMLA 4IMCA 1D7KA 5FF4A 3CC1A 1Q6FA 4S3KA 5C54A 4GINA 3EDEA 1S1PA 1WKYA 4UTTC 2IPWA 5L9FA 4OT7A 2HVMA 3U8GA 5A8QA 1QTWA 4RCXA 4A35A 4CNUA 1H41A 3ITGA 3MV01 4R9XA 1XBVA 3EZ4A 1LQAA 1AMKA 2QT3A 3M5XA 1OABA 2VFHA 4F0KA 3WUBA 2BBFA 3THUA 4N0RA 3DZ1A 1JNDA 3ZMRA 2WBKA 1JCYA 4TIMA 1FFQA 2AL2A 2FB2A 4J5NA 1KKOA 1OG0A 2EG6A 4C7DA 8TIMA 2VOMA 3PM6A 4K7YA 4Q7BA 2PBGA 3CQIA 2V38A 3H2EA 1YBQB 4IOTA 3G0XA 4NY2A 1FHUA 1KGXA 2OSWA 5AVNA 4AXKA 2PDIA 6A3HA 4GI9A 1EDQA 3K46A 4CLMA 4G8TA 2BHUA 4DM1A 4XUGA 1HJWA 2D2GA 1TV2A 2WYSA 3NQBA 3SQMA 1XJBA 3MCMA 4L6DA 1AA1B 3IIXA 3HJEA 4I9JA 2OEJA 3PJTA 4X2PA 3EEGA 2BVYA 1PBGA 5I3GA 5FJTA 5BXTA 2FGBA 1KQYA 5J8LA 3VZZA 3HPZA 1I2RA 2TRSA 3NQVA 4LFYA 3RM8A 1PHWA 3GDLA 5LHFA 2H90A 2OX4A 3G1AA 1R0MA 4NI8A 4Q6JA 4TV5A 1ME9A 5B7YA 1PL9A 3BH4A 3BLKA 4Z1BA 9XIAA 1XG3A 4H8UA 2FHCA 3LI1A 4H01A 4DUVA 1QW9A 1FCVA 1SZRA 2CCRA 4KF1A 4OKDA 4AIOA 3W6YA 5D32A 4LXFA 4IIDA 1Q2RA 1DE5A 1KD0A 1AZ1A 1EKOA 1NEYA 1XICA 1OQFA 3DENA 4GNVA 3SUWA 3EB2A 4JTLA 3MBDA 3BLEA 4LVAA 3GDBA 4QX4A 3WX7A 2ZRUA 4F79A 4HNOA 3U7VA 1HGWA 4XAYA 4DN1A 4DBEA 2ZZ3A 2DV0A 3W53A 1IF2A 5HQMA 3TK7A 3GVRA 5KZDA 2WVVA 3NQFA 3D3FA 4FX6M 1F3XA 5D37A 2E25A 2WPBA 2DZVA 3NAVA 2E5CA 3VIFA 1ISVA 3BW4A 2CLLA 4GNKB 3GC2A 2FGLA 1QVBA 5AC8A 3FKRA 3EWXA 3RAOA 2OLSA 5IHRA 4IHCA 4XZNX 3DYPA 3CHEA 3KFTA 4DF1A 1BKSA 3VK5A 3CL8A 5HJYA 2H3BA 3MDUA 1FHVA 3T9PA 2HPMA 4XTIA 1P0EA 4E8DA 1F3EA 1EQPA 2Q6ZA 3Q4DA 1L6FA 4B92A 4AHPA 4YWSA 4C6EA 2HQAA 5HJXA 3BE7A 3WDPP 4AH7A 3M6DA 2OR2A 5E70A 3ZZ1A 3NL5A 5GJPA 1GVQA 1NP0A 1AW5A 2WB5A 3GB6A 4Z1AA 3HOJA 2PDNA 1W3IA 4QBXA 1ENUA 2ALDA 2W62A 4DYJA 2BLEA 3MTWA 2QNEA 5K7JA 2PP1A 3Q94A 1H7NA 1UD5A 3GG0A 3V5OA 2HPIA 4L6OA 2FZBA 1PZ3A 3ORWA 2YA2A 2G8ZA 3P8JA 4JQ4A 4JN7A 1TFVA 3R6IA 3QGKC 1EF3A 1NOWA 3VM7A 3QKZA 3PJUA 2XU2A 3R1ZA 4KCWA 3LCWA 4HBKA 2X30A 4PMOA 1UWRA 1XR2A 2VFIA 1R9ZA 1H2JA 1XLMA 1JYVA 3UCDA 3TC3A 3AS3A 2XGIA 1PKYA 4Q4OA 2XH2A 3BK0A 3DFQA 4EACA 2IQTA 5D2VA 3UZJA 3VD5A 3TA6A 1SZEA 3DX5A 5TBOA 4PUWA 1HVQA 3EOUA 2QIIA 5KEZA 1UQYA 3A4XA 3W28A 5AFDA 1PZ0A 4LYRA 1E6PA 1SUXA 2QYGA 3QW3A 3EYPA 4JTHA 2F6KA 1OM0A 2FLIA 3EXSA 3K30A 1EC9A 2WHMA 4MADA 3T2OA 5CKSA 4FNQA 1VGAA 3NZ1A 3BWWA 1H7OA 2PWEA 3E2SA 3OHMB 3THQA 1OBAA 2E0PA 3AXHA 1C7SA 3B8UA 4X2RA 2VUYA 3NQDA 2BXZA 4QSFA 4EWND 3FYOA 3PPHA 3W2UA 2HS6A 3C3NA 3S9IA 2INFA 1V6WA 3G1FA 2DT1A 5KETA 3PUDA 4M19A 4REQA 3PTMA 1XIJA 4GXWA 3IIZA 4ZEPA 3OBAA 8A3HA 4LCSA 4GY7A 3A22A 3FXGA 1EFZA 5BXRA 3GHUA 1GQJA 3OW1A 2G3FA 3W6MA 4GQBA 3KL5A 3LK6A 3VD4A 3BDKA 2DT3A 3RLVA 2AMGA 1ODZA 1ZP3A 1V51A 3KZPA 3P6LA 4J2MA 1W9BM 1HNYA 3WBYA 3UERA 1XGEA 4M51A 2VX7A 4H3DA 3PF3A 2GZXA 2BY3A 2IXVA 2RDUA 4LWWA 2J7FA 2O4QA 3LCLA 3VNDA 2V2DA 1OX5A 1OCBA 2QCDA 3LY0A 2X05A 3BTNA 5E1QA 4JTAA 5U4NA 4EPKA 2BXVA 5JH1A 2CXEA 2PWVA 1VBRA 3GG7A 4LUIA 3LSBA 4A3HA 1H61A 5F1UA 2DT0A 3DBPA 2D23A 1M6JA 2BS9A 3UA4A 2YSWA 1VENA 5JUVA 4M80A 4UTJA 3QFWA 5E09A 2QCFA 1PCKA 1VCVA 1YDNA 4QSHA 3OTRA 5C2GA 2Z28A 1XKYA 2ZRZA 3KBJA 5MKGB 2PLCA 3LD5A 4B91A 1CGUA 2JIWA 4QIUA 3ECQA 2DZPA 3NSMA 3AYVA 4LYPA 1HFBA 4R7OA 4Z1YA 4MNJA 2V9DA 2BXYA 1IT7A 5I3DA 2OYMA 3OZPA 5I0DA 3N34A 1W5OA 2OTDA 4R53A 1XRFA 4W7WA 4W5UA 1LL7A 3V0TA 5JIPA 4R7JA 2W3ZA 2FH6A 1EUNA 4PMYA 2TMDA 4AU0A 1A5BA 3L5MA 1NAL1 1VH7A 4Z0SA 4AZGA 4U10A 3WDRA 4BI6A 4RZ6A 5FF7A 3W73A 2A6NA 1KFKA 4IXHA 1DEDA 3SEPA 1THFD 1PCWA 3CBWA 1C91A 2ZFAA 1BXBA 1UH2A 4M29A 1XL9A 3AIEA 3CPUA 1RUSA 4GGHA 2X42A 1L0PA 3MVIA 7ODCA 3A5FA 3FA3A 1JJKA 4FO4A 2A3AA 1EPXA 1KBKA 5DF0A 4CNPA 2QV5A 3VIPA 4EP8C 4C5YA 4ZFMA 4UUIA 2WVUA 2FZDA 5TQLA 4GH3A 1V03A 1M7PA 2INEA 2DEPA 4WY0B 4AFYA 3WL1A 4NU7A 3V5FA 3B40A 3WBAA 4RK8A 4KWUA 4WOZA 1TCMA 1RD5A 3PULA 3VNJA 4JYDA 4IM4A 4OJYA 4O1DA 1I60A 2GFTA 2V2HA 3TW7A 1H62A 4HU8A 2C16A 1E3XA 4LAUA 3P8IA 3QC3A 4UFJA 2P76A 1SQ7A 4Z1CA 1GWJA 4L4OA 2QMKA 3GM8A 3M5YA 3SCOA 3V1PA 4PMQA 1CW2A 1IEVA 4HD5A 2E09A 2BOEX 4OFCA 2PLKA 4ADUA 3QGVA 1ZRQA 4NRSA 3RO8A 3WDHA 5HPCA 2QEZA 2AOSA 1PIFA 4QQUA 3WLNA 3WMCA 4XV0A 1DJXA 3GK0A 1KO0A 2DW6A 3EPMA 3OPSA 1I2QA 5AYIA 4DVOA 2ISSA 4CNSA 1OFQA 2CKSA 2FZ9A 4Q8WA 1XIHA 5HBFA 1SO6A 2Z6IA 1UWAA 1KXTA 2FKPA 5DBUA 3GS6A 5H8MA 3P81A 5GQBA 1GORA 1KCZA 4XK2A 1ZUAX 1ICQA 4JDYA 4OV4A 3TQKA 3T4WA 3WUGA 4MHBA 1LM1A 2GGIA 3ARVA 4AIBA 1HL2A 3H4WA 4H9MA 1B30A 3CPRA 4AD3A 5CBBA 5JQ9A 4Y9AA 1BTMA 3PTKA 4PUUA 1IYXA 1DJWA 1RPKA 3BQ6A 4UMBA 2TPSA 3GXMA 3WF0A 1AK5A 1P4CA 1OCNA 1AODA 3GTXA 4FNTA 4JFTA 4DBUA 2YBVA 3A23A 5ABGA 3G8RA 4W89A 3WLJA 3RXZA 1TWWA 1C3FA 2E1DA 2IW0A 3PWAA 2PDFA 4NZ4A 4IFRA 3DEQA 3P62A 3FVMA 5AZ1A 1LL4A 1TWIA 3HF3A 1VFMA 3MMTA 2GQAA 2OMAA 2XM2A 4RV3A 1KR1A 2QUUA 2WQPA 4GJJA 3HGSA 3NOEA 4F3HA 1AVAA 2BSLA 3SRFA 3AZTA 2DIJA 3UZZA 3FJ6A 2HVOA 4AEOA 3EWDA 2ONEA 1C92A 4J3TA 2VFGA 1F9CA 2CZVA 4GUJA 4KGLA 2F6UA 4LF2A 4DO5A 2PDPA 3OLEA 4JFWA 3M16A 4U2YA 4ROQA 4KETA 3DHUA 3LHVA 4W4QA 1Y5VA 5C2XA 2JKAA 4DO6A 4EXBA 1H1ZA 2I16A 3DIPA 1GHSA 2PDQA 3PZ9A 4CCDA 3L4VA 3UPMA 4IMEA 1NQKA 3B8SA 2YL9A 2NV9A 1R46A 2XG9A 2XFWA 5IFPA 1V5XA 2GDVA 3MANA 1Q6EA 4J3XA 4ZENA 1QPKA 3OIHA 5F4XA 5FF2A 3UESA 3NDZA 1DIDA 5J04A 5GVJA 1TJPA 4CD7A 3LCHA 1FWEC 1H1NA 1DIOA 1N82A 4M56A 1F8MA 1OYAA 2WOQA 1X8FA 1JPIA 1N2VA 4M0XA 1W1TA 1LUCB 4W5ZA 1KBLA 3P82A 4LUYA 1TR1A 4D6HA 5A6SA 1ALDA 1KCXA 1UR9A 1SW0A 2Y8UA 1VFOA 3PZMA 2F7FA 5CPTA 1TVPA 1YTEA 1E9YB 1DQUA 1YPFA 4ZTXA 1EOKA 1BRLA 5DRCA 2E9MA 3JZEA 1FXQA 2JALA 4B5WA 4J3UA 4ZQOA 1YQ2A 3ABZA 1B0IA 3SB0A 1PX8A 4JQ2A 4MB3A 3LA4A 4JTIA 1WAUA 1MW1A 1ESWA 1FWTA 1GNXA 4MKSA 2PC4A 3WY1A 3IJQA 1QW8A 1Y8BA 3SCTA 1W17A 2ZX7A 4HYRA 5GNZA 2Z1VA 1TA3B 2G3NA 3LLFA 1YHTA 3S9ZA 1LRTA 5D8ZA 4LNYA 4YJ5A 3MW7A 1RD6A 4LRSA 3BV4A 1M1BA 4C6JA 4MNKA 3U4FA 2V30A 1KW1A 2Q8ZA 3W2MA 1NWTA 2PGWA 5ECUA 4R7WA 4WZHA 3RCYA 3MO7A 1TTPA 3SFKA 3AIUA 3G77A 3MVTA 3KTCA 3WFLA 4FZIA 5DT5A 3EBVA 4AQLA 1VD6A 3TN4A 3N19B 3TX9A 1XLIA 4H6EA 1L6WA 1IXOA 2Z7KA 2FZ8A 2R91A 2HK1A 3WF3A 2JF7A 4UTIA 4H6KA 2UZ9A 5K3VA 1UUMA 4G2DA 1Y65A 1GOXA 4NNAA 5ABHA 1SMAA 3ABOA 4EAYA 4NJJA 3GFZA 3CZLA 4FSAA 1UR8A 3HA1A 3NQMA 3R5EA 3UF9A 5DMLA 4GHRA 4N4PA 2PC8A 2RDXA 2ZVRA 2D20A 4X0VA 3SRHA 4YS1A 2E7FA 4Q7IA 2FB3A 3A3XA 3WK0A 2FTWA 3B0UX 6REQA 5E0CA 1VP5A 2KZHA 1TVNA 1J9YA 3DESA 1W8GA 3UEQA 3UWWA 4RL3A 1I0BA 1V6VA 3WFZA 2CLFA 5CSYA 3H7UA 1U1HA 2DVUA 3IVUA 3U2OA 2E3ZA 5A6AA 1S2VA 1YMYA 1IGSA 4GACA 2YOCA 3AWOA 4XKMA 2REQB 5LSMA 3S2NA 1JDEA 1R6WA 4NKCA 2CBIA 3R8RA 1EXBA 2CYGA 5BRBA 4ONVA 1BGGA 3BAWA 1K9EA 1UA3A 1GPWA 4OWGA 2ISWA 2ZUUA 4XBKA 1NJJA 2QCNA 2ZE0A 1US2A 4I7WA 5C71A 3A13A 4R34A 1ZJHA 4XVDA 5FJJA 3S1VA 1WKDA 3TYUA 3R0KA 3SI9A 1FCQA 3IVTA 1V4YA 3CZEA 3QN3A 4F0LA 1MNZA 3T0TA 1VQTA 3VC6A 5CJMA 1OEPA 2WJFA 4NNCA 4PTMA 3SAZA 5J5RA 4HNCA 4L61A 1W6TA 3LPGA 3HV8A 4AY8A 1Q6GA 3LNMA 1XIGA 4QDWA 3WDQA 4Q4SA 1KBIA 3QZAA 3S5YA 3D6NA 4IGMA 4AIEA 1PX4A 3L9CA 2CNCA 1G4PA 3S2JA 2QPXA 3NPWA 3GU2A 1X98A 5H1WA 5AC7A 3OA3A 4H41A 4J1OA 1WKEA 5A6JA 1B2YA 1XIDA 1LCOA 1G1YA 3LMYA 4O57A 3KVMA 3OG3A 4AZCA 2NSOA 1H4PA 1UKSA 4DHGA 3QZEA 3L4ZA 2OLAA 1A49A 5A95A 3A64A 3KS6A 2Q8XA 2PDYA 4AHQA 1G01A 4N02A 4UQAA 1UR1A 3U48A 4JKMA 1UWTA 5CAKA 1SFLA 1FWFC 2FH8A 3NO5A 3N4FA 3GVQA 2FJKA 3KVKA 1UH3A 5JVLA 4G9PA 5AB3A 1F8IA 1S3HA 3W81A 2IKGA 2NQZA 2XIIA 4Z2JA 1U5JA 3VNYA 4IX0A 1TQJA 1RBOB 4FLSA 3TZFA 4MDPA 1XRVA 4FXSA 2POTA 4XX6A 7CGTA 1EC8A 1EWDA 3C86A 4P7RA 4PB3A 1NSJA 4JOMA 3GX9A 2BVWA 3RILA 3K5XA 2PD5A 2WVSA 5L6UA 2UY2A 1BVNP 1V0MA 1VFFA 3ZSTA 3T7VA 3WELA 4FALA 1LYXA 1HW6A 3GR8A 3AJXA 4WSHA 1GG1A 1AD4A 1Z48A 2DSKA 2OODA 4JBRA 2YW3A 1R47A 5LYRA 2J78A 1RH9A 1WCGA 1N8IA 3CAWA 4LVBA 2CLMA 1VJIA 3GIPA 2P0IA 4MWAE 5CPQA 1RSCA 5BU9A 2EJAA 2E68A 2VENA 1ZHAA 1P6CA 4Z42C 1ITCA 3ZM8A 4Y90A 3QTGA 1NTHA 4K36A 5G1MA 1Q85A 3KL3A 1CT5A 3GC4A 3QGAC 3CAVA 4D6DA 1E72M 3RPTA 3VKCA 4DF2A 3UJSA 1QOXA 1TTIA 2WMKA 5HPOA 3PB2A 4LB3A 2I9UA 4F2BA 1ZAHA 4UFLA 1BEUA 2VTFA 1KFLA 4A3RA 3KWXA 2GL5A 3UR7A 3W1PA 7ENLA 3V3WA 3PZNA 3WLOA 1JPKA 5HQEA 4WEVX 2WLZA 4RR4A 5D04C 3OZYA 4ZVJA 2OQLA 3CGTA 1JPHA 1XP3A 1OGBA 4HK7A 3IIPA 1Q7MA 1Z44A 2UY3A 5CPLA 1CENA 1E1EA 2O56A 4ES4A 1GVOA 1BLIA 2QJIA 2E40A 1K7EA 5IM51 1A0CA 2ON3A 3FXYA 4M6PA 3GNOA 4AYGA 1W1B1 1JNEA 3WQWA 1EXPA 2W67A 4KS0A 2C91A 3LZ3A 3TOYA 3B0XA 1MQQA 1HJQA 1K3UA 4IPIA 1J8VA 3IGUA 3WNKA 1US3A 4LOCA 3MWAA 1X97A 2HZGA 5C9UA 1IWBA 2GJXB 1EO5A 2A0NA 3GD6A 1T99A 3MJYA 4M8UA 4B5UA 1RP9A 3AHXA 4H1ZA 1JDAA 3EXTA 4GYKA 3NZPA 1UOKA 3FYYA 3LQGA 1XW8A 3IAPA 3M47A 1TV8A 4D8AA 1NWSA 2QLYA 3CTTA 1PHQA 2Y24A 1G5AA 2OPJA 3SGZA 4E4UA 3VU2A 5GJMA 1BWLA 2VEPA 1KFWA 2C14A 4BR1A 2OOGA 2IQ0A 3ARSA 4JNMA 1JFHA 3I3DA 1JF6A 1V3JA 4XAFA 3KP0A 1ZTVA 4PSRA 2EJ1A 4D8ZA 2DQWA 2B7NA 1KV8A 3VNIA 5G5IA 4XKYB 4Z17A 1V3LA 1E73M 3ZVHA 3CIXA 4QAWA 3RNDA 1JCMP 1WDRA 4GISA 2PDHA 1NOUA 4PMDA 1WZLA 1CTNA 1R30A 3R7MA 4NQ1A 2VR4A 5BXSA 5G1TA 3M64A 1V93A 3P93A 3NJ3A 1NARA 4PBEA 4A3QA 1V08A 3PSVA 4RE2A 1RBLA 5HAOA 1DWHM 5EMJA 3LHUA 3NOYA 1VHNA 3ZO9A 3V7PA 2PD9A 4H7CA 5G4WA 1A50A 4XD5A 3CWHA 2B0MA 1SMDA 1Q13A 2H9AB 3IK4A 3LBMA 1OG6A 4CN1A 4CGTA 3T42A 3GH4A 3AHYA 2B81A 2PU0A 3KRBA 4NL1A